2OQUA

High pressure cryocooling of capillary sample cryoprotection and diffraction phasing at long wavelengths
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Elastase-1
publication title High-pressure cryocooling for capillary sample cryoprotection and diffraction phasing at long wavelengths.
pubmed doi rcsb
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2007-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2oquA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2oquA01
1THSH 2AMQA 1ZTJA 1D3DB 3GDUA 3OYPA 1H9IE 1ANBA 1KXAA 2ZFPH 3D65E 3LJJA 5EU8A 3M5NA 1P9SA 2BDIA 4UE7H 4ZH8A 3ZYEA 1IQHA 3F9HA 3ZVAA 3KNXA 4U2WA 1HNEE 1E38B 2OTVA 4A1TA 4INKA 3DFJA 3VB4A 1C1WH 5JBTA 1DLKB 1FUJA 4NZQA 3T27A 5A8XA 1LPZB 1CA0B 6ESTA 2FS8A 2HLCA 2ODYB 1TB6H 4KTSA 1T4VH 3BTHE 4THNH 4ASHA 3A7VA 3UTUH 4MNYA 5FBIA 3M7TA 3KHVA 3P92A 3P95A 2XNIA 4OS6A 1C2JA 2J4IA 1DM4B 1ETRH 3LGYA 3ZVCA 1TNHA 1GBLA 1O2MA 2AGIX 3H7OA 1O3IA 1WU1A 2PLXA 5DKMA 4BAMB 3RP2A 1GBMA 3FVFB 1TABE 1ZSLA 3E8LA 2GCTC 1P03A 4AX9H 1QURH 3RXQA 1A3BH 3SNEA 1MD7A 2CHAC 1JIMA 4NGAH 5EODA 1EPTB 1SSXA 1LQEA 4KELA 4IBLH 3BTDE 3SHAH 3ZZ8A 1NRQH 2BDAA 1GL0E 3LT3A 4LXBH 1BTWA 5E0GA 1SOZA 3MH5A 4ZHLU 3VB3A 4BAHB 3RXMA 2Y5GA 4YT6H 4A5TS 1TPAE 2ZF0H 1EAWA 4JYVH 4K3JA 1PJPA 1QNJA 1RTKA 2Q6FA 1JWTA 1A46H 1CT0E 2QV1A 3BV9B 5EXLA 1K1PA 1A5GH 2J92A 5CMXH 4K8YA 3TNTA 2ZO3H 3LIWA 4NFFA 2BD4A 1JIRA 4XDEA 1SLVB 4NIVA 2XC4A 5E0JA 3SJ8A 2ZGBH 1AO5A 2WPKS 1QY6A 2PTCE 3BIVH 1GBKA 5T6DA 4B71A 1SGEE 4AZ2B 2VGCB 1C1OA 1OP8A 1RXPA 1VCPA 2ZCHP 2B9LA 1G36A 3S9CA 1T32A 3LC5A 4HZHA 2IJOB 1DWEH 3MH7A 3IWMA 3UNQA 3A85A 2JH5D 1O5EH 1VITH 2OQUA 2ZCKP 3M3TA 4D7FA 1T8LA 2GX4A 1HJAB 2Y82A 2SGDE 4MDSA 3OU0A 5I46H 3ZVFA 2B7DH 1AUTC 1S83A 1ZTKA 3KIDU 1O2NA 2BZ6H 1BRAA 3V12A 5HMAA 1K1LA 1MCVA 1SC8U 2XC5A 3ODFA 1AVWA 2BDYA 3NKKA 4Y79A 3D49H 1XUIA 2HVXA 3GY5A 1O35A 1TBRH 2FWWA 3K65B 1GJCB 1LPKB 3NUMA 1VJAU 3ATIA 1YPHE 1GJAB 1MKWK 3DFLA 1L4DA 3FFGA 1BTPA 1C5WB 1KSNA 2GZ7A 3SJKA 4YOJA 1AE8H 1F5KU 3PLBA 1BCUH 1SB1H 1GCTC 1UK4A 2BLQA 3EAJA 5DJ7A 5LPFA 2WV5A 1TX7A 1UHBB 1SLXB 3T2NA 1S6FA 5EXNA 1P3CA 1EZUC 1Z1IA 1BMMH 1P09A 1SQAA 1O2LA 4X6MA 3RXTA 4MNVA 4E06H 2FOAA 2XCFA 1OOKB 3QGNB 1ZOMA 1V2TT 2AMDA 1O3DA 1Y59T 1W14U 2FOEA 1HRTH 1BBRE 2UUKB 2AFQB 2VIOA 2EI8A 3KF2A 1EP5A 1GBTA 1JXPA 2F9VA 4MTBA 1O0DH 1O3GA 3RDZA 2TPIZ 2ODQA 2BY8X 2BY9X 1ELFA 1TLDA 1GI0A 1HAIH 2Y81A 4UDWH 4DVAU 2XBXA 2BQ7B 1V2RT 2ZTXA 2HNTE 1KXCA 1QA0A 4YZUA 4KP0A 1GJ8B 2ANWA 1C5VA 3EA8A 1C5MD 1XKBC 2FDAA 1G2LA 2SGEE 1O39A 1JRSA 1C5TA 1MTWA 3MU5A 3B9FH 1GGDB 1YKTA 5G4BA 5JBAS 2ALPA 4UD9H 1CHOG 1SPJA 1AFEH 2DE8A 1W0YH 5C2ZA 4FUJA 1V2WT 1HXFH 2A5IA 1NS3A 4BTUB 1GJ7B 1WCZA 2FO9A 3E6PH 3PO1C 3SU0A 2G5NA 1ZTLA 1PQ7A 1YPLH 3TH2H 1ELEE 1ZPCA 3SJIA 3UIRA 1GDUA 4TWWA 3UOUA 3S9AA 4OS2A 3BTME 4NG9H 1DSUA 4X8SH 2ZQ2A 1PPHE 2BOKA 4NWKA 1YYY1 1AB9B 3M3VA 4J2YB 1EAUA 1DANH 2QXIA 1TE0A 4WH6A 5FAHA 1MUEB 2WPLS 5CE1A 5JB8S 3U1IB 3GCHB 2OQ5A 4I8JA 1X7AC 4UFFH 5TJXA 2FI3E 1GMDF 2JETB 3NZIA 1EATA 3EYDA 2KAIB 3C1KA 1DS2E 4NFEA 3HPTB 4GHQA 2FOFA 2IN2A 4DGJA 1DWDH 2BDGA 3SV2H 1KYNA 4YM9A 1P11E 1FN8A 1DE7H 2ZDKA 4BTIB 1D9IA 1TA2A 2CV3A 3MYWA 1LHCH 1P2JA 1LVOA 1O3LA 2PKSB 4JMYA 3U9AH 3V7TA 2HNTC 1NY22 2HWLB 2STAE 1TQ0B 3L6PA 4Y76A 5ETXA 3MH4A 1ABJH 1W11U 3VEQB 1ZRBA 1K1MA 3PB1E 3R3GB 2QYIA 1CGJE 4TPYA 1VCWA 3KQEA 4ABEA 1GMCG 3A8BA 2FOBA 4HTCH 4WF8A 4ISIH 3SU5A 4Z0KA 2CN0H 1H4WA 1QIXB 2C90B 2Z3EA 1Q31A 3ELAH 3GY6A 1CA0C 4CBNA 1YP9A 4BXSA 1BRUP 2YNBA 1QQ4A 2VVVA 1SG8B 3T26A 1RRKA 1Y5AT 4FU8A 5L6NH 1O3NA 3QTVH 3B23B 2IPHA 4NIYA 4O97A 3TPIZ 1CO7E 3M7QA 1EZQA 3UWJH 1AU8A 2XWAA 1WAYB 4RKJB 3WY8A 3RUOA 1QRXA 1S84A 2ZIQH 1UVPA 4ZAEA 1YLDA 4JZ1A 1GBJA 2BYAX 1TAWA 4DJZB 1NC6A 4AORA 1OSSA 3RXSA 3HKIB 4F4OC 4X1QU 4X1PU 3LKWA 2BDHA 4BTTB 2BD3A 2SGPE 2PUQH 2YNAA 4GCHG 3A7ZA 3PROA 1EPTC 1A0HB 1L2EA 3SN8A 1FY4A 1TPPA 3SU2A 2BTCE 3U8RH 1CE5A 2G00A 3SNAA 1WSSH 1DXWA 4Y0YE 3Q3YA 1AVGH 1BHXB 3RLYH 1DVAH 1EKBB 1TGBA 1UTNA 1XXDA 5L2YH 1NRRH 1Z8JB 4INHA 5EPYA 2VIQA 3U69H 3K9XB 4R0IA 3RXEA 5L30H 1A4WH 2BLVA 1C1SA 3M5MA 3IITA 1W3CA 1J14A 5A2MH 5HXFA 3ATLA 4I8KA 1UTQA 1K28D 2Q6GA 2G81E 4CRAA 2OLGA 1TNGA 1TMUH 5T6GA 3Q3XA 3U1JB 3GCTG 1C1QA 2EI7A 2OC1A 4BAQB 3M35A 3P8OA 2R9PA 1V2VT 1V2ST 4GLYA 2ZTZA 4WWYA 4K8BA 1Z8RA 3SI3H 3KQCA 2VGCC 5CHAB 2GTBA 1GI3A 1A5HA 1S81A 1CA8B 1IQFA 5LPEA 1SGQE 2WV4A 1ETTH 1TWXB 1CGHA 3ZZAA 1ZJKA 1HBTH 1UTMA 2P3TB 2STBE 4ZROA 3BSQA 1HJAC 1XUJA 3AVZA 3M36A 1GI5A 3BTEE 4YLQH 2JH0D 3TH4H 2A7CA 3SNDA 3ZZCA 5C67A 1SGFG 2A31A 5FX5A 1SGRE 1T8MA 1UVSH 1XVMA 4D7GA 3QK1A 1CBWB 1P02A 1GJ4H 2TGTA 4ISHH 4H42U 2BDBA 1OP2A 1C4V2 1ZHPA 1SQOA 2Y80A 2BQWB 1C2DA 1O2SA 1AE5A 1QTFA 2LPRA 5JB9S 1OKXA 3PMHB 2EI6A 3TJVA 1QL7A 2HPPH 5A8YA 9ESTA 1HCGA 4H6SB 4GVUA 4I8HA 1N6XA 3SGBE 5E2PA 1GVLA 2ZZUH 4KKDA 1P8VC 1THRH 4TY6A 1YPEH 2ZDNA 2BD9A 4INLA 1RFNA 3IG6B 2ASUB 2BY7X 5JBBS 1ABIH 1HAVA 2VB0A 2RG3A 2BX3A 4NSVA 4ZKSU 3A83A 1MKWH 2ZTYA 2C3SA 1HAYB 1KTTB 2J95A 3P17H 3VGCB 5FPYA 1WYKA 2UUYA 2UUFB 1S85A 3A88A 2HGTH 1EJMA 4AG1A 1L1JA 3RM2H 1RGQA 1DICA 5EQQA 2BD2A 1P10A 1C5LH 4O3UA 1UHBA 5A0BA 1SGIB 4H6TA 4UFDH 2ZFTA 4NWLA 3RXGA 4JYUH 5HM9A 4HGCA 4AB9A 1CT2E 1CSOE 1O3EA 2BD5A 3Q77A 1TIOA 1HDTH 2PSYA 1OWJA 1AKSB 5EW2H 2F91A 4I7YH 2BLWA 5IDKA 2OP9A 5FCRA 1C5QA 1T8NA 1UTLM 1O33A 1C5NH 3TVJB 3E0NB 1F5LA 1GGDC 1HLTH 2OBOA 3RXLA 4Y11E 1EB1H 3ZVBA 1F0RA 3F1SB 3LGVA 1A3EH 3U98H 1V2MT 1TOCB 3QN7A 3KCGH 4HI3A 2OBQA 3L3TA 5AFYH 1ETSH 2GV7A 3RXUA 5C5NA 4MPXA 1PQAA 2ZDMA 1SGFA 1WV7H 1J17T 1ELCA 1YC0A 1O2OA 1XUFA 1O3AA 2ZU3A 1HUTH 2AIPA 3Q3KA 1IAUA 2Z9LA 1GDNA 1AGJA 3A80A 3N7OA 3URCA 4A1VA 2UWPA 3Q76A 4ZUHA 1O2IA 3GOVB 5GDSH 1O34A 5JYIA 2A2XH 1HIAB 2QF3A 4CR5A 1CHOF 2HNTF 1C1VH 1AB9C 1C2FA 2R3UA 1BDAA 1F92A 3QGJA 3SO3A 3SZNA 2R2WU 4YT7H 2UWLA 2LNCA 3MNXA 3P6ZB 4AOQA 4AB8A 1SGDE 3GCHC 1OPHB 2ZDAH 1NROH 2FODA 1L4ZA 3PTBA 5DP5A 4BXWA 2SGAA 4DIIH 2JETC 2H9EH 3UPEA 1BTZA 1GHAG 4R8TB 1SGCA 5ESBA 4ISLA 2ZFSA 5K7RA 3UY9A 3RU4T 2XBYA 3RM0H 1J16A 1OWKA 1O2JA 5DO4H 1GBAA 3RMLH 3PMBB 1Z6EA 3GY8A 4RKOB 2BM2A 4ABIA 4CRDA 1ELBA 2PKSC 2FOHA 4VGCB 1TGSZ 1DITH 1A7SA 1DX5M 5EXMA 2KAIA 1ID5H 4XBDA 2BY5X 3AAVA 1F2SE 2XBWA 2HOBA 2FIRH 1C4Y2 4Y7AA 3SV9A 1K9OE 4B2BA 4ESTE 3TGJE 1L1NA 1AQ7A 4DW2U 3UQVA 1HJ8A 2WUCA 3LOXA 3SUDA 1C1UH 1TNJA 3GCOA 1JBUH 3A7YA 1TBZH 2CF8H 3R0FA 3MHWU 4B75A 1GHZA 7KMEH 2VIWA 1O5CB 2JKHA 1QBNA 3G01A 1OYTH 4AN7A 3MO9A 1IQJA 1IOEA 1HB0B 2Q6DA 4ZMAH 2PWXA 1GMCF 2F9UA 1FQ3A 1SHHB 2SFAA 3DA9B 2W26A 2ZKSA 4Z6AH 2AEIH 3FP6E 2H5DA 3TGKE 5EGMA 3NK8A 4I31A 1GG6B 1DWCH 1FZZA 1RTLA 1A0JA 4FVDA 1QHRB 1T8OA 1LCYA 2A7HA 2ZFQH 1CHGA 1D6WA 1FXYA 4H4FA 4DOQA 1LDTT 1NFUA 1O3CA 2O8LA 3V13A 1FV9A 4LK4A 4OS7A 3T62A 4CRCA 5JBCS 2VH6A 1NU9A 1GI2A 1V2LT 4ABHA 2I6QA 2ZQ1A 1GHXH 1GI4A 4WVPE 2HRVA 1EJNA 1O2WA 3SU4A 7ESTE 2CXVA 2VNTA 1YLCA 2H9TH 1C4U2 1LPGB 2NU4E 4IC6A 3NCLA 2ZG0H 1BUIA 1AY6H 1TALA 1O2GH 2CF9H 3P8GA 3RXAA 1QB6A 4LZ1H 3EGKH 1EOJA 5F8XA 1O31A 4B2CA 1C5OH 1HV7A 1GI7B 1V2KT 3VXEH 3LONA 1TA6A 2H1UA 1BOQA 4K1EA 2AMPA 2QXGA 3GY7A 4Q7YA 4UFGH 1QJ6B 2O8WA 1YCPK 3U8TH 1E35B 3F6UH 2GT7A 1Y5BT 1GBBA 4GCHF 4AFQA 2VWMA 1VGCB 4X2VA 2A4GA 1T31A 2XC0A 3P8FA 4E05H 3H7TA 6CHAB 4UONA 2ZGCA 1K1OA 2Z9IA 4JK5A 4X0WU 5E0HA 4X8UH 1OWHA 3QO6A 1ACBE 1GJDB 1THPB 2J34A 3QWCH 3V3MA 1GJ6A 2ZDVH 3KQBA 4B2AA 2Z9KA 1BBRK 4Y7BA 1G3EA 3BTWE 4FVBA 4A1XA 1AMHA 2PFEA 3ZZBA 2BVRH 1RIWB 1XXFA 5CHAC 2P94A 4DCDA 1AIXH 1FN6A 1GJ9B 2ZU4A 2GGVB 3EQ0H 1TGTA 4FU9A 2QA9E 4AFUA 4A7IB 1AN1E 1OXGA 1UCYE 1MZAA 1GI8B 4X1SU 1H9LB 1O38A 1QRZA 2W3IA 3M5LA 3HATH 8GCHG 1EAXA 3GCTF 1FPCH 1PYTC 4DT7B 3ZV9A 5A09A 4ABFA 4GAWA 3F9FA 1C1MA 1KXFA 1GMHG 3QZRA 1MD8A 3UUZA 2FM2A 1BMNH 1ARBA 1TGCA 3AAUA 3S9BA 3RXIA 4NSYA 1CBWC 4IW4E 4JCNA 2R0LA 4WMFA 1JRTA 4JZIA 1MZDA 1PPCE 1O32A 2D1JA 1P01A 4X2YA 3T25A 2G5VA 3MH6A 1C1TA 2A0QB 2FTMA 4XSKU 1ELVA 1ZHMA 3SJ9A 1P0SH 2BX4A 4SGBE 2UUJB 2PSXA 3MO6A 2NU1E 2VVUA 1KLTA 1GL1A 4KGAA 4CH2B 2SNWA 3K6ZA 1MQ5A 1UTJA 5SGAE 1EB2A 1C2EA 1DOJA 2ESTE 3VGCC 1AI8H 2CMYA 1DFPA 1HPGA 3LPRA 2OXSA 3SU3A 1XX9A 1A5IA 1GI6A 4X1NU 4YESB 3S7KB 1GHYH 1A0LA 2BD8A 4D9QA 4MNWA 5C1YA 5EW1H 1W8BH 1O2KA 1GVKB 1ZRKA 1F0TA 3MU1A 2OINA 1BQYA 2ZHQH 1GJBB 3GY2A 1XVOA 2ZPRA 3PV4A 2ZPQA 1LHFH 3VB6A 2PKAA 5DPAA 1UMAH 3T29A 2G8TA 4AG2A 1D3QB 1SLWB 1QRWA 4B74A 1UVTH 3BEUA 4KTCA 2WPJS 3RXCA 1P57B 1ZYOA 1PQ5A 1OWIA 5K0HA 1N6YA 2QAAA 4K69A 2V6NA 3BG8A 1BMLA 2H5CA 1TPSA 2FYRA 2VJ1A 1LVBA 3GICB 5H4IB 1MU6B 3A7XA 2D2DA 3SU1A 1TX6A 4Y8XA 1O2UA 3HGNA 3V0XA 3RXHA 5DP3A 1CQQA 3OY6U 2A4OA 2AH4X 2G52A 1AKSA 3RXOA 2NU3E 1V2PT 1EASA 1P2NA 3MO3A 1KDQB 4X1RU 3E3TA 1VR1H 1LTOA 5LPRA 4CHAB 4ZKOU 2F83A 3M37A 2A1DB 2XTTB 1Q3XA 3ITIA 1GBFA 1SBWA 5GJ4B 1UVOA 3AASA 2FYQA 2RCEA 2NWNA 1G9IE 2HPQH 1HAHH 2V35A 5FPTA 3PWBA 3EA9A 1FNIA 3STIA 3STJA 1BB0B 1QQUA 2GZ8A 3ZYDA 2OC7A 2J2UA 4FU7A 1O30A 2PW8H 1LVMA 1GHBG 2UWOA 3BTTE 2H2ZA 4K2YA 3ZVEA 1DLEA 4X8TH 5JDUB 3TNSA 2VVCA 2P95A 4OS1A 2GZ9A 1MBMA 4X6PA 2PV9B 1G3BA 2XRCA 3M7UA 1FLEE 2ZU1A 1VITG 1HIAA 4ZKRU 1D3TB 1DSTA 3ESTA 3ZZDA 2I6SA 1TOMH 2HALA 1AZ8A 1AD8H 3RC5A 1P05A 3LGIA 1Z6JH 1T7CA 1V2NT 4B76A 3CS0A 1D4PB 2XYAA 1FY1A 4VGCC 1QJ7B 1Y3XA 3TU7H 1E34B 1A61H 1GBHA 1SGNE 1BRCE 1J15A 3MTYA 1BT7A 1ZMNA 1K2I1 4A6LA 3S7HB 1GHAF 2A4RA 3MI4A 5AF9H 1GI9B 2GCHG 2BDCA 2Z6BD 1IQGA 3SQEE 3KEEA 2B8OH 1F0SA 2SNVA 1H9HE 1W7XH 1EPTA 3O8CA 3BTFE 3SV7A 3RXFA 1TQ7B 1O2HA 1O3HA 2Y6TA 1C5YB 3OY5U 4HFPB 2C8ZB 1T4UH 4BNRA 3U8OH 3PYHA 1BIOA 1MTNB 5ABWA 1GI1A 1ESAA 8LPRA 1G3DA 2FP7B 4NA8A 1TRNA 3D23A 4ZXYH 3Q00A 2K1QA 1O5DH 1KTSB 1QBVH 1YPMH 3TK6A 4Y10E 3SUFA 5PTPA 1UO6A 2CGAA 1GG6C 1QL8A 3ZV8A 3RU4E 3TH3H 4IC5A 2C4FH 1HAXB 4FUIA 1BHXF 2TBSA 3JZ2B 7GCHG 1TMTH 4WH8A 1H8DH 3A82A 1EJAA 1G2MA 2XXLA 3PMJA 3SORA 1WUNH 1GVZA 2Y5HA 4K60A 1BZXE 2W7UA 3DHKH 4O03A 1FY3A 1Y8TA 1NESE 2GT8A 1HAOH 1DY9A 5E8EH 5JPMH 1DUEA 2A2QH 6LPRA 1H8IH 3ZZ3A 3KGPA 1HFDA 1GBEA 1FY5A 1BJVA 1PPBH 3HK6B 4OS5A 2R3YA 3VB7A 2TRMA 2TGPZ 1C1PA 3BTKE 4A92A 4ISNA 2C8XB 4TY7A 4JK6A 2XBVA 1LHDH 1O2XA 3T5FH 3A7TA 4NCYA 3RMNH 5FHTA 1B0EA 1LQDB 4B73A 1RTFB 5F6MA 2RA0A 3HK3B 1RS0A 1VGCC 1P9UA 1O37A 3RMMH 2Y7XA 3F68H 3RXKA 6CHAC 2FI4E 2G55A 4Q7ZA 2WPMS 3EA7A 3GCNA 2P16A 2P93A 2W7SA 4YTAA 2ZHWH 3UQOA 2AS9A 5DP6A 2OD3B 3UREA 2FOCA 1AVXA 1C2IA 1ZMLA 1P2OA 2V3HH 8ESTE 1BA8B 2ZPSA 2F9OA 4OGYA 1LKAA 2WINI 4NIWA 1NO9H 1AUJA 1RIWC 1YCPH 2J94A 4DIHH 4Y71A 4KTUA 4BANB 4XOJA 1SLUB 4E7NA 1ANCA 1S0RA 1SR5C 3SI4H 2ZWLH 4MLFB 1GPZA 1C2LA 1NRPH 3SW2B 1BTHH 4Y6DA 2FX6A 2QF0A 2NU2E 1DDJA 4FUBA 5DP9A 1FDPA 1W10U 3ZVDA 1AWFH 1MTUA 1BBRH 1WBGB 1Z71A 1BMAA 3UNSA 3S69A 1Z8GA 1M9UA 1WOFA 1ELAA 1CVWH 1UTOA 1AFQB 4K1SA 2BY6X 1EX3A 1SHYA 1O2ZA 1ELTA 8GCHF 1G30B 3BG4B 1XM1A 1V3XA 2IOTA 2OCVB 1UCYH 1ESTA 3RMOH 4X6NA 1UTPA 1O36A 2EA3A 5HM2A 4ZKNU 2GMTB 4X6OA 3PMAB 4UEHH 3NWUA 3UWIA 3MNCA 2YOLA 3MNBA 1GMHF 5L2ZH 3S0NA 2F3CE 1A2CH 1N8OB 1MKXK 6GCHG 2GDDA 5AHGH 2D8WA 2AERH 5FBEA 1IQIA 1O3JA 1C9TA 4ABAA 3FP7E 5F8ZA 1W12U 3LC3A 1C5XB 1SOTA 3TK9A 2SGQE 3HKJB 3RC6A 3QTOH 4MG3A 3RXPA 1MBQA 5FX6A 1G32B 3M61U 1N1LA 1OWEA 1DWBH 2Y5FA 3C27B 1F0UA 1GHWH 1GDQA 2Z9GA 1V2JT 2P3UB 3HGPA 1FIWA 2FXRA 1Z1JA 5GCHG 1ZHRA 2FESH 3E1XB 3RC4A 1SI5H 3GY3A 5B6OA 1EQ9A 1O5GH 1C2GA 3LU9B 1TBQH 2ZC9H 1E37B 2R2MB 5EOKA 1QB1A 3ZZ6A 3MNSA 4YOGA 2JH6D 1GBDA 5T6FA 1O2VA 4ABBA 1C5SA 1WQVH 1EP6A 4D9RA 1O2TA 4Q2KA 2GP9B 1CT4E 3CP7A 4RN6A 3BEIB 3SJOA 4MNXA 1DT2A 1VZQH 2FI5E 2XCNA 2XWBI 3SOSA 3CENA 1EOLA 1NM6A 5DP4A 2Z94A 1Y3WA 1F5RA 1PYTD 7LPRA 2PHBA 1ZZZA 1JMOH 3BTQE 4BOHA 2TIOA 2VIDA 2OUAA 1QR3E 3MOCA 5DP8A 1O3MA 2W3KA 3ATWA 4D76A 3A81A 1TX8A 1K22H 5TCCA 4CHAC 3O8RA 4JYTA 3OX7U 1O2YA 2H9HA 3TITA 1MU8B 2ULLA 3AW0A 3ATKA 1YPJH 2G4UA 5FCKA 2B5TB 2R0KA 2BVSH 1XKAC 4UFEH 1P2QA 2VH0A 2A4QA 2A32A 4GPGA 2G4TA 1YM0A 3GYMA 1SQTA 1KDQA 1W7GH 1KXBA 1MCTA 2GDEH 5A0CA 4K5ZA 3H5CB 3M3SA 5FXLA 2ZDLA 4IN1A 1MQ6A 4I32A 4ZHMU 4RSPA 3A8DA 3MU0A 5EPNA 5C5OA 3I77A 4O3TA 3P8NA 4FXGH 1QA7A 1YPKH 2WYGA 1IQLA 1KXDA 1ZLRA 2ZU2A 2J38A 2ZEBA 1Y3YA 1FPHH 4AFZA 1HAGE 1B0FA 3VFEA 1GHBF 1C1NA 2ANMH 3RXDA 2QIQA 1ARCA 1O3BA 3SUGA 2ZFRH 5DP7A 1BTYA 1FONA 5F03A 1IHSH 4WMEA 1ESBA 1HAZB 1V6DA 4FUCA 5GXPA 4YLUA 1VITF 1Y3VA 2F9BH 1QB9A 2QY0B 1S82A 2RDLA 3ZZ9A 1C1RA 2PGQB 3GDVA 1ZR0A 1OP0A 3ATMA 3SGQE 2ZNKH 1NRSH 1HAVB 2Z3DA 2VIPA 3QUMP 2BD7A 5HGGA 2VINA 1Y3UA 3TLOA 4B1TA 1EUFA 2PTNA 2BZAA 5BPEA 4MQAA 2A45B 3RXRA 2QC2A 3E91A 3DD2H 1RJXB 5I25A 2C93B 1YF4A 3BTGE 1XUGA 1MTNC 1KIGH 4IMQA 1L1GA 1C5ZB 1TRYA 2WPHS 2FOGA 2GCHF 3RLWH 1O3OA 2VIVA 2W5EA 1Y5UT 2A5KA 2FLRH 2GD4B 1SFQB 4CR9A 1AZZA 1JOUB 1HJ9A 1TNLA 3ENSB 2AYWA 2SGFE 1F7ZA 1GWAA 1ELDE 1Z7KA 1IQKA 1O2RA 1UCYK 1SMFE 2QXHA 2ZECA 1UTKA 2ILNA 4ISOA 4O9VA 1DUAA 1B5GH 4FUGA 1KY9A 3QLPH 4AGJA 2B0FA 4I8GA 3ZZ5A 3UNRA 2FTLE 3D62A 3GY4A 1C2KA 2P59A 3BN9A 1QJ1B 1NPMA 1ANEA 3QX5H 1OS8A 1WTHD 3B8JA 4BAOB 4CREA 1QL9A 2THFB 3K2UA 2P8OB 4WMDA 4LZ4B 2ZGHA 1GJ5H 7GCHF 2AIQA 1O5FH 1QCPA 4WXIA 1HXEH 2PUXB 2GV6A 5GWZA 4DY7B 1S6HA 3VPKA 2RA3A 1KXEA 2BMGB 1C2HA 4ZXXH 1YPGH 5DG6A 5C20A 1L0ZA 3MMGA 3I78A 2ZFFH 5F8TA 4GSOA 1C9PA 1DY8A 3LJOA 2XW9A 1FAKH 3K6YA 1MMJN 2C8WB 1P2IA 1NFWA 3EDXB 2DE9A 1QGFA 5DGJA 4Y8YA 1ZSJA 1YPHC 4NIXA 3PLKA 5DK1A 2ZGJA 1YGCH 1NTPA 2Z9JA 3E90B 1SGPE 2ZA5A 1SFIA 1P06A 2ZHEH 3MFJA 4NA7A 4PROA 3TJUA 3QZQA 3BIUH 3A87A 1NZQH 1MTSA 1BJUA 5HYOA 1PPEE 1BRBE 4CRGA 3UFAA 3W94A 4K1TA 3OTJE 4NZLA 2FMJA 3AW1A 1ZJDA 4J1YA 4ZHAA 1EZXC 1UVUH 2BLOA 2Z7FE 1YCPM 2GCTB 4DURA 3PWCA 2OC0A 1BTXA 4E7RG 1TMBH 1IQNA 2QGRA 1ZSKA 1O5AB 2CHAB 1C5PA 2BQ6B 3RXJA 1Z8IB 1HGTH 2BXTH 4AFSA 2BB4A 2TGDA 1P2KA 3FZZA 1AFQC 1V2UT 3FP8E 4LOYH 5A8ZA 2ZP0H 1O5BB 1UK3A 1D6RA 1D3PB 4Y0ZE 3BG4C 3DT0H 3TJOA 1LHEH 2AGGX 2VWNA 1YBWA 4X8VH 1FY8E 2H6MA 9LPRA 2GMTC 1ORFA 1IQEA 1TPOA 1FIZA 2ANKH 2Q1JA 2EC9H 4OS4A 1N8OC 1XUHA 1LHGH 2GKVE 3GYLB 4IN2A 4XBCA 3TGIE 3KQDA 1INCA 3A8AA 4X2WA 5C1UA 1ZGVA 3L33A 1B7XB 3SGAE 1LKBA 4IGDA 4QT8C 1V2OT 1EAIA 1VJ9U 1GHVH 2VU8E 1C5RA 1UK2A 4MVNA 4AGKA 3SUEA 3EE0B 1O3FA 3URDA 1MAYA 1WTGH 3NXPA 1P04A 3F9EA 3KL6A 1TYNA 3F9GA 1G3CA 4BAKB 1TONA 3LDXH 2BOHB 3TJNA 5EQSA 2ZHFH 6GCHF 1MKXH 1P3EA 1DPOA 3A8CA 3P70B 3GISB 4XBBA 2V0BA 1TNIA 3NPSA 1PQ8A 4XE4A 1W0ZU 1O3KA 2P3FH 3SNCA 1QBOA 5EG4A 4CH8B 4Q80A 4DG4A 5J4SA 2GVFA 4AYYB 1K1JA 1SGTA 1Q2WA 3SU6A 1ZGIA 1O2PA 4FUFA 5J4QA 5LH8A 1CU1A 1H1BA 4X2XA 1S0QA 2FLBH 5GCHF 4AYVB 2BHGA 3M5OA 1NFYA 1U6QA 1PFXC 5GPIB 1ELGA 3E0PB 2AGEX 2J9NA 2ZHDA 4CBOA 3RU4D 1O2QA 3A84A 3O8BA 1J8AA 5LGOA 1C5UA 1FAXA 3QDZB 1EZSC 1O3PB 3MU8A 2WPIS 2WUBA 3SV6A 1IHTH 3SQHE 3DUXH 1K1IA 3SHCH 4IMZA 1C2MA 2ZCLP 2FOMB 4WY3A 4JZEH 1KLJH 4M7GA 2PR3A 1OYQA 1GCTB 5A0AE 1TFXA 1E36B 3A7WA 4TWYA 4JZFH 3LGWA 1P12E 1ZMJA 2VWLA 4IS5A 5ESTE 3RXVA 3A89A 1P2MA 2FZZA 4SGAE 1BTUA 1AHTH 3SBKA 5GIBA 1NFXA 3PTNA 4FUEA 3UOPA 3JZ1B 4CRFA 1NRNH 3LH3A 1MTVA 2Z3CA 1AWHB 4YOIA 5AFZH 1SL3A 2O8MA 1EXFA 4U01A 2QXJA 3VB5A 1SGYE 3UR9A 2WYJA 3PLPA 1FMGA 3UR6A 3LGTA 4MPWA 3E16B 1VCQA 5EQRA 2QN5T 3SV8A 1XUKA 5C3NA 1GBIA 5T3HA 1TRMA 3RXBA 5BRRE 3ODDA 4I8LA 2V3OH 1G37A 1RD3B 4FUDA 2FS9A 2PGBB 1LO6A 5TCAA 2DUCA 3SNBA 1S5SA 2Y7ZA 8KME2 1QFKH 4XFQA 4U30A 2FPZA 4JZDH 1KLIH 4F49A 1A1RA 3I29A 1TNKA 3CS7A 1HAPH 1OWDA 2F9PA 2ZI2H 2ANYA 2FEQH 2BVXH 3OSYA 3O8DA 3BF6H 1K21H 3T28A 2G51A 1OX1A 1MAXA 4D8NA 3A86A 3PO1B 4NA9H 3VXFH 1GCDA 4WJG2 4ABGA 4WXVA 1ANDA 1V2QT 3MWIU 2ALVA 1GMDG 4U32A 3LGUA 2BXUH 5IYTA 2FX4A 2OC8A 1IQMA 4GHTA 3FZDA 2TGAA 1NT1A 1NU7B 3ZZ7A 4TYDA 5FPSA 1E0FD 3FAOA 4Y8ZA 5AVDA 1SVPA 3TK5A 1ZPZA 4ABJA 1WQSA 2QCYA 2VWOA 2O9QA 3FANA 1PPGE 2M5TA 4CRBA 2PKAB 1J9CH 1ZPBA 4OGXA 3MU4A 4GUXA 1BITA 1PPFE 3ZVGA 3ZZ4A 1W2KH 4MPVA 3GDSA 2A5AA 3TIUA 1MH0A 1LVYA 3LH1A 1UJ1A 1NN6A 3PM3A 1W13U 2A7JA 2F9NA 2ODPA 5C1XA 4I33A 4YO9A 4MPUA 4ABDA 4FUHA 1XMNB 2EEKA 2C8YB 2ZU5A 1PPZA 4TPIZ 1CGIE 1LMWB 1DXPA 2NU0E 2ZGXH 3W95A 2CJIA 2O8TA 4Q7XA 5E2OA 2D26C 1HYLA 1K1NA 1TGNA 2P8OC 3KN2A 3BEFB 1FI8A 1GBCA 2O8UA 1FJSA
chains in the Genus database with same CATH superfamily
1THSH 2AMQA 1ZTJA 1D3DB 2J97A 3GDUA 3OYPA 1H9IE 1ANBA 1KXAA 2ZFPH 3D65E 3LJJA 5EU8A 3M5NA 1P9SA 2BDIA 4UE7H 4ZH8A 3ZYEA 1IQHA 3F9HA 3ZVAA 3KNXA 4U2WA 1HNEE 1E38B 2OTVA 4A1TA 4INKA 3DFJA 3VB4A 1C1WH 5JBTA 1DLKB 1FUJA 4NZQA 3T27A 5A8XA 1LPZB 1CA0B 6ESTA 2FS8A 2HLCA 2ODYB 1TB6H 5KGOA 4KTSA 1T4VH 3BTHE 4THNH 4ASHA 3A7VA 3UTUH 2QE7D 4MNYA 5FBIA 3M7TA 3KHVA 3P92A 2RFKC 3P95A 4Q4LA 2XNIA 4OS6A 1C2JA 2J4IA 1DM4B 1ETRH 3LGYA 3ZVCA 1TNHA 1GBLA 1O2MA 2AGIX 3H7OA 1O3IA 1WU1A 2PLXA 5DKMA 4BAMB 3RP2A 1GBMA 3FVFB 1TABE 1ZSLA 3E8LA 2GCTC 1P03A 4AX9H 1QURH 3RXQA 1A3BH 3SNEA 1MD7A 2CHAC 3MQKC 1JIMA 4NGAH 5EODA 1EPTB 1SSXA 1LQEA 4KELA 4IBLH 3BTDE 3SHAH 3ZZ8A 1NRQH 4Z1MD 2BDAA 1GL0E 3LT3A 4LXBH 1BTWA 5E0GA 1SOZA 3MH5A 4ZHLU 3VB3A 4BAHB 2W6JD 3RXMA 2Y5GA 4YT6H 4A5TS 1TPAE 2ZF0H 1EAWA 4JYVH 4K3JA 1PJPA 1QNJA 1RTKA 2Q6FA 1JWTA 1A46H 1CT0E 2QV1A 3BV9B 5EXLA 1K1PA 1A5GH 2J92A 5CMXH 4K8YA 3TNTA 2ZO3H 3LIWA 4NFFA 4OM9A 2BD4A 2KCAA 1JIRA 4XDEA 1SLVB 4NIVA 2XC4A 5E0JA 3SJ8A 2ZGBH 1AO5A 2WPKS 1QY6A 2PTCE 3BIVH 1GBKA 5T6DA 4B71A 1SGEE 4AZ2B 2VGCB 1C1OA 1OP8A 1RXPA 1VCPA 2ZCHP 2B9LA 1G36A 3S9CA 1T32A 2J5UA 3LC5A 4HZHA 5CHBA 3SYJA 2IJOB 1DWEH 3MH7A 3IWMA 3UNQA 3A85A 2JH5D 1O5EH 1VITH 2OQUA 2ZCKP 3M3TA 4D7FA 1T8LA 2GX4A 1HJAB 2Y82A 2SGDE 4MDSA 3OU0A 5I46H 3ZVFA 2B7DH 1AUTC 1S83A 1ZTKA 3KIDU 1O2NA 2BZ6H 1BRAA 3V12A 5HMAA 1K1LA 1MCVA 1SC8U 2XC5A 3ODFA 1AVWA 2BDYA 3NKKA 4Y79A 3D49H 1XUIA 3OEED 2HVXA 3GY5A 1O35A 1TBRH 2FWWA 3K65B 1GJCB 1LPKB 3NUMA 1VJAU 3ATIA 1YPHE 1GJAB 1MKWK 3DFLA 1L4DA 3FFGA 1BTPA 5EJ1A 1C5WB 1KSNA 2GZ7A 3SJKA 4YOJA 1AE8H 1F5KU 4TT3D 3PLBA 1BCUH 1SB1H 1GCTC 1UK4A 2BLQA 3EAJA 5DJ7A 5LPFA 2WV5A 1TX7A 1UHBB 1SLXB 3T2NA 1S6FA 5EXNA 1P3CA 1EZUC 5DN6D 2WHXA 1Z1IA 1BMMH 1P09A 1SQAA 1O2LA 4X6MA 3RXTA 4MNVA 1NBMD 4E06H 2FOAA 2XCFA 1OOKB 3QGNB 1ZOMA 1V2TT 2AMDA 1O3DA 1Y59T 1W14U 2FOEA 1HRTH 1BBRE 2UUKB 2AFQB 2VIOA 2EI8A 3KF2A 3DSGA 1EP5A 1GBTA 1JXPA 2F9VA 4MTBA 1O0DH 1O3GA 3RDZA 2TPIZ 2ODQA 2BY8X 2BY9X 1ELFA 1TLDA 1GI0A 1HAIH 2Y81A 4UDWH 4DVAU 3CNRA 2XBXA 2BQ7B 1V2RT 2ZTXA 2HNTE 1KXCA 1QA0A 5EIYA 4YZUA 4KP0A 1GJ8B 2ANWA 3FKSD 1C5VA 3EA8A 1C5MD 1XKBC 2FDAA 1G2LA 2SGEE 1O39A 1JRSA 1C5TA 1MTWA 3MU5A 3B9FH 1GGDB 1YKTA 5G4BA 5JBAS 2ALPA 4UD9H 1CHOG 1SPJA 1AFEH 2DE8A 1W0YH 5C2ZA 4FUJA 1V2WT 1HXFH 2A5IA 1NS3A 4BTUB 1GJ7B 1WCZA 2FO9A 3E6PH 3PO1C 3SU0A 2G5NA 1ZTLA 1PQ7A 1YPLH 3TH2H 1ELEE 1ZPCA 3SJIA 3UIRA 1GDUA 4TWWA 3UOUA 3S9AA 4OS2A 3BTME 4NG9H 1DSUA 4X8SH 2ZQ2A 1PPHE 2BOKA 4NWKA 1YYY1 1AB9B 3M3VA 4J2YB 1EAUA 1DANH 2QXIA 3FN8A 1TE0A 4WH6A 5FAHA 1MUEB 2WPLS 5CE1A 5JB8S 3U1IB 3GCHB 2OQ5A 4I8JA 1X7AC 4UFFH 3DCLA 5TJXA 2FI3E 1GMDF 2JETB 3NZIA 1EATA 3EYDA 2KAIB 3C1KA 1DS2E 4NFEA 3HPTB 4GHQA 2FOFA 2IN2A 3UB0A 4DGJA 1DWDH 2BDGA 3SV2H 1KYNA 4YM9A 1P11E 1FN8A 1DE7H 2ZDKA 4BTIB 1D9IA 1TA2A 2CV3A 3MYWA 1LHCH 1P2JA 1LVOA 1O3LA 2PKSB 4JMYA 5C0UA 3U9AH 3V7TA 2HNTC 1NY22 2HWLB 1W0KD 2STAE 1TQ0B 3L6PA 2YMSB 4Y76A 5ETXA 3MH4A 1ABJH 1W11U 3VEQB 1ZRBA 1K1MA 3PB1E 3R3GB 2QYIA 1CGJE 4TPYA 1VCWA 3KQEA 4ABEA 1GMCG 3A8BA 4YXWD 2FOBA 3FO8D 4HTCH 4WF8A 4ISIH 3SU5A 4Z0KA 1YWUA 2CN0H 1H4WA 1QIXB 2C90B 2Z3EA 1Q31A 3ELAH 1WXRA 3GY6A 1CA0C 4CBNA 1YP9A 4BXSA 1BRUP 2YNBA 1QQ4A 2VVVA 1SG8B 3T26A 1RRKA 1Y5AT 4FU8A 5L6NH 1O3NA 2XNDD 3QTVH 3B23B 2IPHA 4NIYA 4I86A 4O97A 3TPIZ 2RDEA 1CO7E 3M7QA 1EZQA 3PRBA 3UWJH 1AU8A 2XWAA 3F2GA 1WAYB 4RKJB 3WY8A 3RUOA 1QRXA 1S84A 2ZIQH 1UVPA 4ZAEA 2WSSD 1YLDA 4JZ1A 1GBJA 2BYAX 1TAWA 4DJZB 3AK5A 1NC6A 4AORA 2LP6A 2XOKD 1OSSA 3RXSA 3HKIB 4F4OC 2M2AA 4X1QU 4X1PU 3LKWA 2BDHA 4BTTB 2BD3A 2SGPE 2PUQH 2YNAA 4GCHG 3A7ZA 3PROA 1EPTC 1A0HB 1L2EA 3SN8A 1FY4A 2K8IA 1TPPA 3SU2A 2BTCE 3U8RH 1CE5A 2G00A 3SNAA 1WSSH 1DXWA 4Y0YE 3Q3YA 1AVGH 1BHXB 3RLYH 1DVAH 1EKBB 1TGBA 1UTNA 1XXDA 5L2YH 1NRRH 1Z8JB 4INHA 5EPYA 2VIQA 3U69H 3K9XB 4R0IA 3RXEA 5L30H 1A4WH 2BLVA 1C1SA 2KCYA 3M5MA 3IITA 1W3CA 1J14A 5A2MH 5HXFA 3ATLA 4I8KA 1UTQA 1K28D 2Q6GA 2G81E 4CRAA 3PV5A 2OLGA 1TNGA 1TMUH 4HG6A 5T6GA 3Q3XA 3U1JB 3GCTG 1C1QA 2EI7A 2OC1A 4BAQB 3M35A 3P8OA 4TSFD 2R9PA 1V2VT 1V2ST 4GLYA 2ZTZA 4WWYA 4K8BA 1Z8RA 3SI3H 3KQCA 2VGCC 5CHAB 2GTBA 1GI3A 1A5HA 1S81A 1CA8B 1IQFA 5LPEA 1SGQE 2WV4A 1ETTH 1TWXB 2QF4A 1CGHA 1W0JD 3ZZAA 1ZJKA 1HBTH 1UTMA 2P3TB 2STBE 4ZROA 3BSQA 1HJAC 1XUJA 3AVZA 3M36A 1GI5A 3BTEE 4YLQH 2JH0D 3TH4H 2A7CA 3SNDA 3ZZCA 5C67A 1SGFG 2VBCA 2A31A 5FX5A 1SGRE 1T8MA 1UVSH 1YLNA 1XVMA 4D7GA 3QK1A 1CBWB 1P02A 1GJ4H 2TGTA 4ISHH 4H42U 2BDBA 1OP2A 1C4V2 1ZHPA 1SQOA 2Y80A 2BQWB 1C2DA 1O2SA 1AE5A 1QTFA 2LPRA 2L6OA 5JB9S 1OKXA 3PMHB 2EI6A 3TJVA 1QL7A 2HPPH 5A8YA 9ESTA 1HCGA 4H6SB 4GVUA 4I8HA 1N6XA 3SGBE 5E2PA 1GVLA 2ZZUH 4KKDA 1P8VC 1THRH 4TY6A 1YPEH 2ZDNA 2BD9A 4INLA 1RFNA 3IG6B 2ASUB 2BY7X 5JBBS 1ABIH 1HAVA 3DSOA 2VB0A 2RG3A 2BX3A 4NSVA 4ZKSU 3A83A 1MKWH 2ZTYA 2C3SA 1HAYB 1KTTB 3W1EA 2J95A 2JDID 3P17H 3VGCB 5FPYA 1WYKA 2UUYA 2UUFB 1S85A 3A88A 2HGTH 1EJMA 4AG1A 1L1JA 3RM2H 1RGQA 1DICA 5EQQA 2BD2A 1P10A 1C5LH 4O3UA 1UHBA 5A0BA 1SGIB 4H6TA 4UFDH 2ZFTA 4NWLA 3RXGA 4JYUH 5HM9A 4HGCA 4AB9A 1CT2E 4RT0A 1CSOE 1O3EA 2BD5A 3Q77A 1TIOA 1HDTH 2PSYA 1OWJA 3F0OA 1AKSB 5EW2H 2F91A 4I7YH 2BLWA 5IDKA 3OTPA 2OP9A 5FCRA 1C5QA 1T8NA 1UTLM 1O33A 1C5NH 3TVJB 3E0NB 1F5LA 1GGDC 1HLTH 2OBOA 3RXLA 4Y11E 1EB1H 3ZVBA 1F0RA 3F1SB 3LGVA 1A3EH 3U98H 1V2MT 1TOCB 3QN7A 3KCGH 4HI3A 2OBQA 3L3TA 5AFYH 1ETSH 2GV7A 3RXUA 4XD7D 4MPXA 1PQAA 5C5NA 2ZDMA 1SGFA 1WV7H 3N7DA 1J17T 1ELCA 1YC0A 1O2OA 1SKYE 1XUFA 1O3AA 2ZU3A 1HUTH 2AIPA 3Q3KA 1IAUA 2Z9LA 1GDNA 1AGJA 3A80A 3N7OA 3URCA 4A1VA 2UWPA 3Q76A 4ZUHA 1O2IA 3GOVB 5GDSH 4F55A 1O34A 5JYIA 2A2XH 1HIAB 2QF3A 4CR5A 1CHOF 2HNTF 1C1VH 1AB9C 1C2FA 2R3UA 1BDAA 1F92A 3QGJA 3SO3A 3SZNA 2R2WU 4YT7H 2UWLA 2LNCA 3MNXA 3P6ZB 4AOQA 4AB8A 1SGDE 3GCHC 1OPHB 2ZDAH 1NROH 2FODA 1L4ZA 3PTBA 5DP5A 4BXWA 2SGAA 4DIIH 2JETC 2H9EH 3DSPA 3UPEA 1BTZA 1GHAG 4R8TB 1SGCA 5ESBA 4ISLA 2ZFSA 5K7RA 3UY9A 3RU4T 2XBYA 3RM0H 1J16A 1OWKA 1O2JA 5DO4H 4B6EA 1GBAA 3RMLH 3PMBB 1Z6EA 3GY8A 4RKOB 2BM2A 4ABIA 4CRDA 1ELBA 2PKSC 2FOHA 1E1QD 4VGCB 1TGSZ 1DITH 1A7SA 1DX5M 5EXMA 2KAIA 2YMSC 1ID5H 4XBDA 5GNDA 2BY5X 3AAVA 1F2SE 2XBWA 2HOBA 2FIRH 1C4Y2 4Y7AA 3SV9A 1K9OE 4B2BA 4ESTE 3TGJE 1L1NA 1AQ7A 4DW2U 3UQVA 1HJ8A 2WUCA 3LOXA 3SUDA 1C1UH 1TNJA 3GCOA 4P02A 3H09A 1JBUH 3WWFA 5DSFA 3A7YA 1TBZH 2CF8H 3R0FA 3MHWU 4B75A 1GHZA 7KMEH 2VIWA 1O5CB 2JKHA 1QBNA 3G01A 1OYTH 4AN7A 3MO9A 2KFWA 1H8HD 1IQJA 1IOEA 1HB0B 2Q6DA 4ZMAH 2PWXA 1GMCF 2F9UA 1FQ3A 1SHHB 5HKKD 2SFAA 3DA9B 2W26A 2ZKSA 4Z6AH 2AEIH 3FP6E 2H5DA 3TGKE 5EGMA 3NK8A 4I31A 1GG6B 1DWCH 1FZZA 1RTLA 1A0JA 4FVDA 1QHRB 1T8OA 1LCYA 2A7HA 2ZFQH 1CHGA 1D6WA 1FXYA 4H4FA 4DOQA 1LDTT 1NFUA 1O3CA 2O8LA 3V13A 1FV9A 4LK4A 4OS7A 4RI0A 3T62A 1WDIA 1E79D 4CRCA 5JBCS 2VH6A 1NU9A 1GI2A 1V2LT 4ABHA 2I6QA 2ZQ1A 1GHXH 1GI4A 4WVPE 2HRVA 1EJNA 1O2WA 4M9FA 3SU4A 7ESTE 2CXVA 2VNTA 1YLCA 2H9TH 1C4U2 3PV2A 1LPGB 2NU4E 4IC6A 3NCLA 2ZG0H 1BUIA 1AY6H 1TALA 1O2GH 2CF9H 3P8GA 3GS9A 3RXAA 1QB6A 4LZ1H 2IJD1 3EGKH 1EOJA 5F8XA 1O31A 4B2CA 1C5OH 1HV7A 1GI7B 1V2KT 3VXEH 3LONA 1TA6A 2H1UA 1BOQA 4K1EA 2AMPA 2QXGA 3GY7A 4Q7YA 4UFGH 1QJ6B 5HIYA 2O8WA 1YCPK 3U8TH 1E35B 3F6UH 2GT7A 1Y5BT 1GBBA 4GCHF 4AFQA 2VWMA 1VGCB 4X2VA 2A4GA 1T31A 2XC0A 3P8FA 4E05H 3H7TA 6CHAB 4UONA 3F3BA 2ZGCA 1K1OA 4P00A 2Z9IA 4JK5A 4X0WU 5E0HA 4X8UH 1OWHA 3QO6A 1ACBE 1GJDB 1THPB 2J34A 3QWCH 3V3MA 1GJ6A 2HLDD 2ZDVH 1KMHB 3KQBA 4B2AA 2Z9KA 1BBRK 4Y7BA 1G3EA 3BTWE 4FVBA 4A1XA 1AMHA 2PFEA 3ZZBA 2BVRH 1RIWB 1XXFA 5CHAC 2P94A 4DCDA 1AIXH 1FN6A 1GJ9B 2ZU4A 2GGVB 3EQ0H 1TGTA 4FU9A 2QA9E 4AFUA 4A7IB 1AN1E 1OXGA 1UCYE 1MZAA 1GI8B 4X1SU 1H9LB 1O38A 1QRZA 2W3IA 3M5LA 3HATH 8GCHG 1EAXA 3GCTF 1FPCH 5KEDA 1PYTC 4DT7B 3ZV9A 5A09A 4ABFA 2KX4A 4GAWA 3F9FA 1C1MA 1KXFA 1GMHG 3QZRA 1MD8A 3UUZA 2FM2A 1BMNH 1ARBA 1TGCA 3AAUA 3S9BA 3RXIA 4NSYA 2QF5A 1CBWC 4IW4E 4JCNA 2R0LA 4WMFA 1JRTA 4JZIA 1MZDA 1PPCE 1O32A 2D1JA 1P01A 2KR7A 4X2YA 3T25A 2G5VA 3MH6A 1C1TA 2A0QB 2FTMA 4XSKU 1ELVA 1BMFD 1ZHMA 3SJ9A 1P0SH 2BX4A 4SGBE 2UUJB 2PSXA 3MO6A 2NU1E 2VVUA 1KLTA 1GL1A 4KGAA 4CH2B 2SNWA 3K6ZA 1MQ5A 1UTJA 5SGAE 1EB2A 1C2EA 1DOJA 2ESTE 4Q63A 1AI8H 3VGCC 2CMYA 1DFPA 1HPGA 3LPRA 2OXSA 3SU3A 1XX9A 1A5IA 1GI6A 4X1NU 4YESB 3S7KB 1GHYH 1A0LA 2BD8A 4D9QA 4MNWA 5C1YA 5EW1H 1W8BH 1O2KA 1GVKB 2KM0A 1ZRKA 1FX0B 5B6LA 1F0TA 3MU1A 4FETA 2OINA 1BQYA 2ZHQH 1GJBB 3GY2A 1XVOA 2ZPRA 3PV4A 2ZPQA 1LHFH 3VB6A 2PKAA 5DPAA 1UMAH 5HIZA 3T29A 2OK5A 2G8TA 4AG2A 1D3QB 1SLWB 1QRWA 4B74A 1UVTH 3BEUA 4KTCA 2WPJS 3RXCA 1P57B 1ZYOA 1PQ5A 1OWIA 5K0HA 1N6YA 2QAAA 4K69A 2V6NA 3BG8A 1BMLA 2H5CA 1TPSA 2FYRA 2VJ1A 1LVBA 3GICB 5H4IB 1MU6B 3A7XA 2D2DA 3SU1A 1TX6A 4Y8XA 1O2UA 3HGNA 3V0XA 3RXHA 5DP3A 1CQQA 3OY6U 2A4OA 2AH4X 2G52A 1AKSA 3RXOA 2NU3E 1V2PT 1EASA 1P2NA 3MO3A 1KDQB 4X1RU 3E3TA 1VR1H 1LTOA 5LPRA 4CHAB 4ZKOU 2F83A 3M37A 2A1DB 2XTTB 1Q3XA 3ITIA 2WZQA 1GBFA 1SBWA 5GJ4B 1UVOA 3AASA 2FYQA 2RCEA 2NWNA 1G9IE 2HPQH 1HAHH 2V35A 5FPTA 3PWBA 3EA9A 1FNIA 3STIA 3STJA 1BB0B 1QQUA 2GZ8A 5F53A 3ZYDA 2OC7A 2J2UA 3N7EA 4FU7A 1O30A 2PW8H 1LVMA 1GHBG 2UWOA 3BTTE 2H2ZA 4K2YA 3ZVEA 1DLEA 4F48B 4X8TH 5JDUB 3TNSA 2VVCA 2P95A 4OS1A 2GZ9A 1MBMA 4X6PA 2PV9B 1G3BA 2XRCA 4FOUC 3M7UA 2PP6A 1FLEE 2ZU1A 1VITG 1HIAA 4ZKRU 1D3TB 1DSTA 3ESTA 3ZZDA 2I6SA 3WW7A 1K0HA 1TOMH 2HALA 1AZ8A 1AD8H 3RC5A 1P05A 3LGIA 1Z6JH 1T7CA 1V2NT 4B76A 3CS0A 1D4PB 2XYAA 1FY1A 4VGCC 1QJ7B 1Y3XA 3TU7H 1E34B 1A61H 1GBHA 1SGNE 1BRCE 1J15A 3MTYA 1BT7A 1ZMNA 1K2I1 4A6LA 3S7HB 1GHAF 2A4RA 3MI4A 5AF9H 1GI9B 2GCHG 2BDCA 2Z6BD 1IQGA 3SQEE 3KEEA 5EJZA 2B8OH 1F0SA 2SNVA 1H9HE 1W7XH 1EPTA 3O8CA 3BTFE 3SV7A 3VG8A 3RXFA 1TQ7B 1O2HA 1O3HA 2Y6TA 3UAIC 1C5YB 3OY5U 4HFPB 2C8ZB 1T4UH 4BNRA 3U8OH 2HVYB 3PYHA 1BIOA 1MTNB 5ABWA 1GI1A 1ESAA 1E1RD 8LPRA 1G3DA 2FP7B 4NA8A 1TRNA 3D23A 4ZXYH 3Q00A 2K1QA 1O5DH 1KTSB 1QBVH 1YPMH 3TK6A 2IPQX 2EQNA 4Y10E 3SUFA 5PTPA 1UO6A 2CGAA 1GG6C 1QL8A 3ZV8A 3RU4E 3TH3H 4IC5A 2C4FH 1HAXB 4FUIA 1BHXF 2TBSA 3JZ2B 3OFND 7GCHG 1TMTH 4WH8A 1H8DH 3A82A 1EJAA 1G2MA 2XXLA 3PMJA 3SORA 1WUNH 1GVZA 2Y5HA 4K60A 1BZXE 2W7UA 3N99A 3DHKH 4O03A 5FL7D 1FY3A 1Y8TA 1NESE 2GT8A 1HAOH 1DY9A 5E8EH 5CDFE 5JPMH 1DUEA 2A2QH 6LPRA 1H8IH 3ZZ3A 4AC9A 3KGPA 1HFDA 1GBEA 1FY5A 1BJVA 1PPBH 3HK6B 3PRDA 4OS5A 2R3YA 3VB7A 2TRMA 2TGPZ 4RT1A 1C1PA 3BTKE 4A92A 4ISNA 2C8XB 4TY7A 4JK6A 3OAAD 2XBVA 1LHDH 1O2XA 3T5FH 3A7TA 4NCYA 3RMNH 2KCOA 5FHTA 1B0EA 2J98B 1LQDB 4B73A 1RTFB 5F6MA 2RA0A 3HK3B 1RS0A 1VGCC 2F43B 1P9UA 1O37A 2YMSD 2Y7XA 3F68H 3RMMH 3RXKA 6CHAC 2FI4E 2G55A 4Q7ZA 2WPMS 3EA7A 3GCNA 3OE7D 2P16A 2P93A 2W7SA 4YTAA 2ZHWH 3UQOA 2AS9A 5DP6A 2OD3B 3UREA 2FOCA 1AVXA 1C2IA 1ZMLA 1P2OA 2JIZD 2V3HH 8ESTE 1BA8B 2ZPSA 2F9OA 4OGYA 2V3MA 1LKAA 2WINI 2GJGA 4NIWA 1NO9H 1AUJA 1RIWC 1YCPH 2J94A 4DIHH 4Y71A 4KTUA 4BANB 4XOJA 1SLUB 3SZEA 4E7NA 1ANCA 1S0RA 1SR5C 3SI4H 2ZWLH 4MLFB 1GPZA 1C2LA 1NRPH 3SW2B 1BTHH 4Y6DA 2FX6A 2QF0A 2NU2E 1DDJA 4FUBA 5DP9A 1FDPA 1W10U 3ZVDA 1AWFH 1MTUA 1BBRH 1WBGB 1Z71A 1BMAA 5T1VA 3S69A 3UNSA 1Z8GA 1M9UA 1WOFA 1YY3A 3ZIAD 1ELAA 1CVWH 1UTOA 1AFQB 2KZ4A 4K1SA 2BY6X 1EX3A 1SHYA 1O2ZA 1ELTA 8GCHF 1G30B 3BG4B 1XM1A 1V3XA 2IOTA 2OCVB 1UCYH 1ESTA 3RMOH 4X6NA 1UTPA 1O36A 2EA3A 5HM2A 4ZKNU 2GMTB 4X6OA 3PMAB 4UEHH 3NWUA 3UWIA 3MNCA 2YOLA 3MNBA 1GMHF 5L2ZH 3S0NA 2F3CE 1A2CH 1N8OB 1MKXK 6GCHG 4ACAA 2GDDA 5AHGH 2D8WA 2AERH 5FBEA 1IQIA 1O3JA 1C9TA 4ABAA 3FP7E 5F8ZA 1W12U 3LC3A 1C5XB 1SOTA 3TK9A 2SGQE 3HKJB 3RC6A 5IK2D 3QTOH 4MG3A 3RXPA 1MBQA 5FX6A 3KYGA 1G32B 3M61U 1N1LA 1OWEA 1DWBH 2Y5FA 3C27B 1F0UA 1GHWH 1GDQA 2Z9GA 1V2JT 2P3UB 3HGPA 1FIWA 2FXRA 1Z1JA 5GCHG 1ZHRA 2FESH 3E1XB 3RC4A 1SI5H 3GY3A 5B6OA 1EQ9A 1O5GH 1C2GA 3LU9B 1TBQH 2ZC9H 1E37B 2R2MB 5EOKA 1QB1A 3ZZ6A 3MNSA 4YOGA 2JH6D 1GBDA 5T6FA 1O2VA 2WPDD 4ABBA 4XRNA 1C5SA 1WQVH 1EP6A 4D9RA 1O2TA 4Q2KA 2GP9B 1CT4E 3CP7A 3F2FA 4RN6A 3BEIB 3SJOA 4MNXA 1DT2A 1VZQH 2FI5E 2XCNA 1H8ED 2XWBI 3SOSA 3CENA 1EOLA 1NM6A 5DP4A 2Z94A 1Y3WA 1F5RA 1PYTD 7LPRA 2PHBA 1ZZZA 1JMOH 3BTQE 1MABB 4BOHA 2TIOA 2VIDA 2OUAA 1QR3E 3MOCA 5DP8A 1O3MA 2W3KA 3ATWA 4D76A 3A81A 1TX8A 2JJ2D 1K22H 5TCCA 4CHAC 3O8RA 4JYTA 3OX7U 1O2YA 2H9HA 3TITA 1MU8B 2ULLA 3AW0A 3ATKA 1YPJH 2G4UA 5FCKA 2B5TB 2R0KA 2BVSH 1XKAC 4UFEH 1P2QA 2VH0A 2EY4C 2A4QA 2A32A 4GPGA 2G4TA 1YM0A 3GYMA 1SQTA 1KDQA 1W7GH 1KXBA 1MCTA 2GDEH 2LELA 5A0CA 4K5ZA 3H5CB 3M3SA 5FXLA 2ZDLA 4IN1A 1MQ6A 4I32A 4ZHMU 4RSPA 3A8DA 3MU0A 5EPNA 5C5OA 3I77A 4O3TA 3P8NA 4FXGH 1QA7A 1YPKH 2WYGA 1IQLA 1KXDA 1ZLRA 2ZU2A 2J38A 2ZEBA 1Y3YA 1FPHH 4AFZA 1HAGE 1B0FA 3VFEA 1GHBF 1C1NA 2ANMH 3RXDA 2QIQA 1ARCA 1O3BA 3SUGA 2ZFRH 5DP7A 1BTYA 1FONA 5F03A 1IHSH 4WMEA 5C94A 1ESBA 1HAZB 1VKYA 1V6DA 4FUCA 5GXPA 4YLUA 1VITF 1Y3VA 2F9BH 1QB9A 2QY0B 1S82A 2RDLA 3ZZ9A 1C1RA 2PGQB 3GDVA 1ZR0A 1OP0A 3ATMA 3SGQE 2ZNKH 1NRSH 1HAVB 2Z3DA 2VIPA 3QUMP 2BD7A 5HGGA 2VINA 1Y3UA 3TLOA 4B1TA 1EUFA 2PTNA 2BZAA 5BPEA 4MQAA 2A45B 3RXRA 2QC2A 3E91A 3DD2H 1RJXB 5I25A 2C93B 5KECA 1YF4A 3BTGE 1XUGA 1MTNC 1KIGH 4IMQA 1L1GA 1C5ZB 1TRYA 2WPHS 2FOGA 2GCHF 3RLWH 1O3OA 2VIVA 2W5EA 1Y5UT 2A5KA 2FLRH 2GD4B 1SFQB 4CR9A 1AZZA 1JOUB 3F2HA 1HJ9A 1TNLA 3ENSB 2AYWA 2SGFE 1F7ZA 1GWAA 1ELDE 1Z7KA 2L74A 1IQKA 1O2RA 1UCYK 1SMFE 2QXHA 2ZECA 1UTKA 2ILNA 4ISOA 4O9VA 1DUAA 1B5GH 4FUGA 1KY9A 3QLPH 4AGJA 2B0FA 4I8GA 3ZZ5A 3UNRA 2FTLE 3D62A 3GY4A 1C2KA 2P59A 3KYFA 3BN9A 1QJ1B 1NPMA 1ANEA 3QX5H 1OS8A 1WTHD 3B8JA 4BAOB 4CREA 1QL9A 2THFB 3K2UA 2P8OB 1NBME 4WMDA 4LZ4B 2ZGHA 4DT4A 1GJ5H 7GCHF 2AIQA 1O5FH 1QCPA 4WXIA 1HXEH 1UW7A 2PUXB 2GV6A 5GWZA 4DY7B 1S6HA 3VPKA 2RA3A 1KXEA 2BMGB 1C2HA 4ZXXH 1YPGH 5DG6A 5C20A 1L0ZA 3MMGA 3I78A 2ZFFH 5F8TA 4GSOA 1C9PA 1DY8A 3LJOA 2XW9A 1FAKH 3K6YA 1MMJN 2C8WB 1P2IA 1NFWA 5C17A 3EDXB 2DE9A 3OEHD 1QGFA 5DGJA 2JJ1D 4Y8YA 1ZSJA 1YPHC 4NIXA 3U28C 3PLKA 5DK1A 2ZGJA 1YGCH 1NTPA 2Z9JA 3E90B 1SGPE 2ZA5A 1SFIA 1P06A 2ZHEH 3MFJA 4NA7A 4PROA 3TJUA 3QZQA 2V7QD 3BIUH 3A87A 2J98A 1NZQH 2AHME 1MTSA 1BJUA 5HYOA 1PPEE 1BRBE 4CRGA 3UFAA 3W94A 4K1TA 3OTJE 4NZLA 2FMJA 3AW1A 1ZJDA 4J1YA 4ZHAA 1EZXC 1UVUH 2BLOA 2Z7FE 1YCPM 2GCTB 3KQ5A 4DURA 3PWCA 2OC0A 1BTXA 4E7RG 1TMBH 3FOAA 1IQNA 2QGRA 1ZSKA 5EJLA 1O5AB 2CHAB 1C5PA 1COWD 2BQ6B 3RXJA 1Z8IB 1HGTH 2BXTH 4AFSA 2BB4A 2TGDA 1P2KA 3FZZA 1AFQC 1V2UT 3FP8E 4LOYH 5A8ZA 2ZP0H 1O5BB 1UK3A 1D6RA 1D3PB 2CK3D 4Y0ZE 3BG4C 3DT0H 3TJOA 1LHEH 2AGGX 2VWNA 1YBWA 4X8VH 1FY8E 2H6MA 9LPRA 2GMTC 1ORFA 1IQEA 1TPOA 1FIZA 2ANKH 2Q1JA 2EC9H 4OS4A 1N8OC 1OHHD 1XUHA 1LHGH 2GKVE 3GYLB 4IN2A 4XBCA 3TGIE 3KQDA 1INCA 3A8AA 4X2WA 5C1UA 1ZGVA 3L33A 1B7XB 3SGAE 1LKBA 4IGDA 4QT8C 1V2OT 1EAIA 1VJ9U 5C0TA 1GHVH 2VU8E 1C5RA 1UK2A 4MVNA 4AGKA 3SUEA 3EE0B 1O3FA 3URDA 1MAYA 1WTGH 3NXPA 1P04A 3F9EA 3KL6A 1TYNA 3F9GA 1G3CA 4BAKB 1TONA 3LDXH 2BOHB 3TJNA 5EQSA 2ZHFH 6GCHF 1MKXH 1P3EA 1DPOA 3A8CA 3P70B 3GISB 4XBBA 2V0BA 1TNIA 3NPSA 1PQ8A 4XE4A 1W0ZU 1O3KA 2P3FH 3SNCA 1QBOA 5EG4A 4CH8B 4Q80A 4DG4A 5J4SA 2GVFA 4AYYB 1K1JA 1SGTA 1Q2WA 3SU6A 1ZGIA 1O2PA 4FUFA 5J4QA 5LH8A 1CU1A 1H1BA 4X2XA 1S0QA 2FLBH 5GCHF 4AYVB 2BHGA 3M5OA 1NFYA 1U6QA 1PFXC 5GPIB 1ELGA 3E0PB 2AGEX 2J9NA 2ZHDA 4CBOA 3RU4D 1O2QA 3A84A 3O8BA 1J8AA 5LGOA 1C5UA 1FAXA 3QDZB 1EZSC 1O3PB 3MU8A 2WPIS 2WUBA 3SV6A 1IHTH 3SQHE 3DUXH 1K1IA 3SHCH 4IMZA 3WWBA 3NRLA 1C2MA 2ZCLP 2FOMB 4WY3A 4JZEH 1KLJH 4M7GA 2PR3A 1OYQA 1GCTB 5A0AE 1TFXA 1E36B 3A7WA 4TWYA 4JZFH 3LGWA 1P12E 1ZMJA 2VWLA 4IS5A 5ESTE 3RXVA 3A89A 1P2MA 2FZZA 4SGAE 1BTUA 1AHTH 2KCPA 3SBKA 5GIBA 1NFXA 3PTNA 4FUEA 3UOPA 3JZ1B 4CRFA 1NRNH 3LH3A 1MTVA 2Z3CA 1AWHB 4YOIA 5AFZH 1SL3A 2O8MA 1EXFA 4U01A 2QXJA 3VB5A 1SGYE 3UR9A 2WYJA 3PLPA 1FMGA 3UR6A 1S6LA 3LGTA 4MPWA 3E16B 1VCQA 1EFRD 5EQRA 2QN5T 4B6FA 3SV8A 1XUKA 5C3NA 1GBIA 5T3HA 1TRMA 3RXBA 5BRRE 3ODDA 4I8LA 2V3OH 1G37A 1RD3B 4FUDA 2FS9A 2PGBB 1LO6A 5TCAA 2DUCA 3SNBA 1S5SA 2Y7ZA 8KME2 1QFKH 4XFQA 4U30A 2FPZA 4JZDH 1KLIH 4F49A 1A1RA 3I29A 1TNKA 3CS7A 1HAPH 1OWDA 2F9PA 2ZI2H 2ANYA 2FEQH 2BVXH 3OSYA 3O8DA 2F4LA 3BF6H 1K21H 3T28A 2G51A 1OX1A 1MAXA 4D8NA 3A86A 3PO1B 4NA9H 3VXFH 1GCDA 4WJG2 4ABGA 4WXVA 4ACBA 1ANDA 2WV9A 1V2QT 3MWIU 3EE7A 2ALVA 1GMDG 4U32A 3LGUA 2BXUH 5IYTA 2FX4A 2OC8A 1IQMA 4GHTA 3FZDA 2TGAA 1NT1A 1NU7B 3ZZ7A 4TYDA 5FPSA 1E0FD 3FAOA 4Y8ZA 5AVDA 1SVPA 3TK5A 1ZPZA 4ABJA 1WQSA 2QCYA 2VWOA 2O9QA 3FANA 1PPGE 2M5TA 4CRBA 2PKAB 1J9CH 1ZPBA 4OGXA 3MU4A 4GUXA 4ASUD 1BITA 1PPFE 3ZVGA 3ZZ4A 1W2KH 4MPVA 2W6ID 2A5AA 3GDSA 3TIUA 1MH0A 1LVYA 3LH1A 1UJ1A 4ZCNA 2K0QA 1NN6A 3PM3A 1W13U 2A7JA 2F9NA 1QZ8A 2ODPA 1SQRA 5C1XA 4I33A 4YO9A 4MPUA 4ABDA 4FUHA 1XMNB 2EEKA 2C8YB 2ZU5A 1PPZA 3F0PA 4TPIZ 1CGIE 1LMWB 1DXPA 2NU0E 2ZGXH 3W95A 2CJIA 2O8TA 4Q7XA 5E2OA 2D26C 1HYLA 1K1NA 1TGNA 2P8OC 3KN2A 3BEFB 1FI8A 1GBCA 2O8UA 1FJSA
chains in the Genus database with same CATH topology
1THSH 2AMQA 1ZTJA 1D3DB 3GDUA 3OYPA 1H9IE 1ANBA 1KXAA 2ZFPH 3D65E 3LJJA 5EU8A 3M5NA 1P9SA 2BDIA 4UE7H 4ZH8A 3ZYEA 1IQHA 3F9HA 3ZVAA 3KNXA 4U2WA 1HNEE 1E38B 2OTVA 4A1TA 4INKA 3DFJA 3VB4A 1C1WH 5JBTA 1DLKB 1FUJA 4NZQA 3T27A 5A8XA 1LPZB 1CA0B 6ESTA 2FS8A 2HLCA 2ODYB 1TB6H 4KTSA 1T4VH 3BTHE 4THNH 4ASHA 3A7VA 3UTUH 4MNYA 5FBIA 3M7TA 3KHVA 3P92A 3P95A 2XNIA 4OS6A 1C2JA 2J4IA 1DM4B 1ETRH 3LGYA 3ZVCA 1TNHA 1GBLA 1O2MA 2AGIX 3H7OA 1O3IA 1WU1A 2PLXA 5DKMA 4BAMB 3RP2A 1GBMA 3FVFB 1TABE 1ZSLA 3E8LA 2GCTC 1P03A 4AX9H 1QURH 3RXQA 1A3BH 3SNEA 1MD7A 2CHAC 1JIMA 4NGAH 5EODA 1EPTB 1SSXA 1LQEA 4KELA 4IBLH 3BTDE 3SHAH 3ZZ8A 1NRQH 2BDAA 1GL0E 3LT3A 4LXBH 1BTWA 5E0GA 1SOZA 3MH5A 4ZHLU 3VB3A 4BAHB 3RXMA 2Y5GA 4YT6H 4A5TS 1TPAE 2ZF0H 1EAWA 4JYVH 4K3JA 1PJPA 1QNJA 1RTKA 2Q6FA 1JWTA 1A46H 1CT0E 2QV1A 3BV9B 5EXLA 1K1PA 1A5GH 2J92A 5CMXH 4K8YA 3TNTA 2ZO3H 3LIWA 4NFFA 2BD4A 1JIRA 4XDEA 1SLVB 4NIVA 2XC4A 5E0JA 3SJ8A 2ZGBH 1AO5A 2WPKS 1QY6A 2PTCE 3BIVH 1GBKA 5T6DA 4B71A 1SGEE 4AZ2B 2VGCB 1C1OA 1OP8A 1RXPA 1VCPA 2ZCHP 2B9LA 1G36A 3S9CA 1T32A 3LC5A 4HZHA 2IJOB 1DWEH 3MH7A 3IWMA 3UNQA 3A85A 2JH5D 1O5EH 1VITH 2OQUA 2ZCKP 3M3TA 4D7FA 1T8LA 2GX4A 1HJAB 2Y82A 2SGDE 4MDSA 3OU0A 5I46H 3ZVFA 2B7DH 1AUTC 1S83A 1ZTKA 3KIDU 1O2NA 2BZ6H 1BRAA 3V12A 5HMAA 1K1LA 1MCVA 1SC8U 2XC5A 3ODFA 1AVWA 2BDYA 3NKKA 4Y79A 3D49H 1XUIA 2HVXA 3GY5A 1O35A 1TBRH 2FWWA 3K65B 1GJCB 1LPKB 3NUMA 1VJAU 3ATIA 1YPHE 1GJAB 1MKWK 3DFLA 1L4DA 3FFGA 1BTPA 1C5WB 1KSNA 2GZ7A 3SJKA 4YOJA 1AE8H 1F5KU 3PLBA 1BCUH 1SB1H 1GCTC 1UK4A 2BLQA 3EAJA 5DJ7A 5LPFA 2WV5A 1TX7A 1UHBB 1SLXB 3T2NA 1S6FA 5EXNA 1P3CA 1EZUC 1Z1IA 1BMMH 1P09A 1SQAA 1O2LA 4X6MA 3RXTA 4MNVA 4E06H 2FOAA 2XCFA 1OOKB 3QGNB 1ZOMA 1V2TT 2AMDA 1O3DA 1Y59T 1W14U 2FOEA 1HRTH 1BBRE 2UUKB 2AFQB 2VIOA 2EI8A 3KF2A 1EP5A 1GBTA 1JXPA 2F9VA 4MTBA 1O0DH 1O3GA 3RDZA 2TPIZ 2ODQA 2BY8X 2BY9X 1ELFA 1TLDA 1GI0A 1HAIH 2Y81A 4UDWH 4DVAU 2XBXA 2BQ7B 1V2RT 2ZTXA 2HNTE 1KXCA 1QA0A 4YZUA 4KP0A 1GJ8B 2ANWA 1C5VA 3EA8A 1C5MD 1XKBC 2FDAA 1G2LA 2SGEE 1O39A 1JRSA 1C5TA 1MTWA 3MU5A 3B9FH 1GGDB 1YKTA 5G4BA 5JBAS 2ALPA 4UD9H 1CHOG 1SPJA 1AFEH 2DE8A 1W0YH 5C2ZA 4FUJA 1V2WT 1HXFH 2A5IA 1NS3A 4BTUB 1GJ7B 1WCZA 2FO9A 3E6PH 3PO1C 3SU0A 2G5NA 1ZTLA 1PQ7A 1YPLH 3TH2H 1ELEE 1ZPCA 3SJIA 3UIRA 1GDUA 4TWWA 3UOUA 3S9AA 4OS2A 3BTME 4NG9H 1DSUA 4X8SH 2ZQ2A 1PPHE 2BOKA 4NWKA 1YYY1 1AB9B 3M3VA 4J2YB 1EAUA 1DANH 2QXIA 1TE0A 4WH6A 5FAHA 1MUEB 2WPLS 5CE1A 5JB8S 3U1IB 3GCHB 2OQ5A 4I8JA 1X7AC 4UFFH 5TJXA 2FI3E 1GMDF 2JETB 3NZIA 1EATA 3EYDA 2KAIB 3C1KA 1DS2E 4NFEA 3HPTB 4GHQA 2FOFA 2IN2A 4DGJA 1DWDH 2BDGA 3SV2H 1KYNA 4YM9A 1P11E 1FN8A 1DE7H 2ZDKA 4BTIB 1D9IA 1TA2A 2CV3A 3MYWA 1LHCH 1P2JA 1LVOA 1O3LA 2PKSB 4JMYA 3U9AH 3V7TA 2HNTC 1NY22 2HWLB 2STAE 1TQ0B 3L6PA 4Y76A 5ETXA 3MH4A 1ABJH 1W11U 3VEQB 1ZRBA 1K1MA 3PB1E 3R3GB 2QYIA 1CGJE 4TPYA 1VCWA 3KQEA 4ABEA 1GMCG 3A8BA 2FOBA 4HTCH 4WF8A 4ISIH 3SU5A 4Z0KA 2CN0H 1H4WA 1QIXB 2C90B 2Z3EA 1Q31A 3ELAH 3GY6A 1CA0C 4CBNA 1YP9A 4BXSA 1BRUP 2YNBA 1QQ4A 2VVVA 1SG8B 3T26A 1RRKA 1Y5AT 4FU8A 5L6NH 1O3NA 3QTVH 3B23B 2IPHA 4NIYA 4O97A 3TPIZ 1CO7E 3M7QA 1EZQA 3UWJH 1AU8A 2XWAA 1WAYB 4RKJB 3WY8A 3RUOA 1QRXA 1S84A 2ZIQH 1UVPA 4ZAEA 1YLDA 4JZ1A 1GBJA 2BYAX 1TAWA 4DJZB 1NC6A 4AORA 1OSSA 3RXSA 3HKIB 4F4OC 4X1QU 4X1PU 3LKWA 2BDHA 4BTTB 2BD3A 2SGPE 2PUQH 2YNAA 4GCHG 3A7ZA 3PROA 1EPTC 1A0HB 1L2EA 3SN8A 1FY4A 1TPPA 3SU2A 2BTCE 3U8RH 1CE5A 2G00A 3SNAA 1WSSH 1DXWA 4Y0YE 3Q3YA 1AVGH 1BHXB 3RLYH 1DVAH 1EKBB 1TGBA 1UTNA 1XXDA 5L2YH 1NRRH 1Z8JB 4INHA 5EPYA 2VIQA 3U69H 3K9XB 4R0IA 3RXEA 5L30H 1A4WH 2BLVA 1C1SA 3M5MA 3IITA 1W3CA 1J14A 5A2MH 5HXFA 3ATLA 4I8KA 1UTQA 1K28D 2Q6GA 2G81E 4CRAA 2OLGA 1TNGA 1TMUH 5T6GA 3Q3XA 3U1JB 3GCTG 1C1QA 2EI7A 2OC1A 4BAQB 3M35A 3P8OA 2R9PA 1V2VT 1V2ST 4GLYA 2ZTZA 4WWYA 4K8BA 1Z8RA 3SI3H 3KQCA 2VGCC 5CHAB 2GTBA 1GI3A 1A5HA 1S81A 1CA8B 1IQFA 5LPEA 1SGQE 2WV4A 1ETTH 1TWXB 1CGHA 3ZZAA 1ZJKA 1HBTH 1UTMA 2P3TB 2STBE 4ZROA 3BSQA 1HJAC 1XUJA 3AVZA 3M36A 1GI5A 3BTEE 4YLQH 2JH0D 3TH4H 2A7CA 3SNDA 3ZZCA 5C67A 1SGFG 2A31A 5FX5A 1SGRE 1T8MA 1UVSH 1XVMA 4D7GA 3QK1A 1CBWB 1P02A 1GJ4H 2TGTA 4ISHH 4H42U 2BDBA 1OP2A 1C4V2 1ZHPA 1SQOA 2Y80A 2BQWB 1C2DA 1O2SA 1AE5A 1QTFA 2LPRA 5JB9S 1OKXA 3PMHB 2EI6A 3TJVA 1QL7A 2HPPH 5A8YA 9ESTA 1HCGA 4H6SB 4GVUA 4I8HA 1N6XA 3SGBE 5E2PA 1GVLA 2ZZUH 4KKDA 1P8VC 1THRH 4TY6A 1YPEH 2ZDNA 2BD9A 4INLA 1RFNA 3IG6B 2ASUB 2BY7X 5JBBS 1ABIH 1HAVA 2VB0A 2RG3A 2BX3A 4NSVA 4ZKSU 3A83A 1MKWH 2ZTYA 2C3SA 1HAYB 1KTTB 2J95A 3P17H 3VGCB 5FPYA 1WYKA 2UUYA 2UUFB 1S85A 3A88A 2HGTH 1EJMA 4AG1A 1L1JA 3RM2H 1RGQA 1DICA 5EQQA 2BD2A 1P10A 1C5LH 4O3UA 1UHBA 5A0BA 1SGIB 4H6TA 4UFDH 2ZFTA 4NWLA 3RXGA 4JYUH 5HM9A 4HGCA 4AB9A 1CT2E 1CSOE 1O3EA 2BD5A 3Q77A 1TIOA 1HDTH 2PSYA 1OWJA 1AKSB 5EW2H 2F91A 4I7YH 2BLWA 5IDKA 2OP9A 5FCRA 1C5QA 1T8NA 1UTLM 1O33A 1C5NH 3TVJB 3E0NB 1F5LA 1GGDC 1HLTH 2OBOA 3RXLA 4Y11E 1EB1H 3ZVBA 1F0RA 3F1SB 3LGVA 1A3EH 3U98H 1V2MT 1TOCB 3QN7A 3KCGH 4HI3A 2OBQA 3L3TA 5AFYH 1ETSH 2GV7A 3RXUA 5C5NA 4MPXA 1PQAA 2ZDMA 1SGFA 1WV7H 1J17T 1ELCA 1YC0A 1O2OA 1XUFA 1O3AA 2ZU3A 1HUTH 2AIPA 3Q3KA 1IAUA 2Z9LA 1GDNA 1AGJA 3A80A 3N7OA 3URCA 4A1VA 2UWPA 3Q76A 4ZUHA 1O2IA 3GOVB 5GDSH 1O34A 5JYIA 2A2XH 1HIAB 2QF3A 4CR5A 1CHOF 2HNTF 1C1VH 1AB9C 1C2FA 2R3UA 1BDAA 1F92A 3QGJA 3SO3A 3SZNA 2R2WU 4YT7H 2UWLA 2LNCA 3MNXA 3P6ZB 4AOQA 4AB8A 1SGDE 3GCHC 1OPHB 2ZDAH 1NROH 2FODA 1L4ZA 3PTBA 5DP5A 4BXWA 2SGAA 4DIIH 2JETC 2H9EH 3UPEA 1BTZA 1GHAG 4R8TB 1SGCA 5ESBA 4ISLA 2ZFSA 5K7RA 3UY9A 3RU4T 2XBYA 3RM0H 1J16A 1OWKA 1O2JA 5DO4H 1GBAA 3RMLH 3PMBB 1Z6EA 3GY8A 4RKOB 2BM2A 4ABIA 4CRDA 1ELBA 2PKSC 2FOHA 4VGCB 1TGSZ 1DITH 1A7SA 1DX5M 5EXMA 2KAIA 1ID5H 4XBDA 2BY5X 3AAVA 1F2SE 2XBWA 2HOBA 2FIRH 1C4Y2 4Y7AA 3SV9A 1K9OE 4B2BA 4ESTE 3TGJE 1L1NA 1AQ7A 4DW2U 3UQVA 1HJ8A 2WUCA 3LOXA 3SUDA 1C1UH 1TNJA 3GCOA 1JBUH 3A7YA 1TBZH 2CF8H 3R0FA 3MHWU 4B75A 1GHZA 7KMEH 2VIWA 1O5CB 2JKHA 1QBNA 3G01A 1OYTH 4AN7A 3MO9A 1IQJA 1IOEA 1HB0B 2Q6DA 4ZMAH 2PWXA 1GMCF 2F9UA 1FQ3A 1SHHB 2SFAA 3DA9B 2W26A 2ZKSA 4Z6AH 2AEIH 3FP6E 2H5DA 3TGKE 5EGMA 3NK8A 4I31A 1GG6B 1DWCH 1FZZA 1RTLA 1A0JA 4FVDA 1QHRB 1T8OA 1LCYA 2A7HA 2ZFQH 1CHGA 1D6WA 1FXYA 4H4FA 4DOQA 1LDTT 1NFUA 1O3CA 2O8LA 3V13A 1FV9A 4LK4A 4OS7A 3T62A 4CRCA 5JBCS 2VH6A 1NU9A 1GI2A 1V2LT 4ABHA 2I6QA 2ZQ1A 1GHXH 1GI4A 4WVPE 2HRVA 1EJNA 1O2WA 3SU4A 7ESTE 2CXVA 2VNTA 1YLCA 2H9TH 1C4U2 1LPGB 2NU4E 4IC6A 3NCLA 2ZG0H 1BUIA 1AY6H 1TALA 1O2GH 2CF9H 3P8GA 3RXAA 1QB6A 4LZ1H 3EGKH 1EOJA 5F8XA 1O31A 4B2CA 1C5OH 1HV7A 1GI7B 1V2KT 3VXEH 3LONA 1TA6A 2H1UA 1BOQA 4K1EA 2AMPA 2QXGA 3GY7A 4Q7YA 4UFGH 1QJ6B 2O8WA 1YCPK 3U8TH 1E35B 3F6UH 2GT7A 1Y5BT 1GBBA 4GCHF 4AFQA 2VWMA 1VGCB 4X2VA 2A4GA 1T31A 2XC0A 3P8FA 4E05H 3H7TA 6CHAB 4UONA 2ZGCA 1K1OA 2Z9IA 4JK5A 4X0WU 5E0HA 4X8UH 1OWHA 3QO6A 1ACBE 1GJDB 1THPB 2J34A 3QWCH 3V3MA 1GJ6A 2ZDVH 3KQBA 4B2AA 2Z9KA 1BBRK 4Y7BA 1G3EA 3BTWE 4FVBA 4A1XA 1AMHA 2PFEA 3ZZBA 2BVRH 1RIWB 1XXFA 5CHAC 2P94A 4DCDA 1AIXH 1FN6A 1GJ9B 2ZU4A 2GGVB 3EQ0H 1TGTA 4FU9A 2QA9E 4AFUA 4A7IB 1AN1E 1OXGA 1UCYE 1MZAA 1GI8B 4X1SU 1H9LB 1O38A 1QRZA 2W3IA 3M5LA 3HATH 8GCHG 1EAXA 3GCTF 1FPCH 1PYTC 4DT7B 3ZV9A 5A09A 4ABFA 4GAWA 3F9FA 1C1MA 1KXFA 1GMHG 3QZRA 1MD8A 3UUZA 2FM2A 1BMNH 1ARBA 1TGCA 3AAUA 3S9BA 3RXIA 4NSYA 1CBWC 4IW4E 4JCNA 2R0LA 4WMFA 1JRTA 4JZIA 1MZDA 1PPCE 1O32A 2D1JA 1P01A 4X2YA 3T25A 2G5VA 3MH6A 1C1TA 2A0QB 2FTMA 4XSKU 1ELVA 1ZHMA 3SJ9A 1P0SH 2BX4A 4SGBE 2UUJB 2PSXA 3MO6A 2NU1E 2VVUA 1KLTA 1GL1A 4KGAA 4CH2B 2SNWA 3K6ZA 1MQ5A 1UTJA 5SGAE 1EB2A 1C2EA 1DOJA 2ESTE 3VGCC 1AI8H 2CMYA 1DFPA 1HPGA 3LPRA 2OXSA 3SU3A 1XX9A 1A5IA 1GI6A 4X1NU 4YESB 3S7KB 1GHYH 1A0LA 2BD8A 4D9QA 4MNWA 5C1YA 5EW1H 1W8BH 1O2KA 1GVKB 1ZRKA 1F0TA 3MU1A 2OINA 1BQYA 2ZHQH 1GJBB 3GY2A 1XVOA 2ZPRA 3PV4A 2ZPQA 1LHFH 3VB6A 2PKAA 5DPAA 1UMAH 3T29A 2G8TA 4AG2A 1D3QB 1SLWB 1QRWA 4B74A 1UVTH 3BEUA 4KTCA 2WPJS 3RXCA 1P57B 1ZYOA 1PQ5A 1OWIA 5K0HA 1N6YA