2OQUA

High pressure cryocooling of capillary sample cryoprotection and diffraction phasing at long wavelengths
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elastase-1
publication title High-pressure cryocooling for capillary sample cryoprotection and diffraction phasing at long wavelengths.
pubmed doi rcsb
molecule tags Hydrolase
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2007-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2oquA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2oquA01
1D6WA 1VGCB 1ZTJA 3GISB 2XBVA 4NSVA 1HLTH 3T62A 3ZV9A 1O2IA 1T31A 1CT4E 3M5NA 3M5MA 1Y3VA 4XBDA 1PPCE 2ZHWH 2GZ7A 1HXFH 5HGGA 3E3TA 1TNIA 1ZGVA 1O3HA 1TIOA 1O2SA 1G2MA 1SI5H 3RXTA 2XC0A 3SNCA 1CGIE 3E91A 4Y8YA 5HMAA 3BEIB 4BTUB 2FDAA 2CN0H 4LZ1H 1MTNB 5J4SA 4GUXA 4X1SU 2RA3A 2O8LA 2QV1A 1UCYE 2F9VA 2FTMA 5DGJA 1K1IA 2SGAA 1UTKA 2GCTB 4JZDH 1UO6A 1UCYH 1Y3UA 2ZDNA 3MU4A 1GI8B 2GMTB 1NZQH 2F3CE 1YPMH 1TQ0B 1VGCC 2PLXA 1O5GH 4FUBA 4DGJA 1Z7KA 4ABEA 6ESTA 1GDUA 4FUEA 2DE8A 1TE0A 3UR6A 2OTVA 4AFSA 5SGAE 1VJAU 1JRSA 3S7KB 2VIQA 1ETSH 4X8VH 3T26A 1O3CA 5DP9A 1YCPM 2SGPE 2TGDA 1JBUH 2Q1JA 2RDLA 3KQEA 3UR9A 5F6MA 1MTNC 4X8SH 1Y3YA 2OUAA 1Y3XA 5DPAA 1V2ST 2ZFQH 5F8ZA 4ISLA 4DT7B 5HM9A 3EA9A 2GCTC 2KAIB 1K1LA 4WH6A 1O2OA 4FUGA 4TWYA 3M5LA 1K21H 3SORA 1IQIA 2GMTC 4NGAH 3UNSA 2QF0A 1CA0B 3F9GA 3SI3H 1LCYA 1LHCH 1SPJA 3SGBE 4UFGH 3IWMA 3RM0H 1IQNA 3GDVA 2OD3B 1DITH 3GY4A 5ABWA 4Z6AH 2BZAA 4ZH8A 3PROA 3T28A 3UQVA 3SV2H 1E36B 3SUFA 1SLVB 2BOHB 1GL1A 3K65B 4NA9H 1ABIH 1C2IA 3U69H 1AIXH 1IQEA 2XCFA 2WPKS 2ZP0H 1MTSA 1UVTH 4I8GA 2HLCA 3PLKA 3ITIA 6CHAB 1MAXA 4DVAU 1H1BA 2PR3A 2G5VA 2CMYA 3H7OA 1EAUA 3D65E 1L4DA 3FP7E 2HGTH 3LPRA 1SMFE 1LHFH 1L1NA 1W0YH 1ORFA 5DJ7A 3A82A 4ZAEA 2G5NA 4B1TA 1QL9A 1O5DH 1QURH 1NC6A 4Y8ZA 1AZZA 3LJOA 2Y80A 1WOFA 2AS9A 1QNJA 1XXDA 4AFZA 3PTBA 1GJ6A 4I31A 4CRBA 1GHBF 1O2KA 1GPZA 3HK6B 4YZUA 3URDA 1XXFA 2UUJB 2VIDA 4ISHH 6CHAC 2ZDLA 3PMHB 4X6PA 4JZIA 2BY8X 3SGQE 1O2HA 4UFFH 3AVZA 1T8OA 1GDNA 1IQKA 5DK1A 1AUJA 5C67A 3BF6H 4VGCB 3ZVEA 1H8DH 1GDQA 1UMAH 1QJ7B 3V3MA 1A5GH 1V3XA 1FMGA 2J34A 1YBWA 4ABBA 1OYTH 3ZVDA 4E05H 3ZZ6A 1C2MA 2GX4A 2OC8A 4D7FA 3RXBA 3RXUA 1V2JT 1GI1A 3IITA 1GCDA 5HM2A 2G4UA 1NRQH 1C9TA 3M36A 1GMCF 4NFFA 3F68H 1ZMNA 2VIWA 1GI7B 2GVFA 2BVXH 2Y5GA 3PV4A 4OGYA 1OOKB 1IQHA 2A4OA 3BTKE 1CVWH 1D3DB 2BHGA 3GDSA 4ZHMU 4VGCC 1BOQA 1AD8H 2VINA 2FO9A 3BTHE 1CU1A 2BYAX 1GI9B 4ISOA 1BTYA 1TFXA 1ELEE 2AMDA 1KXDA 3AW0A 1TONA 4NCYA 4UEHH 3NXPA 4NA7A 3RXMA 3L3TA 5IYTA 1QTFA 3LH3A 1F92A 1EKBB 3ENSB 1D3QB 4MTBA 1SQTA 1Z8GA 2R3YA 3K6YA 1LHDH 1E37B 1V6DA 1JWTA 2HVXA 2ULLA 4H4FA 2R0KA 4K1SA 2GGVB 1GHAF 1S82A 1LHEH 2LPRA 2GCHF 5EXMA 2B9LA 1O5AB 2NU0E 4GAWA 2EI6A 4X1PU 4CH2B 2Y5HA 3E6PH 3ZZ4A 1C5LH 1EJAA 1K28D 4O3UA 4IW4E 1IQJA 1O3NA 3E90B 4DIHH 1FPHH 1P2JA 4X2WA 1BRUP 1W10U 3KIDU 4B73A 5LH8A 1SGDE 1BRBE 2HNTF 5F8TA 3SU2A 3K2UA 1ELFA 1HIAA 5C20A 1LKBA 2FOMB 1W0ZU 2FOHA 3RC6A 3I78A 1EZXC 1G3BA 1SOTA 2BDIA 1C2FA 1AN1E 1ANCA 5GDSH 1LO6A 3O8BA 3A86A 2FX6A 1C1WH 1NTPA 3EQ0H 3OY6U 1N8OB 1DY8A 3QZQA 4TWWA 1SG8B 5FX6A 1D6RA 2FWWA 4KP0A 2D2DA 4GCHF 3LGVA 4GLYA 1GJDB 3H7TA 5DKMA 2YOLA 1V2VT 5JPMH 3SO3A 3M5OA 1X7AC 1QQUA 1M9UA 3MH4A 1BZXE 3Q3YA 1DSUA 2ZKSA 3CP7A 3VB5A 3ATIA 4UDWH 2VNTA 3LKWA 1J9CH 3K9XB 1OS8A 1LDTT 4J1YA 3RXKA 5IDKA 3MU1A 3T5FH 1N8OC 1V2QT 1DE7H 4XBCA 3BTFE 2P93A 2J92A 4TY7A 4X6MA 4B76A 1CA8B 1HXEH 1SLXB 2A2QH 1J17T 4NWLA 3E0NB 2F9OA 3LGWA 2XYAA 1VITF 3RXSA 1JMOH 1PPHE 3BV9B 3KQDA 1ELVA 3LH1A 3ATKA 4GHQA 1FPCH 1S5SA 4X1NU 3F6UH 1GI6A 4U2WA 3S9AA 2EC9H 1ABJH 3DFJA 4YESB 1GI2A 1P2QA 1DUAA 3URCA 1ZOMA 4JK6A 2Y6TA 2ZFSA 4A1VA 4INKA 2CXVA 1AB9B 2H1UA 3AAUA 4AYVB 1CE5A 3Q3KA 2ALVA 3VEQB 3TNSA 1ANDA 4YOGA 1ELAA 2OC0A 1GBKA 2W3KA 2ODQA 2NWNA 3ZZAA 1AKSB 4Q7XA 4A5TS 1VR1H 1YP9A 1AO5A 1HV7A 1O0DH 2ANMH 5HXFA 1CT2E 1GJ4H 3LU9B 4I7YH 1QJ1B 1LHGH 1PPGE 3RMOH 3GY5A 5FHTA 1MKXK 3U8RH 3MMGA 3N7OA 4E7RG 3TJNA 2ZQ2A 2BMGB 4ZHAA 1FN8A 2Z9JA 2F9NA 2VB0A 1AB9C 3MNCA 4F4OC 2GV6A 5TCCA 2B8OH 2WPHS 3ZZCA 6GCHF 4AG2A 1AWHB 1TA2A 1UJ1A 5TJXA 1ARCA 3RXGA 1SGTA 1E0FD 2HRVA 1CBWB 1GHVH 3PLPA 2Y81A 5DP7A 3RDZA 1QRZA 1HNEE 1HGTH 1P3CA 5GXPA 1S83A 1TGSZ 1V2MT 4DG4A 3EE0B 2ZTYA 1DX5M 2OCVB 3TJUA 4K5ZA 3SJOA 1NN6A 1B5GH 1BT7A 7GCHG 3SV8A 5LPFA 2VH0A 4IMZA 4CR9A 3FAOA 1UTPA 1Y5BT 1C4Y2 1H9IE 1UHBA 2ODPA 1THRH 2BQ6B 1FIZA 3SBKA 1IOEA 3PMJA 3GYMA 1QB9A 5CE1A 1TLDA 3SUDA 1MTVA 1SBWA 4ASHA 1KDQB 1OWEA 4B75A 2OBOA 2TGAA 2BDHA 1O2RA 4JK5A 4Y7AA 2Z7FE 4KGAA 1C1MA 1MTWA 4H6SB 1WV7H 1CGHA 4XSKU 1CBWC 4WXIA 1NU9A 5DP4A 1AI8H 4Y10E 2AIPA 2UUFB 3RXRA 2Z9IA 2VWOA 4AFQA 1N6XA 5A2MH 1GI0A 2J94A 2ZGJA 5ESBA 1ESBA 1OP8A 3U1JB 2FMJA 2JKHA 4JZEH 1HPGA 3BTDE 1HAVB 5JYIA 1Q31A 4ZKOU 1Z8RA 1ELCA 3OTJE 3QX5H 4FVDA 2H9TH 1T4VH 1HAZB 1ETRH 5T6FA 1LVYA 2NU2E 2ZTXA 1TMUH 1CHOF 1O2VA 3STIA 4I8LA 1RS0A 2AGIX 5L30H 1SR5C 2ZGCA 1GBLA 3Q00A 1UTOA 1ZRKA 3NPSA 1MAYA 2JETB 2FI5E 4AOQA 1GMHF 1K1MA 3UUZA 1O2PA 2ZGBH 1P2IA 2PKSB 2G51A 3E8LA 2OXSA 4OGXA 3SJ8A 3GDUA 1P2MA 4X1RU 3A8DA 1P2OA 3A8AA 5JBCS 4K8YA 2OC1A 4NG9H 1JRTA 2A4QA 3BIUH 1JXPA 2PUXB 3AASA 3SJ9A 2Z9KA 2ZFRH 2GD4B 1TA6A 1J8AA 1ZSLA 3A83A 1TAWA 3QZRA 3JZ2B 5JBBS 1GJ7B 5BRRE 2O8TA 6LPRA 1WBGB 3MHWU 2NU1E 1TRNA 2JETC 3OX7U 1BIOA 1C1VH 1Y59T 3SUGA 3DUXH 3V0XA 1V2PT 2BY9X 2FOGA 1GBIA 4K2YA 2PKSC 1O3BA 4MVNA 2BZ6H 4U30A 1WSSH 3ZVBA 1HAPH 1P09A 3WY8A 3C1KA 1BTXA 1TGTA 2H5CA 2IJOB 3MOCA 1C1TA 1CGJE 1PQAA 4NSYA 1NESE 1V2NT 2ZA5A 1W3CA 1KLJH 1LTOA 1EUFA 1P01A 1YGCH 5FPTA 4CBOA 2PTCE 3SV7A 4AN7A 2ALPA 5GIBA 1GG6C 3DA9B 4BAKB 3A85A 4GPGA 3D62A 1NPMA 3TH2H 2UUYA 4BAHB 1BUIA 1VJ9U 1F0UA 1W13U 5EW1H 2GT8A 4B2CA 2A7CA 4SGBE 3SJKA 2Z3EA 3SNAA 4X6OA 1MKWK 3PB1E 3SU6A 1P57B 2G4TA 3LC5A 5EQQA 1OWDA 2XXLA 1TNLA 5EODA 3P95A 1BJUA 1Q3XA 2F9UA 2FPZA 1RTKA 1O2GH 5A0AE 2VVUA 3KGPA 1KY9A 1XVMA 1F5LA 5JBAS 2BLQA 3FP6E 5A8YA 2XCNA 1O3DA 1TBQH 3KF2A 3RXLA 4BAOB 2AGEX 4CRFA 4NFEA 1AWFH 1O2UA 1TYNA 2H5DA 3QDZB 4DY7B 1MQ6A 1QRWA 3VXFH 1GBAA 2O8WA 3MU0A 3NUMA 2TPIZ 7KMEH 2ZEBA 2WV5A 1Y5AT 1L1JA 1ELTA 4ABAA 1SGFG 1F0TA 2FXRA 2H9HA 4O97A 1ZTLA 1G9IE 2G8TA 5A8ZA 2ZTZA 2B7DH 2A31A 2Z94A 3RXPA 3UWJH 3ZVAA 1S6HA 3RXJA 4JYTA 5I25A 2SGDE 1TMBH 2C93B 4CRCA 2EEKA 2VGCB 2ZECA 1PQ5A 1P06A 3U8OH 1SLUB 5C1UA 4GSOA 3NZIA 1W7GH 1SGQE 1ZYOA 2G00A 1OWKA 5EPYA 4D9RA 1T32A 2P94A 5EGMA 5CMXH 1MD7A 4I8JA 1AHTH 1C5UA 3TITA 3FZDA 1H8IH 2VIVA 3RU4T 5LPRA 3OYPA 3ODDA 1FUJA 3VB7A 2JH6D 3GY7A 3LT3A 1MKWH 1KTTB 2DUCA 1OSSA 3ODFA 1C2HA 1GBJA 1CA0C 2CGAA 3UY9A 4D8NA 1A3BH 1AVWA 2QA9E 1ZHRA 1C1OA 4NIYA 2R3UA 2J38A 2VGCC 2ZHFH 4AYYB 3TIUA 2Y7ZA 1T4UH 3A7ZA 3SNBA 3M35A 3C27B 1O34A 2IN2A 2C8XB 2PWXA 5JB8S 1Z71A 4MNWA 2W3IA 1RD3B 1HAYB 2FESH 3PMBB 3PMAB 1MH0A 1HJAB 1QGFA 3QGJA 2A4RA 1GBBA 1L2EA 5JDUB 4MNYA 2BM2A 2BXTH 1GVLA 1NFYA 2GZ9A 5EQSA 3LGIA 2VWLA 4JCNA 1AFQB 1B7XB 1GVZA 1GHBG 3D23A 5C5NA 4BANB 1F2SE 2JH5D 1SGEE 1C2GA 3EGKH 2A4GA 2PW8H 1AE8H 2WINI 1EB1H 1HAGE 1PPZA 1OWIA 1EAXA 3MNBA 1C2DA 1W11U 4TYDA 3EA8A 2ODYB 1TRMA 2FTLE 1P2KA 3KHVA 5E2PA 1UTNA 4FXGH 1EB2A 3TVJB 3ZZBA 1NT1A 1OP2A 1P2NA 2BDYA 3KQBA 1A1RA 3A7TA 3GCOA 4E7NA 5AF9H 3P92A 2EA3A 2G52A 1NO9H 1S85A 1EAWA 1GVKB 1HJAC 4WF8A 1C1SA 2ZQ1A 3DT0H 3BEFB 2ZU3A 2A5AA 3TH3H 1AFQC 4DW2U 4MDSA 1EOLA 1HIAB 1DWDH 1TOCB 3RMNH 1V2KT 1TPOA 3Q3XA 2F9PA 4MLFB 4ISIH 1GMCG 1GGDB 3SU1A 2SGQE 2AMQA 5JBTA 1TNJA 3RXEA 4CREA 1YPHE 2HPPH 1GBMA 1WCZA 1V2RT 1KXEA 1O2JA 1YYY1 2CHAB 4O9VA 3G01A 4ABJA 2ZDAH 5GWZA 1TNGA 2WV4A 3SUEA 1ZTKA 2BD8A 1DWEH 1F5KU 1NU7B 3U8TH 1LVBA 5T6DA 1A46H 5CHAB 3T29A 4H42U 1DLEA 1GJ5H 3BSQA 1LVMA 2THFB 3A81A 3TH4H 1YLCA 3P8OA 3GY6A 3NWUA 2XWAA 3BN9A 1F0SA 1WU1A 3LGUA 3A87A 1GI5A 1BRCE 1EPTA 1QB1A 3LGYA 5GCHF 1O3MA 2GP9B 4JZFH 4CRDA 2AMPA 3RC5A 1T8MA 2Y82A 3GCTF 2H6MA 5LGOA 2C90B 4ZXYH 3DD2H 1O3IA 1KYNA 2EI7A 1GHAG 2CHAC 2ZF0H 2GCHG 2QY0B 4I8HA 2WYGA 1EP5A 2IPHA 5CHAC 2BDGA 4XOJA 8GCHF 4UE7H 3RU4D 1A4WH 1DXWA 3A8CA 3SW2B 2Z3DA 1K1OA 2FI4E 1P12E 3MO9A 4IC5A 1GJ8B 3P8FA 1DPOA 1Z8IB 3QLPH 1ANEA 1UTJA 1J16A 5DP8A 5DP3A 3RXCA 1O3JA 2AIQA 2VVVA 2J2UA 1KLIH 2ZDVH 2GTBA 2WPJS 1LMWB 1P9UA 3SU5A 1NFWA 1DUEA 2A32A 2PSXA 1BCUH 1Z8JB 2A5KA 2F91A 1O35A 1FQ3A 5A0CA 3O8RA 1DWBH 1MBQA 1Y5UT 1V2OT 1DICA 4TPIZ 1NFXA 1TWXB 1FXYA 4BTIB 4GCHG 3FANA 2ANYA 1FLEE 4AB8A 2BLVA 5DO4H 3T25A 3ZYEA 4Q80A 1QFKH 4LK4A 3HATH 5E0GA 2RG3A 2J95A 5EXNA 5C2ZA 5LPEA 2FLRH 2QXJA 4X2XA 4PROA 1WTGH 5E8EH 5BPEA 4ZMAH 2B0FA 1TALA 3MH6A 3MTYA 3SHCH 1FONA 1K9OE 2QF3A 1C5XB 1SQAA 1XUIA 2F83A 3LGTA 1P3EA 3MWIU 1UVUH 1WAYB 3S9BA 4AFUA 3RU4E 1G3DA 3BTGE 1GI4A 5EQRA 2RCEA 4WWYA 2BD7A 1THSH 1XKAC 3MH5A 1O36A 1RXPA 4B71A 1YLDA 4D7GA 1GBEA 3UFAA 1RJXB 1H4WA 1PYTC 4D9QA 2PV9B 3UWIA 1WQVH 1MU8B 2QCYA 2GDDA 1VITG 4CHAB 3VB3A 5DP6A 2B5TB 1GL0E 2Y5FA 3P8NA 3VPKA 4CBNA 1UTMA 2O9QA 3MYWA 1SGRE 2QAAA 1UHBB 3SU4A 1ELBA 4IBLH 1G32B 2A0QB 3S0NA 1FY1A 5GPIB 1O31A 1QQ4A 4WVPE 2FODA 3SQEE 2WPLS 4Q7YA 2P95A 3SU3A 5C5OA 2HNTE 1GBCA 1FY8E 3MO3A 5FCRA 4YT7H 3RXOA 4K8BA 3HGNA 3T2NA 1QBOA 4X8UH 1RRKA 1QBNA 3EAJA 3HPTB 3KCGH 3KNXA 2ZGHA 4OS7A 2BVRH 1MCVA 4THNH 1TBRH 4ABIA 1GI3A 2GDEH 3PLBA 4CHAC 1NS3A 1O2MA 2PGQB 1BMNH 4KELA 2J4IA 3DFLA 1O37A 1MD8A 1XKBC 3ZV8A 2UWPA 1THPB 2BTCE 3M3SA 3LIWA 1EQ9A 1PQ8A 4NIXA 2STAE 2SFAA 4TY6A 2BQWB 4K1EA 1O3OA 3RMLH 4ZKSU 4JZ1A 3B8JA 4ISNA 6GCHG 1BHXB 4NA8A 1HRTH 3CS0A 4IN1A 2I6SA 1BTHH 1D3TB 4WY3A 8LPRA 2D26C 1TNKA 1L4ZA 1O38A 3P70B 3QN7A 4FUHA 1UK4A 1C5NH 4OS1A 4WH8A 5AFYH 2ZFPH 1ESTA 1DANH 1OWJA 1DDJA 1XM1A 2NU3E 2QIQA 5L2ZH 3R3GB 4AZ2B 2SGFE 1MZDA 1Z1JA 4MG3A 3QTVH 1Z1IA 3BG4B 4AORA 1A61H 1NM6A 2C4FH 1AVGH 1A5HA 3GCHB 4FU9A 3VB4A 1NROH 1P8VC 3PO1B 1GBTA 1CQQA 1VCPA 1UTLM 2Q6FA 2YNAA 3RXFA 4MQAA 5TCAA 5J4QA 1ZLRA 1C5WB 4YT6H 1EZSC 3MFJA 1TGNA 2W5EA 5EU8A 1C5OH 4ZXXH 3EYDA 3FZZA 1C1UH 2ASUB 3E0PB 4XE4A 2UUKB 4ESTE 1NRPH 3GY2A 2BX3A 2WUCA 3MNXA 1OPHB 4R8TB 4X2YA 3BG4C 2QN5T 1CHOG 4CH8B 3GCHC 2IOTA 3PO1C 1F0RA 1O33A 2FEQH 5L6NH 5C1YA 3FVFB 4AG1A 5H4IB 1TGBA 1O2NA 2YNBA 3F9HA 1SC8U 1GMHG 4A7IB 5AVDA 3Q76A 1AU8A 1ZPCA 4KTCA 1BTZA 1XUFA 4NWKA 2K1QA 4YLQH 1A5IA 1VCWA 1MUEB 2Z6BD 4LXBH 5E0HA 2XW9A 4X0WU 2C8ZB 1E38B 3SV9A 2PSYA 1C2EA 5EPNA 4FVBA 1A0LA 1LQDB 1GBDA 4XDEA 2P59A 1J15A 1E34B 1MQ5A 2PKAB 1DWCH 1C5ZB 1GJCB 3M7UA 4U01A 4JMYA 1FAXA 1ZHMA 4AB9A 3ATMA 3B23B 1C5MD 3TGJE 4AX9H 1FI8A 4HTCH 4UFDH 3ZZ3A 1AGJA 2ZU5A 3RXQA 3U98H 1UVOA 2OC7A 2ZPSA 2O8MA 4WMEA 1FNIA 1Y8TA 3A7XA 3HGPA 3U1IB 3R0FA 2FM2A 1SGPE 3A8BA 2VIPA 1D4PB 2J9NA 1YF4A 1O3LA 2UWOA 3SI4H 3BTME 2XRCA 3FFGA 1Y3WA 2FYQA 4K3JA 1ZHPA 1KXBA 4ZKNU 1IQFA 1Q2WA 3OY5U 4HZHA 1C5SA 2A7JA 1XMNB 1ZRBA 3DHKH 2QYIA 4Q2KA 4WMFA 4D76A 3RP2A 1HAHH 4ZHLU 2BQ7B 2W26A 5FX5A 1SLWB 2XBYA 3GY3A 3AAVA 2W7UA 2PTNA 1SHHB 4I32A 1E35B 2SGEE 1AE5A 4JYVH 4Y11E 1S0QA 2VJ1A 3BIVH 4RN6A 4AGKA 1ESAA 4K1TA 1C5QA 3M7TA 4YOIA 4IGDA 2ZFTA 4YM9A 3SGAE 1GMDF 1DOJA 5E0JA 1AQ7A 1P03A 1CT0E 4Y6DA 4GVUA 3UIRA 3BTEE 1QA7A 1YPKH 1DLKB 2V3HH 3MH7A 1T7CA 1GMDG 3TK9A 1MTUA 1P02A 2VVCA 1YPLH 1PPFE 5L2YH 2VH6A 5E2OA 1C1QA 2VWMA 2PKAA 1SGNE 3KN2A 1D3PB 3BTQE 1IHSH 1A0JA 5AHGH 1ANBA 1ELGA 1IAUA 1WQSA 1A2CH 1K1NA 1L0ZA 2ANKH 3TJVA 3AW1A 2BDCA 5GJ4B 2P3UB 1OP0A 3M3VA 4BXSA 4O03A 1L1GA 5AFZH 2VWNA 1ZSJA 1N1LA 1BMAA 4Q7ZA 2BLOA 4YOJA 2P8OB 1GBHA 2XTTB 1J14A 2FYRA 4DOQA 3RXIA 4ABFA 1YPJH 9ESTA 1QJ6B 4Y0YE 4B74A 1C5PA 1C5RA 1QBVH 2Z9GA 3HK3B 5A0BA 2WPMS 1FZZA 1F7ZA 4QT8C 1DT2A 4ABGA 1RIWB 4Y71A 3L6PA 4HI3A 3MU8A 1O5BB 1TGCA 1YPHC 1IQLA 1GHWH 3ZZ7A 1SGFA 1MZAA 2W7SA 2OLGA 1A0HB 1LPZB 2ZHQH 4YO9A 3KEEA 1O3FA 1SQOA 1TQ7B 3BTTE 2SNWA 2P8OC 2QXHA 2ZFFH 3MU5A 1BBRK 3QTOH 1HBTH 3TNTA 1W12U 5EW2H 3SOSA 3ZZ9A 4A1TA 5HYOA 1EJMA 2ZCLP 1BJVA 1AMHA 2BY7X 3NCLA 1PQ7A 2JH0D 3A7WA 3UNRA 2G55A 1ZPBA 1TRYA 1KSNA 2ZHDA 1FV9A 2AYWA 1C2JA 3S69A 3H5CB 9LPRA 1NY22 4FU7A 1DVAH 3VB6A 1GCTB 1O3GA 1RIWC 5ETXA 2V0BA 3A7YA 2CV3A 3M37A 1V2UT 4ABHA 4I33A 1TPSA 4XFQA 2C3SA 1GJBB 2WYJA 1PFXC 4TPYA 1CSOE 3TJOA 2BXUH 3NK8A 2AFQB 3SV6A 3UQOA 1ZMJA 4BXWA 1SSXA 2BY5X 2ZU1A 1SGIB 2BY6X 5FBIA 1S6FA 4FUFA 3GOVB 1PPBH 3UTUH 1O2QA 4HFPB 1ZZZA 1INCA 1O39A 2ESTE 1K1PA 4UONA 3BTWE 1BTUA 1EPTB 2ZWLH 4B2AA 3O8DA 1RGQA 1SFIA 4NZQA 2ZDKA 3W95A 1ETTH 1G36A 3SHAH 3IG6B 3ZVFA 3RUOA 1HJ8A 1OKXA 2A45B 3GICB 1GCTC 4F49A 2KAIA 1NFUA 8KME2 3ZZ5A 5F03A 2OQUA 4J2YB 1GJAB 3VFEA 4BAMB 1MBMA 2GZ8A 4YTAA 4GHTA 3ZZ8A 2D8WA 2A1DB 1AY6H 1HB0B 3M7QA 1BQYA 1NRSH 3LDXH 8ESTE 3GY8A 3F9EA 1SGCA 5T3HA 2ZNKH 2QC2A 1QL8A 3RMMH 4KTUA 1DFPA 5A8XA 1BBRE 4CRGA 2V3OH 4OS2A 1B0FA 1A7SA 4E06H 3TPIZ 1EPTC 1TX7A 2F9BH 1BBRH 2ANWA 1UTQA 1AVXA 3RLYH 1TABE 4H6TA 2XBWA 2ZO3H 4NIWA 2AEIH 2FOBA 1C9PA 4FU8A 1QB6A 4FUJA 5EG4A 3I77A 1C1RA 1FN6A 1XVOA 3RXVA 1IQGA 4DCDA 1O2LA 5DP5A 1UK2A 5C1XA 2FOAA 1SGYE 2ZCKP 4I8KA 4YLUA 4Y79A 1BMMH 1LPKB 1G30B 1YC0A 1YM0A 2BLWA 7ESTE 2ZCHP 3VGCB 1EZUC 1JIRA 2PGBB 4INHA 1N6YA 2ZI2H 2P16A 1FJSA 1GGDC 3SNEA 5GCHG 1O2XA 4M7GA 1G37A 1TPAE 3ATWA 3QK1A 1HJ9A 1BB0B 1G3EA 3P8GA 4A92A 1V2LT 2G81E 2OBQA 3GCTG 2FI3E 5JB9S 2AH4X 3QUMP 4RKOB 2XNIA 4ZKRU 1KXFA 1G2LA 1JOUB 7LPRA 3SN8A 1IQMA 1H9LB 1S81A 1HYLA 2R2WU 1KTSB 5FPYA 3ZVGA 1CHGA 1TMTH 2PHBA 5EXLA 1W8BH 3L33A 1BA8B 1K2I1 3SJIA 2OQ5A 2HNTC 2R2MB 4ABDA 4NZLA 2M5TA 4O3TA 5F8XA 8GCHG 2OINA 1TPPA 1B0EA 4Y76A 2BD3A 1UVSH 4AGJA 3VGCC 1ZR0A 4BAQB 2V35A 3KQCA 1C2LA 3MI4A 1QIXB 1QRXA 4ZROA 4BOHA 2A5IA 1NRNH 3ATLA 4OS4A 4MNXA 1EXFA 2ZU2A 4WJG2 5I46H 3GCNA 3M61U 1FDPA 4JYUH 3SQHE 4DIIH 5PTPA 1PPEE 2FOCA 3PWBA 1G3CA 1H9HE 1JIMA 2FS9A 3PM3A 4B2BA 3QO6A 4Y7BA 1CO7E 2V6NA 2PUQH 1GWAA 1PJPA 4LOYH 1O3KA 3S9CA 1RFNA 4U32A 3SZNA 3UOPA 2SNVA 2A2XH 2D1JA 1O32A 4X6NA 1T8NA 3ZYDA 3TK5A 1UVPA 4CR5A 3B9FH 1O30A 1W7XH 1FY5A 1P9SA 4OS5A 3TLOA 3TU7H 3CENA 1TNHA 1EZQA 1O3EA 5B6OA 2Z9LA 4MNVA 1HDTH 2BOKA 1DXPA 1P10A 2PFEA 2HALA 1AZ8A 1QR3E 1S0RA 2H9EH 5T6GA 3LONA 3TK6A 3UNQA 1P05A 2FX4A 1K22H 2ZZUH 1HUTH 4HGCA 2FIRH 1O2TA 1KXAA 3O8CA 3E16B 1O3PB 1MMJN 4K60A 4IC6A 2Q6GA 3D49H 2BDBA 1ARBA 1W14U 3F9FA 4A6LA 2ZU4A 1OXGA 1QHRB 3SNDA 1Z6EA 3RXDA 3QWCH 3PWCA 4BNRA 4XBBA 5C3NA 1WYKA 2LNCA 3GYLB 1D9IA 1EATA 4DJZB 1O2YA 3KL6A 2ZG0H 2XC5A 1MU6B 2AERH 3P6ZB 1O5EH 1FAKH 3V13A 2WUBA 1DSTA 1HAIH 1C2KA 2OP9A 1U6QA 5A09A 2GV7A 5G4BA 3RC4A 3UPEA 4BTTB 1FY3A 1HFDA 1HCGA 3V12A 1YCPK 2RA0A 3U9AH 1OYQA 4CRAA 3V7TA 1TX8A 2CF9H 3MO6A 2BB4A 1ZSKA 1GBFA 4LZ4B 1BMLA 1EX3A 1LQEA 3K6ZA 3EDXB 2XBXA 1F5RA 3LJJA 1PYTD 1S84A 1OX1A 1C5TA 1ZPZA 1LPGB 1YPEH 2HPQH 1SOZA 1WUNH 3TGIE 3S7HB 1DY9A 3BEUA 1IHTH 3OSYA 1OWHA 3TGKE 3UREA 3A80A 3T27A 4OS6A 1EAIA 4FUDA 5ESTE 4MPUA 2I6QA 3ZZDA 2ZGXH 1TB6H 1GJ9B 1SB1H 1C5VA 4Y8XA 1ZJKA 1UK3A 1EJNA 2Q6DA 1XX9A 2BVSH 1QL7A 3F1SB 3BG8A 1AFEH 1C4V2 5DG6A 3HKJB 2GKVE 4Z0KA 2TRMA 7GCHF 3RXAA 4DURA 4IN2A 1QA0A 2ZPQA 5K0HA 2ZIQH 3P17H 2TBSA 2NU4E 4IS5A 3STJA 2ZDMA 4MPVA 2QGRA 3ELAH 4NIVA 2P3FH 3FP8E 3RLWH 4X1QU 1ELDE 3M3TA 4UFEH 4MPWA 3JZ1B 1SVPA 1VITH 2DE9A 3A84A 1GHXH 4IMQA 1C4U2 2BDAA 1KIGH 2P3TB 4INLA 5FPSA 1P0SH 1MCTA 2ILNA 2Y7XA 2R0LA 1GHZA 1P04A 1AKSA 1TOMH 4X8TH 1XUKA 1YCPH 4RKJB 1FY4A 1HAXB 2FLBH 1BHXF 1BRAA 1ZJDA 1TBZH 2UWLA 1SL3A 3HKIB 3MNSA 1KXCA 1EP6A 1C1NA 1XUJA 1W2KH 3PTNA 1O2WA 1O2ZA 5K7RA 3VXEH 1TX6A 1NRRH 2TGPZ 1Z6JH 4KTSA 1BTPA 2BX4A 4WMDA 4X2VA 1QY6A 2BD5A 1XUHA 4UD9H 1ID5H 1QCPA 3RM2H 2ZC9H 2BD9A 2Z3CA 3I29A 4RSPA 2GT7A 2WPIS 2EI8A 2A7HA 1YKTA 2FOFA 1MKXH 4A1XA 1VCQA 5FXLA 1LKAA 3CS7A 3W94A 4KKDA 2HOBA 4ZUHA 2FZZA 2AGGX 1EASA 2H2ZA 2FS8A 1P11E 1ACBE 4MPXA 1LVOA 2CF8H 2TGTA 1V2TT 1C1PA 2R9PA 2XC4A 3OU0A 1XUGA 1WTHD 1KLTA 2BD4A 1C5YB 1T8LA 2VU8E 1UCYK 2XWBI 1HAOH 3QGNB 3A89A 1DM4B 4WXVA 2STBE 3LC3A 3A7VA 5FCKA 2FP7B 1BDAA 1ZMLA 2C8YB 3NKKA 2FOEA 1BITA 1SFQB 1AUTC 5EOKA 3E1XB 3PYHA 4K69A 1RTFB 2HWLB 1KDQA 2ZPRA 3Q77A 3ESTA 2BD2A 3LOXA 5FBEA 3UOUA 1YPGH 1O5CB 2CJIA 2ZHEH 1GG6B 4Y0ZE 1VZQH 2O8UA 1A3EH 1ZGIA 1BTWA 1RTLA 4R0IA 1SHYA 2QXGA 2QXIA 1EOJA 1DS2E 3RXHA 4SGAE 2C8WB 4FUCA 2TIOA 2VIOA 3A88A 4FUIA 1V2WT 1FIWA 1HAVA 3SU0A 3ZVCA 5FAHA 1K1JA 1O5FH 1O3AA 1GHYH 3EA7A
chains in the Genus database with same CATH superfamily
1D6WA 1VGCB 1ZTJA 3GISB 2XBVA 2J97A 4NSVA 1HLTH 2WPDD 3T62A 3ZV9A 1O2IA 1T31A 1CT4E 3M5NA 3M5MA 1Y3VA 4XBDA 1PPCE 2ZHWH 2GZ7A 1HXFH 5HGGA 3E3TA 1TNIA 1ZGVA 4RT1A 1O3HA 1TIOA 1O2SA 1G2MA 1SI5H 3PV5A 3RXTA 2XC0A 3FOAA 3SNCA 1CGIE 3E91A 4Y8YA 5HMAA 3BEIB 4BTUB 2FDAA 2CN0H 4LZ1H 1MTNB 5J4SA 4GUXA 4X1SU 2RA3A 2O8LA 2QV1A 1UCYE 2F9VA 2FTMA 5DGJA 1K1IA 2SGAA 1UTKA 2GCTB 4JZDH 1UO6A 1UCYH 1Y3UA 2ZDNA 3MU4A 1GI8B 2GMTB 1NZQH 2F3CE 1YPMH 1TQ0B 1VGCC 2PLXA 1O5GH 4FUBA 4DGJA 1Z7KA 4ABEA 6ESTA 1GDUA 4FUEA 2DE8A 1TE0A 3UR6A 2OTVA 4AFSA 5SGAE 1VJAU 1JRSA 3S7KB 2VIQA 1ETSH 2KM0A 4X8VH 3T26A 1O3CA 5DP9A 1YCPM 2SGPE 2TGDA 1JBUH 2Q1JA 2RDLA 3KQEA 3UR9A 5F6MA 1MTNC 4X8SH 5KEDA 2LELA 1Y3YA 2OUAA 1Y3XA 5KGOA 5DPAA 3WWBA 1V2ST 2ZFQH 5F8ZA 4ISLA 4DT7B 5HM9A 3EA9A 2GCTC 2KAIB 1K1LA 4WH6A 1O2OA 4FUGA 4TWYA 3M5LA 1K21H 3SORA 1IQIA 2GMTC 4NGAH 3UNSA 2QF0A 1CA0B 3F9GA 3SI3H 1LCYA 1LHCH 1SPJA 3SGBE 4UFGH 3IWMA 3RM0H 1IQNA 3GDVA 2OD3B 1DITH 2KCPA 5DN6D 3GY4A 3FN8A 5ABWA 4Z6AH 2BZAA 4ZH8A 2OK5A 3PROA 3T28A 4B6EA 3UQVA 3SV2H 1E36B 3SUFA 1SLVB 2BOHB 1GL1A 3K65B 4NA9H 1ABIH 1C2IA 3U69H 4TT3D 1AIXH 1IQEA 2XCFA 2WPKS 2ZP0H 1MTSA 1UVTH 4I8GA 2HLCA 3PLKA 3ITIA 5EIYA 6CHAB 1MAXA 4DVAU 1H1BA 2PR3A 2G5VA 2CMYA 3H7OA 1EAUA 3D65E 1L4DA 3FP7E 2HGTH 3LPRA 1SMFE 1LHFH 1L1NA 1W0YH 1ORFA 5DJ7A 3A82A 4ZAEA 2G5NA 4B1TA 1QL9A 1O5DH 1QURH 1NC6A 4Y8ZA 1AZZA 3LJOA 2Y80A 1WOFA 5EJLA 2AS9A 1QNJA 1XXDA 4AFZA 3PTBA 2F43B 3F2GA 1GJ6A 4I31A 4CRBA 1GHBF 1O2KA 1GPZA 3HK6B 4YZUA 3URDA 1XXFA 2UUJB 2VIDA 4ISHH 6CHAC 2ZDLA 3PMHB 4X6PA 4JZIA 2BY8X 3SGQE 1O2HA 4UFFH 3AVZA 1T8OA 1GDNA 1IQKA 5DK1A 1AUJA 5C67A 3BF6H 4VGCB 3ZVEA 1H8DH 1GDQA 1UMAH 1QJ7B 3V3MA 1A5GH 1V3XA 1FMGA 2J34A 1YBWA 2KX4A 4ABBA 1OYTH 3ZVDA 4E05H 3ZZ6A 1C2MA 2GX4A 2OC8A 4D7FA 3RXBA 3RXUA 1V2JT 1GI1A 3IITA 1GCDA 5HM2A 2G4UA 1NRQH 3OFND 1C9TA 3M36A 1GMCF 4NFFA 3F68H 1ZMNA 2VIWA 1GI7B 2GVFA 2BVXH 2Y5GA 3PV4A 4OGYA 1OOKB 1IQHA 1SQRA 2A4OA 3BTKE 1CVWH 1D3DB 2BHGA 3GDSA 4ZHMU 4VGCC 1BOQA 1AD8H 2VINA 2FO9A 3BTHE 5GNDA 2KFWA 1CU1A 2BYAX 1GI9B 4ISOA 1BTYA 1TFXA 1ELEE 2AMDA 1KXDA 3AW0A 1TONA 4NCYA 4UEHH 3NXPA 4NA7A 3RXMA 3L3TA 5IYTA 1QTFA 3LH3A 1F92A 1EKBB 3ENSB 1D3QB 4MTBA 1SQTA 1Z8GA 2R3YA 3K6YA 1LHDH 2JJ2D 1E37B 1V6DA 4M9FA 1JWTA 5B6LA 2HVXA 2ULLA 4H4FA 2R0KA 4K1SA 2GGVB 1GHAF 1S82A 1LHEH 2LPRA 2GCHF 5EXMA 2B9LA 1O5AB 2NU0E 4GAWA 2HLDD 2EI6A 4X1PU 4CH2B 2Y5HA 3E6PH 3ZZ4A 1C5LH 1EJAA 1K28D 4O3UA 4IW4E 1IQJA 1O3NA 3E90B 4DIHH 1FPHH 1P2JA 4X2WA 1BRUP 1W10U 3KIDU 4B73A 5LH8A 1SGDE 1BRBE 2HNTF 5F8TA 3SU2A 3K2UA 1ELFA 1HIAA 5C20A 1LKBA 2FOMB 1W0ZU 2FOHA 3RC6A 3I78A 1EZXC 1G3BA 1SOTA 2BDIA 1C2FA 1AN1E 1ANCA 5GDSH 1LO6A 3O8BA 3A86A 2FX6A 1C1WH 1NTPA 3EQ0H 3OY6U 1N8OB 1DY8A 3QZQA 4TWWA 1SG8B 2YMSD 5FX6A 1D6RA 2IJD1 2FWWA 4AC9A 4KP0A 2D2DA 4DT4A 4GCHF 3LGVA 4GLYA 1GJDB 3H7TA 4Z1MD 5DKMA 2YOLA 1V2VT 5JPMH 3SO3A 4Q63A 3M5OA 1X7AC 1QQUA 1M9UA 3MH4A 1BZXE 3Q3YA 1DSUA 2ZKSA 3CP7A 3VB5A 3ATIA 4UDWH 2VNTA 3LKWA 1J9CH 3K9XB 1OS8A 1LDTT 4J1YA 3RXKA 5IDKA 3MU1A 3T5FH 1N8OC 1V2QT 1DE7H 4XBCA 3BTFE 2P93A 2J92A 4TY7A 4X6MA 3NRLA 4B76A 1CA8B 1W0JD 1HXEH 1SLXB 3F3BA 2A2QH 1J17T 4NWLA 3E0NB 2F9OA 3LGWA 2XYAA 1VITF 4OM9A 3RXSA 1JMOH 1PPHE 3BV9B 3KQDA 1ELVA 3LH1A 3ATKA 4GHQA 1FPCH 1S5SA 4X1NU 3F6UH 1GI6A 4U2WA 3S9AA 2EC9H 1ABJH 3DFJA 4YESB 1GI2A 1P2QA 1DUAA 3URCA 1ZOMA 4JK6A 2Y6TA 2ZFSA 4A1VA 4INKA 2CXVA 1AB9B 2H1UA 4RT0A 2WSSD 3AAUA 4AYVB 1CE5A 3Q3KA 2ALVA 3VEQB 3TNSA 1ANDA 4YOGA 1ELAA 2OC0A 1GBKA 2W3KA 2ODQA 2NWNA 3ZZAA 1AKSB 4Q7XA 4A5TS 1VR1H 1YP9A 1AO5A 1HV7A 4F55A 1O0DH 2ANMH 5HXFA 2J98B 1CT2E 1GJ4H 3LU9B 4I7YH 1QJ1B 1LHGH 1PPGE 3RMOH 2QF5A 3GY5A 5FHTA 1MKXK 3U8RH 3MMGA 3N7OA 4E7RG 3TJNA 2ZQ2A 2BMGB 4ZHAA 1FN8A 2Z9JA 2F9NA 2VB0A 1AB9C 5DSFA 3MNCA 4F4OC 2GV6A 5TCCA 2B8OH 2WPHS 3VG8A 3ZZCA 6GCHF 4AG2A 1AWHB 1TA2A 1UJ1A 2CK3D 1ARCA 5TJXA 3RXGA 1SGTA 1E0FD 2HRVA 1CBWB 1GHVH 3PLPA 2Y81A 5DP7A 3RDZA 1QRZA 1HNEE 1HGTH 1P3CA 3PV2A 5GXPA 1S83A 1TGSZ 1V2MT 4DG4A 3EE0B 2ZTYA 1DX5M 1FX0B 2OCVB 3TJUA 4K5ZA 3SJOA 3DSPA 1NN6A 1B5GH 1BT7A 7GCHG 3SV8A 5LPFA 2VH0A 4IMZA 3KQ5A 4CR9A 3FAOA 1UTPA 1Y5BT 1C4Y2 1H9IE 1UHBA 2ODPA 1THRH 2BQ6B 1FIZA 3SBKA 1IOEA 3PMJA 3GYMA 1QB9A 4FETA 2RFKC 5CE1A 1TLDA 3SUDA 1MTVA 1SBWA 4ASHA 1KDQB 1OWEA 4B75A 2OBOA 2TGAA 3CNRA 2BDHA 1O2RA 4JK5A 4Y7AA 2Z7FE 4KGAA 1UW7A 1C1MA 1MTWA 4H6SB 1WV7H 1CGHA 4XSKU 1CBWC 4WXIA 1NU9A 5DP4A 1AI8H 4Y10E 2AIPA 2UUFB 3RXRA 4RI0A 2Z9IA 2VWOA 4AFQA 1N6XA 5A2MH 1GI0A 2J94A 2ZGJA 5ESBA 1ESBA 1OP8A 3U1JB 2FMJA 2JKHA 4JZEH 1HPGA 3BTDE 1HAVB 5JYIA 1Q31A 4ZKOU 1Z8RA 1ELCA 3OTJE 3QX5H 4FVDA 2H9TH 1T4VH 1HAZB 1ETRH 5T6FA 1LVYA 2NU2E 2ZTXA 1TMUH 1CHOF 1O2VA 3STIA 4I8LA 1RS0A 2AGIX 5L30H 1SR5C 2ZGCA 1GBLA 3Q00A 1UTOA 1ZRKA 3NPSA 1MAYA 2JETB 2FI5E 4AOQA 1GMHF 1K1MA 3UUZA 1O2PA 2ZGBH 1P2IA 2PKSB 2G51A 3E8LA 2OXSA 4OGXA 3SJ8A 3GDUA 1P2MA 4X1RU 3A8DA 1P2OA 3A8AA 5JBCS 4K8YA 2OC1A 4NG9H 1JRTA 2A4QA 3BIUH 1JXPA 2PUXB 3AASA 3SJ9A 2Z9KA 2ZFRH 2GD4B 1TA6A 1J8AA 1ZSLA 3A83A 3F2FA 1TAWA 3KYFA 3QZRA 3JZ2B 5JBBS 1GJ7B 5BRRE 2O8TA 6LPRA 1WBGB 1H8HD 3MHWU 2NU1E 1TRNA 2JETC 3OX7U 1BIOA 1C1VH 1Y59T 4XD7D 3SUGA 3DUXH 3V0XA 1V2PT 2BY9X 2FOGA 1GBIA 4K2YA 2PKSC 5F53A 1O3BA 4MVNA 2BZ6H 4U30A 1WSSH 3ZVBA 1HAPH 3W1EA 1P09A 3WY8A 3C1KA 1BTXA 1TGTA 2H5CA 2IJOB 3MOCA 1C1TA 1CGJE 1PQAA 4NSYA 1NESE 1V2NT 2ZA5A 1W3CA 1KLJH 1LTOA 1EUFA 1P01A 1YGCH 5FPTA 2AHME 4CBOA 2PTCE 3SV7A 4AN7A 2ALPA 5GIBA 1GG6C 3DA9B 4BAKB 3A85A 4GPGA 2L6OA 3D62A 1NPMA 3TH2H 2UUYA 4BAHB 1BUIA 1VJ9U 1F0UA 1W13U 5EW1H 2GT8A 4B2CA 2A7CA 4FOUC 4SGBE 3SJKA 2Z3EA 3SNAA 4X6OA 1MKWK 3PB1E 3SU6A 1P57B 2G4TA 3LC5A 5EQQA 1OWDA 2XXLA 1TNLA 5EODA 3P95A 1BJUA 1Q3XA 1E1RD 2F9UA 1K0HA 2FPZA 1RTKA 1O2GH 5A0AE 2VVUA 3KGPA 1KY9A 1XVMA 1F5LA 5JBAS 4ACBA 2BLQA 3FP6E 5A8YA 2IPQX 2XCNA 1O3DA 1TBQH 4P02A 3KF2A 3RXLA 2J5UA 2AGEX 4BAOB 4NFEA 4CRFA 1AWFH 1O2UA 1TYNA 2H5DA 3QDZB 4DY7B 3SZEA 2PP6A 1MQ6A 1QRWA 3VXFH 1GBAA 2O8WA 2XOKD 3MU0A 3NUMA 2TPIZ 7KMEH 2ZEBA 2WV5A 1Y5AT 1L1JA 1ELTA 4ABAA 1SGFG 1F0TA 2FXRA 2H9HA 4O97A 1ZTLA 1G9IE 2G8TA 5A8ZA 2ZTZA 2B7DH 2A31A 2Z94A 3RXPA 3UWJH 3ZVAA 1S6HA 3RXJA 4JYTA 5I25A 5CDFE 2SGDE 3ZIAD 1TMBH 2C93B 4CRCA 2EEKA 2VGCB 2ZECA 1PQ5A 1P06A 3U8OH 1SLUB 5C1UA 3N99A 4GSOA 2KCOA 3NZIA 1W7GH 1SGQE 1ZYOA 2G00A 1OWKA 5EPYA 4D9RA 1T32A 2P94A 5EGMA 5CMXH 1MD7A 4I8JA 1AHTH 1C5UA 3TITA 3FZDA 1H8IH 2VIVA 3RU4T 5LPRA 3OYPA 3ODDA 1FUJA 3VB7A 2JH6D 3GY7A 3LT3A 1MKWH 1KTTB 2DUCA 1OSSA 4B6FA 3ODFA 1C2HA 1GBJA 1CA0C 2CGAA 3UY9A 4D8NA 1A3BH 1AVWA 2QA9E 2XNDD 1ZHRA 1C1OA 4NIYA 1OHHD 2R3UA 2J38A 2VGCC 2ZHFH 4AYYB 3TIUA 2Y7ZA 1T4UH 3A7ZA 3SNBA 2EY4C 3M35A 3C27B 1O34A 3FO8D 2IN2A 2C8XB 2PWXA 5JB8S 1Z71A 4MNWA 5EJ1A 2W3IA 1RD3B 1HAYB 2FESH 3PMBB 3PMAB 1MH0A 1HJAB 1QGFA 3QGJA 2A4RA 1GBBA 1L2EA 5JDUB 4MNYA 2BM2A 2BXTH 1GVLA 1NFYA 2GZ9A 5EQSA 3LGIA 2VWLA 4JCNA 1AFQB 1B7XB 1GVZA 1GHBG 3D23A 5C5NA 4BANB 1F2SE 2JH5D 1SGEE 1C2GA 3EGKH 1YY3A 2A4GA 2PW8H 1AE8H 2WINI 1EB1H 1HAGE 1PPZA 3FKSD 1OWIA 1EAXA 3MNBA 1C2DA 1W11U 4HG6A 4TYDA 3EA8A 2ODYB 2FTLE 1TRMA 1P2KA 1EFRD 3KHVA 5E2PA 1UTNA 2LP6A 1EB2A 4FXGH 3TVJB 1NT1A 1OP2A 1P2NA 2BDYA 3KQBA 3ZZBA 1A1RA 3A7TA 3GCOA 4E7NA 5AF9H 3P92A 2EA3A 2G52A 1NO9H 1S85A 1EAWA 1GVKB 1HJAC 4WF8A 1C1SA 2ZQ1A 3DT0H 3BEFB 2ZU3A 2A5AA 3TH3H 2KR7A 1AFQC 4DW2U 4MDSA 1EOLA 1HIAB 1DWDH 1TOCB 3RMNH 1V2KT 1TPOA 3Q3XA 2F9PA 4MLFB 4ISIH 1GMCG 1NBMD 1GGDB 3SU1A 2SGQE 2AMQA 5JBTA 1TNJA 3RXEA 4CREA 1YPHE 2HPPH 1GBMA 1WCZA 5HIYA 1V2RT 1KXEA 1O2JA 1YYY1 2CHAB 4O9VA 3G01A 4ABJA 2ZDAH 5GWZA 1TNGA 2WV4A 3SUEA 1ZTKA 2BD8A 1DWEH 1F5KU 1NU7B 3U8TH 1LVBA 2YMSB 5T6DA 1A46H 5CHAB 3T29A 4H42U 1DLEA 1GJ5H 3BSQA 1LVMA 2THFB 3A81A 3TH4H 1YLCA 3P8OA 3GY6A 3NWUA 2XWAA 3BN9A 1F0SA 1WU1A 3LGUA 3A87A 1GI5A 1BRCE 1EPTA 1MABB 1QB1A 3LGYA 5GCHF 1O3MA 2GP9B 4JZFH 4CRDA 2AMPA 3OAAD 3RC5A 1T8MA 2Y82A 3GCTF 2H6MA 5LGOA 2C90B 4ZXYH 3DD2H 1O3IA 1KYNA 2EI7A 1GHAG 2CHAC 2ZF0H 2GCHG 2QY0B 4I8HA 2WYGA 1EP5A 2IPHA 5CHAC 2BDGA 2JDID 4XOJA 8GCHF 4UE7H 3RU4D 1A4WH 1DXWA 3A8CA 3SW2B 2Z3DA 1K1OA 2FI4E 1P12E 3MO9A 4IC5A 1GJ8B 3P8FA 1DPOA 1Z8IB 3QLPH 1ANEA 1UTJA 1J16A 5DP8A 5DP3A 3RXCA 1O3JA 1NBME 1QZ8A 2AIQA 2VVVA 2J2UA 1KLIH 3OTPA 2ZDVH 2GTBA 2WPJS 1LMWB 1P9UA 3SU5A 1NFWA 1DUEA 2A32A 2PSXA 3N7EA 1BCUH 1Z8JB 2A5KA 2F91A 1O35A 1FQ3A 5A0CA 3O8RA 1DWBH 1MBQA 1Y5UT 1V2OT 1DICA 4TPIZ 1NFXA 1TWXB 1FXYA 4BTIB 4GCHG 3FANA 2ANYA 1FLEE 4AB8A 2BLVA 5DO4H 3T25A 3ZYEA 4Q80A 1QFKH 4LK4A 3HATH 5E0GA 2RG3A 2J95A 5EXNA 5C2ZA 5LPEA 2FLRH 2QXJA 4X2XA 4PROA 1WTGH 5E8EH 5BPEA 4ZMAH 2B0FA 1TALA 3MH6A 3MTYA 3SHCH 1FONA 1K9OE 2QF3A 1C5XB 1SQAA 1XUIA 2F83A 3LGTA 1P3EA 3MWIU 1UVUH 1WAYB 3S9BA 4AFUA 3RU4E 1G3DA 3BTGE 1GI4A 5EQRA 2RCEA 4WWYA 2BD7A 1THSH 1XKAC 3MH5A 1O36A 1RXPA 2EQNA 1YLDA 4B71A 4D7GA 1GBEA 1SKYE 3UFAA 1RJXB 1H4WA 1PYTC 4D9QA 2PV9B 3UWIA 1WQVH 1MU8B 2QCYA 2GDDA 1VITG 4CHAB 3VB3A 5DP6A 2B5TB 4I86A 1GL0E 2Y5FA 3P8NA 3VPKA 4CBNA 5CHBA 1UTMA 2O9QA 3MYWA 1SGRE 2QAAA 1UHBB 3SU4A 1ELBA 4IBLH 1G32B 2A0QB 3S0NA 3OEHD 1FY1A 2WV9A 5GPIB 1O31A 1QQ4A 4WVPE 3DCLA 2FODA 3SQEE 2WPLS 4Q7YA 2P95A 3SU3A 5C5OA 1E79D 2HNTE 1GBCA 1FY8E 3MO3A 5FCRA 4YT7H 3RXOA 4K8BA 3HGNA 3T2NA 1QBOA 4X8UH 1RRKA 3UB0A 1QBNA 3EAJA 3HPTB 3KCGH 3KNXA 1BMFD 2ZGHA 4OS7A 2BVRH 1MCVA 4THNH 1TBRH 4ABIA 1GI3A 2GDEH 3PLBA 4CHAC 1NS3A 1O2MA 2PGQB 1BMNH 4KELA 2J4IA 3DFLA 1O37A 1MD8A 1XKBC 3ZV8A 2UWPA 1THPB 2BTCE 3M3SA 3LIWA 1EQ9A 1PQ8A 4NIXA 2STAE 2SFAA 4TY6A 2BQWB 4K1EA 4ZCNA 1O3OA 3RMLH 4ZKSU 4JZ1A 3B8JA 4ISNA 6GCHG 1BHXB 4NA8A 1HRTH 3CS0A 4IN1A 2I6SA 1BTHH 1D3TB 4WY3A 8LPRA 2KZ4A 2D26C 1TNKA 1L4ZA 1O38A 2W6JD 3P70B 3QN7A 4FUHA 1UK4A 1C5NH 4OS1A 4WH8A 5AFYH 2ZFPH 1ESTA 1DANH 1OWJA 1DDJA 1XM1A 2NU3E 2QIQA 4TSFD 5L2ZH 3R3GB 4AZ2B 2SGFE 1MZDA 1Z1JA 4MG3A 3QTVH 1Z1IA 3BG4B 4AORA 1A61H 1NM6A 2C4FH 1AVGH 1A5HA 3GCHB 4FU9A 3VB4A 1NROH 1P8VC 3PO1B 1GBTA 3H09A 1CQQA 1VCPA 1UTLM 2Q6FA 2YNAA 3RXFA 4MQAA 5TCAA 5J4QA 1ZLRA 1C5WB 4YT6H 1EZSC 3MFJA 1TGNA 2W5EA 5EU8A 1C5OH 4ZXXH 3EYDA 3FZZA 1C1UH 2ASUB 3E0PB 4XE4A 2UUKB 4ESTE 1NRPH 3GY2A 2BX3A 2WUCA 3MNXA 1OPHB 4R8TB 4X2YA 3BG4C 1S6LA 2QN5T 1CHOG 4CH8B 3GCHC 2IOTA 3PO1C 3WWFA 1F0RA 1O33A 2FEQH 5L6NH 5C1YA 3FVFB 4AG1A 5H4IB 1TGBA 1O2NA 2YNBA 3F9HA 1SC8U 1GMHG 2JIZD 3F0PA 2W6ID 4A7IB 5AVDA 3Q76A 1AU8A 1ZPCA 4KTCA 1BTZA 1XUFA 4NWKA 2K1QA 5HIZA 4YLQH 1A5IA 1VCWA 1MUEB 2Z6BD 4LXBH 5E0HA 2XW9A 4X0WU 2C8ZB 1E38B 3SV9A 2PSYA 1C2EA 5EPNA 4FVBA 1A0LA 1LQDB 1GBDA 2KCYA 4XDEA 2P59A 1J15A 1E34B 1MQ5A 2PKAB 1DWCH 1C5ZB 1GJCB 3M7UA 4U01A 4JMYA 1FAXA 1ZHMA 4AB9A 3ATMA 3B23B 1C5MD 5C94A 3TGJE 4AX9H 1FI8A 4HTCH 4UFDH 3ZZ3A 1AGJA 2ZU5A 1WXRA 3RXQA 3U98H 1UVOA 2OC7A 2ZPSA 2O8MA 4WMEA 1FNIA 1Y8TA 3A7XA 3HGPA 3U1IB 3R0FA 2FM2A 1SGPE 3A8BA 2VIPA 1D4PB 2J9NA 1YF4A 1O3LA 2UWOA 3SI4H 3BTME 2XRCA 3FFGA 1Y3WA 2FYQA 4K3JA 1ZHPA 1KXBA 4ZKNU 3MQKC 1IQFA 1Q2WA 3OY5U 4HZHA 1C5SA 2A7JA 1XMNB 1ZRBA 3DHKH 2QYIA 4Q2KA 4WMFA 4D76A 3RP2A 1HAHH 4ZHLU 2BQ7B 2W26A 1VKYA 3EE7A 5FX5A 1SLWB 2XBYA 3GY3A 3AAVA 2W7UA 2PTNA 1SHHB 4I32A 1E35B 2SGEE 1AE5A 4JYVH 4Y11E 1S0QA 2VJ1A 3BIVH 4RN6A 4AGKA 1ESAA 4K1TA 1C5QA 3M7TA 4YOIA 4IGDA 2ZFTA 4YM9A 2M2AA 3SGAE 1GMDF 1DOJA 5E0JA 1AQ7A 1P03A 1CT0E 4Y6DA 4GVUA 3UIRA 3BTEE 1QA7A 1YPKH 1DLKB 2V3HH 3MH7A 1T7CA 1GMDG 3TK9A 1MTUA 1P02A 2VVCA 1YPLH 1PPFE 5L2YH 2VH6A 5E2OA 1C1QA 2VWMA 2PKAA 1SGNE 3KN2A 1D3PB 3BTQE 1IHSH 1A0JA 5AHGH 5KECA 1ANBA 1ELGA 1IAUA 1WQSA 1A2CH 1K1NA 1L0ZA 2ANKH 3TJVA 3AW1A 2BDCA 5GJ4B 2P3UB 1OP0A 3M3VA 4BXSA 4O03A 1L1GA 5AFZH 2VWNA 1ZSJA 1N1LA 1BMAA 4Q7ZA 2BLOA 4YOJA 2P8OB 1GBHA 2XTTB 1J14A 2FYRA 4DOQA 3RXIA 4ABFA 1YPJH 9ESTA 1QJ6B 4Y0YE 4B74A 1C5PA 1C5RA 1QBVH 2Z9GA 3HK3B 5A0BA 2WPMS 1FZZA 1F7ZA 4QT8C 1DT2A 4ABGA 3OEED 1RIWB 4Y71A 2RDEA 3L6PA 4HI3A 3MU8A 1O5BB 1TGCA 1YPHC 3AK5A 1IQLA 1GHWH 3ZZ7A 1SGFA 1MZAA 2W7SA 2OLGA 1A0HB 1LPZB 2ZHQH 4YO9A 3KEEA 1O3FA 1SQOA 1TQ7B 3BTTE 2SNWA 2P8OC 2QXHA 2ZFFH 3MU5A 1BBRK 3QTOH 1HBTH 3TNTA 1W12U 5EW2H 3SOSA 3ZZ9A 4A1TA 5HYOA 1EJMA 2ZCLP 1BJVA 1AMHA 2BY7X 3NCLA 1PQ7A 2JH0D 3A7WA 3UNRA 2G55A 1ZPBA 1TRYA 1KSNA 2ZHDA 1FV9A 2AYWA 1C2JA 3S69A 3H5CB 9LPRA 1NY22 4FU7A 1DVAH 3VB6A 1GCTB 1O3GA 1RIWC 5ETXA 2V0BA 3A7YA 2CV3A 3M37A 1V2UT 4ABHA 4I33A 1TPSA 4XFQA 2C3SA 1GJBB 2WYJA 3UAIC 1PFXC 4TPYA 1CSOE 3TJOA 2BXUH 3NK8A 2AFQB 3SV6A 3UQOA 1ZMJA 4BXWA 1SSXA 2BY5X 3F0OA 2ZU1A 1SGIB 2BY6X 5FBIA 1S6FA 4FUFA 3GOVB 1PPBH 3UTUH 1O2QA 4HFPB 1ZZZA 1INCA 1O39A 2ESTE 1K1PA 4UONA 3BTWE 1BTUA 1EPTB 2ZWLH 4B2AA 3O8DA 1RGQA 1SFIA 4NZQA 2ZDKA 3W95A 1ETTH 1G36A 3SHAH 3IG6B 3ZVFA 3RUOA 1HJ8A 1OKXA 2A45B 3GICB 1GCTC 4F49A 2KAIA 1NFUA 8KME2 3ZZ5A 5F03A 2OQUA 4J2YB 1GJAB 3VFEA 4BAMB 1MBMA 2GZ8A 4YTAA 4GHTA 3ZZ8A 2D8WA 2A1DB 1AY6H 1HB0B 3M7QA 4XRNA 1BQYA 1NRSH 3LDXH 8ESTE 3GY8A 3F9EA 1SGCA 5T3HA 2ZNKH 2QC2A 1QL8A 3RMMH 4KTUA 1DFPA 5A8XA 1BBRE 4CRGA 2V3OH 4OS2A 1B0FA 1A7SA 4E06H 3TPIZ 1EPTC 1TX7A 2F9BH 1BBRH 2ANWA 1UTQA 2GJGA 1AVXA 3RLYH 1TABE 4H6TA 2XBWA 2ZO3H 4NIWA 2AEIH 2FOBA 1C9PA 2F4LA 4FU8A 1QB6A 4FUJA 5EG4A 3I77A 1C1RA 1FN6A 1XVOA 3RXVA 1IQGA 4DCDA 1O2LA 5DP5A 1UK2A 5C1XA 2FOAA 1SGYE 2ZCKP 4I8KA 4YLUA 4Y79A 1BMMH 1LPKB 1G30B 1YC0A 1YM0A 2BLWA 7ESTE 3U28C 2ZCHP 3VGCB 1EZUC 1JIRA 2PGBB 4INHA 1N6YA 2ZI2H 2P16A 1FJSA 1GGDC 3SNEA 5GCHG 1O2XA 4M7GA 1G37A 3DSGA 1TPAE 3ATWA 3QK1A 1HJ9A 1BB0B 1COWD 2QE7D 1G3EA 3P8GA 4A92A 1V2LT 2G81E 2OBQA 3GCTG 2FI3E 5JB9S 3KYGA 2AH4X 2QF4A 3QUMP 2V3MA 4RKOB 2XNIA 4ZKRU 1KXFA 1G2LA 1JOUB 7LPRA 3SN8A 1IQMA 1H9LB 2YMSC 1S81A 1HYLA 2R2WU 1KTSB 5FPYA 3ZVGA 1CHGA 1TMTH 2PHBA 5EXLA 1W8BH 3L33A 1BA8B 1K2I1 3SJIA 2OQ5A 2HNTC 2K0QA 2R2MB 4ABDA 4NZLA 3DSOA 2M5TA 4O3TA 5F8XA 8GCHG 2OINA 1TPPA 1B0EA 4Y76A 2BD3A 1UVSH 4AGJA 3VGCC 1ZR0A 4BAQB 2V35A 3KQCA 1C2LA 2K8IA 3MI4A 1QIXB 1QRXA 4ZROA 2V7QD 4BOHA 2A5IA 1NRNH 3ATLA 4OS4A 4MNXA 1EXFA 2ZU2A 4WJG2 5I46H 3GCNA 3WW7A 3M61U 1FDPA 4JYUH 3SQHE 4DIIH 5PTPA 1PPEE 5C0TA 2FOCA 3PWBA 1G3CA 1H9HE 1JIMA 2FS9A 3PM3A 4B2BA 3QO6A 4Y7BA 1CO7E 2V6NA 2PUQH 1GWAA 1PJPA 4LOYH 1O3KA 3S9CA 1RFNA 4P00A 4U32A 3SZNA 3UOPA 2SNVA 2A2XH 2D1JA 1O32A 4X6NA 1T8NA 3ZYDA 5C17A 3TK5A 1UVPA 4CR5A 5IK2D 3B9FH 4F48B 1O30A 1W7XH 1FY5A 1P9SA 4OS5A 3TLOA 3TU7H 3CENA 1TNHA 1EZQA 1O3EA 5B6OA 2Z9LA 4MNVA 1HDTH 2BOKA 1DXPA 1P10A 2PFEA 5EJZA 2HALA 1AZ8A 1QR3E 1S0RA 2H9EH 3PRDA 5T6GA 3LONA 3TK6A 3UNQA 1P05A 2FX4A 1K22H 2ZZUH 1HUTH 4HGCA 2FIRH 1O2TA 1KXAA 3O8CA 3E16B 1O3PB 1MMJN 4K60A 4IC6A 2Q6GA 3D49H 2BDBA 1ARBA 1W14U 3F9FA 3GS9A 4A6LA 2ZU4A 1OXGA 1QHRB 3SNDA 1Z6EA 3RXDA 3QWCH 3PWCA 4BNRA 4XBBA 5C3NA 1WYKA 2LNCA 3GYLB 1D9IA 1EATA 4DJZB 1O2YA 3KL6A 2ZG0H 2XC5A 4ACAA 1MU6B 2AERH 3P6ZB 1O5EH 1FAKH 3V13A 2WUBA 1DSTA 1HAIH 1C2KA 2OP9A 1U6QA 2WZQA 5A09A 2GV7A 5G4BA 2JJ1D 3RC4A 3UPEA 4BTTB 1FY3A 1HFDA 1HCGA 3V12A 1YCPK 2RA0A 3U9AH 1OYQA 4CRAA 3V7TA 1TX8A 2CF9H 3MO6A 2BB4A 1ZSKA 1GBFA 4LZ4B 1BMLA 1EX3A 1LQEA 3K6ZA 3EDXB 2XBXA 1F5RA 3LJJA 1PYTD 1S84A 1WDIA 1OX1A 1C5TA 1ZPZA 1LPGB 1YPEH 2HPQH 1SOZA 1WUNH 3TGIE 3S7HB 1DY9A 3F2HA 3BEUA 1IHTH 3OSYA 1OWHA 3TGKE 3UREA 3A80A 3T27A 4OS6A 1EAIA 4FUDA 5ESTE 4MPUA 2I6QA 3ZZDA 3N7DA 2ZGXH 1TB6H 1GJ9B 1SB1H 1C5VA 4Y8XA 1ZJKA 1UK3A 1EJNA 2Q6DA 1XX9A 2BVSH 1QL7A 3F1SB 3BG8A 1E1QD 1AFEH 1C4V2 5DG6A 3HKJB 2GKVE 4Z0KA 2TRMA 7GCHF 3RXAA 4DURA 4IN2A 1QA0A 2ZPQA 5K0HA 2ZIQH 3P17H 2TBSA 2NU4E 4IS5A 2L74A 3STJA 2ZDMA 4MPVA 2QGRA 3ELAH 4NIVA 2P3FH 3FP8E 3RLWH 4X1QU 1ELDE 3M3TA 4UFEH 4MPWA 1YWUA 3JZ1B 1SVPA 1VITH 2DE9A 3A84A 1GHXH 4IMQA 1C4U2 2BDAA 1KIGH 2P3TB 4INLA 5FPSA 1P0SH 1MCTA 2ILNA 2Y7XA 2R0LA 1GHZA 1P04A 2HVYB 1AKSA 1TOMH 4X8TH 1XUKA 1YCPH 4RKJB 1FY4A 1HAXB 2FLBH 1BHXF 2J98A 1BRAA 1ZJDA 1TBZH 2UWLA 1SL3A 3HKIB 3MNSA 1KXCA 1EP6A 1C1NA 1XUJA 1W2KH 3PTNA 1O2WA 1H8ED 1O2ZA 5K7RA 3VXEH 1TX6A 1NRRH 2TGPZ 1Z6JH 4KTSA 1BTPA 2BX4A 4WMDA 4Q4LA 4X2VA 5HKKD 1QY6A 2BD5A 1XUHA 4UD9H 1ID5H 1QCPA 3RM2H 2ZC9H 2BD9A 3OE7D 2Z3CA 3I29A 4RSPA 2GT7A 2WPIS 2EI8A 2A7HA 1YKTA 2FOFA 1MKXH 3PRBA 4A1XA 1VCQA 5FXLA 1LKAA 1W0KD 3CS7A 3W94A 4KKDA 2VBCA 2HOBA 4ZUHA 2FZZA 2AGGX 1EASA 2H2ZA 2FS8A 1P11E 1ACBE 4MPXA 1LVOA 2CF8H 2TGTA 3SYJA 1V2TT 1C1PA 2R9PA 2XC4A 3OU0A 1XUGA 1WTHD 1KLTA 2BD4A 1C5YB 1T8LA 2VU8E 1UCYK 4YXWD 2XWBI 1HAOH 3QGNB 3A89A 1DM4B 4WXVA 2STBE 3LC3A 3A7VA 5FCKA 2FP7B 1BDAA 1ZMLA 2C8YB 3NKKA 2FOEA 1BITA 1SFQB 1AUTC 5EOKA 3E1XB 2KCAA 3PYHA 4K69A 4ASUD 1RTFB 2HWLB 1KDQA 2WHXA 2ZPRA 3Q77A 3ESTA 2BD2A 3LOXA 5FL7D 5FBEA 3UOUA 1YPGH 1O5CB 2CJIA 2ZHEH 1GG6B 4Y0ZE 1VZQH 2O8UA 1A3EH 1ZGIA 1BTWA 1RTLA 4R0IA 1SHYA 2QXGA 2QXIA 1EOJA 1YLNA 1DS2E 3RXHA 4SGAE 2C8WB 4FUCA 2TIOA 5T1VA 2VIOA 1KMHB 3A88A 4FUIA 1V2WT 1FIWA 1HAVA 3SU0A 5C0UA 3ZVCA 5FAHA 1K1JA 1O5FH 1O3AA 1GHYH 3EA7A
chains in the Genus database with same CATH topology
1D6WA 1VGCB 1ZTJA 3GISB 2XBVA 4NSVA 1HLTH 3T62A 3ZV9A 1O2IA 1T31A 1CT4E 3M5NA 3M5MA 1Y3VA 4XBDA 1PPCE 2ZHWH 2GZ7A 1HXFH 5HGGA 3E3TA 1TNIA 1ZGVA 1O3HA 1TIOA 1O2SA 1G2MA 1SI5H 3RXTA 2XC0A 3SNCA 1CGIE 3E91A 4Y8YA 5HMAA 3BEIB 4BTUB 2FDAA 2CN0H 4LZ1H 1MTNB 5J4SA 4GUXA 4X1SU 2RA3A 2O8LA 2QV1A 1UCYE 2F9VA 2FTMA 5DGJA 1K1IA 2SGAA 1UTKA 2GCTB 4JZDH 1UO6A 1UCYH 1Y3UA 2ZDNA 3MU4A 1GI8B 2GMTB 1NZQH 2F3CE 1YPMH 1TQ0B 1VGCC 2PLXA 1O5GH 4FUBA 4DGJA 1Z7KA 4ABEA 6ESTA 1GDUA 4FUEA 2DE8A 1TE0A 3UR6A 2OTVA 4AFSA 5SGAE 1VJAU 1JRSA 3S7KB 2VIQA 1ETSH 4X8VH 3T26A 1O3CA 5DP9A 1YCPM 2SGPE 2TGDA 1JBUH 2Q1JA 2RDLA 3KQEA 3UR9A 5F6MA 1MTNC 4X8SH 1Y3YA 2OUAA 1Y3XA 5DPAA 1V2ST 2ZFQH 5F8ZA 4ISLA 4DT7B 5HM9A 3EA9A 2GCTC 2KAIB 1K1LA 4WH6A 1O2OA 4FUGA 4TWYA 3M5LA 1K21H 3SORA 1IQIA 2GMTC 4NGAH 3UNSA 2QF0A 1CA0B 3F9GA 3SI3H 1LCYA 1LHCH 1SPJA 3SGBE 4UFGH 3IWMA 3RM0H 1IQNA 3GDVA 2OD3B 1DITH 3GY4A 5ABWA 4Z6AH 2BZAA 4ZH8A 3PROA 3T28A 3UQVA 3SV2H 1E36B 3SUFA 1SLVB 2BOHB 1GL1A 3K65B 4NA9H 1ABIH 1C2IA 3U69H 1AIXH 1IQEA 2XCFA 2WPKS 2ZP0H 1MTSA 1UVTH 4I8GA 2HLCA 3PLKA 3ITIA 6CHAB 1MAXA 4DVAU 1H1BA 2PR3A 2G5VA 2CMYA 3H7OA 1EAUA 3D65E 1L4DA 3FP7E 2HGTH 3LPRA 1SMFE 1LHFH 1L1NA 1W0YH 1ORFA 5DJ7A 3A82A 4ZAEA 2G5NA 4B1TA 1QL9A 1O5DH 1QURH 1NC6A 4Y8ZA 1AZZA 3LJOA 2Y80A 1WOFA 2AS9A 1QNJA 1XXDA 4AFZA 3PTBA 1GJ6A 4I31A 4CRBA 1GHBF 1O2KA 1GPZA 3HK6B 4YZUA 3URDA 1XXFA 2UUJB 2VIDA 4ISHH 6CHAC 2ZDLA 3PMHB 4X6PA 4JZIA 2BY8X 3SGQE 1O2HA 4UFFH 3AVZA 1T8OA 1GDNA 1IQKA 5DK1A 1AUJA 5C67A 3BF6H 4VGCB 3ZVEA 1H8DH 1GDQA 1UMAH 1QJ7B 3V3MA 1A5GH 1V3XA 1FMGA 2J34A 1YBWA 4ABBA 1OYTH 3ZVDA 4E05H 3ZZ6A 1C2MA 2GX4A 2OC8A 4D7FA 3RXBA 3RXUA 1V2JT 1GI1A 3IITA 1GCDA 5HM2A 2G4UA 1NRQH 1C9TA 3M36A 1GMCF 4NFFA 3F68H 1ZMNA 2VIWA 1GI7B 2GVFA 2BVXH 2Y5GA 3PV4A 4OGYA 1OOKB 1IQHA 2A4OA 3BTKE 1CVWH 1D3DB 2BHGA 3GDSA 4ZHMU 4VGCC 1BOQA 1AD8H 2VINA 2FO9A 3BTHE 1CU1A 2BYAX 1GI9B 4ISOA 1BTYA 1TFXA 1ELEE 2AMDA 1KXDA 3AW0A 1TONA 4NCYA 4UEHH 3NXPA 4NA7A 3RXMA 3L3TA 5IYTA 1QTFA 3LH3A 1F92A 1EKBB 3ENSB 1D3QB 4MTBA 1SQTA 1Z8GA 2R3YA 3K6YA 1LHDH 1E37B 1V6DA 1JWTA 2HVXA 2ULLA 4H4FA 2R0KA 4K1SA 2GGVB 1GHAF 1S82A 1LHEH 2LPRA 2GCHF 5EXMA 2B9LA 1O5AB 2NU0E 4GAWA 2EI6A 4X1PU 4CH2B 2Y5HA 3E6PH 3ZZ4A 1C5LH 1EJAA 1K28D 4O3UA 4IW4E 1IQJA 1O3NA 3E90B 4DIHH 1FPHH 1P2JA 4X2WA 1BRUP 1W10U 3KIDU 4B73A 5LH8A 1SGDE 1BRBE 2HNTF 5F8TA 3SU2A 3K2UA 1ELFA 1HIAA 5C20A 1LKBA 2FOMB 1W0ZU 2FOHA 3RC6A 3I78A 1EZXC 1G3BA 1SOTA 2BDIA 1C2FA 1AN1E 1ANCA 5GDSH 1LO6A 3O8BA 3A86A 2FX6A 1C1WH 1NTPA 3EQ0H 3OY6U 1N8OB 1DY8A 3QZQA 4TWWA 1SG8B 5FX6A 1D6RA 2FWWA 4KP0A 2D2DA 4GCHF 3LGVA 4GLYA 1GJDB 3H7TA 5DKMA 2YOLA 1V2VT 5JPMH 3SO3A 3M5OA 1X7AC 1QQUA 1M9UA 3MH4A 1BZXE 3Q3YA 1DSUA 2ZKSA 3CP7A 3VB5A 3ATIA 4UDWH 2VNTA 3LKWA 1J9CH 3K9XB 1OS8A 1LDTT 4J1YA 3RXKA 5IDKA 3MU1A 3T5FH 1N8OC 1V2QT 1DE7H 4XBCA 3BTFE 2P93A 2J92A 4TY7A 4X6MA 4B76A 1CA8B 1HXEH 1SLXB 2A2QH 1J17T 4NWLA 3E0NB 2F9OA 3LGWA 2XYAA 1VITF 3RXSA 1JMOH 1PPHE 3BV9B 3KQDA 1ELVA 3LH1A 3ATKA 4GHQA 1FPCH 1S5SA 4X1NU 3F6UH 1GI6A 4U2WA 3S9AA 2EC9H 1ABJH 3DFJA 4YESB 1GI2A 1P2QA 1DUAA 3URCA 1ZOMA 4JK6A 2Y6TA 2ZFSA 4A1VA 4INKA 2CXVA 1AB9B 2H1UA 3AAUA 4AYVB 1CE5A 3Q3KA 2ALVA 3VEQB 3TNSA 1ANDA 4YOGA 1ELAA 2OC0A 1GBKA 2W3KA 2ODQA 2NWNA 3ZZAA 1AKSB 4Q7XA 4A5TS 1VR1H 1YP9A 1AO5A 1HV7A 1O0DH 2ANMH 5HXFA 1CT2E 1GJ4H 3LU9B 4I7YH 1QJ1B 1LHGH 1PPGE 3RMOH 3GY5A 5FHTA 1MKXK 3U8RH 3MMGA 3N7OA 4E7RG 3TJNA 2ZQ2A 2BMGB 4ZHAA 1FN8A 2Z9JA 2F9NA 2VB0A 1AB9C 3MNCA 4F4OC 2GV6A 5TCCA 2B8OH 2WPHS 3ZZCA 6GCHF 4AG2A 1AWHB 1TA2A 1UJ1A 5TJXA 1ARCA 3RXGA 1SGTA 1E0FD 2HRVA 1CBWB 1GHVH 3PLPA 2Y81A 5DP7A 3RDZA 1QRZA 1HNEE 1HGTH 1P3CA 5GXPA 1S83A 1TGSZ 1V2MT 4DG4A 3EE0B 2ZTYA 1DX5M 2OCVB 3TJUA 4K5ZA 3SJOA 1NN6A 1B5GH 1BT7A 7GCHG 3SV8A 5LPFA 2VH0A 4IMZA 4CR9A 3FAOA 1UTPA 1Y5BT 1C4Y2 1H9IE 1UHBA 2ODPA 1THRH 2BQ6B 1FIZA 3SBKA 1IOEA 3PMJA 3GYMA 1QB9A 5CE1A 1TLDA 3SUDA 1MTVA 1SBWA 4ASHA 1KDQB 1OWEA 4B75A 2OBOA 2TGAA 2BDHA 1O2RA 4JK5A 4Y7AA 2Z7FE 4KGAA 1C1MA 1MTWA 4H6SB 1WV7H 1CGHA 4XSKU 1CBWC 4WXIA 1NU9A 5DP4A 1AI8H 4Y10E 2AIPA 2UUFB 3RXRA 2Z9IA 2VWOA 4AFQA 1N6XA 5A2MH 1GI0A 2J94A 2ZGJA 5ESBA 1ESBA 1OP8A 3U1JB 2FMJA 2JKHA 4JZEH 1HPGA 3BTDE 1HAVB 5JYIA 1Q31A 4ZKOU 1Z8RA 1ELCA 3OTJE 3QX5H 4FVDA 2H9TH 1T4VH 1HAZB 1ETRH 5T6FA 1LVYA 2NU2E 2ZTXA 1TMUH 1CHOF 1O2VA 3STIA 4I8LA 1RS0A 2AGIX 5L30H 1SR5C 2ZGCA 1GBLA 3Q00A 1UTOA 1ZRKA 3NPSA 1MAYA 2JETB 2FI5E 4AOQA 1GMHF 1K1MA 3UUZA 1O2PA 2ZGBH 1P2IA 2PKSB 2G51A 3E8LA 2OXSA 4OGXA 3SJ8A 3GDUA 1P2MA 4X1RU 3A8DA 1P2OA 3A8AA 5JBCS 4K8YA 2OC1A 4NG9H 1JRTA 2A4QA 3BIUH 1JXPA 2PUXB 3AASA 3SJ9A 2Z9KA 2ZFRH 2GD4B 1TA6A 1J8AA 1ZSLA 3A83A 1TAWA 3QZRA 3JZ2B 5JBBS 1GJ7B 5BRRE 2O8TA 6LPRA 1WBGB 3MHWU 2NU1E 1TRNA 2JETC 3OX7U 1BIOA 1C1VH 1Y59T 3SUGA 3DUXH 3V0XA 1V2PT 2BY9X 2FOGA 1GBIA 4K2YA 2PKSC 1O3BA 4MVNA 2BZ6H 4U30A 1WSSH 3ZVBA 1HAPH 1P09A 3WY8A 3C1KA 1BTXA 1TGTA 2H5CA 2IJOB 3MOCA 1C1TA 1CGJE 1PQAA 4NSYA 1NESE 1V2NT 2ZA5A 1W3CA 1KLJH 1LTOA 1EUFA 1P01A 1YGCH 5FPTA 4CBOA 2PTCE 3SV7A 4AN7A 2ALPA 5GIBA 1GG6C 3DA9B 4BAKB 3A85A 4GPGA 3D62A 1NPMA 3TH2H 2UUYA 4BAHB 1BUIA 1VJ9U 1F0UA 1W13U 5EW1H 2GT8A 4B2CA 2A7CA 4SGBE 3SJKA 2Z3EA 3SNAA 4X6OA 1MKWK 3PB1E 3SU6A 1P57B 2G4TA 3LC5A 5EQQA 1OWDA 2XXLA 1TNLA 5EODA 3P95A 1BJUA 1Q3XA 2F9UA 2FPZA 1RTKA 1O2GH 5A0AE 2VVUA 3KGPA 1KY9A 1XVMA 1F5LA 5JBAS 2BLQA 3FP6E 5A8YA 2XCNA 1O3DA 1TBQH 3KF2A 3RXLA 4BAOB 2AGEX 4CRFA 4NFEA 1AWFH 1O2UA 1TYNA 2H5DA 3QDZB 4DY7B 1MQ6A 1QRWA 3VXFH 1GBAA 2O8WA 3MU0A 3NUMA 2TPIZ 7KMEH 2ZEBA 2WV5A 1Y5AT 1L1JA 1ELTA 4ABAA 1SGFG 1F0TA 2FXRA 2H9HA 4O97A 1ZTLA 1G9IE 2G8TA 5A8ZA 2ZTZA 2B7DH 2A31A 2Z94A 3RXPA 3UWJH 3ZVAA 1S6HA 3RXJA 4JYTA 5I25A 2SGDE 1TMBH 2C93B 4CRCA 2EEKA 2VGCB 2ZECA 1PQ5A 1P06A 3U8OH 1SLUB 5C1UA 4GSOA 3NZIA 1W7GH 1SGQE 1ZYOA 2G00A 1OWKA 5EPYA 4D9RA 1T32A 2P94A 5EGMA 5CMXH 1MD7A 4I8JA 1AHTH 1C5UA 3TITA 3FZDA 1H8IH 2VIVA 3RU4T 5LPRA 3OYPA 3ODDA 1FUJA 3VB7A 2JH6D 3GY7A 3LT3A 1MKWH 1KTTB 2DUCA 1OSSA 3ODFA 1C2HA 1GBJA 1CA0C 2CGAA 3UY9A 4D8NA 1A3BH 1AVWA 2QA9E 1ZHRA 1C1OA 4NIYA 2R3UA 2J38A 2VGCC 2ZHFH 4AYYB 3TIUA 2Y7ZA 1T4UH 3A7ZA 3SNBA 3M35A 3C27B 1O34A 2IN2A 2C8XB 2PWXA 5JB8S 1Z71A 4MNWA 2W3IA 1RD3B 1HAYB 2FESH 3PMBB 3PMAB 1MH0A 1HJAB 1QGFA 3QGJA 2A4RA 1GBBA 1L2EA 5JDUB 4MNYA 2BM2A 2BXTH 1GVLA 1NFYA 2GZ9A 5EQSA 3LGIA 2VWLA 4JCNA 1AFQB 1B7XB 1GVZA 1GHBG 3D23A 5C5NA 4BANB 1F2SE 2JH5D 1SGEE 1C2GA 3EGKH 2A4GA 2PW8H 1AE8H 2WINI 1EB1H 1HAGE 1PPZA 1OWIA 1EAXA 3MNBA 1C2DA 1W11U 4TYDA 3EA8A 2ODYB 1TRMA 2FTLE 1P2KA 3KHVA 5E2PA 1UTNA 4FXGH 1EB2A 3TVJB 3ZZBA 1NT1A 1OP2A 1P2NA 2BDYA 3KQBA 1A1RA 3A7TA 3GCOA 4E7NA 5AF9H 3P92A 2EA3A 2G52A 1NO9H 1S85A 1EAWA 1GVKB 1HJAC 4WF8A 1C1SA 2ZQ1A 3DT0H 3BEFB 2ZU3A 2A5AA 3TH3H 1AFQC 4DW2U 4MDSA 1EOLA 1HIAB 1DWDH 1TOCB 3RMNH 1V2KT 1TPOA 3Q3XA 2F9PA 4MLFB 4ISIH 1GMCG 1GGDB 3SU1A 2SGQE 2AMQA 5JBTA 1TNJA 3RXEA 4CREA 1YPHE 2HPPH 1GBMA 1WCZA 1V2RT 1KXEA 1O2JA 1YYY1 2CHAB 4O9VA 3G01A 4ABJA 2ZDAH 5GWZA 1TNGA 2WV4A 3SUEA 1ZTKA 2BD8A 1DWEH 1F5KU 1NU7B 3U8TH 1LVBA 5T6DA 1A46H 5CHAB 3T29A 4H42U 1DLEA 1GJ5H 3BSQA 1LVMA 2THFB 3A81A 3TH4H 1YLCA 3P8OA 3GY6A 3NWUA 2XWAA 3BN9A 1F0SA 1WU1A 3LGUA 3A87A 1GI5A 1BRCE 1EPTA 1QB1A 3LGYA 5GCHF 1O3MA 2GP9B 4JZFH 4CRDA 2AMPA 3RC5A 1T8MA 2Y82A 3GCTF 2H6MA 5LGOA 2C90B 4ZXYH 3DD2H 1O3IA 1KYNA 2EI7A 1GHAG 2CHAC 2ZF0H 2GCHG 2QY0B 4I8HA 2WYGA 1EP5A 2IPHA 5CHAC 2BDGA 4XOJA 8GCHF 4UE7H 3RU4D 1A4WH 1DXWA 3A8CA 3SW2B 2Z3DA 1K1OA 2FI4E 1P12E 3MO9A 4IC5A 1GJ8B 3P8FA 1DPOA 1Z8IB 3QLPH 1ANEA 1UTJA 1J16A 5DP8A 5DP3A 3RXCA 1O3JA 2AIQA 2VVVA 2J2UA 1KLIH 2ZDVH 2GTBA 2WPJS 1LMWB 1P9UA 3SU5A 1NFWA 1DUEA 2A32A 2PSXA 1BCUH 1Z8JB 2A5KA 2F91A 1O35A 1FQ3A 5A0CA 3O8RA 1DWBH 1MBQA 1Y5UT 1V2OT 1DICA 4TPIZ 1NFXA 1TWXB 1FXYA 4BTIB 4GCHG 3FANA 2ANYA 1FLEE 4AB8A 2BLVA 5DO4H 3T25A 3ZYEA 4Q80A 1QFKH 4LK4A 3HATH 5E0GA 2RG3A 2J95A 5EXNA 5C2ZA 5LPEA 2FLRH 2QXJA 4X2XA 4PROA 1WTGH 5E8EH 5BPEA 4ZMAH