1KXCA

Sindbis virus capsid (n190k mutant), tetragonal crystal form
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
ALKLEADRLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTYTSEHPEGFYKWHHGAVQYSGGRFTIPRGVGGRGDSGRPIMDNSGRVVAIVLGGADEGTRTALSVVTWNSKGKTIKTTPEGTEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of Sindbis virus capsid mutants involving assembly and catalysis.
pubmed doi rcsb
source organism Sindbis virus
molecule tags Viral protein
molecule keywords SINDBIS VIRUS CAPSID PROTEIN
total genus 34
structure length 158
sequence length 158
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1996-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxcA01
1NT1A 1C9PA 4JYVH 1BMLA 1HYLA 1EZSC 4B73A 1BZXE 1GGDC 4I8LA 4XBCA 3PMBB 4IN2A 1AFEH 3AVZA 4CREA 3K65B 4X0WU 3DT0H 2EI7A 1O2YA 3SOSA 2XC4A 1G3EA 4FUBA 3T25A 1O32A 1VJ9U 4ZMAH 1O2KA 2ZGXH 4GPGA 4NCYA 2QCYA 3RLYH 2FTMA 1C5MD 1HAZB 3ZZ9A 1H8IH 1LO6A 3ZZBA 3FZZA 3I78A 3NUMA 1O30A 5FX6A 2FM2A 1YPGH 4YOIA 1HV7A 2SGQE 4DT7B 2ZHWH 1S85A 2NU0E 1EB1H 1P3CA 1C4V2 1W13U 1DICA 4ABAA 1AQ7A 5FPTA 7KMEH 1K28D 3U8OH 2VH0A 2C3SA 1E34B 1LVBA 3RP2A 2ALPA 3ZVCA 2BD5A 2ZU5A 4WXVA 1C9TA 1C1RA 1FN8A 2V3HH 2ZIQH 2HPPH 1FPCH 1Z6JH 1IQLA 4WWYA 3TNTA 5C1XA 1O3NA 1PPFE 2XC0A 1QFKH 2EC9H 2ZGCA 2ZGBH 1MU6B 1ZYOA 2V3OH 1NRRH 4ZH8A 1XKBC 1WOFA 2KAIA 1GDQA 3EGKH 1GMCF 1EXFA 1OXGA 4Y0ZE 8LPRA 1EPTC 4CHAC 1DSTA 1GI8B 2TBSA 1GMCG 2AIPA 1GGDB 2J38A 4WH6A 2J94A 1HAOH 2UUFB 2D8WA 3MU0A 1EASA 1C5PA 1QRWA 4K5ZA 3M7QA 3BG8A 4DIHH 2ODYB 1O2XA 1LKAA 3B9FH 1SPJA 1EAXA 1C2FA 2NU4E 3PROA 2BY5X 2PKSB 1L1NA 4ZXYH 4AB8A 1O33A 3HATH 1EP6A 4MTBA 4FUFA 1TX8A 2GGVB 1K1MA 1A5IA 1SGTA 3A88A 1D3TB 4K8YA 4NSYA 3SHCH 1XUHA 2BDGA 2VWMA 1K1IA 1ZSKA 3T27A 3T62A 4AFUA 1GBAA 3ATKA 4IC5A 3T26A 1PYTC 1ID5H 1NRNH 1T4VH 3SBKA 1P12E 2XBYA 3UNRA 3SO3A 4HI3A 4FUGA 1C4Y2 1P2IA 2ZHDA 1EAUA 1AVGH 2ZPRA 2FODA 1C5VA 4R8TB 2F9BH 1DPOA 3QWCH 6LPRA 4RKJB 5A09A 1LQEA 3K6ZA 1GBCA 2XBVA 1HJ9A 2B8OH 3BN9A 4UFDH 5FBEA 4INLA 2C8WB 2ZFQH 1HAIH 3TH4H 1O5EH 5T6GA 4KELA 1FXYA 3SJOA 1ANBA 1O2NA 4NSVA 3BTME 1TWXB 1GHVH 1IQGA 4FXGH 1SLVB 3GY7A 2XWAA 1L0ZA 2ZU4A 1TQ7B 1Z7KA 2HGTH 2Y81A 3V7TA 1NO9H 2PKSC 1FONA 4MDSA 2Z9IA 2ZZUH 1CU1A 3GDVA 3LDXH 4HTCH 1ZJDA 4IMQA 1C2MA 1LVYA 2FTLE 3M35A 4AGKA 1VZQH 3STJA 1O5FH 4MPVA 1INCA 3RXVA 5FCRA 4ZAEA 3ZVAA 5DO4H 3RXPA 5JPMH 1MZAA 2Q6GA 1O2GH 1DSUA 2R9PA 2FOFA 1HXEH 1YP9A 1Q2WA 2FPZA 1A7SA 1BQYA 5C20A 1O39A 4KP0A 2THFB 4DW2U 3EYDA 5HM9A 1N6YA 1SSXA 2BY6X 1TA2A 1C5XB 1P2NA 1MCVA 1AZZA 2G00A 2IPHA 3RU4D 2SNVA 1J15A 2VIPA 1ESAA 4Y8YA 1VITG 1O2JA 1O2SA 3A7XA 4MNWA 1Y5AT 1YPHE 1GBIA 3VPKA 2WPLS 5EW1H 3SNBA 1MTNB 2W5EA 1NFUA 4IBLH 3URDA 2AS9A 1TRNA 2FLBH 1Y3WA 3SGBE 1EJMA 2ZDVH 3RXOA 2ZKSA 5C5NA 1CGHA 1SC8U 1P09A 4UFFH 1BTXA 2FX4A 1F0UA 1EPTA 1UK4A 1XUFA 1TAWA 3E6PH 2BDHA 1SGDE 2VVCA 5DKMA 5EQQA 2XCNA 1ELAA 5I46H 1UO6A 5CHAB 2VIVA 2A1DB 1SGFG 5ABWA 5E0JA 1ORFA 1TOCB 2EI8A 1K2I1 5LGOA 1A3BH 1SL3A 1QJ7B 3W94A 1BRUP 5T6FA 1E0FD 1YCPH 1SBWA 5DP4A 3MNXA 3GYMA 1MAYA 2R2MB 1NRPH 3ZZ3A 1ZRBA 6CHAC 1K1NA 5DP6A 4K2YA 1GVLA 2ODQA 3LJJA 3FP7E 1O31A 2G52A 1AIXH 4KGAA 1QBOA 2FLRH 5DG6A 4MVNA 1GL1A 3UQVA 4XBBA 4AG1A 1K1OA 4FU9A 1FY3A 2ZTZA 2FESH 1SLXB 2CF9H 3SNEA 3ZZ6A 3E91A 1P04A 2I6SA 8GCHF 2VVUA 4I8HA 3UQOA 1AZ8A 1GWAA 4ZUHA 3UOPA 1XVOA 1IAUA 3LIWA 3EAJA 1JOUB 1C1MA 2QIQA 3V3MA 5L6NH 1GI5A 4A6LA 4Y76A 1TIOA 4IS5A 4OS1A 1C2KA 5JDUB 5GIBA 1C5WB 1Z71A 1BRAA 4ABGA 4RN6A 1NY22 2TGTA 3GISB 4UD9H 1O0DH 3SJ9A 2H9TH 2OCVB 1BTYA 1HNEE 2QN5T 1ZOMA 2VWNA 2VU8E 3CS0A 1V2KT 4FVBA 2XW9A 1DUAA 4JYUH 1BMMH 3BTKE 4DGJA 2GKVE 2QGRA 1D3QB 4I31A 4DJZB 1GHYH 1KYNA 2RDLA 4YOGA 5C1YA 4CH2B 1YPEH 3P6ZB 4U01A 1O3LA 1ZSLA 2FOHA 2P8OC 1FN6A 3MOCA 3UWIA 3S0NA 4Y6DA 1U6QA 3NKKA 4KKDA 1UCYK 1O3HA 1TE0A 1G36A 3S9BA 1TGCA 1O2PA 1ZLRA 3TITA 3MFJA 3MTYA 1TNGA 6GCHG 1MKWH 1EJNA 1OYTH 5LH8A 1IQEA 1MD7A 3P8NA 3VB7A 2GDDA 2O8WA 2BLOA 3SU0A 1AN1E 3ZZ8A 2Q6DA 1NFXA 2P93A 1OX1A 1LPGB 3SGQE 3SI4H 1QHRB 4MQAA 1BJUA 2ZDAH 3BTGE 1TB6H 1GHBF 1LHFH 2R0LA 1QBNA 3RXDA 1P0SH 3E90B 4FUDA 5L30H 1E37B 1SHYA 1QA0A 1W8BH 4D9QA 1AE5A 1PPCE 2BDBA 1RFNA 1FAXA 1P01A 2SGPE 1HGTH 1RJXB 2UUYA 1GI6A 1OWHA 3E0NB 5L2YH 3TK5A 2PSXA 2VIOA 1LVOA 1D3DB 3ZVFA 1ZTLA 3TK6A 1XUGA 3SJ8A 2UWPA 2WYGA 2OQUA 1ESBA 1HB0B 4R0IA 2G5NA 1MH0A 1GJ9B 4X8TH 3F9HA 1C1UH 3CENA 4UEHH 2BB4A 3H5CB 2ZPQA 4BAHB 3URCA 4BANB 4BNRA 3E3TA 1CVWH 1VGCB 1FJSA 1O5AB 1DANH 3DHKH 3BEUA 4LZ4B 1AKSB 2PHBA 5HMAA 2HLCA 3TPIZ 2QXJA 1E36B 2VGCB 1FDPA 4IMZA 1Y3UA 1AUTC 1C1OA 3ESTA 3ODFA 1RTKA 2BY9X 1T8MA 4DIIH 4U2WA 1LQDB 1B0EA 1BB0B 1C5NH 2G5VA 1HXFH 3AAVA 3NZIA 1O36A 5A0BA 2F9OA 1ZR0A 1ELDE 1QBVH 2ANWA 1OYQA 1IQJA 2BD2A 2O8TA 1K21H 1XUKA 4ISIH 8GCHG 1G37A 1PQ8A 3QTOH 3BG4C 2EEKA 1GMHG 2SNWA 2SFAA 1J8AA 1GBDA 1YLDA 3VFEA 2BLQA 3QO6A 3RM0H 3Q3YA 1MKXH 1WQSA 2ZC9H 4I33A 1S5SA 3S7KB 2BXUH 1GHAF 1F5KU 1DITH 1TNIA 2WPIS 2BQ7B 3A85A 2VIQA 4B74A 3PTNA 2FI3E 3BTDE 3O8CA 3T2NA 1TBQH 1QJ1B 2ZFSA 1NFWA 1AMHA 3OX7U 2OTVA 2G8TA 3L33A 1VGCC 1H9IE 2Z3CA 4X6OA 2FI4E 4O9VA 2NU2E 3OTJE 3V13A 1S84A 2JH5D 1LMWB 2PFEA 1KLIH 5AHGH 1Y3YA 1L2EA 1P2OA 2RCEA 2WPJS 2A4OA 4XBDA 1FAKH 1P02A 1UTMA 2ANYA 1MTVA 2BYAX 5DP9A 2TGDA 1FZZA 1G3DA 1MCTA 3V0XA 2HNTE 4MNYA 3Q3XA 3UNQA 1CSOE 1EATA 4RKOB 3IWMA 1GG6B 1UVSH 3A7VA 1V2UT 1O2TA 3VB4A 1DXWA 3U1IB 3BG4B 2BQ6B 1LHDH 1UTKA 5J4QA 5DP8A 1ZTJA 3TH2H 1BTPA 2AEIH 1HJAC 1A46H 5T3HA 2BHGA 1MAXA 1P3EA 1GJBB 1P11E 2AMDA 1O3DA 1T7CA 1FY5A 1GI9B 4CH8B 2Y82A 5F8TA 4JCNA 2AYWA 4NZLA 5FXLA 3DFJA 3ENSB 4WF8A 2FOAA 3MWIU 4INKA 5BRRE 1V2OT 3RXMA 2VIDA 1AU8A 1EPTB 3SZNA 4NIVA 1B7XB 1AHTH 1CHOF 4AFZA 1JMOH 2H9HA 3MU8A 2A5IA 3LKWA 5EXMA 2PUXB 2QXHA 3QGNB 3RMLH 1BTHH 1SI5H 3ZYEA 3BTEE 3BV9B 1J17T 1ABJH 3EE0B 3CS7A 3GY8A 3RLWH 3GDUA 1SHHB 2GT7A 2R0KA 3SNCA 3BTFE 2BLWA 1SFIA 1T8OA 4CR5A 1TPPA 3PYHA 1TONA 1DS2E 1KLJH 1GI3A 1SGRE 3AW1A 4CRBA 3PV4A 1ETRH 1BDAA 1G3BA 1BTWA 5E0HA 1HUTH 1GJAB 1UTPA 1CE5A 1O5DH 1JRSA 1FPHH 1HAYB 3SU2A 5EW2H 3HK6B 1T8NA 2OUAA 6CHAB 1FUJA 2WV4A 1QGFA 3KQDA 1O2VA 2Z7FE 1TGNA 3A80A 5JBAS 3UWJH 3OYPA 4U32A 1ZHMA 5E2OA 2ILNA 1C1WH 1FIWA 4YO9A 1ARCA 1LDTT 1MZDA 1YPLH 4O97A 2VWOA 1P05A 1UK3A 1DY9A 3EA7A 1QR3E 4NA8A 5EOKA 2QYIA 3KHVA 1A1RA 4A1TA 3N7OA 2XTTB 2VIWA 1V2RT 3F9FA 4ABEA 1GHAG 3B23B 4MLFB 1CBWB 4ISHH 2FMJA 4JZDH 2WUBA 2ZHQH 1TX6A 3FP6E 2PLXA 2BM2A 2ZU3A 2TGAA 2O8LA 4VGCC 2GX4A 2QF0A 5C2ZA 1E38B 2H9EH 1GJ6A 4JZFH 1TNLA 3QLPH 1QTFA 3MO3A 2HALA 1YC0A 3LC3A 1C2LA 1Z8JB 4A92A 1AGJA 4Y11E 3GCNA 3RMNH 1NM6A 1NRQH 1EQ9A 2W7UA 2HNTC 1XM1A 1UTQA 3RXAA 3IG6B 1P2QA 1PPEE 4BTUB 3ZZ4A 3QX5H 1GI2A 2AGEX 3ATLA 1RTLA 1V2ST 2P8OB 1GBKA 4GLYA 1O3CA 3OY6U 1SMFE 3RXFA 2B5TB 1VR1H 4Y8XA 3TGKE 3ZZDA 4UFEH 3VGCB 3VXFH 1YCPM 3SW2B 1P2KA 2BDCA 3C1KA 2BVRH 1O5BB 4GAWA 4GCHF 3T29A 1UVOA 4IN1A 5GWZA 4GUXA 4YLQH 2FS8A 1W10U 4NFEA 3SQEE 1BA8B 2C8YB 2XRCA 3U8TH 4UONA 3HKJB 1VITH 3P95A 2BZ6H 3ZZ5A 1MTWA 5PTPA 1RXPA 1F2SE 2OBOA 5EQRA 5LPRA 4D7FA 1GI1A 3MH6A 5A0CA 1GI4A 3D49H 3QZRA 3TGIE 3FFGA 4CRGA 1DDJA 2SGDE 4MNXA 2Y7ZA 2ZTYA 3QUMP 1F92A 1FLEE 4IW4E 3F9GA 4X6MA 5DGJA 1CA0B 4NA9H 1O3GA 3K9XB 1AE8H 1TALA 2DE8A 1SGYE 3A84A 3ZVGA 5CMXH 4ISNA 2JH0D 1HFDA 2IN2A 1JIMA 1D3PB 1LTOA 1P9SA 7GCHF 3C27B 1WCZA 3A81A 1RS0A 5A2MH 3M61U 2ZGHA 2ZA5A 5EG4A 4OGYA 1LCYA 3QZQA 2P94A 3VB6A 3PLKA 3SHAH 1UCYE 3RXGA 1MKWK 1L1GA 2WYJA 2FOEA 1UMAH 9ESTA 1O2UA 4NWLA 4JK6A 1UCYH 2AH4X 1XXFA 1SGPE 3EDXB 7ESTE 1GHWH 1QL7A 2ZNKH 1GCTB 1TFXA 1QL9A 2ZI2H 4MG3A 3F68H 5JB8S 1GVZA 2NU3E 2BX3A 1O5CB 2PTCE 1TNKA 1V6DA 2D26C 1W12U 2F9UA 2ZDNA 2GV6A 2H5CA 1FI8A 1DWEH 1C4U2 3UR6A 1O2RA 3SU4A 1S83A 3VGCC 4QT8C 4H6TA 1O3OA 3A86A 1GJ7B 2A32A 1HAVB 3RXKA 4PROA 4ABDA 5BPEA 5EPYA 6GCHF 4CRFA 3P8OA 2ZWLH 2Z94A 1DVAH 3DUXH 1QL8A 1Y3VA 3MMGA 2HRVA 3TNSA 2ESTE 1UHBB 3FANA 5HXFA 2DUCA 2XYAA 4OS4A 1FMGA 2NU1E 1KXAA 5ESBA 2FEQH 5F6MA 4YM9A 1K1LA 2OBQA 3VB3A 1KXBA 3SU1A 4ZXXH 1G30B 1J14A 3TJOA 3QTVH 4XOJA 3AAUA 1YYY1 1HJ8A 1V2VT 4BAKB 3U9AH 3BTWE 2BD3A 5ESTE 3EA9A 1O3PB 3MHWU 4JK5A 2PGBB 2ALVA 2O8MA 3HK3B 3O8RA 3SV7A 3TLOA 1BT7A 4NIWA 1DY8A 2UUJB 1D6RA 5CHAC 1OP8A 4BXSA 3D65E 1F0SA 1IQNA 2F9NA 1SGFA 1WBGB 2A2QH 3GOVB 2H6MA 1IQIA 3ODDA 3LU9B 1IQKA 8ESTE 4X6PA 2BD9A 2CJIA 3RM2H 3A8BA 5E2PA 3NK8A 4KTUA 1DE7H 2JKHA 5DP5A 1LPKB 1WYKA 1BJVA 2PTNA 1AO5A 2G51A 4ASHA 1C1SA 3SUFA 1SLWB 5A0AE 1Y5BT 3M5MA 4K1EA 2FIRH 1FV9A 4D7GA 2VWLA 1EKBB 1N8OC 4E7RG 8KME2 3V12A 2B9LA 3LT3A 4TWWA 1W7XH 4CRCA 4ZKRU 2W3IA 3D23A 5GXPA 3FAOA 4B76A 1DM4B 1ZPBA 2C93B 7GCHG 4YT6H 2ZDLA 2A31A 1AFQB 2Z3EA 4J2YB 4SGBE 1CO7E 1RRKA 3SUDA 3RXTA 4XSKU 1YKTA 3KN2A 4UDWH 1G3CA 4BXWA 1AVWA 2BDAA 2YNBA 1AI8H 1UHBA 1OWJA 5DPAA 1O3EA 4ZKOU 2AIQA 3P8FA 2FS9A 1TRYA 4E7NA 1B5GH 1ANDA 3LGVA 3PB1E 2SGEE 4BTIB 2QAAA 1WQVH 4O3TA 1ZMJA 2B7DH 2HOBA 3QDZB 2Y5HA 1GBJA 1HBTH 3RXHA 1J16A 2J34A 3I77A 2BZAA 3OSYA 1GDUA 2GV7A 1TNHA 2C90B 4X2XA 5SGAE 3ZZAA 2FDAA 3PO1C 2GZ7A 5C3NA 1A2CH 4E05H 5LPEA 1GBMA 1GL0E 5FX5A 3MH7A 4NIXA 3TH3H 2BDIA 1LKBA 2BD4A 1TRMA 1GBHA 1XXDA 1BBRK 1ETSH 1IHTH 2Y7XA 3AW0A 5EGMA 4AN7A 3U8RH 1ELFA 5FCKA 1S6HA 5GJ4B 3MU1A 3VEQB 1SGNE 4MPWA 4A5TS 1O2OA 1OWDA 2FX6A 1P9UA 2C8ZB 1C5RA 1MQ6A 4BAOB 4O03A 1CA0C 3GY3A 1G2MA 1KIGH 4K69A 4ISLA 1AWHB 1XKAC 2BOHB 2J2UA 5F8ZA 3QN7A 1BIOA 1K1JA 1AFQC 1QCPA 4B75A 3LJOA 3IITA 4IGDA 3UIRA 1SQTA 3BF6H 1BOQA 3M3VA 1QQUA 4NGAH 4Y79A 3KGPA 2AMQA 1ZTKA 3KF2A 4VGCB 4F4OC 4ZKSU 1JXPA 1NS3A 5EODA 3GCHB 1AD8H 3GCTG 2K1QA 3UR9A 4K3JA 1KXFA 1O2WA 1TX7A 1SFQB 1THSH 4B2AA 5DP3A 4YT7H 1CGIE 4FVDA 3PTBA 2A4RA 1MD8A 1TMBH 5TJXA 2ASUB 3SN8A 3DA9B 1K1PA 3PMJA 1F5LA 2BQWB 3BEFB 1O2ZA 2OINA 1SLUB 5EU8A 2QXIA 3LH3A 5FBIA 4BAQB 2DE9A 4Z0KA 3GICB 3PWCA 4DOQA 3RC6A 1PPZA 1VCWA 2P3TB 2WPMS 3SV2H 2JH6D 1P10A 1O2HA 1TGBA 3RXUA 5FHTA 4H42U 3PO1B 2BLVA 3AASA 5EQSA 5IYTA 3RXBA 1IQFA 3M5NA 1NZQH 4X1NU 3STIA 1V2WT 1AY6H 4WMDA 3SUGA 1GDNA 1C1TA 1F0TA 1PPBH 1TLDA 4X8VH 1A0JA 1O37A 2ANMH 4FUCA 4FUIA 4JZEH 2W7SA 1ABIH 2OLGA 4BOHA 5FAHA 1H9LB 4A1XA 1Y59T 2XXLA 2BD8A 2EI6A 4WXIA 1DLKB 1ZGIA 2A0QB 1OP0A 3EQ0H 3U69H 2ZO3H 1PPHE 2XBWA 3GYLB 4CRAA 1ZRKA 1T8LA 1O38A 1GMDF 3PWBA 1A0HB 2PUQH 3LGTA 4ZHMU 4YTAA 1QURH 1THRH 3SJKA 2FO9A 1BITA 1C5YB 2H5DA 3M5OA 1P57B 4ABIA 4FUJA 4XE4A 2BD7A 4ABJA 1KTSB 1O3KA 1W2KH 1S6FA 1Z1JA 1ZSJA 5JYIA 1DFPA 1XMNB 3JZ2B 3O8DA 1AB9C 3RC4A 1PQ5A 4DY7B 2GDEH 2ZHEH 3BIUH 1DWBH 3M5LA 1W0YH 3HGPA 1HIAA 1BHXB 1M9UA 4X8UH 4TYDA 2FXRA 1BBRE 1S0QA 1XX9A 3E8LA 3MNCA 3SQHE 3ZV9A 1Z6EA 1H1BA 3OY5U 3BTHE 1UTLM 1EX3A 3ITIA 1O2LA 2BMGB 1D4PB 3F9EA 3A8CA 2GTBA 1ELCA 2YOLA 3ZZCA 5HYOA 3RXQA 1GCDA 1TQ0B 2CGAA 1BMNH 2A5AA 3ZV8A 1HAPH 1HAGE 2P95A 3P70B 4X6NA 4H6SB 3F6UH 4UE7H 1T4UH 1A5HA 3MH4A 4K60A 2HVXA 2P3UB 1K22H 2LPRA 3MNBA 3Q77A 5L2ZH 1KDQA 2G81E 2ZG0H 5H4IB 1GMHF 2PKAB 1GJ5H 1MU8B 1FNIA 3MH5A 3LH1A 5AFZH 1TPAE 1ZPCA 4WJG2 1ELVA 2ZP0H 1TGTA 3RXJA 4Y10E 3SU6A 1CGJE 2ZU1A 2Z9KA 3M37A 2RG3A 1QY6A 2O8UA 1YPJH 3SNAA 4NFFA 1VITF 1Z1IA 2G4TA 2OC8A 1RGQA 1BTZA 2Y5FA 1ZPZA 1O35A 1UVPA 2VJ1A 3UNSA 1QQ4A 2ZPSA 1ELBA 3BEIB 4YOJA 4NG9H 1HAHH 4X8SH 1V3XA 1HPGA 1ZHRA 3JZ1B 3QGJA 5GDSH 1VJAU 2XCFA 2CF8H 3M3SA 5CE1A 4Y71A 1KSNA 1RIWC 3NXPA 5DJ7A 4AGJA 2SGFE 4CRDA 5K7RA 3M7UA 3S69A 1ZJKA 2WINI 4AZ2B 3SI3H 5G4BA 1EZXC 4FU7A 1AKSA 1QIXB 3BSQA 1AUJA 4K1SA 1EZUC 1BCUH 2VB0A 4AG2A 1C2JA 2BDYA 3P92A 2VGCC 1ANCA 1C1PA 1NRSH 1ANEA 1Y5UT 4NA7A 2JETC 3ZZ7A 1GHZA 1WV7H 1O5GH 4O3UA 1YPMH 1TABE 2FI5E 5DP7A 4B71A 4Y8ZA 4GCHG 3SU5A 2FOMB 2HPQH 4E06H 4Q2KA 2ZGJA 2A4QA 5TCCA 2J4IA 4Y7AA 4ESTE 4GHTA 1C5SA 4ABBA 1UVTH 1GI7B 4Q7YA 1H4WA 3LGUA 1PJPA 2A7HA 2BOKA 2WV5A 2IOTA 2A4GA 2PV9B 3A8AA 4YESB 2ZEBA 5A8XA 1C5OH 1KTTB 9LPRA 1ETTH 3VB5A 1CBWC 1EOLA 1Y3XA 2ZDMA 2PKAA 2ZFTA 1CQQA 3H7TA 1CT0E 5FPSA 1RIWB 4MPXA 1GBTA 1THPB 1BBRH 1MTNC 3RXLA 3SUEA 1IQMA 2IJOB 2A7JA 3RC5A 2Q1JA 1G2LA 1C1VH 3MI4A 1G9IE 1L4ZA 2ZFPH 3MO6A 4HZHA 1O2QA 1N6XA 2AMPA 1UJ1A 5J4SA 3TGJE 1DX5M 3S9AA 2OC0A 1UVUH 3L3TA 2STAE 2A45B 2GVFA 3RDZA 2WUCA 3TJNA 2AERH 1S81A 2CN0H 1MTUA 2ZECA 4ZHLU 1A3EH 4X1QU 3M36A 1Q31A 3D62A 5E0GA 1TYNA 1DWDH 1AWFH 1GCTC 4X2VA 3MYWA 1NESE 1YCPK 4AB9A 5FPYA 1HIAB 2OC7A 3ATMA 1C2GA 1C5UA 2RA3A 1NU7B 3A7ZA 1GG6C 1IHSH 4GSOA 4B2CA 1EUFA 1O34A 1P2MA 1XUIA 4UFGH 3LPRA 2QXGA 3LGWA 1Z8GA 3ZYDA 5LPFA 2F83A 4Y0YE 4DCDA 1D6WA 1BHXF 1C5TA 4TY6A 2W26A 2ZTXA 4CBOA 1BRCE 1YLCA 1F5RA 3P8GA 1MKXK 1J9CH 1TMTH 1A4WH 1SOTA 2GZ9A 2EA3A 1MBMA 1GI0A 2HNTF 3LGIA 3OU0A 3HGNA 4GHQA 2CV3A 1O3MA 4AFQA 1DWCH 2PW8H 2GT8A 5EXLA 2FOGA 1W3CA 3KL6A 2V35A 1SQOA 1GHBG 1F0RA 1PPGE 2QC2A 1SG8B 1P06A 3LGYA 2TRMA 3UREA 1QB6A 4XFQA 2Z9JA 4H4FA 1Z8RA 2WPHS 1QA7A 2CHAC 2FOBA 3U98H 4LOYH 1DOJA 2OXSA 3TJVA 4X2YA 3A82A 1YGCH 1EZQA 2PGQB 1SQAA 1V2QT 3SORA 3MU5A 1F7ZA 2CXVA 5EPNA 1OWKA 4D8NA 2WPKS 4THNH 1CHGA 4B2BA 4LZ1H 4CHAB 1MMJN 3E16B 2Z9LA 2M5TA 3MU4A 4X1SU 1JRTA 1V2MT 3TVJB 1TBZH 2TPIZ 1RD3B 3LONA 2ZFRH 3PM3A 3U1JB 3NCLA 4I7YH 1OOKB 1S82A 4FUHA 2GP9B 2P16A 3M3TA 3LOXA 1SGEE 1SR5C 4TWYA 1O2MA 4JZ1A 3BIVH 1P8VC 3TIUA 3GY2A 1JBUH 4B1TA 4JMYA 5GPIB 4Q7XA 2VVVA 3Q76A 1QB1A 2H2ZA 1C5ZB 4YZUA 1E35B 2Y80A 1FIZA 1C5LH 1XVMA 3KCGH 3F1SB 1L1JA 1C2DA 5HM2A 5AF9H 3LC5A 3S9CA 4K1TA 1P03A 1SGQE 1EP5A 1YF4A 3CP7A 2A5KA 4X2WA 2FYQA 1MBQA 4XDEA 3T28A 1Z8IB 3SV6A 2F9VA 5GCHF 3A83A 2OD3B 2JETB 1EAIA 2CHAB 3B8JA 5I25A 1C2EA 2PSYA 1UK2A 1GHXH 4AYYB 5IDKA 1KY9A 1S0RA 1V2PT 2ZU2A 1FY8E 2D1JA 4FUEA 4HFPB 3SGAE 1LHCH 1PYTD 4J1YA 1WTHD 1ACBE 2RA0A 4Z6AH 3DD2H 1YBWA 1TMUH 1O3AA 1YM0A 1TPOA 2GCHG 2ULLA 1DLEA 1TNJA 2GCHF 2FZZA 4Y7BA 4AOQA 6ESTA 3A8DA 1BRBE 2J92A 1N1LA 5T6DA 1TBRH 2C4FH 1GBLA 4OS6A 1DT2A 3M7TA 1OKXA 2ZHFH 3QK1A 4JYTA 2ANKH 2VNTA 2Q6FA 2J9NA 1FY1A 1ARBA 1V2LT 1ELEE 4AYVB 1QRXA 2KAIB 4BAMB 1BMAA 3ATWA 1YPKH 4RSPA 1XUJA 2F3CE 5JBCS 4JZIA 3SV8A 3ELAH 3ZVEA 2GD4B 3FP8E 4LXBH 1MTSA 4WY3A 3UFAA 1FQ3A 3SNDA 3UUZA 3GY6A 4OS5A 3I29A 3Q3KA 4YLUA 5F03A 4MPUA 3GY4A 4CBNA 1YPHC 4TPYA 3R0FA 1SOZA 3A87A 1KXCA 1SGCA 3A7TA 1NFYA 2TIOA 1SB1H 1TOMH 4NIYA 2Z6BD 1N8OB 2GMTC 2D2DA 3VXEH 1W11U 3GCHC 1HRTH 5JBBS 3BTTE 4I8KA 2PWXA 1EB2A 3GCOA 3PMAB 1Y8TA 2ZQ1A 1GPZA 2AFQB 1Q3XA 1GMDG 1O3JA 4CR9A 1HCGA 2YNAA 1UTJA 2FOCA 2V6NA 4WVPE 4TPIZ 1ELGA 1GJDB 3FZDA 4FU8A 3UOUA 1BUIA 3KQCA 4I8GA 1V2JT 1WUNH 4INHA 1GBFA 1OS8A 2OQ5A 2R3UA 3RMMH 3WY8A 1QJ6B 2Z9GA 4M7GA 3ZVBA 5EXNA 4ISOA 2H1UA 5C67A 3RUOA 3GDSA 1LVMA 3RMOH 1LPZB 4WH8A 1WAYB 1A5GH 4ZHAA 1GJ8B 1C1QA 2GZ8A 1OPHB 4OS2A 2G55A 2ODPA 3HPTB 4DVAU 2BY8X 5B6OA 1A0LA 2O9QA 1TA6A 2F9PA 1O3IA 3P17H 5ETXA 2P59A 2VINA 3KEEA 2STBE 5HGGA 2Y6TA 2ZQ2A 2XNIA 1HLTH 3GY5A 4DG4A 2GCTC 3KIDU 4LK4A 3O8BA 1FY4A 1D9IA 2A2XH 2FWWA 2R2WU 3SV9A 4MNVA 1JIRA 1P2JA 1A61H 3R3GB 3ZVDA 4A1VA 1DXPA 4X1PU 1UTNA 4K8BA 3W95A 3UY9A 4D76A 5JB9S 3L6PA 1CA8B 1LHEH 2XWBI 4I32A 5A8YA 1GJCB 2BVSH 1HDTH 3KNXA 4ZKNU 1GBEA 4AORA 3KQEA 1ELTA 2BXTH 1V2NT 2ZDKA 1HAVA 4Q7ZA 1KDQB 3E0PB 1TPSA 1OWIA 1GJ4H 5AFYH 3T5FH 1UTOA 1W7GH 5F8XA 2FYRA 3UPEA 1SGIB 3SJIA 1O3FA 1ZHPA 4U30A 4ABHA 4DURA 2ZCHP 1AVXA 1KLTA 4D9RA 1VCQA 1K9OE 3A7WA 4ZROA 4TY7A 2I6QA 1GBBA 4A7IB 1IOEA 1H8DH 1ZMLA 3NPSA 1V2TT 3RXRA 2ZCKP 4OS7A 1C5QA 2R3YA 2BX4A 3FVFB 1T32A 2QV1A 1RTFB 2NWNA 3PLBA 1O2IA 4IC6A 1T31A 2VH6A 1GVKB 1O3BA 2W3KA 1HAXB 3RU4T 7LPRA 2QF3A 2ZF0H 4NZQA 3A7YA 4I8JA 3GCTF 3HKIB 2V0BA 1OSSA 2SGAA 3RXCA 1NN6A 2XC5A 4SGAE 4F49A 2B0FA 2LNCA 1G32B 1OP2A 1EAWA 3K2UA 2BY7X 1JWTA 2Z3DA 2BTCE 2BVXH 1PQAA 1WTGH 1QB9A 4Q80A 3S7HB 2OC1A 4OGXA 2A7CA 3SU3A 1C1NA 1CT2E 4AFSA 3RU4E 2HWLB 5AVDA 2C8XB 1DUEA 2QA9E 2CMYA 3MNSA 2G4UA 1X7AC 1QRZA 2TGPZ 1ZMNA 1MUEB 1NPMA 2PR3A 2OP9A 2J95A 3Q00A 3RXEA 4ABFA 1WSSH 3TJUA 3RXIA 3RXSA 1B0FA 3NWUA 2AGIX 5A8ZA 5E8EH 3E1XB 3KQBA 2P3FH 2QY0B 2GMTB 5C5OA 4WMEA 1BTUA 3PMHB 4HGCA 2UWOA 1CT4E 3TK9A 1HJAB 1KXDA 4NWKA 3TU7H 4GVUA 1CHOG 1EOJA 1NROH 1KXEA 3H7OA 1W0ZU 1NU9A 5GCHG 1W14U 3ATIA 3A89A 1VCPA 1LHGH 2ZFFH 3MO9A 1MQ5A 1PFXC 5K0HA 1AB9B 1EJAA 3G01A 5JBTA 4X1RU 1SVPA 5DK1A 2F91A 1C2HA 1ZZZA 3K6YA 2UWLA 1WU1A 4BTTB 2Y5GA 1C2IA 2FP7B 3BTQE 3PLPA 1ESTA 1QNJA 3DFLA 3EA8A 1NTPA 5C1UA 1OWEA 2UUKB 4AX9H 1IQHA 2ZCLP 1TGSZ 2GCTB 3UTUH 2XBXA 1NC6A 1PQ7A 4WMFA 1L4DA 5TCAA 2AGGX 1ZGVA 4KTSA 4KTCA 1H9HE
chains in the Genus database with same CATH superfamily
1NT1A 1C9PA 4JYVH 1BMLA 1HYLA 1EZSC 4B73A 1BZXE 1GGDC 4I8LA 4XBCA 3PMBB 4IN2A 1AFEH 3AVZA 4CREA 3K65B 4X0WU 2WSSD 3DT0H 2EI7A 1O2YA 3SOSA 2XC4A 1G3EA 4FUBA 3T25A 1O32A 1VJ9U 4ZMAH 1O2KA 2ZGXH 4GPGA 4NCYA 2WV9A 2QCYA 3RLYH 2FTMA 1C5MD 1HAZB 3ZZ9A 1H8IH 1LO6A 3ZZBA 3FZZA 3I78A 3NUMA 1O30A 5FX6A 2K0QA 2FM2A 1YPGH 4YOIA 1HV7A 2SGQE 4DT7B 2ZHWH 1S85A 2NU0E 1EB1H 1P3CA 1C4V2 1W13U 1DICA 4ABAA 1AQ7A 5FPTA 7KMEH 1K28D 3U8OH 2VH0A 2C3SA 1E34B 1LVBA 1E1QD 2ALPA 3RP2A 3ZVCA 2BD5A 2ZU5A 4WXVA 1C9TA 1C1RA 1FN8A 2V3HH 2ZIQH 1S6LA 2HPPH 1FPCH 1Z6JH 1IQLA 4RT0A 4WWYA 3TNTA 5C1XA 1O3NA 1PPFE 2XC0A 1QFKH 3FKSD 2EC9H 2ZGCA 2ZGBH 1MU6B 4ACAA 1ZYOA 1NRRH 2V3OH 4ZH8A 2KCYA 1XKBC 1WOFA 2KAIA 1GDQA 3EGKH 1GMCF 1EXFA 1OXGA 4Y0ZE 8LPRA 1EPTC 3KQ5A 4CHAC 1DSTA 1GI8B 2TBSA 1GMCG 2AIPA 1GGDB 2J38A 4WH6A 2J94A 1HAOH 2UUFB 2D8WA 3MU0A 1EASA 1C5PA 1QRWA 4K5ZA 3M7QA 3BG8A 4DIHH 2ODYB 1O2XA 1LKAA 3B9FH 1SPJA 1EAXA 1C2FA 2NU4E 3PROA 2BY5X 2PKSB 1L1NA 4ZXYH 4AB8A 1O33A 3HATH 1EP6A 4MTBA 4FUFA 1TX8A 2GGVB 1K1MA 1A5IA 1SGTA 3A88A 1D3TB 4K8YA 4NSYA 3SHCH 1XUHA 2BDGA 2VWMA 1K1IA 1ZSKA 3T27A 3T62A 4AFUA 1GBAA 3ATKA 2V7QD 4IC5A 3T26A 1PYTC 1H8ED 1ID5H 1NRNH 1T4VH 3SBKA 1P12E 2XBYA 3UNRA 3SO3A 4HI3A 4FUGA 1C4Y2 2OK5A 1P2IA 2ZHDA 1EAUA 1AVGH 2ZPRA 2VBCA 2FODA 1C5VA 4R8TB 2F9BH 1DPOA 3QWCH 6LPRA 4RKJB 5A09A 2F4LA 1LQEA 3K6ZA 4ASUD 1GBCA 2XBVA 1HJ9A 2B8OH 3BN9A 4UFDH 5FBEA 4INLA 2PP6A 2C8WB 2ZFQH 1HAIH 3TH4H 1O5EH 5T6GA 4KELA 1FXYA 3SJOA 1ANBA 1O2NA 4NSVA 3BTME 1TWXB 1GHVH 1IQGA 4FXGH 1SLVB 3GY7A 2XWAA 1L0ZA 2ZU4A 1TQ7B 1Z7KA 2HGTH 2Y81A 3V7TA 1NO9H 2PKSC 1FONA 4MDSA 2Z9IA 2EY4C 2ZZUH 1CU1A 3GDVA 3LDXH 4HTCH 1ZJDA 4IMQA 1C2MA 1LVYA 2FTLE 3M35A 4AGKA 1VZQH 3STJA 1O5FH 4MPVA 1INCA 3RXVA 5FCRA 4ZAEA 3ZVAA 5DO4H 3RXPA 5JPMH 1MZAA 5T1VA 2Q6GA 1O2GH 1DSUA 2R9PA 3UB0A 2FOFA 1HXEH 1YP9A 1Q2WA 2FPZA 1A7SA 1BQYA 5C20A 1O39A 4KP0A 2THFB 4DW2U 3DSPA 3EYDA 5HM9A 1N6YA 1SSXA 2BY6X 1TA2A 1C5XB 1P2NA 1MCVA 1AZZA 2G00A 2IPHA 3RU4D 2SNVA 1J15A 2VIPA 1ESAA 4Y8YA 1VITG 1COWD 2KM0A 1O2JA 1O2SA 3A7XA 4MNWA 1Y5AT 1YPHE 1GBIA 3VPKA 2WPLS 5EW1H 3SNBA 1MTNB 2W5EA 1NFUA 1KMHB 4IBLH 3URDA 2AS9A 1TRNA 2FLBH 1Y3WA 3SGBE 3SYJA 1EJMA 2ZDVH 3RXOA 2ZKSA 2F43B 1WDIA 5C5NA 1CGHA 1SC8U 3MQKC 1P09A 4UFFH 1BTXA 2FX4A 1F0UA 1EPTA 1UK4A 1XUFA 2RDEA 1TAWA 3E6PH 2BDHA 3F3BA 1SGDE 2VVCA 5DKMA 5EQQA 2XCNA 5F53A 1ELAA 5I46H 1UO6A 5CHAB 5GNDA 2VIVA 2A1DB 1SGFG 5ABWA 4FETA 5E0JA 1ORFA 1TOCB 2EI8A 1K2I1 5LGOA 1A3BH 1SL3A 1QJ7B 3W94A 1BRUP 5T6FA 1E0FD 1YCPH 1SBWA 5DP4A 3MNXA 3GYMA 1MAYA 2R2MB 1NRPH 3ZZ3A 1ZRBA 6CHAC 1K1NA 5DP6A 4K2YA 1GVLA 2ODQA 3LJJA 3FP7E 1O31A 2G52A 1AIXH 4KGAA 1QBOA 2FLRH 5DG6A 4MVNA 1GL1A 3UQVA 4XBBA 4AG1A 1K1OA 4FU9A 1FY3A 2ZTZA 2FESH 1SLXB 2CF9H 3SNEA 3SZEA 2KFWA 3ZZ6A 3E91A 1P04A 2I6SA 8GCHF 2VVUA 4I8HA 3UQOA 1AZ8A 1GWAA 1YY3A 4ZUHA 3UOPA 3ZIAD 1XVOA 1IAUA 3LIWA 3EAJA 4XD7D 1JOUB 1C1MA 2QIQA 3V3MA 5L6NH 1GI5A 4A6LA 4Y76A 1TIOA 4IS5A 4OS1A 1C2KA 5JDUB 5GIBA 1C5WB 1Z71A 1BRAA 4ABGA 4RN6A 1NY22 2TGTA 3GISB 4UD9H 1O0DH 3SJ9A 2H9TH 2OCVB 1BTYA 1HNEE 2QN5T 1ZOMA 2VWNA 2VU8E 3CS0A 1V2KT 4FVBA 2XW9A 1DUAA 4JYUH 1BMMH 3BTKE 4DGJA 5KEDA 2GKVE 2QGRA 1D3QB 4I31A 3N99A 5FL7D 4DJZB 1GHYH 4FOUC 1KYNA 2RDLA 4YOGA 5C1YA 4CH2B 1YPEH 3P6ZB 4U01A 1O3LA 1ZSLA 2FOHA 2P8OC 1FN6A 3MOCA 3UWIA 3S0NA 4Y6DA 1U6QA 3NKKA 4KKDA 1UCYK 1O3HA 1TE0A 1G36A 3WWFA 1TGCA 5IK2D 1O2PA 3S9BA 1ZLRA 3TITA 3MFJA 3MTYA 1TNGA 6GCHG 1MKWH 1EJNA 1OYTH 5LH8A 1IQEA 1MD7A 3P8NA 3VB7A 2GDDA 2O8WA 2BLOA 3SU0A 1AN1E 4Q4LA 3ZZ8A 2Q6DA 1NFXA 2P93A 1OX1A 1LPGB 3SGQE 3SI4H 1QHRB 2WPDD 2L74A 4MQAA 1BJUA 2ZDAH 3BTGE 1TB6H 1GHBF 1LHFH 2R0LA 1QBNA 3RXDA 1P0SH 3E90B 4FUDA 2JIZD 5L30H 5B6LA 1E37B 1SHYA 3KYFA 1QA0A 1W8BH 4D9QA 5EIYA 1AE5A 1PPCE 2BDBA 1RFNA 1FAXA 1P01A 2SGPE 1HGTH 1RJXB 2UUYA 1GI6A 1OWHA 3E0NB 5L2YH 3TK5A 2PSXA 2VIOA 1LVOA 1D3DB 3ZVFA 1ZTLA 3TK6A 1XUGA 3SJ8A 2UWPA 2WYGA 2OQUA 1ESBA 1HB0B 4R0IA 2G5NA 1MH0A 1GJ9B 4X8TH 3F9HA 1C1UH 3CENA 4UEHH 2BB4A 3H5CB 2ZPQA 4BAHB 3URCA 4BANB 4BNRA 3E3TA 1CVWH 1VGCB 4DT4A 1FJSA 1O5AB 1DANH 3DHKH 3BEUA 4LZ4B 3OAAD 1AKSB 2PHBA 5HMAA 3GS9A 2HLCA 3TPIZ 2QXJA 1E36B 2VGCB 1FDPA 4IMZA 1Y3UA 1AUTC 1C1OA 3ESTA 3ODFA 1RTKA 2BY9X 3NRLA 1T8MA 4DIIH 4U2WA 1LQDB 1B0EA 1BB0B 1C5NH 2G5VA 1HXFH 3AAVA 3NZIA 1O36A 5A0BA 2F9OA 1ZR0A 1ELDE 1QBVH 2ANWA 1OYQA 1IQJA 2BD2A 2O8TA 1K21H 1XUKA 4ISIH 8GCHG 1G37A 1PQ8A 3QTOH 3BG4C 2EEKA 1GMHG 2SNWA 2SFAA 1J8AA 1GBDA 1YLDA 3VFEA 2BLQA 3QO6A 3RM0H 3Q3YA 1MKXH 1WQSA 2ZC9H 4I33A 1S5SA 3S7KB 2BXUH 1GHAF 1F5KU 1DITH 1TNIA 2WPIS 2BQ7B 3A85A 2VIQA 4B74A 3PTNA 2FI3E 3BTDE 3O8CA 3T2NA 1TBQH 1QJ1B 2ZFSA 1NFWA 1AMHA 3OX7U 2OTVA 2G8TA 3L33A 1VGCC 1H9IE 2Z3CA 4X6OA 2FI4E 4O9VA 2NU2E 3OTJE 3V13A 1S84A 2JH5D 1LMWB 2PFEA 1KLIH 5AHGH 1Y3YA 1L2EA 1P2OA 2RCEA 2WPJS 2A4OA 4XBDA 1FAKH 1P02A 1UTMA 2ANYA 1MTVA 2BYAX 2XOKD 5DP9A 2TGDA 1FZZA 1G3DA 1MCTA 3V0XA 2HNTE 4MNYA 3Q3XA 3UNQA 1CSOE 1EATA 4RKOB 3IWMA 1GG6B 1UVSH 3A7VA 1V2UT 1O2TA 3VB4A 1DXWA 3U1IB 3BG4B 2BQ6B 1LHDH 1UTKA 1W0KD 5J4QA 5DP8A 1ZTJA 3TH2H 1BTPA 2AEIH 1HJAC 1A46H 5T3HA 2BHGA 1MAXA 1P3EA 1GJBB 1P11E 2AMDA 1O3DA 4HG6A 1T7CA 1FY5A 1GI9B 4CH8B 2Y82A 5F8TA 4JCNA 2AYWA 4NZLA 5FXLA 3DFJA 3ENSB 4WF8A 2FOAA 3MWIU 4INKA 5BRRE 1V2OT 3RXMA 2VIDA 1AU8A 1EPTB 3SZNA 4NIVA 1B7XB 1AHTH 1CHOF 4AFZA 1JMOH 2H9HA 3MU8A 2A5IA 3LKWA 5EXMA 2PUXB 2QXHA 3QGNB 3RMLH 3F2FA 1BTHH 1SI5H 3ZYEA 3BTEE 3BV9B 5EJZA 1J17T 1ABJH 3EE0B 3CS7A 3GY8A 3RLWH 3GDUA 1SHHB 2GT7A 2R0KA 3SNCA 3BTFE 2BLWA 1SFIA 1T8OA 4CR5A 1TPPA 3PYHA 1TONA 1DS2E 1KLJH 1GI3A 5HKKD 1SGRE 3AW1A 4CRBA 3PV4A 1ETRH 1BDAA 1G3BA 1BTWA 5E0HA 1HUTH 1GJAB 1UTPA 1CE5A 1O5DH 1JRSA 1FPHH 1HAYB 3SU2A 5EW2H 3HK6B 4TSFD 1T8NA 2OUAA 6CHAB 1FUJA 2WV4A 1QGFA 2RFKC 3KQDA 3W1EA 1O2VA 2Z7FE 1TGNA 3A80A 5JBAS 3UWJH 3OYPA 4U32A 1ZHMA 5E2OA 2ILNA 1C1WH 1FIWA 4YO9A 1ARCA 1LDTT 1MZDA 1YPLH 4O97A 2VWOA 2KZ4A 1P05A 1UK3A 1DY9A 2CK3D 1QR3E 3EA7A 4NA8A 2HVYB 5EOKA 2QYIA 3KHVA 1A1RA 4A1TA 3N7OA 2XTTB 2VIWA 1V2RT 3F9FA 4ABEA 1GHAG 3B23B 4MLFB 1CBWB 4ISHH 2FMJA 4JZDH 2WUBA 2ZHQH 1TX6A 3FP6E 2PLXA 2BM2A 2ZU3A 2TGAA 2O8LA 4VGCC 2GX4A 2QF0A 5C2ZA 1E38B 2H9EH 1GJ6A 4JZFH 1TNLA 3QLPH 1QTFA 3MO3A 2HALA 1YC0A 3LC3A 1C2LA 1Z8JB 4A92A 1AGJA 4Y11E 3GCNA 3RMNH 1NM6A 1NRQH 1EQ9A 2W7UA 3H09A 2HNTC 1W0JD 1XM1A 4RI0A 1UTQA 3RXAA 3IG6B 1P2QA 1PPEE 4BTUB 2QF4A 3ZZ4A 3QX5H 1GI2A 2K8IA 2AGEX 3ATLA 1RTLA 1V2ST 2P8OB 1GBKA 4GLYA 1O3CA 3OY6U 1SMFE 3RXFA 2B5TB 1VR1H 4Y8XA 1EFRD 3TGKE 3ZZDA 4UFEH 3VGCB 3VXFH 1YCPM 3SW2B 2IJD1 1P2KA 2BDCA 3C1KA 2BVRH 1O5BB 4GAWA 4GCHF 3T29A 1UVOA 4IN1A 5GWZA 4GUXA 4YLQH 2FS8A 1W10U 4NFEA 3SQEE 1BA8B 2C8YB 2XRCA 3U8TH 2M2AA 4UONA 3HKJB 1VITH 3P95A 2BZ6H 3ZZ5A 1MTWA 5PTPA 1RXPA 1F2SE 2OBOA 5EQRA 5LPRA 4D7FA 1GI1A 3MH6A 5A0CA 1GI4A 3D49H 3QZRA 3TGIE 3FFGA 4CRGA 1DDJA 2SGDE 4MNXA 2Y7ZA 2ZTYA 3QUMP 1F92A 4ZCNA 1FLEE 4IW4E 3F9GA 4X6MA 5DGJA 1CA0B 4NA9H 1O3GA 3K9XB 1AE8H 1TALA 2DE8A 1SGYE 3A84A 3ZVGA 5CMXH 4ISNA 2JH0D 1HFDA 2IN2A 1JIMA 1D3PB 1LTOA 1P9SA 7GCHF 3C27B 1WCZA 3A81A 1RS0A 5A2MH 3M61U 2JJ1D 2ZGHA 2ZA5A 5EG4A 4OGYA 1LCYA 3QZQA 5KGOA 2KCPA 2P94A 3VB6A 3PLKA 3SHAH 1UCYE 3RXGA 1MKWK 1L1GA 2WYJA 2FOEA 1UMAH 3PRBA 9ESTA 1O2UA 4NWLA 1E1RD 4JK6A 1UCYH 2AH4X 1XXFA 1SGPE 2JJ2D 3EDXB 7ESTE 1GHWH 1QL7A 2ZNKH 1GCTB 1TFXA 1QL9A 2ZI2H 4MG3A 3F68H 5JB8S 1GVZA 2NU3E 2BX3A 1O5CB 2PTCE 1TNKA 1V6DA 2D26C 1W12U 2F9UA 2ZDNA 2GV6A 2H5CA 1FI8A 1DWEH 1C4U2 3UR6A 1O2RA 3SU4A 1S83A 2KX4A 3VGCC 4QT8C 4H6TA 1O3OA 3A86A 1H8HD 1GJ7B 2A32A 1HAVB 2W6JD 3RXKA 4PROA 4ABDA 5BPEA 3UAIC 5EPYA 6GCHF 4CRFA 3P8OA 2ZWLH 2Z94A 1DVAH 3DUXH 1QL8A 1Y3VA 3MMGA 2HRVA 3TNSA 2ESTE 1UHBB 3FANA 5HXFA 2DUCA 2XYAA 4OS4A 1FMGA 2NU1E 1KXAA 5ESBA 2FEQH 5F6MA 4YM9A 1K1LA 2OBQA 3VB3A 3F0OA 1KXBA 3SU1A 4ZXXH 1G30B 1J14A 4AC9A 2V3MA 3QTVH 3TJOA 4XOJA 3AAUA 1YYY1 1HJ8A 1V2VT 4BAKB 3U9AH 3BTWE 2BD3A 5ESTE 3EA9A 1O3PB 3MHWU 4JK5A 2PGBB 2ALVA 2J98B 2O8MA 3HK3B 3O8RA 3SV7A 3TLOA 1BT7A 4NIWA 1DY8A 2UUJB 1D6RA 5CHAC 1OP8A 4BXSA 3D65E 1F0SA 1IQNA 2F9NA 1SGFA 1WBGB 2A2QH 3GOVB 2H6MA 1IQIA 3ODDA 3LU9B 1IQKA 8ESTE 4X6PA 2BD9A 2CJIA 3RM2H 3A8BA 5E2PA 3NK8A 4KTUA 1DE7H 2YMSC 2JKHA 5DP5A 1LPKB 3OFND 1WYKA 1BJVA 2PTNA 1AO5A 2G51A 4ASHA 1C1SA 3SUFA 5C0TA 1SLWB 5A0AE 1Y5BT 2JDID 3M5MA 4K1EA 2FIRH 1FV9A 2XNDD 4D7GA 2VWLA 1EKBB 1N8OC 3N7DA 4E7RG 8KME2 3V12A 2B9LA 3LT3A 4TWWA 1W7XH 4CRCA 4ZKRU 2W3IA 3D23A 5GXPA 3FAOA 4B76A 1DM4B 1ZPBA 2C93B 7GCHG 4YT6H 2ZDLA 2A31A 1AFQB 2Z3EA 4J2YB 4SGBE 1CO7E 1RRKA 3SUDA 3RXTA 4XSKU 1YKTA 3KN2A 4UDWH 1G3CA 4BXWA 1YWUA 1AVWA 2BDAA 2YNBA 1AI8H 1UHBA 1OWJA 5DPAA 1O3EA 4ZKOU 2AIQA 3P8FA 2FS9A 1TRYA 4E7NA 1B5GH 1ANDA 3LGVA 3PB1E 2SGEE 4BTIB 2QAAA 1WQVH 4O3TA 1ZMJA 2B7DH 2HOBA 3QDZB 2Y5HA 1GBJA 1HBTH 3RXHA 4RT1A 1J16A 2J34A 3I77A 2BZAA 3OSYA 1GDUA 2GV7A 1TNHA 2C90B 4X2XA 5SGAE 3ZZAA 2FDAA 3PO1C 2GZ7A 5C3NA 1A2CH 4E05H 5LPEA 1GBMA 1GL0E 5FX5A 3MH7A 4NIXA 4P02A 3TH3H 2BDIA 1LKBA 2BD4A 1TRMA 1GBHA 1XXDA 1UW7A 1BBRK 1ETSH 1IHTH 2Y7XA 3AW0A 5EGMA 3OEHD 4AN7A 3U8RH 5HIZA 5EJLA 1ELFA 5FCKA 1S6HA 5GJ4B 3MU1A 3VEQB 1SGNE 4MPWA 4A5TS 1O2OA 1OWDA 2FX6A 1P9UA 2C8ZB 1C5RA 1MQ6A 4BAOB 4O03A 1CA0C 3GY3A 1G2MA 1KIGH 4K69A 4ISLA 1AWHB 1XKAC 2BOHB 2J2UA 5F8ZA 3QN7A 1BIOA 1K1JA 1AFQC 1QCPA 4B75A 3LJOA 3IITA 4IGDA 3UIRA 1SQTA 3BF6H 1BOQA 3M3VA 1QQUA 4NGAH 4Y79A 3KGPA 2AMQA 1ZTKA 3KF2A 4VGCB 1MABB 4F4OC 4F48B 4ZKSU 1JXPA 1NS3A 1FX0B 5EODA 3GCHB 1AD8H 3GCTG 2K1QA 3UR9A 4K3JA 1KXFA 1O2WA 1TX7A 1SFQB 1THSH 1VKYA 4B2AA 5DP3A 4YT7H 1CGIE 4FVDA 3PTBA 2A4RA 1MD8A 1TMBH 5TJXA 2ASUB 3SN8A 3DA9B 1K1PA 3PMJA 1F5LA 2BQWB 3BEFB 3FN8A 1O2ZA 2OINA 1SLUB 5EU8A 2QXIA 3LH3A 5FBIA 4BAQB 2DE9A 4Z0KA 3GICB 3PWCA 4DOQA 3RC6A 1PPZA 1VCWA 2P3TB 2WPMS 3SV2H 2JH6D 1P10A 1O2HA 1TGBA 3RXUA 5FHTA 2J98A 4H42U 3PV5A 3PO1B 2BLVA 3AASA 5EQSA 5IYTA 3RXBA 1IQFA 3M5NA 1NZQH 4X1NU 3STIA 1V2WT 1AY6H 4WMDA 3SUGA 1GDNA 1C1TA 1F0TA 5C0UA 1PPBH 4OM9A 1TLDA 4X8VH 3N7EA 1A0JA 1O37A 2ANMH 4FUCA 4FUIA 4JZEH 2W7SA 1ABIH 2OLGA 4BOHA 5FAHA 1H9LB 4A1XA 1Y59T 2XXLA 2BD8A 2EI6A 4WXIA 1DLKB 1ZGIA 2A0QB 1OP0A 3EQ0H 3U69H 2ZO3H 1PPHE 2XBWA 3GYLB 4CRAA 3PRDA 3OEED 1ZRKA 1T8LA 1O38A 1GMDF 3PWBA 1A0HB 2PUQH 3LGTA 4ZHMU 4YTAA 1QURH 1THRH 3SJKA 2FO9A 1BITA 3WW7A 1C5YB 2H5DA 3M5OA 1P57B 4ABIA 4FUJA 4XE4A 2BD7A 4ABJA 1KTSB 1O3KA 1W2KH 1S6FA 1Z1JA 1ZSJA 5JYIA 1DFPA 1XMNB 3JZ2B 3O8DA 4B6FA 1AB9C 3RC4A 1PQ5A 1NBMD 4DY7B 2GDEH 2ZHEH 3BIUH 1DWBH 3M5LA 1W0YH 3HGPA 1HIAA 1BHXB 1M9UA 4X8UH 4TYDA 2KCOA 2FXRA 1BBRE 1S0QA 1XX9A 3E8LA 3MNCA 3SQHE 3ZV9A 1Z6EA 1H1BA 3OY5U 3BTHE 1UTLM 1EX3A 3ITIA 3AK5A 1O2LA 2BMGB 1D4PB 3F9EA 3A8CA 2GTBA 1ELCA 2YOLA 3ZZCA 5HYOA 3RXQA 1GCDA 1TQ0B 2CGAA 1BMNH 2A5AA 3ZV8A 1HAPH 1HAGE 2P95A 3P70B 4X6NA 4H6SB 3F6UH 4UE7H 2LELA 1T4UH 5HIYA 1A5HA 3MH4A 4K60A 2HVXA 2P3UB 1K22H 2LPRA 3MNBA 2GJGA 3Q77A 1KDQA 2G81E 2ZG0H 5L2ZH 5H4IB 1GMHF 2PKAB 1GJ5H 1MU8B 3FOAA 1FNIA 3MH5A 3LH1A 5AFZH 1TPAE 1ZPCA 2EQNA 1SKYE 1ELVA 4WJG2 2ZP0H 1TGTA 3RXJA 3DSOA 4Y10E 3SU6A 1CGJE 2ZU1A 2Z9KA 3M37A 2RG3A 2J5UA 1QY6A 1NBME 2O8UA 1YPJH 3U28C 3SNAA 4NFFA 1VITF 1Z1IA 2G4TA 2OC8A 1OHHD 1RGQA 1BTZA 2Y5FA 1ZPZA 1O35A 1UVPA 2VJ1A 3UNSA 1QQ4A 2ZPSA 3PV2A 1ELBA 4M9FA 3BEIB 4YOJA 4NG9H 3F2GA 1HAHH 4X8SH 1V3XA 1HPGA 1ZHRA 3JZ1B 3QGJA 5GDSH 1VJAU 2CF8H 2XCFA 3M3SA 5CE1A 4Y71A 1KSNA 1RIWC 3NXPA 5DJ7A 4AGJA 2SGFE 4CRDA 5K7RA 3M7UA 1YLNA 3S69A 1ZJKA 2WINI 4AZ2B 3SI3H 5G4BA 1EZXC 4FU7A 1AKSA 1QIXB 3BSQA 1AUJA 4K1SA 1EZUC 1BCUH 2VB0A 4AG2A 1C2JA 2BDYA 3P92A 1SQRA 2VGCC 1ANCA 1C1PA 1NRSH 1ANEA 1Y5UT 4NA7A 2JETC 3ZZ7A 1GHZA 1WV7H 1O5GH 4O3UA 1YPMH 1TABE 2FI5E 5DP7A 4B71A 4Y8ZA 4GCHG 3SU5A 2LP6A 2FOMB 2HPQH 4E06H 4Q2KA 2ZGJA 3EE7A 2A4QA 5TCCA 2J4IA 4Y7AA 1WXRA 4ESTE 4GHTA 1C5SA 2KR7A 4ABBA 1UVTH 1GI7B 4Q7YA 1H4WA 3LGUA 3DSGA 1PJPA 2A7HA 2BOKA 2WV5A 2IOTA 2A4GA 2PV9B 3A8AA 4YESB 2ZEBA 5A8XA 1C5OH 3FO8D 1KTTB 9LPRA 1ETTH 3VB5A 1CBWC 1EOLA 1Y3XA 2ZDMA 2PKAA 2ZFTA 1CQQA 3H7TA 1CT0E 5FPSA 1RIWB 4MPXA 1GBTA 1THPB 1BBRH 1MTNC 3RXLA 3SUEA 1IQMA 2IJOB 2A7JA 3RC5A 2Q1JA 1G2LA 1C1VH 3MI4A 1G9IE 1L4ZA 2ZFPH 3MO6A 4HZHA 1O2QA 1N6XA 2AMPA 1UJ1A 5J4SA 3TGJE 1DX5M 3S9AA 2OC0A 1UVUH 3L3TA 2STAE 2A45B 2GVFA 3RDZA 2WUCA 3TJNA 2AERH 1S81A 2CN0H 1MTUA 2ZECA 4ZHLU 1A3EH 4X1QU 3M36A 1Q31A 3D62A 5E0GA 1TYNA 1DWDH 1AWFH 1GCTC 4X2VA 3MYWA 1NESE 1YCPK 4AB9A 5FPYA 1HIAB 2OC7A 3ATMA 1C2GA 1C5UA 2RA3A 4ACBA 1NU7B 3A7ZA 1GG6C 1IHSH 4GSOA 4B2CA 1EUFA 1O34A 1P2MA 1XUIA 5DN6D 4UFGH 3LPRA 2QXGA 3LGWA 1Z8GA 3ZYDA 5LPFA 2F83A 4Y0YE 4DCDA 1D6WA 1BHXF 1C5TA 4TY6A 2W26A 2ZTXA 4CBOA 1BRCE 4Z1MD 1YLCA 1F5RA 3P8GA 1MKXK 4YXWD 1J9CH 1TMTH 1A4WH 1SOTA 2GZ9A 2EA3A 1MBMA 1GI0A 2HNTF 3LGIA 3OU0A 3HGNA 4GHQA 2CV3A 1O3MA 4AFQA 1DWCH 2WHXA 2PW8H 2GT8A 5EXLA 3OTPA 2FOGA 1W3CA 3KL6A 2V35A 1SQOA 1GHBG 1F0RA 1PPGE 2QC2A 1SG8B 1P06A 3LGYA 2TRMA 2HLDD 3UREA 1QB6A 4XFQA 2Z9JA 4H4FA 1Z8RA 2WPHS 1QA7A 2CHAC 2FOBA 3U98H 4LOYH 1DOJA 2OXSA 3TJVA 4X2YA 3A82A 1YGCH 1EZQA 2PGQB 1SQAA 1V2QT 3SORA 5DSFA 3MU5A 1F7ZA 2CXVA 5EPNA 1OWKA 4D8NA 4TT3D 1BMFD 2WPKS 4THNH 1CHGA 4B2BA 4LZ1H 4CHAB 1MMJN 3E16B 2Z9LA 2M5TA 3MU4A 4X1SU 1JRTA 1V2MT 3TVJB 1TBZH 2TPIZ 1RD3B 3LONA 2ZFRH 3PM3A 3U1JB 3NCLA 4I7YH 1OOKB 3VG8A 1S82A 3OE7D 4FUHA 2GP9B 2YMSB 2P16A 3M3TA 3LOXA 1SGEE 4B6EA 1SR5C 4TWYA 1O2MA 4JZ1A 3BIVH 1P8VC 3TIUA 3GY2A 2YMSD 1JBUH 4B1TA 4JMYA 5GPIB 4Q7XA 2VVVA 3Q76A 1QB1A 2H2ZA 1C5ZB 4YZUA 1E35B 2Y80A 1FIZA 1C5LH 1XVMA 3KCGH 3DCLA 3F1SB 1L1JA 1C2DA 5HM2A 5AF9H 3F0PA 3LC5A 3S9CA 4K1TA 1P03A 1SGQE 1EP5A 1YF4A 3CP7A 2A5KA 4X2WA 2FYQA 1MBQA 4XDEA 3T28A 1Z8IB 3SV6A 2F9VA 5GCHF 3A83A 2OD3B 2JETB 1EAIA 2CHAB 3B8JA 5I25A 1K0HA 1C2EA 2PSYA 1UK2A 1GHXH 4AYYB 5IDKA 1KY9A 1S0RA 5EJ1A 1V2PT 2ZU2A 1FY8E 5KECA 2D1JA 4FUEA 4HFPB 3SGAE 1LHCH 1PYTD 4J1YA 1WTHD 1ACBE 2RA0A 4Z6AH 3DD2H 1YBWA 1TMUH 1O3AA 1YM0A 1TPOA 2GCHG 2ULLA 1DLEA 1TNJA 2GCHF 2FZZA 4Y7BA 4AOQA 6ESTA 3A8DA 1BRBE 2J92A 1N1LA 5T6DA 1TBRH 2C4FH 1GBLA 4OS6A 1DT2A 3M7TA 1OKXA 2ZHFH 3QK1A 4JYTA 2ANKH 2VNTA 2Q6FA 2J9NA 1FY1A 1ARBA 1V2LT 1ELEE 4AYVB 1QRXA 2KAIB 4BAMB 1BMAA 5CHBA 3ATWA 1YPKH 4RSPA 1XUJA 2F3CE 5JBCS 4JZIA 3SV8A 3ELAH 3ZVEA 2GD4B 3FP8E 4LXBH 1MTSA 4WY3A 3UFAA 1FQ3A 3SNDA 3UUZA 3GY6A 4OS5A 3I29A 3Q3KA 4YLUA 3F2HA 5F03A 4MPUA 3GY4A 4CBNA 1YPHC 4TPYA 3R0FA 1SOZA 3A87A 1KXCA 1SGCA 3A7TA 1NFYA 2TIOA 1SB1H 1TOMH 4NIYA 2Z6BD 1N8OB 2GMTC 2D2DA 3VXEH 1W11U 3GCHC 1HRTH 5JBBS 3BTTE 4I8KA 2PWXA 1EB2A 3GCOA 3PMAB 1Y8TA 2ZQ1A 1GPZA 2AFQB 1Q3XA 1GMDG 1O3JA 4CR9A 1HCGA 2YNAA 1UTJA 2FOCA 2QF5A 2V6NA 4WVPE 4TPIZ 1ELGA 1GJDB 3FZDA 4FU8A 3UOUA 1BUIA 3KQCA 4I8GA 1V2JT 1WUNH 4INHA 2R3UA 1GBFA 1OS8A 2OQ5A 3WWBA 3RMMH 3WY8A 1QJ6B 2Z9GA 4M7GA 3ZVBA 5EXNA 4ISOA 2H1UA 5C67A 3RUOA 3GDSA 1LVMA 3RMOH 1LPZB 4WH8A 1WAYB 1A5GH 4ZHAA 1GJ8B 1E79D 1C1QA 2GZ8A 1OPHB 4OS2A 2G55A 2ODPA 3HPTB 4DVAU 2BY8X 5B6OA 1A0LA 2O9QA 1TA6A 2F9PA 1O3IA 3P17H 5ETXA 2P59A 2VINA 3KEEA 2STBE 5HGGA 2Y6TA 2ZQ2A 2XNIA 1HLTH 3GY5A 4DG4A 2GCTC 3KIDU 4LK4A 3O8BA 1FY4A 1D9IA 2A2XH 2FWWA 2R2WU 3SV9A 4MNVA 1JIRA 1P2JA 1A61H 3R3GB 3ZVDA 4A1VA 1DXPA 4X1PU 1UTNA 4K8BA 3W95A 3UY9A 4D76A 5JB9S 3L6PA 1CA8B 1LHEH 2XWBI 4I32A 5A8YA 1GJCB 2BVSH 1HDTH 3KNXA 4ZKNU 1GBEA 4AORA 3KQEA 1ELTA 2BXTH 1V2NT 2ZDKA 5C17A 1QZ8A 1HAVA 2W6ID 4Q7ZA 1KDQB 3E0PB 1TPSA 1OWIA 1GJ4H 5AFYH 3T5FH 1UTOA 1W7GH 5F8XA 2FYRA 3UPEA 1SGIB 3SJIA 1O3FA 1ZHPA 3KYGA 4U30A 4ABHA 2IPQX 4DURA 2ZCHP 1AVXA 1KLTA 2J97A 4D9RA 1VCQA 1K9OE 3A7WA 4ZROA 4TY7A 2AHME 1GBBA 2I6QA 4A7IB 1IOEA 1H8DH 1ZMLA 3NPSA 1V2TT 3RXRA 2ZCKP 4OS7A 4F55A 1C5QA 2R3YA 2BX4A 3FVFB 1T32A 2QV1A 1RTFB 2NWNA 4Q63A 3PLBA 1O2IA 4IC6A 1T31A 2VH6A 1GVKB 1O3BA 2W3KA 1HAXB 3RU4T 7LPRA 2QF3A 2ZF0H 4NZQA 3A7YA 4I8JA 3GCTF 3HKIB 2V0BA 1OSSA 2SGAA 3RXCA 1NN6A 2XC5A 4SGAE 4F49A 2B0FA 2LNCA 1G32B 1OP2A 1EAWA 3K2UA 4P00A 2BY7X 1JWTA 2Z3DA 2BTCE 2BVXH 1PQAA 4XRNA 1WTGH 1QB9A 4Q80A 3S7HB 2OC1A 4OGXA 2A7CA 3SU3A 1C1NA 1CT2E 4AFSA 3RU4E 2HWLB 5AVDA 2C8XB 1DUEA 2QA9E 2CMYA 3MNSA 2G4UA 1X7AC 1QRZA 2TGPZ 1ZMNA 1MUEB 1NPMA 2PR3A 2OP9A 2J95A 3Q00A 3RXEA 4ABFA 1WSSH 3TJUA 3RXIA 3RXSA 1B0FA 3NWUA 2AGIX 5A8ZA 5E8EH 3E1XB 3KQBA 2P3FH 2QY0B 2GMTB 5C5OA 4WMEA 1BTUA 3PMHB 4HGCA 2UWOA 1CT4E 3TK9A 1HJAB 1KXDA 4NWKA 3TU7H 4GVUA 1CHOG 1EOJA 1NROH 5C94A 1KXEA 3H7OA 1W0ZU 1NU9A 5GCHG 1W14U 3ATIA 2WZQA 3A89A 1VCPA 1LHGH 2ZFFH 3MO9A 1MQ5A 1PFXC 2QE7D 5K0HA 1AB9B 1EJAA 3G01A 5JBTA 4X1RU 1SVPA 5DK1A 2L6OA 2F91A 1C2HA 1ZZZA 3K6YA 2UWLA 1WU1A 4BTTB 2Y5GA 1C2IA 2FP7B 3BTQE 3PLPA 1ESTA 1QNJA 3DFLA 3EA8A 1NTPA 3CNRA 5C1UA 1OWEA 2UUKB 2KCAA 4AX9H 1IQHA 4I86A 2ZCLP 1TGSZ 2GCTB 3UTUH 2XBXA 1NC6A 1PQ7A 4WMFA 1L4DA 5CDFE 5TCAA 2AGGX 1ZGVA 4KTSA 4KTCA 1H9HE
chains in the Genus database with same CATH topology
1NT1A 1C9PA 4JYVH 1BMLA 1HYLA 1EZSC 4B73A 1BZXE 1GGDC 4I8LA 4XBCA 3PMBB 4IN2A 1AFEH 3AVZA 4CREA 3K65B 4X0WU 3DT0H 2EI7A 1O2YA 3SOSA 2XC4A 1G3EA 4FUBA 3T25A 1O32A 1VJ9U 4ZMAH 1O2KA 2ZGXH 4GPGA 4NCYA 2QCYA 3RLYH 2FTMA 1C5MD 1HAZB 3ZZ9A 1H8IH 1LO6A 3ZZBA 3FZZA 3I78A 3NUMA 1O30A 5FX6A 2FM2A 1YPGH 4YOIA 1HV7A 2SGQE 4DT7B 2ZHWH 1S85A 2NU0E 1EB1H 1P3CA 1C4V2 1W13U 1DICA 4ABAA 1AQ7A 5FPTA 7KMEH 1K28D 3U8OH 2VH0A 2C3SA 1E34B 1LVBA 3RP2A 2ALPA 3ZVCA 2BD5A 2ZU5A 4WXVA 1C9TA 1C1RA 1FN8A 2V3HH 2ZIQH 2HPPH 1FPCH 1Z6JH 1IQLA 4WWYA 3TNTA 5C1XA 1O3NA 1PPFE 2XC0A 1QFKH 2EC9H 2ZGCA 2ZGBH 1MU6B 1ZYOA 2V3OH 1NRRH 4ZH8A 1XKBC 1WOFA 2KAIA 1GDQA 3EGKH 1GMCF 1EXFA 1OXGA 4Y0ZE 8LPRA 1EPTC 4CHAC 1DSTA 1GI8B 2TBSA 1GMCG 2AIPA 1GGDB 2J38A 4WH6A 2J94A 1HAOH 2UUFB 2D8WA 3MU0A 1EASA 1C5PA 1QRWA 4K5ZA 3M7QA 3BG8A 4DIHH 2ODYB 1O2XA 1LKAA 3B9FH 1SPJA 1EAXA 1C2FA 2NU4E 3PROA 2BY5X 2PKSB 1L1NA 4ZXYH 4AB8A 1O33A 3HATH 1EP6A 4MTBA 4FUFA 1TX8A 2GGVB 1K1MA 1A5IA 1SGTA 3A88A 1D3TB 4K8YA 4NSYA 3SHCH 1XUHA 2BDGA 2VWMA 1K1IA 1ZSKA 3T27A 3T62A 4AFUA 1GBAA 3ATKA 4IC5A 3T26A 1PYTC 1ID5H 1NRNH 1T4VH 3SBKA 1P12E 2XBYA 3UNRA 3SO3A 4HI3A 4FUGA 1C4Y2 1P2IA 2ZHDA 1EAUA 1AVGH 2ZPRA 2FODA 1C5VA 4R8TB 2F9BH 1DPOA 3QWCH 6LPRA 4RKJB 5A09A 1LQEA 3K6ZA 1GBCA 2XBVA 1HJ9A 2B8OH 3BN9A 4UFDH 5FBEA 4INLA 2C8WB 2ZFQH 1HAIH 3TH4H 1O5EH 5T6GA 4KELA 1FXYA 3SJOA 1ANBA 1O2NA 4NSVA 3BTME 1TWXB 1GHVH 1IQGA 4FXGH 1SLVB 3GY7A 2XWAA 1L0ZA 2ZU4A 1TQ7B 1Z7KA 2HGTH 2Y81A 3V7TA 1NO9H 2PKSC 1FONA 4MDSA 2Z9IA 2ZZUH 1CU1A 3GDVA 3LDXH 4HTCH 1ZJDA 4IMQA 1C2MA 1LVYA 2FTLE 3M35A 4AGKA 1VZQH 3STJA 1O5FH 4MPVA 1INCA 3RXVA 5FCRA 4ZAEA 3ZVAA 5DO4H 3RXPA 5JPMH 1MZAA 2Q6GA 1O2GH 1DSUA 2R9PA 2FOFA 1HXEH 1YP9A 1Q2WA 2FPZA 1A7SA 1BQYA 5C20A 1O39A 4KP0A 2THFB 4DW2U 3EYDA 5HM9A 1N6YA 1SSXA 2BY6X 1TA2A 1C5XB 1P2NA 1MCVA 1AZZA 2G00A 2IPHA 3RU4D 2SNVA 1J15A 2VIPA 1ESAA 4Y8YA 1VITG 1O2JA 1O2SA 3A7XA 4MNWA 1Y5AT 1YPHE 1GBIA 3VPKA 2WPLS 5EW1H 3SNBA 1MTNB 2W5EA 1NFUA 4IBLH 3URDA 2AS9A 1TRNA 2FLBH 1Y3WA 3SGBE 1EJMA 2ZDVH 3RXOA 2ZKSA 5C5NA 1CGHA 1SC8U 1P09A 4UFFH 1BTXA 2FX4A 1F0UA 1EPTA 1UK4A 1XUFA 1TAWA 3E6PH 2BDHA 1SGDE 2VVCA 5DKMA 5EQQA 2XCNA 1ELAA 5I46H 1UO6A 5CHAB 2VIVA 2A1DB 1SGFG 5ABWA 5E0JA 1ORFA 1TOCB 2EI8A 1K2I1 5LGOA 1A3BH 1SL3A 1QJ7B 3W94A 1BRUP 5T6FA 1E0FD 1YCPH 1SBWA 5DP4A 3MNXA 3GYMA 1MAYA 2R2MB 1NRPH 3ZZ3A 1ZRBA 6CHAC 1K1NA 5DP6A 4K2YA 1GVLA 2ODQA 3LJJA 3FP7E 1O31A 2G52A 1AIXH 4KGAA 1QBOA 2FLRH 5DG6A 4MVNA 1GL1A 3UQVA 4XBBA 4AG1A 1K1OA 4FU9A 1FY3A 2ZTZA 2FESH 1SLXB 2CF9H 3SNEA 3ZZ6A 3E91A 1P04A 2I6SA 8GCHF 2VVUA 4I8HA 3UQOA 1AZ8A 1GWAA 4ZUHA 3UOPA 1XVOA 1IAUA 3LIWA 3EAJA 1JOUB 1C1MA 2QIQA 3V3MA 5L6NH 1GI5A 4A6LA 4Y76A 1TIOA 4IS5A 4OS1A 1C2KA 5JDUB 5GIBA 1C5WB 1Z71A 1BRAA 4ABGA 4RN6A 1NY22 2TGTA 3GISB 4UD9H 1O0DH 3SJ9A 2H9TH 2OCVB 1BTYA 1HNEE 2QN5T 1ZOMA 2VWNA 2VU8E 3CS0A 1V2KT 4FVBA 2XW9A 1DUAA 4JYUH 1BMMH 3BTKE 4DGJA 2GKVE 2QGRA 1D3QB 4I31A 4DJZB 1GHYH 1KYNA 2RDLA 4YOGA 5C1YA 4CH2B 1YPEH 3P6ZB 4U01A 1O3LA 1ZSLA 2FOHA 2P8OC 1FN6A 3MOCA 3UWIA 3S0NA 4Y6DA 1U6QA 3NKKA 4KKDA 1UCYK 1O3HA 1TE0A 1G36A 3S9BA 1TGCA 1O2PA 1ZLRA 3TITA 3MFJA 3MTYA 1TNGA 6GCHG 1MKWH 1EJNA 1OYTH 5LH8A 1IQEA 1MD7A 3P8NA 3VB7A 2GDDA 2O8WA 2BLOA 3SU0A 1AN1E 3ZZ8A 2Q6DA 1NFXA 2P93A 1OX1A 1LPGB 3SGQE 3SI4H 1QHRB 4MQAA 1BJUA 2ZDAH 3BTGE 1TB6H 1GHBF 1LHFH 2R0LA 1QBNA 3RXDA 1P0SH 3E90B 4FUDA 5L30H 1E37B 1SHYA 1QA0A 1W8BH 4D9QA 1AE5A 1PPCE 2BDBA 1RFNA 1FAXA 1P01A 2SGPE 1HGTH 1RJXB 2UUYA 1GI6A 1OWHA 3E0NB 5L2YH 3TK5A 2PSXA 2VIOA 1LVOA 1D3DB 3ZVFA 1ZTLA 3TK6A 1XUGA 3SJ8A 2UWPA 2WYGA 2OQUA 1ESBA 1HB0B 4R0IA 2G5NA 1MH0A 1GJ9B 4X8TH 3F9HA 1C1UH 3CENA 4UEHH 2BB4A 3H5CB 2ZPQA 4BAHB 3URCA 4BANB 4BNRA 3E3TA 1CVWH 1VGCB 1FJSA 1O5AB 1DANH 3DHKH 3BEUA 4LZ4B 1AKSB 2PHBA 5HMAA 2HLCA 3TPIZ 2QXJA 1E36B 2VGCB 1FDPA 4IMZA 1Y3UA 1AUTC 1C1OA 3ESTA 3ODFA 1RTKA 2BY9X 1T8MA 4DIIH 4U2WA 1LQDB 1B0EA 1BB0B 1C5NH 2G5VA 1HXFH 3AAVA 3NZIA 1O36A 5A0BA 2F9OA 1ZR0A 1ELDE 1QBVH 2ANWA 1OYQA 1IQJA 2BD2A 2O8TA 1K21H 1XUKA 4ISIH 8GCHG 1G37A 1PQ8A 3QTOH 3BG4C 2EEKA 1GMHG 2SNWA 2SFAA 1J8AA 1GBDA 1YLDA 3VFEA 2BLQA 3QO6A 3RM0H 3Q3YA 1MKXH 1WQSA 2ZC9H 4I33A 1S5SA 3S7KB 2BXUH 1GHAF 1F5KU 1DITH 1TNIA 2WPIS 2BQ7B 3A85A 2VIQA 4B74A 3PTNA 2FI3E 3BTDE 3O8CA 3T2NA 1TBQH 1QJ1B 2ZFSA 1NFWA 1AMHA 3OX7U 2OTVA 2G8TA 3L33A 1VGCC 1H9IE 2Z3CA 4X6OA 2FI4E 4O9VA 2NU2E 3OTJE 3V13A 1S84A 2JH5D 1LMWB 2PFEA 1KLIH 5AHGH 1Y3YA 1L2EA 1P2OA 2RCEA 2WPJS 2A4OA 4XBDA 1FAKH 1P02A 1UTMA 2ANYA 1MTVA 2BYAX 5DP9A 2TGDA 1FZZA 1G3DA 1MCTA 3V0XA 2HNTE 4MNYA 3Q3XA 3UNQA 1CSOE 1EATA 4RKOB 3IWMA 1GG6B 1UVSH 3A7VA 1V2UT 1O2TA 3VB4A 1DXWA 3U1IB 3BG4B 2BQ6B 1LHDH 1UTKA 5J4QA 5DP8A 1ZTJA 3TH2H 1BTPA 2AEIH 1HJAC 1A46H 5T3HA 2BHGA 1MAXA 1P3EA 1GJBB 1P11E 2AMDA 1O3DA 1T7CA 1FY5A 1GI9B 4CH8B 2Y82A 5F8TA 4JCNA 2AYWA 4NZLA 5FXLA 3DFJA 3ENSB 4WF8A 2FOAA 3MWIU 4INKA 5BRRE 1V2OT 3RXMA 2VIDA 1AU8A 1EPTB 3SZNA 4NIVA 1B7XB 1AHTH 1CHOF 4AFZA 1JMOH 2H9HA 3MU8A 2A5IA 3LKWA 5EXMA 2PUXB 2QXHA 3QGNB 3RMLH 1BTHH 1SI5H 3ZYEA 3BTEE 3BV9B 1J17T 1ABJH 3EE0B 3CS7A 3GY8A 3RLWH 3GDUA 1SHHB 2GT7A 2R0KA 3SNCA 3BTFE 2BLWA 1SFIA 1T8OA 4CR5A 1TPPA 3PYHA 1TONA 1DS2E 1KLJH 1GI3A 1SGRE 3AW1A 4CRBA 3PV4A 1ETRH 1BDAA 1G3BA 1BTWA 5E0HA 1HUTH 1GJAB 1UTPA 1CE5A 1O5DH 1JRSA 1FPHH 1HAYB 3SU2A 5EW2H 3HK6B 1T8NA 2OUAA 6CHAB 1FUJA 2WV4A 1QGFA 3KQDA 1O2VA 2Z7FE 1TGNA 3A80A 5JBAS 3UWJH 3OYPA 4U32A 1ZHMA 5E2OA 2ILNA 1C1WH 1FIWA 4YO9A 1ARCA 1LDTT 1MZDA 1YPLH 4O97A 2VWOA 1P05A 1UK3A 1DY9A 3EA7A 1QR3E 4NA8A 5EOKA 2QYIA 3KHVA 1A1RA 4A1TA 3N7OA 2XTTB 2VIWA 1V2RT 3F9FA 4ABEA 1GHAG 3B23B 4MLFB 1CBWB 4ISHH 2FMJA 4JZDH 2WUBA 2ZHQH 1TX6A 3FP6E 2PLXA 2BM2A 2ZU3A 2TGAA 2O8LA 4VGCC 2GX4A 2QF0A 5C2ZA 1E38B 2H9EH 1GJ6A 4JZFH 1TNLA 3QLPH 1QTFA 3MO3A 2HALA 1YC0A 3LC3A 1C2LA 1Z8JB 4A92A 1AGJA 4Y11E 3GCNA 3RMNH 1NM6A 1NRQH 1EQ9A 2W7UA 2HNTC 1XM1A 1UTQA 3RXAA 3IG6B 1P2QA 1PPEE 4BTUB 3ZZ4A 3QX5H 1GI2A 2AGEX 3ATLA 1RTLA 1V2ST 2P8OB 1GBKA 4GLYA 1O3CA 3OY6U 1SMFE 3RXFA 2B5TB 1VR1H 4Y8XA 3TGKE 3ZZDA 4UFEH 3VGCB 3VXFH 1YCPM 3SW2B 1P2KA 2BDCA 3C1KA 2BVRH 1O5BB 4GAWA 4GCHF 3T29A 1UVOA 4IN1A 5GWZA 4GUXA 4YLQH 2FS8A 1W10U 4NFEA 3SQEE 1BA8B 2C8YB 2XRCA 3U8TH 4UONA 3HKJB 1VITH 3P95A 2BZ6H 3ZZ5A 1MTWA 5PTPA 1RXPA 1F2SE 2OBOA 5EQRA 5LPRA 4D7FA 1GI1A 3MH6A 5A0CA 1GI4A 3D49H 3QZRA 3TGIE 3FFGA 4CRGA 1DDJA 2SGDE 4MNXA 2Y7ZA 2ZTYA 3QUMP 1F92A 1FLEE 4IW4E 3F9GA 4X6MA 5DGJA 1CA0B 4NA9H 1O3GA 3K9XB 1AE8H 1TALA 2DE8A 1SGYE 3A84A 3ZVGA 5CMXH 4ISNA 2JH0D 1HFDA 2IN2A 1JIMA 1D3PB 1LTOA 1P9SA 7GCHF 3C27B 1WCZA 3A81A 1RS0A 5A2MH 3M61U 2ZGHA 2ZA5A 5EG4A 4OGYA 1LCYA 3QZQA 2P94A 3VB6A 3PLKA 3SHAH 1UCYE 3RXGA 1MKWK 1L1GA 2WYJA 2FOEA 1UMAH 9ESTA 1O2UA 4NWLA 4JK6A 1UCYH 2AH4X 1XXFA 1SGPE 3EDXB 7ESTE 1GHWH 1QL7A 2ZNKH 1GCTB 1TFXA 1QL9A 2ZI2H 4MG3A 3F68H 5JB8S 1GVZA 2NU3E 2BX3A 1O5CB 2PTCE 1TNKA 1V6DA 2D26C 1W12U 2F9UA 2ZDNA 2GV6A 2H5CA 1FI8A 1DWEH 1C4U2 3UR6A 1O2RA 3SU4A 1S83A 3VGCC 4QT8C 4H6TA 1O3OA 3A86A 1GJ7B 2A32A 1HAVB 3RXKA 4PROA 4ABDA 5BPEA 5EPYA 6GCHF 4CRFA 3P8OA 2ZWLH 2Z94A 1DVAH 3DUXH 1QL8A 1Y3VA 3MMGA 2HRVA 3TNSA 2ESTE 1UHBB 3FANA 5HXFA 2DUCA 2XYAA 4OS4A 1FMGA 2NU1E 1KXAA 5ESBA 2FEQH 5F6MA 4YM9A 1K1LA 2OBQA 3VB3A 1KXBA 3SU1A 4ZXXH 1G30B 1J14A 3TJOA 3QTVH 4XOJA 3AAUA 1YYY1 1HJ8A 1V2VT 4BAKB 3U9AH 3BTWE 2BD3A 5ESTE 3EA9A 1O3PB 3MHWU 4JK5A 2PGBB 2ALVA 2O8MA 3HK3B 3O8RA 3SV7A 3TLOA 1BT7A 4NIWA 1DY8A 2UUJB 1D6RA 5CHAC 1OP8A 4BXSA 3D65E 1F0SA 1IQNA 2F9NA 1SGFA 1WBGB 2A2QH 3GOVB 2H6MA 1IQIA 3ODDA 3LU9B 1IQKA 8ESTE 4X6PA 2BD9A 2CJIA 3RM2H 3A8BA 5E2PA 3NK8A 4KTUA 1DE7H 2JKHA 5DP5A 1LPKB 1WYKA 1BJVA 2PTNA 1AO5A 2G51A 4ASHA 1C1SA 3SUFA 1SLWB 5A0AE 1Y5BT 3M5MA 4K1EA 2FIRH 1FV9A 4D7GA 2VWLA 1EKBB 1N8OC 4E7RG 8KME2 3V12A 2B9LA 3LT3A 4TWWA 1W7XH 4CRCA 4ZKRU 2W3IA 3D23A 5GXPA 3FAOA 4B76A 1DM4B 1ZPBA 2C93B 7GCHG 4YT6H 2ZDLA 2A31A 1AFQB 2Z3EA 4J2YB 4SGBE 1CO7E 1RRKA 3SUDA 3RXTA 4XSKU 1YKTA 3KN2A 4UDWH