2BZAA

Bovine pancreas beta-trypsin in complex with benzylamine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title Non-Boltzmann thermodynamic integration (NBTI) for macromolecular systems: relative free energy of binding of trypsin to benzamidine and benzylamine.
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bzaA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bzaA02
1ZTLA 1G2MA 2F9VA 2Z9IA 4Q7YA 1GG6C 4UFGH 4X1PU 3S7HB 1NY22 2HVXA 1P2OA 1GI5A 2SGQE 1ZHPA 4KTUA 2ZI2H 3GY7A 2ZG0H 5DP5A 1O3DA 1V2MT 3UWJH 1GI7B 1HGTH 1BTPA 2VU8E 4K5ZA 1S81A 2B0FA 3ZVCA 1N6XA 2GGVB 2FOGA 1GVKB 1O5AB 1O35A 5TCCA 1AD8H 3K6ZA 5AHGH 1WYKA 2ZFQH 3ATWA 3KQBA 5FX6A 1PYTC 2G5NA 4NZQA 1TFXA 3BTFE 1C1WH 4RSPA 4X6NA 2Z3CA 1DWDH 2ZGHA 1C1OA 3TNTA 1Q3XA 2H5DA 1L0ZA 2D26C 1PPBH 5L6NH 3M3VA 1DWBH 1MZDA 4R8TB 1S5SA 2P3UB 3S69A 5ESTE 1O3FA 1BIOA 2ZDMA 4FUDA 3BTKE 1O34A 1T4UH 2P59A 3A8AA 5LH8A 1MKXH 2QIQA 1C1SA 4FUJA 1HAIH 5IDKA 6GCHG 3OY6U 5EPNA 3KQEA 4NWKA 1C1VH 4FXGH 4INLA 1P2NA 4AFQA 4KGAA 1F5RA 1OWKA 1L2EA 5FPSA 4K8BA 3SUGA 2C93B 1QL7A 3M7TA 1DWEH 2ZHWH 3ATKA 1TNKA 3MU1A 1W7XH 2GZ8A 1P01A 2EA3A 1GJ5H 2PSXA 1MAXA 1F92A 4B73A 1B5GH 3VGCC 1QJ6B 3BEFB 1O3CA 3LGYA 3DHKH 1YPGH 3SJIA 1O5DH 1QA7A 2ZU4A 2ESTE 4I8KA 1P03A 2H9HA 1C1MA 4J2YB 4ZKNU 3U8RH 2QXJA 1B7XB 1FPCH 3IITA 1O2NA 1SGFA 1C5TA 1S6HA 2FLRH 3P92A 4B1TA 4NA9H 1TOCB 1D4PB 5DP6A 1BTZA 1UK3A 1MQ5A 2HNTF 1E0FD 2ZFRH 4ABFA 2QF3A 3PTNA 4E05H 3BTQE 2J2UA 3UWIA 1J8AA 2FP7B 5JBBS 2OINA 1Y5UT 1FQ3A 2A7HA 3RXVA 1G3CA 3RXBA 2TGAA 1QURH 3QO6A 4OS5A 4WVPE 4ZXYH 1CA0C 5EXMA 3F9GA 2VGCC 2XC5A 3GOVB 4K1TA 4YOIA 3T2NA 1P0SH 2AH4X 1BMMH 2JETB 3UFAA 3GY3A 1DICA 5DG6A 3E1XB 1D6WA 4WMEA 3FVFB 4MNVA 5EXNA 1GBBA 4GHQA 1RTFB 1PYTD 2HPPH 3RXFA 4JZDH 1S84A 1V6DA 2ZHFH 1UVPA 2ZF0H 3HK6B 3SNEA 3SJKA 1HJ9A 3BTME 1QRZA 1A0LA 3T26A 4HFPB 2GDEH 2CGAA 2BOKA 5LGOA 1O3LA 3BF6H 4ZHLU 3O8RA 2ZKSA 3SNCA 1WSSH 1W10U 3ATIA 1D3PB 1ESBA 3AW0A 2BLOA 4JZEH 5EG4A 3SU2A 5GPIB 1AHTH 3E16B 2BDYA 3P6ZB 3QWCH 1GMHF 4YLQH 4IS5A 1HNEE 2BDGA 3RXCA 3ZZBA 1FIWA 2G51A 1P57B 3HKJB 2Y5FA 1T4VH 4U30A 2OUAA 1O2RA 1HJAC 4GAWA 1V2UT 1QHRB 5I25A 1O5EH 2F9PA 1EJMA 2P16A 1GBLA 1TNGA 1BTWA 3UR6A 5DO4H 1ZZZA 4TPIZ 4XE4A 2FS9A 1GPZA 5FPTA 3L3TA 2ZDLA 3GCOA 1O2SA 1O3OA 3HKIB 2BX4A 2FLBH 1TX8A 2OD3B 1HB0B 2HNTE 3VB7A 4KKDA 1P2IA 1ELDE 4A1XA 2PWXA 1ZJDA 3AAUA 4SGAE 1WU1A 3O8DA 1UCYE 3DFLA 3ZYDA 2FESH 4O97A 1ACBE 1L1GA 5CHAC 4WF8A 1JWTA 1MZAA 2TPIZ 2W5EA 1A0HB 1G3EA 2ZO3H 4IC5A 1SGRE 1C5YB 1W11U 2HPQH 1A5IA 1H9HE 1UTPA 2HALA 4WJG2 1YPKH 2OBQA 5E8EH 4AFZA 3KNXA 1AY6H 1N8OC 1YPMH 6ESTA 1PQ8A 1WCZA 3TK6A 1SLVB 1GI8B 1SR5C 1NTPA 2A31A 2ZFTA 4YTAA 1YPHE 5FBEA 1TB6H 2WYGA 4MVNA 4U2WA 4GPGA 9ESTA 4OGXA 1D3TB 1ARCA 1YC0A 3FAOA 5GCHF 1EPTA 2OC7A 4X2YA 4D8NA 2G5VA 1W0YH 3BTGE 4JZ1A 1C2EA 4O3UA 2R9PA 3KEEA 5E0JA 5A2MH 3SNDA 1SQOA 2ZDVH 1N6YA 1CT2E 5DJ7A 1CT4E 4E06H 1F5KU 1F7ZA 3MU0A 4ISNA 4BTTB 3LJOA 1K1OA 5BPEA 1SVPA 1V3XA 2ZHQH 5EU8A 4IN1A 3SV8A 4DJZB 2A2XH 3OY5U 5JPMH 1SQAA 1MU6B 2UWPA 1YPJH 1RIWB 4YT6H 2GX4A 5JBAS 2Z6BD 3SZNA 1OP2A 2A5IA 1EPTB 3UOPA 2A4GA 4FVBA 5L30H 3E91A 2SNVA 3RXSA 1Z8JB 3PLPA 4ZXXH 1C4V2 1UTQA 1FXYA 1F0SA 2AYWA 2W3IA 3UY9A 4B2CA 3UNQA 2GVFA 1EASA 1HV7A 1KXEA 2PV9B 2B7DH 2QXIA 3GCHC 1VZQH 3FFGA 4ABGA 1LDTT 2VIVA 1NRSH 5JYIA 1W3CA 1C2KA 2FODA 3A82A 1Z1JA 1GHWH 4OS6A 4QT8C 3PM3A 2BD4A 3MYWA 3SU0A 1O2ZA 1NS3A 3I29A 3A80A 3RXIA 1O2GH 2Z7FE 1SC8U 3EA9A 1GBAA 1K1IA 1BOQA 1A4WH 1LVBA 4Y8ZA 1DE7H 1K1MA 3EQ0H 2ULLA 2VIDA 3E0NB 4KP0A 4K1SA 2RG3A 1T7CA 4AB9A 1UHBA 1CSOE 2BTCE 4H6TA 3PYHA 3JZ2B 4ZAEA 3A86A 1A2CH 2RA3A 4HTCH 1EB1H 1WOFA 1PPHE 1P8VC 2PFEA 3P8FA 5TJXA 5DP7A 2CHAB 1ZGIA 3ZVGA 4A1VA 1FV9A 1TRMA 1C5ZB 3BG4B 1TRNA 1NROH 3DFJA 3TU7H 1FNIA 1WQSA 2PUXB 4HGCA 4H6SB 2J38A 2ZGXH 3UREA 2XBXA 3F68H 4KTCA 5A8YA 5HM9A 1GCTB 1QB9A 1JIRA 1THRH 1GMHG 2VWLA 3SUFA 3M35A 1P05A 2GCTC 1BZXE 3GCTF 1UHBB 4E7NA 1ELGA 3VB4A 2WUCA 1F0UA 1Y59T 1W8BH 2BM2A 1OP0A 2C4FH 1ANCA 4UFEH 4DW2U 1XXDA 4KTSA 1LPGB 3Q3XA 1BHXB 3FP8E 1NRPH 1YLCA 4GLYA 2FI5E 1TALA 1C1NA 5GDSH 3SJ8A 2SGAA 3PLBA 4FUHA 5DP8A 3T28A 2G8TA 4X6OA 3RM0H 2RDLA 1EAXA 4ABDA 2EI6A 1ANEA 2AGIX 1XUIA 3L6PA 1J9CH 3F1SB 4F4OC 3G01A 1TRYA 1V2NT 1RS0A 2R2MB 3RU4D 1RTLA 1LQEA 1DXPA 4MPVA 1A1RA 1TABE 1O2PA 2V6NA 4A92A 3ZVAA 5HXFA 4CRBA 1DLKB 3ZZ6A 3PWBA 2DE9A 3EE0B 1AQ7A 5FX5A 1T8OA 1O2IA 2QAAA 1H8IH 3BTHE 3OYPA 1ZMLA 2GP9B 1IQLA 3UNRA 2GDDA 2BDIA 4NSVA 4JYUH 1H1BA 1SOTA 2H9EH 1A5GH 1C1PA 1V2TT 2FYRA 4FUCA 1KXFA 5E0GA 3KQCA 5GCHG 8LPRA 4NG9H 1ZHMA 3SGBE 2CF9H 3RXJA 4RN6A 2ZIQH 4ABBA 1UCYH 3A7ZA 3F9EA 1XUKA 5G4BA 3V3MA 3ZV9A 3U69H 4DCDA 3U1JB 1CT0E 4PROA 1LO6A 1WAYB 1DY9A 2C8YB 4K3JA 1KXBA 1TGCA 3LJJA 4CHAC 4IMQA 6CHAC 3STIA 1BBRE 2THFB 1NU7B 1V2LT 2F9UA 1YPLH 2R0KA 3DD2H 3GY4A 3MH4A 3F9FA 3PWCA 3MU5A 1EQ9A 5A0AE 2C8XB 3Q3KA 3SHCH 4Q7ZA 3LGIA 4DVAU 2PKSB 2AERH 3ZVDA 1UTJA 1IQJA 2D2DA 4BXWA 4Y79A 1JOUB 3TGIE 1Z1IA 1P04A 2FYQA 3O8BA 4NCYA 1C2HA 5FHTA 1SSXA 1MQ6A 3RXTA 3URCA 1V2WT 1NRNH 2IJOB 3ZVBA 1K2I1 2BD3A 4YM9A 1PQAA 2UWOA 1AUTC 4D9QA 2Z9JA 3NKKA 1UTOA 1FPHH 3H7OA 1P02A 1U6QA 1TNLA 2FOEA 1BUIA 5JB9S 2QN5T 3LU9B 1DDJA 2BVXH 4GVUA 4MQAA 1IQMA 1TYNA 3A8CA 1AN1E 1OS8A 2V35A 4AGJA 7GCHF 1SFQB 3FANA 1VJAU 2ANKH 1GCDA 4X1SU 1KIGH 1K1LA 4CBNA 1SGPE 3LGTA 2B8OH 1DLEA 1TPPA 2BD7A 4BANB 1CHGA 1AUJA 3T25A 4BTUB 1C2DA 2WINI 1ZGVA 2NU3E 2QF0A 4AB8A 5HYOA 3W94A 1CGJE 2WPJS 1BJUA 3HGNA 4UDWH 1P06A 2TGDA 4K69A 4TY6A 5AF9H 1CHOF 3KIDU 4DY7B 1ZSKA 1EB2A 1ABIH 2A0QB 4ISOA 2R2WU 1TNIA 2GMTC 1GL0E 3R3GB 1O2YA 4SGBE 2Y5HA 1G37A 4Y8YA 2ZGBH 3W95A 3M5NA 1G30B 2ZU2A 4O03A 1LKAA 4CBOA 2W26A 3TLOA 4X1NU 3CENA 3TVJB 2UUJB 3EA8A 3GCTG 1LKBA 1P2MA 1CU1A 4ZHAA 2BXTH 1O32A 1RD3B 2R3UA 1QIXB 1A7SA 1MKWH 2QGRA 2FOMB 4K1EA 5A0BA 3FZDA 1QBVH 1AU8A 1FAKH 1CBWC 1QQ4A 1OWEA 2BB4A 1OWJA 5EGMA 1ARBA 1SBWA 3ZZ5A 1O2XA 1TLDA 4TWWA 1A3BH 1IQGA 5SGAE 3ODDA 1YCPK 1TQ0B 3D49H 1ELTA 2J95A 5EXLA 3QTVH 3H7TA 2STBE 1W7GH 4I7YH 3UR9A 3BTDE 1GHBF 2XC4A 1SMFE 3E0PB 2BQWB 7LPRA 1Z8GA 2OTVA 1GBMA 2G00A 1V2PT 3R0FA 3V12A 1HAYB 3OU0A 4O9VA 1H8DH 2J4IA 3QN7A 1C4Y2 3F9HA 2GKVE 5EPYA 2PHBA 1XXFA 3AW1A 3TJOA 1QY6A 1TIOA 3MI4A 1J14A 2BX3A 3E3TA 1SGIB 3I78A 1C5QA 1SGNE 2ZQ2A 4HZHA 4THNH 3S7KB 2ZU5A 2V3HH 1XVMA 2BLQA 2A4OA 2TRMA 3BEUA 2XW9A 2NU1E 4U32A 1C1UH 4UONA 2AFQB 1WTGH 1S83A 4ZHMU 1BTUA 8GCHF 4Y76A 1O3MA 5FBIA 3P8GA 1Y5BT 1KSNA 4IBLH 2FZZA 9LPRA 2ZFPH 4TWYA 4D7FA 1A46H 2GD4B 1QRWA 1ETSH 1NRRH 1DX5M 1GBDA 3MO3A 4WWYA 4A1TA 4Y11E 2QA9E 2FPZA 1AB9C 2ALVA 4ZROA 1TGBA 1FY1A 1GDQA 4Y7BA 1P2KA 4Y6DA 4AG1A 3O8CA 2VGCB 3RM2H 2WUBA 4ISLA 2TBSA 3Q77A 5HGGA 4AFUA 1PPCE 1N1LA 1FN8A 2XTTB 1HBTH 1GJAB 1K1NA 2XCNA 1RGQA 1QL9A 3RMOH 4CRCA 1OP8A 1ZPBA 3T29A 3EDXB 3M3TA 1O2VA 3SUEA 3ZVFA 5ABWA 3LDXH 1Q2WA 1HXFH 1LPKB 1NFXA 1ZOMA 1IQFA 4Y0ZE 3T5FH 3M5MA 3U8TH 2PLXA 2AS9A 3UUZA 4BOHA 3T27A 1FY5A 4CRGA 5F6MA 3PMHB 4JK5A 4X1QU 1ABJH 2SFAA 2P8OB 1SHHB 3NZIA 2UUFB 1HJAB 2FEQH 3KL6A 3MHWU 1MTVA 4CRAA 1O2HA 1UMAH 2C8ZB 2FOAA 1BBRH 4YZUA 3MNSA 7GCHG 1UVTH 2Y6TA 3LGWA 3SNAA 3RUOA 1TA6A 1HIAA 1BRAA 3PMJA 4K60A 5ETXA 1GI6A 4JYTA 3P70B 1SI5H 4JCNA 2YOLA 1GBCA 3TITA 4INKA 4IGDA 2JETC 5LPRA 1KDQA 3RMMH 3VFEA 3TJUA 3MH5A 1OYTH 4UD9H 5T3HA 4Z6AH 4MNXA 2QCYA 1E37B 1BITA 1AI8H 2BQ6B 3U98H 1O2LA 3RXEA 1BB0B 1EKBB 3UOUA 1ELCA 1C1QA 3HPTB 4X0WU 4I32A 3WY8A 1CHOG 1UTLM 3TGJE 3NPSA 1E36B 1O3GA 2VWMA 1FY8E 2KAIA 3ENSB 3Q76A 4TYDA 4LZ1H 1Z71A 1GJDB 1N8OB 3ELAH 1HIAB 1VGCC 2Y7XA 2ZDAH 1XX9A 2BD8A 3C1KA 4NA7A 4MDSA 1UCYK 2CJIA 2W7SA 3ZZAA 5CE1A 2BD5A 4X8SH 4UEHH 3SN8A 1LVMA 2FOBA 1KDQB 2CF8H 2PW8H 4ABAA 2JH0D 2STAE 4NFFA 1O37A 4GUXA 1GMDF 2F83A 2VH6A 4JK6A 1L1NA 5GIBA 1ZHRA 1KXCA 1OOKB 5K7RA 2FTMA 1EUFA 1NN6A 3QGJA 2KAIB 3KHVA 4IW4E 1VITF 3CS0A 2FM2A 3OSYA 1ZRBA 3BSQA 1V2VT 1VJ9U 2G4TA 2PTNA 1AFQB 5A8XA 4K8YA 1GHBG 1C5NH 4LZ4B 2XBVA 1O36A 1BRCE 3NXPA 2FMJA 3E90B 4DG4A 2Q1JA 1ZPCA 2HWLB 4D7GA 2XBYA 3SU6A 4BAHB 1DSTA 1LVOA 1EX3A 4Q2KA 3SORA 5JDUB 5EOKA 1Y3UA 1SOZA 2BY8X 4GSOA 1SQTA 5FCRA 1A61H 3Q3YA 1GBKA 4RKJB 2UWLA 3QK1A 1GVZA 3RMNH 1SG8B 1AE8H 2XWBI 1QR3E 1YCPH 1O38A 1ZSJA 4FU9A 1A5HA 1MBMA 8GCHG 2FI4E 3GCHB 4ZH8A 1C2IA 1GGDB 1KY9A 5E2OA 2G55A 4LXBH 1GI9B 1ZMNA 2Z9KA 2B9LA 3TIUA 1H9LB 1HDTH 4R0IA 4ABJA 1C2JA 3SU1A 1ZLRA 4FVDA 5BRRE 3DA9B 1CO7E 3QTOH 3GY6A 1EP5A 2GZ9A 4OGYA 1BMNH 3UNSA 3PTBA 4ZMAH 1QBOA 2P3FH 2G4UA 2AIQA 2GZ7A 1GHZA 2SGDE 4XBDA 3KF2A 2F9NA 4DT7B 3RC6A 1FDPA 1QBNA 5C5NA 2A4QA 1O3IA 2SGFE 2HRVA 1AIXH 1XUFA 2IOTA 5L2ZH 3QZRA 3A8DA 1XUGA 1SFIA 1TNHA 4NZLA 3BIVH 1EJAA 3LC3A 5C1YA 4JMYA 1MKWK 1ZRKA 1HAPH 2XBWA 1FI8A 2A5AA 2EI8A 2W7UA 3RDZA 1KXAA 1O2JA 2ZCHP 2W3KA 1E38B 2M5TA 3Q00A 1O5FH 2VIPA 1CGIE 2PTCE 2YNAA 1OWIA 1PQ5A 3A7VA 1DPOA 3V7TA 2XCFA 1MD8A 1PPGE 4Q7XA 1AZZA 2OCVB 4ABHA 2WPKS 2O8LA 3NK8A 3TJVA 2BOHB 5DPAA 2PSYA 2XC0A 5AVDA 5AFZH 3S9BA 1FY3A 1TMBH 4ZKRU 2VVVA 1QJ1B 2PUQH 2ZHEH 3EYDA 3LONA 2ZP0H 1P3EA 3PMBB 3SI4H 1V2OT 1XUHA 2GT8A 1UK4A 2FX6A 3SHAH 1QCPA 4A5TS 2WPIS 1EAIA 2HGTH 1AMHA 1SGQE 2CN0H 4GCHF 3RC4A 1F2SE 4BXSA 3P95A 4ZUHA 1Y8TA 1OSSA 1L1JA 2ZGJA 2VIOA 1RTKA 4H4FA 2TGPZ 4FUFA 4YLUA 5FXLA 3TK9A 4CR9A 2J9NA 1PPFE 3MOCA 2CHAC 1GHXH 3RLYH 2P95A 3M7QA 1PPEE 2JH6D 4AGKA 1SPJA 1BRUP 3N7OA 5EODA 2FWWA 2BD9A 1ID5H 1PFXC 3H5CB 3A7WA 2SGEE 6LPRA 3QDZB 1VR1H 1MH0A 3TH3H 1ZPZA 3M7UA 1P9SA 1TGTA 1IQNA 4MPXA 1FAXA 3DUXH 4BAQB 3BV9B 4MPUA 1ANBA 4BAKB 1Z7KA 2OC1A 1GMDG 1Z6JH 2F91A 4B75A 4YOJA 1TX7A 1Q31A 4MNWA 4TPYA 1BRBE 4H42U 1L4DA 1Z8RA 1GJBB 2BVRH 1J17T 2SNWA 4CRDA 1DFPA 4D76A 1GVLA 2FIRH 2Q6GA 5DP9A 3HK3B 3SV6A 1W13U 2JKHA 3RXOA 4CHAB 2ZDKA 1LHEH 5J4SA 1K9OE 4AG2A 1VITG 5I46H 1LCYA 3QZQA 1TBQH 1JMOH 1HCGA 1Z6EA 1V2RT 5C2ZA 4ZKOU 1BA8B 4ABIA 1EP6A 4Z0KA 2XXLA 5JBTA 8KME2 1AWFH 5E2PA 2OQUA 3RXLA 1D3DB 4XOJA 1TOMH 1SLXB 1THSH 4VGCC 1YGCH 3EGKH 3S9AA 3TJNA 2Z9GA 5A09A 1BBRK 4BNRA 4MTBA 1BJVA 1O5BB 4FUGA 2ZEBA 1EZQA 2WPHS 1DANH 2O8TA 3VXEH 2OC8A 1BTYA 3MH7A 4UFFH 3NCLA 1M9UA 1GMCF 1JBUH 4LOYH 1ZTKA 1RFNA 3ESTA 1DITH 1AVGH 3D23A 2Z94A 2WV4A 2FTLE 1SLUB 2AMDA 1C9TA 4CR5A 3PO1C 1INCA 5B6OA 1S82A 1O3HA 3TGKE 1HUTH 4BTIB 4Q80A 4ABEA 3ZZ3A 1W2KH 1E35B 5F03A 2WYJA 4XBBA 1MU8B 1UVOA 1A0JA 2ZPSA 1FONA 3P8OA 1NO9H 4WMFA 3UQVA 1O3KA 4I8JA 1ESAA 3SQHE 2NU2E 1ETRH 4I33A 5EQQA 1NFWA 4CRFA 2H1UA 2ZFSA 2VB0A 2R0LA 1V2KT 1KTTB 1MTNB 4WY3A 4XFQA 1TMUH 2LPRA 4ASHA 1JRSA 2PKSC 3GDSA 1NFYA 1C2MA 1Y3VA 1IQKA 1UTNA 5LPEA 1JRTA 2ODQA 3LIWA 2ZHDA 1Z8IB 2AMPA 1GHYH 2LNCA 1IQHA 3NUMA 3CP7A 3IWMA 4XBCA 2V3OH 4DURA 3STJA 3OTJE 1LQDB 3RXGA 1EZSC 1CE5A 1TPSA 1OKXA 1G36A 2A5KA 2JH5D 1T31A 4X8VH 1D3QB 1HAXB 2BDCA 1GBEA 7ESTE 1XVOA 1KLJH 2BYAX 3SW2B 1GG6B 1CA8B 4TY7A 2PGQB 1O0DH 1S0QA 1G2LA 1G32B 3MO9A 1GHVH 2O8WA 1ZR0A 4ESTE 1XM1A 1V2JT 2WPLS 1UTMA 2BD2A 2BQ7B 1BMLA 3IG6B 1RXPA 1W12U 1CBWB 1B0FA 2ZGCA 2OP9A 3SQEE 1VITH 5L2YH 4AFSA 3OX7U 5CMXH 1FJSA 2G52A 1C2FA 4AORA 4Y71A 2ZU3A 2HNTC 1BQYA 3ZZ8A 2UUKB 5DK1A 1QL8A 2VWOA 2FDAA 1T8MA 3GDUA 1ZJKA 4GCHG 5GWZA 1O2QA 1K21H 3GICB 3AVZA 5JBCS 4Y8XA 3M36A 1C5OH 1SGDE 3I77A 2BMGB 1HJ8A 4F49A 1GHAF 4M7GA 3SBKA 4J1YA 1Y3XA 2FOHA 1C5RA 1TNJA 2VVCA 3ITIA 1YP9A 5AFYH 1V2ST 1HFDA 5ESBA 2BVSH 5DKMA 5FAHA 1H9IE 1J16A 1XUJA 1NM6A 2FOFA 1C5UA 1YPHC 1HAVA 2OBOA 2XYAA 5A0CA 1TA2A 4FUIA 1T8LA 4WXVA 4FUBA 1SLWB 3S0NA 3C27B 1QQUA 3GY5A 1DOJA 1O2KA 4YT7H 1GBFA 5EW2H 3U9AH 3VGCB 1AGJA 1YYY1 3V0XA 4RKOB 3TH2H 2CXVA 3AAVA 1KTSB 1G3DA 1KLIH 1AB9B 3M61U 3VB5A 1TMTH 3RXPA 1P12E 2VH0A 1DM4B 2QXGA 3KQDA 1SGEE 5K0HA 1BDAA 5GJ4B 5TCAA 3UTUH 4NWLA 3LH3A 5C5OA 2F3CE 4MLFB 4X1RU 1K28D 4AZ2B 1GJ7B 1EOLA 3QUMP 4IN2A 1YLDA 2XWAA 1HAVB 2A32A 1DT2A 1F5LA 1TWXB 3GISB 4UFDH 3SI3H 1DWCH 2BY5X 1GDNA 5T6DA 2BY6X 4OS7A 4GHTA 2VVUA 1P10A 2GCHF 3M5LA 4AOQA 1CA0B 2A2QH 3QLPH 1UO6A 3M37A 3AASA 1IQEA 3HGPA 1O3NA 2ZECA 3ZZCA 1ELFA 1IQIA 1CQQA 1ETTH 4WH8A 1EXFA 1SHYA 2A1DB 4X2VA 2QYIA 5C20A 3GYMA 4MPWA 1YPEH 2C90B 2PGBB 1O30A 1GMCG 2QXHA 4OS1A 3UPEA 3TK5A 1FMGA 3GCNA 3A7YA 2C8WB 1ELVA 4B76A 4NIVA 2OC0A 3VXFH 1OX1A 1NESE 3ZZ7A 4JZFH 3U1IB 3JZ1B 1BMAA 2BY7X 1C1TA 3GY8A 1YBWA 1FIZA 2ALPA 2J34A 1GI2A 4X2WA 3B9FH 5DP4A 4NIWA 3FZZA 4X8UH 3E8LA 4OS2A 1NT1A 5F8TA 3ZYEA 2VIWA 4I8HA 3P17H 2PR3A 1AVXA 2ZFFH 3U8OH 2ZTZA 3KGPA 2NU0E 4NIYA 4WXIA 1TGNA 3SOSA 1LHCH 2ILNA 2V0BA 3SV2H 1K1PA 5LPFA 1GWAA 5EQSA 3FP6E 2IPHA 1TAWA 1UK2A 1DXWA 2BDHA 2PKAA 3EA7A 1MD7A 2GV7A 2VWNA 3E6PH 4LK4A 1VGCB 4BAMB 4WMDA 1FZZA 2XRCA 4B2BA 1UVUH 2P8OC 5CHAB 1HXEH 1O39A 3EAJA 5J4QA 2FOCA 1LHDH 2Y80A 3RXKA 3B8JA 3BTWE 3M3SA 3GDVA 2TGTA 1GDUA 2ZCLP 2ZWLH 2ZCKP 2AEIH 1G3BA 3MNBA 1SGYE 3K9XB 1OWDA 1ZSLA 2FI3E 3B23B 3VB6A 2ZDNA 1WQVH 4K2YA 1THPB 2PKAB 1C2LA 1C5SA 1OPHB 3QX5H 5FCKA 3ZZDA 1O5GH 1MTUA 4FU8A 4YO9A 2RA0A 1GJ8B 3SU5A 1EAWA 1HAHH 5GXPA 2D8WA 4OS4A 1O2TA 1PQ7A 4AX9H 7KMEH 1W0ZU 2UUYA 1QB1A 3BTTE 1C5XB 4UE7H 3RXMA 3SU4A 4YOGA 1HAZB 3A88A 2A45B 5C67A 1O3JA 3SV9A 1LHGH 3MNXA 1GHAG 1ELBA 1K1JA 5EW1H 4AN7A 1GI4A 2ODPA 5C1UA 3BIUH 3SO3A 1EAUA 4X2XA 1P3CA 4B74A 3K6YA 2OQ5A 2ZC9H 3A8BA 1LVYA 4O3TA 1F0RA 1P11E 1GI1A 2ZNKH 1O5CB 1ESTA 4DIIH 1GBIA 1IOEA 1BTXA 1C5LH 1C5MD 1IAUA 1C2GA 3A87A 2K1QA 2ZU1A 4NA8A 2DE8A 1TPAE 4XSKU 1QTFA 1K22H 1MBQA 1VCQA 2GT7A 5C1XA 1EJNA 1EATA 1AFQC 2H9TH 5F8XA 1OWHA 3TPIZ 3A81A 5JB8S 3PV4A 3ODFA 4DIHH 1LTOA 2Q6DA 4I8GA 2AGEX 1HAOH 3D65E 4CH2B 1BT7A 2ZQ1A 1E34B 2OXSA 2F9BH 1Y5AT 1OYQA 2ZPQA 3UQOA 4Y7AA 2AGGX 2EI7A 3UIRA 3RXHA 2VIQA 5EQRA 1V2QT 1TX6A 2BDBA 2NU4E 1YM0A 3HATH 2GCHG 2I6QA 1ANDA 1YF4A 1C5WB 1TQ7B 2VJ1A 4DOQA 2DUCA 3MMGA 1ELAA 2G81E 1GJ6A 1H4WA 1O3AA 2J92A 1UJ1A 1GBJA 1AWHB 1UTKA 1GJ4H 3RU4T 1LHFH 1RIWC 1Y3WA 1P2QA 1EPTC 1WV7H 5HM2A 1O31A 2XNIA 3LKWA 2A7CA 1QGFA 1HYLA 1W14U 2Y81A 1QFKH 1GGDC 2AIPA 3ATLA 1C4U2 1LMWB 1DY8A 1XKBC 2ASUB 4BAOB 1D6RA 1TBRH 3RXQA 2C3SA 3A89A 1TGSZ 3RXAA 1FLEE 4A6LA 1MUEB 3LT3A 1DUAA 2VINA 2FX4A 1P2JA 1WBGB 1DS2E 1O3BA 1JXPA 2GCTB 2CV3A 2ZPRA 4B2AA 4YESB 1FUJA 3RXUA 2J94A 1O2WA 3KCGH 3A84A 1O2UA 3MNCA 4ISIH 3VPKA 3ZVEA 3TH4H 2R3YA 1SL3A 2AMQA 5H4IB 3NWUA 1S85A 3TNSA 1O33A 3GY2A 3DT0H 2ZZUH 4I31A 2Z3EA 2BLWA 1MAYA 1ELEE 1NC6A 1CVWH 2TIOA 2P3TB 3QGNB 1RRKA 1SB1H 5IYTA 2IN2A 2B5TB 1S0RA 3ZZ4A 2ZTXA 4AYVB 3L33A 1FN6A 1QRXA 3RC5A 2BZAA 1GI3A 2QY0B 1BCUH 1MKXK 2Y5GA 1BTHH 3LPRA 4X8TH 1KXDA 3FP7E 3LGVA 3SNBA 3BG4C 2I6SA 3ZZ9A 3M5OA 2Z9LA 1VCWA 4INHA 3A7TA 2GV6A 3RMLH 2F9OA 4Y10E 3MU4A 1GCTC 1C5VA 1YCPM 4NSYA 1GL1A 1RJXB 1P9UA 4MG3A 3MTYA 3LOXA 2GTBA 1KYNA 4A7IB 1KLTA 1L4ZA 3V13A 3GYLB 2BXUH 4CREA 1SGCA 2ZTYA 2QV1A 1FY4A 2FS8A 2HLCA 2P94A 4FU7A 3BN9A 1AE5A 2BDAA 2Z3DA 3PB1E 3SJ9A 1C5PA 1AFEH 1UVSH 5E0HA 1IHTH 2ZA5A 1P09A 5T6FA 3MH6A 3PLKA 1GJCB 1D9IA 4IC6A 4Y0YE 1ZYOA 3URDA 3S9CA 6GCHF 1CGHA 4D9RA 1HRTH 3BEIB 2D1JA 4VGCB 1G9IE 5C3NA 6CHAB 2WPMS 3BTEE 3LC5A 1EZXC 2EC9H 4U01A 1AKSA 1QB6A 1EZUC 1NPMA 3SGQE 2VNTA 4WH6A 2A4RA 1J15A 3SJOA 1GJ9B 2Y82A 3SUDA 1MTSA 3RXRA 1ZMJA 3BG8A 4ZKSU 2HOBA 2ANWA 3SU3A 1WTHD 2NWNA 2BLVA 8ESTE 1WUNH 3PO1B 4KELA 1GBHA 2FXRA 2OLGA 4I8LA 1QJ7B 2EEKA 1DUEA 1T8NA 3KN2A 1DVAH 1NRQH 3MWIU 5FPYA 5PTPA 3CS7A 1TE0A 3PROA 1IHSH 1AKSB 5DP3A 4NGAH 4ISHH 2SGPE 2RCEA 1MMJN 4XDEA 3ZV8A 4FUEA 2O8UA 1PPZA 1C1RA 1GI0A 1Y3YA 3P8NA 4HI3A 3D62A 2ODYB 1O2OA 3RU4E 1LPZB 4B71A 2BZ6H 3MFJA 1C9PA 1SGTA 1T32A 1ZTJA 1QNJA 1XKAC 1SGFG 1PJPA 1AO5A 4E7RG 4AYYB 3T62A 1TBZH 1QA0A 4X6PA 1S6FA 1GBTA 1JIMA 1AVWA 1A3EH 3LH1A 4DGJA 5DGJA 1O2MA 1MCTA 1B0EA 2GMTB 3A85A 3SV7A 2ANYA 2Y7ZA 4MNYA 2WV5A 2BY9X 4NIXA 1HLTH 2O8MA 1VCPA 1YKTA 2FO9A 3MU8A 1DSUA 1TONA 3F6UH 3K2UA 4JZIA 1BHXF 2P93A 4X6MA 5F8ZA 1MCVA 1NU9A 1X7AC 3RXDA 1HPGA 1O3EA 3RP2A 2YNBA 5T6GA 1OXGA 1XMNB 3ATMA 1MTNC 1NFUA 2A7JA 1AZ8A 3VB3A 2O9QA 3A7XA 4NFEA 3PMAB 3A83A 2Q6FA 2BHGA 3SGAE 1F0TA 5A8ZA 2H2ZA 2CMYA 3VEQB 1HAGE 1TPOA 4CH8B 3RLWH 1MTWA 3LGUA 2ANMH 2H6MA 2QC2A 3K65B 4JYVH 1EOJA 1ORFA 2H5CA 4IMZA 3MO6A 1O3PB 1NZQH 5HMAA
chains in the Genus database with same CATH superfamily
1ZTLA 1G2MA 2F9VA 2Z9IA 4Q7YA 1GG6C 4UFGH 4X1PU 3S7HB 1NY22 2HVXA 1P2OA 1GI5A 2SGQE 1ZHPA 4KTUA 2L74A 2ZI2H 3GY7A 2ZG0H 5DP5A 1O3DA 1V2MT 3UWJH 1GI7B 1HGTH 1BTPA 2VU8E 4K5ZA 1S81A 2B0FA 4RT0A 3ZVCA 1N6XA 2GGVB 2FOGA 1GVKB 3N99A 4Q4LA 1O5AB 1O35A 5TCCA 1AD8H 3K6ZA 5AHGH 1WYKA 2ZFQH 4M9FA 3ATWA 3KQBA 5FX6A 1PYTC 2G5NA 4NZQA 1TFXA 3BTFE 1C1WH 4RSPA 4X6NA 1MABB 2Z3CA 1DWDH 2ZGHA 1C1OA 3TNTA 1Q3XA 2H5DA 1L0ZA 2D26C 1PPBH 5L6NH 3M3VA 1DWBH 1MZDA 4R8TB 1S5SA 2P3UB 3S69A 5ESTE 1O3FA 1BIOA 2ZDMA 4FUDA 3BTKE 1O34A 1T4UH 2P59A 3A8AA 5LH8A 1MKXH 2QIQA 1C1SA 4FUJA 5B6LA 1HAIH 5IDKA 6GCHG 3OY6U 4B6EA 5EPNA 3KQEA 4NWKA 1C1VH 4FXGH 4INLA 1P2NA 4AFQA 4KGAA 1F5RA 1OWKA 1L2EA 5FPSA 4K8BA 2QF5A 3SUGA 2C93B 2LELA 1QL7A 3M7TA 1DWEH 2ZHWH 3ATKA 1TNKA 3MU1A 1W7XH 2GZ8A 1P01A 2EA3A 1GJ5H 2PSXA 1MAXA 1F92A 4B73A 1B5GH 3VGCC 1QJ6B 3BEFB 1O3CA 3LGYA 3DHKH 1YPGH 3SJIA 1O5DH 1QA7A 2ZU4A 2ESTE 4I8KA 1P03A 2H9HA 1C1MA 4J2YB 4ZKNU 3U8RH 2QXJA 1B7XB 1FPCH 3IITA 1O2NA 1SGFA 1C5TA 1S6HA 2FLRH 3P92A 4B1TA 4NA9H 1TOCB 1D4PB 5DP6A 1BTZA 1UK3A 3OFND 1MQ5A 2HNTF 1E0FD 2ZFRH 4ABFA 2QF3A 3PTNA 4E05H 3BTQE 2J2UA 3PV5A 3UWIA 4F55A 1J8AA 2FP7B 5JBBS 2OINA 1Y5UT 1FQ3A 1WDIA 2A7HA 1G3CA 3RXVA 3RXBA 2TGAA 1QURH 3QO6A 4OS5A 4WVPE 4ZXYH 1CA0C 5EXMA 3F9GA 2VGCC 2XC5A 3GOVB 4K1TA 4YOIA 3T2NA 1P0SH 2AH4X 1BMMH 2JETB 3UFAA 3GY3A 2KCOA 1DICA 5DG6A 3E1XB 1D6WA 4WMEA 3FVFB 4MNVA 5EXNA 1GBBA 4GHQA 1RTFB 1PYTD 2HPPH 3RXFA 4JZDH 1S84A 3DCLA 1V6DA 2ZHFH 1UVPA 2ZF0H 3HK6B 3SNEA 2W6JD 3SJKA 1HJ9A 3BTME 1QRZA 1A0LA 3T26A 4HFPB 2GDEH 2CGAA 3FN8A 2BOKA 5LGOA 1O3LA 3BF6H 4ZHLU 3O8RA 2ZKSA 5KGOA 3SNCA 1WSSH 1W10U 3ATIA 1D3PB 1ESBA 3AW0A 2BLOA 4JZEH 5EG4A 3SU2A 5GPIB 1AHTH 3E16B 2BDYA 3P6ZB 3QWCH 1GMHF 3OEED 4YLQH 4IS5A 1HNEE 2BDGA 3RXCA 3ZZBA 1FIWA 2G51A 1P57B 3HKJB 2Y5FA 1T4VH 4U30A 2OUAA 1O2RA 1HJAC 4GAWA 1V2UT 1QHRB 5I25A 1O5EH 2F9PA 1EJMA 2P16A 1GBLA 1TNGA 1BTWA 3UR6A 5DO4H 1ZZZA 4TPIZ 4XE4A 2FS9A 1GPZA 5FPTA 3L3TA 2ZDLA 3GCOA 1O2SA 1O3OA 3HKIB 1E1QD 2BX4A 2FLBH 1TX8A 2OD3B 4TT3D 1HB0B 2HNTE 3VB7A 4KKDA 1P2IA 1ELDE 4A1XA 2PWXA 1ZJDA 3AAUA 4SGAE 1WU1A 3O8DA 1UCYE 3DFLA 3ZYDA 2FESH 4O97A 1ACBE 1L1GA 5CHAC 4WF8A 1JWTA 1MZAA 2TPIZ 2W5EA 1A0HB 1G3EA 2ZO3H 4IC5A 5C0UA 1SGRE 1C5YB 1W11U 2HPQH 1A5IA 1H9HE 1UTPA 2HALA 4WJG2 1YPKH 2OBQA 2YMSB 5E8EH 4AFZA 3KNXA 1AY6H 1N8OC 1YPMH 6ESTA 1PQ8A 1WCZA 4FETA 3TK6A 1SLVB 1GI8B 1SR5C 1NTPA 2A31A 2ZFTA 4YTAA 1YPHE 5FBEA 1TB6H 2WYGA 4MVNA 4U2WA 4GPGA 9ESTA 4OGXA 1D3TB 1ARCA 2J5UA 1YC0A 3KYFA 3FAOA 5GCHF 1EPTA 2OC7A 4X2YA 4D8NA 2G5VA 1W0YH 3BTGE 4JZ1A 1C2EA 4O3UA 2R9PA 3KEEA 5E0JA 5A2MH 3SNDA 1SQOA 2F43B 2ZDVH 1N6YA 1CT2E 5DJ7A 1CT4E 4E06H 1F5KU 1F7ZA 3MU0A 4ISNA 4BTTB 3LJOA 1K1OA 5BPEA 1SVPA 1V3XA 2ZHQH 5EU8A 4IN1A 3SV8A 4DJZB 2A2XH 3OY5U 5JPMH 1SQAA 1MU6B 2UWPA 1YPJH 1RIWB 4YT6H 2GX4A 5JBAS 2Z6BD 3SZNA 1OP2A 2A5IA 1EPTB 3UOPA 2A4GA 4FVBA 5L30H 3E91A 2SNVA 3RXSA 1Z8JB 3PLPA 4ZXXH 1C4V2 1UTQA 1FXYA 1F0SA 2AYWA 1YLNA 2W3IA 3UY9A 4B2CA 3UNQA 2GVFA 1EASA 1HV7A 1KXEA 2PV9B 2B7DH 2QXIA 3GCHC 1VZQH 3FFGA 4ABGA 1LDTT 2VIVA 1NRSH 5JYIA 1W3CA 1C2KA 2FODA 3A82A 1Z1JA 1GHWH 4OS6A 4QT8C 3PM3A 2BD4A 3MYWA 3SU0A 1O2ZA 1NS3A 3I29A 3A80A 3RXIA 1O2GH 2Z7FE 4P00A 1SC8U 3EA9A 1GBAA 5KECA 1K1IA 1BOQA 2J98A 1A4WH 1LVBA 4Y8ZA 1DE7H 1K1MA 3EQ0H 2ULLA 2VIDA 3E0NB 4KP0A 4K1SA 2RG3A 1T7CA 4AB9A 1UHBA 1CSOE 2BTCE 4H6TA 3PYHA 3JZ2B 4ZAEA 3A86A 1A2CH 2RA3A 3KYGA 4HTCH 1EB1H 1WOFA 1PPHE 1P8VC 2PFEA 3P8FA 5TJXA 5DP7A 2CHAB 1ZGIA 3ZVGA 4A1VA 1FV9A 1TRMA 1C5ZB 3BG4B 1TRNA 1NROH 3DFJA 3TU7H 1FNIA 1WQSA 2PUXB 4HGCA 1W0JD 4H6SB 2J38A 2ZGXH 3UREA 2XBXA 3F68H 4KTCA 5A8YA 5HM9A 1GCTB 1QB9A 1JIRA 2J98B 1THRH 1GMHG 2VWLA 3SUFA 2KCAA 3OTPA 3M35A 1P05A 2GCTC 1BZXE 3GCTF 1UHBB 4E7NA 1ELGA 3VB4A 2WUCA 1F0UA 1Y59T 2XOKD 1W8BH 4ACAA 2BM2A 1OP0A 2C4FH 1ANCA 4UFEH 4DW2U 1XXDA 4KTSA 1LPGB 3Q3XA 1BHXB 3FP8E 1NRPH 1E1RD 1YLCA 4GLYA 2FI5E 2KFWA 1TALA 1C1NA 5GDSH 3SJ8A 2SGAA 3PLBA 4FUHA 5DP8A 3T28A 2G8TA 4X6OA 3RM0H 2RDLA 5EJZA 1EAXA 4ABDA 2EI6A 1ANEA 2AGIX 1XUIA 3L6PA 1J9CH 3F1SB 4F4OC 3G01A 1TRYA 1V2NT 1RS0A 5T1VA 2R2MB 3RU4D 1RTLA 1LQEA 1DXPA 1OHHD 4MPVA 1A1RA 1TABE 1O2PA 2V6NA 4A92A 2W6ID 3ZVAA 5HXFA 4CRBA 1DLKB 3WW7A 3ZZ6A 3PWBA 2DE9A 3EE0B 1AQ7A 5FX5A 1T8OA 1O2IA 2QAAA 1FX0B 1H8IH 3BTHE 3OYPA 1ZMLA 2GP9B 1IQLA 3UNRA 5F53A 2GDDA 2BDIA 4NSVA 4JYUH 1H1BA 1SOTA 3UAIC 2H9EH 1A5GH 1C1PA 1V2TT 2FYRA 4FUCA 1KXFA 5E0GA 3KQCA 5GCHG 8LPRA 4NG9H 1ZHMA 3SGBE 2CF9H 3RXJA 4RN6A 2ZIQH 2KZ4A 4ABBA 1UCYH 3A7ZA 3CNRA 3F9EA 1XUKA 5G4BA 3V3MA 3ZV9A 3U69H 4DCDA 3U1JB 1CT0E 4PROA 1LO6A 1WAYB 1DY9A 2C8YB 4K3JA 1KXBA 1TGCA 3LJJA 4CHAC 4IMQA 6CHAC 3STIA 1BBRE 2THFB 1NU7B 1V2LT 2F9UA 1YPLH 2R0KA 3DD2H 3GY4A 2K0QA 3MH4A 3F9FA 3PWCA 3MU5A 1EQ9A 5A0AE 2C8XB 5CHBA 3Q3KA 3SHCH 4Q7ZA 3LGIA 4DVAU 2PKSB 2AERH 3ZVDA 1UTJA 1H8HD 1IQJA 2D2DA 4BXWA 4Y79A 1JOUB 3TGIE 1Z1IA 1P04A 2FYQA 3O8BA 4NCYA 1C2HA 5FHTA 5DSFA 1SSXA 1MQ6A 3RXTA 3URCA 2V7QD 1V2WT 1NRNH 2IJOB 3ZVBA 1K2I1 2BD3A 4YM9A 1PQAA 2UWOA 1AUTC 4D9QA 2Z9JA 3NKKA 1UTOA 1FPHH 3H7OA 1P02A 1U6QA 1TNLA 2FOEA 1BUIA 5JB9S 2QN5T 3OE7D 3LU9B 1DDJA 2BVXH 4GVUA 4MQAA 1IQMA 1TYNA 3A8CA 1AN1E 3AK5A 4P02A 1OS8A 2V35A 4AGJA 7GCHF 1SFQB 3FANA 1VJAU 2ANKH 1GCDA 4X1SU 3GS9A 1KIGH 1K1LA 4CBNA 1SGPE 3LGTA 2B8OH 1DLEA 1TPPA 2BD7A 4BANB 1CHGA 1AUJA 3T25A 4BTUB 1C2DA 2WINI 1ZGVA 2NU3E 2QF0A 4AB8A 5HYOA 3W94A 1CGJE 2WPJS 1BJUA 3UB0A 3HGNA 4UDWH 1P06A 2J97A 2TGDA 4K69A 4TY6A 5AF9H 1CHOF 3KIDU 4DY7B 1ZSKA 1EB2A 1ABIH 2A0QB 4ISOA 2R2WU 1TNIA 2GMTC 1GL0E 3R3GB 1O2YA 4SGBE 2Y5HA 1G37A 4Y8YA 2ZGBH 3W95A 3M5NA 1G30B 2ZU2A 4O03A 2KCPA 1LKAA 4CBOA 2W26A 3TLOA 4X1NU 3CENA 3TVJB 2UUJB 3FOAA 3EA8A 3GCTG 1LKBA 1P2MA 1CU1A 4ZHAA 2BXTH 1O32A 1RD3B 2R3UA 1QIXB 1A7SA 1MKWH 2QGRA 2FOMB 4K1EA 5A0BA 3FZDA 1QBVH 2LP6A 1AU8A 1FAKH 1CBWC 1QQ4A 1OWEA 2BB4A 4HG6A 1OWJA 5EGMA 1ARBA 1SBWA 3ZZ5A 1O2XA 1TLDA 4TWWA 2JDID 1A3BH 1IQGA 5SGAE 3ODDA 1YCPK 1TQ0B 3D49H 1VKYA 1ELTA 2J95A 5EXLA 3QTVH 3H7TA 2STBE 1W7GH 4I7YH 3UR9A 1K0HA 3BTDE 1GHBF 2XC4A 1SMFE 3E0PB 2BQWB 7LPRA 1Z8GA 2OTVA 1GBMA 2G00A 1V2PT 3R0FA 3V12A 1HAYB 3OU0A 4O9VA 1H8DH 2J4IA 3QN7A 1C4Y2 3F9HA 2GKVE 5EPYA 1YY3A 2PHBA 1XXFA 3AW1A 3TJOA 1QY6A 1TIOA 3MI4A 1J14A 2BX3A 3E3TA 5KEDA 1SGIB 3I78A 1C5QA 1SGNE 2ZQ2A 4HZHA 4THNH 3S7KB 2ZU5A 2V3HH 1XVMA 2BLQA 2A4OA 2TRMA 3BEUA 2XW9A 2NU1E 4U32A 1C1UH 4UONA 2AFQB 4OM9A 1WTGH 1S83A 4ZHMU 1BTUA 8GCHF 4Y76A 1O3MA 5FBIA 3P8GA 1Y5BT 1KSNA 4IBLH 2FZZA 9LPRA 2ZFPH 4TWYA 4D7FA 1A46H 2GD4B 1QRWA 1ETSH 1NRRH 1DX5M 1GBDA 3MO3A 3PRBA 4WWYA 4Y11E 4A1TA 2QA9E 2FPZA 1AB9C 2ALVA 4ZROA 1TGBA 1FY1A 1GDQA 4Y7BA 1P2KA 4Y6DA 4AG1A 3O8CA 2VGCB 3RM2H 2WUBA 4ISLA 2TBSA 3Q77A 5HGGA 4AFUA 1PPCE 1N1LA 1FN8A 2GJGA 2XTTB 1HBTH 1GJAB 1K1NA 2XCNA 1RGQA 1QL9A 3N7DA 3RMOH 4CRCA 1OP8A 1ZPBA 3T29A 3EDXB 3M3TA 1O2VA 3SUEA 3ZVFA 5ABWA 3LDXH 1Q2WA 1HXFH 1LPKB 1NFXA 1ZOMA 1IQFA 4Y0ZE 3T5FH 3M5MA 3U8TH 2PLXA 2AS9A 3UUZA 4BOHA 3T27A 1FY5A 4XD7D 4CRGA 3PMHB 4JK5A 4X1QU 1BMFD 5F6MA 1ABJH 2SFAA 2P8OB 1SHHB 3NZIA 2UUFB 3FO8D 1W0KD 1HJAB 2FEQH 3KL6A 3MHWU 1MTVA 4CRAA 1O2HA 1UMAH 2C8ZB 1SQRA 2FOAA 1BBRH 4YZUA 3MNSA 7GCHG 1UVTH 2Y6TA 3LGWA 3SNAA 3RUOA 1TA6A 1HIAA 1BRAA 3PMJA 4K60A 5ETXA 1GI6A 4JYTA 3P70B 1SI5H 4JCNA 5EJLA 2YOLA 1GBCA 3TITA 4INKA 4IGDA 2JETC 5LPRA 1KDQA 3RMMH 3VFEA 3TJUA 3MH5A 1OYTH 4UD9H 5T3HA 4Z6AH 4MNXA 2QCYA 1E37B 1BITA 1AI8H 3VG8A 2BQ6B 3U98H 1O2LA 3RXEA 1BB0B 1EKBB 3UOUA 1ELCA 1C1QA 3HPTB 4X0WU 4I32A 3WY8A 1CHOG 1UTLM 3TGJE 3NPSA 1E36B 1O3GA 2VWMA 1FY8E 2KAIA 3ENSB 3Q76A 4TYDA 4LZ1H 1Z71A 1GJDB 1N8OB 3ELAH 5DN6D 5C17A 1HIAB 1VGCC 2Y7XA 2ZDAH 1XX9A 2BD8A 3C1KA 4NA7A 4MDSA 1UCYK 2CJIA 2W7SA 3ZZAA 5CE1A 2BD5A 4X8SH 4UEHH 3SN8A 1LVMA 2FOBA 1KDQB 2CF8H 2PW8H 4ABAA 2JH0D 2STAE 4NFFA 1O37A 2EY4C 4GUXA 1GMDF 2F83A 2VH6A 2QF4A 4JK6A 1L1NA 5GIBA 1ZHRA 1KXCA 1OOKB 5K7RA 2FTMA 2AHME 1EUFA 1NN6A 3FKSD 3QGJA 2KAIB 3KHVA 4IW4E 1VITF 3CS0A 2FM2A 3OSYA 1ZRBA 3BSQA 1V2VT 1VJ9U 2G4TA 2PTNA 1AFQB 1WXRA 5A8XA 4K8YA 1GHBG 1C5NH 4LZ4B 2XBVA 1O36A 1BRCE 3NXPA 2FMJA 3E90B 4DG4A 2Q1JA 1ZPCA 2HWLB 4D7GA 1SKYE 2XBYA 3SU6A 3F0PA 4BAHB 1DSTA 1LVOA 1EX3A 4Q2KA 3SORA 2IJD1 5JDUB 5EOKA 1Y3UA 1SOZA 2BY8X 4GSOA 1SQTA 5FCRA 1A61H 3Q3YA 1GBKA 4RKJB 2M2AA 2UWLA 3QK1A 2WPDD 1GVZA 3RMNH 1SG8B 1AE8H 2XWBI 1QR3E 4F48B 2JJ2D 4Q63A 1YCPH 1O38A 1ZSJA 4FU9A 1A5HA 1MBMA 8GCHG 2FI4E 3GCHB 4ZH8A 1C2IA 3OEHD 1GGDB 1KY9A 5E2OA 2G55A 4LXBH 1GI9B 1ZMNA 2Z9KA 3SYJA 2B9LA 3H09A 3TIUA 1H9LB 1HDTH 4R0IA 4ABJA 2WZQA 1C2JA 3SU1A 1ZLRA 4FVDA 5BRRE 3DA9B 1CO7E 3QTOH 3GY6A 1EP5A 2GZ9A 4OGYA 1BMNH 3UNSA 3PTBA 4ZMAH 5CDFE 1QBOA 2P3FH 2G4UA 2AIQA 2GZ7A 1GHZA 2SGDE 4XBDA 3KF2A 2F9NA 4DT7B 3RC6A 1FDPA 1QBNA 5C5NA 2A4QA 1O3IA 2SGFE 1NBMD 2HRVA 1AIXH 1XUFA 2IOTA 5L2ZH 3QZRA 3A8DA 1XUGA 1SFIA 1TNHA 4NZLA 3BIVH 1EJAA 3LC3A 5C1YA 4JMYA 1MKWK 1ZRKA 1HAPH 2XBWA 1FI8A 2A5AA 2EI8A 2W7UA 3RDZA 1KXAA 2IPQX 1O2JA 2ZCHP 2RDEA 2W3KA 1E38B 2M5TA 3Q00A 1O5FH 2VIPA 1CGIE 1YWUA 2PTCE 2YNAA 2KX4A 1OWIA 1PQ5A 2PP6A 3A7VA 1DPOA 3V7TA 2XCFA 1MD8A 1PPGE 4Q7XA 1AZZA 2K8IA 2OCVB 4ABHA 2WPKS 2O8LA 3NK8A 3TJVA 2BOHB 5DPAA 2PSYA 2XC0A 3WWBA 5AVDA 5AFZH 3S9BA 1FY3A 1TMBH 4ZKRU 2VVVA 1QJ1B 2KM0A 2PUQH 2ZHEH 3EYDA 3LONA 2YMSD 1P3EA 2ZP0H 3PMBB 3SI4H 1V2OT 1XUHA 2GT8A 1UK4A 2FX6A 3SHAH 1QCPA 4A5TS 2WPIS 1EAIA 2HGTH 1AMHA 1SGQE 2CN0H 4GCHF 3RC4A 1F2SE 4BXSA 3P95A 4ZUHA 1Y8TA 1OSSA 1L1JA 2ZGJA 2VIOA 1RTKA 4H4FA 2TGPZ 4FUFA 4YLUA 5FXLA 3TK9A 4CR9A 2J9NA 1S6LA 1PPFE 3MOCA 2CHAC 1GHXH 3RLYH 2P95A 3M7QA 2V3MA 1PPEE 2JH6D 2JIZD 4AGKA 1SPJA 1BRUP 3N7OA 5EODA 2FWWA 2BD9A 1ID5H 1PFXC 3H5CB 3A7WA 4I86A 2SGEE 6LPRA 3QDZB 1VR1H 1MH0A 3TH3H 1ZPZA 3M7UA 1P9SA 1TGTA 1IQNA 4MPXA 1FAXA 3DUXH 4BAQB 3BV9B 4MPUA 1ANBA 4BAKB 1Z7KA 2OC1A 1GMDG 1Z6JH 2F91A 4B75A 4YOJA 1COWD 1TX7A 1Q31A 4MNWA 4TPYA 1BRBE 4H42U 1L4DA 1Z8RA 1GJBB 2BVRH 1J17T 2SNWA 4CRDA 1DFPA 4B6FA 1GVLA 2FIRH 2Q6GA 4D76A 5DP9A 3HK3B 3SV6A 1W13U 2JKHA 3RXOA 4CHAB 2ZDKA 1LHEH 5J4SA 1K9OE 4AG2A 1VITG 5I46H 1LCYA 3QZQA 1TBQH 1JMOH 1EFRD 1HCGA 1Z6EA 1V2RT 5C2ZA 4ZKOU 1BA8B 4ABIA 1EP6A 4Z0KA 2XXLA 5JBTA 4DT4A 8KME2 1AWFH 5E2PA 2OQUA 3RXLA 1D3DB 4XOJA 1TOMH 1SLXB 1THSH 4VGCC 1YGCH 2WV9A 3EGKH 3S9AA 3TJNA 2Z9GA 5A09A 1BBRK 4BNRA 4MTBA 1BJVA 1O5BB 4FUGA 2ZEBA 1EZQA 2WPHS 1DANH 2L6OA 2O8TA 3VXEH 2OC8A 1BTYA 3MH7A 4UFFH 3NCLA 1M9UA 1GMCF 1JBUH 3F3BA 4LOYH 1ZTKA 1RFNA 3ESTA 1DITH 1AVGH 3D23A 2Z94A 2WV4A 2FTLE 1SLUB 2AMDA 1C9TA 4CR5A 3PO1C 1INCA 5B6OA 1S82A 1O3HA 3TGKE 1HUTH 4BTIB 4Q80A 4ABEA 3ZZ3A 1W2KH 1E35B 5F03A 2WYJA 4XBBA 1MU8B 1UVOA 1A0JA 2ZPSA 4RT1A 1FONA 3P8OA 1NO9H 4WMFA 3UQVA 1O3KA 4I8JA 1ESAA 3SQHE 2NU2E 1ETRH 4I33A 5EQQA 1NFWA 4CRFA 2H1UA 2ZFSA 2VB0A 2R0LA 1V2KT 1KTTB 1MTNB 4WY3A 4XFQA 1TMUH 2LPRA 4ASHA 1JRSA 2PKSC 3GDSA 1NFYA 5EJ1A 1C2MA 1Y3VA 2RFKC 1IQKA 1UTNA 5LPEA 1JRTA 2ODQA 3LIWA 2ZHDA 1Z8IB 2AMPA 1GHYH 2LNCA 1IQHA 3NUMA 3CP7A 3IWMA 4XBCA 2V3OH 4DURA 3STJA 3OTJE 1LQDB 3RXGA 1EZSC 1CE5A 1TPSA 1OKXA 1G36A 2A5KA 4ASUD 2JH5D 1T31A 4X8VH 1D3QB 1HAXB 2BDCA 1GBEA 7ESTE 1XVOA 1KLJH 2BYAX 3SW2B 1GG6B 1CA8B 4TY7A 2PGQB 1O0DH 1S0QA 1G2LA 1G32B 3MO9A 1GHVH 2O8WA 1ZR0A 4ESTE 1XM1A 1V2JT 2WPLS 1UTMA 2BD2A 2BQ7B 1BMLA 3IG6B 1RXPA 1W12U 1CBWB 2QE7D 1B0FA 2ZGCA 2OP9A 3SQEE 1VITH 5L2YH 4AFSA 3OX7U 5CMXH 1FJSA 2G52A 1C2FA 4AORA 2HVYB 4Y71A 3SZEA 2ZU3A 2HNTC 1BQYA 3ZZ8A 2UUKB 5DK1A 1QL8A 2VWOA 2FDAA 1T8MA 3GDUA 1ZJKA 4GCHG 5GWZA 1O2QA 1K21H 3GICB 3AVZA 5JBCS 4Y8XA 3M36A 1C5OH 4ACBA 1SGDE 3I77A 2BMGB 1HJ8A 4F49A 1GHAF 4M7GA 3SBKA 4J1YA 1Y3XA 2FOHA 1C5RA 1TNJA 2VVCA 3ITIA 1YP9A 5FL7D 5AFYH 1V2ST 1HFDA 5ESBA 2BVSH 5DKMA 3F0OA 5FAHA 1H9IE 1J16A 1XUJA 3PRDA 1NM6A 2FOFA 1C5UA 1YPHC 1HAVA 2OBOA 5HIYA 2XYAA 5A0CA 5EIYA 3F2FA 1TA2A 4FUIA 1T8LA 4WXVA 4FUBA 1SLWB 3S0NA 3C27B 1QQUA 3GY5A 1DOJA 1O2KA 4YT7H 1GBFA 5EW2H 3U9AH 3VGCB 1AGJA 1YYY1 3V0XA 4RKOB 3TH2H 2CXVA 3AAVA 1KTSB 1G3DA 1KLIH 1AB9B 3M61U 3VB5A 1TMTH 3RXPA 1P12E 2VH0A 1DM4B 2QXGA 3KQDA 1SGEE 5K0HA 1BDAA 5GJ4B 5TCAA 3UTUH 4NWLA 3LH3A 5C5OA 2F3CE 4MLFB 4X1RU 1K28D 4AZ2B 1GJ7B 1EOLA 3QUMP 4IN2A 1YLDA 2XWAA 1HAVB 2A32A 1DT2A 1F5LA 1TWXB 3EE7A 3GISB 4UFDH 3SI3H 1DWCH 2BY5X 1GDNA 5T6DA 2BY6X 4OS7A 4GHTA 2VVUA 1P10A 2GCHF 3M5LA 4AOQA 1CA0B 2A2QH 3QLPH 1UO6A 3M37A 3AASA 1IQEA 3HGPA 1O3NA 2ZECA 3ZZCA 1ELFA 1IQIA 1CQQA 1ETTH 4WH8A 1EXFA 1SHYA 2A1DB 4X2VA 2QYIA 5C20A 3GYMA 4MPWA 1YPEH 2C90B 2PGBB 1O30A 1GMCG 2QXHA 4OS1A 3UPEA 3TK5A 1FMGA 3GCNA 3A7YA 2C8WB 1ELVA 4B76A 4NIVA 2OC0A 3VXFH 1OX1A 3WWFA 1NESE 3ZZ7A 4JZFH 3U1IB 3JZ1B 1BMAA 2BY7X 1C1TA 2XNDD 3GY8A 1YBWA 1FIZA 2ALPA 2J34A 1GI2A 4X2WA 3B9FH 5DP4A 4NIWA 3FZZA 4X8UH 3E8LA 4OS2A 3N7EA 1NT1A 5F8TA 3ZYEA 2VIWA 4I8HA 3P17H 2PR3A 1AVXA 2ZFFH 3U8OH 2ZTZA 3KGPA 2NU0E 4NIYA 4WXIA 1TGNA 3SOSA 1LHCH 2ILNA 2V0BA 3SV2H 1K1PA 5LPFA 1GWAA 5EQSA 3FP6E 2IPHA 1TAWA 1UK2A 1DXWA 2BDHA 2PKAA 3F2GA 3EA7A 1MD7A 2GV7A 2VWNA 3E6PH 2EQNA 4LK4A 1VGCB 4BAMB 4WMDA 1FZZA 2XRCA 4B2BA 1UVUH 2P8OC 5CHAB 1HXEH 1O39A 3EAJA 5C94A 5J4QA 2F4LA 2FOCA 3OAAD 1LHDH 2Y80A 3RXKA 3U28C 3B8JA 3BTWE 3M3SA 3GDVA 2TGTA 1GDUA 2ZCLP 2ZWLH 1QZ8A 2ZCKP 2AEIH 1G3BA 3MNBA 1SGYE 3K9XB 1OWDA 1ZSLA 2FI3E 3B23B 3VB6A 2ZDNA 1WQVH 4K2YA 1THPB 2PKAB 1C2LA 3DSGA 1C5SA 1OPHB 3QX5H 5FCKA 3ZZDA 1O5GH 1MTUA 4FU8A 4YO9A 2RA0A 1GJ8B 2CK3D 2JJ1D 3SU5A 1EAWA 1HAHH 5GXPA 2D8WA 4OS4A 1O2TA 1PQ7A 4AX9H 7KMEH 1W0ZU 2UUYA 1QB1A 3BTTE 1C5XB 4UE7H 3RXMA 3SU4A 4YOGA 1HAZB 1UW7A 3A88A 3F2HA 2A45B 5C67A 1O3JA 3SV9A 1LHGH 3MNXA 1GHAG 1ELBA 1K1JA 5EW1H 4AN7A 1GI4A 2ODPA 5C1UA 3BIUH 3SO3A 2KR7A 1EAUA 4X2XA 1P3CA 4B74A 3K6YA 2OQ5A 2ZC9H 3A8BA 1LVYA 2YMSC 1F0RA 4O3TA 1P11E 1GI1A 2ZNKH 1O5CB 1ESTA 4DIIH 1GBIA 1IOEA 1BTXA 1C5LH 1C5MD 1IAUA 1C2GA 3A87A 2K1QA 2ZU1A 4NA8A 2DE8A 1TPAE 4XSKU 1QTFA 1K22H 1MBQA 1VCQA 2GT7A 5C1XA 1EJNA 1EATA 3MQKC 1AFQC 2H9TH 5F8XA 1OWHA 3TPIZ 3A81A 5JB8S 3PV4A 3ODFA 4DIHH 1LTOA 2Q6DA 4I8GA 2AGEX 1HAOH 3D65E 4CH2B 1BT7A 2ZQ1A 1E34B 2OXSA 2F9BH 1Y5AT 1OYQA 2ZPQA 3UQOA 4Y7AA 2AGGX 2EI7A 3UIRA 3RXHA 2VIQA 5EQRA 5HIZA 1V2QT 1TX6A 2BDBA 2NU4E 1YM0A 3HATH 2GCHG 2I6QA 1ANDA 1YF4A 1C5WB 1TQ7B 2VJ1A 4DOQA 2DUCA 3MMGA 1ELAA 2G81E 1GJ6A 1H4WA 1O3AA 2J92A 1UJ1A 3NRLA 4YXWD 1GBJA 1E79D 1AWHB 1UTKA 1GJ4H 3RU4T 1LHFH 1RIWC 4ZCNA 1Y3WA 1P2QA 1EPTC 1WV7H 5HM2A 1O31A 2XNIA 3LKWA 2A7CA 1QGFA 2WHXA 1HYLA 1W14U 2Y81A 1QFKH 1GGDC 2AIPA 3ATLA 1C4U2 1LMWB 1DY8A 1XKBC 2ASUB 4BAOB 1D6RA 1TBRH 3RXQA 2C3SA 3A89A 1TGSZ 3RXAA 1FLEE 4A6LA 1MUEB 3LT3A 1DUAA 2VINA 2FX4A 1P2JA 1WBGB 1DS2E 1O3BA 1JXPA 2GCTB 2CV3A 2ZPRA 4B2AA 4YESB 1FUJA 2WSSD 3RXUA 2J94A 1O2WA 3KCGH 3A84A 1O2UA 3MNCA 4ISIH 3VPKA 3ZVEA 3TH4H 2R3YA 1SL3A 2AMQA 5H4IB 3NWUA 1S85A 3TNSA 3W1EA 1O33A 3GY2A 3DT0H 2ZZUH 4I31A 2Z3EA 2BLWA 1MAYA 1ELEE 1NC6A 1CVWH 2TIOA 2P3TB 3QGNB 1RRKA 1SB1H 3PV2A 5IYTA 2IN2A 2B5TB 1S0RA 3ZZ4A 2ZTXA 4AYVB 3L33A 1FN6A 1QRXA 3RC5A 2BZAA 1GI3A 2QY0B 1BCUH 1MKXK 2Y5GA 1BTHH 3LPRA 4X8TH 1KXDA 3FP7E 3LGVA 3SNBA 3BG4C 2I6SA 3ZZ9A 3M5OA 2Z9LA 1VCWA 4INHA 3A7TA 2GV6A 1H8ED 3RMLH 2F9OA 4Y10E 3MU4A 1GCTC 1C5VA 1YCPM 2KCYA 4NSYA 1GL1A 1RJXB 1P9UA 4MG3A 5C0TA 3MTYA 3LOXA 2GTBA 1KYNA 4A7IB 1KLTA 1L4ZA 1NBME 3V13A 3GYLB 2BXUH 4CREA 1SGCA 2ZTYA 2QV1A 1FY4A 2FS8A 2HLCA 2P94A 4RI0A 4FU7A 3BN9A 1AE5A 2VBCA 2BDAA 2Z3DA 3PB1E 3SJ9A 1C5PA 1AFEH 1UVSH 5E0HA 1IHTH 2ZA5A 1P09A 5T6FA 3MH6A 3PLKA 1GJCB 1D9IA 4IC6A 4Y0YE 1ZYOA 3URDA 3S9CA 6GCHF 1CGHA 3ZIAD 4D9RA 1HRTH 3BEIB 2D1JA 4VGCB 1G9IE 5C3NA 6CHAB 5GNDA 2WPMS 3BTEE 3LC5A 1EZXC 2EC9H 4U01A 1AKSA 3KQ5A 1QB6A 1EZUC 1NPMA 3SGQE 2VNTA 4WH6A 5HKKD 2A4RA 1J15A 3SJOA 1GJ9B 2Y82A 3SUDA 1MTSA 3RXRA 1ZMJA 3BG8A 4ZKSU 2HOBA 2ANWA 3SU3A 1WTHD 2NWNA 2BLVA 8ESTE 1WUNH 3PO1B 4KELA 1GBHA 2FXRA 2OLGA 4I8LA 1QJ7B 2EEKA 4AC9A 1DUEA 1T8NA 3KN2A 1DVAH 1NRQH 3MWIU 5FPYA 5PTPA 3CS7A 1TE0A 3PROA 1IHSH 1AKSB 5DP3A 4NGAH 4ISHH 2SGPE 2RCEA 1MMJN 4XDEA 3ZV8A 4FUEA 2O8UA 1PPZA 1C1RA 1GI0A 1Y3YA 3P8NA 4HI3A 3D62A 2ODYB 1O2OA 3RU4E 1LPZB 4B71A 2BZ6H 4FOUC 3MFJA 1C9PA 1SGTA 1T32A 1ZTJA 1QNJA 1XKAC 1SGFG 1PJPA 1AO5A 4E7RG 4AYYB 3T62A 1TBZH 1QA0A 4X6PA 5IK2D 1S6FA 1GBTA 1JIMA 3DSPA 1AVWA 2OK5A 2HLDD 1A3EH 4TSFD 3LH1A 4DGJA 5DGJA 1O2MA 1MCTA 1B0EA 3DSOA 2GMTB 3A85A 3SV7A 2ANYA 2Y7ZA 4MNYA 2WV5A 2BY9X 4NIXA 1HLTH 2O8MA 1VCPA 1YKTA 2FO9A 3MU8A 1DSUA 1TONA 3F6UH 3K2UA 4JZIA 1BHXF 2P93A 4X6MA 5F8ZA 1MCVA 1NU9A 1X7AC 3RXDA 1HPGA 1O3EA 4Z1MD 3RP2A 2YNBA 5T6GA 1OXGA 1XMNB 3ATMA 1MTNC 1NFUA 2A7JA 1AZ8A 3VB3A 2O9QA 3A7XA 4NFEA 3PMAB 3A83A 2Q6FA 2BHGA 3SGAE 1F0TA 1KMHB 5A8ZA 2H2ZA 2CMYA 3VEQB 1HAGE 1TPOA 4CH8B 3RLWH 1MTWA 3LGUA 2ANMH 2H6MA 2QC2A 3K65B 4JYVH 1EOJA 1ORFA 2H5CA 4IMZA 3MO6A 1O3PB 1NZQH 5HMAA 4XRNA
chains in the Genus database with same CATH topology
1ZTLA 1G2MA 2F9VA 2Z9IA 4Q7YA 1GG6C 4UFGH 4X1PU 3S7HB 1NY22 2HVXA 1P2OA 1GI5A 2SGQE 1ZHPA 4KTUA 2ZI2H 3GY7A 2ZG0H 5DP5A 1O3DA 1V2MT 3UWJH 1GI7B 1HGTH 1BTPA 2VU8E 4K5ZA 1S81A 2B0FA 3ZVCA 1N6XA 2GGVB 2FOGA 1GVKB 1O5AB 1O35A 5TCCA 1AD8H 3K6ZA 5AHGH 1WYKA 2ZFQH 3ATWA 3KQBA 5FX6A 1PYTC 2G5NA 4NZQA 1TFXA 3BTFE 1C1WH 4RSPA 4X6NA 2Z3CA 1DWDH 2ZGHA 1C1OA 3TNTA 1Q3XA 2H5DA 1L0ZA 2D26C 1PPBH 5L6NH 3M3VA 1DWBH 1MZDA 4R8TB 1S5SA 2P3UB 3S69A 5ESTE 1O3FA 1BIOA 2ZDMA 4FUDA 3BTKE 1O34A 1T4UH 2P59A 3A8AA 5LH8A 1MKXH 2QIQA 1C1SA 4FUJA 1HAIH 5IDKA 6GCHG 3OY6U 5EPNA 3KQEA 4NWKA 1C1VH 4FXGH 4INLA 1P2NA 4AFQA 4KGAA 1F5RA 1OWKA 1L2EA 5FPSA 4K8BA 3SUGA 2C93B 1QL7A 3M7TA 1DWEH 2ZHWH 3ATKA 1TNKA 3MU1A 1W7XH 2GZ8A 1P01A 2EA3A 1GJ5H 2PSXA 1MAXA 1F92A 4B73A 1B5GH 3VGCC 1QJ6B 3BEFB 1O3CA 3LGYA 3DHKH 1YPGH 3SJIA 1O5DH 1QA7A 2ZU4A 2ESTE 4I8KA 1P03A 2H9HA 1C1MA 4J2YB 4ZKNU 3U8RH 2QXJA 1B7XB 1FPCH 3IITA 1O2NA 1SGFA 1C5TA 1S6HA 2FLRH 3P92A 4B1TA 4NA9H 1TOCB 1D4PB 5DP6A 1BTZA 1UK3A 1MQ5A 2HNTF 1E0FD 2ZFRH 4ABFA 2QF3A 3PTNA 4E05H 3BTQE 2J2UA 3UWIA 1J8AA 2FP7B 5JBBS 2OINA 1Y5UT 1FQ3A 2A7HA 3RXVA 1G3CA 3RXBA 2TGAA 1QURH 3QO6A 4OS5A 4WVPE 4ZXYH 1CA0C 5EXMA 3F9GA 2VGCC 2XC5A 3GOVB 4K1TA 4YOIA 3T2NA 1P0SH 2AH4X 1BMMH 2JETB 3UFAA 3GY3A 1DICA 5DG6A 3E1XB 1D6WA 4WMEA 3FVFB 4MNVA 5EXNA 1GBBA 4GHQA 1RTFB 1PYTD 2HPPH 3RXFA 4JZDH 1S84A 1V6DA 2ZHFH 1UVPA 2ZF0H 3HK6B 3SNEA 3SJKA 1HJ9A 3BTME 1QRZA 1A0LA 3T26A 4HFPB 2GDEH 2CGAA 2BOKA 5LGOA 1O3LA 3BF6H 4ZHLU 3O8RA 2ZKSA 3SNCA 1WSSH 1W10U 3ATIA 1D3PB 1ESBA 3AW0A 2BLOA 4JZEH 5EG4A 3SU2A 5GPIB 1AHTH 3E16B 2BDYA 3P6ZB 3QWCH 1GMHF 4YLQH 4IS5A 1HNEE 2BDGA 3RXCA 3ZZBA 1FIWA 2G51A 1P57B 3HKJB 2Y5FA 1T4VH 4U30A 2OUAA 1O2RA 1HJAC 4GAWA 1V2UT 1QHRB 5I25A 1O5EH 2F9PA 1EJMA 2P16A 1GBLA 1TNGA 1BTWA 3UR6A 5DO4H 1ZZZA 4TPIZ 4XE4A 2FS9A 1GPZA 5FPTA 3L3TA 2ZDLA 3GCOA 1O2SA 1O3OA 3HKIB 2BX4A 2FLBH 1TX8A 2OD3B 1HB0B 2HNTE 3VB7A 4KKDA 1P2IA 1ELDE 4A1XA 2PWXA 1ZJDA 3AAUA 4SGAE 1WU1A 3O8DA 1UCYE 3DFLA 3ZYDA 2FESH 4O97A 1ACBE 1L1GA 5CHAC 4WF8A 1JWTA 1MZAA 2TPIZ 2W5EA 1A0HB 1G3EA 2ZO3H 4IC5A 1SGRE 1C5YB 1W11U 2HPQH 1A5IA 1H9HE 1UTPA 2HALA 4WJG2 1YPKH 2OBQA 5E8EH 4AFZA 3KNXA 1AY6H 1N8OC 1YPMH 6ESTA 1PQ8A 1WCZA 3TK6A 1SLVB 1GI8B 1SR5C 1NTPA 2A31A 2ZFTA 4YTAA 1YPHE 5FBEA 1TB6H 2WYGA 4MVNA 4U2WA 4GPGA 9ESTA 4OGXA 1D3TB 1ARCA 1YC0A 3FAOA 5GCHF 1EPTA 2OC7A 4X2YA 4D8NA 2G5VA 1W0YH 3BTGE 4JZ1A 1C2EA 4O3UA 2R9PA 3KEEA 5E0JA 5A2MH 3SNDA 1SQOA 2ZDVH 1N6YA 1CT2E 5DJ7A 1CT4E 4E06H 1F5KU 1F7ZA 3MU0A 4ISNA 4BTTB 3LJOA 1K1OA 5BPEA 1SVPA 1V3XA 2ZHQH 5EU8A 4IN1A 3SV8A 4DJZB 2A2XH 3OY5U 5JPMH 1SQAA 1MU6B 2UWPA 1YPJH 1RIWB 4YT6H 2GX4A 5JBAS 2Z6BD 3SZNA 1OP2A 2A5IA 1EPTB 3UOPA 2A4GA 4FVBA 5L30H 3E91A 2SNVA 3RXSA 1Z8JB 3PLPA 4ZXXH 1C4V2 1UTQA 1FXYA 1F0SA 2AYWA 2W3IA 3UY9A 4B2CA 3UNQA 2GVFA 1EASA 1HV7A 1KXEA 2PV9B 2B7DH 2QXIA 3GCHC 1VZQH 3FFGA 4ABGA 1LDTT 2VIVA 1NRSH 5JYIA 1W3CA 1C2KA 2FODA 3A82A 1Z1JA 1GHWH 4OS6A 4QT8C 3PM3A 2BD4A 3MYWA 3SU0A 1O2ZA 1NS3A 3I29A 3A80A 3RXIA 1O2GH 2Z7FE 1SC8U 3EA9A 1GBAA 1K1IA 1BOQA 1A4WH 1LVBA 4Y8ZA 1DE7H 1K1MA 3EQ0H 2ULLA 2VIDA 3E0NB 4KP0A 4K1SA 2RG3A 1T7CA 4AB9A 1UHBA 1CSOE 2BTCE 4H6TA 3PYHA 3JZ2B 4ZAEA 3A86A 1A2CH 2RA3A 4HTCH 1EB1H 1WOFA 1PPHE 1P8VC 2PFEA 3P8FA 5TJXA 5DP7A 2CHAB 1ZGIA 3ZVGA 4A1VA 1FV9A 1TRMA 1C5ZB 3BG4B 1TRNA 1NROH 3DFJA 3TU7H 1FNIA 1WQSA 2PUXB 4HGCA 4H6SB 2J38A 2ZGXH 3UREA 2XBXA 3F68H 4KTCA 5A8YA 5HM9A 1GCTB 1QB9A 1JIRA 1THRH 1GMHG 2VWLA 3SUFA 3M35A 1P05A 2GCTC 1BZXE 3GCTF 1UHBB 4E7NA 1ELGA 3VB4A 2WUCA 1F0UA 1Y59T 1W8BH 2BM2A 1OP0A 2C4FH 1ANCA 4UFEH 4DW2U 1XXDA 4KTSA 1LPGB 3Q3XA 1BHXB 3FP8E 1NRPH 1YLCA 4GLYA 2FI5E 1TALA 1C1NA 5GDSH 3SJ8A 2SGAA 3PLBA 4FUHA 5DP8A 3T28A 2G8TA 4X6OA 3RM0H 2RDLA 1EAXA 4ABDA 2EI6A 1ANEA 2AGIX 1XUIA 3L6PA 1J9CH 3F1SB 4F4OC 3G01A 1TRYA 1V2NT 1RS0A 2R2MB 3RU4D 1RTLA 1LQEA 1DXPA 4MPVA 1A1RA 1TABE 1O2PA 2V6NA 4A92A 3ZVAA 5HXFA 4CRBA 1DLKB 3ZZ6A 3PWBA 2DE9A 3EE0B 1AQ7A 5FX5A 1T8OA 1O2IA 2QAAA 1H8IH 3BTHE 3OYPA 1ZMLA 2GP9B 1IQLA 3UNRA 2GDDA 2BDIA 4NSVA 4JYUH 1H1BA 1SOTA 2H9EH 1A5GH 1C1PA 1V2TT 2FYRA 4FUCA 1KXFA 5E0GA 3KQCA 5GCHG 8LPRA 4NG9H 1ZHMA 3SGBE 2CF9H 3RXJA 4RN6A 2ZIQH 4ABBA 1UCYH 3A7ZA 3F9EA 1XUKA 5G4BA 3V3MA 3ZV9A 3U69H 4DCDA 3U1JB 1CT0E 4PROA 1LO6A 1WAYB 1DY9A 2C8YB 4K3JA 1KXBA 1TGCA 3LJJA 4CHAC 4IMQA 6CHAC 3STIA 1BBRE 2THFB 1NU7B 1V2LT 2F9UA 1YPLH 2R0KA 3DD2H 3GY4A 3MH4A 3F9FA 3PWCA 3MU5A 1EQ9A 5A0AE 2C8XB 3Q3KA 3SHCH 4Q7ZA 3LGIA 4DVAU 2PKSB 2AERH 3ZVDA 1UTJA 1IQJA 2D2DA 4BXWA 4Y79A 1JOUB 3TGIE 1Z1IA 1P04A 2FYQA 3O8BA 4NCYA 1C2HA 5FHTA 1SSXA 1MQ6A 3RXTA 3URCA 1V2WT 1NRNH 2IJOB 3ZVBA 1K2I1 2BD3A 4YM9A 1PQAA 2UWOA 1AUTC 4D9QA 2Z9JA 3NKKA 1UTOA 1FPHH 3H7OA 1P02A 1U6QA 1TNLA 2FOEA 1BUIA 5JB9S 2QN5T 3LU9B 1DDJA 2BVXH 4GVUA 4MQAA 1IQMA 1TYNA 3A8CA 1AN1E 1OS8A 2V35A 4AGJA 7GCHF 1SFQB 3FANA 1VJAU 2ANKH 1GCDA 4X1SU 1KIGH 1K1LA 4CBNA 1SGPE 3LGTA 2B8OH 1DLEA 1TPPA 2BD7A 4BANB 1CHGA 1AUJA 3T25A 4BTUB 1C2DA 2WINI 1ZGVA 2NU3E 2QF0A 4AB8A 5HYOA 3W94A 1CGJE 2WPJS 1BJUA 3HGNA 4UDWH 1P06A 2TGDA 4K69A 4TY6A 5AF9H 1CHOF 3KIDU 4DY7B 1ZSKA 1EB2A 1ABIH 2A0QB 4ISOA 2R2WU 1TNIA 2GMTC 1GL0E 3R3GB 1O2YA 4SGBE 2Y5HA 1G37A 4Y8YA 2ZGBH 3W95A 3M5NA 1G30B 2ZU2A 4O03A 1LKAA 4CBOA 2W26A 3TLOA 4X1NU 3CENA 3TVJB 2UUJB 3EA8A 3GCTG 1LKBA 1P2MA 1CU1A 4ZHAA 2BXTH 1O32A 1RD3B 2R3UA 1QIXB 1A7SA 1MKWH 2QGRA 2FOMB 4K1EA 5A0BA 3FZDA 1QBVH 1AU8A 1FAKH 1CBWC 1QQ4A 1OWEA 2BB4A 1OWJA 5EGMA 1ARBA 1SBWA 3ZZ5A 1O2XA 1TLDA 4TWWA 1A3BH 1IQGA 5SGAE 3ODDA 1YCPK 1TQ0B 3D49H 1ELTA 2J95A 5EXLA 3QTVH 3H7TA 2STBE 1W7GH 4I7YH 3UR9A 3BTDE 1GHBF 2XC4A 1SMFE 3E0PB 2BQWB 7LPRA 1Z8GA 2OTVA 1GBMA 2G00A 1V2PT 3R0FA 3V12A 1HAYB 3OU0A 4O9VA 1H8DH 2J4IA 3QN7A 1C4Y2 3F9HA 2GKVE 5EPYA 2PHBA 1XXFA 3AW1A 3TJOA 1QY6A 1TIOA 3MI4A 1J14A 2BX3A 3E3TA 1SGIB 3I78A 1C5QA 1SGNE 2ZQ2A 4HZHA 4THNH 3S7KB 2ZU5A 2V3HH 1XVMA 2BLQA 2A4OA 2TRMA 3BEUA 2XW9A 2NU1E 4U32A 1C1UH 4UONA 2AFQB 1WTGH 1S83A 4ZHMU 1BTUA 8GCHF 4Y76A 1O3MA 5FBIA 3P8GA 1Y5BT 1KSNA 4IBLH 2FZZA 9LPRA 2ZFPH 4TWYA 4D7FA 1A46H 2GD4B 1QRWA 1ETSH 1NRRH 1DX5M 1GBDA 3MO3A 4WWYA 4A1TA 4Y11E 2QA9E 2FPZA 1AB9C 2ALVA 4ZROA 1TGBA 1FY1A 1GDQA 4Y7BA 1P2KA 4Y6DA 4AG1A 3O8CA 2VGCB 3RM2H 2WUBA 4ISLA 2TBSA 3Q77A 5HGGA 4AFUA 1PPCE 1N1LA 1FN8A 2XTTB 1HBTH 1GJAB 1K1NA 2XCNA 1RGQA 1QL9A 3RMOH 4CRCA 1OP8A 1ZPBA 3T29A 3EDXB 3M3TA 1O2VA 3SUEA 3ZVFA 5ABWA 3LDXH 1Q2WA 1HXFH 1LPKB 1NFXA 1ZOMA 1IQFA 4Y0ZE 3T5FH 3M5MA 3U8TH 2PLXA 2AS9A 3UUZA 4BOHA 3T27A 1FY5A 4CRGA 5F6MA 3PMHB 4JK5A 4X1QU 1ABJH 2SFAA 2P8OB 1SHHB 3NZIA 2UUFB 1HJAB 2FEQH 3KL6A 3MHWU 1MTVA 4CRAA 1O2HA 1UMAH 2C8ZB 2FOAA 1BBRH 4YZUA 3MNSA 7GCHG 1UVTH 2Y6TA 3LGWA 3SNAA 3RUOA 1TA6A 1HIAA 1BRAA 3PMJA 4K60A 5ETXA 1GI6A 4JYTA 3P70B 1SI5H 4JCNA 2YOLA 1GBCA 3TITA 4INKA 4IGDA 2JETC 5LPRA 1KDQA 3RMMH 3VFEA 3TJUA 3MH5A 1OYTH 4UD9H 5T3HA 4Z6AH 4MNXA 2QCYA 1E37B 1BITA 1AI8H 2BQ6B 3U98H 1O2LA 3RXEA 1BB0B 1EKBB 3UOUA 1ELCA 1C1QA 3HPTB 4X0WU 4I32A 3WY8A 1CHOG 1UTLM 3TGJE 3NPSA 1E36B 1O3GA 2VWMA 1FY8E 2KAIA 3ENSB 3Q76A 4TYDA 4LZ1H 1Z71A 1GJDB 1N8OB 3ELAH 1HIAB 1VGCC 2Y7XA 2ZDAH 1XX9A 2BD8A 3C1KA 4NA7A 4MDSA 1UCYK 2CJIA 2W7SA 3ZZAA 5CE1A 2BD5A 4X8SH 4UEHH 3SN8A 1LVMA 2FOBA 1KDQB 2CF8H 2PW8H 4ABAA 2JH0D 2STAE 4NFFA 1O37A 4GUXA 1GMDF 2F83A 2VH6A 4JK6A 1L1NA 5GIBA 1ZHRA 1KXCA 1OOKB 5K7RA 2FTMA 1EUFA 1NN6A 3QGJA 2KAIB 3KHVA 4IW4E 1VITF 3CS0A 2FM2A 3OSYA 1ZRBA 3BSQA 1V2VT 1VJ9U 2G4TA 2PTNA 1AFQB 5A8XA 4K8YA 1GHBG 1C5NH 4LZ4B 2XBVA 1O36A 1BRCE 3NXPA 2FMJA 3E90B 4DG4A 2Q1JA 1ZPCA 2HWLB 4D7GA 2XBYA 3SU6A 4BAHB 1DSTA 1LVOA 1EX3A 4Q2KA 3SORA 5JDUB 5EOKA 1Y3UA 1SOZA 2BY8X 4GSOA 1SQTA 5FCRA 1A61H 3Q3YA 1GBKA 4RKJB 2UWLA 3QK1A 1GVZA 3RMNH 1SG8B 1AE8H 2XWBI 1QR3E 1YCPH 1O38A 1ZSJA 4FU9A 1A5HA 1MBMA 8GCHG 2FI4E 3GCHB 4ZH8A 1C2IA 1GGDB 1KY9A 5E2OA 2G55A 4LXBH 1GI9B 1ZMNA 2Z9KA 2B9LA 3TIUA 1H9LB 1HDTH 4R0IA 4ABJA 1C2JA 3SU1A 1ZLRA 4FVDA 5BRRE 3DA9B 1CO7