1KXCA

Sindbis virus capsid (n190k mutant), tetragonal crystal form
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
ALKLEADRLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTYTSEHPEGFYKWHHGAVQYSGGRFTIPRGVGGRGDSGRPIMDNSGRVVAIVLGGADEGTRTALSVVTWNSKGKTIKTTPEGTEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SINDBIS VIRUS CAPSID PROTEIN
publication title Structural analysis of Sindbis virus capsid mutants involving assembly and catalysis.
pubmed doi rcsb
source organism Sindbis virus
molecule tags Viral protein
total genus 34
structure length 158
sequence length 158
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1996-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxcA01
1TBQH 3E1XB 1CHOG 4ZKSU 4Y8YA 3TJUA 3D23A 1P12E 3ITIA 2A2XH 4ISOA 1QB1A 2JH0D 2ULLA 3LT3A 3PMJA 1UHBB 2OCVB 1GJAB 1Y3YA 5A0BA 4ZUHA 1BB0B 1BTWA 3RC4A 7KMEH 1RS0A 5DK1A 3RMNH 3ZV9A 2ZDVH 4IBLH 3PWBA 1O5AB 1ZPBA 1O3KA 5L30H 3NPSA 3SNBA 1C1OA 1LCYA 1MCTA 1EB2A 4O97A 1BRCE 1ELEE 1UTNA 1O3IA 2VWLA 1YF4A 1C5MD 2Z9LA 3PYHA 1C5RA 1GL1A 3V7TA 5F03A 3KQBA 3STIA 4ABJA 1WSSH 2XBXA 1NRRH 3ZYEA 1J8AA 1SGTA 2QXIA 1OS8A 1ANEA 1ESTA 1TRNA 4JZEH 4NZLA 3ZZDA 5LGOA 4I32A 5JBBS 1ZMLA 3GDVA 4K60A 1WV7H 5LPFA 3MNSA 2P94A 4ZHMU 2PTCE 3FP8E 3TIUA 1L4DA 1NRQH 2A0QB 4OS5A 2FOFA 4OS7A 1W7XH 1RD3B 5JBAS 1QL7A 1LKBA 8LPRA 3LC3A 1YC0A 3MH5A 3AASA 4YT6H 4ABHA 2GZ8A 5L2YH 1PFXC 1S0QA 5ABWA 2J38A 1O5DH 4X6OA 4ZROA 3VPKA 1O3GA 3PM3A 2BTCE 1Y3VA 1OOKB 1GBHA 3DT0H 1QR3E 2FESH 4NIXA 3A7ZA 1B0EA 3U9AH 1KXFA 1TPOA 1DE7H 4NA7A 1F0SA 1O2PA 2THFB 1BOQA 3QX5H 4Y71A 1VJAU 2B8OH 3HGNA 1UVUH 2FMJA 1HAIH 1C9PA 4Q7XA 2BDYA 3K6YA 1ANCA 3SV2H 2A32A 3BTHE 2BD7A 3BTFE 2ZCHP 1O3HA 3NZIA 5EQQA 1YPEH 1QNJA 3I77A 4XBBA 5B6OA 4XFQA 4FXGH 1S83A 3MU0A 1O2WA 1G3CA 1N8OC 1FY5A 3ELAH 3OU0A 1KLJH 3BTWE 3GCTF 2KAIB 5A8YA 1PQ7A 1JIMA 3F68H 1GCDA 1O2ZA 1C1PA 3MFJA 1RFNA 2O8TA 1L1GA 2ZGJA 2A31A 1AUTC 4ZH8A 2P59A 3RXFA 5FX5A 1BRUP 2VB0A 1O2OA 2OXSA 4ABIA 2WINI 2OTVA 1TX6A 3E16B 2WV4A 1KSNA 1WUNH 2BD3A 1D9IA 2FIRH 1UCYE 3EE0B 4NGAH 3UIRA 1FZZA 2TIOA 3AW1A 2BQ7B 2SGFE 1EPTC 3MO6A 2GCTC 1MZDA 3RXHA 6GCHF 5K7RA 1BHXB 3VB7A 5L2ZH 3M7UA 1EAIA 5DP8A 2ZA5A 4ZXXH 5LH8A 1IQHA 2ZFPH 1C1VH 2NU2E 3LH1A 2GT8A 3TJVA 3GY4A 2CGAA 2DE8A 2JETC 2FEQH 3Q77A 3Q3XA 3B9FH 1F5KU 1MTUA 3E0NB 4TWWA 5GDSH 5TCCA 4WMEA 1MTNC 1F7ZA 9ESTA 1YLCA 4YLQH 2WYGA 2WPKS 1H8IH 3VB3A 1AZ8A 1FN8A 2W26A 1PPFE 3RXSA 1OP2A 1LVYA 2Z7FE 2QF3A 3R0FA 2Z9JA 2BLQA 3BTQE 1AVGH 1YBWA 2AYWA 3R3GB 2XW9A 5GCHG 2OQ5A 1TONA 3P92A 3CS0A 2OC0A 3UR9A 1EPTB 1Y8TA 2HWLB 4WMDA 2GCTB 3EGKH 7ESTE 1QL9A 1O5GH 1XXDA 4A92A 1SGQE 1TLDA 2CV3A 3GCHC 3TH3H 4BXWA 1N1LA 2VWOA 1IQMA 1GHXH 1QA0A 1P3CA 3SU5A 4FUIA 3M7TA 2XXLA 2EEKA 1QJ7B 2JETB 1IHSH 5DP6A 1EASA 3VXEH 1ZLRA 1O2RA 3TK6A 1GBAA 1E37B 1BRBE 1C5WB 1OSSA 1TOMH 2PGQB 2ZHWH 3GY7A 3PTBA 2P8OC 2BZAA 2XBVA 4FUJA 2BDAA 1A5GH 4FVBA 1HAGE 3BG4C 3S69A 1MBQA 1ELGA 3SO3A 2C8ZB 3BEUA 2C8WB 3JZ1B 3VEQB 1BTZA 2R9PA 1QJ6B 1GG6C 1FPHH 1WTGH 1GJCB 8GCHF 1O3EA 3EQ0H 3RXQA 1SGCA 3TPIZ 3ZZ9A 2PUQH 3QZQA 3T2NA 1WQVH 1AO5A 3GCHB 4O3UA 2ASUB 1NPMA 3QLPH 1MKWH 3Q76A 2BX3A 2FS9A 3FZZA 1SLXB 1O3CA 2YNAA 3KGPA 1EJNA 4JYVH 2Y7XA 1NRNH 2BVRH 3IWMA 2P8OB 3MMGA 2XCFA 3LGWA 2A7CA 2B0FA 1YPLH 1C5QA 3F6UH 3BG4B 1VITG 1GBTA 1HAPH 1AMHA 4AFUA 4AGKA 1HLTH 1SHYA 1Z8JB 1V2MT 1WOFA 2NU1E 3A80A 8ESTE 1TNHA 3PV4A 1SOTA 3MH4A 2ZEBA 1GG6B 2FYQA 2ZFRH 4JYUH 1A3BH 1G3EA 1BTHH 2QCYA 1O33A 3GISB 1CSOE 1MD8A 1XKBC 3FP6E 4F49A 1SGIB 1LPKB 4MNYA 2F9BH 1FUJA 1QBVH 1ELCA 1GI0A 3KHVA 2A4RA 2GCHF 4YO9A 1Y3UA 4DY7B 5DP9A 1DLKB 1AN1E 1NRPH 1MTVA 1XKAC 2ZDKA 4YOJA 3Q3KA 2WPHS 1EKBB 2V6NA 5DP4A 1A5HA 1K1OA 3RU4E 2GD4B 2ZFQH 3VB5A 1H9IE 4O03A 4IN2A 2WPMS 5DPAA 5E8EH 2SGPE 2GMTB 2TGPZ 5L6NH 2F9VA 4GHTA 4E7NA 1TGCA 1TNJA 3MU8A 1OP8A 1TGTA 1AB9C 3A7WA 2QY0B 4WH8A 5T6DA 3A8CA 2PV9B 2Y5FA 1A46H 1C4V2 2ZQ2A 1ESBA 1DWBH 1G9IE 3SI4H 6CHAC 1O5BB 2EA3A 1E38B 1MKWK 2CN0H 1WBGB 3SI3H 1DANH 1QA7A 2PUXB 2Y82A 1ZJKA 4U2WA 1A1RA 2VIDA 3SHCH 1AE5A 4K1TA 3P8GA 4ZAEA 4INLA 3RXOA 3ENSB 1F0RA 2QGRA 4DG4A 1ZTLA 4NIWA 1A5IA 2BDIA 5JB8S 1PPBH 1CHGA 1NFYA 1L0ZA 1OWKA 1ACBE 2ZP0H 5FPSA 1AB9B 1O2JA 4D9QA 1L1JA 5A09A 1M9UA 1O2LA 1DOJA 2G4TA 3QUMP 5EW2H 1DWEH 3A83A 3UOPA 1P04A 3V3MA 1CE5A 2VH6A 4UFEH 1O2QA 1HJ8A 2XTTB 6CHAB 3DHKH 5HYOA 4JYTA 1AKSA 2GKVE 3GDUA 3WY8A 4BOHA 1SVPA 1LKAA 4BAMB 7GCHG 7LPRA 2DUCA 2K1QA 4MQAA 3MYWA 1OYTH 3VXFH 3URCA 1C5YB 2ODYB 1C1QA 1A0JA 3QGNB 2J92A 4AZ2B 2ILNA 1HGTH 5F8ZA 2CMYA 1H9LB 2W5EA 1HDTH 1UK4A 2V3OH 4OS1A 2BOKA 1MQ6A 2QXJA 1NROH 4Y8ZA 2GDDA 1T32A 3ATLA 3PMAB 1FAXA 3UR6A 1GMHF 1TNIA 1PQ5A 3LH3A 1INCA 4BAHB 5BRRE 1FPCH 1HUTH 1UCYH 2CF8H 3S9BA 2VWNA 1EZSC 4ASHA 3KF2A 1SR5C 2FI4E 2GVFA 2OP9A 2O8LA 1C1TA 1IOEA 2TRMA 5CMXH 1XUKA 3SV6A 1AU8A 2AGGX 3Q3YA 1TQ0B 3MHWU 4A1XA 4JZIA 4K3JA 9LPRA 1H4WA 4X1QU 2BLOA 2PSXA 3VFEA 2ZHFH 5A0CA 3LGYA 1V2QT 5C3NA 4X0WU 1OXGA 4AORA 1EUFA 1CGHA 1T8MA 1D6RA 2AMQA 2FOMB 3CENA 1AFQB 3RMLH 1CVWH 3SJ9A 2ZGHA 2TGAA 4ABDA 3LJOA 2W7UA 4AB9A 1NESE 2I6SA 3SHAH 3IG6B 1H8DH 1BIOA 2JH5D 3ZZAA 2A2QH 3U1JB 4CRAA 1PJPA 2BD8A 1BA8B 1EOJA 5FPTA 4Y0YE 3RXJA 3KIDU 4A6LA 1GCTC 3TGIE 1XUFA 3SJOA 2Y7ZA 4B1TA 1Y3WA 4NIVA 5ESTE 4X1RU 1EAWA 1KY9A 5DP7A 1MMJN 1A7SA 2AEIH 2H9EH 2VVUA 1SFIA 1BITA 1ETSH 1PYTD 1JRTA 3E0PB 3RMOH 4ABGA 2ZPQA 4KTUA 1T8NA 1ZPCA 1P57B 1DICA 1KDQB 1DWDH 1IQFA 1BCUH 3A7YA 1V2JT 4ZHLU 5C67A 2V35A 3NXPA 4FUHA 2ZGCA 1V2PT 3NKKA 3M3SA 3MTYA 1P2MA 4CRGA 2ANMH 1UCYK 4X8VH 3ZVBA 1O5FH 3SQHE 1FY8E 3T28A 1TBZH 2FODA 3SBKA 2HVXA 2FM2A 4E06H 5DP3A 1GBKA 2QN5T 2FI5E 4U30A 1GCTB 3UNQA 2RA3A 1HB0B 1NRSH 2Z6BD 2Z94A 3SQEE 4HTCH 3NUMA 1MAYA 2VU8E 1Z71A 4IMQA 3MOCA 2XBWA 2G00A 3A88A 1J16A 5FBIA 2J2UA 1MTWA 3EDXB 1O3PB 2UUYA 2VIWA 4HZHA 2Q6DA 1HV7A 1TQ7B 1SLVB 4U32A 3SU3A 2ZECA 1AKSB 1CHOF 4I8GA 4KGAA 2V3HH 1S0RA 1IQGA 3O8CA 2BY6X 1Y59T 1GI4A 1K21H 3SU1A 3MU4A 1G3DA 1GBEA 3F9FA 1S84A 2ZFSA 3UNRA 1E0FD 3EAJA 1FIWA 3M7QA 2PTNA 3H7OA 1LTOA 5E2PA 4TWYA 3P8NA 3A7XA 1QRZA 2FLBH 2UUKB 4ISLA 1C9TA 4IW4E 1HAVB 2A4QA 3BTEE 1ESAA 1C2HA 3FZDA 2ZTZA 1QCPA 2UWLA 1BTUA 1DUEA 3OY5U 4X8UH 1EPTA 2ANKH 4Y79A 1DITH 1ABIH 1H9HE 1O3MA 4RSPA 1DFPA 2OQUA 4B75A 3ATKA 4DCDA 1C5VA 1A61H 2QIQA 3SUFA 1V6DA 1DXWA 1NY22 1FY1A 2WUBA 3TLOA 5IDKA 3TK5A 1U6QA 1UO6A 3RXAA 4CBOA 3M37A 1C1WH 2W3KA 2G5NA 1OWJA 2PKAA 5FCRA 3BTTE 1XUGA 3A8BA 1QL8A 3ZZ5A 5JYIA 1O3DA 5EXMA 1C5ZB 4THNH 4Y76A 1K2I1 1UTKA 1MAXA 4SGBE 3RLYH 1C5OH 3GOVB 1GGDC 2VH0A 1QRWA 1O38A 1EZXC 5GJ4B 2BDBA 3ODDA 1P2IA 4X6PA 2JKHA 3ATMA 1SOZA 3SJKA 4XBDA 3OTJE 2IPHA 3K6ZA 3LPRA 2PKSB 3FP7E 3STJA 5F8TA 1VCWA 1D3QB 3VGCB 3DUXH 4FUCA 1TPSA 2ZDMA 4A1TA 3SW2B 2XC0A 1GBIA 2ZGBH 3KQDA 1RJXB 6LPRA 1VZQH 1MKXH 1P2JA 2VVVA 2UWPA 1AI8H 1S6HA 1GHWH 3CS7A 2ZPSA 4JZ1A 1THPB 3GCOA 1O2TA 1E34B 4I31A 4YOGA 1SMFE 5DKMA 1UVPA 2FDAA 3L6PA 2I6QA 3RC5A 2C4FH 4NWLA 1BMLA 1H1BA 1GGDB 1SI5H 3SNAA 1ARCA 1O5CB 2Q6FA 1TPAE 2RDLA 2QYIA 1S5SA 3M61U 1ZRBA 2Z3CA 1HCGA 1WYKA 1Q3XA 2G52A 1TA6A 3PB1E 5DG6A 1O2KA 1XUJA 3UFAA 1WQSA 5EXLA 3KCGH 5AFYH 1HXEH 4AFZA 1F0UA 1YPKH 2HNTC 1JRSA 1FN6A 2D8WA 1T7CA 5C1YA 1O2NA 1HXFH 4YESB 3NWUA 5F8XA 1OWEA 2BD2A 1V2NT 2ZDLA 3A7VA 2GV7A 1GHAG 4UEHH 3SZNA 3ZZ6A 1C5TA 1DLEA 3CP7A 3RXGA 2OINA 4KKDA 4QT8C 2WPIS 2J9NA 3RUOA 5EOKA 3SU2A 1GMDG 2BB4A 3M3VA 1SFQB 4AYVB 1BT7A 3PROA 2FLRH 5CE1A 2Z9KA 5PTPA 1XX9A 1ZGVA 1W12U 3RMMH 1P05A 2VINA 4AOQA 1T8OA 3M35A 3SV7A 3ZVFA 1NO9H 1O3AA 1MKXK 4TYDA 3LC5A 3E90B 2PFEA 1DY9A 4ISNA 2ZG0H 1HNEE 5JPMH 1C2FA 2PLXA 5GCHF 2G81E 1GBLA 2J94A 1TX8A 4Y0ZE 1S85A 4LOYH 5T6GA 1YYY1 3GY5A 4Q7ZA 5FXLA 5JBTA 4NFFA 1SGRE 1TA2A 3ZVEA 3RXLA 1NZQH 1GHBG 4UE7H 1DX5M 3SGAE 1FAKH 1SGNE 3EYDA 1GVZA 2PGBB 3E6PH 3GY8A 2GGVB 1EB1H 2F91A 4MLFB 1NTPA 5A8ZA 8KME2 4Y7BA 5EQSA 5JB9S 1LDTT 2PKAB 2BHGA 5FPYA 4AX9H 4I8LA 4TPYA 4X6MA 4B2CA 1C1RA 3T27A 1OWHA 1BRAA 1W0YH 4I33A 2ALVA 4NWKA 1YPJH 3BN9A 3SN8A 1EXFA 1O2VA 4WF8A 2OLGA 1UTLM 2DE9A 2JH6D 3UPEA 5GWZA 1RTFB 1SLUB 2ESTE 1TNKA 3RXUA 3RM0H 2CJIA 2ZU1A 2BDCA 1YCPH 1F5LA 1BMMH 1VGCC 1DT2A 1ZZZA 2BOHB 1YPHE 2OC7A 2ZDNA 1ZOMA 1AY6H 2FOCA 4DT7B 2B7DH 2OBOA 2NU0E 3QWCH 2FO9A 1CQQA 1ID5H 2HGTH 2G55A 2XC4A 4UFFH 3BIUH 4PROA 3H5CB 3U98H 1A3EH 4ISIH 1Z6JH 2FX4A 4X2WA 3D62A 3V0XA 1GWAA 1VITF 1QBNA 1A2CH 2O9QA 2STBE 2GMTC 2D1JA 2RA0A 4YZUA 4FUFA 1FMGA 1LO6A 1DSTA 2SNWA 1V3XA 2Y6TA 1PQAA 4D9RA 1JXPA 1N6YA 3UOUA 1TMTH 5GIBA 1ETTH 1VGCB 1BZXE 5C1UA 4UD9H 5FHTA 3BTDE 2ZKSA 3P70B 3SNEA 2AH4X 2Q1JA 2XNIA 5EPYA 1AIXH 1QGFA 1P9UA 3MH6A 1SQAA 1UK2A 4B71A 3SGQE 4J1YA 2ZTXA 1BHXF 2H6MA 3F9EA 3UY9A 2OC8A 2AS9A 1NFWA 1EATA 6ESTA 3UTUH 1CBWB 2XWBI 2FPZA 1JIRA 1P8VC 1EP6A 3AAUA 1G3BA 4BTIB 1J17T 5EGMA 1QFKH 1P01A 1TIOA 4NSYA 4BAOB 1NFUA 1V2WT 3MH7A 3TGJE 4NA8A 4BTTB 1HAXB 1NN6A 1C1SA 1YCPK 4UFGH 4NIYA 2LPRA 3E91A 3K9XB 5HM2A 2BY8X 1Z8RA 1C1MA 4KELA 3PLBA 1OP0A 3ZZCA 1KDQA 4XE4A 2SNVA 1SGFG 1O3OA 1ELDE 3D65E 1UMAH 3ZZ4A 2FYRA 5EU8A 1TBRH 3SNDA 1XUIA 1RIWB 4MPXA 4OS4A 1QRXA 3RXRA 2TPIZ 3E3TA 1AE8H 5AHGH 4DGJA 2FXRA 2ZHDA 3TJOA 2BLVA 3NK8A 2AMPA 4B2BA 3HKIB 1CA0C 2VIVA 5GPIB 1LHFH 2FS8A 1IQEA 2BDHA 5EPNA 2ZCLP 5J4SA 2ODQA 3BV9B 5DP5A 1YM0A 3LDXH 4GSOA 4K5ZA 4DVAU 4CH8B 3GDSA 3F9GA 1SGPE 2AMDA 1C2GA 4AG2A 1C2MA 2AIPA 1GMCG 5TJXA 2VNTA 1D4PB 3PLKA 1O2SA 1SLWB 2B9LA 4Q80A 3A89A 1O2IA 3TITA 4BAQB 1C2IA 1SBWA 1C5XB 1MTSA 1DSUA 1O2YA 2OUAA 4GPGA 1SGYE 4FUBA 1F92A 2GDEH 1HIAB 1GI6A 1TRYA 1TGNA 1J9CH 7GCHF 3EA8A 3FAOA 2FOBA 4Z6AH 5I46H 4E7RG 1IHTH 2FOAA 3A7TA 3TVJB 1Z7KA 1IQKA 1O36A 2A5KA 4MPVA 3S0NA 1CA0B 4FUEA 4MPUA 1PPCE 3IITA 3TNTA 1GL0E 3NCLA 1EAUA 2GV6A 1KTSB 4ZMAH 1IQLA 4I8JA 1AFQC 4H4FA 3H7TA 3QTVH 4X1NU 1O0DH 3PMBB 1HAVA 1FIZA 3GY6A 1O2HA 2VJ1A 2UWOA 4Y6DA 1KXDA 4K8YA 3FANA 1ZRKA 3QGJA 1ELTA 1SGEE 1FJSA 1EZQA 1YPHC 4A1VA 1TNLA 1T4UH 1OWIA 3SNCA 1J15A 4X2XA 3BIVH 4UFDH 1HFDA 1T4VH 3A8DA 1GI8B 1GJ4H 3TK9A 2HPQH 1P11E 1P2KA 4CRCA 3SGBE 3PWCA 1TPPA 2J4IA 1C1NA 3MO3A 1THSH 3SV9A 4ZKOU 5CHAB 3MU5A 4UONA 1O2XA 2A7HA 2FTLE 1BMNH 3ESTA 5AF9H 3KNXA 4NFEA 1EAXA 3F1SB 3AAVA 1PYTC 1BMAA 1O35A 2BD4A 2HRVA 5LPEA 4JMYA 3TH2H 3AVZA 4MNXA 2WV5A 2EI8A 2G4UA 4KTCA 4DIHH 2EI6A 1NC6A 4NSVA 1ZSKA 4CRDA 4HI3A 1ZMNA 5FX6A 1PPGE 1OPHB 1L2EA 4CHAC 3A82A 1TRMA 4X8TH 1ZYOA 5A2MH 4MG3A 2BM2A 1C5SA 3N7OA 1YGCH 4RKOB 1Y5BT 3RXEA 4H42U 4AFSA 1LMWB 2J34A 1HJAB 4BXSA 3ZVCA 1B5GH 5AFZH 1GPZA 1QJ1B 1ZJDA 4ZHAA 4GCHG 1QIXB 1MQ5A 4X2YA 1FXYA 2BXUH 3UNSA 3MO9A 2XC5A 2HNTE 3P8FA 3UQOA 1G37A 4GUXA 4OS6A 1MZAA 4DW2U 1XVOA 2O8WA 3T62A 1TGBA 4BTUB 3BEFB 1THRH 1D3PB 4B73A 3M5MA 3E8LA 4GLYA 4BANB 1PQ8A 2BXTH 3P17H 1C5NH 4GVUA 2SGEE 4ZKRU 1ZR0A 1G30B 2W7SA 4CHAB 3A81A 5T6FA 1O34A 3RXMA 2BX4A 1BTYA 2SGAA 3HKJB 3U8RH 1S6FA 1G2LA 2H5CA 4HFPB 3L3TA 3GY3A 4RKJB 1O3NA 1P3EA 1W3CA 1HAOH 1IQJA 2HALA 3MNXA 1HRTH 1FI8A 1BJVA 3MNCA 5LPRA 5EG4A 4YOIA 3RU4D 1ANBA 1QY6A 1HBTH 4D7FA 4FU7A 1GHZA 4MNVA 2YNBA 1UTPA 1CT0E 3HK3B 1P9SA 2FOHA 2GP9B 1XMNB 1EX3A 2Y81A 5FAHA 3SOSA 1V2RT 1Y5AT 1UVSH 1GJ6A 2ZU4A 2BQ6B 5ETXA 1BJUA 1W2KH 2FOGA 1JBUH 1W7GH 4BNRA 3SV8A 1W8BH 3OSYA 1GHVH 1F2SE 3A8AA 1GDQA 4O3TA 2F3CE 5C2ZA 3RXBA 1S82A 1AVXA 1N6XA 5EW1H 1DM4B 4TY7A 2BYAX 2QXGA 1DY8A 1SGFA 4MDSA 2ZCKP 4X1PU 1RTKA 1EP5A 1HAZB 5I25A 2B5TB 2M5TA 1GI9B 3LU9B 2PKSC 3U8TH 2GX4A 3SUDA 1CO7E 3U1IB 3VGCC 2RCEA 2UUFB 4YT7H 3DA9B 3MNBA 3S9AA 1SC8U 1ELAA 1ZSJA 1AQ7A 4CR5A 2BD9A 2A4OA 1EJMA 1ZHMA 1C4Y2 1LHCH 2QXHA 3PMHB 1FNIA 2A7JA 2CXVA 1PPZA 1GJ5H 1Y3XA 1XVMA 1WU1A 4KP0A 3K2UA 1A0LA 4NZQA 2R3UA 3A87A 2BZ6H 1T8LA 2PSYA 1Z1JA 4MVNA 4LZ1H 5GXPA 3O8BA 1GJBB 2O8UA 3GICB 1DDJA 2HLCA 1UVTH 4HGCA 3BEIB 4DOQA 3LGIA 3ZZBA 1GHYH 4B74A 1ABJH 1ARBA 2ALPA 3A84A 1MU8B 2FZZA 3TU7H 2XYAA 3RXPA 1DUAA 2WPJS 1XXFA 3M3TA 2BVXH 3TJNA 1DS2E 5E0HA 2ZNKH 1IAUA 2H1UA 1GBCA 5HXFA 3S7KB 1OWDA 3KL6A 2G5VA 3F9HA 2F83A 3LJJA 5EQRA 2P3TB 2RG3A 2SFAA 5EXNA 2PW8H 1ZMJA 3UWIA 1X7AC 1KYNA 1RRKA 1K1PA 4K2YA 1TOCB 3SU6A 3T25A 1GVLA 3OX7U 2XBYA 1B7XB 3QO6A 4YTAA 5JBCS 3SORA 1SL3A 1LHEH 1C4U2 1W14U 2Y80A 3RXTA 4NCYA 1HAYB 1YP9A 1VCPA 2ZU5A 1UK3A 2ZO3H 2LNCA 1NU9A 2ZQ1A 3RDZA 2UUJB 3BSQA 4Y11E 3JZ2B 1SHHB 4DJZB 2R2WU 2VVCA 1LVMA 1UTQA 2YOLA 1KLIH 2C93B 2ZFTA 1LVOA 2ZGXH 2ZZUH 1K1NA 3SUEA 1YCPM 2AIQA 4FUDA 1VCQA 1FQ3A 1D3TB 3M5OA 3GCTG 3BTKE 1IQNA 1TABE 1HYLA 3QDZB 1GHAF 2QV1A 3QTOH 4NA9H 1AHTH 2C3SA 4I8KA 1GDNA 3L33A 5DJ7A 1TNGA 4IC6A 5E2OA 1GBJA 3ZZ8A 5HGGA 1GMDF 4D8NA 1NU7B 1VR1H 4JCNA 5DO4H 4CRBA 1CT4E 4X8SH 1BTXA 2TGDA 1DXPA 4AFQA 1QHRB 3C1KA 1C5PA 2J95A 2ZHQH 1ZHPA 2ZC9H 1K22H 2P3UB 1S81A 1CT2E 4VGCC 3W95A 4A7IB 6GCHG 4X2VA 2R0KA 3GCNA 2PHBA 4MPWA 1VITH 3KEEA 2Q6GA 2H5DA 2ZF0H 1F0TA 1HJ9A 1N8OB 2R0LA 2STAE 5J4QA 1Z6EA 3Q00A 2SGQE 1TFXA 1AVWA 4CH2B 4JZFH 4KTSA 1RXPA 2ZTYA 5DGJA 1TMUH 4X1SU 4FU8A 1AWFH 4YLUA 1A4WH 1W0ZU 1RGQA 1MU6B 3MU1A 4LK4A 1GHBF 1ZSLA 3VB6A 1CGIE 1O5EH 2ANWA 1GBMA 1K28D 1P03A 1T31A 1EQ9A 1ORFA 3RXDA 1V2LT 2D26C 1DPOA 2HOBA 4K8BA 4VGCB 5FBEA 3GYMA 2QC2A 3ATWA 4XDEA 3S9CA 1EJAA 5FCKA 3M5LA 1TX7A 3HK6B 4XSKU 2ANYA 5SGAE 1GBFA 1MH0A 1HIAA 1QB6A 1SB1H 2Z9GA 3OY6U 1GJDB 3HGPA 4F4OC 1XM1A 1O37A 1SQTA 2GTBA 3DD2H 1GI1A 5BPEA 5A0AE 1MTNB 3V12A 3A86A 1TYNA 1UVOA 1MBMA 1QB9A 2F9PA 1V2ST 3FFGA 4WWYA 1ANDA 3ZV8A 4ABBA 3B23B 1RTLA 1O3FA 3MWIU 1HPGA 5C5OA 3ZYDA 1KLTA 2EC9H 4JK5A 2VWMA 4NG9H 2ZU3A 3ZZ3A 1MUEB 1KTTB 2OD3B 1E36B 1UJ1A 1BBRH 1BQYA 1O31A 3UUZA 4CRFA 1D6WA 3RXVA 1C2KA 1AFEH 1CBWC 8GCHG 1GJ7B 1YPGH 4WH6A 5A8XA 3T5FH 1JMOH 3AW0A 3B8JA 2A45B 3DFJA 1UTMA 1P2NA 4WMFA 4X6NA 2A4GA 5C1XA 1SQOA 1C2LA 2BY7X 5HMAA 1O2UA 2GT7A 2WPLS 3URDA 2BDGA 4SGAE 2BLWA 3TNSA 1GI3A 4AYYB 4Q2KA 2ZI2H 2NU4E 1TGSZ 1A0HB 3M36A 4MNWA 5AVDA 2ZPRA 2G8TA 1QURH 1RIWC 2C8XB 3PO1C 2Y5GA 2FI3E 1FY3A 1P02A 3UWJH 1FDPA 1P06A 1O2MA 2TGTA 1Z8GA 4WVPE 4AN7A 3LIWA 4INKA 2BD5A 3TGKE 4R8TB 4GHQA 3PTNA 3EA7A 1PPHE 1DWCH 3G01A 2A5IA 1Q2WA 5EODA 2CHAC 4IGDA 1O2GH 1Q31A 1LVBA 2GCHG 1ZHRA 3O8DA 4WXIA 2ZFFH 2HNTF 2FP7B 3RM2H 2G51A 2QA9E 1TAWA 3U69H 3MI4A 2GZ7A 2H9HA 3KQCA 4IC5A 2EI7A 4UDWH 5C20A 1O3BA 3KQEA 4I8HA 4K1EA 1OKXA 1EOLA 4R0IA 1O32A 3PO1B 4Y7AA 1BBRK 4OS2A 2P93A 4IMZA 5T3HA 1J14A 3I78A 1FONA 4ISHH 1C5UA 1EZUC 5F6MA 1SSXA 2AERH 4MTBA 1JOUB 1W13U 2CHAB 1CGJE 2R3YA 2AGEX 1NM6A 3TH4H 1SGDE 2C8YB 2BVSH 1V2TT 1GMCF 1YKTA 1TALA 2CF9H 3U8OH 2F9OA 2NU3E 5IYTA 1O3LA 5HM9A 2Z3DA 4OGXA 1AUJA 1BTPA 4JK6A 3SU0A 2Z9IA 4ZKNU 1K1JA 2BY5X 3I29A 2ZU2A 1QBOA 2F9NA 2R2MB 1MD7A 3DFLA 4CBNA 2D2DA 1PPEE 1C1UH 1KIGH 2FOEA 1ELVA 3P6ZB 3T26A 1ELBA 2P16A 1K1IA 1LPZB 3GY2A 3BG8A 2PWXA 1C5LH 1MCVA 5CHAC 3P8OA 2ZWLH 1K9OE 2IOTA 3FVFB 4M7GA 1O30A 1NFXA 2BMGB 2FWWA 2IJOB 3ATIA 3ZVGA 3LGVA 4Y8XA 4IN1A 3T29A 1W11U 4Z0KA 3UQVA 4BAKB 3ZZ7A 1ZTJA 2SGDE 5E0JA 3LOXA 3ODFA 3PLPA 4AG1A 1FV9A 1K1LA 2ZDAH 4I7YH 3QZRA 2QAAA 1TMBH 3GYLB 4J2YB 1BDAA 1UHBA 2AFQB 2Y5HA 4WY3A 4AB8A 2PR3A 2TBSA 2ZHEH 1LPGB 1WTHD 4OGYA 1HAHH 3ZVDA 1CU1A 4AGJA 1TE0A 3OYPA 1UTOA 2QF0A 2VIPA 4GAWA 4CREA 4D7GA 1LQEA 1LHDH 1FY4A 3HPTB 3SJIA 1AGJA 3V13A 3A85A 1WCZA 4ZXYH 1HJAC 1KXCA 1GMHG 1TB6H 1NT1A 1DVAH 1ZPZA 4YM9A 3LGUA 1D3DB 3RP2A 1AWHB 3SJ8A 1CA8B 3K65B 3QN7A 3UREA 4DURA 1YLDA 2XCNA 2H9TH 1LHGH 1P2OA 4WXVA 4ABFA 2VGCC 1G36A 4K1SA 5ESBA 4H6SB 1KXEA 4CR9A 1V2UT 1E35B 4JZDH 3BF6H 2VIQA 1C2JA 1JWTA 1GI5A 1ELFA 1P10A 1C2EA 3SU4A 4INHA 1WAYB 1K1MA 1FLEE 2GZ9A 2A5AA 4TPIZ 3QK1A 1W10U 4ABAA 2VIOA 4XBCA 1GI7B 4FVDA 4ESTE 5H4IB 3ZVAA 1GJ8B 4WJG2 1LQDB 4DIIH 3W94A 5G4BA 1L1NA 4GCHF 4ABEA 4FU9A 1QQ4A 2A1DB 3BTGE 2WYJA 2ODPA 3S7HB 4XOJA 4U01A 5JDUB 2P3FH 2W3IA 3EA9A 2HPPH 4D76A 2VGCB 4E05H 1GVKB 3VB4A 5E0GA 1GJ9B 4RN6A 1V2VT 3KN2A 3RC6A 3O8RA 1GI2A 1SPJA 1GBDA 5TCAA 1L4ZA 4B76A 5C5NA 2F9UA 4O9VA 3P95A 4Y10E 2OC1A 4H6TA 1C2DA 3C27B 4LZ4B 1O39A 1AZZA 1SG8B 1G32B 4B2AA 1GBBA 2P95A 1P09A 2V0BA 1G2MA 1QTFA 1AD8H 4IS5A 2BQWB 2ZIQH 1BBRE 1BUIA 2IN2A 2KAIA 5K0HA 1VJ9U 3RXKA 1ZTKA 2FTMA 4TY6A 1NS3A 1Y5UT 2O8MA 3RXIA 1UTJA 2C90B 2WUCA 3HATH 1TWXB 1ZGIA 2AGIX 3LONA 1QQUA 1OX1A 2XRCA 1KXAA 3M5NA 1ETRH 1OYQA 1V2KT 2FX6A 3RXCA 3D49H 2XWAA 1XUHA 1V2OT 3BTME 4LXBH 4K69A 2OBQA 2Z3EA 1P2QA 3LKWA 1KXBA 1O3JA 2BY9X 1YPMH 3RLWH 3SUGA 1IQIA 1B0FA 4Q7YA 4A5TS 1F5RA 3LGTA 2H2ZA 4FUGA 3RU4T 1GDUA 1Z8IB 2NWNA 1P0SH 1Z1IA
chains in the Genus database with same CATH superfamily
1TBQH 3E1XB 1CHOG 4ZKSU 4Y8YA 3TJUA 3D23A 1P12E 3ITIA 2A2XH 4ISOA 1QB1A 2IPQX 2JH0D 2ULLA 3LT3A 3PMJA 1UHBB 2OCVB 1GJAB 1Y3YA 5A0BA 4ZUHA 1BB0B 1BTWA 3RC4A 7KMEH 1RS0A 5DK1A 3RMNH 3ZV9A 2ZDVH 4IBLH 3PWBA 1O5AB 1ZPBA 1O3KA 5L30H 3NPSA 3SNBA 1C1OA 1LCYA 4I86A 1MCTA 1EB2A 4O97A 5C94A 1BRCE 1ELEE 1UTNA 1O3IA 2VWLA 1YF4A 1C5MD 2Z9LA 3PYHA 1C5RA 1GL1A 3V7TA 5F03A 3KQBA 3STIA 4ABJA 1WSSH 2XBXA 1NRRH 3ZYEA 1J8AA 1SGTA 2QXIA 1OS8A 1ANEA 1ESTA 1TRNA 4JZEH 4NZLA 3FOAA 3ZZDA 5LGOA 4I32A 3OEHD 5JBBS 1ZMLA 3GDVA 4K60A 1WV7H 5LPFA 2J98A 3MNSA 2P94A 4ZHMU 2PTCE 3FP8E 3TIUA 1L4DA 1NRQH 2A0QB 4OS5A 2FOFA 4OS7A 1W7XH 1RD3B 5JBAS 1QL7A 1LKBA 8LPRA 3LC3A 1YC0A 3MH5A 3AASA 4YT6H 4ABHA 2GZ8A 5L2YH 1PFXC 1S0QA 5ABWA 2J38A 1O5DH 4X6OA 4ZROA 3VPKA 1O3GA 3PM3A 3PRBA 2BTCE 1Y3VA 1OOKB 1GBHA 3DT0H 1QR3E 2FESH 4NIXA 3A7ZA 1B0EA 3U9AH 1KXFA 1TPOA 1DE7H 4NA7A 1F0SA 1O2PA 2THFB 1BOQA 3QX5H 4Y71A 1VJAU 2B8OH 3HGNA 1UVUH 2FMJA 1HAIH 1C9PA 4Q7XA 2BDYA 3K6YA 1ANCA 3SV2H 2A32A 3BTHE 2BD7A 3BTFE 2ZCHP 1O3HA 3NZIA 5EQQA 1YPEH 1QNJA 3I77A 4XBBA 5B6OA 4XFQA 4FETA 4FXGH 1S83A 3MU0A 1O2WA 1G3CA 1N8OC 1FY5A 3ELAH 3OU0A 1KLJH 3BTWE 3GCTF 2KAIB 5A8YA 1PQ7A 2W6ID 4Q63A 1JIMA 3F68H 2KR7A 1GCDA 1O2ZA 1C1PA 3MFJA 1RFNA 2O8TA 1L1GA 2ZGJA 2A31A 1AUTC 4ZH8A 2P59A 1EFRD 3RXFA 5FX5A 1BRUP 2VB0A 1O2OA 2OXSA 4ABIA 2WINI 2OTVA 1TX6A 3E16B 2WV4A 1KSNA 1WUNH 2BD3A 1D9IA 2FIRH 1UCYE 3EE0B 2YMSD 4NGAH 3UIRA 1FZZA 2TIOA 3AW1A 2BQ7B 2SGFE 1EPTC 3MO6A 2GCTC 1MZDA 3RXHA 6GCHF 5K7RA 1BHXB 3VB7A 5L2ZH 3M7UA 2YMSB 1EAIA 5DP8A 2ZA5A 4ZXXH 5LH8A 1IQHA 2ZFPH 1C1VH 2NU2E 3LH1A 2GT8A 3TJVA 3GY4A 2CGAA 2DE8A 2JETC 2FEQH 3Q77A 3Q3XA 3B9FH 1F5KU 1MTUA 3E0NB 4TWWA 5GDSH 5TCCA 4WMEA 1MTNC 1F7ZA 9ESTA 1YLCA 4YLQH 2WYGA 2WPKS 1H8IH 3VB3A 1AZ8A 1FN8A 2W26A 1PPFE 3RXSA 1OP2A 1LVYA 2Z7FE 2QF3A 3R0FA 2Z9JA 2BLQA 3BTQE 1AVGH 1YBWA 2AYWA 3R3GB 2XW9A 5GCHG 2OQ5A 1TONA 3P92A 3CS0A 2OC0A 3UR9A 1EPTB 1Y8TA 2HWLB 4WMDA 2GCTB 3EGKH 2KX4A 7ESTE 2HLDD 1QL9A 1O5GH 1XXDA 2CK3D 4A92A 1SGQE 1TLDA 2CV3A 3GCHC 3TH3H 4BXWA 1N1LA 2VWOA 1IQMA 1GHXH 1QA0A 1P3CA 3SU5A 4FUIA 3M7TA 2XXLA 2EEKA 1QJ7B 2JETB 1IHSH 5DP6A 1EASA 3VXEH 1ZLRA 1O2RA 3TK6A 1GBAA 5F53A 1E37B 1BRBE 1C5WB 1OSSA 1TOMH 2PGQB 2ZHWH 3GY7A 3PTBA 2P8OC 2BZAA 2XBVA 4FUJA 2BDAA 1A5GH 2KFWA 4FVBA 1HAGE 3BG4C 3S69A 1MBQA 1ELGA 3SO3A 2C8ZB 3BEUA 2C8WB 3JZ1B 3VEQB 1BTZA 2R9PA 1QJ6B 1GG6C 1FPHH 1WTGH 1GJCB 8GCHF 1O3EA 3EQ0H 3RXQA 1SGCA 3TPIZ 3ZZ9A 2PUQH 3QZQA 3T2NA 1WQVH 1AO5A 3GCHB 4O3UA 2ASUB 1NPMA 3QLPH 1MKWH 3Q76A 2BX3A 2FS9A 3FZZA 1SLXB 1O3CA 2YNAA 3KGPA 1EJNA 4JYVH 2Y7XA 1NRNH 2BVRH 3IWMA 2P8OB 3MMGA 2XCFA 3LGWA 2A7CA 2B0FA 1YPLH 1C5QA 3F6UH 3BG4B 1VITG 1GBTA 1HAPH 1AMHA 4AFUA 2IJD1 4AGKA 1HLTH 1SHYA 1Z8JB 1V2MT 1WOFA 2NU1E 3A80A 8ESTE 2JJ2D 1TNHA 3PV4A 1SOTA 3MH4A 2ZEBA 1GG6B 2FYQA 2ZFRH 4JYUH 1A3BH 1G3EA 3OFND 1BTHH 2QCYA 1O33A 3GISB 1CSOE 1MD8A 1XKBC 3FP6E 4F49A 1SGIB 1LPKB 4MNYA 2F9BH 1FUJA 1QBVH 1ELCA 1GI0A 3KHVA 2A4RA 2GCHF 4YO9A 1Y3UA 4DY7B 5DP9A 1DLKB 1AN1E 1NRPH 3OAAD 1MTVA 1XKAC 4Z1MD 2ZDKA 4YOJA 3Q3KA 2WPHS 1EKBB 2V6NA 5DP4A 1A5HA 2GJGA 1K1OA 3RU4E 2GD4B 2ZFQH 3VB5A 1H9IE 4O03A 4IN2A 2WPMS 5DPAA 5E8EH 2SGPE 2GMTB 2TGPZ 5L6NH 2F9VA 4GHTA 4E7NA 1TGCA 1TNJA 3MU8A 1OP8A 1TGTA 1AB9C 3A7WA 2QY0B 4WH8A 5T6DA 3A8CA 2PV9B 2Y5FA 1A46H 1C4V2 2ZQ2A 1ESBA 3MQKC 1DWBH 1G9IE 3SI4H 6CHAC 2K8IA 1O5BB 2EA3A 3DSOA 1E38B 1MKWK 2CN0H 1WBGB 3SI3H 1DANH 1QA7A 2PUXB 2Y82A 1ZJKA 4U2WA 1A1RA 2VIDA 3SHCH 1AE5A 4K1TA 3P8GA 4ZAEA 4INLA 3RXOA 3ENSB 1F0RA 2QGRA 4DG4A 1ZTLA 2JJ1D 4NIWA 1A5IA 2BDIA 5JB8S 1W0JD 1PPBH 4FOUC 1CHGA 4B6EA 3OEED 1NFYA 1L0ZA 1OWKA 5KGOA 1ACBE 2ZP0H 5FPSA 1AB9B 1O2JA 4D9QA 1L1JA 5A09A 1M9UA 1O2LA 1DOJA 2G4TA 3QUMP 5EW2H 1DWEH 3A83A 3UOPA 1P04A 3V3MA 1CE5A 2VH6A 4UFEH 1O2QA 1HJ8A 2XTTB 6CHAB 3DHKH 1FX0B 5HYOA 4JYTA 1AKSA 2GKVE 2KCOA 3GDUA 3WY8A 4BOHA 3F3BA 2L6OA 1SVPA 1LKAA 4BAMB 7GCHG 7LPRA 2DUCA 2K1QA 4MQAA 2QF5A 3MYWA 2JDID 1OYTH 3VXFH 3URCA 1C5YB 2ODYB 1C1QA 1A0JA 2LP6A 3QGNB 2J92A 4AZ2B 2ILNA 1HGTH 3GS9A 5F8ZA 2CMYA 1H9LB 2W5EA 1HDTH 1UK4A 2V3OH 4OS1A 2BOKA 1MQ6A 2QXJA 1NROH 4Y8ZA 2GDDA 1T32A 3ATLA 3PMAB 1FAXA 1H8HD 3UR6A 1GMHF 1TNIA 1PQ5A 3LH3A 1INCA 1YLNA 4BAHB 5BRRE 1FPCH 1HUTH 1UCYH 2CF8H 3S9BA 2VWNA 1EZSC 4ASHA 3KF2A 1SR5C 2FI4E 2GVFA 2OP9A 2O8LA 1C1TA 1IOEA 2TRMA 5CMXH 1XUKA 3SV6A 1AU8A 2AGGX 3Q3YA 1TQ0B 3MHWU 4A1XA 4JZIA 4K3JA 9LPRA 1H4WA 4X1QU 2BLOA 2LELA 2PSXA 3VFEA 4B6FA 2ZHFH 5A0CA 3LGYA 1V2QT 5C3NA 4X0WU 1OXGA 4AORA 1EUFA 1CGHA 1T8MA 1D6RA 2AMQA 2FOMB 3CENA 1AFQB 3RMLH 1CVWH 3SJ9A 2ZGHA 2TGAA 4ABDA 3LJOA 3DCLA 2W7UA 4AB9A 1NESE 2I6SA 3SHAH 1W0KD 3IG6B 2WHXA 2F43B 1H8DH 1BIOA 2JH5D 3ZZAA 2A2QH 1UW7A 3U1JB 4CRAA 1PJPA 2BD8A 1BA8B 1EOJA 5FPTA 4Y0YE 3RXJA 3KIDU 4A6LA 1GCTC 3TGIE 1XUFA 3SJOA 2Y7ZA 4B1TA 1Y3WA 4NIVA 5ESTE 4X1RU 1EAWA 1KY9A 5DP7A 1MMJN 1A7SA 2AEIH 2H9EH 2VVUA 1SFIA 1BITA 1ETSH 1PYTD 1JRTA 3E0PB 3RMOH 4ABGA 2ZPQA 4KTUA 1T8NA 1ZPCA 2WV9A 1P57B 1DICA 1KDQB 1DWDH 1IQFA 1BCUH 3A7YA 1V2JT 2PP6A 4ZHLU 5C67A 2V35A 3NXPA 2QE7D 4FUHA 2ZGCA 1V2PT 3NKKA 3M3SA 3MTYA 1P2MA 4CRGA 2ANMH 1UCYK 4X8VH 3ZVBA 1O5FH 3SQHE 2RFKC 1FY8E 3T28A 1TBZH 2FODA 2QF4A 3SBKA 2HVXA 2FM2A 4E06H 5DP3A 1GBKA 2QN5T 2FI5E 4U30A 1GCTB 3UNQA 2RA3A 1HB0B 1NRSH 2Z6BD 1NBMD 2Z94A 3SQEE 4HTCH 3NUMA 1MAYA 2VU8E 1Z71A 4IMQA 3MOCA 2XBWA 1S6LA 2G00A 3A88A 1J16A 5FBIA 2J2UA 1MTWA 3EDXB 1O3PB 2UUYA 2VIWA 4HZHA 4YXWD 2Q6DA 1HV7A 1TQ7B 1SLVB 4U32A 3SU3A 2ZECA 1AKSB 1CHOF 4I8GA 4KGAA 2V3HH 1S0RA 1IQGA 2EQNA 3OTPA 3O8CA 2BY6X 1Y59T 1GI4A 2KCYA 1K21H 3SU1A 3MU4A 1G3DA 1GBEA 3F9FA 1S84A 2ZFSA 3UNRA 1E0FD 3EAJA 1FIWA 3M7QA 2PTNA 3H7OA 1LTOA 5E2PA 4TWYA 3P8NA 3A7XA 1QRZA 2FLBH 2UUKB 4ISLA 1C9TA 4IW4E 1HAVB 2A4QA 3BTEE 1ESAA 3UAIC 1C2HA 3FZDA 2ZTZA 2XNDD 1QCPA 2UWLA 1BTUA 1DUEA 3OY5U 4X8UH 1EPTA 2ANKH 4Y79A 1DITH 1ABIH 1H9HE 1O3MA 4RSPA 1DFPA 2OQUA 4B75A 3ATKA 4DCDA 1C5VA 5KEDA 1A61H 2QIQA 2EY4C 3SUFA 1V6DA 1DXWA 1NY22 1FY1A 2WUBA 3TLOA 5IDKA 3TK5A 1U6QA 1UO6A 3RXAA 4CBOA 3M37A 1C1WH 2W3KA 2G5NA 1OWJA 2PKAA 5FCRA 3BTTE 1XUGA 3A8BA 1QL8A 3ZZ5A 5JYIA 1O3DA 5EXMA 1C5ZB 4THNH 3WWBA 4Y76A 1K2I1 1UTKA 1MAXA 4SGBE 3RLYH 1C5OH 3GOVB 1GGDC 2VH0A 1QRWA 1O38A 1EZXC 5GJ4B 2BDBA 2JIZD 3ODDA 1P2IA 4X6PA 2JKHA 3ATMA 1SOZA 3SJKA 4XBDA 3OTJE 2IPHA 3K6ZA 3LPRA 2PKSB 3FP7E 3STJA 5F8TA 1VCWA 1D3QB 3VGCB 3DUXH 4FUCA 1TPSA 2ZDMA 4A1TA 3SW2B 2XC0A 1GBIA 2ZGBH 3KQDA 1RJXB 6LPRA 1VZQH 1MKXH 1P2JA 2VVVA 2UWPA 1AI8H 1S6HA 1GHWH 1YWUA 3CS7A 2ZPSA 4JZ1A 1THPB 3GCOA 3UB0A 1O2TA 1E34B 4I31A 4YOGA 1SMFE 5DKMA 1UVPA 2FDAA 3L6PA 2I6QA 3RC5A 2C4FH 3EE7A 4NWLA 1BMLA 2YMSC 1H1BA 2OK5A 1GGDB 1SI5H 3SNAA 1ARCA 3F0OA 1O5CB 2Q6FA 1TPAE 2RDLA 2QYIA 1S5SA 3M61U 1ZRBA 2Z3CA 1HCGA 1WYKA 1Q3XA 2G52A 1TA6A 3PB1E 5DG6A 1O2KA 1XUJA 3UFAA 1WQSA 5EXLA 3KCGH 5AFYH 1HXEH 4AFZA 1F0UA 1YPKH 2HNTC 1JRSA 3KQ5A 1FN6A 3F2FA 2D8WA 1T7CA 5C1YA 1O2NA 1HXFH 4YESB 3NWUA 5F8XA 1OWEA 2BD2A 1V2NT 2ZDLA 4AC9A 3A7VA 2GV7A 1GHAG 4UEHH 3SZNA 3ZZ6A 1C5TA 1DLEA 3F2HA 3CP7A 3FN8A 3RXGA 2OINA 4KKDA 4QT8C 2WPIS 3KYFA 5IK2D 2J9NA 3RUOA 5EOKA 3SU2A 1GMDG 2BB4A 3M3VA 1SFQB 4AYVB 1BT7A 3PROA 2FLRH 5CE1A 2Z9KA 5PTPA 1XX9A 5CHBA 1ZGVA 1W12U 3RMMH 1P05A 2VINA 4AOQA 1T8OA 3M35A 3SV7A 3ZVFA 1NO9H 1O3AA 1MKXK 4TYDA 3LC5A 1K0HA 3E90B 2PFEA 1DY9A 4ISNA 2ZG0H 1HNEE 5JPMH 1C2FA 2PLXA 3N7DA 5GCHF 2G81E 1GBLA 2J94A 1TX8A 4Y0ZE 1S85A 4LOYH 5T6GA 3F0PA 1YYY1 3GY5A 4Q7ZA 5FXLA 5JBTA 4NFFA 1SGRE 1TA2A 3ZVEA 3RXLA 1NZQH 1GHBG 4UE7H 1DX5M 3SGAE 1FAKH 1SGNE 3EYDA 1GVZA 2PGBB 3E6PH 3WWFA 3GY8A 2GGVB 1EB1H 2F91A 4MLFB 1NTPA 5A8ZA 8KME2 4Y7BA 5EQSA 5JB9S 1LDTT 2PKAB 2BHGA 5FPYA 4AX9H 4I8LA 4TPYA 4X6MA 4B2CA 1C1RA 3T27A 1OWHA 1BRAA 1W0YH 4I33A 2ALVA 4NWKA 1YPJH 3BN9A 3SN8A 1EXFA 1O2VA 4WF8A 2OLGA 1UTLM 2DE9A 2JH6D 3UPEA 5GWZA 3FKSD 1RTFB 1SLUB 2ESTE 1TNKA 3RXUA 3RM0H 2CJIA 2ZU1A 2BDCA 1YCPH 1F5LA 1BMMH 1VGCC 2V7QD 1DT2A 1ZZZA 2BOHB 4RI0A 1YPHE 2OC7A 2ZDNA 1ZOMA 1AY6H 2FOCA 4DT7B 2B7DH 2OBOA 2NU0E 3QWCH 2FO9A 1CQQA 1ID5H 2HGTH 2G55A 2XC4A 4UFFH 3BIUH 2V3MA 4PROA 3H5CB 3U98H 1A3EH 4ISIH 1Z6JH 2FX4A 4X2WA 3D62A 3V0XA 1GWAA 1VITF 1QBNA 1A2CH 2O9QA 2STBE 2GMTC 2D1JA 2RA0A 4YZUA 4FUFA 1FMGA 1LO6A 1DSTA 2SNWA 1V3XA 2Y6TA 1PQAA 3N99A 4D9RA 1JXPA 1N6YA 3UOUA 1TMTH 5GIBA 1ETTH 1VGCB 1BZXE 5C1UA 4UD9H 5FHTA 5CDFE 3BTDE 2ZKSA 3P70B 3SNEA 2AH4X 2Q1JA 2XNIA 5EPYA 1AIXH 1QGFA 1P9UA 3MH6A 1SQAA 2K0QA 1UK2A 4B71A 3SGQE 4ASUD 4J1YA 2ZTXA 1BHXF 2H6MA 3F9EA 3UY9A 2OC8A 2AS9A 1NFWA 1EATA 6ESTA 3UTUH 1CBWB 2XWBI 2FPZA 2HVYB 1JIRA 1P8VC 1EP6A 2KM0A 3AAUA 1G3BA 4BTIB 1J17T 5EGMA 1QFKH 1P01A 1TIOA 3DSPA 4NSYA 4BAOB 1NFUA 1V2WT 3MH7A 3TGJE 4NA8A 4BTTB 1HAXB 1NN6A 1C1SA 1YCPK 4UFGH 4NIYA 2LPRA 3E91A 3K9XB 5HM2A 2BY8X 1Z8RA 1C1MA 4KELA 3PLBA 1OP0A 3ZZCA 1KDQA 4XE4A 2SNVA 1SGFG 1O3OA 1ELDE 3D65E 3N7EA 1UMAH 3ZZ4A 2FYRA 3NRLA 1TBRH 5EU8A 3SNDA 1XUIA 1RIWB 4MPXA 4OS4A 1QRXA 3RXRA 2TPIZ 3E3TA 5DN6D 1AE8H 5AHGH 4DGJA 2FXRA 2ZHDA 1WDIA 3TJOA 2BLVA 3NK8A 2AMPA 4B2BA 3HKIB 1CA0C 2VIVA 5GPIB 1LHFH 2FS8A 1IQEA 2BDHA 5EPNA 2ZCLP 5J4SA 2ODQA 3BV9B 5DP5A 1YM0A 3LDXH 4GSOA 4K5ZA 4DVAU 4CH8B 3GDSA 3F9GA 1SGPE 2AMDA 1C2GA 4AG2A 1C2MA 2AIPA 1GMCG 5TJXA 2VNTA 1D4PB 3PLKA 1O2SA 1SLWB 2B9LA 4Q80A 3A89A 1O2IA 3TITA 4BAQB 1C2IA 1SBWA 1C5XB 1MTSA 1DSUA 1O2YA 2OUAA 4GPGA 5C17A 1SGYE 4FUBA 1F92A 2GDEH 1HIAB 1GI6A 1TRYA 1TGNA 1J9CH 7GCHF 3EA8A 3FAOA 2FOBA 4Z6AH 5I46H 4E7RG 2FOAA 1IHTH 3A7TA 3TVJB 1Z7KA 1IQKA 1O36A 2A5KA 4MPVA 3S0NA 1CA0B 4FUEA 4MPUA 1PPCE 3IITA 3TNTA 1GL0E 3NCLA 3PV5A 1EAUA 2GV6A 1KTSB 4ZMAH 1IQLA 4I8JA 1AFQC 4H4FA 3H7TA 3QTVH 4X1NU 1O0DH 3PMBB 1HAVA 1FIZA 3GY6A 1O2HA 2VJ1A 5HKKD 5C0TA 2UWOA 4Y6DA 1KXDA 4K8YA 3FANA 1ZRKA 3QGJA 1ELTA 1SGEE 1FJSA 4Q4LA 1EZQA 1YPHC 4A1VA 1TNLA 1T4UH 1OWIA 3CNRA 1J15A 3SNCA 4X2XA 3ZIAD 3BIVH 4UFDH 1HFDA 1T4VH 3A8DA 1GI8B 1GJ4H 3TK9A 2HPQH 1P11E 1P2KA 4HG6A 4CRCA 3AK5A 3SGBE 3PWCA 1TPPA 2J4IA 1C1NA 3MO3A 1THSH 3SV9A 4ZKOU 3F2GA 4TT3D 5CHAB 3MU5A 4UONA 1O2XA 2A7HA 2FTLE 2KZ4A 1BMNH 3ESTA 5AF9H 3KNXA 4NFEA 1EAXA 3F1SB 3AAVA 1PYTC 1BMAA 1O35A 2BD4A 2HRVA 5LPEA 4JMYA 3TH2H 3AVZA 4MNXA 2WV5A 5EJLA 2EI8A 2G4UA 4KTCA 4DIHH 2EI6A 1NC6A 4NSVA 1ZSKA 3U28C 4CRDA 4HI3A 1ZMNA 5FX6A 1PPGE 1OPHB 1L2EA 4CHAC 3A82A 1TRMA 4X8TH 1ZYOA 5A2MH 4MG3A 2BM2A 1C5SA 3N7OA 1YGCH 4RKOB 1Y5BT 3RXEA 4H42U 4AFSA 1LMWB 2J34A 1HJAB 4BXSA 3ZVCA 1B5GH 5AFZH 1GPZA 1QJ1B 1ZJDA 4ZHAA 4GCHG 1QIXB 1MQ5A 4X2YA 1FXYA 2BXUH 4F48B 3UNSA 3MO9A 2XC5A 2HNTE 3P8FA 3UQOA 1G37A 4GUXA 4OS6A 1MZAA 4DW2U 1XVOA 2O8WA 3T62A 1SQRA 1TGBA 4BTUB 3BEFB 1THRH 1D3PB 4B73A 3M5MA 3E8LA 4GLYA 4BANB 1PQ8A 2BXTH 4RT1A 3P17H 1C5NH 4GVUA 2SGEE 4ZKRU 1ZR0A 1G30B 2W7SA 4CHAB 3A81A 5T6FA 1O34A 3RXMA 2BX4A 1BTYA 2SGAA 3HKJB 3U8RH 1S6FA 1G2LA 2H5CA 4HFPB 3L3TA 3GY3A 4XD7D 4RKJB 1O3NA 1P3EA 1W3CA 1HAOH 1IQJA 2HALA 2KCPA 3MNXA 1HRTH 5T1VA 1FI8A 1BJVA 3MNCA 5LPRA 5EG4A 4YOIA 3RU4D 2XOKD 1ANBA 1QY6A 1HBTH 4D7FA 4FU7A 1GHZA 4MNVA 2YNBA 1UTPA 1CT0E 3HK3B 1P9SA 2FOHA 2GP9B 1XMNB 1EX3A 2Y81A 5FAHA 3SOSA 1V2RT 2WZQA 1Y5AT 1UVSH 1GJ6A 2ZU4A 2BQ6B 5ETXA 1BJUA 1W2KH 2FOGA 1JBUH 1W7GH 4BNRA 3SV8A 1W8BH 3OSYA 1GHVH 1F2SE 3A8AA 1GDQA 4O3TA 2F3CE 5C2ZA 3RXBA 1S82A 1AVXA 1N6XA 5EW1H 1DM4B 4TY7A 2BYAX 2QXGA 1DY8A 1SGFA 4MDSA 2ZCKP 4X1PU 1RTKA 1EP5A 1HAZB 1MABB 5I25A 2B5TB 2M5TA 1GI9B 3LU9B 2PKSC 3U8TH 2GX4A 3SUDA 1CO7E 3U1IB 3VGCC 2RCEA 2UUFB 4YT7H 3DA9B 3MNBA 3S9AA 1SC8U 1ELAA 1ZSJA 1AQ7A 4CR5A 2BD9A 2A4OA 1EJMA 1ZHMA 1C4Y2 1LHCH 2QXHA 3PMHB 1FNIA 2A7JA 3VG8A 2CXVA 1PPZA 1GJ5H 1Y3XA 1XVMA 1WU1A 4KP0A 3K2UA 1A0LA 4NZQA 4P02A 2R3UA 3A87A 2BZ6H 1T8LA 2PSYA 1Z1JA 4MVNA 4F55A 5GXPA 4LZ1H 3O8BA 1GJBB 2O8UA 3GICB 1DDJA 2HLCA 1UVTH 4HGCA 3BEIB 4DOQA 3LGIA 3ZZBA 1GHYH 4B74A 1ABJH 1ARBA 2ALPA 3A84A 1MU8B 1SKYE 2FZZA 4XRNA 3TU7H 2XYAA 3RXPA 1DUAA 2WPJS 1XXFA 3M3TA 2BVXH 3TJNA 1DS2E 3PRDA 5E0HA 2ZNKH 1IAUA 2H1UA 1GBCA 5HXFA 3S7KB 1OWDA 3KL6A 2G5VA 3F9HA 2F83A 3LJJA 5EQRA 2P3TB 2RG3A 2SFAA 5EXNA 2PW8H 1ZMJA 2RDEA 3UWIA 1X7AC 1KYNA 1RRKA 1K1PA 4K2YA 1TOCB 3SU6A 3T25A 1GVLA 3OX7U 2XBYA 1B7XB 3QO6A 4YTAA 5JBCS 3SORA 1SL3A 1LHEH 1C4U2 1W14U 2WSSD 2Y80A 3RXTA 4NCYA 1HAYB 1YP9A 1VCPA 2ZU5A 1UK3A 2ZO3H 2LNCA 1NU9A 2ZQ1A 3RDZA 2UUJB 3BSQA 4Y11E 3JZ2B 1SHHB 4DJZB 2R2WU 2VVCA 1LVMA 1UTQA 2YOLA 1KLIH 2C93B 2ZFTA 1LVOA 2ZGXH 2ZZUH 1K1NA 3SUEA 1YCPM 2AIQA 4FUDA 1VCQA 1FQ3A 1D3TB 3M5OA 3GCTG 3BTKE 1IQNA 1TABE 1HYLA 3QDZB 1GHAF 2QV1A 3QTOH 4NA9H 1AHTH 2C3SA 4I8KA 1GDNA 3L33A 5DJ7A 1TNGA 4IC6A 5E2OA 1GBJA 3OE7D 3ZZ8A 5HGGA 1GMDF 4D8NA 1NU7B 1VR1H 4JCNA 5DO4H 4CRBA 1CT4E 4X8SH 4ACBA 1BTXA 2TGDA 1DXPA 4AFQA 1QHRB 3C1KA 1C5PA 2J95A 2ZHQH 1ZHPA 2ZC9H 1K22H 2P3UB 1S81A 1CT2E 4VGCC 5DSFA 3W95A 4A7IB 6GCHG 4X2VA 2R0KA 3GCNA 2PHBA 4MPWA 1VITH 3KEEA 2Q6GA 2H5DA 2ZF0H 1F0TA 1HJ9A 1N8OB 2R0LA 2STAE 5J4QA 1Z6EA 3Q00A 2SGQE 1TFXA 1AVWA 4CH2B 2VBCA 4JZFH 4KTSA 1RXPA 2ZTYA 5DGJA 1TMUH 4X1SU 4FU8A 1AWFH 3KYGA 4YLUA 1A4WH 1W0ZU 1RGQA 1MU6B 3MU1A 4LK4A 1GHBF 1ZSLA 3VB6A 1CGIE 1O5EH 2ANWA 5EJZA 1GBMA 5EIYA 1K28D 1P03A 1T31A 1EQ9A 1ORFA 3SYJA 3RXDA 1V2LT 2D26C 1DPOA 1OHHD 2HOBA 4K8BA 4VGCB 5FBEA 2W6JD 3GYMA 2QC2A 3ATWA 4XDEA 3S9CA 1EJAA 5FCKA 3M5LA 1TX7A 3HK6B 4XSKU 2ANYA 5SGAE 1GBFA 1MH0A 1HIAA 1QB6A 1SB1H 2Z9GA 3OY6U 1GJDB 3HGPA 5GNDA 4F4OC 1XM1A 1O37A 1SQTA 2GTBA 3DD2H 1E1QD 1GI1A 5EJ1A 5BPEA 5A0AE 1MTNB 3V12A 3A86A 2J98B 1TYNA 1UVOA 1MBMA 1QB9A 2F9PA 1V2ST 3FFGA 4WWYA 1ANDA 3ZV8A 4ABBA 3B23B 1RTLA 1O3FA 3MWIU 1HPGA 5C5OA 3ZYDA 1KLTA 2EC9H 4JK5A 2VWMA 4NG9H 2ZU3A 3SZEA 3ZZ3A 1MUEB 1VKYA 1KTTB 2OD3B 1E36B 1UJ1A 1BBRH 1BQYA 1O31A 3UUZA 4CRFA 1E79D 1D6WA 3RXVA 1C2KA 1AFEH 1CBWC 8GCHG 1GJ7B 1YPGH 4WH6A 5A8XA 3T5FH 1JMOH 3AW0A 3B8JA 2A45B 3DFJA 1UTMA 1P2NA 4WMFA 4X6NA 2A4GA 5C1XA 1SQOA 1C2LA 2BY7X 5HMAA 1O2UA 2GT7A 2WPLS 3URDA 2BDGA 4SGAE 2BLWA 3TNSA 1GI3A 4AYYB 4Q2KA 2ZI2H 2NU4E 1TGSZ 1A0HB 3M36A 4OM9A 5FL7D 4MNWA 5AVDA 2ZPRA 2G8TA 1QURH 1RIWC 2C8XB 3PO1C 2Y5GA 2FI3E 1FY3A 3W1EA 1P02A 3UWJH 1FDPA 1P06A 1O2MA 2TGTA 1Z8GA 4WVPE 4AN7A 3LIWA 4INKA 2BD5A 3TGKE 4R8TB 4GHQA 3PTNA 3EA7A 1PPHE 1DWCH 3G01A 2A5IA 2WPDD 4TSFD 1NBME 1Q2WA 5EODA 2CHAC 4IGDA 1O2GH 1Q31A 1LVBA 2GCHG 5B6LA 1ZHRA 3O8DA 1E1RD 4WXIA 2ZFFH 2HNTF 2FP7B 4P00A 3RM2H 2G51A 2QA9E 1TAWA 2KCAA 3U69H 3MI4A 2GZ7A 2H9HA 3KQCA 4IC5A 2EI7A 4UDWH 5C20A 1O3BA 3KQEA 4I8HA 1BMFD 4K1EA 1OKXA 1EOLA 4R0IA 1O32A 3PO1B 5KECA 4ACAA 4Y7AA 1BBRK 4OS2A 2P93A 4IMZA 5T3HA 1J14A 3I78A 1FONA 2L74A 4ISHH 1C5UA 1EZUC 5F6MA 1SSXA 2AERH 1H8ED 4MTBA 1JOUB 1W13U 2CHAB 1CGJE 2R3YA 2AGEX 1NM6A 3TH4H 1SGDE 2C8YB 2BVSH 1V2TT 1GMCF 1YKTA 1TALA 2CF9H 3U8OH 2F9OA 2NU3E 5IYTA 1O3LA 5HM9A 2Z3DA 4M9FA 4OGXA 1AUJA 1BTPA 4JK6A 3SU0A 2Z9IA 4ZKNU 3FO8D 1K1JA 2BY5X 3I29A 2ZU2A 1QBOA 2F9NA 2R2MB 1MD7A 3DFLA 4CBNA 2D2DA 1PPEE 1C1UH 1KIGH 2FOEA 1ELVA 3P6ZB 3T26A 1ELBA 2P16A 1K1IA 1LPZB 3GY2A 3BG8A 2PWXA 1C5LH 1MCVA 5CHAC 3P8OA 2ZWLH 1K9OE 2IOTA 3FVFB 4M7GA 1O30A 1NFXA 2BMGB 2FWWA 2IJOB 3ATIA 3ZVGA 3LGVA 4Y8XA 4IN1A 3T29A 1W11U 4Z0KA 3UQVA 4BAKB 3ZZ7A 2AHME 1ZTJA 2SGDE 5E0JA 3LOXA 3ODFA 3PLPA 4AG1A 1FV9A 1K1LA 2ZDAH 4I7YH 3QZRA 2QAAA 1TMBH 3PV2A 3GYLB 4J2YB 1BDAA 1UHBA 2AFQB 2Y5HA 4WY3A 4AB8A 2PR3A 2TBSA 2ZHEH 1LPGB 1WTHD 4OGYA 1HAHH 3ZVDA 1CU1A 4AGJA 1TE0A 3OYPA 1UTOA 2QF0A 2M2AA 2VIPA 4GAWA 4CREA 4D7GA 1LQEA 1LHDH 1FY4A 3DSGA 3HPTB 3SJIA 1AGJA 3V13A 2J5UA 3A85A 1WCZA 4ZXYH 4DT4A 1HJAC 1KXCA 1GMHG 1TB6H 1NT1A 1DVAH 1ZPZA 4YM9A 3LGUA 1D3DB 3RP2A 1AWHB 3SJ8A 1CA8B 2J97A 3K65B 3QN7A 3UREA 4DURA 1YLDA 2XCNA 2H9TH 1LHGH 1P2OA 4WXVA 4ABFA 2VGCC 1G36A 4K1SA 5ESBA 4H6SB 1KXEA 4CR9A 1V2UT 1E35B 4JZDH 3BF6H 2VIQA 1C2JA 5HIZA 1JWTA 1GI5A 1ELFA 1P10A 1C2EA 3SU4A 4INHA 1WAYB 1K1MA 1FLEE 2GZ9A 2A5AA 4TPIZ 3QK1A 1W10U 4ABAA 2VIOA 4XBCA 1GI7B 4FVDA 4RT0A 4ESTE 4ZCNA 5H4IB 3ZVAA 1GJ8B 1WXRA 4WJG2 1LQDB 4DIIH 3W94A 5G4BA 1L1NA 4GCHF 4ABEA 4FU9A 1QQ4A 5HIYA 5C0UA 2A1DB 3BTGE 2WYJA 2ODPA 3S7HB 4XOJA 4U01A 5JDUB 2P3FH 2W3IA 3EA9A 2HPPH 4D76A 2VGCB 4E05H 1GVKB 3VB4A 5E0GA 1GJ9B 4RN6A 1V2VT 3KN2A 3RC6A 3O8RA 1GI2A 1SPJA 1GBDA 5TCAA 1L4ZA 3H09A 4B76A 5C5NA 2F9UA 4O9VA 3P95A 4Y10E 2OC1A 4H6TA 1C2DA 3C27B 4LZ4B 1O39A 1AZZA 1SG8B 1G32B 4B2AA 1GBBA 1P09A 2P95A 2V0BA 1G2MA 1QTFA 3WW7A 1AD8H 4IS5A 2BQWB 2ZIQH 1BBRE 1BUIA 2IN2A 2KAIA 5K0HA 1VJ9U 3RXKA 1ZTKA 2FTMA 4TY6A 1NS3A 1Y5UT 2O8MA 3RXIA 1UTJA 2C90B 2WUCA 1YY3A 3HATH 1COWD 1TWXB 1ZGIA 2AGIX 3LONA 1QQUA 1OX1A 2XRCA 1KXAA 3M5NA 1ETRH 1OYQA 1V2KT 2FX6A 3RXCA 3D49H 2XWAA 1QZ8A 1XUHA 1V2OT 3BTME 4LXBH 4K69A 2OBQA 2Z3EA 1P2QA 3LKWA 1KXBA 1O3JA 2BY9X 1YPMH 3RLWH 3SUGA 1IQIA 1B0FA 4Q7YA 4A5TS 1KMHB 1F5RA 3LGTA 2H2ZA 4FUGA 2F4LA 3RU4T 1GDUA 1Z8IB 2NWNA 1P0SH 1Z1IA
chains in the Genus database with same CATH topology
1TBQH 3E1XB 1CHOG 4ZKSU 4Y8YA 3TJUA 3D23A 1P12E 3ITIA 2A2XH 4ISOA 1QB1A 2JH0D 2ULLA 3LT3A 3PMJA 1UHBB 2OCVB 1GJAB 1Y3YA 5A0BA 4ZUHA 1BB0B 1BTWA 3RC4A 7KMEH 1RS0A 5DK1A 3RMNH 3ZV9A 2ZDVH 4IBLH 3PWBA 1O5AB 1ZPBA 1O3KA 5L30H 3NPSA 3SNBA 1C1OA 1LCYA 1MCTA 1EB2A 4O97A 1BRCE 1ELEE 1UTNA 1O3IA 2VWLA 1YF4A 1C5MD 2Z9LA 3PYHA 1C5RA 1GL1A 3V7TA 5F03A 3KQBA 3STIA 4ABJA 1WSSH 2XBXA 1NRRH 3ZYEA 1J8AA 1SGTA 2QXIA 1OS8A 1ANEA 1ESTA 1TRNA 4JZEH 4NZLA 3ZZDA 5LGOA 4I32A 5JBBS 1ZMLA 3GDVA 4K60A 1WV7H 5LPFA 3MNSA 2P94A 4ZHMU 2PTCE 3FP8E 3TIUA 1L4DA 1NRQH 2A0QB 4OS5A 2FOFA 4OS7A 1W7XH 1RD3B 5JBAS 1QL7A 1LKBA 8LPRA 3LC3A 1YC0A 3MH5A 3AASA 4YT6H 4ABHA 2GZ8A 5L2YH 1PFXC 1S0QA 5ABWA 2J38A 1O5DH 4X6OA 4ZROA 3VPKA 1O3GA 3PM3A 2BTCE 1Y3VA 1OOKB 1GBHA 3DT0H 1QR3E 2FESH 4NIXA 3A7ZA 1B0EA 3U9AH 1KXFA 1TPOA 1DE7H 4NA7A 1F0SA 1O2PA 2THFB 1BOQA 3QX5H 4Y71A 1VJAU 2B8OH 3HGNA 1UVUH 2FMJA 1HAIH 1C9PA 4Q7XA 2BDYA 3K6YA 1ANCA 3SV2H 2A32A 3BTHE 2BD7A 3BTFE 2ZCHP 1O3HA 3NZIA 5EQQA 1YPEH 1QNJA 3I77A 4XBBA 5B6OA 4XFQA 4FXGH 1S83A 3MU0A 1O2WA 1G3CA 1N8OC 1FY5A 3ELAH 3OU0A 1KLJH 3BTWE 3GCTF 2KAIB 5A8YA 1PQ7A 1JIMA 3F68H 1GCDA 1O2ZA 1C1PA 3MFJA 1RFNA 2O8TA 1L1GA 2ZGJA 2A31A 1AUTC 4ZH8A 2P59A 3RXFA 5FX5A 1BRUP 2VB0A 1O2OA 2OXSA 4ABIA 2WINI 2OTVA 1TX6A 3E16B 2WV4A 1KSNA 1WUNH 2BD3A 1D9IA 2FIRH 1UCYE 3EE0B 4NGAH 3UIRA 1FZZA 2TIOA 3AW1A 2BQ7B 2SGFE 1EPTC 3MO6A 2GCTC 1MZDA 3RXHA 6GCHF 5K7RA 1BHXB 3VB7A 5L2ZH 3M7UA 1EAIA 5DP8A 2ZA5A 4ZXXH 5LH8A 1IQHA 2ZFPH 1C1VH 2NU2E 3LH1A 2GT8A 3TJVA 3GY4A 2CGAA 2DE8A 2JETC 2FEQH 3Q77A 3Q3XA 3B9FH 1F5KU 1MTUA 3E0NB 4TWWA 5GDSH 5TCCA 4WMEA 1MTNC 1F7ZA 9ESTA 1YLCA 4YLQH 2WYGA 2WPKS 1H8IH 3VB3A 1AZ8A 1FN8A 2W26A 1PPFE 3RXSA 1OP2A 1LVYA 2Z7FE 2QF3A 3R0FA 2Z9JA 2BLQA 3BTQE 1AVGH 1YBWA 2AYWA 3R3GB 2XW9A 5GCHG 2OQ5A 1TONA 3P92A 3CS0A 2OC0A 3UR9A 1EPTB 1Y8TA 2HWLB 4WMDA 2GCTB 3EGKH 7ESTE 1QL9A 1O5GH 1XXDA 4A92A 1SGQE 1TLDA 2CV3A 3GCHC 3TH3H 4BXWA 1N1LA 2VWOA 1IQMA 1GHXH 1QA0A 1P3CA 3SU5A 4FUIA 3M7TA 2XXLA 2EEKA 1QJ7B 2JETB 1IHSH 5DP6A 1EASA 3VXEH 1ZLRA 1O2RA 3TK6A 1GBAA 1E37B 1BRBE 1C5WB 1OSSA 1TOMH 2PGQB 2ZHWH 3GY7A 3PTBA 2P8OC 2BZAA 2XBVA 4FUJA 2BDAA 1A5GH 4FVBA 1HAGE 3BG4C 3S69A 1MBQA 1ELGA 3SO3A 2C8ZB 3BEUA 2C8WB 3JZ1B 3VEQB 1BTZA 2R9PA 1QJ6B 1GG6C 1FPHH 1WTGH 1GJCB 8GCHF 1O3EA 3EQ0H 3RXQA 1SGCA 3TPIZ 3ZZ9A 2PUQH 3QZQA 3T2NA 1WQVH 1AO5A 3GCHB 4O3UA 2ASUB 1NPMA 3QLPH 1MKWH 3Q76A 2BX3A 2FS9A 3FZZA 1SLXB 1O3CA 2YNAA 3KGPA 1EJNA 4JYVH 2Y7XA 1NRNH 2BVRH 3IWMA 2P8OB 3MMGA 2XCFA 3LGWA 2A7CA 2B0FA 1YPLH 1C5QA 3F6UH 3BG4B 1VITG 1GBTA 1HAPH 1AMHA 4AFUA 4AGKA 1HLTH 1SHYA 1Z8JB 1V2MT 1WOFA 2NU1E 3A80A 8ESTE 1TNHA 3PV4A 1SOTA 3MH4A 2ZEBA 1GG6B 2FYQA 2ZFRH 4JYUH 1A3BH 1G3EA 1BTHH 2QCYA 1O33A 3GISB 1CSOE 1MD8A 1XKBC 3FP6E 4F49A 1SGIB 1LPKB 4MNYA 2F9BH 1FUJA 1QBVH 1ELCA 1GI0A 3KHVA 2A4RA 2GCHF 4YO9A 1Y3UA 4DY7B 5DP9A 1DLKB 1AN1E 1NRPH 1MTVA 1XKAC 2ZDKA 4YOJA 3Q3KA 2WPHS 1EKBB 2V6NA 5DP4A 1A5HA 1K1OA 3RU4E 2GD4B 2ZFQH 3VB5A 1H9IE 4O03A 4IN2A 2WPMS 5DPAA 5E8EH 2SGPE 2GMTB 2TGPZ 5L6NH 2F9VA 4GHTA 4E7NA 1TGCA 1TNJA 3MU8A 1OP8A 1TGTA 1AB9C 3A7WA 2QY0B 4WH8A 5T6DA 3A8CA 2PV9B 2Y5FA 1A46H 1C4V2 2ZQ2A 1ESBA 1DWBH 1G9IE 3SI4H 6CHAC 1O5BB 2EA3A 1E38B 1MKWK 2CN0H 1WBGB 3SI3H 1DANH 1QA7A 2PUXB 2Y82A 1ZJKA 4U2WA 1A1RA 2VIDA 3SHCH 1AE5A 4K1TA 3P8GA 4ZAEA 4INLA 3RXOA 3ENSB 1F0RA 2QGRA 4DG4A 1ZTLA 4NIWA 1A5IA 2BDIA 5JB8S 1PPBH 1CHGA 1NFYA 1L0ZA 1OWKA 1ACBE 2ZP0H 5FPSA 1AB9B 1O2JA 4D9QA 1L1JA 5A09A 1M9UA 1O2LA 1DOJA 2G4TA 3QUMP 5EW2H 1DWEH 3A83A 3UOPA 1P04A 3V3MA 1CE5A 2VH6A 4UFEH 1O2QA 1HJ8A 2XTTB 6CHAB 3DHKH 5HYOA 4JYTA 1AKSA 2GKVE 3GDUA 3WY8A 4BOHA 1SVPA 1LKAA 4BAMB 7GCHG 7LPRA 2DUCA 2K1QA 4MQAA 3MYWA 1OYTH 3VXFH 3URCA 1C5YB 2ODYB 1C1QA 1A0JA 3QGNB 2J92A 4AZ2B 2ILNA 1HGTH 5F8ZA 2CMYA 1H9LB 2W5EA 1HDTH 1UK4A 2V3OH 4OS1A 2BOKA 1MQ6A 2QXJA 1NROH 4Y8ZA 2GDDA 1T32A 3ATLA 3PMAB 1FAXA 3UR6A 1GMHF 1TNIA 1PQ5A 3LH3A 1INCA 4BAHB 5BRRE 1FPCH 1HUTH 1UCYH 2CF8H 3S9BA 2VWNA 1EZSC 4ASHA 3KF2A 1SR5C 2FI4E 2GVFA 2OP9A 2O8LA 1C1TA 1IOEA 2TRMA 5CMXH 1XUKA 3SV6A 1AU8A 2AGGX 3Q3YA 1TQ0B 3MHWU 4A1XA 4JZIA 4K3JA 9LPRA 1H4WA 4X1QU 2BLOA 2PSXA 3VFEA 2ZHFH 5A0CA 3LGYA 1V2QT 5C3NA 4X0WU 1OXGA 4AORA 1EUFA 1CGHA 1T8MA 1D6RA 2AMQA 2FOMB 3CENA 1AFQB 3RMLH 1CVWH 3SJ9A 2ZGHA 2TGAA 4ABDA 3LJOA 2W7UA 4AB9A 1NESE 2I6SA 3SHAH 3IG6B 1H8DH 1BIOA 2JH5D 3ZZAA 2A2QH 3U1JB 4CRAA 1PJPA 2BD8A 1BA8B 1EOJA 5FPTA 4Y0YE 3RXJA 3KIDU 4A6LA 1GCTC 3TGIE 1XUFA 3SJOA 2Y7ZA 4B1TA 1Y3WA 4NIVA 5ESTE 4X1RU 1EAWA 1KY9A 5DP7A 1MMJN 1A7SA 2AEIH 2H9EH 2VVUA 1SFIA 1BITA 1ETSH 1PYTD 1JRTA 3E0PB 3RMOH 4ABGA 2ZPQA 4KTUA 1T8NA 1ZPCA 1P57B 1DICA 1KDQB 1DWDH 1IQFA 1BCUH 3A7YA 1V2JT 4ZHLU 5C67A 2V35A 3NXPA 4FUHA 2ZGCA 1V2PT 3NKKA 3M3SA 3MTYA 1P2MA 4CRGA 2ANMH 1UCYK 4X8VH 3ZVBA 1O5FH 3SQHE 1FY8E 3T28A 1TBZH 2FODA 3SBKA 2HVXA 2FM2A 4E06H 5DP3A 1GBKA 2QN5T 2FI5E 4U30A 1GCTB 3UNQA 2RA3A 1HB0B 1NRSH 2Z6BD 2Z94A 3SQEE 4HTCH 3NUMA 1MAYA 2VU8E 1Z71A 4IMQA 3MOCA 2XBWA 2G00A 3A88A 1J16A 5FBIA 2J2UA 1MTWA 3EDXB 1O3PB 2UUYA 2VIWA 4HZHA 2Q6DA 1HV7A 1TQ7B 1SLVB 4U32A 3SU3A 2ZECA 1AKSB 1CHOF 4I8GA 4KGAA 2V3HH 1S0RA 1IQGA 3O8CA 2BY6X 1Y59T 1GI4A 1K21H 3SU1A 3MU4A 1G3DA 1GBEA 3F9FA 1S84A 2ZFSA 3UNRA 1E0FD 3EAJA 1FIWA 3M7QA 2PTNA 3H7OA 1LTOA 5E2PA 4TWYA 3P8NA 3A7XA 1QRZA 2FLBH 2UUKB 4ISLA 1C9TA 4IW4E 1HAVB 2A4QA 3BTEE 1ESAA 1C2HA 3FZDA 2ZTZA 1QCPA 2UWLA 1BTUA 1DUEA 3OY5U 4X8UH 1EPTA 2ANKH 4Y79A 1DITH 1ABIH 1H9HE 1O3MA 4RSPA 1DFPA 2OQUA 4B75A 3ATKA 4DCDA 1C5VA 1A61H 2QIQA 3SUFA 1V6DA 1DXWA 1NY22 1FY1A 2WUBA 3TLOA 5IDKA 3TK5A 1U6QA 1UO6A 3RXAA 4CBOA 3M37A 1C1WH 2W3KA 2G5NA 1OWJA 2PKAA 5FCRA 3BTTE 1XUGA 3A8BA 1QL8A 3ZZ5A 5JYIA 1O3DA 5EXMA 1C5ZB 4THNH 4Y76A 1K2I1 1UTKA 1MAXA 4SGBE 3RLYH 1C5OH 3GOVB 1GGDC 2VH0A 1QRWA 1O38A 1EZXC 5GJ4B 2BDBA 3ODDA 1P2IA 4X6PA 2JKHA 3ATMA 1SOZA 3SJKA 4XBDA 3OTJE 2IPHA 3K6ZA 3LPRA 2PKSB 3FP7E 3STJA 5F8TA 1VCWA 1D3QB 3VGCB 3DUXH 4FUCA 1TPSA 2ZDMA 4A1TA 3SW2B 2XC0A 1GBIA 2ZGBH 3KQDA 1RJXB 6LPRA 1VZQH 1MKXH 1P2JA 2VVVA 2UWPA 1AI8H 1S6HA 1GHWH 3CS7A 2ZPSA 4JZ1A 1THPB 3GCOA 1O2TA 1E34B 4I31A 4YOGA 1SMFE 5DKMA 1UVPA 2FDAA 3L6PA 2I6QA 3RC5A 2C4FH 4NWLA 1BMLA 1H1BA 1GGDB 1SI5H 3SNAA 1ARCA 1O5CB 2Q6FA 1TPAE 2RDLA 2QYIA 1S5SA 3M61U 1ZRBA 2Z3CA 1HCGA 1WYKA 1Q3XA 2G52A 1TA6A 3PB1E 5DG6A 1O2KA 1XUJA 3UFAA 1WQSA 5EXLA 3KCGH 5AFYH 1HXEH 4AFZA 1F0UA 1YPKH 2HNTC 1JRSA 1FN6A 2D8WA 1T7CA 5C1YA 1O2NA 1HXFH 4YESB 3NWUA 5F8XA 1OWEA 2BD2A 1V2NT 2ZDLA 3A7VA 2GV7A 1GHAG 4UEHH 3SZNA 3ZZ6A 1C5TA 1DLEA 3CP7A 3RXGA 2OINA 4KKDA 4QT8C 2WPIS 2J9NA 3RUOA 5EOKA 3SU2A 1GMDG 2BB4A 3M3VA 1SFQB 4AYVB 1BT7A 3PROA 2FLRH 5CE1A 2Z9KA 5PTPA 1XX9A 1ZGVA 1W12U 3RMMH 1P05A 2VINA 4AOQA 1T8OA 3M35A 3SV7A 3ZVFA 1NO9H 1O3AA 1MKXK 4TYDA 3LC5A 3E90B 2PFEA 1DY9A 4ISNA 2ZG0H 1HNEE 5JPMH 1C2FA 2PLXA 5GCHF 2G81E 1GBLA 2J94A 1TX8A 4Y0ZE 1S85A 4LOYH 5T6GA 1YYY1 3GY5A 4Q7ZA 5FXLA 5JBTA 4NFFA 1SGRE 1TA2A 3ZVEA 3RXLA 1NZQH 1GHBG 4UE7H 1DX5M 3SGAE 1FAKH 1SGNE 3EYDA 1GVZA 2PGBB 3E6PH 3GY8A 2GGVB 1EB1H 2F91A 4MLFB 1NTPA 5A8ZA 8KME2 4Y7BA 5EQSA 5JB9S 1LDTT 2PKAB 2BHGA 5FPYA 4AX9H 4I8LA 4TPYA 4X6MA 4B2CA 1C1RA 3T27A 1OWHA 1BRAA 1W0YH 4I33A 2ALVA 4NWKA 1YPJH 3BN9A 3SN8A 1EXFA 1O2VA 4WF8A 2OLGA 1UTLM 2DE9A 2JH6D 3UPEA 5GWZA 1RTFB 1SLUB 2ESTE 1TNKA 3RXUA 3RM0H 2CJIA 2ZU1A 2BDCA 1YCPH 1F5LA 1BMMH 1VGCC 1DT2A 1ZZZA 2BOHB 1YPHE 2OC7A 2ZDNA 1ZOMA 1AY6H 2FOCA 4DT7B 2B7DH 2OBOA 2NU0E 3QWCH 2FO9A 1CQQA 1ID5H 2HGTH 2G55A 2XC4A 4UFFH 3BIUH 4PROA 3H5CB 3U98H 1A3EH 4ISIH 1Z6JH 2FX4A 4X2WA 3D62A 3V0XA 1GWAA 1VITF 1QBNA 1A2CH 2O9QA 2STBE 2GMTC 2D1JA 2RA0A 4YZUA 4FUFA 1FMGA 1LO6A 1DSTA 2SNWA 1V3XA 2Y6TA 1PQAA 4D9RA 1JXPA 1N6YA 3UOUA 1TMTH 5GIBA 1ETTH 1VGCB 1BZXE 5C1UA 4UD9H 5FHTA 3BTDE 2ZKSA 3P70B 3SNEA 2AH4X 2Q1JA 2XNIA 5EPYA 1AIXH 1QGFA 1P9UA 3MH6A 1SQAA 1UK2A 4B71A 3SGQE 4J1YA 2ZTXA 1BHXF 2H6MA 3F9EA 3UY9A 2OC8A 2AS9A 1NFWA 1EATA 6ESTA 3UTUH 1CBWB 2XWBI 2FPZA 1JIRA 1P8VC