1KXCA

Sindbis virus capsid (n190k mutant), tetragonal crystal form
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
b'ALKLEADRLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTYTSEHPEGFYKWHHGAVQYSGGRFTIPRGVGGRGDSGRPIMDNSGRVVAIVLGGADEGTRTALSVVTWNSKGKTIKTTPEGTEEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SINDBIS VIRUS CAPSID PROTEIN
molecule tags Viral protein
source organism Sindbis virus
publication title Structural analysis of Sindbis virus capsid mutants involving assembly and catalysis.
pubmed doi rcsb
total genus 34
structure length 158
sequence length 158
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1996-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxcA01
1FUJA 1XMNB 1BOQA 1TFXA 2FOGA 2BOHB 1YGCH 4WMFA 1FNIA 2VINA 4ZKRU 1Z6EA 4LOYH 1PQ7A 1UK2A 7GCHG 1KXEA 3A8DA 4JK5A 2ZGJA 4JZIA 1C5YB 1FIWA 1GBHA 1FMGA 1ZJKA 1K1NA 1CA0B 2PW8H 3VGCB 4ABDA 3RXHA 1J9CH 3UPEA 1ANBA 1SFIA 1RTKA 1ZSJA 2A5AA 2FTMA 2NU2E 1PPEE 1OWIA 3E16B 3ODDA 1ELDE 3TJUA 1ELCA 2A0QB 3BEUA 2OD3B 1DWDH 1SGEE 1DWBH 1A4WH 4PROA 3ZZBA 3SU3A 3UOPA 1BRUP 2BD5A 1BTHH 1EZQA 2Y80A 2FIRH 2J92A 1MBMA 1ESTA 5ETXA 3QTVH 2FI5E 1O3FA 1VITH 3MU0A 1W14U 4MTBA 2GX4A 1XX9A 1O2RA 4I32A 1HLTH 1BTYA 2SGDE 1GBMA 2G4UA 4NA8A 3PMHB 1HAYB 1O2OA 8GCHF 3PV4A 4AYVB 3LH1A 2V3HH 4K69A 1K1LA 1EP6A 1MTNB 1C2DA 3QDZB 1FY4A 2W5EA 5GJ4B 1NROH 2VIOA 5AVDA 5A0BA 3VB5A 4ZMAH 4FUDA 4MPXA 2P59A 6CHAB 1NESE 2WV5A 3MO3A 2VGCC 1TONA 1JWTA 1WV7H 2UUFB 1VJAU 2O8TA 3LU9B 4GPGA 2W7UA 1EPTC 1LPGB 1PQ5A 2ZHWH 2Z9KA 3ZZ7A 1JOUB 3AVZA 4Q80A 4BTIB 4TY6A 1SMFE 4ISHH 2C4FH 2Z7FE 3LGWA 1PQ8A 3EA8A 4K8BA 1OX1A 3DD2H 1BBRK 1S6HA 1YLDA 1P06A 1FN6A 2UWLA 3R0FA 5GCHF 2UWPA 1JRTA 1T4VH 3PB1E 1EX3A 2ZHFH 3RLYH 3KIDU 3EDXB 2BMGB 4KP0A 1A5HA 1V2JT 2DE9A 3PMAB 3Q3YA 1TBQH 4MNVA 1UVPA 3OSYA 1AB9B 3URDA 4B71A 2G5NA 1BJVA 5FBEA 1V2NT 1UVOA 4F4OC 1P9SA 2H9HA 1TRNA 4WH6A 1N8OB 3P70B 3LC3A 5EPNA 1AKSB 2B9LA 1FY8E 1SGPE 1YPGH 4CREA 2XWAA 2BY5X 2ZP0H 1ZTLA 4ZKSU 3PMBB 2OCVB 3ZZ3A 6LPRA 5L30H 3SOSA 1QURH 1TOMH 2P8OB 5AHGH 2R3YA 3GDVA 1O3HA 4AG1A 2VB0A 4K3JA 1BTWA 2AGGX 1HAGE 4KKDA 1DSTA 1O2NA 3RU4E 2ZFRH 1MTUA 2ZPSA 3KCGH 2ZU4A 3K6YA 4I8GA 2ZHQH 1LHEH 1ZTKA 2I6QA 3TJOA 1P2IA 1E37B 2M5TA 1O2QA 1P0SH 2FLBH 1QJ1B 2IN2A 3T26A 2ZGCA 1C2IA 2VWLA 3LC5A 1V2PT 2BY8X 2ZTZA 1MKXH 2FS9A 1S82A 2WPLS 3FAOA 3LGTA 2GZ9A 3SNBA 4RSPA 5AFYH 4LZ1H 1O2KA 2CHAC 2Z9IA 3A81A 4TPIZ 4X2XA 5HM9A 3SQEE 3QLPH 1MTSA 4DCDA 2ZGBH 4GCHG 1KYNA 1O2LA 2PSYA 2VVCA 4X2VA 4DW2U 1DX5M 1AU8A 1NRRH 3QN7A 2FDAA 2P3FH 2HVXA 3ODFA 5JB8S 1KTTB 5C2ZA 3KQDA 2HLCA 2BOKA 4YT7H 2VU8E 3EA9A 4NWLA 2CHAB 1HDTH 5JDUB 5F6MA 1C1NA 1P09A 1OP8A 4D8NA 2A4OA 1RJXB 1ZLRA 8ESTE 2PR3A 7GCHF 1P2OA 2JH5D 2BVRH 2ODYB 4OGXA 1GBIA 5CMXH 3K65B 1P10A 1ZMLA 4FVBA 5FAHA 1HJ8A 1XUHA 1YLCA 1UO6A 1MZDA 1O31A 3MTYA 2WPKS 4JYUH 1E35B 1NS3A 4NIVA 3UQOA 5JBCS 1V2LT 1P2NA 3E3TA 3M5MA 3RM2H 1O3MA 1AGJA 1K1OA 2W3KA 2A4QA 1XM1A 1EB2A 1GHZA 2XC0A 3TU7H 3MWIU 2OC0A 3LKWA 1SSXA 1BHXB 3SU6A 3A7WA 2A1DB 1Z1IA 4A5TS 4UFFH 1SPJA 4VGCB 2SGFE 2PKAB 4AOQA 4I7YH 1TX6A 3A7XA 1FN8A 2G51A 4K2YA 3SV6A 5L6NH 3GDUA 3M5LA 3SV9A 1GGDB 4YOGA 2VIQA 1THSH 3SJIA 3SI4H 2ZTXA 3F1SB 2P16A 4KTCA 1GJAB 5EXNA 4FU7A 2H6MA 2R3UA 3UFAA 2PGQB 1CT0E 2C8ZB 1O34A 3P17H 2WPIS 3TGJE 1V2OT 4HGCA 5CHAC 5DG6A 2OQUA 4K8YA 5HMAA 2Q6GA 1XXDA 4WH8A 4Y8ZA 1B7XB 1SBWA 1P11E 1Y3VA 4X8UH 1LKBA 1MTWA 2BVSH 2ZFPH 1TGCA 3WY8A 3H7OA 4FUBA 5FXLA 1G2MA 2ZEBA 1AVGH 1QL8A 3F6UH 4NZLA 3RXVA 2GV6A 4IMQA 5T6DA 1EPTA 1Q3XA 1CE5A 5C5NA 3TPIZ 1VR1H 4AZ2B 3SV8A 2AGEX 1DFPA 4A7IB 3SHCH 5DP5A 4KTUA 3P8GA 1GVKB 2Q6DA 1AIXH 4CR9A 2J4IA 3UQVA 4D76A 2FPZA 1SGNE 5I46H 4ISNA 1H4WA 1QNJA 4NIWA 4FUHA 2ULLA 1SGIB 2W7SA 4X6MA 1TX7A 2BX3A 1GI0A 1C1WH 3SW2B 1NT1A 5E2PA 2BX4A 4ABEA 4GHQA 1G3CA 5DKMA 1LQEA 1YPHC 1AUJA 2QC2A 1ZGVA 1ELTA 1C2HA 3SU1A 2D8WA 1SFQB 3HGNA 1C5RA 2CF9H 3LGVA 3P92A 1O5EH 2ZA5A 3GCHB 2G8TA 3VB6A 1P05A 1ZSLA 1C5SA 1K22H 2GD4B 2HWLB 5IYTA 3UNQA 1C1MA 4ZHLU 2ALPA 2FTLE 4X1SU 2PUXB 1WQVH 2QXJA 2GKVE 2Y5FA 4INHA 1ETRH 1HNEE 2C8YB 3QO6A 5JBTA 1EAUA 2ZI2H 1V2WT 1RGQA 1CHOF 1GMDF 1O3BA 3M35A 1F92A 4LK4A 4Y7AA 4YM9A 1UTLM 1HCGA 2ZF0H 1IQIA 1LVOA 3LH3A 2WPHS 5GIBA 1Y5UT 3A82A 2FOBA 1WAYB 1W7GH 3UR6A 2C90B 4B76A 5GXPA 1C1PA 1HAIH 3DA9B 3S9AA 2VWNA 1VITF 4BXWA 1GJCB 2G55A 3HATH 3Q76A 4WJG2 1PFXC 3RXBA 3OU0A 1FPCH 1RXPA 3BTME 4XDEA 1KTSB 2BTCE 1FY5A 1MBQA 1EAXA 1QB1A 5EPYA 1CU1A 1H9HE 2QCYA 1ID5H 1TA2A 1DY9A 1GBTA 1N6XA 2PKSB 1E38B 1Z6JH 2A7CA 1UCYE 1NPMA 2VIVA 2ZCLP 2JH6D 3BIUH 3RXCA 3RUOA 4YLQH 1SLXB 2DE8A 4FVDA 4H6SB 4ZHAA 3P8FA 4D9QA 1H8IH 1NTPA 3BTTE 1WTHD 4I8KA 4UFDH 2FLRH 1UTOA 1KLIH 1KXAA 1MCVA 1DVAH 3U1IB 3GY6A 2Y7ZA 2UUYA 1G37A 1O39A 3F9GA 1C2MA 3RU4D 2CXVA 1CSOE 2ZFSA 5HM2A 1K21H 3K9XB 4JZFH 1XKAC 1BITA 1SQAA 4NCYA 3QUMP 2F3CE 1P04A 1SR5C 4A1XA 3IITA 2FYRA 2AFQB 3LT3A 1O2VA 3A86A 1O35A 3PMJA 1S84A 2PSXA 1YBWA 4DT7B 1BMAA 1A0HB 1QGFA 4X6NA 3SV2H 2STBE 3S9BA 1OWEA 4Z0KA 2ODPA 1HUTH 1AWFH 1AKSA 3UNSA 1B0FA 1GJBB 3M3VA 5EQRA 1CGJE 1O2HA 2HRVA 2J95A 1N1LA 1LQDB 1P01A 4ZAEA 1QA7A 3ZZ4A 3PROA 1CGIE 1GHAF 3QGJA 2GZ8A 5DP4A 5E0JA 2QXIA 2RDLA 3RXJA 1VGCC 3UREA 2EA3A 2FWWA 1W11U 3QGNB 3CS7A 1SGFA 3GICB 3ZZ5A 1M9UA 1LMWB 3M5NA 4OS2A 1SQOA 1O3KA 2AMDA 2F91A 5E0GA 2ZFQH 3O8RA 2QF0A 3SJOA 4Q7ZA 4ZXYH 4CRDA 2XYAA 1TNKA 1ESBA 3O8CA 1GG6B 1YPHE 1DXPA 1TABE 2BDIA 1CBWB 1RFNA 4LXBH 1O2WA 1W0YH 1GDNA 1OWDA 3GY7A 1WYKA 2SFAA 3SGBE 3KGPA 1FJSA 2WYGA 3LGIA 4GCHF 4BTUB 1Z8IB 4Y79A 1TWXB 5AFZH 1D3DB 4D9RA 5C67A 2BQWB 4CBNA 1XVOA 3FP8E 2G4TA 3NZIA 2NWNA 1AE8H 1OP2A 1IHSH 1O5FH 1MKWH 2AGIX 4JYVH 3V7TA 2B8OH 1CHOG 4YOJA 5HYOA 1GJ5H 2ZKSA 3MH6A 4NFFA 4Y71A 3M37A 1XXFA 2A2XH 3B9FH 1UVSH 1DXWA 3PLBA 5LPFA 1UTQA 1Y8TA 4WMEA 2ZDMA 1SI5H 4IW4E 3SU0A 2OC1A 1TNGA 1GGDC 1ARCA 4MNWA 2GDDA 2TGDA 1E36B 4ZKOU 2W3IA 3DHKH 4I8JA 2FZZA 1A7SA 1S83A 2NU3E 1NM6A 3RXQA 1QA0A 2BVXH 5FPYA 1P3CA 4KGAA 4ASHA 3TLOA 2VIWA 3Q3KA 2HNTF 6GCHG 3D65E 1YPKH 2F9BH 1TRMA 1ZSKA 2NU0E 2RA0A 2ZPRA 1IQLA 2FO9A 1BMMH 1NFXA 3UIRA 1CT4E 2K1QA 3MNBA 5IDKA 2FI3E 5E8EH 1GJ8B 1PQAA 1KXDA 2ZPQA 3BSQA 2FODA 1O30A 2PHBA 2ZG0H 2ZU3A 3KL6A 1WOFA 3OY5U 3QK1A 4OS1A 1ZZZA 1V2TT 5T3HA 4XFQA 5A8XA 1C5QA 1SL3A 2JKHA 3TH4H 2KAIA 1S0RA 1DOJA 3ZYDA 2VVUA 1DSUA 2AMPA 3SNDA 1DS2E 1QBVH 4U32A 2STAE 1BBRE 3MO6A 3SUFA 4Q2KA 4O9VA 4TPYA 1C1OA 3RXFA 3M61U 1VGCB 2ZGXH 1ZHPA 2WV4A 4X6OA 1EOLA 2BD8A 2OP9A 2TBSA 3DFLA 2QY0B 3CS0A 3VPKA 4D7GA 2TGPZ 1TX8A 4X8SH 1AN1E 3TGIE 1QY6A 1JRSA 3ZVDA 3FZDA 3VB4A 1GBEA 2F9VA 1YP9A 5C1UA 2O8MA 3MYWA 3PTBA 2GVFA 3FP6E 1BHXF 4XBCA 3BG4B 1O3AA 4Q7YA 3VXEH 3M5OA 1GJ6A 2BXUH 1EJNA 1W0ZU 4J1YA 3SJ8A 3HK3B 2GZ7A 3MH5A 3VGCC 3TITA 5L2YH 1QHRB 2P93A 1D3PB 1ORFA 1O2TA 1O2MA 1DWCH 1TPAE 1UCYK 3ZZ8A 1EB1H 1GI6A 5FX6A 4CRBA 2W26A 3T25A 4FUFA 1L4DA 3U8TH 3ZV8A 5LPEA 2ZDNA 1C1UH 2PUQH 1ZGIA 4NSVA 4X1PU 3SNCA 2G00A 3NWUA 4K5ZA 1EAWA 3I78A 2ZNKH 1O5DH 1IHTH 2R9PA 3RXDA 2OINA 3MFJA 2Y82A 1EZUC 1ZYOA 1TA6A 1C5TA 4O3TA 1AFQC 1GBKA 3SU4A 2R0KA 4M7GA 4YOIA 4NGAH 3ZV9A 1TLDA 2R2WU 4ABHA 1LHGH 3MNCA 2QA9E 5EXMA 4FUJA 2J94A 3MU4A 2A45B 3SGQE 1GI2A 1SLUB 2AIQA 2H9EH 2R0LA 1GMDG 2Z6BD 5EGMA 1T8NA 3CENA 1ACBE 1YYY1 1K1IA 2XCNA 3EA7A 4IMZA 2C3SA 1IAUA 1YPJH 1LHFH 2HOBA 2P3UB 1KDQA 5F8ZA 2BQ6B 2OBOA 1DE7H 1C2KA 3NXPA 2ILNA 5ESBA 2O9QA 2XBWA 1L1JA 2PGBB 1D3TB 1O37A 1G2LA 2VIPA 3JZ1B 1O2GH 1J17T 1TGSZ 3IG6B 3ZZDA 1TPSA 3RXLA 4GVUA 3SUDA 1AI8H 1MH0A 2TGTA 4JK6A 4KTSA 3ZZAA 1Y3XA 1K1MA 1SGFG 1UVTH 1W12U 3A80A 3ATKA 2Z3CA 2BLVA 1QCPA 1CT2E 1O2ZA 4NIYA 1ZMJA 1FI8A 1HRTH 1EUFA 3GY4A 1P9UA 2RG3A 3RXMA 3SU2A 1C5LH 2WUBA 3T62A 2GCHG 1TBRH 1G3BA 4GLYA 2V0BA 5GCHG 2OLGA 1MTNC 2HGTH 1GBLA 4FXGH 2V3OH 4U2WA 3VFEA 4AFQA 4B2AA 1EJAA 5FBIA 1VCWA 2AIPA 2QXHA 2SGPE 1MD8A 4I8HA 1G36A 2ZFFH 3ENSB 4OGYA 1T8MA 4FUIA 2B7DH 3VEQB 3A7ZA 3W95A 1L1GA 1ZR0A 1X7AC 4BAMB 4XBDA 4AFUA 1ELGA 1PPGE 4K1EA 1EXFA 3RM0H 3BG8A 3GOVB 2CGAA 2QV1A 2EC9H 1OOKB 2ZDKA 3RXGA 1TMTH 1W10U 2VVVA 1BB0B 1UK3A 4Y10E 1U6QA 1V6DA 3ESTA 5GDSH 3PM3A 1C9TA 3E90B 4DGJA 2FYQA 3ATLA 4GHTA 1YPLH 3EYDA 7LPRA 5CHAB 5EXLA 2G52A 3W94A 3SGAE 9LPRA 2YNAA 4HTCH 1EZSC 1F7ZA 5BPEA 5JB9S 2Z3EA 1LVMA 5EOKA 1BTZA 8KME2 5FPTA 3PWCA 3RXOA 4DY7B 1SOZA 2HALA 1A2CH 2AS9A 2Z94A 1DLEA 2CF8H 4NWKA 3U8OH 3A87A 1FV9A 1NO9H 2EI7A 4BXSA 5EG4A 2QAAA 2H5CA 1C2JA 2Y7XA 1YC0A 1H8DH 1TE0A 1FY1A 2F83A 1FQ3A 5ABWA 3ZVEA 1NFYA 4CH2B 3BTKE 1VCPA 1KXFA 3IWMA 3B8JA 1W3CA 4FUGA 3UWJH 1GI9B 1J14A 4Y7BA 3I29A 1A0LA 2PKSC 1VZQH 1WUNH 2SNWA 4NZQA 3UTUH 2WYJA 2JETC 3SNAA 5C1XA 1UTNA 1NRSH 1HXEH 1AZ8A 4MNXA 3Q77A 2ZDLA 4ABJA 1C5WB 3N7OA 3TK5A 1NU9A 4LZ4B 1AO5A 1EOJA 2ANMH 3UR9A 2HNTC 1K28D 3L6PA 1Y5BT 4OS7A 1F2SE 1O3CA 1GBCA 1FIZA 2BD2A 2GT8A 1RS0A 1GHAG 1ANCA 1V2ST 2BD4A 5E2OA 2CN0H 2ZQ1A 1GHVH 2OC7A 2SGAA 1XUIA 4B2BA 1IQMA 2D1JA 1AWHB 1WBGB 2PKAA 1C5OH 7KMEH 1HFDA 1J8AA 3GCOA 3BTGE 1O2XA 1O33A 1C2LA 1RTFB 1T8LA 2A5IA 1LHDH 1NC6A 3E0NB 1XKBC 2A4GA 1ZRKA 4JCNA 1TNHA 3S69A 4ZUHA 1G3DA 3A8AA 1OSSA 3B23B 3P6ZB 4O97A 5TJXA 4E06H 3GCHC 2A4RA 4AFSA 2XTTB 3GISB 3SO3A 3TGKE 1GI1A 4INKA 4AB9A 3UNRA 1ELAA 1HB0B 2BDGA 4SGBE 5C1YA 5LH8A 2GGVB 5E0HA 1DUEA 2ZDVH 2P95A 3D23A 2WPJS 4CRAA 3E6PH 1CHGA 4X1QU 1GL0E 2VGCB 1ABIH 1SHHB 3KN2A 3GDSA 4FU9A 4A1VA 1EP5A 1P02A 6CHAC 1THRH 1IOEA 4X0WU 1ZPZA 4Y76A 5H4IB 1MKXK 2XBVA 1PPFE 2UUJB 2A32A 1BDAA 4IBLH 3U1JB 1QR3E 5TCCA 2WPMS 1IQJA 1MU6B 4OS5A 5DO4H 3BTEE 2FM2A 4MPVA 5DP3A 2Y6TA 4HZHA 2BLOA 1C5UA 1O2SA 5A0CA 3RXUA 2J34A 1TNLA 1BTXA 1GI5A 1FY3A 3QTOH 1WU1A 4CHAB 4Y0ZE 4NFEA 3S0NA 4GUXA 1QL7A 1A46H 1AVXA 1P2KA 1SGCA 1WTGH 3C27B 1HAXB 1BZXE 4D7FA 4TYDA 3E1XB 2DUCA 1DPOA 1S0QA 2SNVA 2ZTYA 1O0DH 3LOXA 1PYTD 4X8TH 2V35A 2ZC9H 5EU8A 1EZXC 1MTVA 2FX4A 3FANA 3ATWA 4XBBA 3LONA 2OTVA 3AW1A 2IJOB 2ANWA 4U01A 4DURA 4DJZB 1GCTB 3MU8A 3I77A 1GBJA 1W7XH 5JBAS 1P2JA 5FPSA 1V3XA 1RD3B 1TNJA 3L33A 1SLWB 3TJVA 1DANH 2BDHA 3RP2A 1C2FA 2ASUB 4IN2A 3A7YA 3EAJA 2BLWA 3KF2A 1TRYA 4ZROA 2D2DA 1C1RA 1GBBA 2GMTC 2BM2A 2QGRA 2G5VA 4Q7XA 4YZUA 4AB8A 3RXSA 1L1NA 1ZMNA 1C2EA 2CJIA 2PTNA 2C93B 3STJA 1GJDB 1GI4A 1CO7E 3FP7E 4TY7A 2P3TB 2V6NA 1C5VA 3BTWE 1ANEA 1ZPBA 1W2KH 4BANB 2O8UA 1TAWA 4AGKA 2Y5HA 4E05H 2GP9B 2VNTA 4AGJA 3AAUA 3BG4C 3Q3XA 2NU1E 3EE0B 3SQHE 1GJ9B 3MI4A 3RC5A 1YCPM 1MUEB 1V2KT 1GVLA 4NA9H 1SLVB 4I31A 3RC4A 3E91A 2FEQH 1GMHG 1HJ9A 1T4UH 1TMUH 3TNTA 3OY6U 1P2MA 1O38A 1NU7B 2A2QH 4BAKB 1FZZA 1P2QA 1INCA 3BTQE 3BN9A 3Q00A 2ZGHA 2BY7X 3V13A 5G4BA 1QJ7B 1JMOH 2A5KA 3RXIA 4CR5A 3U98H 1ESAA 4K60A 4XE4A 2ESTE 2OUAA 4NG9H 4JMYA 3ZVGA 2GCHF 1ZJDA 1O3OA 3BEIB 2OXSA 5A8YA 1FPHH 3RMMH 3URCA 5EQQA 1RRKA 1GI8B 1FAXA 4A92A 1LVYA 1ZTJA 5JPMH 1C1TA 3A8BA 1K2I1 1GHBF 1Z71A 1PPCE 1IQEA 2ZZUH 2B0FA 2ZHEH 1O2IA 1TNIA 1DT2A 4WY3A 1H9LB 1G30B 4BAHB 2GMTB 1WQSA 4Y11E 1JBUH 1Q2WA 1CA8B 3ZYEA 2Z3DA 1HIAB 3M36A 3ZVCA 1HAVA 4O03A 3O8BA 1FXYA 2F9OA 3BTHE 3K6ZA 2FX6A 1OWJA 4H6TA 4JZEH 3AAVA 2PTCE 4ISIH 3HGPA 1LDTT 5L2ZH 2QN5T 2BY6X 5CE1A 2ZCKP 8GCHG 2H2ZA 4RKJB 4BOHA 1MD7A 3U69H 3PO1B 1HJAC 2ZU5A 1B0EA 1C4U2 1C5MD 1MQ6A 2C8XB 1AZZA 1UHBB 3E8LA 3SV7A 1XUKA 1BIOA 2FOCA 1WSSH 4TWYA 4Y0YE 3O8DA 4U30A 3M3TA 3UY9A 1MCTA 4R8TB 1MAYA 4B2CA 1JXPA 2EEKA 3RMNH 4GSOA 1G32B 2BD7A 3C1KA 4IGDA 1UTJA 3PYHA 1Z8RA 4AORA 1GMHF 2ANYA 1QRWA 4MQAA 5JBBS 1GCDA 1IQKA 4ISLA 1N6YA 3SNEA 1BRBE 2XBYA 1O2YA 3PO1C 2I6SA 3F9HA 3F9FA 4NIXA 4IC6A 2QYIA 1LKAA 1C5NH 3NPSA 1OYQA 2SGQE 2OBQA 4VGCC 3M3SA 4XSKU 1RIWC 2G81E 1IQGA 1ABJH 1L4ZA 2WUCA 3M7QA 2PFEA 3ZVAA 1VITG 2YOLA 1CBWC 5DGJA 1QQ4A 1VCQA 1BT7A 3MNXA 1AY6H 2A31A 1NFWA 1A61H 2VJ1A 1TQ0B 1P03A 2FMJA 3ZZ9A 4MNYA 2KAIB 1NRNH 2UUKB 1SHYA 1FLEE 3PWBA 3GCNA 1BRAA 3RXPA 4MLFB 3BTFE 4K1SA 2TRMA 3KQCA 4IC5A 3LJJA 1UTPA 3P8OA 1A3BH 1O2UA 2ZO3H 2XCFA 4R0IA 3G01A 1TGNA 3U8RH 4BTTB 1SG8B 1GBDA 2J38A 5HXFA 4K1TA 4SGAE 3MMGA 1C1SA 1J15A 3SUGA 4RN6A 4NSYA 3MH4A 3PLPA 3F9EA 2BHGA 1ETSH 6GCHF 5B6OA 3LPRA 2H1UA 4FU8A 1KXBA 1O32A 3TNSA 3LGUA 5DP9A 3HK6B 4UFGH 1ZOMA 2RCEA 1EASA 1OS8A 1GDQA 1AHTH 5DP6A 3TVJB 1C1VH 4MVNA 1OXGA 1AFEH 5F03A 1C5ZB 3H5CB 2F9PA 1GMCF 1SOTA 4THNH 1O3NA 1F0UA 3AW0A 1BMNH 1W8BH 2QXGA 1CVWH 3ELAH 3TK9A 3LJOA 4DIIH 1IQNA 3ATMA 4WVPE 3STIA 2ZCHP 3UOUA 1D6RA 1UTKA 2JETB 2ZIQH 1EKBB 1W13U 3UWIA 4ISOA 1GJ7B 5K7RA 4YLUA 1GHBG 2OQ5A 2HNTE 2XXLA 5EQSA 2ZWLH 3RDZA 4Y6DA 2PV9B 1GHXH 1T8OA 2LPRA 5ESTE 1P12E 1DICA 3GY3A 2F9UA 1VJ9U 1O2JA 1PJPA 2FOEA 4CBOA 4O3UA 1ETTH 3A84A 1TGTA 3S7KB 1QL9A 2BD9A 4I8LA 4X2WA 1YCPH 3LDXH 4WF8A 1LPKB 1DUAA 3DUXH 3OYPA 4X2YA 2FI4E 3F68H 4A1TA 4E7RG 2ZU2A 3SI3H 3EQ0H 3RLWH 2FOHA 1Y5AT 3TK6A 2PWXA 1NRPH 3E0PB 2XC5A 3MH7A 1V2UT 1UMAH 1TMBH 3NK8A 3MO9A 1YM0A 3SZNA 1GMCG 2XBXA 4YO9A 5HGGA 1GJ4H 3RXKA 1JIRA 2BDBA 2WINI 4MG3A 3OX7U 1KY9A 4ZHMU 4Y8YA 2SGEE 2ANKH 1A0JA 5FCRA 1WCZA 1SGRE 1EAIA 2GCTB 1QFKH 1GBFA 3M7UA 1GHWH 1SGDE 2BDCA 4F49A 4JYTA 3RMLH 1SQTA 4AX9H 5FCKA 5SGAE 1AQ7A 3ZVBA 3QWCH 5J4SA 2JH0D 2P94A 1T32A 2BDAA 2LNCA 3U9AH 3QZQA 2VH0A 1QQUA 4IS5A 3A89A 2TIOA 2FOMB 1D4PB 2TPIZ 1BA8B 1HAVB 2GT7A 4YESB 1L2EA 1HIAA 4OS4A 3T29A 1YCPK 1QB9A 2GTBA 4UEHH 2Z9LA 1V2QT 5DP8A 1V2RT 1F5LA 1BMLA 1O3EA 2XW9A 4CRCA 1LTOA 1C1QA 1AE5A 4KELA 3PTNA 1TPPA 3NCLA 1O3JA 3M7TA 2ZQ2A 3T28A 3HPTB 1SGTA 3VXFH 3ZZ6A 1CGHA 3VB3A 1GPZA 3GYLB 5BRRE 1F0SA 1UCYH 1T7CA 1RIWB 1DLKB 2EI6A 2Z9JA 3LIWA 2NU4E 3LGYA 1K1PA 2AYWA 1YPEH 1ZHMA 1BRCE 5F8TA 3TH3H 3D49H 3KHVA 1HAPH 1KSNA 1AD8H 2D26C 5F8XA 2GDEH 2AERH 5A09A 1N8OC 1GI3A 3ITIA 1RTLA 1LO6A 4DG4A 4ESTE 1IQHA 3GY5A 1HAZB 3D62A 1GCTC 1BQYA 1Z8JB 3FZZA 2ZDAH 3A83A 4YT6H 5FX5A 5J4QA 1TQ7B 4UDWH 2CV3A 1O3GA 3ZVFA 1F5RA 1AUTC 3GY2A 5GPIB 1PYTC 1PPZA 5PTPA 3KQBA 1HAHH 3MU5A 4MPWA 4UD9H 2OC8A 9ESTA 1BUIA 1SC8U 3OTJE 3BIVH 2C8WB 1D6WA 4OS6A 5T6FA 2F9NA 1KLJH 1SGYE 4CRGA 3TJNA 1AFQB 1BBRH 3FFGA 5TCAA 2QF3A 1K1JA 4ZH8A 2P8OC 2H5DA 3GCTG 1MZAA 2O8LA 1O3IA 2ZFTA 1C2GA 1F0TA 1L0ZA 3FVFB 3AASA 1SGQE 1ELFA 1YPMH 2BB4A 4TWWA 1Z8GA 1Q31A 2GV7A 3BTDE 4B74A 1F5KU 3MNSA 1A1RA 3JZ2B 4B73A 4H42U 4BAQB 1OWKA 5DP7A 1H9IE 1HGTH 3KEEA 1HAOH 1G3EA 4UONA 3RXAA 3SORA 5LPRA 2Y5GA 1AB9C 2R2MB 4YTAA 4NA7A 4FUCA 1TB6H 4INLA 4HFPB 4GAWA 1FONA 1G9IE 3CP7A 2PLXA 3EGKH 1TIOA 5DPAA 1AMHA 1MKWK 1P3EA 2BY9X 4CH8B 2BYAX 3H7TA 2BQ7B 1LCYA 2FXRA 1HBTH 1O3LA 4AYYB 5C3NA 1PPHE 2EI8A 2O8WA 2HPPH 1HPGA 1UTMA 3KQEA 1P8VC 3RXEA 2VWOA 2FOFA 4WXVA 3P95A 2AH4X 1Y3YA 3T27A 1ZPCA 1O3PB 4CHAC 3L3TA 4MPUA 2CMYA 3MU1A 3GCTF 1V2MT 5DK1A 2FS8A 1SVPA 2AMQA 1EPTB 1V2VT 3SBKA 3S9CA 1BTPA 3HKIB 2BLQA 3BF6H 4ABIA 3T2NA 1QJ6B 4JZDH 1LPZB 2IPHA 1ARBA 2HPQH 1Z1JA 3SU5A 5FHTA 1OYTH 2A7JA 2VH6A 4BNRA 1YF4A 3SUEA 1MMJN 3SN8A 4Z6AH 1OWHA 1XVMA 1O5AB 3R3GB 1MAXA 1KIGH 1A3EH 2ODQA 3ATIA 1A5IA 1GWAA 2FESH 2XWBI 1E34B 3NKKA 1Z7KA 2ALVA 1O5GH 5LGOA 1B5GH 2ZU1A 3GY8A 2UWOA 1DY8A 1OPHB 1QB6A 4CRFA 5AF9H 4UE7H 1JIMA 1UJ1A 1THPB 3HKJB 2GCTC 3P8NA 2H9TH 2ZECA 3RC6A 3SJ9A 1LHCH 2QIQA 2AEIH 3A85A 5A0AE 1PPBH 1C5XB 5GWZA 1S85A 4ABAA 4UFEH 3DT0H 3TIUA 5K0HA 1BCUH 1DM4B 4ZKNU 1H1BA 1ZRBA 3V0XA 2BD3A 3RXTA 4E7NA 3QZRA 1QIXB 3T5FH 1CA0C 1BJUA 3SHAH 1E0FD 2J2UA 1S6FA 1SB1H 1O36A 4Y8XA 1FAKH 1XUJA 2Q6FA 1C4V2 1ELBA 1KLTA 3S7HB 3MOCA 3MHWU 5JYIA 1BTUA 1D9IA 4FUEA 5I25A 4AN7A 1HJAB 1O5BB 1LVBA 5C20A 1DWEH 1GI7B 1YKTA 3NUMA 2Y81A 5EODA 4BAOB 2B5TB 1NFUA 1TBZH 4QT8C 2YNBA 4X6PA 2FOAA 1O5CB 2TGAA 6ESTA 4DVAU 5C5OA 4X8VH 1NN6A 4XOJA 1HYLA 4DIHH 4HI3A 4WMDA 4WXIA 1GG6C 1GVZA 1Y59T 1EJMA 4X1RU 1EQ9A 1J16A 2Z9GA 2RA3A 1Y3WA 1UVUH 1HV7A 3A7VA 4J2YB 1KDQB 4I33A 2BZ6H 1T31A 3RU4T 1IQFA 1XUFA 1C4Y2 3RXRA 1AVWA 4B1TA 1QTFA 1NY22 1ELVA 8LPRA 2IOTA 1MQ5A 1OP0A 3V3MA 2VIDA 1C9PA 1O3DA 1GBAA 1Y3UA 1TGBA 3QX5H 1P57B 4RKOB 1S81A 1ELEE 5A2MH 1GDUA 3A8CA 4A6LA 1EATA 4B75A 1XUGA 1GHYH 4AFZA 3UUZA 1DDJA 1TALA 1S5SA 3RMOH 4X1NU 1ANDA 1QRXA 4H4FA 1F0RA 1OKXA 1QBOA 2FP7B 2VWMA 3PLKA 4DOQA 3A7TA 3BEFB 3VB7A 3KNXA 5EW2H 4IN1A 4ABFA 2J9NA 3ZZCA 1C5PA 3K2UA 2BZAA 1HXFH 1GL1A 3BV9B 3GYMA 4AG2A 2BXTH 4WWYA 4JZ1A 2THFB 1TYNA 1KXCA 1CQQA 2A7HA 2XRCA 3DFJA 2ZHDA 3A88A 1QRZA 4ABGA 1A5GH 1TOCB 2Q1JA 1DITH 1K9OE 5A8ZA 5T6GA 5EW1H 4ABBA 1ZHRA 2XC4A 1NZQH 1UHBA 4ZXXH 2XNIA 1NRQH 5DJ7A 1MU8B 3TH2H 1D3QB 3SJKA 1UK4A 1FDPA 1TPOA 1O2PA 1QBNA 3V12A 2BDYA 7ESTE 4MDSA
chains in the Genus database with same CATH superfamily
1FUJA 1XMNB 1BOQA 1TFXA 2FOGA 2BOHB 1YGCH 4WMFA 1FNIA 2VINA 4ZKRU 1Z6EA 4RT0A 4LOYH 1PQ7A 1UK2A 7GCHG 1KXEA 3A8DA 4JK5A 2ZGJA 4JZIA 1C5YB 1FIWA 1GBHA 1FMGA 1ZJKA 1K1NA 1CA0B 2PW8H 3VGCB 4ABDA 3RXHA 1J9CH 3UPEA 1ANBA 1SFIA 1RTKA 1ZSJA 2A5AA 2FTMA 2NU2E 5EIYA 1PPEE 1OWIA 3E16B 3ODDA 1ELDE 3TJUA 1ELCA 2A0QB 3BEUA 2OD3B 1DWDH 1SGEE 1DWBH 1A4WH 4PROA 5EJZA 3ZZBA 2M2AA 3SU3A 3UOPA 1BRUP 2BD5A 1BTHH 1EZQA 2Y80A 2FIRH 5KECA 2J92A 1MBMA 1ESTA 5ETXA 3QTVH 2FI5E 3FO8D 1O3FA 4B6FA 1VITH 3MU0A 1W14U 4MTBA 2GX4A 5C94A 1XX9A 3N7DA 1O2RA 4I32A 1HLTH 1BTYA 2SGDE 4ACAA 1GBMA 2G4UA 4NA8A 3PMHB 1HAYB 1O2OA 8GCHF 3PV4A 4AYVB 3LH1A 2V3HH 4K69A 1K1LA 1EP6A 1MTNB 1C2DA 3QDZB 1FY4A 2W5EA 5GJ4B 1NROH 2VIOA 3DSPA 5AVDA 5A0BA 3VB5A 1QZ8A 4ZMAH 4FUDA 4MPXA 2P59A 6CHAB 1NESE 2WV5A 3MO3A 2VGCC 1TONA 1JWTA 1WV7H 2UUFB 1VJAU 2O8TA 3LU9B 4GPGA 2W7UA 1EPTC 1LPGB 1PQ5A 2ZHWH 2Z9KA 3ZZ7A 1JOUB 3AVZA 4Q80A 4BTIB 4TY6A 1SMFE 4ISHH 2C4FH 2Z7FE 3LGWA 1PQ8A 3EA8A 4K8BA 1OX1A 3DD2H 4YXWD 5F53A 2KCPA 3PRBA 1BBRK 1S6HA 1YLDA 1P06A 1FN6A 2UWLA 3R0FA 5GCHF 2UWPA 1JRTA 1T4VH 3PB1E 1EX3A 2ZHFH 3RLYH 3KIDU 3EDXB 2BMGB 1VKYA 4KP0A 1A5HA 1V2JT 2YMSC 2DE9A 3PMAB 3Q3YA 1TBQH 4MNVA 1UVPA 3OSYA 1AB9B 3URDA 4B71A 2G5NA 1BJVA 5FBEA 1V2NT 1UVOA 4F4OC 2F4LA 1P9SA 2H9HA 1TRNA 4WH6A 1N8OB 3P70B 4Q4LA 3LC3A 5EPNA 3EE7A 1AKSB 2B9LA 1FY8E 1SGPE 1YPGH 4CREA 2XWAA 2BY5X 2ZP0H 1ZTLA 4ZKSU 3PMBB 2OCVB 3ZZ3A 5HIYA 6LPRA 5L30H 3SOSA 1QURH 1TOMH 2P8OB 5AHGH 2R3YA 3GDVA 1O3HA 4F55A 4AG1A 2VB0A 4K3JA 1BTWA 2AGGX 1HAGE 4KKDA 1DSTA 1O2NA 3RU4E 2ZFRH 1MTUA 2ZPSA 3KCGH 2ZU4A 3K6YA 4I8GA 2ZHQH 1LHEH 1ZTKA 2I6QA 3TJOA 1P2IA 1E37B 2M5TA 1O2QA 1P0SH 4B6EA 2FLBH 1QJ1B 2IN2A 3T26A 2ZGCA 1C2IA 2VWLA 3LC5A 1V2PT 2BY8X 2ZTZA 3UAIC 1MKXH 2FS9A 1S82A 2WPLS 3FAOA 3LGTA 2GZ9A 3SNBA 4RSPA 5AFYH 4LZ1H 1O2KA 2CHAC 2Z9IA 3A81A 4TPIZ 4X2XA 5HM9A 2LP6A 3SQEE 3QLPH 1MTSA 3SZEA 4DCDA 2ZGBH 4GCHG 1KYNA 1O2LA 2PSYA 2VVCA 4RI0A 4X2VA 4DW2U 1DX5M 1AU8A 1NRRH 3QN7A 2FDAA 2P3FH 2HVXA 3ODFA 5JB8S 1KTTB 5C2ZA 3KQDA 2HLCA 2IPQX 2BOKA 4YT7H 2VU8E 3EA9A 4NWLA 2CHAB 1HDTH 5JDUB 3KYFA 5F6MA 1C1NA 1P09A 1OP8A 4D8NA 2A4OA 1RJXB 1ZLRA 8ESTE 2PR3A 7GCHF 1P2OA 2JH5D 2BVRH 2ODYB 4OGXA 1GBIA 5CMXH 3K65B 1P10A 1ZMLA 4FVBA 5FAHA 1HJ8A 1XUHA 1YLCA 1UO6A 1MZDA 1O31A 3AK5A 3MTYA 2WPKS 4JYUH 1E35B 1NS3A 4NIVA 3UQOA 5JBCS 1V2LT 1P2NA 3E3TA 3M5MA 3RM2H 1O3MA 1AGJA 1K1OA 2W3KA 2A4QA 1XM1A 1EB2A 1GHZA 2XC0A 3TU7H 3MWIU 2J98A 2OC0A 3LKWA 1SSXA 1BHXB 3SU6A 3A7WA 2A1DB 1Z1IA 4A5TS 4UFFH 1SPJA 5IK2D 4VGCB 2SGFE 2PKAB 4AOQA 4I7YH 1TX6A 3A7XA 1FN8A 2G51A 4K2YA 3SV6A 5L6NH 3GDUA 3M5LA 3SV9A 1GGDB 4YOGA 1THSH 2VIQA 3SJIA 3SI4H 2ZTXA 3F1SB 2P16A 4KTCA 1GJAB 5EXNA 4FU7A 2H6MA 2R3UA 3UFAA 2PGQB 1CT0E 2C8ZB 1O34A 3P17H 2WPIS 3TGJE 1V2OT 4HGCA 5CHAC 5DG6A 2OQUA 4K8YA 5HMAA 2Q6GA 1XXDA 4WH8A 4Y8ZA 1B7XB 1SBWA 1P11E 1Y3VA 4X8UH 1LKBA 1MTWA 2BVSH 2ZFPH 1TGCA 3WY8A 3H7OA 1E79D 4FUBA 5FXLA 1G2MA 2ZEBA 1AVGH 1QL8A 3F6UH 4NZLA 3RXVA 2GV6A 4IMQA 5T6DA 1EPTA 1Q3XA 3DCLA 1CE5A 5C5NA 3TPIZ 1VR1H 4AZ2B 3SV8A 2AGEX 1DFPA 4A7IB 3SHCH 5DP5A 4KTUA 3P8GA 1GVKB 2Q6DA 1AIXH 4CR9A 2J4IA 3UQVA 4D76A 2FPZA 1SGNE 5I46H 2K0QA 1H4WA 1QNJA 4ISNA 4NIWA 4FUHA 2ULLA 1SGIB 2W7SA 4X6MA 1TX7A 2BX3A 1GI0A 1C1WH 3SW2B 1NT1A 5E2PA 2BX4A 4ABEA 4GHQA 1G3CA 4XD7D 4FETA 5DKMA 1LQEA 1YPHC 1AUJA 2QC2A 1ZGVA 1ELTA 1C2HA 3SU1A 2D8WA 1SFQB 3HGNA 1C5RA 2CF9H 3LGVA 3P92A 1O5EH 2AHME 2ZA5A 3GCHB 2G8TA 3VB6A 1P05A 1ZSLA 1C5SA 1K22H 2GD4B 2HWLB 5IYTA 3UNQA 1C1MA 4ZHLU 2ALPA 2FTLE 4X1SU 2PUXB 1WQVH 2QXJA 2GKVE 2Y5FA 4INHA 1ETRH 1HNEE 2C8YB 3QO6A 5JBTA 1EAUA 2ZI2H 1V2WT 1RGQA 1CHOF 1GMDF 1O3BA 3M35A 1F92A 4LK4A 4Y7AA 4YM9A 1UTLM 1HCGA 2ZF0H 1IQIA 1LVOA 3LH3A 2WPHS 5GIBA 1Y5UT 3A82A 2FOBA 1WAYB 1W7GH 3UR6A 2C90B 4B76A 4F48B 5GXPA 1C1PA 1HAIH 3DA9B 3S9AA 2VWNA 1VITF 4BXWA 1GJCB 2G55A 3HATH 3Q76A 4WJG2 1PFXC 3RXBA 3OU0A 1FPCH 1RXPA 3BTME 4XDEA 3PRDA 1KTSB 2BTCE 1FY5A 1MBQA 1EAXA 1QB1A 5EPYA 1CU1A 1H9HE 2QCYA 1ID5H 1TA2A 1DY9A 1GBTA 1N6XA 2PKSB 1E38B 1Z6JH 2A7CA 1UCYE 1NPMA 2VIVA 2ZCLP 2JH6D 3BIUH 3RXCA 3RUOA 4YLQH 1SLXB 2DE8A 4FVDA 4H6SB 4ZHAA 3P8FA 4D9QA 2LELA 1H8IH 1NTPA 3BTTE 1WTHD 4I8KA 3PV5A 4UFDH 2FLRH 1UTOA 1KLIH 1KXAA 1MCVA 1DVAH 3U1IB 3GY6A 2Y7ZA 2UUYA 1G37A 1O39A 3F9GA 1C2MA 3RU4D 2CXVA 1CSOE 2ZFSA 5HM2A 1K21H 3K9XB 2V3MA 4JZFH 1XKAC 1BITA 1SQAA 4NCYA 3QUMP 2F3CE 1P04A 1SR5C 2KR7A 4A1XA 3WWBA 3IITA 2YMSB 2FYRA 2AFQB 3LT3A 1O2VA 3A86A 1O35A 3PMJA 1S84A 2PSXA 1YBWA 4DT7B 1BMAA 1A0HB 1QGFA 4X6NA 3SV2H 2STBE 3S9BA 1OWEA 4Z0KA 2ODPA 1HUTH 1AWFH 1AKSA 3UNSA 1B0FA 1GJBB 3M3VA 5EQRA 1CGJE 1O2HA 2HRVA 2J95A 1N1LA 1LQDB 1P01A 4ZAEA 1QA7A 3ZZ4A 3PROA 1CGIE 1GHAF 3QGJA 2GZ8A 5DP4A 5E0JA 2QXIA 2RDLA 3RXJA 1VGCC 3UREA 2EA3A 2FWWA 1W11U 3QGNB 3CS7A 1SGFA 3GICB 3ZZ5A 1M9UA 1LMWB 3M5NA 4OS2A 1SQOA 1O3KA 2AMDA 2F91A 1OHHD 5E0GA 2ZFQH 3O8RA 2QF0A 3SJOA 4Q7ZA 4ZXYH 4CRDA 2XYAA 1TNKA 1ESBA 3O8CA 1GG6B 1YPHE 1DXPA 1TABE 2BDIA 1CBWB 1RFNA 4LXBH 1O2WA 1W0YH 1GDNA 1OWDA 3GY7A 2HLDD 1WYKA 2SFAA 3SGBE 4DT4A 3KGPA 1FJSA 2WYGA 3LGIA 4GCHF 4BTUB 1Z8IB 4Y79A 1TWXB 5AFZH 1D3DB 4D9RA 5C67A 2BQWB 4CBNA 1XVOA 3FP8E 2G4TA 2K8IA 3NZIA 2NWNA 1AE8H 1OP2A 1IHSH 1O5FH 1MKWH 2AGIX 4JYVH 3V7TA 2QF4A 2B8OH 1CHOG 4YOJA 5HYOA 1GJ5H 2ZKSA 3MH6A 4NFFA 4Y71A 3M37A 2QF5A 1XXFA 2A2XH 3H09A 3B9FH 1UVSH 1DXWA 3PLBA 1YWUA 5LPFA 1UTQA 1Y8TA 4WMEA 2ZDMA 2KCYA 1SI5H 4IW4E 3SU0A 2OC1A 1TNGA 1GGDC 1ARCA 4MNWA 2GDDA 2TGDA 1E36B 4ZKOU 2W3IA 3DHKH 4I8JA 2FZZA 1A7SA 1S83A 2NU3E 1NM6A 3RXQA 1QA0A 2BVXH 5FPYA 1P3CA 4KGAA 4ASHA 3TLOA 3ZIAD 3OEED 1H8HD 2VIWA 3Q3KA 2HNTF 6GCHG 3D65E 1YPKH 2F9BH 1TRMA 1ZSKA 2NU0E 2RA0A 3U28C 2ZPRA 1IQLA 2FO9A 1BMMH 1NFXA 3UIRA 1CT4E 2K1QA 3MNBA 5IDKA 2FI3E 5E8EH 1GJ8B 1PQAA 1KXDA 2ZPQA 3BSQA 2FODA 1O30A 2JIZD 2PHBA 2ZG0H 2ZU3A 3KL6A 1WOFA 3OY5U 3QK1A 4OS1A 1ZZZA 1V2TT 5T3HA 4XFQA 5A8XA 1C5QA 1SL3A 2JKHA 3TH4H 2KAIA 1S0RA 1DOJA 3ZYDA 1W0KD 2VVUA 1DSUA 2AMPA 3SNDA 1DS2E 1QBVH 4U32A 2STAE 1BBRE 3MO6A 3SUFA 4Q2KA 4O9VA 4TPYA 1C1OA 3RXFA 3M61U 1VGCB 2ZGXH 5FL7D 1ZHPA 2WV4A 4X6OA 1EOLA 2BD8A 2OP9A 2TBSA 3DFLA 2QY0B 3CS0A 3VPKA 4D7GA 2TGPZ 1TX8A 4X8SH 2JDID 1AN1E 3TGIE 1QY6A 3N7EA 1JRSA 3ZVDA 3FZDA 3VB4A 1GBEA 2F9VA 1YP9A 1YY3A 3F3BA 5C1UA 2O8MA 3MYWA 3PTBA 2GVFA 3FP6E 1BHXF 4XBCA 3BG4B 1O3AA 4Q7YA 3VXEH 3M5OA 1GJ6A 2BXUH 1EJNA 1W0ZU 4J1YA 3SJ8A 3HK3B 2GZ7A 3MH5A 3VGCC 3TITA 3SYJA 1QHRB 2P93A 5L2YH 1D3PB 1ORFA 1O2TA 1O2MA 1DWCH 1TPAE 1UCYK 3ZZ8A 1EB1H 1GI6A 5FX6A 4CRBA 2W26A 3T25A 2RDEA 4FUFA 1L4DA 3U8TH 3ZV8A 5LPEA 2ZDNA 1C1UH 2PUQH 1ZGIA 4NSVA 4X1PU 3SNCA 2G00A 3NWUA 4K5ZA 1EAWA 3I78A 2ZNKH 1O5DH 1IHTH 2R9PA 3RXDA 2OINA 3MFJA 2Y82A 1EZUC 1ZYOA 1TA6A 1C5TA 4O3TA 1AFQC 1GBKA 3SU4A 2R0KA 4M7GA 4YOIA 4NGAH 3ZV9A 1TLDA 2R2WU 4ABHA 1LHGH 3MNCA 1FX0B 2QA9E 5EXMA 4FUJA 2J94A 3MU4A 2A45B 3SGQE 1GI2A 1SLUB 3KYGA 2AIQA 4RT1A 2H9EH 2L6OA 2R0LA 1GMDG 2Z6BD 5EGMA 1T8NA 3CENA 1ACBE 1YYY1 1K1IA 2XCNA 3EA7A 4IMZA 2C3SA 1IAUA 1YPJH 1LHFH 2HOBA 2P3UB 1KDQA 5F8ZA 2BQ6B 2OBOA 1DE7H 1C2KA 3NXPA 2ILNA 5ESBA 3FKSD 2O9QA 2XBWA 1L1JA 2PGBB 1D3TB 1O37A 3OFND 1G2LA 2VIPA 3JZ1B 1O2GH 1J17T 1TGSZ 3IG6B 3ZZDA 1TPSA 3RXLA 4GVUA 3SUDA 1AI8H 1MH0A 2TGTA 4JK6A 4KTSA 3ZZAA 1Y3XA 1K1MA 1SGFG 1UVTH 1W12U 3A80A 3ATKA 2Z3CA 5HKKD 5KEDA 2BLVA 1QCPA 1CT2E 1O2ZA 4NIYA 1ZMJA 1FI8A 1HRTH 1EUFA 3GY4A 1P9UA 2RG3A 3RXMA 3SU2A 1C5LH 4ACBA 2WUBA 3T62A 2GCHG 1TBRH 1G3BA 4GLYA 2V0BA 5GCHG 2OLGA 1MTNC 2HGTH 1GBLA 4FXGH 2V3OH 4U2WA 3VFEA 4AFQA 4B2AA 1EJAA 5FBIA 1VCWA 2AIPA 2QXHA 2SGPE 1MD8A 4I8HA 1G36A 1NBME 2ZFFH 3ENSB 4OGYA 1T8MA 4FUIA 2B7DH 3VEQB 4OM9A 3A7ZA 3W95A 1L1GA 1ZR0A 1X7AC 4BAMB 4XBDA 4AFUA 1ELGA 1PPGE 4K1EA 1EXFA 3RM0H 3BG8A 3GOVB 2CGAA 2QV1A 2EC9H 1OOKB 2ZDKA 3RXGA 1TMTH 1W10U 1BB0B 2VVVA 1UK3A 4Y10E 1U6QA 1V6DA 3ESTA 5GDSH 3PM3A 1C9TA 3E90B 4DGJA 2FYQA 3ATLA 4GHTA 2WZQA 1YPLH 3EYDA 7LPRA 5CHAB 5EXLA 2G52A 3W94A 3SGAE 9LPRA 2YNAA 4HTCH 1EZSC 1F7ZA 5BPEA 5JB9S 2Z3EA 1LVMA 5EOKA 1BTZA 8KME2 5FPTA 3PWCA 3RXOA 4DY7B 1SOZA 2HALA 1A2CH 2AS9A 2Z94A 1DLEA 2CF8H 4NWKA 3U8OH 3A87A 1FV9A 1NO9H 2EI7A 4BXSA 5EG4A 2QAAA 2H5CA 1C2JA 2Y7XA 1YC0A 1H8DH 1TE0A 1FY1A 2F83A 1FQ3A 5ABWA 3ZVEA 1WXRA 1NFYA 4CH2B 3BTKE 1VCPA 1KXFA 3IWMA 3B8JA 1W3CA 4FUGA 3UWJH 1GI9B 5HIZA 1J14A 4Y7BA 3I29A 1A0LA 2PKSC 1K0HA 1VZQH 1WUNH 2SNWA 4NZQA 3UTUH 2WYJA 2JETC 3SNAA 5C1XA 3GS9A 1COWD 1UTNA 1NRSH 1HXEH 1AZ8A 3OE7D 4MNXA 3Q77A 2ZDLA 4ABJA 1C5WB 3N7OA 3TK5A 1NU9A 4LZ4B 1AO5A 1EOJA 2ANMH 3UR9A 2HNTC 1K28D 3L6PA 1Y5BT 4OS7A 1F2SE 1O3CA 1GBCA 1FIZA 2BD2A 2GT8A 1RS0A 1GHAG 1ANCA 3F2HA 1V2ST 2BD4A 5E2OA 2CN0H 2ZQ1A 2PP6A 1GHVH 2OC7A 2SGAA 1XUIA 4B2BA 1IQMA 2D1JA 1AWHB 1WBGB 2PKAA 1C5OH 7KMEH 1HFDA 1MABB 1J8AA 3GCOA 3BTGE 1O2XA 1O33A 1C2LA 1RTFB 1T8LA 2A5IA 1LHDH 1NC6A 3E0NB 1XKBC 2A4GA 1ZRKA 4JCNA 1TNHA 3S69A 2KM0A 4ZUHA 1G3DA 3A8AA 1OSSA 3B23B 3P6ZB 4O97A 5TJXA 4E06H 3GCHC 2A4RA 4AFSA 2XTTB 3GISB 3SO3A 3TGKE 1GI1A 4INKA 4AB9A 3UNRA 1ELAA 1HB0B 2BDGA 4SGBE 5C1YA 5LH8A 2GGVB 5E0HA 1DUEA 2ZDVH 2P95A 3D23A 2WPJS 4CRAA 3E6PH 4ZCNA 1CHGA 4X1QU 1GL0E 2VGCB 1ABIH 1SHHB 3KN2A 1KMHB 3GDSA 4FU9A 4A1VA 1EP5A 1P02A 6CHAC 1THRH 1IOEA 4X0WU 1ZPZA 4Y76A 5H4IB 1MKXK 2XBVA 1PPFE 2UUJB 2A32A 1BDAA 4IBLH 2KX4A 3U1JB 1QR3E 5TCCA 2WPMS 1IQJA 1MU6B 4OS5A 5DO4H 3BTEE 2FM2A 4MPVA 5DP3A 2Y6TA 4HZHA 2BLOA 1C5UA 1O2SA 5A0CA 3RXUA 2J34A 3F2FA 1TNLA 1BTXA 1GI5A 1FY3A 2W6JD 3QTOH 1WU1A 4CHAB 4Y0ZE 4NFEA 3S0NA 2J5UA 4GUXA 1QL7A 1A46H 1AVXA 1P2KA 1SGCA 1WTGH 3C27B 1HAXB 1BZXE 4D7FA 4TYDA 3E1XB 2DUCA 1DPOA 1S0QA 2SNVA 2ZTYA 1O0DH 3LOXA 1PYTD 4X8TH 2RFKC 2V35A 2ZC9H 5EU8A 1EZXC 1MTVA 2FX4A 3FANA 3ATWA 4XBBA 3LONA 2OTVA 3AW1A 2IJOB 2ANWA 4U01A 4DURA 4P00A 2OK5A 4DJZB 1GCTB 4TSFD 3MU8A 3I77A 1GBJA 1W7XH 2V7QD 5JBAS 1P2JA 5FPSA 1V3XA 5GNDA 1RD3B 1TNJA 3L33A 1SLWB 3TJVA 1DANH 2BDHA 3RP2A 3PV2A 1C2FA 2ASUB 4IN2A 3A7YA 3EAJA 2BLWA 3KF2A 1S6LA 2EQNA 1TRYA 4ZROA 3FN8A 2D2DA 1C1RA 1GBBA 2GMTC 2BM2A 2QGRA 2G5VA 4Q7XA 4YZUA 4AB8A 3RXSA 1L1NA 1ZMNA 1C2EA 2CJIA 2PTNA 2C93B 3STJA 1E1QD 1GJDB 1GI4A 1CO7E 3FP7E 4TY7A 2P3TB 2V6NA 1C5VA 3BTWE 3F0PA 1ANEA 1ZPBA 1W2KH 4BANB 2O8UA 1TAWA 4AGKA 2Y5HA 4E05H 2GP9B 2VNTA 4AGJA 3AAUA 3BG4C 3Q3XA 2NU1E 1NBMD 3EE0B 3SQHE 1GJ9B 3MI4A 3RC5A 1YCPM 1MUEB 1V2KT 1GVLA 4NA9H 1SLVB 4I31A 3RC4A 3E91A 2FEQH 1GMHG 1HJ9A 1T4UH 1TMUH 2W6ID 3TNTA 3OY6U 1P2MA 1O38A 1NU7B 2A2QH 4BAKB 2L74A 1FZZA 1P2QA 1INCA 3BTQE 3BN9A 3Q00A 1BMFD 2ZGHA 3OEHD 2BY7X 3V13A 5G4BA 1QJ7B 1JMOH 2A5KA 3RXIA 4CR5A 3U98H 3F2GA 5C0TA 1ESAA 4K60A 4XE4A 2ESTE 2OUAA 4NG9H 4JMYA 3ZVGA 2GCHF 1ZJDA 1O3OA 3BEIB 2OXSA 5A8YA 1FPHH 3RMMH 3URCA 5EQQA 1RRKA 1GI8B 1FAXA 4A92A 1LVYA 3DSOA 2CK3D 1ZTJA 5JPMH 1C1TA 3A8BA 2WHXA 1K2I1 1GHBF 1Z71A 1PPCE 1IQEA 2ZZUH 2B0FA 2ZHEH 1O2IA 1TNIA 1DT2A 4WY3A 1H9LB 1G30B 5DSFA 4BAHB 2GMTB 1WQSA 4Y11E 1JBUH 1Q2WA 1CA8B 3ZYEA 2Z3DA 1HIAB 3M36A 3ZVCA 1HAVA 4O03A 3O8BA 1FXYA 2F9OA 3BTHE 3K6ZA 2FX6A 1OWJA 4H6TA 4JZEH 3AAVA 2PTCE 4ISIH 3HGPA 1LDTT 5L2ZH 2QN5T 2BY6X 5CE1A 2ZCKP 8GCHG 2H2ZA 4RKJB 4BOHA 1MD7A 3U69H 3PO1B 1HJAC 2ZU5A 1B0EA 1C4U2 1C5MD 1MQ6A 2C8XB 1AZZA 1UHBB 2KFWA 3E8LA 3SV7A 1XUKA 1BIOA 2FOCA 1WSSH 4TWYA 4Y0YE 3MQKC 3O8DA 4U30A 3M3TA 3UY9A 1MCTA 4R8TB 1MAYA 4B2CA 1JXPA 2EEKA 3RMNH 4GSOA 1G32B 2BD7A 3C1KA 4IGDA 1UTJA 3PYHA 1Z8RA 4AORA 1GMHF 2ANYA 1QRWA 4MQAA 5JBBS 1GCDA 1IQKA 4ISLA 1N6YA 3SNEA 1BRBE 2XBYA 1O2YA 3PO1C 4TT3D 2I6SA 3F9HA 4Z1MD 3F9FA 4NIXA 4IC6A 2QYIA 3VG8A 1LKAA 1C5NH 5EJ1A 3NPSA 1OYQA 2SGQE 2OBQA 4VGCC 3M3SA 4XSKU 1RIWC 2G81E 1IQGA 1ABJH 1L4ZA 2WUCA 3M7QA 2PFEA 3ZVAA 1VITG 2YOLA 1CBWC 5DGJA 1QQ4A 1VCQA 1BT7A 3MNXA 1AY6H 2A31A 1NFWA 1A61H 2VJ1A 1TQ0B 1P03A 2FMJA 3ZZ9A 4MNYA 2KAIB 1NRNH 2YMSD 2UUKB 1SHYA 1FLEE 3PWBA 3GCNA 2GJGA 1BRAA 3RXPA 4MLFB 3BTFE 4K1SA 2TRMA 3KQCA 4IC5A 3LJJA 1UTPA 3P8OA 1A3BH 2F43B 1O2UA 2ZO3H 2XCFA 4R0IA 3G01A 1TGNA 3U8RH 4BTTB 1SG8B 1GBDA 4XRNA 2J38A 5HXFA 4K1TA 4SGAE 3MMGA 1C1SA 1J15A 3SUGA 4RN6A 4NSYA 3MH4A 3PLPA 5DN6D 3F9EA 2BHGA 1ETSH 3OAAD 6GCHF 5B6OA 3LPRA 2H1UA 4FU8A 1KXBA 1O32A 3TNSA 3LGUA 5DP9A 3HK6B 4UFGH 1ZOMA 2RCEA 1EASA 1EFRD 1OS8A 1GDQA 1AHTH 5DP6A 3TVJB 1C1VH 4MVNA 1OXGA 1AFEH 3WWFA 5F03A 1C5ZB 3H5CB 2F9PA 1GMCF 1SOTA 4THNH 3UB0A 1SQRA 1O3NA 1F0UA 3AW0A 1BMNH 1W8BH 2QXGA 1CVWH 3ELAH 3TK9A 3LJOA 4DIIH 1IQNA 3ATMA 4WVPE 3STIA 2ZCHP 3UOUA 2QE7D 1D6RA 1UTKA 2JETB 2ZIQH 1EKBB 1W13U 3UWIA 4ISOA 1GJ7B 5K7RA 4YLUA 1GHBG 2OQ5A 2HNTE 2XXLA 5EQSA 2ZWLH 3RDZA 4Y6DA 2PV9B 1UW7A 4P02A 1GHXH 5EJLA 1T8OA 2LPRA 5ESTE 1P12E 3WW7A 1DICA 3GY3A 2F9UA 1VJ9U 1O2JA 1PJPA 2FOEA 4CBOA 4O3UA 1ETTH 3A84A 1TGTA 3S7KB 1QL9A 2BD9A 4I8LA 4X2WA 1YCPH 3LDXH 4WF8A 1LPKB 1DUAA 3DUXH 3OYPA 4X2YA 2FI4E 3F68H 4A1TA 4E7RG 2ZU2A 3SI3H 3EQ0H 3RLWH 2FOHA 1Y5AT 3TK6A 2PWXA 1NRPH 3E0PB 2XC5A 2XOKD 3MH7A 1V2UT 1UMAH 1TMBH 3NK8A 3MO9A 1YM0A 3SZNA 1GMCG 2XBXA 1E1RD 4YO9A 5HGGA 1GJ4H 3RXKA 5CDFE 1JIRA 2BDBA 2WINI 4M9FA 4MG3A 3OX7U 1KY9A 4ZHMU 4Y8YA 2SGEE 2ANKH 1A0JA 5FCRA 1WCZA 1SGRE 1EAIA 2GCTB 1QFKH 1GBFA 3M7UA 1GHWH 1SGDE 2BDCA 4F49A 4JYTA 3RMLH 1SQTA 4AX9H 5FCKA 5SGAE 1AQ7A 3ZVBA 3QWCH 5J4SA 2JH0D 2P94A 1T32A 2BDAA 2LNCA 3U9AH 3QZQA 2VH0A 1QQUA 4IS5A 3A89A 2TIOA 2FOMB 1D4PB 2TPIZ 1BA8B 1HAVB 2GT7A 4YESB 1L2EA 1HIAA 4OS4A 3T29A 1YCPK 1QB9A 2GTBA 4UEHH 2Z9LA 1V2QT 2IJD1 2KCAA 5DP8A 1V2RT 1F5LA 1BMLA 1O3EA 2XW9A 4CRCA 1LTOA 5T1VA 1C1QA 1AE5A 4KELA 3PTNA 1TPPA 3NCLA 1O3JA 3M7TA 2ZQ2A 3T28A 3HPTB 1SGTA 3VXFH 3ZZ6A 1CGHA 3VB3A 1GPZA 3GYLB 5BRRE 1F0SA 1UCYH 3W1EA 1T7CA 1RIWB 1DLKB 2EI6A 2Z9JA 3LIWA 2NU4E 3LGYA 1K1PA 2AYWA 1YPEH 1ZHMA 1BRCE 5F8TA 2WPDD 3TH3H 3D49H 3KHVA 1HAPH 1KSNA 1AD8H 2D26C 5F8XA 2GDEH 2AERH 5A09A 1N8OC 1GI3A 3ITIA 1RTLA 1LO6A 4DG4A 4ESTE 1IQHA 3GY5A 1HAZB 3D62A 1GCTC 1BQYA 1Z8JB 3FZZA 2ZDAH 3A83A 4YT6H 4AC9A 5FX5A 5J4QA 1WDIA 1TQ7B 4UDWH 2CV3A 1O3GA 3ZVFA 4ASUD 1F5RA 1AUTC 3GY2A 5GPIB 1PYTC 1PPZA 5PTPA 3KQBA 1HAHH 3MU5A 4MPWA 4UD9H 2OC8A 9ESTA 1BUIA 1SC8U 3OTJE 3BIVH 2C8WB 1D6WA 4OS6A 5T6FA 2F9NA 1KLJH 1SGYE 4CRGA 3TJNA 1AFQB 1BBRH 3FFGA 5TCAA 2QF3A 1K1JA 4ZH8A 2P8OC 2H5DA 3GCTG 1MZAA 2O8LA 1O3IA 2ZFTA 5C0UA 1C2GA 1F0TA 1L0ZA 3N99A 3FVFB 3AASA 1SGQE 1ELFA 1YPMH 2BB4A 4TWWA 1Z8GA 1Q31A 2GV7A 3NRLA 3BTDE 4B74A 1F5KU 3MNSA 1A1RA 3JZ2B 4B73A 4H42U 4BAQB 1OWKA 5DP7A 5KGOA 1H9IE 1HGTH 3KEEA 1HAOH 1G3EA 4UONA 3RXAA 3SORA 5LPRA 5CHBA 2Y5GA 4HG6A 1AB9C 2R2MB 4YTAA 4NA7A 4FUCA 1TB6H 4INLA 4HFPB 4GAWA 1FONA 1G9IE 3CP7A 2PLXA 3EGKH 3OTPA 4I86A 1TIOA 5DPAA 1AMHA 1MKWK 3F0OA 1P3EA 2BY9X 4CH8B 2BYAX 3H7TA 2BQ7B 2JJ1D 1LCYA 2FXRA 1HBTH 1O3LA 4AYYB 5C3NA 1PPHE 2EI8A 2O8WA 2HPPH 1HPGA 1UTMA 3KQEA 1P8VC 3RXEA 2VWOA 2FOFA 4WXVA 3P95A 2AH4X 1Y3YA 3T27A 1ZPCA 1O3PB 4CHAC 3L3TA 4MPUA 2CMYA 3MU1A 3GCTF 1V2MT 5DK1A 2FS8A 1SVPA 2AMQA 1EPTB 1V2VT 3SBKA 3S9CA 1BTPA 3HKIB 2EY4C 2BLQA 3BF6H 4ABIA 2KZ4A 3T2NA 1QJ6B 4JZDH 1LPZB 2IPHA 1ARBA 2HPQH 1Z1JA 2WSSD 2XNDD 3SU5A 5FHTA 1OYTH 1YLNA 2A7JA 2VH6A 4BNRA 1YF4A 3SUEA 1MMJN 3SN8A 4Z6AH 1OWHA 1XVMA 1O5AB 2HVYB 3R3GB 1MAXA 1KIGH 1A3EH 2ODQA 3ATIA 1A5IA 1GWAA 2FESH 2VBCA 2J98B 2XWBI 1E34B 3NKKA 1Z7KA 2ALVA 1O5GH 5LGOA 1B5GH 2ZU1A 3GY8A 2UWOA 1DY8A 1OPHB 1QB6A 4CRFA 5AF9H 4Q63A 4UE7H 1JIMA 1UJ1A 1THPB 3HKJB 2GCTC 3P8NA 2H9TH 2ZECA 3RC6A 2WV9A 3SJ9A 1LHCH 2QIQA 2AEIH 3A85A 5A0AE 1PPBH 1C5XB 5GWZA 1S85A 4ABAA 4UFEH 3DT0H 3TIUA 1SKYE 5K0HA 1BCUH 1DM4B 4ZKNU 1H1BA 1ZRBA 3V0XA 2BD3A 3RXTA 4E7NA 3QZRA 1QIXB 3T5FH 1CA0C 1BJUA 3SHAH 1E0FD 2J2UA 1S6FA 1SB1H 1O36A 4Y8XA 1FAKH 1XUJA 2Q6FA 1C4V2 1ELBA 1KLTA 3S7HB 3MOCA 3MHWU 5JYIA 1BTUA 1D9IA 4FUEA 5I25A 4AN7A 1HJAB 1O5BB 1LVBA 5C20A 1DWEH 1GI7B 1YKTA 2JJ2D 1H8ED 3NUMA 2Y81A 5EODA 4BAOB 4FOUC 2B5TB 1NFUA 1TBZH 4QT8C 2YNBA 4X6PA 2FOAA 1O5CB 2TGAA 6ESTA 4DVAU 5C5OA 4X8VH 1NN6A 4XOJA 1HYLA 4DIHH 4HI3A 4WMDA 4WXIA 1GG6C 1GVZA 1Y59T 1EJMA 3FOAA 4X1RU 1EQ9A 1J16A 2Z9GA 2RA3A 1Y3WA 1UVUH 1HV7A 3A7VA 4J2YB 1KDQB 4I33A 2BZ6H 1T31A 3RU4T 1IQFA 1XUFA 1C4Y2 3RXRA 1AVWA 4B1TA 1QTFA 1NY22 1ELVA 8LPRA 2IOTA 1MQ5A 1OP0A 3V3MA 2VIDA 1C9PA 1O3DA 1GBAA 1Y3UA 1TGBA 3QX5H 1P57B 4RKOB 1S81A 1W0JD 1ELEE 5A2MH 1GDUA 3A8CA 4A6LA 1EATA 4B75A 1XUGA 1GHYH 4AFZA 3UUZA 1DDJA 1TALA 1S5SA 3RMOH 4X1NU 1ANDA 2J97A 1QRXA 4H4FA 1F0RA 1OKXA 1QBOA 2FP7B 2VWMA 3PLKA 4DOQA 3A7TA 3BEFB 3VB7A 3KNXA 5EW2H 4IN1A 4ABFA 2J9NA 3ZZCA 1C5PA 3K2UA 2BZAA 1HXFH 1GL1A 3BV9B 3GYMA 4AG2A 2BXTH 5B6LA 4WWYA 5C17A 3CNRA 4JZ1A 2THFB 1TYNA 1KXCA 1CQQA 2A7HA 2XRCA 3DFJA 2ZHDA 3A88A 1QRZA 4ABGA 1A5GH 1TOCB 2Q1JA 1DITH 1K9OE 5A8ZA 3DSGA 5T6GA 5EW1H 4ABBA 1ZHRA 2XC4A 1NZQH 1UHBA 4ZXXH 2XNIA 1NRQH 2KCOA 5DJ7A 1MU8B 3TH2H 1D3QB 3SJKA 1UK4A 1FDPA 1TPOA 1O2PA 1QBNA 3V12A 2BDYA 3KQ5A 7ESTE 4MDSA
chains in the Genus database with same CATH topology
1FUJA 1XMNB 1BOQA 1TFXA 2FOGA 2BOHB 1YGCH 4WMFA 1FNIA 2VINA 4ZKRU 1Z6EA 4LOYH 1PQ7A 1UK2A 7GCHG 1KXEA 3A8DA 4JK5A 2ZGJA 4JZIA 1C5YB 1FIWA 1GBHA 1FMGA 1ZJKA 1K1NA 1CA0B 2PW8H 3VGCB 4ABDA 3RXHA 1J9CH 3UPEA 1ANBA 1SFIA 1RTKA 1ZSJA 2A5AA 2FTMA 2NU2E 1PPEE 1OWIA 3E16B 3ODDA 1ELDE 3TJUA 1ELCA 2A0QB 3BEUA 2OD3B 1DWDH 1SGEE 1DWBH 1A4WH 4PROA 3ZZBA 3SU3A 3UOPA 1BRUP 2BD5A 1BTHH 1EZQA 2Y80A 2FIRH 2J92A 1MBMA 1ESTA 5ETXA 3QTVH 2FI5E 1O3FA 1VITH 3MU0A 1W14U 4MTBA 2GX4A 1XX9A 1O2RA 4I32A 1HLTH 1BTYA 2SGDE 1GBMA 2G4UA 4NA8A 3PMHB 1HAYB 1O2OA 8GCHF 3PV4A 4AYVB 3LH1A 2V3HH 4K69A 1K1LA 1EP6A 1MTNB 1C2DA 3QDZB 1FY4A 2W5EA 5GJ4B 1NROH 2VIOA 5AVDA 5A0BA 3VB5A 4ZMAH 4FUDA 4MPXA 2P59A 6CHAB 1NESE 2WV5A 3MO3A 2VGCC 1TONA 1JWTA 1WV7H 2UUFB 1VJAU 2O8TA 3LU9B 4GPGA 2W7UA 1EPTC 1LPGB 1PQ5A 2ZHWH 2Z9KA 3ZZ7A 1JOUB 3AVZA 4Q80A 4BTIB 4TY6A 1SMFE 4ISHH 2C4FH 2Z7FE 3LGWA 1PQ8A 3EA8A 4K8BA 1OX1A 3DD2H 1BBRK 1S6HA 1YLDA 1P06A 1FN6A 2UWLA 3R0FA 5GCHF 2UWPA 1JRTA 1T4VH 3PB1E 1EX3A 2ZHFH 3RLYH 3KIDU 3EDXB 2BMGB 4KP0A 1A5HA 1V2JT 2DE9A 3PMAB 3Q3YA 1TBQH 4MNVA 1UVPA 3OSYA 1AB9B 3URDA 4B71A 2G5NA 1BJVA 5FBEA 1V2NT 1UVOA 4F4OC 1P9SA 2H9HA 1TRNA 4WH6A 1N8OB 3P70B 3LC3A 5EPNA 1AKSB 2B9LA 1FY8E 1SGPE 1YPGH 4CREA 2XWAA 2BY5X 2ZP0H 1ZTLA 4ZKSU 3PMBB 2OCVB 3ZZ3A 6LPRA 5L30H 3SOSA 1QURH 1TOMH 2P8OB 5AHGH 2R3YA 3GDVA 1O3HA 4AG1A 2VB0A 4K3JA 1BTWA 2AGGX 1HAGE 4KKDA 1DSTA 1O2NA 3RU4E 2ZFRH 1MTUA 2ZPSA 3KCGH 2ZU4A 3K6YA 4I8GA 2ZHQH 1LHEH 1ZTKA 2I6QA 3TJOA 1P2IA 1E37B 2M5TA 1O2QA 1P0SH 2FLBH 1QJ1B 2IN2A 3T26A 2ZGCA 1C2IA 2VWLA 3LC5A 1V2PT 2BY8X 2ZTZA 1MKXH 2FS9A 1S82A 2WPLS 3FAOA 3LGTA 2GZ9A 3SNBA 4RSPA 5AFYH 4LZ1H 1O2KA 2CHAC 2Z9IA 3A81A 4TPIZ 4X2XA 5HM9A 3SQEE 3QLPH 1MTSA 4DCDA 2ZGBH 4GCHG 1KYNA 1O2LA 2PSYA 2VVCA 4X2VA 4DW2U 1DX5M 1AU8A 1NRRH 3QN7A 2FDAA 2P3FH 2HVXA 3ODFA 5JB8S 1KTTB 5C2ZA 3KQDA 2HLCA 2BOKA 4YT7H 2VU8E 3EA9A 4NWLA 2CHAB 1HDTH 5JDUB 5F6MA 1C1NA 1P09A 1OP8A 4D8NA 2A4OA 1RJXB 1ZLRA 8ESTE 2PR3A 7GCHF 1P2OA 2JH5D 2BVRH 2ODYB 4OGXA 1GBIA 5CMXH 3K65B 1P10A 1ZMLA 4FVBA 5FAHA 1HJ8A 1XUHA 1YLCA 1UO6A 1MZDA 1O31A 3MTYA 2WPKS 4JYUH 1E35B 1NS3A 4NIVA 3UQOA 5JBCS 1V2LT 1P2NA 3E3TA 3M5MA 3RM2H 1O3MA 1AGJA 1K1OA 2W3KA 2A4QA 1XM1A 1EB2A 1GHZA 2XC0A 3TU7H 3MWIU 2OC0A 3LKWA 1SSXA 1BHXB 3SU6A 3A7WA 2A1DB 1Z1IA 4A5TS 4UFFH 1SPJA 4VGCB 2SGFE 2PKAB 4AOQA 4I7YH 1TX6A 3A7XA 1FN8A 2G51A 4K2YA 3SV6A 5L6NH 3GDUA 3M5LA 3SV9A 1GGDB 4YOGA 2VIQA 1THSH 3SJIA 3SI4H 2ZTXA 3F1SB 2P16A 4KTCA 1GJAB 5EXNA 4FU7A 2H6MA 2R3UA 3UFAA 2PGQB 1CT0E 2C8ZB 1O34A 3P17H 2WPIS 3TGJE 1V2OT 4HGCA 5CHAC 5DG6A 2OQUA 4K8YA 5HMAA 2Q6GA 1XXDA 4WH8A 4Y8ZA 1B7XB 1SBWA 1P11E 1Y3VA 4X8UH 1LKBA 1MTWA 2BVSH 2ZFPH 1TGCA 3WY8A 3H7OA 4FUBA 5FXLA 1G2MA 2ZEBA 1AVGH 1QL8A 3F6UH 4NZLA 3RXVA 2GV6A 4IMQA 5T6DA 1EPTA 1Q3XA 1CE5A 5C5NA 3TPIZ 1VR1H 4AZ2B 3SV8A 2AGEX 1DFPA 4A7IB 3SHCH 5DP5A 4KTUA 3P8GA 1GVKB 2Q6DA 1AIXH 4CR9A 2J4IA 3UQVA 4D76A 2FPZA 1SGNE 5I46H 4ISNA 1H4WA 1QNJA 4NIWA 4FUHA 2ULLA 1SGIB 2W7SA 4X6MA 1TX7A 2BX3A 1GI0A 1C1WH 3SW2B 1NT1A 5E2PA 2BX4A 4ABEA 4GHQA 1G3CA 5DKMA 1LQEA 1YPHC 1AUJA 2QC2A 1ZGVA 1ELTA 1C2HA 3SU1A 2D8WA 1SFQB 3HGNA 1C5RA 2CF9H 3LGVA 3P92A 1O5EH 2ZA5A 3GCHB 2G8TA 3VB6A 1P05A 1ZSLA 1C5SA 1K22H 2GD4B 2HWLB 5IYTA 3UNQA 1C1MA 4ZHLU 2ALPA 2FTLE 4X1SU 2PUXB 1WQVH 2QXJA 2GKVE 2Y5FA 4INHA 1ETRH 1HNEE 2C8YB 3QO6A 5JBTA 1EAUA 2ZI2H 1V2WT 1RGQA 1CHOF 1GMDF 1O3BA 3M35A 1F92A 4LK4A 4Y7AA 4YM9A 1UTLM 1HCGA 2ZF0H 1IQIA 1LVOA 3LH3A 2WPHS 5GIBA 1Y5UT 3A82A 2FOBA 1WAYB 1W7GH 3UR6A 2C90B 4B76A 5GXPA 1C1PA 1HAIH 3DA9B 3S9AA 2VWNA 1VITF 4BXWA 1GJCB 2G55A 3HATH 3Q76A 4WJG2 1PFXC 3RXBA 3OU0A 1FPCH 1RXPA 3BTME 4XDEA 1KTSB 2BTCE 1FY5A 1MBQA 1EAXA 1QB1A 5EPYA 1CU1A 1H9HE 2QCYA 1ID5H 1TA2A 1DY9A 1GBTA 1N6XA 2PKSB 1E38B 1Z6JH 2A7CA 1UCYE 1NPMA 2VIVA 2ZCLP 2JH6D 3BIUH 3RXCA 3RUOA 4YLQH 1SLXB 2DE8A 4FVDA 4H6SB 4ZHAA 3P8FA 4D9QA 1H8IH 1NTPA 3BTTE 1WTHD 4I8KA 4UFDH 2FLRH 1UTOA 1KLIH 1KXAA 1MCVA 1DVAH 3U1IB 3GY6A 2Y7ZA 2UUYA 1G37A 1O39A 3F9GA 1C2MA 3RU4D 2CXVA 1CSOE 2ZFSA 5HM2A 1K21H 3K9XB 4JZFH 1XKAC 1BITA 1SQAA 4NCYA 3QUMP 2F3CE 1P04A 1SR5C 4A1XA 3IITA 2FYRA 2AFQB 3LT3A 1O2VA 3A86A 1O35A 3PMJA 1S84A 2PSXA 1YBWA 4DT7B 1BMAA 1A0HB 1QGFA 4X6NA 3SV2H 2STBE 3S9BA 1OWEA 4Z0KA 2ODPA 1HUTH 1AWFH 1AKSA 3UNSA 1B0FA 1GJBB 3M3VA 5EQRA 1CGJE 1O2HA 2HRVA 2J95A 1N1LA 1LQDB 1P01A 4ZAEA 1QA7A 3ZZ4A 3PROA 1CGIE 1GHAF 3QGJA 2GZ8A 5DP4A 5E0JA 2QXIA 2RDLA 3RXJA 1VGCC 3UREA 2EA3A 2FWWA 1W11U 3QGNB 3CS7A 1SGFA 3GICB 3ZZ5A 1M9UA 1LMWB 3M5NA 4OS2A 1SQOA 1O3KA 2AMDA 2F91A 5E0GA 2ZFQH 3O8RA 2QF0A 3SJOA 4Q7ZA 4ZXYH 4CRDA 2XYAA 1TNKA 1ESBA 3O8CA 1GG6B 1YPHE 1DXPA 1TABE 2BDIA 1CBWB 1RFNA 4LXBH 1O2WA 1W0YH 1GDNA 1OWDA 3GY7A 1WYKA 2SFAA 3SGBE 3KGPA 1FJSA 2WYGA 3LGIA 4GCHF 4BTUB 1Z8IB 4Y79A 1TWXB 5AFZH 1D3DB 4D9RA 5C67A 2BQWB 4CBNA 1XVOA 3FP8E 2G4TA 3NZIA 2NWNA 1AE8H 1OP2A 1IHSH 1O5FH 1MKWH 2AGIX 4JYVH 3V7TA 2B8OH 1CHOG 4YOJA 5HYOA 1GJ5H 2ZKSA 3MH6A 4NFFA 4Y71A 3M37A 1XXFA 2A2XH 3B9FH 1UVSH 1DXWA 3PLBA 5LPFA 1UTQA 1Y8TA 4WMEA 2ZDMA 1SI5H 4IW4E 3SU0A 2OC1A 1TNGA 1GGDC 1ARCA 4MNWA 2GDDA 2TGDA 1E36B 4ZKOU 2W3IA 3DHKH 4I8JA 2FZZA 1A7SA 1S83A 2NU3E 1NM6A 3RXQA 1QA0A 2BVXH 5FPYA 1P3CA 4KGAA 4ASHA 3TLOA 2VIWA 3Q3KA 2HNTF 6GCHG 3D65E 1YPKH 2F9BH 1TRMA 1ZSKA 2NU0E 2RA0A 2ZPRA 1IQLA 2FO9A 1BMMH 1NFXA 3UIRA 1CT4E 2K1QA 3MNBA 5IDKA 2FI3E 5E8EH 1GJ8B 1PQAA 1KXDA 2ZPQA 3BSQA 2FODA 1O30A 2PHBA 2ZG0H 2ZU3A 3KL6A 1WOFA 3OY5U 3QK1A 4OS1A 1ZZZA 1V2TT 5T3HA 4XFQA 5A8XA 1C5QA 1SL3A 2JKHA 3TH4H 2KAIA 1S0RA 1DOJA 3ZYDA 2VVUA 1DSUA 2AMPA 3SNDA 1DS2E 1QBVH 4U32A 2STAE 1BBRE 3MO6A 3SUFA 4Q2KA 4O9VA 4TPYA 1C1OA 3RXFA 3M61U 1VGCB 2ZGXH 1ZHPA 2WV4A 4X6OA 1EOLA 2BD8A 2OP9A 2TBSA 3DFLA 2QY0B 3CS0A 3VPKA 4D7GA 2TGPZ 1TX8A 4X8SH 1AN1E 3TGIE 1QY6A 1JRSA 3ZVDA 3FZDA 3VB4A 1GBEA 2F9VA 1YP9A 5C1UA 2O8MA 3MYWA 3PTBA 2GVFA 3FP6E 1BHXF 4XBCA 3BG4B 1O3AA 4Q7YA 3VXEH 3M5OA 1GJ6A 2BXUH 1EJNA 1W0ZU 4J1YA 3SJ8A 3HK3B 2GZ7A 3MH5A 3VGCC 3TITA 5L2YH 1QHRB 2P93A 1D3PB 1ORFA 1O2TA 1O2MA 1DWCH 1TPAE 1UCYK 3ZZ8A 1EB1H 1GI6A 5FX6A 4CRBA 2W26A 3T25A 4FUFA 1L4DA 3U8TH 3ZV8A 5LPEA 2ZDNA 1C1UH 2PUQH 1ZGIA 4NSVA 4X1PU 3SNCA 2G00A 3NWUA 4K5ZA 1EAWA 3I78A 2ZNKH 1O5DH 1IHTH 2R9PA 3RXDA 2OINA 3MFJA 2Y82A 1EZUC 1ZYOA 1TA6A 1C5TA 4O3TA 1AFQC 1GBKA 3SU4A 2R0KA 4M7GA 4YOIA 4NGAH 3ZV9A 1TLDA 2R2WU 4ABHA 1LHGH 3MNCA 2QA9E 5EXMA 4FUJA 2J94A 3MU4A 2A45B 3SGQE 1GI2A 1SLUB 2AIQA 2H9EH 2R0LA 1GMDG 2Z6BD 5EGMA 1T8NA 3CENA 1ACBE 1YYY1 1K1IA 2XCNA 3EA7A 4IMZA 2C3SA 1IAUA 1YPJH 1LHFH 2HOBA 2P3UB 1KDQA 5F8ZA 2BQ6B 2OBOA 1DE7H 1C2KA 3NXPA 2ILNA 5ESBA 2O9QA 2XBWA 1L1JA 2PGBB 1D3TB 1O37A 1G2LA 2VIPA 3JZ1B 1O2GH 1J17T 1TGSZ 3IG6B 3ZZDA 1TPSA 3RXLA 4GVUA 3SUDA 1AI8H 1MH0A 2TGTA 4JK6A 4KTSA 3ZZAA 1Y3XA 1K1MA 1SGFG 1UVTH 1W12U 3A80A 3ATKA 2Z3CA 2BLVA 1QCPA 1CT2E 1O2ZA 4NIYA 1ZMJA 1FI8A 1HRTH 1EUFA 3GY4A 1P9UA 2RG3A 3RXMA 3SU2A 1C5LH 2WUBA 3T62A 2GCHG 1TBRH 1G3BA 4GLYA 2V0BA 5GCHG 2OLGA 1MTNC 2HGTH 1GBLA 4FXGH 2V3OH 4U2WA 3VFEA 4AFQA 4B2AA 1EJAA 5FBIA 1VCWA 2AIPA 2QXHA 2SGPE 1MD8A 4I8HA 1G36A 2ZFFH 3ENSB 4OGYA 1T8MA 4FUIA 2B7DH 3VEQB 3A7ZA 3W95A 1L1GA 1ZR0A 1X7AC 4BAMB 4XBDA 4AFUA 1ELGA 1PPGE 4K1EA 1EXFA 3RM0H 3BG8A 3GOVB 2CGAA 2QV1A 2EC9H 1OOKB 2ZDKA 3RXGA 1TMTH 1W10U 2VVVA 1BB0B 1UK3A 4Y10E 1U6QA 1V6DA 3ESTA 5GDSH 3PM3A 1C9TA 3E90B 4DGJA 2FYQA 3ATLA 4GHTA 1YPLH 3EYDA 7LPRA 5CHAB 5EXLA 2G52A 3W94A 3SGAE 9LPRA 2YNAA 4HTCH 1EZSC 1F7ZA 5BPEA 5JB9S 2Z3EA 1LVMA 5EOKA 1BTZA 8KME2 5FPTA 3PWCA 3RXOA 4DY7B 1SOZA 2HALA 1A2CH 2AS9A 2Z94A 1DLEA 2CF8H 4NWKA 3U8OH 3A87A 1FV9A 1NO9H 2EI7A 4BXSA 5EG4A 2QAAA 2H5CA 1C2JA 2Y7XA 1YC0A 1H8DH 1TE0A 1FY1A 2F83A 1FQ3A 5ABWA 3ZVEA 1NFYA 4CH2B 3BTKE 1VCPA 1KXFA 3IWMA 3B8JA 1W3CA 4FUGA 3UWJH 1GI9B 1J14A 4Y7BA 3I29A 1A0LA 2PKSC 1VZQH 1WUNH 2SNWA 4NZQA 3UTUH 2WYJA 2JETC 3SNAA 5C1XA 1UTNA 1NRSH 1HXEH 1AZ8A 4MNXA 3Q77A 2ZDLA 4ABJA 1C5WB 3N7OA 3TK5A 1NU9A 4LZ4B 1AO5A 1EOJA 2ANMH 3UR9A