1KXCA

Sindbis virus capsid (n190k mutant), tetragonal crystal form
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
ALKLEADRLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTYTSEHPEGFYKWHHGAVQYSGGRFTIPRGVGGRGDSGRPIMDNSGRVVAIVLGGADEGTRTALSVVTWNSKGKTIKTTPEGTEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of Sindbis virus capsid mutants involving assembly and catalysis.
pubmed doi rcsb
source organism Sindbis virus
molecule tags Viral protein
molecule keywords SINDBIS VIRUS CAPSID PROTEIN
total genus 34
structure length 158
sequence length 158
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1996-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxcA01
3SGBE 2OINA 3BTGE 5HXFA 4BAOB 1N1LA 4O9VA 5EQSA 4NG9H 3I29A 1YPHC 1RD3B 4YLQH 1ZTLA 1QL8A 1TGSZ 1GHBG 1IQEA 4Y0YE 1NRSH 1PPBH 2ZQ2A 4CRFA 1C9TA 3KF2A 1YPJH 6CHAC 1KXBA 2DE8A 1MQ5A 1ANDA 3K65B 2AH4X 1HB0B 1TE0A 2YNBA 3GCOA 1MTNB 2NU4E 1EXFA 4ISIH 4X2XA 2PKAB 1QA7A 3OYPA 4MDSA 5CMXH 3Q77A 4ZKRU 1ZGIA 3MO9A 4WXVA 1O3NA 3UUZA 1BITA 2XBWA 1O5FH 5TJXA 1L4ZA 1DXPA 3NZIA 2WUCA 2VGCC 4WH6A 5E0HA 2OLGA 4UFFH 3SI3H 1G30B 1L1GA 2Z3CA 5E0JA 3PYHA 3VXEH 1K1PA 4MPXA 1D3QB 8GCHG 5J4QA 1HJ9A 3KGPA 1O2IA 1C5PA 1BBRE 1LTOA 3UNRA 1A0LA 1UVSH 2BDAA 2SGFE 1EJAA 1MBQA 2VH0A 2A7JA 4GUXA 5T3HA 1GHAF 1FNIA 4D8NA 1C2MA 4X1RU 5FPSA 1O2ZA 2AFQB 4I8LA 1LMWB 2GT7A 3D49H 1FLEE 1C2HA 7GCHF 5A09A 1P11E 1LKAA 4DOQA 1BJVA 1DS2E 3QN7A 1UK4A 4K8YA 1C1WH 1BTXA 1GMCF 3M3SA 1DM4B 1CO7E 1P2QA 3PTNA 2HALA 3RXGA 3RXQA 4B75A 3V13A 4XDEA 5BPEA 1WCZA 3TLOA 1VGCB 1O3DA 1SHYA 4AFZA 3F6UH 2SFAA 2SNWA 4MTBA 1HGTH 1JRTA 3LOXA 4YT6H 1EAWA 1FAXA 1ZOMA 3V12A 1K9OE 4MNYA 1P3CA 4CRBA 1UTNA 2H9TH 1P02A 1GJ6A 5F6MA 3DA9B 3QDZB 2BVRH 3Q00A 5A0AE 1FN6A 3SUFA 4DT7B 4YOIA 1K1NA 1YKTA 1BRUP 2GCTC 3RXBA 1DWCH 2BVSH 4I33A 4OS7A 1C5WB 5DP7A 3U9AH 1Z8JB 1C5ZB 4UDWH 1DY8A 4Y0ZE 3H7OA 5A2MH 5J4SA 1O5BB 2QGRA 4GCHG 3MHWU 3MO3A 4QT8C 1QBVH 1YM0A 1OWIA 3MH4A 5DO4H 1THRH 1KXCA 3L3TA 1D3TB 4KTSA 1MH0A 3QK1A 3RXCA 1T7CA 1IQLA 1EASA 1ETTH 1S84A 1C9PA 1S5SA 4OGYA 2AMQA 1ANCA 1C5VA 3RXHA 2FOHA 1ARCA 1PQ8A 3T29A 1C5NH 1GL0E 1W7XH 1MTWA 3Q3YA 1J14A 1ELAA 3NUMA 1PPGE 3DFJA 1GHZA 1XXFA 1AU8A 1OX1A 3A8AA 3IITA 4INHA 2Z3DA 4LOYH 3SV8A 1QTFA 4NCYA 5CHAB 4OGXA 4BTIB 4ISLA 3QUMP 2QA9E 2ZGBH 3HPTB 1HAGE 2ZFFH 2ZFTA 2FWWA 1RTFB 1O3AA 1OKXA 1ZPCA 1E37B 1TBRH 5B6OA 2J34A 3TK9A 3A81A 1AO5A 4BTTB 1V2WT 3W94A 3ENSB 1FXYA 2F91A 1F5KU 3IWMA 1UJ1A 2ZPSA 4I8JA 5EOKA 3ZZBA 3SUDA 3VB7A 1W7GH 3B23B 3RLWH 1O3CA 2BLOA 4YLUA 1T4UH 1MTSA 4YESB 1AKSA 4KP0A 1GBKA 1IQFA 1NT1A 4WWYA 3RM0H 4FU7A 1UVTH 2XCNA 1IOEA 2CHAB 1KTTB 2QF3A 1PYTD 1G32B 3R3GB 5A0CA 2ESTE 2A45B 1SGQE 1HRTH 1UTMA 3ATIA 2SGQE 5DKMA 1C1NA 1DICA 4OS6A 2GV6A 1H4WA 1TALA 5IYTA 4NFEA 5GXPA 2WYGA 2GP9B 3OY6U 1BTWA 4K3JA 1C2IA 1AHTH 2R2MB 2WPHS 2WYJA 5JBBS 1ORFA 1WQSA 4X1NU 1GBDA 1E34B 1EOJA 1FY1A 3SHAH 3N7OA 2WPMS 1RXPA 2XRCA 1O3GA 2AS9A 4Z0KA 2AIPA 3SV9A 4DIHH 5JYIA 2JH6D 3S0NA 4NZQA 3GCTG 3SQEE 1ANEA 1GBTA 3ZZ8A 5LPEA 2HVXA 2GMTC 5GCHG 1K2I1 2CMYA 4UE7H 4Q7XA 2TIOA 3SNEA 1ELBA 1N8OB 2FLBH 4OS2A 1TA6A 2ZU1A 3AVZA 1P06A 1SBWA 3JZ2B 1V2PT 4B71A 1OWJA 1P04A 4IC5A 1SOTA 1TX7A 2A4OA 2VNTA 3VEQB 6CHAB 2G4TA 3RMLH 2ZWLH 3VB3A 4B76A 5DJ7A 3UREA 1C2GA 1SL3A 8ESTE 1BJUA 4TWWA 1UK3A 1WOFA 1TA2A 4BAQB 4TYDA 1TONA 2VWMA 3SJ9A 5F8XA 3A86A 4AYYB 5JBCS 1Z8IB 1HAXB 2VWNA 4YOJA 1QR3E 2G4UA 4DW2U 3KIDU 3U1JB 4Y71A 5TCAA 1P9SA 3UWIA 5I25A 1MKXH 2UUKB 2P93A 1EX3A 1ZYOA 3SJKA 3BIVH 2FOCA 1SGTA 2BD9A 3BEFB 1S83A 1GVZA 1ABIH 2GKVE 3QZRA 4XE4A 2CGAA 4NIWA 6LPRA 1J9CH 2O8WA 1O2QA 1FV9A 8LPRA 3OY5U 4WMDA 4UFGH 2GX4A 4UONA 3ATLA 5E2OA 1ACBE 1QQ4A 3SQHE 1ZSJA 1AGJA 1DT2A 1RFNA 4CBNA 3SORA 1Y8TA 1LDTT 2ZTZA 3T26A 1QB9A 3ELAH 1A0HB 4FXGH 1ZSLA 5AHGH 1AD8H 2ZA5A 4WMFA 1PQAA 1GJDB 1DFPA 1A3BH 3KHVA 5HMAA 1E0FD 4HTCH 1GHBF 4NA9H 1TYNA 1MUEB 1X7AC 1O2OA 1O2TA 3AAUA 3EYDA 4ABHA 1K28D 1JIMA 3UR6A 2IPHA 1H9LB 4XBBA 5C1XA 3A7YA 1OXGA 2ODYB 1BIOA 3TIUA 1MTNC 1V2ST 2FX4A 1P12E 5C1YA 3F9HA 1VJAU 1ABJH 1GCDA 3FANA 3TGIE 1UCYE 2AEIH 2BTCE 3SO3A 1O2NA 3U8RH 2VGCB 1FZZA 3SGAE 2CXVA 2FOMB 1BRBE 2F9UA 3P6ZB 4MLFB 2H2ZA 3TGJE 4O03A 3TU7H 1TRMA 2XYAA 1AZ8A 1T4VH 2CN0H 3TK6A 5FBEA 4CHAC 2OTVA 1EB2A 1C1QA 5HYOA 2NU1E 3G01A 1IHTH 4Q7YA 3A7XA 2JETC 5L2YH 1E36B 1YYY1 3GISB 1PPFE 5L2ZH 1DWEH 3V3MA 3EA9A 1ELFA 4MG3A 1ZR0A 3SJIA 3FP8E 2GGVB 4ISHH 1MKXK 4DVAU 1GMDG 4RN6A 1FPHH 2W7SA 1SLXB 1VITG 3LT3A 1NFUA 1YCPM 2G00A 2BDYA 5C3NA 4NSVA 1DWBH 2ASUB 3F9FA 2ALVA 1D9IA 1CBWC 3DFLA 2ZCHP 4ZHMU 3QO6A 1QL9A 5C67A 1L4DA 5LPRA 1GBJA 1QRWA 2F9BH 3NPSA 5DK1A 1MAYA 2JH0D 1BMLA 3FP6E 3ZVFA 3D62A 3IG6B 1GCTB 6GCHF 5EW2H 3TJNA 4ZHAA 1V2NT 3E1XB 3SU4A 3TPIZ 2G8TA 4JZ1A 9LPRA 1QJ6B 4GHTA 1EJMA 1QCPA 1AWFH 1TB6H 4HFPB 1WYKA 4X8SH 3BIUH 4FUIA 1EAIA 3BEUA 3MU0A 1HJAC 2SGDE 3UWJH 1UTOA 1V2UT 3SNDA 5GCHF 3T5FH 2V35A 1HCGA 2XCFA 2BLQA 4GVUA 1GBEA 1TNJA 2BOKA 3GYLB 2VIDA 4E7RG 2C93B 4U30A 3QLPH 3TJOA 5FCKA 1EAUA 2HLCA 3GY3A 2PV9B 2Y7ZA 2FDAA 1S81A 2XC4A 3I77A 3VGCC 1C4U2 4NFFA 1RTKA 1UTPA 3LJJA 2ZKSA 1Q3XA 4CH8B 1G2LA 3SV2H 1UVPA 3PLKA 2ZFPH 4B2CA 1QB6A 3ZZAA 1BTPA 1C2LA 1YC0A 3QTOH 3PO1C 1AFQB 3MNCA 1WTHD 1GI9B 3L6PA 1TABE 1GJ4H 4H4FA 1PPHE 1BRCE 1S0RA 2BVXH 2UWLA 4AG2A 1DUEA 1Z8RA 1C2EA 2EI7A 3SW2B 1YCPH 2RCEA 1J17T 1FY8E 1KDQA 1VZQH 2BLVA 2H9HA 1KLIH 3M7UA 2ZFRH 4UD9H 4ZXXH 1GHAG 2A4QA 1THSH 5HGGA 2FEQH 3UNSA 1A46H 4MNXA 2B0FA 3DT0H 1SQTA 1SR5C 1TX6A 1ZRBA 3T27A 5EXNA 2FESH 2PSXA 2D26C 1W2KH 1MZDA 4JK5A 1QURH 5L30H 1LO6A 1WAYB 3SGQE 1KLTA 1SHHB 1N8OC 2ZGJA 3SV7A 2P8OB 1BBRH 1Z1IA 1DSTA 2FOEA 4JZFH 3T28A 5LH8A 1Y3UA 1GBMA 5C1UA 5DGJA 1QBOA 3BTTE 1GBHA 1ESAA 3LGWA 1NFXA 4AORA 5EPNA 2A5KA 4DGJA 2ODPA 1O5DH 1V2JT 1FMGA 1A7SA 4FUCA 1YPHE 3K2UA 5AF9H 1H8DH 4ESTE 4D7GA 2Z9LA 1EP6A 1V3XA 3BF6H 3E91A 4DURA 4A1XA 1MCTA 4AFUA 4A7IB 1IAUA 1NESE 1CGJE 3RU4E 3LGTA 1PPCE 4ZH8A 1GDUA 3TH3H 4TY7A 4MPUA 1GBAA 1GI1A 2C3SA 1LPKB 1Y3YA 3A7TA 2BD3A 2ZHFH 3A80A 2ZO3H 1LPGB 4AB9A 2HGTH 1XVMA 4H6SB 1KXEA 2LPRA 1O33A 3ZZ5A 2WPKS 4ZHLU 2XWAA 2OQUA 2TGDA 1GG6B 1C5QA 1XUFA 1ZHPA 1S85A 2F83A 5FX6A 4GCHF 3KEEA 1O2PA 2J92A 1GMCG 1ELDE 1GI7B 3T25A 2A32A 1P0SH 4CR9A 1J16A 1C1OA 1C1MA 3C27B 3FVFB 1VGCC 4D9QA 2PKSB 2OC7A 3RMNH 2FO9A 1CU1A 1PQ7A 1Z6JH 5A8ZA 3A85A 3KQCA 2VWLA 4WF8A 1J8AA 4ZKOU 3K6YA 1O2XA 3QWCH 4CRDA 3CS0A 3S9CA 1ARBA 4B74A 1MZAA 1O5AB 1BBRK 1SFQB 1GCTC 1P2MA 1HXEH 1LHFH 1NRPH 1HIAB 7LPRA 4WY3A 1O2VA 1A61H 1KYNA 2O8MA 2A31A 1O3LA 4ZAEA 5K7RA 3PWBA 3AASA 1LKBA 1DSUA 1Q31A 2ZGHA 3UOUA 1SGDE 1W0YH 7GCHG 3TK5A 3M3TA 1FDPA 3P95A 1SGCA 2QXIA 1D3PB 1NY22 2VIWA 2Z9IA 1O5CB 1DOJA 1O38A 1ZHRA 1TPPA 1UK2A 3D23A 3T2NA 1LHCH 1MKWH 1O2MA 1O2KA 5FCRA 2G5NA 3SNAA 3VB5A 7ESTE 4BAHB 1MTUA 1O0DH 2GZ8A 1ELVA 1C2FA 4BXWA 4X6OA 1FY3A 2YOLA 3PLBA 3VB4A 4IN1A 5C2ZA 3MNSA 4MVNA 1F0RA 1WQVH 1HXFH 3A84A 1P05A 1TWXB 1TRYA 1GG6C 1YF4A 3RC5A 3FAOA 3BTDE 3P92A 2V0BA 2EA3A 1EUFA 4CRCA 4VGCC 3I78A 1O5EH 5EG4A 2BY7X 1VCQA 4JYTA 1Q2WA 4Y7BA 1QRZA 3GY6A 3LGYA 1O2HA 3GY2A 3EGKH 3NXPA 2HRVA 3BTHE 2XWBI 1O3JA 2BDCA 3RXOA 1O35A 3ATMA 4ABBA 3DD2H 1GI8B 2XC0A 1NRRH 3EDXB 1O3OA 3MH7A 1N6YA 1HLTH 3T62A 3PMHB 2Q6FA 1C1RA 4IN2A 4GLYA 2K1QA 1EZXC 1Y5AT 3LJOA 3BTME 4IMQA 4JYVH 2BX3A 2J4IA 1TNIA 1TGCA 3HK3B 1H8IH 1C5SA 2BD2A 2BD5A 2CV3A 1CA0B 1RGQA 1C5XB 4JCNA 2ZDVH 1ID5H 4X6PA 2GD4B 1O3MA 1SI5H 2V3HH 1BUIA 1P03A 1SPJA 1TNLA 1C5RA 2R0KA 3GCHB 1KDQB 1CHOF 1O2LA 3QTVH 1DANH 1LVBA 4YZUA 1XXDA 1PPEE 4I8HA 3PM3A 4X1QU 3SU0A 1XUIA 2ODQA 4ZXYH 3DUXH 3OX7U 1O3EA 1SGYE 2V3OH 3RM2H 5A8YA 1NU7B 5GWZA 2FMJA 1W12U 2OC0A 2RA0A 2ZPQA 2G5VA 1BB0B 4SGAE 1BTYA 1SGIB 4X1SU 1HAZB 2A0QB 2PWXA 4J2YB 1DY9A 2AMPA 3BTQE 2LNCA 2J94A 2XW9A 2BDBA 3URCA 2PUQH 1TNGA 1FUJA 2HNTC 2C8YB 1FY5A 1SFIA 4CHAB 3RXPA 1IQKA 4AB8A 3BTWE 1QQUA 1BDAA 1NRNH 1G3BA 1ZGVA 5ESBA 2H9EH 4ISNA 4AX9H 1TFXA 2Y5FA 1VJ9U 3ZZ3A 4AFQA 4IBLH 1BMAA 1MBMA 2QYIA 3H5CB 5F8ZA 2CF9H 1K1LA 2SGAA 1KLJH 1TRNA 3BTFE 1EPTC 2NU0E 2FI3E 3A87A 5H4IB 3ZYDA 1XMNB 5LGOA 3HGNA 1F7ZA 3Q3KA 1V2KT 1B7XB 2KAIB 3UQOA 2B5TB 1AE8H 3LH3A 3KNXA 4NWLA 1GJBB 3PWCA 2FX6A 3BTKE 2Z9KA 1S6FA 2QXHA 2J9NA 3MOCA 5FHTA 4O3UA 4O97A 5T6DA 1T8OA 1EPTA 1DLEA 1K1OA 3U69H 1OPHB 3SU5A 1AWHB 1BHXB 2Y5HA 1MU6B 2ANMH 1ELEE 1NM6A 2Z9GA 1Y3XA 3STIA 1SLUB 1LHEH 2FM2A 2FXRA 2ANKH 2H6MA 3SUGA 1AUTC 3LPRA 2ZCLP 1HFDA 4AZ2B 2Y6TA 1W0ZU 3A83A 1O34A 2Z3EA 3SZNA 3TITA 1AZZA 1INCA 2FYRA 1B5GH 1QRXA 1TMBH 4GAWA 1YPGH 1C5MD 1XVOA 4BXSA 3OU0A 2GZ7A 3P17H 1VITH 1NRQH 3KQDA 3QGNB 1GMDF 1LQEA 3F1SB 2OBQA 3UIRA 1W10U 3RXSA 1CA0C 1OOKB 1SGRE 5EXLA 2BM2A 1ELCA 4XBCA 4CREA 1OWHA 3EAJA 1JWTA 3M36A 4R0IA 2ZP0H 5DP3A 3ZYEA 1XM1A 1HAHH 3TJVA 1Y3WA 2OXSA 1E38B 3EE0B 2UUFB 1EZSC 2ZU2A 3GDUA 1ZMLA 1O36A 4WXIA 4B73A 2HWLB 2QF0A 3C1KA 1C2DA 1T8LA 1TPSA 3LH1A 2PW8H 2VIVA 3MNBA 1F5RA 3AAVA 4B2BA 1SMFE 4I32A 4ABAA 1RTLA 4ZUHA 4ABDA 1OWKA 1T8NA 1S82A 1O2SA 2A2QH 1IQHA 3LGUA 1HYLA 1GBCA 1G3DA 1CGIE 3E0PB 5G4BA 5JDUB 1GI6A 1O3PB 1W3CA 1DPOA 2V6NA 3M7TA 3UFAA 2FTMA 5DP5A 1CGHA 4E7NA 2AIQA 2QXGA 1NTPA 1AMHA 1HIAA 3RXIA 1G3CA 1C1VH 4ABGA 2WV5A 1GL1A 2B9LA 3SV6A 3KQEA 3RXTA 1JOUB 1KIGH 1DVAH 1C5TA 1C5UA 2QN5T 4TPYA 2XBXA 4WVPE 2BZ6H 1JMOH 3FZDA 5DP6A 3MO6A 2TRMA 2BX4A 2VVVA 2BB4A 1V2VT 2ZGCA 4I7YH 1AE5A 1AB9B 2BDIA 3ZVCA 1C4V2 2FOFA 3E90B 1S0QA 2VVCA 3DHKH 2W3IA 3GY5A 1TPOA 1DUAA 3P8FA 3RLYH 1AFEH 4FU8A 3EA8A 2DUCA 1IQIA 1O32A 1TNKA 2F9NA 4JMYA 4WMEA 2VWOA 2ZI2H 2GCHF 4AYVB 2NWNA 1GMHF 3MYWA 1H9IE 2R9PA 4A92A 2W26A 4X2YA 1LCYA 1QY6A 1WTGH 2ZDAH 5IDKA 3M5LA 2DE9A 5CE1A 1O3IA 2P94A 4OS4A 4THNH 1BMMH 4CR5A 4UFEH 2OC8A 6GCHG 1FONA 2A4GA 4DY7B 4CH2B 2VB0A 4KGAA 2PTNA 3V0XA 2GCTB 2G55A 1BTZA 4FUGA 3U8TH 2QY0B 3L33A 2WPIS 1F92A 3HATH 1VITF 4X2WA 3LC5A 1ELTA 1KY9A 3RU4D 4ASHA 3UOPA 3GDVA 4NGAH 3B9FH 3MU8A 1KTSB 1SLVB 4Y11E 1BA8B 1TMTH 4DIIH 2ALPA 4RKOB 1GBIA 3BEIB 1HAIH 5SGAE 3GCNA 1AQ7A 1C1UH 5PTPA 1A2CH 4FUFA 3LIWA 4AFSA 3RU4T 1XUJA 1ZHMA 4HGCA 1FIZA 1AI8H 3RXLA 1EZUC 2FZZA 3MH6A 3O8DA 1XUGA 1E35B 2I6QA 5JB8S 3NCLA 4ABJA 2OP9A 1O3BA 4Y7AA 2BQ6B 4AG1A 4X8TH 2J2UA 2JKHA 4UEHH 1EP5A 1RIWC 1HJAB 4CRAA 2P3UB 1H1BA 1FPCH 4Y6DA 2C8WB 2KAIA 4INKA 1CQQA 3U8OH 4INLA 1C1SA 2FI4E 2HOBA 4ISOA 1QGFA 1LQDB 4WH8A 2SNVA 1ANBA 1SG8B 4E05H 3M61U 2JH5D 1YCPK 1YLCA 1NC6A 2GTBA 1FN8A 3AW1A 1ESBA 3RXRA 5GJ4B 5F03A 3SOSA 3JZ1B 5FAHA 5FPTA 1HAVA 4DCDA 1P2IA 1KXDA 1QNJA 1VR1H 1GGDC 2AGIX 1KXAA 1OSSA 1TOMH 3ZZDA 4JZEH 1TBZH 4XOJA 4MNVA 1O2GH 3M3VA 2VINA 1GJ9B 3UY9A 1F0TA 3SI4H 1GMHG 2A2XH 5BRRE 2Y80A 1H9HE 4K69A 4VGCB 4YM9A 1F5LA 3MMGA 2CJIA 3ATKA 1IQJA 2BY8X 5GPIB 1EQ9A 4ZKNU 1DWDH 3O8RA 3RXKA 2P95A 1CHGA 4I8KA 4TPIZ 3LC3A 1QB1A 2AGEX 2J38A 1P57B 3ZZ7A 2FYQA 1D3DB 3PB1E 3PLPA 5T6GA 1ZMNA 2AGGX 1A3EH 1NZQH 1XX9A 1KXFA 1CE5A 4AOQA 3S9BA 1VCWA 1YPEH 2HNTE 1MQ6A 1UTKA 1Z71A 2G81E 1HAOH 1PYTC 1YLDA 3SJ8A 5A8XA 4GPGA 4KTCA 4MPVA 3BV9B 2VIQA 4NA8A 3QX5H 1V2TT 1AY6H 2O8TA 3RXMA 2Q6DA 2W3KA 1GI5A 3TGKE 1EAXA 1CSOE 2C8XB 3BG4C 1V2OT 2GVFA 3LONA 4NWKA 3TNTA 4LK4A 1GGDB 2OBOA 3RXEA 4NSYA 1OWEA 1AIXH 2IOTA 2ULLA 3GCHC 4DG4A 1YPKH 1JXPA 1GWAA 3S7KB 4IGDA 5AVDA 4MPWA 3SU1A 2ZEBA 1OS8A 1AB9C 1GBBA 2ZDKA 1GBFA 1N6XA 1ETRH 1V2RT 3A82A 1CT0E 1HAVB 3ZVBA 3LKWA 2O8LA 1G37A 1GDNA 3VPKA 1FAKH 1P8VC 4NIVA 3NKKA 2ANYA 1EOLA 1QJ1B 2WUBA 1MD7A 4XFQA 1F0UA 1P09A 2P16A 2ZTYA 2C90B 1J15A 4U2WA 3GOVB 4HZHA 3U98H 1RIWB 7KMEH 1GJAB 2B8OH 1RJXB 2O9QA 2JETB 1GHVH 2QCYA 2OCVB 1FJSA 1P01A 1MAXA 1LVOA 4IMZA 2GDEH 1TBQH 4H6TA 3O8CA 1O39A 1ZLRA 3M37A 3A89A 2RA3A 4NIYA 1GI4A 1O2UA 2PR3A 3LDXH 5EGMA 1ZMJA 2ZC9H 1BT7A 3LGVA 1O37A 5A0BA 4FVDA 2XNIA 4K2YA 3RDZA 4UFDH 2XTTB 3RXJA 1K22H 5ABWA 1HDTH 4K1EA 1TLDA 1CT4E 2THFB 3F68H 1XKAC 4K5ZA 4J1YA 1C2JA 1DDJA 5C20A 8GCHF 3RMMH 2ZG0H 5DP4A 3S69A 1CA8B 1PPZA 1L2EA 4OS5A 3E6PH 1A1RA 1A0JA 4X6MA 1EPTB 3PV4A 1CT2E 1C4Y2 3BN9A 3QGJA 6ESTA 4A6LA 3UTUH 2PGBB 5FXLA 1A5HA 3BSQA 3BG8A 1S6HA 1NU9A 4X6NA 1EKBB 2ZHDA 2QIQA 3KQBA 4FUBA 4X8UH 2FP7B 1G3EA 2EI6A 2OC1A 3MH5A 1IHSH 4IS5A 1BMNH 2HPPH 2I6SA 1LHGH 1MMJN 4Y79A 3E0NB 3UQVA 2CHAC 1Z6EA 2R3YA 2BOHB 2F3CE 4B1TA 2PLXA 1LVMA 2QAAA 3GY4A 3UR9A 3ZVEA 2WV4A 2FIRH 1ZTKA 2ZDLA 1AKSB 1PFXC 2OD3B 1C1PA 4I8GA 3FZZA 5CHAC 3MU4A 2ZFQH 1BHXF 4Y8XA 1BTUA 4ABEA 1IQGA 2F9OA 2ZDMA 2FS9A 2VIPA 1SSXA 2XXLA 4A1VA 2ZF0H 1GI2A 1Y5BT 1ZSKA 3MFJA 1EJNA 3VB6A 1O3HA 2RG3A 4SGBE 2BY6X 2W7UA 1UHBA 4A5TS 1QBNA 2GV7A 1TAWA 1SGPE 2GCHG 1SGEE 3LU9B 3BG4B 2HNTF 1V6DA 1JRSA 4B2AA 3NK8A 1B0FA 4KKDA 1P2OA 2AYWA 3URDA 1GVKB 1YPMH 1MTVA 3ZV9A 3EA7A 4FUDA 1FY4A 4JYUH 3HGPA 3P8NA 1NO9H 4Q7ZA 1VCPA 4GHQA 4YO9A 4X1PU 2ZU4A 1AVGH 2PGQB 4NIXA 3P70B 2AERH 5FBIA 1HAYB 4TY6A 1TIOA 1L1NA 1ZPBA 3AW0A 1C5OH 1HBTH 4ABIA 3F9GA 4CRGA 1C2KA 1W11U 3VGCB 3SU3A 4I31A 4K8BA 4KTUA 2C4FH 1OWDA 1GHXH 1D4PB 1SQOA 4YT7H 1ZTJA 2BD7A 4O3TA 1ZRKA 1Z7KA 1EATA 1TMUH 2PKAA 3K9XB 4LXBH 4MQAA 1QFKH 4FUJA 2OQ5A 2UUYA 1LHDH 2ZPRA 4D76A 1G36A 2PSYA 1BRAA 3CENA 3VFEA 3M5NA 1GI3A 2TGTA 3OSYA 2ZNKH 3D65E 1DLKB 4BOHA 3M7QA 2R3UA 1YP9A 2ZHWH 5LPFA 3A7ZA 3SU6A 2BD4A 3MU1A 3SNBA 1TQ7B 1YBWA 1QJ7B 1BOQA 1HV7A 2G52A 5E2PA 2TBSA 2Z9JA 5EXMA 5EU8A 3HKJB 5F8TA 2ZGXH 1TQ0B 4XSKU 3HK6B 3H7TA 2EEKA 2ZCKP 2A7HA 2ZU5A 5K0HA 2EI8A 1PQ5A 4AN7A 1ETSH 4ZROA 1HNEE 1SVPA 2J95A 3ZZ6A 3PMAB 3STJA 3MU5A 1SB1H 2PFEA 4GSOA 1DITH 2PKSC 3Q76A 2Q1JA 4U32A 4FUHA 1OYQA 3PO1B 1C1TA 1PJPA 1Y3VA 2TGAA 2Y81A 1CBWB 2QC2A 5EW1H 1GVLA 4A1TA 1A4WH 2TGPZ 2ZZUH 4JZIA 3PMBB 1GJ8B 1O30A 1BCUH 1EZQA 1UO6A 2BXTH 1OP8A 8KME2 3RUOA 1P2NA 5HM9A 2FODA 1GJ7B 4K60A 3RC4A 1JBUH 4D7FA 1P9UA 4RKJB 2GDDA 3M35A 3S7HB 3R0FA 1AFQC 1KSNA 2CF8H 3GCTF 1T8MA 1UHBB 2FOAA 4OS1A 4YOGA 1YGCH 3V7TA 4Y10E 1TGNA 3SU2A 3B8JA 4ABFA 3NWUA 2GMTB 5ETXA 1AVWA 3EQ0H 4M7GA 2IJOB 1ZJKA 1C5LH 2G51A 3O8BA 1O2JA 2TPIZ 1GHWH 1GBLA 3ATWA 2EC9H 2Y82A 1ZZZA 1BZXE 3ZZ4A 5DP8A 1WBGB 2ANWA 1AUJA 2PTCE 1SLWB 1UVOA 3GYMA 1TGBA 3ZVAA 2SGEE 3ZV8A 3PTBA 4FVBA 4JK6A 2BY5X 2NU2E 3K6ZA 1UTJA 4PROA 1Z1JA 1OYTH 4X0WU 2D1JA 3MI4A 2STBE 5GIBA 2P8OC 4FUEA 1P3EA 3A8CA 2BLWA 2HPQH 5I46H 3KN2A 3RXVA 2GZ9A 4RSPA 1SOZA 4X2VA 4AGKA 3SUEA 1O2YA 4IC6A 3ODFA 1W14U 1MKWK 2BY9X 2VVUA 3A7VA 1DE7H 1V2LT 2WPJS 1K21H 2F9PA 1HAPH 3A8BA 2YNAA 2A1DB 2R0LA 2Z94A 4DJZB 1O2WA 1ZPZA 5T6FA 2Y7XA 3M5OA 1AVXA 3GY7A 2P3TB 4F4OC 1QHRB 2BMGB 2M5TA 3SHCH 3RXDA 2W5EA 1JIRA 3TJUA 4D9RA 4NA7A 1G2MA 3U1IB 2PUXB 2H1UA 1TGTA 3FP7E 2BQ7B 2ZQ1A 3LGIA 1GJ5H 3E8LA 4X8VH 3F9EA 2P59A 4MNWA 1O3KA 2BXUH 2ZECA 2ZFSA 1AN1E 5FX5A 1XUKA 3FFGA 1L0ZA 4FU9A 1O5GH 4Z6AH 2AMDA 2STAE 3HKIB 2BDHA 5EODA 2ZIQH 5L6NH 2H5CA 3MTYA 1IQNA 1GDQA 1NROH 1CVWH 1Z8GA 4TWYA 1U6QA 3RXUA 3SJOA 1A5IA 2ZU3A 3RC6A 5JPMH 1XKBC 1V2QT 1W8BH 2A7CA 1MU8B 2VJ1A 4R8TB 2WPLS 3RXAA 2Q6GA 1DXWA 3CP7A 1LPZB 1P2JA 3ZVGA 2VU8E 4Q2KA 3ODDA 1ELGA 2Y5GA 3W95A 1THPB 5HM2A 1M9UA 2Z6BD 1DX5M 2FTLE 4Y8YA 2R2WU 3A7WA 3E3TA 3QZQA 4Y76A 2FI5E 1GJCB 2A4RA 3TVJB 1TNHA 3GICB 4BAKB 4BNRA 2ZDNA 2Z7FE 2XBVA 4F49A 5JB9S 1G9IE 1NPMA 1Y5UT 1FIWA 1T31A 1ESTA 2D2DA 1OP2A 1QA0A 4CBOA 3MWIU 4WJG2 1P10A 3TNSA 2FOBA 3CS7A 3KL6A 1GHYH 2C8ZB 1WSSH 1LVYA 4LZ4B 2QXJA 9ESTA 1D6RA 3P8GA 3E16B 3UNQA 2D8WA 2IN2A 5EPYA 1RRKA 2A5AA 5ESTE 1F2SE 2NU3E 3A8DA 1C5YB 5EQRA 1ZJDA 3RP2A 2B7DH 1HPGA 3SN8A 3ZZ9A 1P2KA 1TPAE 2A5IA 1GI0A 2FPZA 1UCYK 3WY8A 1WV7H 4JZDH 1MCVA 5C5NA 1HJ8A 2UWPA 3BTEE 2ZHEH 4NZLA 4E06H 2P3FH 2BZAA 3PROA 3ZZCA 1K1MA 3UPEA 1RS0A 3Q3XA 1K1IA 3P8OA 4KELA 1QIXB 5FPYA 1TOCB 4LZ1H 1CHOG 1SQAA 1NFYA 1HUTH 4BANB 3ITIA 3A88A 2VIOA 1NS3A 2RDLA 5C5OA 5AFYH 2UUJB 1FQ3A 4ZKSU 1OP0A 1UMAH 2UWOA 1XUHA 1SGFG 1UTQA 4K1SA 2BD8A 3SBKA 2VH6A 1WUNH 2H5DA 1L1JA 1SGNE 3KCGH 5GDSH 2BQWB 5E0GA 3S9AA 3RMOH 1BQYA 1WU1A 2XC5A 2XBYA 3PMJA 2SGPE 1SGFA 1D6WA 1EB1H 1B0EA 4Y8ZA 1TX8A 3VXFH 1GPZA 5E8EH 2FLRH 1V2MT 3TH2H 2ZHQH 4BTUB 1O31A 4AGJA 1Y59T 5AFZH 5DPAA 4HI3A 1K1JA 3MNXA 2ZTXA 1F0SA 3M5MA 3OTJE 5JBAS 4IW4E 2BDGA 1SC8U 2FOGA 2WINI 3RXFA 1UTLM 1IQMA 2BHGA 2BYAX 2FS8A 1UCYH 2F9VA 2QV1A 3GDSA 4U01A 4YTAA 2O8UA 2OUAA 1BTHH 2GT8A 1MD8A 1W13U 4H42U 5EQQA 4ZMAH 1NN6A 1QL7A 2ILNA 2PHBA 5DG6A 5TCCA 3TH4H 4BAMB 3SNCA 1YPLH 1FI8A 1NFWA 1A5GH 4Q80A 4K1TA 4XBDA 3ZVDA 5JBTA 1O3FA 1UVUH 3GY8A 1O2RA 3ESTA 5DP9A 1T32A
chains in the Genus database with same CATH superfamily
3SGBE 2OINA 3BTGE 5HXFA 4BAOB 1N1LA 4O9VA 5EQSA 4NG9H 3I29A 1YPHC 1RD3B 4YLQH 1ZTLA 1QL8A 1TGSZ 1GHBG 1IQEA 4Y0YE 2K8IA 1NRSH 1PPBH 1WDIA 2W6ID 2ZQ2A 4CRFA 1C9TA 3KF2A 1YPJH 6CHAC 1KXBA 2DE8A 1MQ5A 1ANDA 3K65B 2AH4X 1HB0B 1TE0A 2YNBA 3GCOA 1MTNB 2NU4E 1EXFA 4ISIH 4X2XA 2PKAB 1QA7A 3OYPA 4MDSA 5CMXH 3Q77A 4ZKRU 1ZGIA 3MO9A 5C94A 4WXVA 1O3NA 3UUZA 1BITA 2XBWA 1O5FH 5TJXA 1L4ZA 1DXPA 3NZIA 2WUCA 2VGCC 4WH6A 5E0HA 2OLGA 4UFFH 3SI3H 1G30B 1L1GA 5T1VA 2Z3CA 5E0JA 3PYHA 3VXEH 1K1PA 4MPXA 2HLDD 1D3QB 8GCHG 5J4QA 1HJ9A 3KGPA 1O2IA 1C5PA 1BBRE 1LTOA 3UNRA 1A0LA 1UVSH 2BDAA 2SGFE 1EJAA 1MBQA 2VH0A 2A7JA 4GUXA 5T3HA 1GHAF 1FNIA 4D8NA 1C2MA 2V3MA 4X1RU 5FPSA 1O2ZA 2AFQB 4I8LA 1LMWB 2GT7A 3D49H 1FLEE 1C2HA 7GCHF 5A09A 1P11E 1LKAA 4DOQA 1BJVA 1DS2E 3QN7A 1UK4A 4K8YA 1C1WH 1BTXA 1GMCF 3M3SA 1DM4B 1CO7E 1P2QA 3PTNA 2HALA 3RXGA 3RXQA 4B75A 3V13A 4XDEA 5BPEA 1WCZA 3TLOA 1VGCB 1O3DA 1SHYA 4AFZA 3F6UH 2GJGA 2SFAA 2SNWA 4MTBA 3U28C 1HGTH 1JRTA 3LOXA 4YT6H 1EAWA 1FAXA 5KECA 1ZOMA 3V12A 1K9OE 4MNYA 1P3CA 4CRBA 1UTNA 2H9TH 1P02A 1GJ6A 5F6MA 3DA9B 3QDZB 1FX0B 2BVRH 3Q00A 5A0AE 1FN6A 3SUFA 4DT7B 4YOIA 3W1EA 1K1NA 1YKTA 1BRUP 2GCTC 3RXBA 1DWCH 2BVSH 4I33A 4OS7A 1C5WB 5DP7A 3U9AH 1Z8JB 1C5ZB 4UDWH 1DY8A 4Y0ZE 3H7OA 5A2MH 5J4SA 1O5BB 2QGRA 4GCHG 3MHWU 3MO3A 4QT8C 1QBVH 1YM0A 1OWIA 3MH4A 5DO4H 2VBCA 1THRH 1KXCA 3L3TA 1D3TB 4KTSA 1MH0A 3PRDA 3QK1A 1T7CA 1NBMD 1IQLA 1EASA 1ETTH 3RXCA 1S84A 1C9PA 1S5SA 4OGYA 2AMQA 1ANCA 1C5VA 3RXHA 2FOHA 1ARCA 1PQ8A 3T29A 1C5NH 1GL0E 1W7XH 1MTWA 3Q3YA 1J14A 1ELAA 3NUMA 1PPGE 3DFJA 1GHZA 3F0PA 3FOAA 1XXFA 1AU8A 1OX1A 3A8AA 3IITA 4INHA 5EJLA 2Z3DA 4LOYH 3SV8A 1QTFA 4NCYA 5CHAB 4OGXA 4BTIB 4ISLA 3QUMP 2QA9E 1E1RD 2ZGBH 3HPTB 1HAGE 2ZFFH 2ZFTA 2FWWA 3PRBA 2OK5A 5CHBA 1RTFB 1O3AA 1OKXA 1ZPCA 1E37B 1TBRH 5B6OA 2J34A 3TK9A 3A81A 1AO5A 4BTTB 1V2WT 3W94A 3ENSB 1FXYA 2F91A 1F5KU 2RDEA 3IWMA 5GNDA 1UJ1A 2ZPSA 4I8JA 5EOKA 3ZZBA 3SUDA 1OHHD 3VB7A 1W7GH 3B23B 3RLWH 1O3CA 2BLOA 4YLUA 1T4UH 1MTSA 4YESB 1AKSA 4KP0A 1GBKA 1IQFA 1NT1A 4WWYA 3RM0H 4FU7A 1UVTH 1COWD 2XCNA 1IOEA 2CHAB 5HIYA 1KTTB 2QF3A 1YY3A 1PYTD 1G32B 3R3GB 5A0CA 2ESTE 2A45B 1EFRD 1SGQE 1HRTH 1UTMA 3ATIA 2SGQE 5DKMA 1C1NA 1DICA 4OS6A 1KMHB 2GV6A 1H4WA 1TALA 5IYTA 4NFEA 5GXPA 2WYGA 2GP9B 3OY6U 1BTWA 4K3JA 1C2IA 2WSSD 2EY4C 1AHTH 2R2MB 2WPHS 2WYJA 5JBBS 1ORFA 1WQSA 4X1NU 1GBDA 1E34B 1EOJA 1FY1A 4RI0A 3SHAH 3N7OA 2WPMS 1RXPA 2XRCA 1O3GA 2AS9A 4Z0KA 2AIPA 3SV9A 4DIHH 5JYIA 2JH6D 3S0NA 4NZQA 1H8HD 3GCTG 3SQEE 1ANEA 1GBTA 3ZZ8A 5LPEA 2HVXA 2GMTC 5GCHG 1K2I1 2CMYA 4UE7H 4Q7XA 2TIOA 2M2AA 3SNEA 1ELBA 1N8OB 2FLBH 4OS2A 1TA6A 2ZU1A 3AVZA 5DN6D 1P06A 1SBWA 3JZ2B 1V2PT 4B71A 1OWJA 1P04A 4IC5A 1SOTA 1TX7A 2A4OA 2VNTA 3VEQB 3VG8A 2G4TA 3RMLH 2ZWLH 3VB3A 4B76A 6CHAB 5DJ7A 3UREA 1C2GA 1SL3A 3CNRA 8ESTE 1BJUA 4TWWA 1UK3A 1WOFA 1TA2A 4BAQB 4TYDA 1TONA 2VWMA 3SJ9A 5F8XA 3A86A 4AYYB 1E1QD 5JBCS 1Z8IB 2LELA 1HAXB 2VWNA 4YOJA 1QR3E 2G4UA 4DW2U 3KIDU 3U1JB 4Y71A 5TCAA 1P9SA 3UWIA 5I25A 1MKXH 2UUKB 2P93A 1EX3A 1ZYOA 3SJKA 3BIVH 2FOCA 1SGTA 2BD9A 3BEFB 1S83A 1GVZA 1ABIH 2GKVE 3QZRA 4XE4A 2CGAA 2LP6A 4NIWA 6LPRA 1J9CH 2O8WA 1O2QA 1FV9A 8LPRA 3OY5U 4WMDA 4UFGH 2GX4A 4UONA 3ATLA 5E2OA 1ACBE 1QQ4A 2K0QA 3SQHE 1ZSJA 1AGJA 1DT2A 1RFNA 4CBNA 3SORA 1Y8TA 1LDTT 2ZTZA 3T26A 1QB9A 3ELAH 1A0HB 4FXGH 1ZSLA 5AHGH 1AD8H 2ZA5A 4WMFA 1SKYE 1PQAA 1GJDB 1DFPA 1A3BH 3KHVA 5HMAA 1E0FD 4HTCH 1GHBF 4NA9H 1TYNA 1MUEB 1X7AC 1O2OA 1O2TA 3AAUA 3EYDA 4ABHA 1K28D 1JIMA 3UR6A 2IPHA 1H9LB 4XBBA 5C1XA 3A7YA 1OXGA 2ODYB 1BIOA 3TIUA 1MTNC 1V2ST 2FX4A 1P12E 5C1YA 3F9HA 1VJAU 1ABJH 1GCDA 4B6EA 3FANA 3TGIE 1UCYE 2AEIH 2BTCE 3SO3A 1O2NA 3U8RH 2VGCB 1FZZA 2EQNA 3SGAE 2CXVA 2FOMB 1BRBE 2F9UA 3P6ZB 4HG6A 2H2ZA 2KCYA 4MLFB 1MABB 3TGJE 4O03A 3TU7H 1TRMA 2XYAA 5C0UA 1AZ8A 1T4VH 2CN0H 3TK6A 5FBEA 4F55A 4CHAC 2OTVA 1EB2A 1C1QA 5HYOA 2NU1E 3SYJA 3G01A 1IHTH 4Q7YA 3A7XA 2JETC 5L2YH 1E36B 1YYY1 3GISB 1PPFE 5L2ZH 1DWEH 3V3MA 3EA9A 1ELFA 4MG3A 1ZR0A 3SJIA 3FP8E 2GGVB 3OEHD 4ISHH 1MKXK 4DVAU 1GMDG 4RN6A 1FPHH 2W7SA 1SLXB 1VITG 3LT3A 1NFUA 1YCPM 2G00A 2BDYA 5C3NA 4NSVA 1DWBH 2ASUB 3F9FA 2ALVA 2KZ4A 1D9IA 1CBWC 3DFLA 2IPQX 2ZCHP 4ZHMU 4ACAA 3QO6A 1QL9A 5C67A 2F4LA 1L4DA 5LPRA 1GBJA 1QRWA 2F9BH 3NPSA 5DK1A 1MAYA 2JH0D 1BMLA 3FP6E 3ZVFA 3D62A 3IG6B 1GCTB 6GCHF 5EW2H 3TJNA 4ZHAA 1V2NT 4RT1A 3E1XB 3SU4A 3TPIZ 2G8TA 4JZ1A 9LPRA 1QJ6B 4GHTA 1EJMA 1QCPA 1AWFH 1TB6H 4HFPB 1WYKA 4X8SH 3BIUH 4FUIA 2J98B 1EAIA 3BEUA 3MU0A 1HJAC 2SGDE 3UWJH 1UTOA 1V2UT 3SNDA 5GCHF 3T5FH 2V35A 1HCGA 2XCFA 1UW7A 2BLQA 4GVUA 1GBEA 1TNJA 2BOKA 3GYLB 2VIDA 4E7RG 2C93B 4U30A 3QLPH 3TJOA 5FCKA 1EAUA 2HLCA 3GY3A 2PV9B 4XRNA 2Y7ZA 2FDAA 1S81A 2XC4A 3I77A 3VGCC 1C4U2 4NFFA 1RTKA 1UTPA 3LJJA 2ZKSA 1Q3XA 4CH8B 1G2LA 3SV2H 4ASUD 1UVPA 3PLKA 2ZFPH 4B2CA 1QB6A 3DSOA 3ZZAA 1BTPA 1C2LA 1YC0A 3QTOH 3PO1C 1AFQB 3MNCA 1WTHD 1GI9B 3L6PA 1TABE 1GJ4H 4H4FA 1PPHE 1BRCE 1S0RA 2BVXH 2UWLA 3WWFA 4AG2A 1DUEA 1Z8RA 1C2EA 2EI7A 3SW2B 1YCPH 2RCEA 1J17T 1FY8E 1KDQA 1VZQH 2BLVA 2H9HA 1KLIH 3M7UA 2ZFRH 4UD9H 2CK3D 4ZXXH 1GHAG 2A4QA 1THSH 5FL7D 5HGGA 2FEQH 3UNSA 2HVYB 1A46H 4MNXA 2B0FA 3DT0H 1SQTA 1SR5C 1TX6A 1ZRBA 3T27A 5EXNA 2FESH 2PSXA 2D26C 1W2KH 4TSFD 1MZDA 4P02A 4JK5A 1QURH 5L30H 1LO6A 3F3BA 1WAYB 3SGQE 1KLTA 1SHHB 1N8OC 2ZGJA 3SV7A 2P8OB 1BBRH 1Z1IA 1DSTA 2FOEA 4JZFH 3T28A 4TT3D 5LH8A 1Y3UA 1GBMA 5C1UA 5DGJA 1QBOA 3BTTE 1GBHA 1ESAA 3LGWA 1NFXA 4AORA 3N99A 5EPNA 2A5KA 4DGJA 2ODPA 1O5DH 1V2JT 1FMGA 1A7SA 4FUCA 1YPHE 3K2UA 5AF9H 1H8DH 4ESTE 5KEDA 2KCAA 4D7GA 2Z9LA 1EP6A 1V3XA 3BF6H 3E91A 4DURA 4A1XA 1MCTA 4AFUA 4A7IB 1IAUA 1NESE 1CGJE 3RU4E 3LGTA 1PPCE 4ZH8A 1GDUA 3TH3H 4TY7A 4MPUA 1GBAA 1GI1A 2C3SA 1LPKB 1Y3YA 3A7TA 2BD3A 2ZHFH 3A80A 2ZO3H 1LPGB 4AB9A 2HGTH 1XVMA 4H6SB 1KXEA 2LPRA 1O33A 3ZZ5A 2WPKS 4ZHLU 2XWAA 2OQUA 2TGDA 1GG6B 1C5QA 1XUFA 1ZHPA 1S85A 2F83A 5FX6A 4GCHF 3KEEA 1O2PA 2J92A 1GMCG 1ELDE 1GI7B 3T25A 2A32A 1P0SH 4CR9A 1J16A 1C1OA 1C1MA 3C27B 3FVFB 1VGCC 4D9QA 2PKSB 2OC7A 3RMNH 2FO9A 1CU1A 1PQ7A 1Z6JH 5A8ZA 3A85A 3KQCA 2JIZD 2VWLA 4WF8A 1J8AA 4ZKOU 3K6YA 2AHME 1O2XA 3QWCH 4CRDA 3CS0A 3S9CA 1ARBA 4B74A 1MZAA 1O5AB 1BBRK 3FKSD 1SFQB 1GCTC 1P2MA 1HXEH 1LHFH 1NRPH 1HIAB 7LPRA 4WY3A 1O2VA 1A61H 1KYNA 2O8MA 2A31A 1O3LA 4ZAEA 5K7RA 3PWBA 3AASA 2V7QD 4P00A 1LKBA 1DSUA 1Q31A 2ZGHA 3UOUA 1SGDE 2JDID 1W0YH 7GCHG 3TK5A 3M3TA 1FDPA 3P95A 1SGCA 2QXIA 1D3PB 1NY22 2VIWA 2Z9IA 1O5CB 1DOJA 1O38A 1ZHRA 1TPPA 1UK2A 3D23A 3T2NA 1LHCH 1MKWH 1O2MA 1O2KA 5FCRA 2G5NA 3SNAA 3VB5A 7ESTE 4BAHB 1MTUA 1O0DH 2GZ8A 1ELVA 1C2FA 4BXWA 4X6OA 1FY3A 2YOLA 3PLBA 3VB4A 4IN1A 5C2ZA 3MNSA 4MVNA 1F0RA 5KGOA 1WQVH 1HXFH 3A84A 1P05A 2KR7A 2YMSB 1TWXB 1TRYA 1GG6C 1YF4A 3RC5A 3FAOA 2WPDD 3BTDE 3P92A 2V0BA 2EA3A 1EUFA 4CRCA 4VGCC 3I78A 1O5EH 5EG4A 2W6JD 2BY7X 1VCQA 4JYTA 1Q2WA 4Y7BA 1QRZA 3GY6A 3LGYA 1O2HA 3GY2A 3EGKH 3NXPA 2HRVA 3BTHE 2XWBI 1O3JA 2BDCA 3RXOA 1O35A 3ATMA 4ABBA 3DD2H 1GI8B 2XC0A 1NRRH 3EDXB 1O3OA 3MH7A 2QE7D 1N6YA 1HLTH 3T62A 3PMHB 2Q6FA 1C1RA 3OAAD 4IN2A 4GLYA 2K1QA 1EZXC 1Y5AT 3LJOA 3BTME 4IMQA 4JYVH 2BX3A 2J4IA 1TNIA 1TGCA 3HK3B 1H8IH 1C5SA 2BD2A 2BD5A 2CV3A 1CA0B 3DSGA 1RGQA 3PV5A 1C5XB 4JCNA 2ZDVH 1ID5H 4X6PA 2GD4B 1O3MA 1SI5H 2V3HH 1BUIA 1P03A 1SPJA 2QF4A 1TNLA 1C5RA 2R0KA 3GCHB 1KDQB 1CHOF 1O2LA 3QTVH 1DANH 1LVBA 4YZUA 1XXDA 1PPEE 4I8HA 3PM3A 4X1QU 3SU0A 1XUIA 2ODQA 4ZXYH 3DUXH 3OX7U 1O3EA 1SGYE 2V3OH 3RM2H 5A8YA 1NU7B 5GWZA 2FMJA 1W12U 2OC0A 3F0OA 2RA0A 2ZPQA 2G5VA 1BB0B 4SGAE 1BTYA 1SGIB 4X1SU 1HAZB 2A0QB 2PWXA 4J2YB 1DY9A 2AMPA 3BTQE 2LNCA 2J94A 2XW9A 2BDBA 3URCA 2PUQH 1TNGA 1FUJA 2HNTC 2C8YB 1FY5A 1SFIA 4CHAB 3RXPA 1IQKA 4AB8A 3BTWE 1QQUA 1BDAA 1NRNH 1G3BA 1ZGVA 5ESBA 2H9EH 4ISNA 4AX9H 1TFXA 2Y5FA 1VJ9U 3ZZ3A 4AFQA 4IBLH 1BMAA 1MBMA 2QYIA 3H5CB 5F8ZA 2CF9H 1K1LA 2SGAA 1KLJH 1TRNA 3BTFE 1EPTC 2NU0E 2FI3E 3A87A 5H4IB 3ZYDA 1XMNB 5LGOA 3HGNA 2XNDD 1F7ZA 3Q3KA 1V2KT 1B7XB 2KAIB 3UQOA 2B5TB 1AE8H 3LH3A 3KNXA 4NWLA 1GJBB 3PWCA 1NBME 2FX6A 3BTKE 2Z9KA 1S6FA 2QXHA 2J9NA 2KM0A 3MOCA 4FETA 5FHTA 4O3UA 4O97A 5T6DA 1T8OA 1EPTA 1DLEA 1K1OA 3U69H 1OPHB 3SU5A 1AWHB 1BHXB 2Y5HA 1MU6B 2ANMH 1ELEE 4F48B 1NM6A 2Z9GA 1Y3XA 3STIA 1SLUB 1LHEH 2FM2A 2FXRA 2ANKH 2JJ1D 3WWBA 2H6MA 3SUGA 1AUTC 3LPRA 2ZCLP 1HFDA 4AZ2B 2Y6TA 1W0ZU 3A83A 1O34A 2Z3EA 3SZNA 3TITA 1AZZA 1INCA 2FYRA 1B5GH 1QRXA 1TMBH 4GAWA 1YPGH 1C5MD 1XVOA 4BXSA 3OU0A 2GZ7A 3P17H 4Z1MD 1VITH 1NRQH 3KQDA 3QGNB 1GMDF 1LQEA 3F1SB 3OEED 4AC9A 2OBQA 3UIRA 1W10U 3RXSA 1CA0C 1OOKB 1SGRE 5EXLA 2BM2A 1ELCA 4XBCA 4CREA 5HIZA 1OWHA 3EAJA 1JWTA 3M36A 4R0IA 2ZP0H 5DP3A 3ZYEA 1XM1A 1HAHH 5DSFA 2L6OA 3TJVA 1Y3WA 2OXSA 1E38B 3EE0B 2UUFB 1EZSC 2ZU2A 3GDUA 1ZMLA 1O36A 4WXIA 4B73A 2HWLB 2QF0A 5EJZA 3C1KA 1C2DA 1T8LA 1TPSA 3LH1A 2PW8H 2VIVA 3MNBA 1F5RA 4FOUC 3AAVA 4B2BA 1SMFE 4I32A 4ABAA 3H09A 1RTLA 4ZUHA 4ABDA 1OWKA 1T8NA 1S82A 1O2SA 2A2QH 1IQHA 3LGUA 1HYLA 1GBCA 1G3DA 1CGIE 3E0PB 5G4BA 5JDUB 1GI6A 4B6FA 1O3PB 1W3CA 1DPOA 2V6NA 3M7TA 3UFAA 2FTMA 5DP5A 1CGHA 4E7NA 3NRLA 2AIQA 2QXGA 3OTPA 1NTPA 1AMHA 1HIAA 3RXIA 1G3CA 1C1VH 1W0KD 2WV5A 4ABGA 1GL1A 2B9LA 3SV6A 3KQEA 3RXTA 1JOUB 1KIGH 4OM9A 1DVAH 1C5TA 1C5UA 2QN5T 4TPYA 2XBXA 4WVPE 2BZ6H 1JMOH 3FZDA 5DP6A 3MO6A 2TRMA 2BX4A 2VVVA 2BB4A 1V2VT 2ZGCA 4I7YH 1AE5A 4Q63A 1AB9B 2BDIA 3ZVCA 1C4V2 2FOFA 3E90B 1S0QA 2VVCA 3DHKH 2W3IA 3GY5A 1TPOA 1DUAA 3P8FA 3RLYH 1AFEH 4FU8A 3EA8A 2DUCA 1IQIA 1O32A 1TNKA 2F9NA 3FO8D 4JMYA 4WMEA 2VWOA 2ZI2H 2GCHF 4AYVB 2NWNA 1GMHF 3MYWA 1H9IE 2R9PA 4A92A 2W26A 4X2YA 1LCYA 1QY6A 1WTGH 2ZDAH 5IDKA 1K0HA 3M5LA 2DE9A 4ACBA 5CE1A 1O3IA 2P94A 4OS4A 4THNH 1BMFD 1BMMH 4CR5A 4UFEH 2OC8A 6GCHG 1FONA 2A4GA 4DY7B 4CH2B 2VB0A 1SQRA 4KGAA 2PTNA 3V0XA 2GCTB 2G55A 1BTZA 4FUGA 3U8TH 2QY0B 3L33A 2WPIS 1F92A 3HATH 1VITF 4X2WA 3LC5A 2KFWA 1ELTA 1KY9A 3RU4D 4ASHA 3UOPA 3GDVA 4NGAH 3B9FH 3MU8A 1KTSB 1SLVB 4Y11E 1BA8B 1TMTH 2KCOA 2ALPA 4RKOB 4DIIH 1GBIA 3BEIB 1HAIH 5SGAE 3GCNA 4YXWD 1AQ7A 1C1UH 5PTPA 1A2CH 4FUFA 3LIWA 4AFSA 3RU4T 1XUJA 1ZHMA 4HGCA 1FIZA 1AI8H 3RXLA 3ZIAD 1EZUC 2FZZA 3MH6A 3O8DA 1XUGA 1E35B 2I6QA 5JB8S 3NCLA 4ABJA 2OP9A 1O3BA 4Y7AA 2BQ6B 4AG1A 4X8TH 3FN8A 2J2UA 2JKHA 4UEHH 1EP5A 1RIWC 1HJAB 3N7DA 4CRAA 2P3UB 1H1BA 1FPCH 4Y6DA 2C8WB 2KAIA 4INKA 1CQQA 3U8OH 4INLA 1C1SA 2FI4E 2HOBA 4ISOA 1QGFA 1LQDB 4WH8A 2SNVA 1ANBA 1SG8B 4E05H 3M61U 2JH5D 1YCPK 1YLCA 1NC6A 2GTBA 1FN8A 3AW1A 1ESBA 3KYFA 3RXRA 5GJ4B 5F03A 3SOSA 3JZ1B 5FAHA 5FPTA 1HAVA 4Q4LA 4DCDA 1P2IA 1KXDA 1QNJA 1VR1H 1GGDC 2AGIX 1KXAA 1OSSA 1TOMH 3ZZDA 4JZEH 1TBZH 4XOJA 4MNVA 1O2GH 3M3VA 1GJ9B 2VINA 3UY9A 1F0TA 3SI4H 2WZQA 1GMHG 2A2XH 5BRRE 2Y80A 1H9HE 4K69A 4VGCB 4YM9A 1F5LA 3MMGA 5CDFE 2CJIA 3UB0A 3ATKA 1IQJA 2BY8X 5GPIB 1EQ9A 4ZKNU 1DWDH 3O8RA 3RXKA 2P95A 1CHGA 4I8KA 4TPIZ 3LC3A 1QB1A 2AGEX 2J38A 1P57B 3ZZ7A 2FYQA 1YLNA 1WXRA 1D3DB 3PB1E 3PLPA 5T6GA 1ZMNA 2AGGX 1A3EH 1NZQH 1XX9A 1KXFA 1CE5A 4AOQA 3DCLA 3S9BA 1VCWA 1YPEH 2HNTE 1MQ6A 1UTKA 1Z71A 2G81E 1HAOH 1PYTC 1YLDA 3SJ8A 5A8XA 4GPGA 4KTCA 4MPVA 3BV9B 2VIQA 4NA8A 3QX5H 1V2TT 1AY6H 2O8TA 3RXMA 2Q6DA 2W3KA 1GI5A 3TGKE 1EAXA 1CSOE 2C8XB 3BG4C 1V2OT 2GVFA 3LONA 4NWKA 3TNTA 4LK4A 1GGDB 2OBOA 3RXEA 4NSYA 1OWEA 1AIXH 2IOTA 2ULLA 3GCHC 4DG4A 1YPKH 1JXPA 1GWAA 3S7KB 4IGDA 5AVDA 4MPWA 3SU1A 2ZEBA 1OS8A 1AB9C 1GBBA 2ZDKA 1GBFA 1N6XA 1ETRH 1V2RT 3A82A 1CT0E 1HAVB 1W0JD 2KCPA 3ZVBA 3LKWA 2O8LA 2YMSD 1G37A 1GDNA 3VPKA 1FAKH 1P8VC 4NIVA 3AK5A 3NKKA 2ANYA 4ZCNA 1EOLA 1QJ1B 2WUBA 1MD7A 2J98A 4XFQA 1F0UA 1P09A 2P16A 2ZTYA 2C90B 1J15A 2XOKD 4U2WA 3GOVB 4HZHA 3U98H 1RIWB 3KQ5A 7KMEH 4I86A 1GJAB 2B8OH 1RJXB 2O9QA 2JETB 1GHVH 3MQKC 2QCYA 2OCVB 1FJSA 1P01A 1MAXA 1LVOA 4IMZA 2GDEH 1TBQH 4H6TA 3O8CA 1O39A 1ZLRA 3M37A 3A89A 2RA3A 4NIYA 1GI4A 1O2UA 2PR3A 3LDXH 5EGMA 1ZMJA 2ZC9H 1BT7A 3LGVA 1O37A 5A0BA 4FVDA 2XNIA 4K2YA 3RDZA 4UFDH 2XTTB 3RXJA 1K22H 5ABWA 1HDTH 4K1EA 1TLDA 1CT4E 2THFB 3F68H 1XKAC 4K5ZA 4J1YA 1C2JA 1DDJA 5C20A 8GCHF 3RMMH 2ZG0H 5DP4A 1H8ED 3S69A 2F43B 1CA8B 1PPZA 1L2EA 4OS5A 3OE7D 3E6PH 1A1RA 1A0JA 4X6MA 1EPTB 3PV4A 1CT2E 1C4Y2 3BN9A 3QGJA 6ESTA 3PV2A 4A6LA 3UTUH 2PGBB 5FXLA 1A5HA 3BSQA 3BG8A 1S6HA 1NU9A 4X6NA 1EKBB 2ZHDA 2QIQA 3KQBA 4FUBA 4X8UH 2FP7B 5B6LA 1G3EA 2EI6A 2OC1A 3MH5A 1IHSH 4IS5A 1BMNH 2HPPH 2I6SA 1LHGH 1MMJN 4Y79A 3E0NB 3UQVA 2CHAC 2IJD1 1Z6EA 2R3YA 2BOHB 2F3CE 4B1TA 2PLXA 1LVMA 2QAAA 3GY4A 3UR9A 3ZVEA 2WV4A 2FIRH 1ZTKA 2ZDLA 2J97A 1AKSB 1PFXC 2OD3B 1C1PA 4I8GA 3FZZA 5CHAC 3MU4A 2ZFQH 1BHXF 4Y8XA 1BTUA 4ABEA 1IQGA 2F9OA 2ZDMA 2FS9A 2VIPA 1SSXA 2XXLA 4A1VA 2ZF0H 3KYGA 1GI2A 1Y5BT 1ZSKA 3MFJA 1EJNA 3VB6A 1O3HA 2RG3A 4SGBE 2BY6X 2W7UA 5HKKD 1UHBA 4A5TS 1QBNA 2GV7A 1TAWA 5C17A 1SGPE 3N7EA 2GCHG 1SGEE 3LU9B 3BG4B 2HNTF 1V6DA 1JRSA 4B2AA 3NK8A 1B0FA 4KKDA 1P2OA 2AYWA 3URDA 1GVKB 1YPMH 1MTVA 3ZV9A 3EA7A 4FUDA 1FY4A 4JYUH 3HGPA 3P8NA 1NO9H 4Q7ZA 1VCPA 4GHQA 4YO9A 3SZEA 4X1PU 2ZU4A 1AVGH 2PGQB 4NIXA 3P70B 2AERH 5FBIA 1HAYB 4TY6A 2QF5A 1TIOA 1L1NA 1ZPBA 3AW0A 1C5OH 1HBTH 4ABIA 3F9GA 4CRGA 1C2KA 1W11U 3VGCB 3F2FA 3SU3A 4I31A 4K8BA 4KTUA 2C4FH 1OWDA 1GHXH 1D4PB 1SQOA 2YMSC 4YT7H 1ZTJA 2BD7A 4O3TA 1ZRKA 1Z7KA 1EATA 1TMUH 2PKAA 3K9XB 4LXBH 4MQAA 1QFKH 4FUJA 2OQ5A 2UUYA 1LHDH 2ZPRA 4D76A 1G36A 2PSYA 1BRAA 3CENA 3VFEA 3M5NA 1GI3A 2TGTA 3OSYA 2ZNKH 3D65E 1DLKB 4BOHA 3M7QA 3GS9A 5F53A 2R3UA 1YP9A 2ZHWH 5LPFA 3A7ZA 3F2GA 3SU6A 2BD4A 3MU1A 3SNBA 1TQ7B 1YBWA 1QJ7B 1BOQA 1HV7A 2G52A 5E2PA 2TBSA 2Z9JA 5EXMA 5EU8A 3HKJB 5F8TA 2ZGXH 1TQ0B 4XSKU 3HK6B 3H7TA 2EEKA 2ZCKP 2A7HA 2ZU5A 5K0HA 2EI8A 1PQ5A 4AN7A 1ETSH 4ZROA 1HNEE 1SVPA 2J95A 3ZZ6A 3PMAB 3STJA 3MU5A 1SB1H 2PFEA 4GSOA 1DITH 2PKSC 3Q76A 1VKYA 2Q1JA 4U32A 4FUHA 1OYQA 3PO1B 1C1TA 1PJPA 1Y3VA 2TGAA 2Y81A 1CBWB 2QC2A 5EW1H 1GVLA 4A1TA 1A4WH 2TGPZ 2ZZUH 4JZIA 3PMBB 1GJ8B 1O30A 1BCUH 1EZQA 1UO6A 2BXTH 1OP8A 8KME2 3RUOA 1P2NA 5HM9A 2FODA 1GJ7B 4K60A 3RC4A 1JBUH 4D7FA 1P9UA 4RKJB 3WW7A 2GDDA 3M35A 3S7HB 3R0FA 1AFQC 1KSNA 2CF8H 3GCTF 1T8MA 1UHBB 2FOAA 4OS1A 4YOGA 1YGCH 3V7TA 4Y10E 1TGNA 3SU2A 3B8JA 4ABFA 3NWUA 2GMTB 1S6LA 5ETXA 1AVWA 3EQ0H 4M7GA 2IJOB 1ZJKA 1C5LH 2G51A 3O8BA 1O2JA 2TPIZ 1GHWH 1GBLA 3ATWA 2EC9H 2Y82A 1ZZZA 1BZXE 3ZZ4A 5DP8A 1WBGB 2ANWA 1AUJA 2PTCE 1SLWB 1UVOA 3GYMA 1TGBA 3ZVAA 2SGEE 3ZV8A 3PTBA 4FVBA 4JK6A 2BY5X 2NU2E 1E79D 3K6ZA 1UTJA 4PROA 1Z1JA 3EE7A 1OYTH 4X0WU 2D1JA 3MI4A 2STBE 5GIBA 2P8OC 4FUEA 1P3EA 2J5UA 3A8CA 2BLWA 2HPQH 5I46H 3KN2A 3RXVA 2GZ9A 4RSPA 1SOZA 4X2VA 4AGKA 3SUEA 1O2YA 4IC6A 3ODFA 1W14U 1MKWK 2BY9X 2VVUA 3A7VA 4DT4A 1DE7H 1V2LT 2WPJS 1K21H 2F9PA 1HAPH 5EIYA 4XD7D 3A8BA 2YNAA 2A1DB 2R0LA 2Z94A 4DJZB 1O2WA 1ZPZA 5T6FA 2Y7XA 3M5OA 1AVXA 3GY7A 2P3TB 4F4OC 1QHRB 2BMGB 2M5TA 3SHCH 3RXDA 1JIRA 2W5EA 3TJUA 4D9RA 4NA7A 1G2MA 3F2HA 3U1IB 2PUXB 5C0TA 2H1UA 1TGTA 3FP7E 2BQ7B 2ZQ1A 3LGIA 1GJ5H 3E8LA 4X8VH 3F9EA 2P59A 4M9FA 4MNWA 1O3KA 2BXUH 2ZECA 2ZFSA 1AN1E 5FX5A 1XUKA 3FFGA 1L0ZA 4FU9A 1O5GH 4Z6AH 2AMDA 2STAE 3HKIB 2BDHA 5EODA 2ZIQH 5L6NH 2H5CA 3MTYA 1IQNA 1GDQA 1NROH 1CVWH 1Z8GA 4TWYA 1U6QA 3RXUA 3SJOA 1A5IA 2ZU3A 3RC6A 1YWUA 5JPMH 1XKBC 1V2QT 1W8BH 2A7CA 1MU8B 2VJ1A 4R8TB 2WPLS 3RXAA 2KX4A 2Q6GA 1DXWA 3CP7A 2RFKC 1LPZB 2PP6A 1P2JA 3ZVGA 2VU8E 4Q2KA 3ODDA 1ELGA 2Y5GA 3W95A 1THPB 5HM2A 1M9UA 2Z6BD 1DX5M 2FTLE 5IK2D 4Y8YA 2R2WU 3A7WA 3E3TA 3QZQA 4Y76A 2FI5E 1GJCB 2A4RA 3TVJB 1TNHA 3GICB 4BAKB 4BNRA 2WHXA 2ZDNA 2Z7FE 2XBVA 4F49A 5JB9S 1G9IE 1NPMA 1Y5UT 1FIWA 1T31A 1ESTA 2D2DA 1OP2A 1QA0A 4CBOA 3MWIU 4WJG2 1P10A 3TNSA 2FOBA 3CS7A 3KL6A 1GHYH 2C8ZB 1WSSH 1LVYA 4LZ4B 2QXJA 9ESTA 1D6RA 3P8GA 3E16B 3UNQA 2D8WA 2IN2A 5EPYA 1RRKA 2A5AA 5ESTE 1QZ8A 1F2SE 2NU3E 3A8DA 1C5YB 5EQRA 1ZJDA 3RP2A 2B7DH 1HPGA 3SN8A 3ZZ9A 1P2KA 1TPAE 2A5IA 3OFND 1GI0A 2FPZA 1UCYK 3WY8A 1WV7H 4JZDH 1MCVA 5C5NA 1HJ8A 2UWPA 3BTEE 2ZHEH 4NZLA 4E06H 4RT0A 2P3FH 2BZAA 3PROA 3ZZCA 1K1MA 3UPEA 1RS0A 3Q3XA 1K1IA 3P8OA 4KELA 1QIXB 5FPYA 1TOCB 4LZ1H 1CHOG 1SQAA 1NFYA 1HUTH 4BANB 3ITIA 3A88A 2VIOA 1NS3A 2RDLA 5C5OA 5AFYH 2UUJB 1FQ3A 4ZKSU 1OP0A 1UMAH 2UWOA 1XUHA 1SGFG 1UTQA 4K1SA 2BD8A 3SBKA 2VH6A 1WUNH 2H5DA 1L1JA 1SGNE 3KCGH 5GDSH 2BQWB 5E0GA 3S9AA 3RMOH 1BQYA 2L74A 1WU1A 2XC5A 2XBYA 3PMJA 2SGPE 3DSPA 1SGFA 1D6WA 1EB1H 1B0EA 4Y8ZA 1TX8A 3VXFH 1GPZA 5E8EH 2FLRH 1V2MT 3TH2H 2ZHQH 4BTUB 2WV9A 1O31A 4AGJA 1Y59T 5AFZH 5DPAA 4HI3A 1K1JA 3MNXA 2ZTXA 1F0SA 3M5MA 3OTJE 5JBAS 5EJ1A 4IW4E 2BDGA 1SC8U 2FOGA 2WINI 3RXFA 1UTLM 1IQMA 2BHGA 2BYAX 2FS8A 1UCYH 2F9VA 2QV1A 3GDSA 4U01A 4YTAA 2O8UA 2OUAA 1BTHH 2GT8A 1MD8A 1W13U 4H42U 5EQQA 2JJ2D 4ZMAH 1NN6A 1QL7A 2ILNA 2PHBA 5DG6A 5TCCA 3TH4H 4BAMB 3SNCA 3UAIC 1YPLH 1FI8A 1NFWA 1A5GH 4Q80A 4K1TA 4XBDA 3ZVDA 5JBTA 1O3FA 1UVUH 3GY8A 1O2RA 3ESTA 5DP9A 1T32A
chains in the Genus database with same CATH topology
3SGBE 2OINA 3BTGE 5HXFA 4BAOB 1N1LA 4O9VA 5EQSA 4NG9H 3I29A 1YPHC 1RD3B 4YLQH 1ZTLA 1QL8A 1TGSZ 1GHBG 1IQEA 4Y0YE 1NRSH 1PPBH 2ZQ2A 4CRFA 1C9TA 3KF2A 1YPJH 6CHAC 1KXBA 2DE8A 1MQ5A 1ANDA 3K65B 2AH4X 1HB0B 1TE0A 2YNBA 3GCOA 1MTNB 2NU4E 1EXFA 4ISIH 4X2XA 2PKAB 1QA7A 3OYPA 4MDSA 5CMXH 3Q77A 4ZKRU 1ZGIA 3MO9A 4WXVA 1O3NA 3UUZA 1BITA 2XBWA 1O5FH 5TJXA 1L4ZA 1DXPA 3NZIA 2WUCA 2VGCC 4WH6A 5E0HA 2OLGA 4UFFH 3SI3H 1G30B 1L1GA 2Z3CA 5E0JA 3PYHA 3VXEH 1K1PA 4MPXA 1D3QB 8GCHG 5J4QA 1HJ9A 3KGPA 1O2IA 1C5PA 1BBRE 1LTOA 3UNRA 1A0LA 1UVSH 2BDAA 2SGFE 1EJAA 1MBQA 2VH0A 2A7JA 4GUXA 5T3HA 1GHAF 1FNIA 4D8NA 1C2MA 4X1RU 5FPSA 1O2ZA 2AFQB 4I8LA 1LMWB 2GT7A 3D49H 1FLEE 1C2HA 7GCHF 5A09A 1P11E 1LKAA 4DOQA 1BJVA 1DS2E 3QN7A 1UK4A 4K8YA 1C1WH 1BTXA 1GMCF 3M3SA 1DM4B 1CO7E 1P2QA 3PTNA 2HALA 3RXGA 3RXQA 4B75A 3V13A 4XDEA 5BPEA 1WCZA 3TLOA 1VGCB 1O3DA 1SHYA 4AFZA 3F6UH 2SFAA 2SNWA 4MTBA 1HGTH 1JRTA 3LOXA 4YT6H 1EAWA 1FAXA 1ZOMA 3V12A 1K9OE 4MNYA 1P3CA 4CRBA 1UTNA 2H9TH 1P02A 1GJ6A 5F6MA 3DA9B 3QDZB 2BVRH 3Q00A 5A0AE 1FN6A 3SUFA 4DT7B 4YOIA 1K1NA 1YKTA 1BRUP 2GCTC 3RXBA 1DWCH 2BVSH 4I33A 4OS7A 1C5WB 5DP7A 3U9AH 1Z8JB 1C5ZB 4UDWH 1DY8A 4Y0ZE 3H7OA 5A2MH 5J4SA 1O5BB 2QGRA 4GCHG 3MHWU 3MO3A 4QT8C 1QBVH 1YM0A 1OWIA 3MH4A 5DO4H 1THRH 1KXCA 3L3TA 1D3TB 4KTSA 1MH0A 3QK1A 3RXCA 1T7CA 1IQLA 1EASA 1ETTH 1S84A 1C9PA 1S5SA 4OGYA 2AMQA 1ANCA 1C5VA 3RXHA 2FOHA 1ARCA 1PQ8A 3T29A 1C5NH 1GL0E 1W7XH 1MTWA 3Q3YA 1J14A 1ELAA 3NUMA 1PPGE 3DFJA 1GHZA 1XXFA 1AU8A 1OX1A 3A8AA 3IITA 4INHA 2Z3DA 4LOYH 3SV8A 1QTFA 4NCYA 5CHAB 4OGXA 4BTIB 4ISLA 3QUMP 2QA9E 2ZGBH 3HPTB 1HAGE 2ZFFH 2ZFTA 2FWWA 1RTFB 1O3AA 1OKXA 1ZPCA 1E37B 1TBRH 5B6OA 2J34A 3TK9A 3A81A 1AO5A 4BTTB 1V2WT 3W94A 3ENSB 1FXYA 2F91A 1F5KU 3IWMA 1UJ1A 2ZPSA 4I8JA 5EOKA 3ZZBA 3SUDA 3VB7A 1W7GH 3B23B 3RLWH 1O3CA 2BLOA 4YLUA 1T4UH 1MTSA 4YESB 1AKSA 4KP0A 1GBKA 1IQFA 1NT1A 4WWYA 3RM0H 4FU7A 1UVTH 2XCNA 1IOEA 2CHAB 1KTTB 2QF3A 1PYTD 1G32B 3R3GB 5A0CA 2ESTE 2A45B 1SGQE 1HRTH 1UTMA 3ATIA 2SGQE 5DKMA 1C1NA 1DICA 4OS6A 2GV6A 1H4WA 1TALA 5IYTA 4NFEA 5GXPA 2WYGA 2GP9B 3OY6U 1BTWA 4K3JA 1C2IA 1AHTH 2R2MB 2WPHS 2WYJA 5JBBS 1ORFA 1WQSA 4X1NU 1GBDA 1E34B 1EOJA 1FY1A 3SHAH 3N7OA 2WPMS 1RXPA 2XRCA 1O3GA 2AS9A 4Z0KA 2AIPA 3SV9A 4DIHH 5JYIA 2JH6D 3S0NA 4NZQA 3GCTG 3SQEE 1ANEA 1GBTA 3ZZ8A 5LPEA 2HVXA 2GMTC 5GCHG 1K2I1 2CMYA 4UE7H 4Q7XA 2TIOA 3SNEA 1ELBA 1N8OB 2FLBH 4OS2A 1TA6A 2ZU1A 3AVZA 1P06A 1SBWA 3JZ2B 1V2PT 4B71A 1OWJA 1P04A 4IC5A 1SOTA 1TX7A 2A4OA 2VNTA 3VEQB 6CHAB 2G4TA 3RMLH 2ZWLH 3VB3A 4B76A 5DJ7A 3UREA 1C2GA 1SL3A 8ESTE 1BJUA 4TWWA 1UK3A 1WOFA 1TA2A 4BAQB 4TYDA 1TONA 2VWMA 3SJ9A 5F8XA 3A86A 4AYYB 5JBCS 1Z8IB 1HAXB 2VWNA 4YOJA 1QR3E 2G4UA 4DW2U 3KIDU 3U1JB 4Y71A 5TCAA 1P9SA 3UWIA 5I25A 1MKXH 2UUKB 2P93A 1EX3A 1ZYOA 3SJKA 3BIVH 2FOCA 1SGTA 2BD9A 3BEFB 1S83A 1GVZA 1ABIH 2GKVE 3QZRA 4XE4A 2CGAA 4NIWA 6LPRA 1J9CH 2O8WA 1O2QA 1FV9A 8LPRA 3OY5U 4WMDA 4UFGH 2GX4A 4UONA 3ATLA 5E2OA 1ACBE 1QQ4A 3SQHE 1ZSJA 1AGJA 1DT2A 1RFNA 4CBNA 3SORA 1Y8TA 1LDTT 2ZTZA 3T26A 1QB9A 3ELAH 1A0HB 4FXGH 1ZSLA 5AHGH 1AD8H 2ZA5A 4WMFA 1PQAA 1GJDB 1DFPA 1A3BH 3KHVA 5HMAA 1E0FD 4HTCH 1GHBF 4NA9H 1TYNA 1MUEB 1X7AC 1O2OA 1O2TA 3AAUA 3EYDA 4ABHA 1K28D 1JIMA 3UR6A 2IPHA 1H9LB 4XBBA 5C1XA 3A7YA 1OXGA 2ODYB 1BIOA 3TIUA 1MTNC 1V2ST 2FX4A 1P12E 5C1YA 3F9HA 1VJAU 1ABJH 1GCDA 3FANA 3TGIE 1UCYE 2AEIH 2BTCE 3SO3A 1O2NA 3U8RH 2VGCB 1FZZA 3SGAE 2CXVA 2FOMB 1BRBE 2F9UA 3P6ZB 4MLFB 2H2ZA 3TGJE 4O03A 3TU7H 1TRMA 2XYAA 1AZ8A 1T4VH 2CN0H 3TK6A 5FBEA 4CHAC 2OTVA 1EB2A 1C1QA 5HYOA 2NU1E 3G01A 1IHTH 4Q7YA 3A7XA 2JETC 5L2YH 1E36B 1YYY1 3GISB 1PPFE 5L2ZH 1DWEH 3V3MA 3EA9A 1ELFA 4MG3A 1ZR0A 3SJIA 3FP8E 2GGVB 4ISHH 1MKXK 4DVAU 1GMDG 4RN6A 1FPHH 2W7SA 1SLXB 1VITG 3LT3A 1NFUA 1YCPM 2G00A 2BDYA 5C3NA 4NSVA 1DWBH 2ASUB 3F9FA 2ALVA 1D9IA 1CBWC 3DFLA 2ZCHP 4ZHMU 3QO6A 1QL9A 5C67A 1L4DA 5LPRA 1GBJA 1QRWA 2F9BH 3NPSA 5DK1A 1MAYA 2JH0D 1BMLA 3FP6E 3ZVFA 3D62A 3IG6B 1GCTB 6GCHF 5EW2H 3TJNA 4ZHAA 1V2NT 3E1XB 3SU4A 3TPIZ 2G8TA 4JZ1A 9LPRA 1QJ6B 4GHTA 1EJMA 1QCPA 1AWFH 1TB6H 4HFPB 1WYKA 4X8SH 3BIUH 4FUIA 1EAIA 3BEUA 3MU0A 1HJAC 2SGDE 3UWJH 1UTOA 1V2UT 3SNDA 5GCHF 3T5FH 2V35A 1HCGA 2XCFA 2BLQA 4GVUA 1GBEA 1TNJA 2BOKA 3GYLB 2VIDA 4E7RG 2C93B 4U30A 3QLPH 3TJOA 5FCKA 1EAUA 2HLCA 3GY3A 2PV9B 2Y7ZA 2FDAA 1S81A 2XC4A 3I77A 3VGCC 1C4U2 4NFFA 1RTKA 1UTPA 3LJJA 2ZKSA 1Q3XA 4CH8B 1G2LA 3SV2H 1UVPA 3PLKA 2ZFPH 4B2CA 1QB6A 3ZZAA 1BTPA 1C2LA 1YC0A 3QTOH 3PO1C 1AFQB 3MNCA 1WTHD 1GI9B 3L6PA 1TABE 1GJ4H 4H4FA 1PPHE 1BRCE 1S0RA 2BVXH 2UWLA 4AG2A 1DUEA 1Z8RA 1C2EA 2EI7A 3SW2B 1YCPH 2RCEA 1J17T 1FY8E 1KDQA 1VZQH 2BLVA 2H9HA 1KLIH 3M7UA 2ZFRH 4UD9H 4ZXXH 1GHAG 2A4QA 1THSH 5HGGA 2FEQH 3UNSA 1A46H 4MNXA 2B0FA 3DT0H 1SQTA 1SR5C 1TX6A 1ZRBA 3T27A 5EXNA 2FESH 2PSXA 2D26C 1W2KH 1MZDA 4JK5A 1QURH 5L30H 1LO6A 1WAYB 3SGQE 1KLTA 1SHHB 1N8OC 2ZGJA 3SV7A 2P8OB 1BBRH 1Z1IA 1DSTA 2FOEA 4JZFH 3T28A 5LH8A 1Y3UA 1GBMA 5C1UA 5DGJA 1QBOA 3BTTE 1GBHA 1ESAA 3LGWA 1NFXA 4AORA 5EPNA 2A5KA 4DGJA 2ODPA 1O5DH 1V2JT 1FMGA 1A7SA 4FUCA 1YPHE 3K2UA 5AF9H 1H8DH 4ESTE 4D7GA 2Z9LA 1EP6A 1V3XA 3BF6H 3E91A 4DURA 4A1XA 1MCTA 4AFUA 4A7IB 1IAUA 1NESE 1CGJE 3RU4E 3LGTA 1PPCE 4ZH8A 1GDUA 3TH3H 4TY7A 4MPUA 1GBAA 1GI1A 2C3SA 1LPKB 1Y3YA 3A7TA 2BD3A 2ZHFH 3A80A 2ZO3H 1LPGB 4AB9A 2HGTH 1XVMA 4H6SB 1KXEA 2LPRA 1O33A 3ZZ5A 2WPKS 4ZHLU 2XWAA 2OQUA 2TGDA 1GG6B 1C5QA 1XUFA 1ZHPA 1S85A 2F83A 5FX6A 4GCHF 3KEEA 1O2PA 2J92A 1GMCG 1ELDE 1GI7B 3T25A 2A32A 1P0SH 4CR9A 1J16A 1C1OA 1C1MA 3C27B 3FVFB 1VGCC 4D9QA 2PKSB 2OC7A 3RMNH 2FO9A 1CU1A 1PQ7A 1Z6JH 5A8ZA 3A85A 3KQCA 2VWLA 4WF8A 1J8AA 4ZKOU 3K6YA 1O2XA 3QWCH 4CRDA 3CS0A 3S9CA 1ARBA 4B74A 1MZAA 1O5AB 1BBRK 1SFQB 1GCTC 1P2MA 1HXEH 1LHFH 1NRPH 1HIAB 7LPRA 4WY3A 1O2VA 1A61H 1KYNA 2O8MA 2A31A 1O3LA 4ZAEA 5K7RA 3PWBA 3AASA 1LKBA 1DSUA 1Q31A 2ZGHA 3UOUA 1SGDE 1W0YH 7GCHG 3TK5A 3M3TA 1FDPA 3P95A 1SGCA 2QXIA 1D3PB 1NY22 2VIWA 2Z9IA 1O5CB 1DOJA 1O38A 1ZHRA 1TPPA 1UK2A 3D23A 3T2NA 1LHCH 1MKWH 1O2MA 1O2KA 5FCRA 2G5NA 3SNAA 3VB5A 7ESTE 4BAHB 1MTUA 1O0DH 2GZ8A 1ELVA 1C2FA 4BXWA 4X6OA 1FY3A 2YOLA 3PLBA 3VB4A 4IN1A 5C2ZA 3MNSA 4MVNA 1F0RA 1WQVH 1HXFH 3A84A 1P05A 1TWXB 1TRYA 1GG6C 1YF4A 3RC5A 3FAOA 3BTDE 3P92A 2V0BA 2EA3A 1EUFA 4CRCA 4VGCC 3I78A 1O5EH 5EG4A 2BY7X 1VCQA 4JYTA 1Q2WA 4Y7BA 1QRZA 3GY6A 3LGYA 1O2HA 3GY2A 3EGKH 3NXPA 2HRVA 3BTHE 2XWBI 1O3JA 2BDCA 3RXOA 1O35A 3ATMA 4ABBA 3DD2H 1GI8B 2XC0A 1NRRH 3EDXB 1O3OA 3MH7A 1N6YA 1HLTH 3T62A 3PMHB 2Q6FA 1C1RA 4IN2A 4GLYA 2K1QA 1EZXC 1Y5AT 3LJOA 3BTME 4IMQA 4JYVH 2BX3A 2J4IA 1TNIA 1TGCA 3HK3B 1H8IH 1C5SA 2BD2A 2BD5A 2CV3A 1CA0B 1RGQA 1C5XB 4JCNA 2ZDVH 1ID5H 4X6PA 2GD4B 1O3MA 1SI5H 2V3HH 1BUIA 1P03A 1SPJA 1TNLA 1C5RA 2R0KA 3GCHB 1KDQB 1CHOF 1O2LA 3QTVH 1DANH 1LVBA 4YZUA 1XXDA 1PPEE 4I8HA 3PM3A 4X1QU 3SU0A 1XUIA 2ODQA 4ZXYH 3DUXH 3OX7U 1O3EA 1SGYE 2V3OH 3RM2H 5A8YA 1NU7B 5GWZA 2FMJA 1W12U 2OC0A 2RA0A 2ZPQA 2G5VA 1BB0B 4SGAE 1BTYA 1SGIB 4X1SU 1HAZB 2A0QB 2PWXA 4J2YB 1DY9A 2AMPA 3BTQE 2LNCA 2J94A 2XW9A 2BDBA 3URCA 2PUQH 1TNGA 1FUJA 2HNTC 2C8YB 1FY5A 1SFIA 4CHAB 3RXPA 1IQKA 4AB8A 3BTWE 1QQUA 1BDAA 1NRNH 1G3BA 1ZGVA 5ESBA 2H9EH 4ISNA 4AX9H 1TFXA 2Y5FA 1VJ9U 3ZZ3A 4AFQA 4IBLH 1BMAA 1MBMA 2QYIA 3H5CB 5F8ZA 2CF9H 1K1LA 2SGAA 1KLJH 1TRNA 3BTFE 1EPTC 2NU0E 2FI3E 3A87A 5H4IB 3ZYDA 1XMNB 5LGOA 3HGNA 1F7ZA 3Q3KA 1V2KT 1B7XB 2KAIB 3UQOA 2B5TB 1AE8H 3LH3A 3KNXA 4NWLA 1GJBB 3PWCA 2FX6A 3BTKE 2Z9KA 1S6FA 2QXHA 2J9NA 3MOCA 5FHTA 4O3UA 4O97A 5T6DA 1T8OA 1EPTA 1DLEA 1K1OA 3U69H 1OPHB 3SU5A 1AWHB 1BHXB 2Y5HA 1MU6B 2ANMH 1ELEE 1NM6A 2Z9GA 1Y3XA 3STIA 1SLUB 1LHEH 2FM2A 2FXRA 2ANKH 2H6MA 3SUGA 1AUTC 3LPRA 2ZCLP 1HFDA 4AZ2B 2Y6TA 1W0ZU 3A83A 1O34A 2Z3EA 3SZNA 3TITA 1AZZA 1INCA 2FYRA 1B5GH 1QRXA 1TMBH 4GAWA 1YPGH 1C5MD 1XVOA 4BXSA 3OU0A 2GZ7A 3P17H 1VITH 1NRQH 3KQDA 3QGNB 1GMDF 1LQEA 3F1SB 2OBQA 3UIRA 1W10U 3RXSA 1CA0C 1OOKB 1SGRE 5EXLA 2BM2A 1ELCA 4XBCA 4CREA 1OWHA 3EAJA 1JWTA 3M36A