2BZAA

Bovine pancreas beta-trypsin in complex with benzylamine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (TRYPSIN)
publication title Non-Boltzmann thermodynamic integration (NBTI) for macromolecular systems: relative free energy of binding of trypsin to benzamidine and benzylamine.
pubmed doi rcsb
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bzaA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bzaA02
1GBIA 3LOXA 1JRSA 1XUGA 3KL6A 4X2VA 2ZDMA 3O8CA 3T28A 4I8HA 1W7XH 3GYLB 3QN7A 2FDAA 1E37B 4DURA 1D3QB 4CHAC 2PSYA 2AIQA 1F0UA 3A82A 3E0NB 1AUTC 1O36A 1Z7KA 1PPBH 1JBUH 4H6SB 1INCA 5TJXA 1HFDA 1NRRH 1RRKA 4FVDA 1UCYK 2G00A 2H9EH 2UUYA 4I8KA 4Z0KA 3LGYA 3P6ZB 1A4WH 4AG1A 4TWWA 2TIOA 3SU0A 7LPRA 9LPRA 4CHAB 5GCHG 2VWMA 4BTUB 3M37A 1CO7E 1HXFH 1TA6A 1C5PA 5EODA 2IJOB 1QNJA 1ELTA 1DICA 1WTHD 4XSKU 5FBEA 1E36B 1FPHH 2ZTYA 3RXPA 3T5FH 2ANKH 4OS5A 1SLXB 2HOBA 1DXPA 3VB7A 1IHSH 4E7RG 2LNCA 4X8SH 1MAXA 1RD3B 1D6RA 4O3UA 3A85A 3MH5A 3MH4A 3GY6A 3RXHA 1TWXB 1UCYH 3NZIA 2C4FH 5GPIB 1S81A 4TY6A 2RG3A 3IWMA 1C2HA 1P09A 4AFSA 1ZMNA 1TALA 3A83A 1UK3A 5K0HA 1BRBE 1P02A 2BXTH 4NWLA 5J4SA 2PSXA 1UVOA 4X6PA 1C2EA 4NIVA 5EQQA 5G4BA 2PTCE 1A3EH 1QRXA 4K1SA 2CF9H 5A0AE 1GBBA 1O3KA 3SHCH 1IQNA 2AMQA 2PGQB 4BAMB 4O9VA 2PHBA 4YT6H 1NROH 1YPEH 3ZV9A 1VITH 2D1JA 4YLUA 2GDEH 1GI3A 2GDDA 3OX7U 1C9TA 4XOJA 1MKXK 4YO9A 2O8UA 1AVWA 1BT7A 1TMBH 1VGCB 2Y7ZA 5C67A 5HGGA 1DM4B 3O8DA 3M5MA 1MBQA 1QL7A 1VITF 3TPIZ 2YNAA 2A7CA 5FX6A 5T6DA 3A88A 1W8BH 1O3PB 5ESBA 2FZZA 2FOAA 1GCTC 1SQOA 3RMMH 2FOEA 3ZVGA 3RLWH 3FFGA 4Y10E 3ODFA 4FUJA 1GVKB 4TWYA 1AB9B 1ZMLA 4VGCB 1KIGH 3TU7H 4JZEH 1NRPH 1JIMA 1FZZA 2BQ6B 4XDEA 1O2YA 1EP6A 1QIXB 2PKAA 1BQYA 1E34B 1MKXH 2J38A 1SGFG 2ZDNA 1GJDB 3S69A 3QGJA 3PMAB 4NA9H 3RC6A 2QGRA 3SI3H 1TRNA 1L1GA 2ZHEH 3RXFA 4YOIA 1E38B 1EXFA 1YM0A 3FZDA 1T32A 4UEHH 3FANA 3SJKA 3NXPA 5FPYA 2UUFB 3BEUA 1S82A 2H1UA 1FY5A 3U8OH 6CHAC 3LGWA 4Y8ZA 1G2LA 4KELA 2FTMA 2AEIH 3ZVDA 1CE5A 1WTGH 3B9FH 4YTAA 3RXBA 3A86A 1SVPA 2Z94A 2H5DA 5E0JA 1A0HB 2NU0E 3F1SB 3DHKH 1H8IH 1V2TT 1EASA 1P12E 1RS0A 3RU4T 1GMCG 1PQ8A 3TITA 1ZHRA 4FUHA 4X6NA 3VB4A 4AZ2B 4CBNA 8ESTE 3V7TA 1ZLRA 2OTVA 1MU8B 4QT8C 2Y6TA 1DPOA 4ESTE 4INLA 1T4UH 3GY2A 1XUJA 2SGEE 1UK4A 3BV9B 1NM6A 2QN5T 4HTCH 4GAWA 5CHAC 1ZZZA 3SO3A 1V2WT 1ESAA 4O03A 2F9VA 1IQGA 1BUIA 4OS1A 1TRYA 1WSSH 1GPZA 4AYVB 3SU5A 2ZFFH 4CRGA 2THFB 1WCZA 1ZTJA 1DXWA 1YPJH 1FN6A 3M35A 1MTSA 3MO6A 4GCHG 1G36A 3LONA 4K1EA 3KN2A 2ZDLA 5ESTE 2OINA 2V3HH 3ATKA 1YPKH 4U01A 1AVGH 4ABAA 1JMOH 1EOLA 1GBKA 1O2PA 3PMBB 1QY6A 3TVJB 2FESH 4RN6A 4I8LA 1BIOA 2NU3E 5FCKA 3U1IB 1AFEH 1QJ7B 1SGEE 3GDSA 4BANB 3LH1A 5LPEA 1ETTH 1W14U 2QXGA 3E16B 3KQDA 1AZ8A 4O3TA 2FTLE 1DUEA 1BTWA 2PKSC 2A5IA 5EW1H 4FUBA 5BRRE 3QTVH 1YPHE 5EXLA 1OWJA 1DOJA 3SZNA 1Z8GA 2R3YA 4NZQA 1QURH 3GCNA 1CHOF 3ENSB 1DWBH 3VEQB 4Q2KA 1O3EA 1P06A 2JH6D 3QTOH 2CGAA 1C5QA 1EZSC 1SMFE 3LGIA 1MZAA 3UREA 1E35B 2WPLS 4K69A 5L2YH 2PKSB 1C2FA 1Y5BT 4KTCA 1C4V2 1P10A 3BTFE 3AAUA 1X7AC 2TGPZ 1SG8B 3GDUA 5DP3A 3TNTA 3UR6A 1BRUP 1P2QA 2ZHDA 3BTDE 1UTNA 1C4Y2 2ALPA 2EI6A 2V6NA 2A5KA 3LPRA 2FIRH 2SNVA 1W0ZU 2ANMH 2J2UA 2GZ9A 3AASA 3TJUA 4WH6A 1ARCA 2R9PA 4NWKA 1HIAA 2AH4X 1O2NA 1MD7A 2AMDA 1S84A 3SUGA 1QFKH 2XWBI 1FY1A 2A45B 3V13A 4INHA 1NS3A 1OX1A 1YPHC 4X1QU 1SHHB 1NC6A 3PLBA 1W0YH 1KYNA 1LHDH 3PO1C 3P95A 2ZTXA 4CH8B 1GBMA 1KXAA 4JCNA 4X6MA 1V2UT 1ZJDA 2NU4E 2Z3DA 3ESTA 1B0EA 1GHXH 4ZKSU 1HJ9A 7GCHF 2XBWA 2CV3A 3BG4C 1TRMA 4D7GA 4ZHLU 5LPRA 2FMJA 1QTFA 2BZAA 1S85A 1K21H 5JB8S 3GYMA 1RXPA 1G37A 1EPTC 1TX6A 1GMDG 4X8TH 4R8TB 2ZECA 1E0FD 1RTKA 4Z6AH 2FS8A 1SPJA 4BAQB 1YKTA 2ZFQH 3DUXH 1W13U 2D8WA 2H9TH 3M3TA 4AB9A 4CH2B 2TGDA 1P01A 3A89A 3BG4B 5FX5A 3Q77A 4CRBA 4DY7B 1P03A 1LHCH 3RXAA 5EGMA 2Z3CA 3MTYA 3RXIA 5LPFA 1EPTB 1SGCA 1WYKA 3A7TA 3Q76A 1OOKB 2ZDVH 1PFXC 2VNTA 1WQVH 2OXSA 4ABEA 1N6XA 1UTQA 1TBRH 1LTOA 3MNBA 1DT2A 5CE1A 3A81A 1WUNH 1F5KU 2IN2A 4HI3A 4ABHA 3UOPA 1TFXA 1AU8A 1OWHA 4GSOA 1T8LA 3SUEA 2ZU2A 4GLYA 4TY7A 1ELGA 1TGNA 1GHAG 1SR5C 2SNWA 3G01A 2QCYA 1LKAA 2ZP0H 4KGAA 1EUFA 2XRCA 3M36A 1AWFH 2PLXA 8GCHG 3EAJA 3M5OA 1DUAA 2TGAA 1HAGE 4A5TS 1Z6EA 5JDUB 5A0BA 1C1PA 1ESTA 1DITH 1ZHPA 1ETSH 1XXDA 3OY5U 1AQ7A 1HPGA 3GICB 1FNIA 1C1QA 2STAE 3JZ1B 4TYDA 2ASUB 3D65E 5HMAA 1O3IA 3SGAE 4B2BA 1O2TA 2BY5X 5DP6A 4GPGA 1QB9A 4J1YA 4ZKNU 1KDQB 3BIUH 1Y59T 1ACBE 1IQMA 3AAVA 5EXMA 3Q3XA 1AKSA 4ISLA 1NPMA 1IQHA 1CHGA 3HKIB 3UPEA 3A7YA 1BMAA 3KQEA 1GDNA 1O31A 1N6YA 2A4OA 2VH0A 2ZGCA 4WVPE 1THRH 1EQ9A 2FOCA 4JK5A 4MPUA 3K2UA 3L6PA 1FI8A 3EE0B 1ABJH 1HBTH 3QWCH 5EW2H 1QA0A 3U9AH 2Y82A 3SGBE 4ZMAH 3URCA 4B73A 5GWZA 2O8LA 4U32A 1ZJKA 3LH3A 5B6OA 3RXUA 3SW2B 1UK2A 2ZPSA 3MMGA 1C9PA 2C93B 2XNIA 3BTHE 4X2XA 6LPRA 3TIUA 4FU9A 1SFIA 1FY4A 3VGCC 1TQ0B 1D3PB 3ATMA 4E7NA 1YGCH 3GY5A 2H6MA 2GZ7A 2B9LA 3BTQE 1L4ZA 2PUXB 1O5AB 1GVLA 5JYIA 4ISOA 1PJPA 1AGJA 4MG3A 5EG4A 2O8WA 3N7OA 1ELDE 1H9LB 1HAZB 2QC2A 1O2GH 3RP2A 1O3NA 1OWKA 1AI8H 1D6WA 1PQAA 1V2NT 4BXSA 1PPHE 2FP7B 1OP0A 3ZZAA 1UTKA 4AOQA 2FOBA 2A7HA 1MTNC 5FBIA 3ZZ5A 4MNWA 3MI4A 2O8MA 1DFPA 1RTFB 1XUKA 2VWLA 2TPIZ 4JZFH 1O2SA 8LPRA 1O2IA 2G51A 2XXLA 2WINI 3URDA 2QA9E 1J9CH 1K22H 3PLPA 1C2JA 2QAAA 4ABFA 3TJOA 2VH6A 2Z9KA 3U8TH 2P8OC 3RM0H 1GBTA 3TK9A 2BTCE 3PLKA 4F49A 1KTSB 2WPIS 3KHVA 3BSQA 1DVAH 1C1SA 3M61U 2GMTB 1K9OE 4AFQA 1GHBG 2ZGXH 4WWYA 3ZVFA 1ELFA 4XBDA 1AMHA 3BEIB 4ISHH 2SGQE 2Z3EA 2P8OB 1L1NA 3FP8E 1NY22 4Y7BA 1LHFH 2QF0A 3QO6A 5DJ7A 1IQEA 1KXCA 2ZC9H 1EOJA 1SGFA 2A2XH 1O38A 5K7RA 2BM2A 1QRWA 1HV7A 1ZSKA 3SV2H 2BOHB 1W12U 3MNSA 3MYWA 1EP5A 4H42U 1EB2A 2Q6GA 5DP7A 5C1UA 4FVBA 3WY8A 1UTLM 1RJXB 1UCYE 2PW8H 2CHAC 3M5NA 1KSNA 1O3HA 5PTPA 1ZTLA 1QQUA 1HAVA 1Z1JA 5E8EH 1LPKB 2G8TA 3CENA 2WPMS 1O3BA 3V3MA 1GBEA 4IMZA 5A8ZA 1BCUH 2XCFA 2H2ZA 2Y5HA 2BQ7B 1YLCA 3ELAH 1K1OA 1P2OA 2J9NA 1IOEA 3OU0A 2DE8A 1TYNA 1KXBA 2WUBA 2BY9X 2ESTE 4H6TA 1O2HA 1GI6A 1GWAA 2FI4E 2LPRA 2ZU1A 3TJVA 3MHWU 3E8LA 2EA3A 1TBQH 2AERH 5IYTA 5C1XA 1V2PT 4K8YA 4A6LA 4FUFA 5I46H 1YPLH 1O3CA 2WPJS 1NESE 3DT0H 4MPVA 5SGAE 4IBLH 1O2LA 4BTTB 2WYGA 2YOLA 1C5XB 4JYVH 5C5OA 3F9FA 1ZMJA 1CT4E 4X2YA 1D4PB 2O9QA 1OP2A 1UJ1A 4A92A 1KLIH 1Y3YA 2QIQA 1AE8H 4CR5A 4DIHH 1G3DA 3VB3A 3ZYDA 4BAHB 2BZ6H 3DFLA 3UQOA 4LXBH 5EQSA 1ZHMA 5C3NA 1GJCB 3SJIA 1RGQA 3ZZ8A 2GP9B 2B8OH 5T6GA 1HAPH 1C5RA 3LGUA 1IHTH 3D23A 3VB6A 5A2MH 1ZYOA 1UHBB 2R2WU 3TJNA 2A1DB 1EATA 3MU4A 2VJ1A 1CGIE 2P3FH 1C5WB 1P2KA 3TK5A 4OGXA 1SGQE 1B0FA 1YYY1 2FO9A 1ELCA 3SGQE 3U69H 1C5ZB 4BAOB 3K9XB 3RXKA 1SGIB 2XCNA 1EZQA 1TNLA 1W2KH 1GHAF 1YPMH 2WYJA 3UNQA 3HGPA 1SGYE 2ZF0H 1O3AA 3EGKH 1GDUA 4DCDA 1AFQC 1TPPA 4A1XA 2BY6X 1IAUA 1V6DA 1NRNH 5TCAA 2FI3E 1ZR0A 3R0FA 2FOGA 1LVMA 3A7ZA 1O3JA 5FAHA 4ZKRU 1O2QA 5FHTA 1HCGA 1MD8A 4YOGA 4DG4A 4D8NA 1OS8A 1D3TB 2GGVB 4FU7A 1TQ7B 1MCVA 4KTUA 1CVWH 2AMPA 3HK3B 1G3BA 1DY8A 1WBGB 1A5HA 3RC4A 2UUKB 3MO3A 4MTBA 2Y5FA 3CS7A 2UWLA 1SLVB 1HUTH 1GMHF 4K3JA 5DPAA 2VIOA 3GY8A 3A8DA 2QY0B 1EZXC 3P8OA 2VGCC 2VIWA 3A8AA 1V2JT 1BBRE 4CRFA 1HJAC 2ZEBA 3K6ZA 1ANCA 4IC6A 1GHVH 1A3BH 1CT0E 1GCTB 1KXDA 1TMTH 2ZGHA 3SHAH 4HZHA 1ESBA 1BMNH 2VGCB 2B0FA 4MQAA 1L2EA 1QJ6B 1HIAB 3DFJA 2OQ5A 1LMWB 1O2OA 1JWTA 3PMHB 3AVZA 1GBAA 1O2XA 4WXIA 1F5LA 1MAYA 1KXFA 1GGDC 2F9PA 2ZFTA 4ZKOU 4DVAU 2ZGJA 1ZPZA 4ZUHA 3A8BA 5DK1A 2UWPA 2CN0H 1MU6B 1IQKA 3MH7A 3SU1A 2O8TA 1DWEH 3FP6E 1PPCE 4D76A 1O3DA 5JB9S 2ZCKP 4B71A 6CHAB 2ZFPH 1PPGE 1TABE 3LU9B 3EYDA 4JZIA 1BTYA 2R3UA 1H4WA 1SLWB 1ZGVA 1DSUA 3FZZA 4NGAH 5EU8A 4FUGA 1IQIA 2VVCA 2G4UA 2Z9GA 3RXQA 2BLQA 1ETRH 3IITA 5A8YA 3FAOA 2HLCA 3OTJE 2IOTA 2ZU3A 1QBVH 5AF9H 2ZWLH 1GI7B 4ABGA 2WUCA 1S5SA 2PR3A 1N1LA 3ZVCA 1AN1E 2PTNA 1SGRE 2AGEX 2A32A 1TX8A 4NG9H 1Y5AT 1BJUA 1EZUC 3AW1A 5CHAB 1QGFA 3F9EA 4MLFB 1GL0E 4WMFA 3SNDA 5DO4H 1WAYB 2P95A 1RFNA 1GHYH 1GJ7B 2J34A 4K2YA 5T3HA 3GCTG 1C5OH 1O2UA 1J8AA 2HGTH 1Y3VA 3SORA 1GVZA 1TPSA 2J4IA 4INKA 2GCHF 2SFAA 3UQVA 8KME2 3S7KB 1OWDA 2P94A 2A4RA 4WF8A 1KTTB 1TOMH 6GCHF 5HM9A 1TPOA 3UNRA 1SI5H 3PV4A 3UWJH 4MPWA 1SC8U 2C8WB 1AUJA 3EA7A 1Z8JB 1VJAU 3MOCA 1BRCE 1S0QA 3A7XA 1O37A 2QXIA 2OUAA 3M7TA 1TNGA 3SU2A 1GCDA 2NWNA 3F68H 1O34A 1KLJH 3KQBA 1HXEH 1MCTA 2F9BH 1GDQA 1GI9B 2K1QA 1T8MA 1HB0B 2BD3A 3SI4H 1CGJE 1Z1IA 3QX5H 5AFYH 2GCTC 1FXYA 1HYLA 3GY7A 1J14A 3RXJA 3STJA 2ZQ1A 3SNCA 2P3UB 4FUDA 1V2ST 3TGJE 2A2QH 3PMJA 1BB0B 5GCHF 4AYYB 2QV1A 2ZIQH 3NK8A 3QGNB 4AN7A 1UO6A 3ZYEA 3HK6B 1S83A 2A4QA 2GCTB 1MTUA 5C5NA 1XMNB 1L0ZA 3HATH 3I29A 2RA0A 2R0KA 4JZ1A 1WOFA 1ZPBA 2QXHA 4GHTA 3V0XA 2XC5A 1XM1A 1BOQA 2CXVA 2A4GA 1OWEA 1HNEE 2AGIX 2AYWA 4D9RA 3LC5A 4UFGH 1BRAA 2B7DH 4FUCA 2EI8A 1SBWA 1FIZA 3UFAA 1ABIH 1FUJA 1YCPK 2FOFA 5JBBS 3M5LA 1F5RA 2QYIA 1NT1A 1P3CA 1P57B 2OCVB 1TNHA 2RDLA 4MNVA 5F6MA 1HRTH 1TGSZ 4UONA 4Y11E 1CBWC 2F3CE 4B2CA 3PO1B 4JMYA 1G32B 4LZ4B 2JETC 1NU7B 2ZA5A 1W3CA 3BIVH 4CRDA 2JKHA 1GJBB 4XFQA 1ANBA 2UUJB 1XVMA 2P3TB 2PWXA 4DJZB 3KF2A 4Y0ZE 4A7IB 1GI2A 1LPGB 1OP8A 4AG2A 3A80A 4SGBE 1LPZB 3T29A 3GCHC 1FIWA 3P8FA 4RKJB 3UUZA 3SUFA 1C1TA 4ABBA 3SV6A 1O3FA 2FYRA 2ZFSA 3P8GA 1P9UA 1GG6C 1YCPH 2ZZUH 1LKBA 3RC5A 4K60A 2D26C 1SSXA 2Z6BD 1IQFA 1UTMA 2ZG0H 1H9HE 1O2RA 2KAIB 3GCHB 5L6NH 3NUMA 2VIDA 2W26A 1PPEE 3A84A 1G30B 3SJOA 1C1OA 2FWWA 1GG6B 4AB8A 1BTHH 3RXOA 3ZZCA 1EKBB 4UDWH 3RXRA 2FS9A 1O5CB 1ZSJA 1EAXA 2ODPA 2VVUA 1C1MA 3A7WA 1HAIH 1LQEA 3OSYA 1ELAA 1O35A 1TGTA 3ATWA 1A7SA 3GISB 3T25A 4ZHAA 2ZQ2A 3LC3A 3L3TA 1GBCA 1P0SH 1C5MD 2F9NA 5C1YA 4J2YB 4DIIH 4CBOA 1ARBA 1WQSA 3KIDU 2ZI2H 3RDZA 4B2AA 5C20A 5F03A 3D62A 5GXPA 1O5GH 1O3GA 1SOTA 1UTPA 1QRZA 3TH3H 1S6FA 1QQ4A 3BTME 4LOYH 2C8XB 3BN9A 4JYTA 1YC0A 1G3CA 1XUIA 1RIWC 2ZCLP 4NA7A 4UFEH 3CP7A 1SB1H 2ALVA 5A09A 5GIBA 2BVSH 1NTPA 2CF8H 1GI5A 1UVSH 5EQRA 1O5DH 5CMXH 1AWHB 1LHEH 1GJ4H 1XUFA 4MNXA 2FPZA 3IG6B 4NSVA 4GHQA 1VITG 5JPMH 1C1WH 1PPZA 1MKWK 2XW9A 1CU1A 4JYUH 2FXRA 4IN2A 1TAWA 2BVRH 5EPNA 1O2ZA 2FLBH 3MU8A 1J16A 1DDJA 5HXFA 4D9QA 1GMCF 4OS4A 2M5TA 5TCCA 2VIQA 3JZ2B 2BLWA 1O5BB 2GZ8A 5JBTA 2R0LA 1UVTH 2Z9IA 3UY9A 3T27A 5DGJA 3UIRA 3TH2H 2ILNA 3RXVA 3RXCA 2GKVE 3E0PB 2ZPRA 2BQWB 4H4FA 4Y6DA 3LJOA 3TK6A 4U30A 1TX7A 1OKXA 3W95A 4CREA 4ZXXH 3F9GA 4LZ1H 2SGPE 3VGCB 3PYHA 1A2CH 2ZTZA 4NFEA 1FAKH 1EJNA 1NU9A 2CJIA 5E2PA 3SBKA 3ZZ3A 1BHXB 2QF3A 3PWCA 1MKWH 3DA9B 1B5GH 1ANDA 3EQ0H 3UNSA 3GY4A 2F91A 3SU4A 2G5VA 2HPQH 3MH6A 1C2GA 1BITA 2AS9A 1YLDA 3L33A 1UVPA 1MMJN 3BEFB 4GCHF 1NFUA 1O2KA 2A7JA 3MU5A 1FN8A 1ID5H 3A8CA 4HFPB 3NPSA 2Q1JA 3RXEA 3SU3A 1MTNB 1QBNA 5EOKA 3V12A 1T7CA 2F83A 1CT2E 1W7GH 4IS5A 1Z8RA 4E06H 4Q80A 2BD8A 3RMLH 2F9OA 2OC8A 1YCPM 4Y8YA 2AGGX 1YPGH 3MU1A 2IPHA 4Y76A 4Y79A 1C1RA 3ITIA 1UTJA 1DWCH 1Y3WA 1EPTA 1P2NA 4ASHA 1GI0A 3LGVA 2V0BA 2FX4A 2FM2A 1G2MA 1QR3E 3RXTA 4DOQA 4OS2A 5EPYA 4NFFA 5E0HA 2P93A 2DUCA 2G4TA 2GX4A 2PV9B 3M7QA 4YOJA 3VPKA 4A1VA 2BLOA 1CA0C 2BDYA 1C5NH 1AHTH 1G9IE 1OYTH 1QCPA 3FVFB 1FY3A 3PM3A 1K28D 5DG6A 3KEEA 4XBCA 3ZZ4A 1CA0B 1EX3A 1T8OA 2PKAB 2WV5A 2BHGA 2HNTF 2CHAB 1O0DH 2HALA 1ORFA 1O5EH 2OQUA 3S9BA 1V2RT 1KDQA 4AX9H 1V2MT 4TPYA 3SV7A 1C5YB 1T4VH 1V2OT 1MTWA 1KY9A 1VCQA 2W3IA 1Y8TA 1LQDB 3CS0A 1VR1H 1P11E 1CHOG 3TNSA 1F7ZA 1XX9A 1KXEA 3P17H 1JOUB 3O8BA 1J15A 5JBCS 2NU2E 3U98H 1JIRA 1A46H 5AFZH 3A7VA 1MUEB 1FLEE 1A5IA 1DE7H 2BDCA 1NN6A 4IGDA 2BMGB 1AE5A 1H1BA 1G3EA 1KLTA 3VFEA 1D9IA 3S0NA 2FEQH 2C8YB 1FV9A 2Y80A 2BY7X 2ODQA 1LVYA 2BD7A 1GMDF 3MNXA 5HYOA 1ELEE 3BTGE 1DS2E 1XKAC 4FXGH 3VXEH 4DT7B 5F8XA 2RA3A 2JH0D 2XYAA 4YM9A 2WV4A 4UFFH 1O2VA 1JXPA 1PYTD 1TLDA 5DP8A 4ZXYH 4TPIZ 4BTIB 3F6UH 3TH4H 1EJMA 1OSSA 3RXGA 4I7YH 2BX4A 2GVFA 1FJSA 4NCYA 1EAWA 3SN8A 1C2MA 4NA8A 1C1UH 3LT3A 4U2WA 4ZH8A 1GJ8B 4YT7H 3ODDA 3TGIE 1TNIA 1UTOA 1W10U 1P3EA 7GCHG 1H9IE 3KCGH 4K8BA 4IC5A 2HWLB 4I8JA 3ZZ6A 2EC9H 8GCHF 2PFEA 3RXSA 2PGBB 2H9HA 3A87A 1N8OC 3EA8A 3SJ9A 2VU8E 1LHGH 1HLTH 3SQEE 1P04A 1FQ3A 1XXFA 3SOSA 1ELVA 3Q3KA 1ZRKA 3E3TA 1VGCC 1VZQH 3ATIA 2J94A 1K2I1 1AFQB 4I8GA 1O30A 3S9AA 1K1LA 2VB0A 3KNXA 1O32A 3QZQA 1XVOA 1HAHH 4NIYA 1EB1H 1N8OB 1A5GH 3NCLA 4NIWA 4X1PU 2ZFRH 4X2WA 2YNBA 1K1PA 2C8ZB 3OY6U 3PROA 1BDAA 1H8DH 3ZZBA 1BTXA 1AB9C 2FOMB 4VGCC 3OYPA 1A0LA 2STBE 3HKJB 2OLGA 2V3OH 1NRSH 2BD9A 2Q6DA 3C27B 1TMUH 1CSOE 1LCYA 1DY9A 2FX6A 1NO9H 3K6YA 4RKOB 4UE7H 2JH5D 4DW2U 1V2VT 1BTZA 3QZRA 2DE9A 2BY8X 3M7UA 1PQ5A 4GUXA 1HJAB 4ISIH 1TE0A 1BMLA 1DWDH 2OBQA 2VIVA 4X0WU 1SGDE 2HRVA 1YF4A 2R2MB 3BTWE 1J17T 4Q7YA 4MPXA 4A1TA 1P2MA 2Y5GA 4Y71A 3S9CA 3ZZDA 2B5TB 2ZCHP 3SNEA 3ZZ9A 2BDIA 3LJJA 4AFUA 2H5CA 2ZKSA 3LIWA 1K1NA 1ZGIA 1GGDB 2ULLA 2XC0A 1TPAE 3RU4D 2FOHA 2P16A 3QK1A 4K1TA 1F92A 1BBRK 1PPFE 4XBBA 1OWIA 1Y5UT 2AFQB 2FODA 2ANYA 2GT7A 1P2IA 1C5TA 1ZOMA 3AW0A 1FONA 2ZNKH 4FUIA 1O2WA 5DP9A 2VWNA 1Z71A 6ESTA 4OGYA 3E90B 4FUEA 1QBOA 2GD4B 2GT8A 1IQJA 1K1IA 5FXLA 3SU6A 1TBZH 4YZUA 1AY6H 3M3VA 1GBFA 1GHBF 3SQHE 2TGTA 1O33A 4MDSA 3QDZB 4I31A 3DD2H 1PYTC 4BNRA 4IW4E 3E91A 1TB6H 1UHBA 1L4DA 1C2DA 2A31A 3GOVB 2OP9A 2VINA 3ZVAA 1OYQA 3RXDA 5LGOA 2TRMA 1BBRH 1QA7A 2UWOA 1DLEA 3R3GB 5J4QA 3ZZ7A 2OBOA 2ODYB 3E1XB 4ABJA 3ATLA 2Z7FE 1LVOA 1VJ9U 3MNCA 2AIPA 2A5AA 1TOCB 1Q31A 3FP7E 5BPEA 1GBDA 1C2IA 3RXLA 1GI8B 1F2SE 3B23B 1W11U 5AHGH 1BTPA 2PUQH 1NFYA 3UOUA 4ZHMU 3T2NA 5FPSA 1V2LT 4M7GA 1GJAB 1BJVA 3ZV8A 1BMMH 2RCEA 4ISNA 1Q2WA 4FU8A 2EI7A 2Z9JA 1UMAH 1DLKB 3GY3A 2BDHA 1TNJA 3UTUH 1O5FH 2J92A 2XBYA 3KGPA 2W7UA 4DGJA 1MQ5A 3QLPH 1HGTH 1AKSB 4BAKB 2Z9LA 4F4OC 3T62A 4AORA 2XBVA 1GI1A 4BXWA 5ABWA 4GVUA 1GJ9B 2V35A 1O2JA 1P2JA 3U8RH 3I78A 4CRCA 1NRQH 4IMQA 2XWAA 3RU4E 1ZRBA 2Q6FA 1SOZA 1HAYB 4JZDH 2SGDE 3RXMA 2ZU4A 1B7XB 1QJ1B 2BD2A 4Q7XA 2C90B 1T31A 1A1RA 3MFJA 3ZVEA 2XC4A 3E6PH 1BTUA 1F0SA 4CR9A 5FPTA 2BDBA 3M3SA 1C5SA 2GV6A 4NSYA 3LGTA 4WMDA 4AGJA 2BB4A 2C3SA 2FI5E 3P70B 5GDSH 4KKDA 7KMEH 1O39A 5E0GA 4WMEA 1SLUB 1O2MA 2BD5A 1THPB 1P8VC 2BOKA 4IN1A 4X1SU 2VWOA 1GHZA 3Q00A 4UFDH 2SGFE 1CQQA 3H7OA 3O8RA 1C4U2 1AZZA 1C5VA 1S0RA 2BXUH 1CA8B 1Q3XA 3HPTB 5AVDA 5H4IB 1QB1A 3B8JA 4JK6A 1T8NA 4KP0A 1A0JA 3H5CB 2W3KA 1BZXE 3BF6H 3K65B 1FY8E 3BG8A 3RUOA 2ZDAH 4RSPA 2VVVA 3NKKA 1GHWH 1QHRB 4I32A 1SQAA 3VXFH 4LK4A 1ANEA 1K1MA 1QL8A 3MWIU 2TBSA 3PTNA 1Z6JH 5EXNA 3C1KA 4THNH 1UVUH 1A61H 3SNBA 3P92A 1Z8IB 1CBWB 4PROA 2JETB 3T26A 3PTBA 1VCPA 1OPHB 3RMOH 4X8VH 3LKWA 1AIXH 4X1NU 1U6QA 1V2KT 1VCWA 2FYQA 4B74A 3NWUA 1BA8B 5I25A 1GBHA 1THSH 2OC7A 4D7FA 1FDPA 2ZDKA 2FLRH 2I6SA 5F8ZA 1SL3A 3PB1E 4K5ZA 1GJ5H 1SGTA 1F0RA 1NFXA 1Y3XA 2OC1A 1XKBC 1TGCA 3EDXB 3H7TA 1TONA 3GDVA 4ZAEA 1C5UA 1MTVA 5F8TA 1P05A 2Y81A 4X1RU 5IDKA 4R0IA 1NZQH 1HJ8A 2CMYA 1YBWA 2SGAA 1S6HA 4XE4A 1Y3UA 1L1JA 2BDAA 2VIPA 2Y7XA 1IQLA 4NIXA 5L2ZH 1CGHA 1SHYA 4MVNA 1ZTKA 4I33A 1C2LA 3TGKE 3EA9A 4YLQH 1HAVB 1DANH 3GCOA 2GTBA 1DX5M 4Y0YE 1AD8H 3Q3YA 4Y7AA 2ZU5A 1C1VH 2ZO3H 3W94A 3KQCA 2A0QB 2BX3A 2W5EA 4UD9H 1FPCH 2W7SA 4WJG2 1C5LH 1RTLA 4B1TA 4ZROA 1GMHG 2G81E 1GJ6A 3BTEE 1RIWB 4OS6A 2ZGBH 3ZVBA 1AVXA 5E2OA 9ESTA 4X8UH 1QL9A 3I77A 2XTTB 1NFWA 1TGBA 2G5NA 4AFZA 4Y8XA 1MBMA 1WU1A 1K1JA 1FMGA 4NZLA 5L30H 5LH8A 3UWIA 1HAXB 3TLOA 3UR9A 2ZHWH 1AO5A 3QUMP 1MH0A 1PQ7A 2BYAX 1SFQB 3P8NA 1TNKA 1V3XA 2HNTE 4YESB 2G52A 1P9SA 4CRAA 3BTTE 3MO9A 1FAXA 3PWBA 5A8XA 3S7HB 4HGCA 2XBXA 2P59A 1TIOA 1EAUA 1LVBA 3SUDA 4WY3A 2BVXH 1C1NA 5FCRA 1LDTT 4WXVA 1WV7H 2F9UA 1SQTA 3GCTF 4OS7A 2ZPQA 4ABIA 1MQ6A 4BOHA 1TA2A 2GV7A 5JBAS 4B76A 1O3MA 1ZPCA 3SJ8A 2BDGA 1GBJA 4WH8A 2NU1E 3LDXH 1HDTH 1YP9A 2GMTC 4E05H 1GL1A 1GI4A 2BD4A 1HAOH 1QB6A 3F9HA 1XUHA 3U1JB 3SV9A 1BHXF 3VB5A 5A0CA 2OD3B 3RLYH 4Q7ZA 3D49H 5HM2A 2HNTC 1O3LA 5ETXA 2HPPH 4AGKA 3BTKE 1LO6A 3STIA 1O3OA 4ABDA 2WPHS 2D2DA 3SV8A 3RM2H 5C2ZA 2ANWA 2I6QA 1M9UA 3HGNA 1GBLA 2KAIA 2QXJA 5GJ4B 1V2QT 4MNYA 5T6FA 3MU0A 4KTSA 1JRTA 2ZHFH 1SGPE 1EJAA 1OXGA 2GCHG 1ZSLA 5DP4A 3SNAA 4X6OA 1C2KA 6GCHG 2OC0A 1SGNE 1MZDA 2HVXA 1DSTA 3RMNH 1EAIA 4SGAE 2EEKA 1F0TA 4O97A 2J95A 2BLVA 7ESTE 5DP5A 4B75A 2WPKS 2ZHQH 1D3DB 1ELBA 2G55A 5DKMA
chains in the Genus database with same CATH superfamily
1GBIA 3LOXA 1JRSA 1XUGA 3KL6A 3AK5A 4X2VA 2ZDMA 3O8CA 3T28A 4I8HA 1W7XH 3GYLB 3QN7A 2FDAA 1E37B 4DURA 1D3QB 4CHAC 2PSYA 2AIQA 3UB0A 1F0UA 3A82A 3E0NB 1AUTC 1O36A 1Z7KA 1PPBH 1JBUH 4H6SB 1INCA 5TJXA 1HFDA 1NRRH 1RRKA 4FVDA 1UCYK 2G00A 2H9EH 2UUYA 4I8KA 4Z0KA 3LGYA 3P6ZB 1A4WH 4AG1A 4TWWA 2TIOA 3SU0A 7LPRA 9LPRA 4CHAB 5GCHG 2VWMA 4BTUB 3M37A 1CO7E 1HXFH 4RT1A 1TA6A 1C5PA 5EODA 2IJOB 1QNJA 1ELTA 1DICA 1WTHD 4XSKU 5FBEA 1E36B 1FPHH 2ZTYA 3RXPA 3T5FH 2ANKH 4OS5A 1SLXB 2HOBA 1DXPA 3VB7A 1IHSH 4E7RG 2LNCA 4X8SH 1MAXA 1RD3B 1D6RA 4O3UA 1W0JD 3A85A 3MH5A 3MH4A 5CDFE 3GY6A 3RXHA 1TWXB 5CHBA 1UCYH 3NZIA 2C4FH 5GPIB 1S81A 4TY6A 2RG3A 3IWMA 1C2HA 1P09A 4AFSA 1ZMNA 1TALA 3A83A 1UK3A 5K0HA 1BRBE 1P02A 2BXTH 4NWLA 5J4SA 2PSXA 1UVOA 4X6PA 1C2EA 4NIVA 5EQQA 5G4BA 2PTCE 1A3EH 1QRXA 4K1SA 2CF9H 5A0AE 1GBBA 1O3KA 3SHCH 1IQNA 2AMQA 2XOKD 2PGQB 4BAMB 3PV5A 4O9VA 2PHBA 4YT6H 1NROH 1YPEH 4AC9A 3F2GA 2JJ1D 3ZV9A 1VITH 2D1JA 4YLUA 2GDEH 1GI3A 2GDDA 3GS9A 3OX7U 3N7EA 2KM0A 1C9TA 4XOJA 1MKXK 4YO9A 2O8UA 1AVWA 1BT7A 1TMBH 1VGCB 2Y7ZA 5C67A 3DCLA 2J98A 5HGGA 1DM4B 3O8DA 3M5MA 2J5UA 1MBQA 1QL7A 1VITF 3TPIZ 2YNAA 2A7CA 5FX6A 5T6DA 3A88A 1W8BH 1O3PB 5ESBA 2FZZA 2FOAA 1GCTC 1SQOA 3RMMH 3OAAD 1NBMD 2FOEA 3ZVGA 3WWBA 3RLWH 5EJLA 3FFGA 4Y10E 3ODFA 4FUJA 1GVKB 4TWYA 1AB9B 1ZMLA 4VGCB 1KIGH 3TU7H 4JZEH 1NRPH 1JIMA 1FZZA 2BQ6B 2L6OA 4XDEA 1O2YA 1EP6A 1QIXB 2PKAA 1BQYA 1E34B 1MKXH 2J38A 1SGFG 2ZDNA 1GJDB 3S69A 3QGJA 3PMAB 4NA9H 3RC6A 2QGRA 3SI3H 1TRNA 1L1GA 2ZHEH 1SQRA 3RXFA 4YOIA 1E38B 1EXFA 1YM0A 3FZDA 1T32A 4UEHH 3FANA 3SJKA 3NXPA 5FPYA 2UUFB 3BEUA 1YWUA 1S82A 2H1UA 1FY5A 3U8OH 6CHAC 3LGWA 4Y8ZA 1G2LA 4KELA 2FTMA 2AEIH 3ZVDA 1CE5A 1WTGH 3B9FH 4YTAA 3RXBA 3A86A 1SVPA 2Z94A 2H5DA 2V3MA 5E0JA 1A0HB 2NU0E 3F1SB 3DHKH 1H8IH 1V2TT 2W6ID 1EASA 1P12E 1RS0A 3OEED 3RU4T 1GMCG 1PQ8A 3TITA 1ZHRA 4FUHA 4X6NA 3VB4A 4AZ2B 4RI0A 4CBNA 8ESTE 3V7TA 1ZLRA 2OTVA 1MU8B 4QT8C 2Y6TA 1DPOA 4ESTE 4INLA 1T4UH 3GY2A 1XUJA 2SGEE 1UK4A 3BV9B 1NM6A 2QN5T 4HTCH 4GAWA 4P02A 5CHAC 1ZZZA 3SO3A 1V2WT 1ESAA 4O03A 2F9VA 1IQGA 1BUIA 4OS1A 1TRYA 1WSSH 1GPZA 4Q63A 4AYVB 3SU5A 2ZFFH 4CRGA 2THFB 1WCZA 1ZTJA 1DXWA 1YPJH 1FN6A 3M35A 1MTSA 3MO6A 4GCHG 1G36A 3LONA 4K1EA 3KN2A 2ZDLA 5ESTE 2OINA 2V3HH 3ATKA 1YPKH 4U01A 1AVGH 4ABAA 1JMOH 1EOLA 1GBKA 1O2PA 3PMBB 2K0QA 1QY6A 3TVJB 2FESH 4RN6A 4I8LA 1BIOA 2XNDD 2NU3E 5FCKA 3U1IB 1AFEH 1QJ7B 1SGEE 3GDSA 4BANB 3LH1A 5LPEA 1ETTH 1W14U 2QXGA 3E16B 3KQDA 1AZ8A 4O3TA 2FTLE 1DUEA 1BTWA 2PKSC 2A5IA 5EW1H 4FUBA 5BRRE 3QTVH 1YPHE 5EXLA 1OWJA 1DOJA 3SZNA 1Z8GA 2R3YA 5KGOA 4NZQA 1QURH 3GCNA 1CHOF 3ENSB 1DWBH 3VEQB 4Q2KA 1O3EA 1P06A 2JH6D 3QTOH 2CGAA 1E1QD 1C5QA 1EZSC 1SMFE 3LGIA 1MZAA 3UREA 1E35B 2WPLS 4K69A 5L2YH 2PKSB 1C2FA 1Y5BT 4KTCA 1C4V2 5B6LA 1P10A 3BTFE 4Z1MD 3AAUA 1X7AC 2TGPZ 1SG8B 3GDUA 5DP3A 3TNTA 3UR6A 1BRUP 1P2QA 2ZHDA 3BTDE 3F0PA 1UTNA 1C4Y2 2ALPA 2EI6A 3OE7D 2V6NA 2A5KA 3LPRA 2FIRH 2HVYB 2SNVA 1W0ZU 2ANMH 2J2UA 2GZ9A 3AASA 3TJUA 4WH6A 1ARCA 2R9PA 4NWKA 1HIAA 2AH4X 1O2NA 1MD7A 2AMDA 1S84A 3SUGA 4TT3D 1QFKH 2XWBI 1FY1A 3MQKC 2A45B 3V13A 4INHA 1NS3A 1OX1A 2KR7A 1YPHC 4X1QU 1SHHB 1NC6A 3PLBA 1W0YH 1KYNA 1LHDH 3PO1C 3P95A 2ZTXA 4CH8B 1GBMA 1KXAA 4JCNA 4X6MA 1V2UT 1ZJDA 2NU4E 2Z3DA 3ESTA 1B0EA 1GHXH 4ZKSU 1HJ9A 7GCHF 2XBWA 2CV3A 3BG4C 1TRMA 4D7GA 4ZHLU 5LPRA 2FMJA 1QTFA 2BZAA 1S85A 1K21H 4ASUD 5JB8S 3GYMA 1RXPA 1G37A 1EPTC 1TX6A 1GMDG 4X8TH 4R8TB 2ZECA 1E0FD 1RTKA 4Z6AH 2FS8A 2LP6A 1SPJA 4BAQB 1YKTA 2ZFQH 3DUXH 1W13U 2D8WA 2H9TH 3M3TA 4AB9A 4CH2B 2TGDA 1P01A 3A89A 3BG4B 5FX5A 3DSOA 3Q77A 4CRBA 4DY7B 1P03A 1LHCH 3RXAA 5EGMA 2Z3CA 5EIYA 3MTYA 3RXIA 5LPFA 1EPTB 1SGCA 1WYKA 3A7TA 3Q76A 1OOKB 2ZDVH 1PFXC 2VNTA 1WQVH 2OXSA 4ABEA 1N6XA 1UTQA 1TBRH 1LTOA 3MNBA 1DT2A 5CE1A 3A81A 1WUNH 1F5KU 2IN2A 4HI3A 4ABHA 3UOPA 1TFXA 1AU8A 1OWHA 5HIZA 4GSOA 1T8LA 3SUEA 2ZU2A 4GLYA 4TY7A 1ELGA 1TGNA 1GHAG 1SR5C 2SNWA 3G01A 2QCYA 1LKAA 2ZP0H 4KGAA 1EUFA 2XRCA 3M36A 1AWFH 2PLXA 8GCHG 3EAJA 3M5OA 1DUAA 2TGAA 1HAGE 4A5TS 1Z6EA 3SYJA 5JDUB 5A0BA 1C1PA 1ESTA 1DITH 1ZHPA 1ETSH 1XXDA 3OY5U 1AQ7A 1HPGA 3GICB 1FNIA 1C1QA 2STAE 3JZ1B 4TYDA 2ASUB 3D65E 5HMAA 1O3IA 3SGAE 4B2BA 1O2TA 2BY5X 5DP6A 4GPGA 1QB9A 4J1YA 4ZKNU 1KDQB 3BIUH 1Y59T 1ACBE 1IQMA 3AAVA 5EXMA 3Q3XA 1AKSA 4ISLA 1NPMA 1IQHA 1CHGA 3HKIB 3UPEA 3A7YA 1BMAA 3KQEA 1GDNA 1O31A 1N6YA 2A4OA 2VH0A 2ZGCA 4WVPE 1THRH 1EQ9A 2FOCA 4JK5A 3DSPA 3K2UA 3L6PA 1FI8A 3EE0B 4MPUA 1ABJH 1HBTH 3QWCH 5EW2H 1QA0A 3U9AH 2Y82A 3SGBE 4ZMAH 3URCA 4B73A 5GWZA 2O8LA 3H09A 4U32A 1ZJKA 3LH3A 5B6OA 3RXUA 3SW2B 2J97A 1UK2A 2ZPSA 3MMGA 1C9PA 2C93B 2XNIA 3BTHE 4X2XA 6LPRA 3TIUA 2PP6A 4FU9A 1SFIA 1FY4A 3VGCC 1TQ0B 1D3PB 3ATMA 4E7NA 1YGCH 3GY5A 2H6MA 2GZ7A 2B9LA 3BTQE 1L4ZA 2PUXB 1O5AB 1GVLA 5JYIA 4ISOA 1PJPA 1AGJA 4MG3A 5EG4A 2O8WA 4I86A 3N7OA 1ELDE 1H9LB 1HAZB 2QC2A 1O2GH 3RP2A 1O3NA 1OWKA 1AI8H 1D6WA 1PQAA 4F55A 1V2NT 4BXSA 1PPHE 2FP7B 1OP0A 3ZZAA 1UTKA 4AOQA 2FOBA 2A7HA 2JDID 1MTNC 5FBIA 3ZZ5A 4MNWA 3MI4A 2O8MA 1DFPA 1RTFB 1XUKA 2VWLA 2TPIZ 4JZFH 1O2SA 5T1VA 8LPRA 1O2IA 2G51A 2XXLA 5C94A 2WINI 3URDA 2QA9E 1J9CH 1K22H 3PLPA 1C2JA 2QAAA 4ABFA 3TJOA 2VH6A 2Z9KA 3U8TH 2P8OC 3RM0H 1GBTA 2WHXA 3TK9A 2BTCE 3PLKA 4F49A 1KTSB 2WPIS 3KHVA 3BSQA 1DVAH 1C1SA 3M61U 2GMTB 1K9OE 2AHME 4AFQA 1GHBG 2ZGXH 4WWYA 3ZVFA 1ELFA 4XBDA 1AMHA 3BEIB 4ISHH 2SGQE 2Z3EA 4DT4A 2P8OB 1L1NA 3FP8E 1NY22 1OHHD 4Y7BA 1LHFH 2QF0A 3QO6A 5DJ7A 1IQEA 1KXCA 2ZC9H 1EOJA 1SGFA 2A2XH 1O38A 5K7RA 2BM2A 1QRWA 1HV7A 1ZSKA 3SV2H 2BOHB 1W12U 3MNSA 3MYWA 1EP5A 4H42U 1EB2A 2Q6GA 5DP7A 5C1UA 4FVBA 3WY8A 1UTLM 1RJXB 1UCYE 2PW8H 2CHAC 3M5NA 1KSNA 1O3HA 5PTPA 1ZTLA 2OK5A 1QQUA 1HAVA 1Z1JA 5E8EH 1LPKB 2G8TA 3CENA 2WPMS 1O3BA 3V3MA 1GBEA 4IMZA 5A8ZA 1BCUH 2XCFA 2H2ZA 2Y5HA 2BQ7B 2QF4A 1YLCA 3ELAH 1K1OA 1P2OA 2J9NA 1IOEA 3OU0A 2DE8A 1TYNA 4FOUC 1KXBA 2WUBA 2BY9X 2ESTE 4H6TA 1O2HA 1GI6A 1GWAA 2FI4E 2LPRA 2ZU1A 3TJVA 3MHWU 3E8LA 2EA3A 1TBQH 2AERH 5IYTA 5C1XA 1V2PT 4K8YA 4A6LA 4FUFA 5I46H 1YPLH 1O3CA 2WPDD 5C17A 2WPJS 1NESE 3DT0H 4MPVA 1YY3A 5SGAE 4IBLH 1O2LA 4BTTB 2WYGA 2YOLA 1C5XB 4JYVH 5C5OA 3F9FA 1ZMJA 1CT4E 4X2YA 1D4PB 2O9QA 1OP2A 1UJ1A 4A92A 1KLIH 1Y3YA 2QIQA 1AE8H 4CR5A 4DIHH 1G3DA 3VB3A 3ZYDA 4BAHB 2BZ6H 3DFLA 3UQOA 4LXBH 5EQSA 1ZHMA 5C3NA 1GJCB 3SJIA 1RGQA 3ZZ8A 2GP9B 2B8OH 5T6GA 1HAPH 3OTPA 1C5RA 3LGUA 1IHTH 3D23A 3VB6A 5A2MH 1ZYOA 1UHBB 2R2WU 3TJNA 2A1DB 1EATA 3MU4A 2VJ1A 1CGIE 2P3FH 1C5WB 1P2KA 3TK5A 4OGXA 3N7DA 1SGQE 1B0FA 1YYY1 2FO9A 3F2HA 3WW7A 1ELCA 3SGQE 3U69H 1C5ZB 4BAOB 3K9XB 3RXKA 2F4LA 1SGIB 2XCNA 1EZQA 4TSFD 1TNLA 1W2KH 1GHAF 1YPMH 2WYJA 3UNQA 3HGPA 1SGYE 2ZF0H 1O3AA 3EGKH 1GDUA 4DCDA 1AFQC 1TPPA 4A1XA 2BY6X 1IAUA 1V6DA 1NRNH 5TCAA 2FI3E 1ZR0A 3R0FA 2FOGA 1LVMA 3A7ZA 1O3JA 5FAHA 4ZKRU 1O2QA 5FHTA 1HCGA 1K0HA 1MD8A 4YOGA 4DG4A 4D8NA 1OS8A 1D3TB 2GGVB 4FU7A 1TQ7B 1MCVA 4KTUA 1CVWH 2AMPA 3HK3B 1G3BA 1DY8A 1WBGB 3OFND 1A5HA 3RC4A 2UUKB 3MO3A 2YMSD 4MTBA 2Y5FA 3CS7A 2UWLA 2KX4A 1SLVB 1HUTH 1GMHF 4K3JA 5DPAA 2VIOA 3GY8A 3A8DA 2QY0B 1EZXC 3EE7A 2KCAA 3P8OA 2VGCC 2VIWA 3A8AA 1V2JT 1BBRE 4CRFA 1HJAC 2ZEBA 3K6ZA 2KCOA 1ANCA 2RFKC 4IC6A 1GHVH 1A3BH 1CT0E 1GCTB 1KXDA 1TMTH 2ZGHA 3SHAH 4HZHA 1ESBA 1BMNH 2VGCB 2B0FA 2GJGA 4MQAA 1L2EA 1QJ6B 1HIAB 3DFJA 2OQ5A 1LMWB 1O2OA 1JWTA 3PMHB 3AVZA 1GBAA 1O2XA 4WXIA 1F5LA 1MAYA 1KXFA 1GGDC 2F9PA 2ZFTA 4ZKOU 4DVAU 2ZGJA 1ZPZA 4ZUHA 3A8BA 5DK1A 2UWPA 2CN0H 1MU6B 1IQKA 3MH7A 3SU1A 2O8TA 1DWEH 3FP6E 1PPCE 4D76A 1O3DA 5JB9S 2ZCKP 4B71A 6CHAB 2ZFPH 1PPGE 1TABE 3LU9B 3EYDA 3FKSD 1BTYA 4JZIA 2R3UA 5HKKD 1H4WA 1SLWB 1ZGVA 1DSUA 3FZZA 4NGAH 5EU8A 4FUGA 1IQIA 2VVCA 2G4UA 2Z9GA 3RXQA 2BLQA 3PRBA 1ETRH 3IITA 5A8YA 3KYFA 3FAOA 2HLCA 3OTJE 2IOTA 2ZU3A 1QBVH 5AF9H 2JJ2D 2ZWLH 1GI7B 4ABGA 2WUCA 1S5SA 2PR3A 1N1LA 3ZVCA 1AN1E 2PTNA 1SGRE 2AGEX 4ACBA 2A32A 1TX8A 4NG9H 1Y5AT 1BJUA 1EZUC 3AW1A 4Q4LA 5CHAB 1QGFA 3SZEA 3F9EA 4MLFB 1GL0E 4WMFA 3SNDA 5DO4H 1WAYB 2P95A 1RFNA 1GHYH 1GJ7B 2J34A 4K2YA 5T3HA 3GCTG 1C5OH 1O2UA 4FETA 1J8AA 2HGTH 1Y3VA 3SORA 1NBME 1GVZA 1TPSA 2J4IA 4INKA 2GCHF 2SFAA 3UQVA 8KME2 3S7KB 1OWDA 2P94A 2A4RA 4WF8A 3CNRA 1KTTB 1TOMH 6GCHF 5HM9A 1TPOA 3UNRA 1SI5H 3PV4A 3UWJH 4MPWA 1SC8U 2C8WB 1AUJA 3EA7A 1Z8JB 1VJAU 3MOCA 2IJD1 1BRCE 1S0QA 3A7XA 1O37A 2QXIA 2OUAA 3M7TA 1TNGA 3SU2A 1GCDA 2NWNA 3F68H 1O34A 1KLJH 3KQBA 1HXEH 1MCTA 2F9BH 4ZCNA 2K8IA 1GDQA 1GI9B 2K1QA 4OM9A 1T8MA 1HB0B 3FOAA 2BD3A 3SI4H 1CGJE 1Z1IA 3QX5H 5AFYH 2GCTC 1FXYA 1HYLA 3GY7A 4LZ1H 1J14A 3RXJA 3STJA 2ZQ1A 3SNCA 2P3UB 4FUDA 1V2ST 3TGJE 2A2QH 3PMJA 1BB0B 5GCHF 4AYYB 2QV1A 2ZIQH 3NK8A 3QGNB 4AN7A 1UO6A 3ZYEA 3HK6B 1S83A 2A4QA 2GCTB 1MTUA 5C5NA 1XMNB 1L0ZA 3HATH 3I29A 3UAIC 2RA0A 2CK3D 2R0KA 3F0OA 4JZ1A 1WOFA 1ZPBA 2QXHA 4GHTA 3V0XA 2XC5A 1XM1A 1BOQA 2CXVA 2A4GA 1OWEA 1HNEE 2AGIX 2AYWA 4D9RA 3LC5A 4UFGH 1BRAA 2B7DH 4FUCA 2EI8A 1SBWA 1FIZA 3UFAA 1ABIH 1FUJA 1YCPK 2FOFA 5JBBS 3M5LA 1F5RA 2QYIA 1NT1A 1P3CA 1P57B 2OCVB 1TNHA 2RDLA 4MNVA 5F6MA 1HRTH 1TGSZ 4UONA 4Y11E 1CBWC 2F3CE 4B2CA 3PO1B 4JMYA 1G32B 4LZ4B 2JETC 5EJ1A 1NU7B 2ZA5A 1W3CA 3BIVH 4CRDA 2JKHA 1GJBB 4XFQA 1ANBA 2UUJB 1XVMA 2P3TB 2PWXA 4DJZB 1E1RD 3KF2A 4Y0ZE 4A7IB 1GI2A 1LPGB 1OP8A 2VBCA 4AG2A 3A80A 4SGBE 1LPZB 3T29A 3GCHC 1FIWA 5HIYA 3P8FA 4RKJB 3UUZA 4F48B 3SUFA 1C1TA 4ABBA 3SV6A 1O3FA 2FYRA 2ZFSA 3P8GA 1P9UA 1GG6C 1YCPH 2ZZUH 1LKBA 3RC5A 4B6FA 4K60A 2D26C 2QE7D 2WV9A 1SSXA 2Z6BD 1IQFA 1UTMA 2ZG0H 1H9HE 1O2RA 2KAIB 3GCHB 5L6NH 3NUMA 2VIDA 2W26A 1PPEE 3A84A 1H8HD 1G30B 3SJOA 1C1OA 2FWWA 1GG6B 4AB8A 1BTHH 3RXOA 3ZZCA 1EKBB 4UDWH 3RXRA 2FS9A 1O5CB 4RT0A 1ZSJA 1COWD 2WSSD 1EAXA 2ODPA 2VVUA 1C1MA 3A7WA 1HAIH 1LQEA 3OSYA 1ELAA 1O35A 1TGTA 3ATWA 1A7SA 4HG6A 3GISB 3T25A 4ZHAA 2ZQ2A 3LC3A 3L3TA 1GBCA 1P0SH 1C5MD 2F9NA 5C1YA 4J2YB 4DIIH 4CBOA 4YXWD 1ARBA 1WQSA 3KIDU 2ZI2H 3RDZA 4B2AA 5C20A 5F03A 3D62A 5GXPA 1O5GH 1O3GA 1SOTA 1UTPA 1QRZA 3TH3H 1S6FA 1QQ4A 3BTME 4LOYH 2C8XB 1WXRA 3BN9A 4JYTA 1YC0A 1G3CA 1XUIA 1RIWC 2ZCLP 4NA7A 4UFEH 3CP7A 1SB1H 2ALVA 5A09A 5GIBA 2BVSH 1NTPA 2CF8H 1GI5A 1UVSH 5EQRA 1O5DH 5CMXH 1AWHB 1LHEH 1GJ4H 1XUFA 4MNXA 2FPZA 3IG6B 4NSVA 4GHQA 1VITG 5JPMH 1C1WH 1PPZA 1MKWK 2XW9A 1CU1A 4JYUH 2IPQX 3OEHD 2FXRA 3F3BA 4IN2A 1TAWA 2BVRH 5EPNA 1O2ZA 2FLBH 3MU8A 1J16A 1DDJA 5HXFA 4D9QA 1GMCF 4OS4A 2M5TA 5TCCA 2VIQA 3JZ2B 2BLWA 1O5BB 2GZ8A 5JBTA 2R0LA 1UVTH 2Z9IA 3UY9A 3T27A 5DGJA 3UIRA 3TH2H 2ILNA 3F2FA 3RXVA 3RXCA 2GKVE 3E0PB 2ZPRA 2BQWB 4H4FA 4Y6DA 3LJOA 3TK6A 4U30A 1TX7A 1OKXA 2KZ4A 3W95A 4ZXXH 3F9GA 4CREA 2SGPE 3FO8D 3VGCB 3PYHA 1A2CH 2ZTZA 4NFEA 1FAKH 1EJNA 1NU9A 2CJIA 5E2PA 3SBKA 3ZZ3A 1BHXB 2QF3A 3PWCA 1MKWH 3DA9B 4ACAA 1B5GH 1ANDA 3EQ0H 3UNSA 3GY4A 2F91A 3SU4A 2M2AA 2G5VA 2HPQH 3MH6A 1C2GA 1BITA 2AS9A 1YLDA 3L33A 2F43B 1UVPA 1MMJN 3BEFB 4GCHF 1NFUA 1O2KA 2A7JA 3MU5A 1FN8A 1ID5H 3A8CA 4HFPB 3NPSA 2Q1JA 3RXEA 1MABB 3SU3A 1MTNB 1QBNA 5EOKA 3V12A 1T7CA 2F83A 1CT2E 1W7GH 4IS5A 1Z8RA 4E06H 4Q80A 2BD8A 5EJZA 3RMLH 2F9OA 2OC8A 3KQ5A 1YCPM 3WWFA 4Y8YA 2AGGX 1YPGH 2JIZD 3MU1A 2IPHA 4Y76A 4Y79A 1C1RA 3ITIA 1UTJA 1DWCH 1YLNA 1Y3WA 1EPTA 1P2NA 4ASHA 1GI0A 3LGVA 2V0BA 2FX4A 2FM2A 1G2MA 1QR3E 1WDIA 3RXTA 4DOQA 4OS2A 5EPYA 4NFFA 5E0HA 2J98B 2P93A 2DUCA 2G4TA 2GX4A 2PV9B 3M7QA 4YOJA 3VPKA 4A1VA 2BLOA 1CA0C 2BDYA 1C5NH 1AHTH 1G9IE 1OYTH 1QCPA 5C0TA 3FVFB 1FY3A 3PM3A 1W0KD 1K28D 5DG6A 3KEEA 4XBCA 3ZZ4A 1CA0B 1EX3A 1T8OA 2PKAB 2WV5A 2RDEA 2BHGA 2HNTF 2CHAB 1O0DH 2HALA 1ORFA 1O5EH 2OQUA 3S9BA 1V2RT 1KDQA 4AX9H 1V2MT 4TPYA 3SV7A 1C5YB 1T4VH 1V2OT 1MTWA 1KY9A 1VCQA 2W3IA 1Y8TA 1LQDB 3CS0A 1VR1H 1P11E 1CHOG 3TNSA 1F7ZA 1XX9A 1KXEA 3P17H 1JOUB 3O8BA 1J15A 5JBCS 2EQNA 2NU2E 3U98H 1JIRA 1A46H 5AFZH 3A7VA 1MUEB 1FLEE 1A5IA 1DE7H 2BDCA 1NN6A 4IGDA 2BMGB 1AE5A 1H1BA 3NRLA 1G3EA 1KLTA 3VFEA 1D9IA 3S0NA 2FEQH 2C8YB 1FV9A 2Y80A 2BY7X 2ODQA 1LVYA 2BD7A 1GMDF 3MNXA 5HYOA 1ELEE 3BTGE 3N99A 1DS2E 1XKAC 4FXGH 3VXEH 4DT7B 5F8XA 2RA3A 2JH0D 2XYAA 4YM9A 2WV4A 4UFFH 1O2VA 1JXPA 1PYTD 1TLDA 5DP8A 4ZXYH 4TPIZ 4BTIB 3F6UH 3TH4H 1EJMA 1OSSA 3RXGA 4I7YH 2BX4A 2GVFA 1FJSA 4NCYA 1EAWA 3PRDA 3SN8A 1C2MA 4NA8A 1C1UH 3LT3A 4U2WA 5C0UA 4ZH8A 1GJ8B 4YT7H 3ODDA 3TGIE 1TNIA 1UTOA 1W10U 1P3EA 7GCHG 1H9IE 3KCGH 4K8BA 4IC5A 2QF5A 2HWLB 4I8JA 3ZZ6A 2EC9H 8GCHF 2PFEA 3RXSA 2PGBB 2H9HA 3A87A 1N8OC 3EA8A 3SJ9A 2VU8E 1LHGH 1HLTH 3SQEE 1P04A 1FQ3A 1XXFA 3SOSA 1ELVA 3Q3KA 1ZRKA 3E3TA 1VGCC 1VZQH 3ATIA 2J94A 1K2I1 2HLDD 1AFQB 4I8GA 1O30A 3S9AA 4B6EA 1K1LA 1SKYE 2VB0A 3KNXA 1O32A 3QZQA 1XVOA 1HAHH 4NIYA 1EB1H 1N8OB 1A5GH 3NCLA 4NIWA 4X1PU 2ZFRH 4X2WA 2YNBA 1K1PA 2C8ZB 3OY6U 5KECA 3PROA 1BDAA 1UW7A 1H8DH 3ZZBA 1BTXA 1AB9C 2FOMB 4VGCC 3OYPA 1A0LA 2STBE 3HKJB 2OLGA 2V3OH 1NRSH 2BD9A 2Q6DA 3C27B 1TMUH 1CSOE 1LCYA 1DY9A 5IK2D 2FX6A 1NO9H 3K6YA 4RKOB 4UE7H 2JH5D 4DW2U 1V2VT 1BTZA 3QZRA 2DE9A 2BY8X 3M7UA 5DSFA 1PQ5A 4GUXA 1HJAB 4ISIH 1TE0A 1BMLA 1DWDH 2OBQA 2VIVA 4X0WU 1SGDE 2HRVA 1YF4A 2R2MB 3BTWE 1J17T 4Q7YA 4MPXA 4A1TA 1P2MA 2Y5GA 4Y71A 3S9CA 3ZZDA 2B5TB 2ZCHP 3SNEA 3ZZ9A 2BDIA 3LJJA 4AFUA 3W1EA 2H5CA 2ZKSA 3LIWA 1K1NA 4XRNA 1ZGIA 3ZIAD 1GGDB 2ULLA 2XC0A 1TPAE 3RU4D 2FOHA 2P16A 3QK1A 4K1TA 1F92A 1BBRK 1PPFE 4XBBA 1OWIA 1Y5UT 2AFQB 2FODA 2ANYA 2GT7A 1P2IA 1C5TA 1ZOMA 3AW0A 1FONA 2ZNKH 4FUIA 1O2WA 5DP9A 2VWNA 1Z71A 6ESTA 4OGYA 1H8ED 3E90B 4FUEA 1QBOA 2GD4B 2GT8A 1IQJA 1K1IA 5FXLA 3SU6A 1TBZH 5F53A 4YZUA 1AY6H 3M3VA 1GBFA 1GHBF 1VKYA 3SQHE 2TGTA 3KYGA 1O33A 4MDSA 3QDZB 4I31A 3DD2H 1PYTC 4BNRA 4IW4E 3E91A 1TB6H 1UHBA 1L4DA 1C2DA 2A31A 3GOVB 2OP9A 2VINA 3ZVAA 1OYQA 3RXDA 5LGOA 2TRMA 1BBRH 1S6LA 1QA7A 2UWOA 1DLEA 3R3GB 5J4QA 3ZZ7A 2OBOA 2ODYB 3E1XB 4ABJA 3ATLA 2Z7FE 1LVOA 1VJ9U 3MNCA 2AIPA 2A5AA 1TOCB 1Q31A 3FP7E 5BPEA 1GBDA 1C2IA 3RXLA 1GI8B 1F2SE 3B23B 1W11U 5AHGH 1BTPA 2PUQH 1NFYA 3UOUA 4ZHMU 3T2NA 5FPSA 1V2LT 4M7GA 1GJAB 1FX0B 1BJVA 3ZV8A 1BMMH 2RCEA 4ISNA 1Q2WA 4FU8A 2EI7A 2Z9JA 1UMAH 1DLKB 3GY3A 2BDHA 1TNJA 3UTUH 1O5FH 2J92A 2XBYA 3KGPA 2W7UA 4DGJA 5GNDA 1MQ5A 3QLPH 1HGTH 1AKSB 4BAKB 2YMSC 2Z9LA 4F4OC 3T62A 4AORA 2XBVA 1GI1A 4BXWA 5ABWA 4GVUA 1GJ9B 2V35A 1O2JA 1P2JA 3U8RH 3I78A 4CRCA 1NRQH 4IMQA 2XWAA 3RU4E 1ZRBA 2KFWA 2Q6FA 1SOZA 1HAYB 4JZDH 2SGDE 3RXMA 2ZU4A 1B7XB 1QJ1B 2BD2A 2YMSB 4Q7XA 2C90B 1T31A 1A1RA 3MFJA 3ZVEA 5KEDA 2XC4A 3E6PH 1BTUA 1F0SA 4CR9A 5FPTA 2BDBA 3M3SA 1C5SA 2GV6A 4NSYA 4M9FA 3LGTA 4WMDA 4AGJA 2BB4A 2C3SA 2FI5E 3P70B 5GDSH 4KKDA 2WZQA 7KMEH 1O39A 5E0GA 4WMEA 1SLUB 1O2MA 2BD5A 1THPB 1P8VC 2BOKA 4IN1A 4X1SU 2VWOA 1GHZA 3Q00A 4UFDH 2SGFE 1CQQA 3H7OA 3O8RA 1C4U2 1AZZA 1C5VA 1S0RA 2BXUH 1CA8B 1Q3XA 3HPTB 5AVDA 5H4IB 1QB1A 3B8JA 4JK6A 1T8NA 4KP0A 1A0JA 2L74A 3H5CB 2W3KA 1BZXE 3BF6H 3K65B 1FY8E 3BG8A 3RUOA 2ZDAH 4RSPA 2VVVA 3NKKA 1GHWH 1QHRB 4I32A 1SQAA 2EY4C 4XD7D 3VXFH 4LK4A 1ANEA 1K1MA 1QL8A 3MWIU 2TBSA 3PTNA 1Z6JH 5EXNA 3C1KA 4THNH 1UVUH 1A61H 3SNBA 3P92A 1Z8IB 1CBWB 4PROA 2JETB 3T26A 3PTBA 1VCPA 1OPHB 3RMOH 4X8VH 3LKWA 1AIXH 4X1NU 1U6QA 1V2KT 1VCWA 2FYQA 4B74A 5DN6D 3NWUA 1BA8B 5I25A 4P00A 1GBHA 1THSH 2OC7A 4D7FA 1FDPA 2ZDKA 2FLRH 2I6SA 5F8ZA 1SL3A 3PB1E 4K5ZA 1GJ5H 1SGTA 1F0RA 1NFXA 1Y3XA 2OC1A 1XKBC 1TGCA 3EDXB 2V7QD 1TONA 3GDVA 3H7TA 4ZAEA 1C5UA 1MTVA 5F8TA 1P05A 2Y81A 4X1RU 5IDKA 4R0IA 1NZQH 1HJ8A 2CMYA 1YBWA 2SGAA 1S6HA 4XE4A 1Y3UA 1L1JA 2BDAA 2VIPA 2Y7XA 1IQLA 4NIXA 5L2ZH 1CGHA 1SHYA 4MVNA 1ZTKA 4I33A 1C2LA 3TGKE 3EA9A 4YLQH 1HAVB 1DANH 3GCOA 2GTBA 1DX5M 4Y0YE 1AD8H 3Q3YA 4Y7AA 2ZU5A 1C1VH 2ZO3H 3W94A 3KQCA 2A0QB 2BX3A 2W5EA 4UD9H 1FPCH 2W7SA 4WJG2 1C5LH 1RTLA 4B1TA 4ZROA 1GMHG 2G81E 1GJ6A 3BTEE 1RIWB 4OS6A 2ZGBH 3ZVBA 1AVXA 5E2OA 9ESTA 1QZ8A 4X8UH 1QL9A 3I77A 2XTTB 1NFWA 1TGBA 2G5NA 4AFZA 4Y8XA 1MBMA 1WU1A 1K1JA 1FMGA 4NZLA 5L30H 5LH8A 3UWIA 1HAXB 3TLOA 3UR9A 2ZHWH 1AO5A 3QUMP 1KMHB 1MH0A 1PQ7A 2BYAX 2KCPA 1SFQB 3P8NA 1TNKA 1V3XA 2HNTE 4YESB 2G52A 1P9SA 4CRAA 3BTTE 3MO9A 1FAXA 1BMFD 3PWBA 5A8XA 3DSGA 3S7HB 4HGCA 2XBXA 2P59A 1TIOA 1EAUA 1LVBA 3SUDA 4WY3A 2BVXH 1C1NA 5FCRA 1LDTT 4WXVA 1WV7H 2F9UA 1SQTA 3GCTF 4OS7A 2ZPQA 3PV2A 4ABIA 1MQ6A 4BOHA 1TA2A 2GV7A 5JBAS 4B76A 1O3MA 1ZPCA 3SJ8A 2BDGA 1GBJA 4WH8A 2NU1E 3LDXH 1HDTH 1EFRD 1YP9A 2GMTC 4E05H 1GL1A 1GI4A 2BD4A 1HAOH 1QB6A 3F9HA 1XUHA 3U1JB 3SV9A 1BHXF 3VB5A 5A0CA 2OD3B 3RLYH 4Q7ZA 3U28C 3D49H 5HM2A 2HNTC 1O3LA 5ETXA 2LELA 2HPPH 4AGKA 3BTKE 1LO6A 3STIA 1O3OA 4ABDA 2WPHS 2D2DA 3SV8A 3RM2H 5C2ZA 2ANWA 2I6QA 1M9UA 3HGNA 1GBLA 2KAIA 2QXJA 3FN8A 5GJ4B 1V2QT 5FL7D 4MNYA 5T6FA 3MU0A 4KTSA 1JRTA 2ZHFH 1SGPE 1EJAA 1OXGA 2GCHG 1ZSLA 5DP4A 3SNAA 3VG8A 4X6OA 1C2KA 6GCHG 2OC0A 1SGNE 1MZDA 2HVXA 1DSTA 1E79D 3RMNH 1EAIA 4SGAE 2EEKA 1F0TA 4O97A 2J95A 2BLVA 7ESTE 5DP5A 4B75A 2KCYA 2WPKS 2ZHQH 1D3DB 2W6JD 1ELBA 2G55A 5DKMA
chains in the Genus database with same CATH topology
1GBIA 3LOXA 1JRSA 1XUGA 3KL6A 4X2VA 2ZDMA 3O8CA 3T28A 4I8HA 1W7XH 3GYLB 3QN7A 2FDAA 1E37B 4DURA 1D3QB 4CHAC 2PSYA 2AIQA 1F0UA 3A82A 3E0NB 1AUTC 1O36A 1Z7KA 1PPBH 1JBUH 4H6SB 1INCA 5TJXA 1HFDA 1NRRH 1RRKA 4FVDA 1UCYK 2G00A 2H9EH 2UUYA 4I8KA 4Z0KA 3LGYA 3P6ZB 1A4WH 4AG1A 4TWWA 2TIOA 3SU0A 7LPRA 9LPRA 4CHAB 5GCHG 2VWMA 4BTUB 3M37A 1CO7E 1HXFH 1TA6A 1C5PA 5EODA 2IJOB 1QNJA 1ELTA 1DICA 1WTHD 4XSKU 5FBEA 1E36B 1FPHH 2ZTYA 3RXPA 3T5FH 2ANKH 4OS5A 1SLXB 2HOBA 1DXPA 3VB7A 1IHSH 4E7RG 2LNCA 4X8SH 1MAXA 1RD3B 1D6RA 4O3UA 3A85A 3MH5A 3MH4A 3GY6A 3RXHA 1TWXB 1UCYH 3NZIA 2C4FH 5GPIB 1S81A 4TY6A 2RG3A 3IWMA 1C2HA 1P09A 4AFSA 1ZMNA 1TALA 3A83A 1UK3A 5K0HA 1BRBE 1P02A 2BXTH 4NWLA 5J4SA 2PSXA 1UVOA 4X6PA 1C2EA 4NIVA 5EQQA 5G4BA 2PTCE 1A3EH 1QRXA 4K1SA 2CF9H 5A0AE 1GBBA 1O3KA 3SHCH 1IQNA 2AMQA 2PGQB 4BAMB 4O9VA 2PHBA 4YT6H 1NROH 1YPEH 3ZV9A 1VITH 2D1JA 4YLUA 2GDEH 1GI3A 2GDDA 3OX7U 1C9TA 4XOJA 1MKXK 4YO9A 2O8UA 1AVWA 1BT7A 1TMBH 1VGCB 2Y7ZA 5C67A 5HGGA 1DM4B 3O8DA 3M5MA 1MBQA 1QL7A 1VITF 3TPIZ 2YNAA 2A7CA 5FX6A 5T6DA 3A88A 1W8BH 1O3PB 5ESBA 2FZZA 2FOAA 1GCTC 1SQOA 3RMMH 2FOEA 3ZVGA 3RLWH 3FFGA 4Y10E 3ODFA 4FUJA 1GVKB 4TWYA 1AB9B 1ZMLA 4VGCB 1KIGH 3TU7H 4JZEH 1NRPH 1JIMA 1FZZA 2BQ6B 4XDEA 1O2YA 1EP6A 1QIXB 2PKAA 1BQYA 1E34B 1MKXH 2J38A 1SGFG 2ZDNA 1GJDB 3S69A 3QGJA 3PMAB 4NA9H 3RC6A 2QGRA 3SI3H 1TRNA 1L1GA 2ZHEH 3RXFA 4YOIA 1E38B 1EXFA 1YM0A 3FZDA 1T32A 4UEHH 3FANA 3SJKA 3NXPA 5FPYA 2UUFB 3BEUA 1S82A 2H1UA 1FY5A 3U8OH 6CHAC 3LGWA 4Y8ZA 1G2LA 4KELA 2FTMA 2AEIH 3ZVDA 1CE5A 1WTGH 3B9FH 4YTAA 3RXBA 3A86A 1SVPA 2Z94A 2H5DA 5E0JA 1A0HB 2NU0E 3F1SB 3DHKH 1H8IH 1V2TT 1EASA 1P12E 1RS0A 3RU4T 1GMCG 1PQ8A 3TITA 1ZHRA 4FUHA 4X6NA 3VB4A 4AZ2B 4CBNA 8ESTE 3V7TA 1ZLRA 2OTVA 1MU8B 4QT8C 2Y6TA 1DPOA 4ESTE 4INLA 1T4UH 3GY2A 1XUJA 2SGEE 1UK4A 3BV9B 1NM6A 2QN5T 4HTCH 4GAWA 5CHAC 1ZZZA 3SO3A 1V2WT 1ESAA 4O03A 2F9VA 1IQGA 1BUIA 4OS1A 1TRYA 1WSSH 1GPZA 4AYVB 3SU5A 2ZFFH 4CRGA 2THFB 1WCZA 1ZTJA 1DXWA 1YPJH 1FN6A 3M35A 1MTSA 3MO6A 4GCHG 1G36A 3LONA 4K1EA 3KN2A 2ZDLA 5ESTE 2OINA 2V3HH 3ATKA 1YPKH 4U01A 1AVGH 4ABAA 1JMOH 1EOLA 1GBKA 1O2PA 3PMBB 1QY6A 3TVJB 2FESH 4RN6A 4I8LA 1BIOA 2NU3E 5FCKA 3U1IB 1AFEH 1QJ7B 1SGEE 3GDSA 4BANB 3LH1A 5LPEA 1ETTH 1W14U 2QXGA 3E16B 3KQDA 1AZ8A 4O3TA 2FTLE 1DUEA 1BTWA 2PKSC 2A5IA 5EW1H 4FUBA 5BRRE 3QTVH 1YPHE 5EXLA 1OWJA 1DOJA 3SZNA 1Z8GA 2R3YA 4NZQA 1QURH 3GCNA 1CHOF 3ENSB 1DWBH 3VEQB 4Q2KA 1O3EA 1P06A 2JH6D 3QTOH 2CGAA 1C5QA 1EZSC 1SMFE 3LGIA 1MZAA 3UREA 1E35B 2WPLS 4K69A 5L2YH 2PKSB 1C2FA 1Y5BT 4KTCA 1C4V2 1P10A 3BTFE 3AAUA 1X7AC 2TGPZ 1SG8B 3GDUA 5DP3A 3TNTA 3UR6A 1BRUP 1P2QA 2ZHDA 3BTDE 1UTNA 1C4Y2 2ALPA 2EI6A 2V6NA 2A5KA 3LPRA 2FIRH 2SNVA 1W0ZU 2ANMH 2J2UA 2GZ9A 3AASA 3TJUA 4WH6A 1ARCA 2R9PA 4NWKA 1HIAA 2AH4X 1O2NA 1MD7A 2AMDA 1S84A 3SUGA 1QFKH 2XWBI 1FY1A 2A45B 3V13A 4INHA 1NS3A 1OX1A 1YPHC 4X1QU 1SHHB 1NC6A 3PLBA 1W0YH 1KYNA 1LHDH 3PO1C 3P95A 2ZTXA 4CH8B 1GBMA 1KXAA 4JCNA 4X6MA 1V2UT 1ZJDA 2NU4E 2Z3DA 3ESTA 1B0EA 1GHXH 4ZKSU 1HJ9A 7GCHF 2XBWA 2CV3A 3BG4C 1TRMA 4D7GA 4ZHLU 5LPRA 2FMJA 1QTFA 2BZAA 1S85A 1K21H 5JB8S 3GYMA 1RXPA 1G37A 1EPTC 1TX6A 1GMDG 4X8TH 4R8TB 2ZECA 1E0FD 1RTKA 4Z6AH 2FS8A 1SPJA 4BAQB 1YKTA 2ZFQH 3DUXH 1W13U 2D8WA 2H9TH 3M3TA 4AB9A 4CH2B 2TGDA 1P01A 3A89A 3BG4B 5FX5A 3Q77A 4CRBA 4DY7B 1P03A 1LHCH 3RXAA 5EGMA 2Z3CA 3MTYA 3RXIA 5LPFA 1EPTB 1SGCA 1WYKA 3A7TA 3Q76A 1OOKB 2ZDVH 1PFXC 2VNTA 1WQVH 2OXSA 4ABEA 1N6XA 1UTQA 1TBRH 1LTOA 3MNBA 1DT2A 5CE1A 3A81A 1WUNH 1F5KU 2IN2A 4HI3A 4ABHA 3UOPA 1TFXA 1AU8A 1OWHA 4GSOA 1T8LA 3SUEA 2ZU2A 4GLYA 4TY7A 1ELGA 1TGNA 1GHAG 1SR5C 2SNWA 3G01A 2QCYA 1LKAA 2ZP0H 4KGAA 1EUFA 2XRCA 3M36A 1AWFH 2PLXA 8GCHG 3EAJA 3M5OA 1DUAA 2TGAA 1HAGE 4A5TS 1Z6EA 5JDUB 5A0BA 1C1PA 1ESTA 1DITH 1ZHPA 1ETSH 1XXDA 3OY5U 1AQ7A 1HPGA 3GICB 1FNIA 1C1QA 2STAE 3JZ1B 4TYDA 2ASUB 3D65E 5HMAA 1O3IA 3SGAE 4B2BA 1O2TA 2BY5X 5DP6A 4GPGA 1QB9A 4J1YA 4ZKNU 1KDQB 3BIUH 1Y59T 1ACBE 1IQMA 3AAVA 5EXMA 3Q3XA 1AKSA 4ISLA 1NPMA 1IQHA 1CHGA 3HKIB 3UPEA 3A7YA 1BMAA 3KQEA 1GDNA 1O31A 1N6YA 2A4OA 2VH0A 2ZGCA 4WVPE 1THRH 1EQ9A 2FOCA 4JK5A 4MPUA 3K2UA 3L6PA 1FI8A 3EE0B 1ABJH 1HBTH 3QWCH 5EW2H 1QA0A 3U9AH 2Y82A 3SGBE 4ZMAH 3URCA 4B73A 5GWZA 2O8LA 4U32A 1ZJKA 3LH3A 5B6OA 3RXUA 3SW2B 1UK2A 2ZPSA 3MMGA 1C9PA 2C93B 2XNIA 3BTHE 4X2XA 6LPRA 3TIUA 4FU9A 1SFIA 1FY4A 3VGCC 1TQ0B 1D3PB 3ATMA 4E7NA 1YGCH 3GY5A 2H6MA 2GZ7A 2B9LA 3BTQE 1L4ZA 2PUXB 1O5AB 1GVLA 5JYIA 4ISOA 1PJPA 1AGJA 4MG3A 5EG4A 2O8WA 3N7OA 1ELDE 1H9LB 1HAZB 2QC2A 1O2GH 3RP2A 1O3NA 1OWKA 1AI8H 1D6WA 1PQAA 1V2NT 4BXSA 1PPHE 2FP7B 1OP0A 3ZZAA 1UTKA 4AOQA 2FOBA 2A7HA 1MTNC 5FBIA 3ZZ5A 4MNWA 3MI4A 2O8MA 1DFPA 1RTFB 1XUKA 2VWLA 2TPIZ 4JZFH 1O2SA 8LPRA 1O2IA 2G51A 2XXLA 2WINI 3URDA 2QA9E 1J9CH 1K22H 3PLPA 1C2JA 2QAAA 4ABFA 3TJOA 2VH6A 2Z9KA 3U8TH 2P8OC 3RM0H 1GBTA 3TK9A 2BTCE 3PLKA 4F49A 1KTSB 2WPIS 3KHVA 3BSQA 1DVAH 1C1SA 3M61U 2GMTB 1K9OE 4AFQA 1GHBG 2ZGXH 4WWYA 3ZVFA 1ELFA 4XBDA 1AMHA 3BEIB 4ISHH 2SGQE 2Z3EA 2P8OB 1L1NA 3FP8E 1NY22 4Y7BA 1LHFH 2QF0A 3QO6A 5DJ7A 1IQEA 1KXCA 2ZC9H 1EOJA 1SGFA 2A2XH 1O38A 5K7RA 2BM2A 1QRWA 1HV7A 1ZSKA 3SV2H 2BOHB 1W12U 3MNSA 3MYWA 1EP5A 4H42U 1EB2A 2Q6GA 5DP7A 5C1UA 4FVBA 3WY8A 1UTLM 1RJXB 1UCYE 2PW8H 2CHAC 3M5NA 1KSNA 1O3HA 5PTPA 1ZTLA 1QQUA 1HAVA 1Z1JA 5E8EH 1LPKB 2G8TA 3CENA 2WPMS 1O3BA 3V3MA 1GBEA 4IMZA 5A8ZA 1BCUH 2XCFA 2H2ZA 2Y5HA 2BQ7B 1YLCA 3ELAH 1K1OA 1P2OA 2J9NA 1IOEA 3OU0A 2DE8A 1TYNA 1KXBA 2WUBA 2BY9X 2ESTE 4H6TA 1O2HA 1GI6A 1GWAA 2FI4E 2LPRA 2ZU1A 3TJVA 3MHWU 3E8LA 2EA3A 1TBQH 2AERH 5IYTA 5C1XA 1V2PT 4K8YA 4A6LA 4FUFA 5I46H 1YPLH 1O3CA 2WPJS 1NESE 3DT0H 4MPVA 5SGAE 4IBLH 1O2LA 4BTTB 2WYGA 2YOLA 1C5XB 4JYVH 5C5OA 3F9FA 1ZMJA 1CT4E 4X2YA 1D4PB 2O9QA 1OP2A 1UJ1A 4A92A 1KLIH 1Y3YA 2QIQA 1AE8H 4CR5A 4DIHH 1G3DA 3VB3A 3ZYDA 4BAHB 2BZ6H 3DFLA 3UQOA 4LXBH 5EQSA 1ZHMA 5C3NA 1GJCB 3SJIA 1RGQA 3ZZ8A 2GP9B 2B8OH 5T6GA 1HAPH 1C5RA 3LGUA 1IHTH 3D23A 3VB6A 5A2MH 1ZYOA 1UHBB 2R2WU 3TJNA 2A1DB 1EATA 3MU4A 2VJ1A 1CGIE 2P3FH 1C5WB 1P2KA 3TK5A 4OGXA 1SGQE 1B0FA 1YYY1 2FO9A 1ELCA 3SGQE 3U69H 1C5ZB 4BAOB 3K9XB 3RXKA 1SGIB 2XCNA 1EZQA 1TNLA 1W2KH 1GHAF 1YPMH 2WYJA 3UNQA 3HGPA 1SGYE 2ZF0H 1O3AA 3EGKH 1GDUA 4DCDA 1AFQC 1TPPA 4A1XA 2BY6X 1IAUA 1V6DA 1NRNH 5TCAA 2FI3E 1ZR0A 3R0FA 2FOGA 1LVMA 3A7ZA 1O3JA 5FAHA 4ZKRU 1O2QA 5FHTA 1HCGA 1MD8A 4YOGA 4DG4A 4D8NA 1OS8A 1D3TB 2GGVB 4FU7A 1TQ7B 1MCVA 4KTUA 1CVWH 2AMPA 3HK3B 1G3BA 1DY8A 1WBGB 1A5HA 3RC4A 2UUKB 3MO3A 4MTBA 2Y5FA 3CS7A 2UWLA 1SLVB 1HUTH 1GMHF 4K3JA 5DPAA 2VIOA 3GY8A 3A8DA 2QY0B 1EZXC 3P8OA 2VGCC 2VIWA 3A8AA 1V2JT 1BBRE 4CRFA 1HJAC 2ZEBA 3K6ZA 1ANCA 4IC6A 1GHVH 1A3BH 1CT0E 1GCTB 1KXDA 1TMTH 2ZGHA 3SHAH 4HZHA 1ESBA 1BMNH 2VGCB 2B0FA 4MQAA 1L2EA 1QJ6B 1HIAB 3DFJA 2OQ5A 1LMWB 1O2OA 1JWTA 3PMHB 3AVZA 1GBAA 1O2XA 4WXIA 1F5LA 1MAYA 1KXFA 1GGDC 2F9PA 2ZFTA 4ZKOU 4DVAU 2ZGJA 1ZPZA 4ZUHA 3A8BA 5DK1A 2UWPA 2CN0H 1MU6B 1IQKA 3MH7A 3SU1A 2O8TA 1DWEH 3FP6E 1PPCE 4D76A 1O3DA 5JB9S 2ZCKP 4B71A 6CHAB 2ZFPH 1PPGE 1TABE 3LU9B 3EYDA 4JZIA 1BTYA 2R3UA 1H4WA 1SLWB 1ZGVA 1DSUA 3FZZA 4NGAH 5EU8A 4FUGA 1IQIA 2VVCA 2G4UA 2Z9GA 3RXQA 2BLQA 1ETRH 3IITA 5A8YA 3FAOA 2HLCA 3OTJE 2IOTA 2ZU3A 1QBVH 5AF9H 2ZWLH 1GI7B 4ABGA 2WUCA 1S5SA 2PR3A 1N1LA 3ZVCA 1AN1E 2PTNA 1SGRE 2AGEX 2A32A 1TX8A 4NG9H 1Y5AT 1BJUA 1EZUC 3AW1A 5CHAB 1QGFA 3F9EA 4MLFB 1GL0E 4WMFA 3SNDA 5DO4H 1WAYB 2P95A 1RFNA 1GHYH 1GJ7B 2J34A 4K2YA 5T3HA 3GCTG 1C5OH 1O2UA 1J8AA 2HGTH 1Y3VA 3SORA 1GVZA 1TPSA 2J4IA 4INKA 2GCHF 2SFAA 3UQVA 8KME2 3S7KB 1OWDA 2P94A 2A4RA 4WF8A 1KTTB 1TOMH 6GCHF 5HM9A 1TPOA 3UNRA 1SI5H 3PV4A 3UWJH 4MPWA 1SC8U 2C8WB 1AUJA 3EA7A 1Z8JB 1VJAU 3MOCA 1BRCE 1S0QA 3A7XA 1O37A 2QXIA 2OUAA 3M7TA 1TNGA 3SU2A 1GCDA 2NWNA 3F68H 1O34A 1KLJH 3KQBA 1HXEH 1MCTA 2F9BH 1GDQA 1GI9B 2K1QA 1T8MA 1HB0B 2BD3A 3SI4H 1CGJE 1Z1IA 3QX5H 5AFYH 2GCTC 1FXYA 1HYLA 3GY7A 1J14A 3RXJA 3STJA 2ZQ1A 3SNCA 2P3UB 4FUDA 1V2ST 3TGJE 2A2QH 3PM