1ELBA

Analogous inhibitors of elastase do not always bind analogously
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title Analogous inhibitors of elastase do not always bind analogously.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1993-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elbA01
3K65B 4CRCA 1ZMLA 1OXGA 1P0SH 3LPRA 1F2SE 1GBAA 1O34A 1HYLA 1VGCC 1WQVH 2HLCA 2BDAA 2NU3E 1Y5AT 1P12E 1BCUH 3T28A 3Q3YA 3CP7A 3T26A 1XVOA 2O8WA 1AWFH 3F6UH 1H1BA 4R8TB 3RXPA 1CA0C 1S83A 2BVSH 2O9QA 2B8OH 1NY22 2BDYA 3EGKH 3MU1A 3GY3A 2OXSA 1QJ1B 1SPJA 4NFFA 4Q7YA 1A5IA 1ORFA 4CRAA 4I8KA 3SUGA 1GMHG 1QBOA 2M5TA 2FDAA 1GJCB 5C2ZA 4Z6AH 2WV4A 1JBUH 3KF2A 5E0JA 1SGIB 1MH0A 2ZHDA 3GCHB 5J4SA 2QGRA 5HMAA 1DY9A 2Z3CA 3F9FA 2OCVB 1LKAA 2ZTZA 4KKDA 1OPHB 3TITA 2FOMB 1CHOF 5ETXA 4NIVA 2Z7FE 1A3EH 1C5WB 1UO6A 4WMFA 1QIXB 2CJIA 2Z9GA 2CF8H 2C8XB 5CHAC 2P3TB 2ZHWH 5A8YA 1C5SA 2AERH 2FIRH 1DUEA 3A85A 1VR1H 3QX5H 2R3YA 3TIUA 4ABIA 3TK5A 1TPSA 2Z9KA 4K1SA 4BNRA 1BUIA 3P92A 2IJOB 5LPFA 4B2BA 3F9GA 1HGTH 4GHTA 2B0FA 2ZHQH 4WJG2 4DURA 2UWPA 2JETC 3H7TA 2PKSB 2ZU2A 1HAVA 1HAXB 1P57B 2VNTA 3L33A 2WPMS 4MNWA 1O2RA 1PYTC 2FS8A 4JYUH 1S82A 2J38A 4IMZA 1C2KA 3GY6A 1MTSA 4X6MA 4B73A 1YPMH 2H5CA 1GVZA 3E6PH 1BRAA 1TX6A 2THFB 1MAYA 1AI8H 5K0HA 5FBEA 4YO9A 3ZYEA 3T62A 1UTJA 2PUQH 4AFQA 4WH6A 4SGAE 2BD3A 2SGFE 3BTTE 1P8VC 1J8AA 1TONA 3C1KA 2GX4A 1JRSA 3M3SA 1BBRE 1THRH 3AAVA 1HAHH 2BLVA 1RTLA 1QB6A 1ZHRA 2GCTB 1P11E 3SU4A 5HXFA 1D3TB 4MTBA 2H6MA 1BZXE 4K8BA 5EQSA 3SGAE 1FONA 1HJAB 2PHBA 3RMLH 1FDPA 1T4VH 1MUEB 2Z9JA 3BTME 3MFJA 4CREA 1GI7B 3SI4H 5A09A 2NU1E 4I8GA 5E2PA 2QV1A 2XC0A 1TBRH 3TJUA 4ABBA 1XUIA 3T5FH 2H9HA 1KXAA 1MKWH 1O32A 2ANYA 2W3KA 1DM4B 2RDLA 1GBBA 1OX1A 1BHXF 2FO9A 4WXIA 4DG4A 1GI1A 4FU8A 4KTSA 4UEHH 1NROH 2OC8A 1CHOG 3V0XA 2ILNA 1MU8B 1Y3VA 1P10A 2BY7X 3RU4T 1KXCA 1ZOMA 4FVBA 4MPWA 1AD8H 1ZGIA 2BLOA 1NRNH 2VIQA 3IWMA 5DK1A 4X6OA 3HATH 1HB0B 2I6SA 3TGKE 1XX9A 4ZUHA 3ZYDA 5C1UA 3LONA 5JPMH 1TPOA 1KLTA 3UR6A 4DOQA 1J17T 5C5NA 3VXFH 1S0RA 1UTNA 1AZZA 1BMLA 1SGNE 3PLPA 1XKAC 1QL7A 2F3CE 2W7SA 3P17H 3F68H 4Y0ZE 7LPRA 4B2AA 1GBKA 2VIPA 1SLVB 2ODYB 3NK8A 3PLKA 1O3MA 3SN8A 3UY9A 1SOTA 4NGAH 4UFEH 2BY6X 4FUBA 4M7GA 3NCLA 4OGYA 3P6ZB 2A7HA 2OQ5A 1UTOA 1C5OH 1NC6A 1J9CH 1O5AB 2A4GA 2UUYA 1GHVH 1S6FA 1EP5A 1EAXA 1GPZA 2J9NA 2ZNKH 3GDSA 1ZTLA 3RXRA 1P2QA 4MQAA 1D3PB 1CQQA 1NRRH 4MNXA 1GHXH 4H6SB 1DLKB 5EGMA 2ZWLH 2BDIA 2G4TA 2ANMH 2J4IA 1ZSJA 3OTJE 1C5VA 1W7XH 3TPIZ 1P04A 3SV9A 1OWJA 2JH6D 2ZDNA 4ISOA 1SGPE 4YT6H 4ISLA 2A32A 3BSQA 5H4IB 3HGNA 3W94A 1A46H 1IOEA 1BMMH 2EI6A 3ATKA 3BTFE 4I8LA 1O2TA 1SL3A 1TGCA 2Y5GA 4NCYA 2ZPQA 4XFQA 4B1TA 3GCHC 1Z8GA 2DUCA 1HUTH 1GCTC 1MCVA 5EQQA 4KTUA 1W8BH 1C5UA 4IS5A 2G8TA 5FPYA 1ELCA 1O38A 1D4PB 2ZTXA 3H5CB 2FS9A 1AUTC 1CT4E 1K28D 1FPHH 1MKXK 1LHCH 1G37A 3R3GB 2FM2A 3P8GA 3M7TA 4BTUB 4AFSA 2WYJA 2GZ9A 3RM0H 2ZU3A 1J16A 2PTNA 2G5VA 3U8TH 6CHAB 2VWOA 5HM2A 3RUOA 1O2YA 1TPPA 1ZMJA 4O97A 1ZYOA 2WPIS 1CHGA 1H4WA 4X2XA 2Z9LA 5C3NA 2ZO3H 3FZZA 5DP3A 3ESTA 1SQTA 1ELFA 2OC1A 2ZP0H 1TMUH 3M5OA 1PQAA 1TBZH 1KIGH 3TH3H 1SOZA 4D7GA 2QXGA 3ENSB 1Y59T 3M37A 4NSVA 5C1XA 1YP9A 2TGTA 2PKSC 1AY6H 2FX6A 1ZJKA 1V2OT 3LGUA 1EJAA 5PTPA 1TA2A 3MNXA 1P2IA 2GT7A 2OD3B 3B8JA 3C27B 3UNRA 2NU2E 4TPIZ 3SHAH 1BB0B 2OP9A 3E91A 5E0GA 3GCOA 1GBFA 4RKJB 1UCYK 1TRMA 1OSSA 2D2DA 3SQEE 3I77A 2G5NA 1F0RA 1GHZA 5HGGA 1VJ9U 3DFJA 3VB4A 2AGEX 2XC5A 4A1VA 2WUBA 2P95A 1L0ZA 3PV4A 4IBLH 8ESTE 5DJ7A 1K1PA 1GBCA 1ZZZA 2QCYA 1HLTH 1SC8U 2GCTC 3U1IB 2FOAA 2V0BA 2ZFPH 1WAYB 1GI4A 3K9XB 4JCNA 2ZG0H 3P8FA 1BIOA 4X1QU 5DPAA 3UWJH 1E0FD 4E06H 2IOTA 2GMTB 4OS2A 2WPKS 1Y3WA 1SGDE 4GHQA 3MOCA 2FOFA 1O2UA 2ZFTA 5F03A 3U9AH 1EXFA 1TYNA 2J92A 1AIXH 4CH2B 1ESTA 2G4UA 1HAOH 1SMFE 4LK4A 3ZZBA 1A4WH 1IQLA 1S81A 5F6MA 1VGCB 2Z6BD 2QXIA 3TJNA 3Q77A 1V2TT 4ABFA 2WPJS 1KDQA 5EW2H 1IQFA 1MMJN 1K9OE 1EZUC 1DY8A 2XXLA 2BOKA 5F8TA 2Z3EA 2Y80A 4ISNA 2HALA 1VZQH 3K6ZA 1Y5UT 2G55A 1C1UH 4TY6A 1GMCG 3UNQA 5AF9H 1O2XA 1XVMA 1YPHE 1QTFA 4ZH8A 3E0PB 1V2LT 3SJ9A 1DX5M 4Q2KA 4FUDA 9ESTA 3SUEA 1DSUA 3B9FH 1WYKA 1KXEA 4ZXXH 7KMEH 1K1MA 1V2PT 1XXDA 1J15A 1LHGH 1ARBA 2AH4X 1O5FH 4B74A 1T8MA 3MNCA 4K2YA 1BJVA 2EA3A 3TK9A 3TJVA 2SGPE 2XCFA 2J95A 4NA7A 2VIOA 1HCGA 1QQUA 1C5MD 1YC0A 1LCYA 2P8OC 1BMAA 2VVUA 3BEFB 5CHAB 1C2MA 2BXTH 1TMBH 3A8CA 3UQOA 1Z71A 4J1YA 4DCDA 4X1SU 1LVYA 3HK3B 2BD7A 5HM9A 1BRUP 8LPRA 2PSXA 2PWXA 1K1JA 2ZGXH 3FP6E 1BRCE 2A2XH 3R0FA 1K1IA 4NSYA 2JETB 4MPVA 1EPTA 1XUKA 3O8BA 2HNTE 5DP4A 4BXWA 4FUEA 4ASHA 1GMDG 1AFEH 1F5RA 1F0UA 2XBXA 1L4ZA 3DT0H 1P2KA 1MKXH 4LOYH 2Q1JA 1O2JA 1UTPA 2ANWA 3UUZA 3ZZ9A 5L6NH 4ZKOU 2BYAX 5F8XA 1CA8B 1X7AC 4ZHLU 5EOKA 3EA8A 1EAIA 2UUJB 3E0NB 3RXUA 2F83A 4PROA 2AMPA 1FLEE 4JK6A 1ZHPA 1U6QA 2A45B 3JZ2B 2QN5T 3M3TA 5GCHF 3GY7A 2WPHS 2P3UB 1T31A 1O3CA 5EG4A 1F5LA 1SQOA 1P05A 2ZDAH 5IYTA 1TGNA 1O2WA 2JH5D 3BEIB 3KQEA 3QTVH 2PKAA 1VITH 1V3XA 2IPHA 3VGCB 2PGBB 6CHAC 3LGIA 1C5YB 3QUMP 3SU3A 1QGFA 1AKSB 2FZZA 2BQWB 5JB9S 1EJNA 3O8DA 4BAOB 4YLQH 1SG8B 3SORA 1O5GH 1NRSH 4MNVA 2A4QA 3S69A 1UCYH 5JBTA 1A5HA 2TRMA 1O5EH 3A81A 4WWYA 3U69H 1K1OA 4A1TA 1ZHMA 5DP7A 1QB9A 4FUCA 1T8NA 3FP7E 4YLUA 1Q3XA 4I8HA 4ABAA 3UFAA 4MNYA 4NZQA 1GDUA 3LDXH 4NIWA 1C1NA 4XBCA 1MU6B 2FEQH 2FOBA 2GZ7A 1AB9C 5EODA 2ZU4A 1C5TA 3RXBA 1Z8RA 4ZKNU 1TNGA 1OP8A 1DOJA 3OU0A 1UJ1A 1CGIE 1HAVB 3B23B 3FZDA 2FOCA 2VH6A 2D8WA 1GVKB 1QBVH 1HAYB 4Y11E 2ZGBH 1V2UT 3QTOH 5LPEA 1PYTD 1ELVA 5CE1A 4BXSA 1NFXA 3A8BA 2FWWA 2ZEBA 3GCNA 1ELTA 2CGAA 4ABDA 1QR3E 1RTKA 4AFZA 4I33A 4RSPA 3SNDA 2F9OA 1SHHB 1O36A 1ZRBA 1YM0A 3RC5A 4ABHA 3QGJA 1JRTA 1TX7A 2Y5HA 1GHAF 1W12U 1NPMA 4Q7XA 1FIZA 3FAOA 3RC4A 4CR9A 2Y7XA 3DFLA 3U1JB 4IW4E 4YZUA 2GMTC 3VB7A 1AUJA 2EC9H 5DKMA 1BITA 4KELA 5FCRA 1TALA 1LVMA 1VITF 1ZPBA 2B5TB 4GUXA 3BF6H 3ATLA 1LMWB 2ZFRH 4TWWA 4Y8ZA 1D3DB 2FI5E 3LKWA 1OOKB 4DVAU 1DLEA 3W95A 5GCHG 3KHVA 3EE0B 3VEQB 2CHAC 3E16B 4ZROA 3RXCA 2Q6DA 2ZA5A 3VXEH 2V35A 1S5SA 3UR9A 2B9LA 4KP0A 3QGNB 2BVXH 3OYPA 1FY3A 2EI7A 2ZCLP 1FAKH 1FJSA 3A8DA 5GPIB 3TGJE 1E35B 3UREA 3M61U 1TQ7B 1C1TA 2NU4E 3M3VA 1CGHA 2HPQH 3ZZ5A 4D8NA 5GXPA 2ZDLA 3BIUH 3A84A 5C1YA 1GCTB 3MH7A 2AIPA 1QJ6B 1RIWB 2ZFQH 1DWDH 1DE7H 5ABWA 3GY2A 2HWLB 1TMTH 1AGJA 1TABE 5JBCS 1HDTH 2Z9IA 3SU5A 5A8XA 3BIVH 2VB0A 1G36A 1JOUB 3BEUA 1O2SA 3LJJA 1CSOE 1GJ9B 1LDTT 2Y5FA 4CR5A 1DT2A 1DITH 4CRDA 4AX9H 3MH4A 1TNJA 3A7YA 4NZLA 2PLXA 1C1PA 3PWCA 2ZFSA 1YCPM 1T4UH 1RS0A 1VCPA 3EYDA 3LH1A 1QJ7B 5A0AE 2FYQA 3WY8A 1NU9A 2QA9E 1KLIH 2F9PA 5AHGH 4JYVH 3UNSA 1QRXA 4JZDH 3MU8A 5TCCA 1H9HE 3BTKE 2VWMA 3MHWU 3GDVA 1W7GH 1GHAG 4IMQA 1TAWA 4GCHF 1UCYE 1BRBE 1ESBA 2ZDVH 5T6FA 2ZFFH 2ZZUH 4SGBE 2TGAA 5JYIA 3SJIA 2HGTH 1SI5H 2FI4E 1CVWH 3LGVA 1VITG 2OINA 2G81E 1AU8A 4CRGA 1KY9A 1ELGA 4FXGH 2DE9A 1BTWA 1C4U2 3TH2H 2Z3DA 5JBBS 4DW2U 1ABIH 1Z8JB 3BG8A 1GBJA 1G2MA 1DUAA 2G51A 4GLYA 2XWBI 3TLOA 1AHTH 1TQ0B 5C20A 1EZSC 3VGCC 1EOLA 3TH4H 1GHBF 2F9VA 1O2LA 3SO3A 4THNH 4BTTB 5DP6A 1FY1A 1NRQH 1ETTH 1WBGB 1P06A 4JYTA 1GI8B 4DY7B 2C8WB 2O8LA 1SGCA 1F7ZA 1TNIA 4TPYA 8GCHF 1PQ5A 2KAIA 1Z1IA 3DHKH 3TJOA 1F0SA 1V2WT 3HKJB 3LT3A 4X2VA 4FU9A 3ZVFA 2BXUH 2H9EH 3G01A 3ZZ7A 1GDQA 1T32A 2UUFB 3RXIA 1D3QB 1GI5A 3ELAH 1HV7A 3MYWA 1ETRH 3BTHE 4FUHA 2LNCA 2WV5A 1TLDA 2ZDMA 1LHEH 3ITIA 1O30A 3LH3A 3SUFA 5FCKA 1KYNA 3GISB 4XBDA 4AZ2B 2B7DH 1BQYA 2VWNA 1G3BA 4Y6DA 4IN1A 1NFWA 3VPKA 2ZPSA 3KQBA 2RA3A 1UHBA 1BTUA 3MTYA 5GWZA 3RLWH 1A61H 1C1VH 4X1RU 1UK4A 1HPGA 4Q7ZA 1C1WH 1UTQA 3RXHA 4MG3A 2WYGA 2WUCA 1NT1A 3BTWE 1MTUA 1TBQH 5JB8S 2PGQB 2BMGB 4AGKA 1IHSH 4Y8XA 3RXVA 1K22H 2QC2A 1OYQA 1GJ4H 2XW9A 3ZVCA 1CBWC 1TOMH 1F92A 1K1LA 2P8OB 5JBAS 1FY5A 2BD4A 2A1DB 1DANH 2SGAA 1SGFA 5L30H 1BTYA 1P3CA 2Y6TA 1O0DH 3A7XA 3LGTA 1C2DA 3ZV9A 2QF3A 1GJ7B 3SJKA 2PW8H 4IGDA 1MTWA 2J34A 1FV9A 1ZLRA 1UVPA 1GJ6A 2A0QB 5EU8A 3TGIE 1BOQA 2ZGCA 3SGBE 2FX4A 2FOGA 5FPSA 1PQ8A 1TNLA 1WV7H 1P2MA 4X1NU 5EXNA 3M7UA 1W13U 3UIRA 3PTBA 1SBWA 4ZKRU 2GT8A 3TK6A 2XBVA 1A0HB 3KCGH 4CBNA 1N8OB 1UK3A 3A7VA 5GDSH 4K8YA 3UOPA 2ESTE 3MH5A 1W0ZU 1EZQA 4LZ4B 1IQKA 3NUMA 3CS0A 3GCTF 4AG1A 1YBWA 1RIWC 5EXLA 1INCA 1GI6A 3MWIU 3KN2A 3RU4E 1FXYA 1JWTA 3EA9A 3LGWA 2VINA 1SLWB 1AE8H 1GVLA 1G32B 2GV6A 1MTNB 2A5KA 1DPOA 1P9SA 4J2YB 3KQDA 3EAJA 3SBKA 1Z1JA 1JIRA 2XC4A 1OYTH 3Q3KA 3SOSA 3V7TA 4A7IB 6GCHF 4OS6A 1DXPA 1V2JT 4NG9H 2Q6FA 4MVNA 1DXWA 1H9LB 1O3PB 6LPRA 5LPRA 2I6QA 5GIBA 1O35A 3IG6B 5C5OA 3NXPA 3HPTB 1O3NA 5CMXH 1UK2A 1WTHD 1SGRE 2F9UA 3F9HA 3URCA 4AN7A 1SGFG 3T29A 3STJA 1GBHA 2BDCA 2OQUA 1GG6B 3FVFB 3RMMH 1Y8TA 2RA0A 2GKVE 4HFPB 1IQMA 1EPTB 1S0QA 3NZIA 2OC7A 1AB9B 5FXLA 1W14U 5T6DA 2ZHFH 1HJ8A 3PB1E 1P01A 1CE5A 1QRZA 3HKIB 1AVXA 3QLPH 1E37B 2O8UA 3A83A 1EATA 2ZPRA 4HTCH 2NWNA 4X6PA 1Y3YA 4K5ZA 3UOUA 1S85A 1HIAB 1QA0A 2BX4A 1P2OA 3Q00A 4XE4A 3RXSA 3RXQA 4WH8A 1SFIA 5ESTE 2CF9H 4Y76A 5HYOA 1A0LA 2ZKSA 5FPTA 1FI8A 1V2VT 1B0FA 2GDEH 3S7KB 1C5QA 2LPRA 2BDGA 2A31A 1NU7B 1BDAA 1PPGE 1PJPA 3OX7U 3ZV8A 1AN1E 1AO5A 3ATMA 1ZJDA 1IQNA 2FXRA 1HXEH 1BTZA 5AVDA 3LJOA 7GCHF 2TPIZ 2CHAB 2VGCC 3F1SB 1NFYA 1WOFA 2QIQA 2ZU5A 1OWHA 4FVDA 1JMOH 3F9EA 3SU0A 4AB8A 1EAUA 2PV9B 1PPFE 1HAZB 2VVVA 2BY8X 3ZVAA 1NO9H 1SQAA 4INLA 2BOHB 1N6XA 1KXFA 3PLBA 5DP9A 2FPZA 4HI3A 3SHCH 1G30B 1YPGH 1K21H 3QWCH 1TX8A 2ZGJA 2ALVA 1KTSB 1YPJH 1OWIA 1ZMNA 3T25A 4BAHB 3AW1A 2YNAA 2GD4B 1RD3B 3MI4A 4JZ1A 4WXVA 4A5TS 1EOJA 5AFYH 1O2HA 4TWYA 2O8TA 1YPHC 1UTKA 1QL9A 5E2OA 1QBNA 2ZI2H 1WUNH 3QDZB 1O37A 4FUJA 5TJXA 1IQIA 4X8SH 1HXFH 2BLWA 2NU0E 3T27A 1LQEA 3MO6A 2DE8A 1P02A 1AMHA 4CBOA 1BT7A 2FLRH 1N1LA 7ESTE 1W0YH 1CGJE 1TGSZ 3D65E 2P93A 1OWDA 3KQCA 3O8RA 3RXKA 4K1TA 3GICB 1O2NA 3M5LA 3RMNH 1C1RA 2ZIQH 1MTVA 1W11U 1YCPK 4U01A 4INHA 1THPB 2VIDA 1TB6H 4TY7A 3T2NA 1GJDB 2ZCHP 2SGEE 4BTIB 1B5GH 1B0EA 1NM6A 1N8OC 5TCAA 2FESH 5LH8A 4WMDA 1YPKH 4NIXA 3QZRA 1GBTA 3HK6B 3P70B 2BDBA 2PUXB 2OUAA 1O3LA 4R0IA 2A4OA 1FN8A 3A88A 2SNVA 2HNTC 1PQ7A 1TNKA 1E36B 1BA8B 3SU2A 4X8VH 2FOHA 3PM3A 3ZVBA 3LIWA 4BAQB 1BMNH 2VIVA 1Z7KA 1M9UA 1C5ZB 2HPPH 7GCHG 2GTBA 1AQ7A 1MTNC 5J4QA 2R2WU 1A2CH 1O3FA 1AWHB 2RG3A 2FMJA 4A1XA 1GBDA 2QYIA 4ZHAA 4BOHA 1B7XB 4O3UA 2ZDKA 3ODDA 4X8TH 3Q76A 1KTTB 3RXEA 3SU6A 2C93B 2AYWA 3BTDE 4X2YA 5ESBA 4AYYB 1GL0E 1O2ZA 2QXJA 1C2IA 3ODFA 4JMYA 1GMHF 2BVRH 2C8YB 4FUGA 3GYLB 4OGXA 1ETSH 4FUFA 3D62A 4NFEA 1IQEA 1GG6C 1YKTA 2AGIX 1NS3A 1FQ3A 3DUXH 5DGJA 4CRFA 3URDA 2BD2A 1EPTC 1YPEH 2CMYA 1L1GA 4KGAA 3KIDU 3PMHB 4AORA 4FU7A 4GPGA 1JIMA 3JZ1B 1QHRB 3SV2H 3GY8A 5FHTA 1O39A 1P03A 3Q3XA 4NA8A 3DA9B 1O2QA 2EEKA 3BTEE 1NESE 1SGQE 1ZR0A 2BX3A 1ANEA 1MAXA 4E05H 4GVUA 2BHGA 1O5DH 1O2VA 2F9BH 4ISHH 1O3GA 4Y0YE 1T8OA 1ZSLA 1UVOA 1A1RA 3SUDA 2G00A 1CBWB 1SFQB 1TIOA 1H8DH 3ZZDA 1DWCH 3RXDA 1YYY1 1GJ5H 1DICA 1K1NA 8KME2 1DS2E 3QO6A 1GWAA 2BLQA 4H6TA 4YOIA 4YT7H 1RJXB 2AMQA 3SNAA 5T3HA 3ZZAA 1SLUB 3SV8A 3RM2H 1PFXC 1O3JA 2ZF0H 3SNBA 3CS7A 1VJAU 3M36A 1AVGH 1MBQA 3CENA 1O2PA 2ZHEH 2CN0H 3D23A 1GL1A 2KAIB 3UWIA 1C9PA 1MCTA 2P94A 4Y7AA 1H9IE 3MNBA 1FUJA 3N7OA 1ELBA 2BD8A 1GHWH 3ZZ3A 2SGQE 4YESB 3IITA 4I31A 2A5IA 1OWKA 1MQ5A 1QQ4A 3KL6A 4Y8YA 1EUFA 3A7TA 2VJ1A 4H42U 2FTLE 2XBYA 2C8ZB 1MQ6A 3PWBA 5E8EH 4Y10E 5A0CA 4JZIA 4X6NA 5BPEA 1BHXB 1G3DA 1C2LA 4D9QA 1DWBH 1UHBB 1UVSH 3O8CA 3MO9A 1SHYA 3A87A 1JXPA 1YCPH 1J14A 1S84A 1UMAH 1HJ9A 1HAGE 3VFEA 1L2EA 4CH8B 1G3CA 3A80A 1O3HA 3RXOA 3L6PA 2XRCA 5G4BA 3QK1A 1TGBA 1AKSA 2H2ZA 4AG2A 1V6DA 1FAXA 4UDWH 3RC6A 4MDSA 1GBLA 4AOQA 1XMNB 1LHFH 3E90B 5EPNA 3S9AA 1NRPH 1EP6A 1MD8A 1L1NA 3MH6A 2UWOA 3EQ0H 3M7QA 4UE7H 2K1QA 1TA6A 3UQVA 1C4V2 3BG4C 1NZQH 4U2WA 4D9RA 3PO1B 3ZZ4A 2FLBH 1GGDC 4B75A 1AZ8A 2QY0B 2FTMA 5A2MH 3KEEA 1AFQB 2CV3A 2QF0A 2C3SA 1GJBB 2YOLA 2FODA 4H4FA 1WCZA 1FIWA 1CO7E 4E7RG 4X2WA 5I25A 3SGQE 4YTAA 3AW0A 4UFDH 1XUHA 4QT8C 4UFGH 4O3TA 3M5MA 3SU1A 2XTTB 4I32A 1C1OA 3KGPA 5SGAE 2WPLS 1C2HA 3I29A 1YF4A 4HZHA 4MPXA 5B6OA 4A6LA 1KSNA 2GVFA 1O3DA 1D6WA 1L4DA 2BY5X 3A89A 4IN2A 4YOGA 3EDXB 1PPBH 2BDHA 4NWKA 4AB9A 1UTMA 4WVPE 1SLXB 1QY6A 1Q31A 2CXVA 4AFUA 1QL8A 2AIQA 3SI3H 5DG6A 4OS1A 4XOJA 2OLGA 4AYVB 1TNHA 3S7HB 3BTGE 1E34B 1ELDE 1DDJA 3E3TA 1KLJH 2VGCB 1LHDH 2ZU1A 3RU4D 1RTFB 3UTUH 1K2I1 4MPUA 3AASA 3VB6A 2VVCA 4O9VA 3AVZA 1HFDA 2R9PA 5JDUB 1NTPA 2ZCKP 2XYAA 4B71A 2D26C 1LTOA 1AVWA 5C67A 1Z6EA 1OP2A 4U30A 2HVXA 1C2GA 4WF8A 2F9NA 2AGGX 4DGJA 3K2UA 3RXGA 2BTCE 1V2RT 2QXHA 2HRVA 3ZZCA 3OSYA 2ULLA 1O3EA 4VGCC 3SZNA 1W2KH 2AEIH 2IN2A 1LVOA 2ALPA 1YGCH 2ZECA 4X1PU 1G9IE 2SGDE 1OS8A 4NA9H 1EX3A 1ID5H 1V2KT 3NWUA 1A7SA 1CU1A 1TRYA 4GCHG 1SVPA 5IDKA 1O31A 1A3BH 1WU1A 4JZFH 3TU7H 1TFXA 1C9TA 1HBTH 1SSXA 5GJ4B 1FY4A 3TVJB 1O3IA 2GV7A 1HRTH 1HAPH 3PMJA 1GDNA 2STAE 4ZMAH 1SB1H 2GDDA 4INKA 4CRBA 1F0TA 5F8ZA 3S0NA 4NIYA 1MBMA 4ABJA 1LQDB 1SGYE 5DO4H 3M35A 1EB2A 1KDQB 1BTXA 2W26A 1P2NA 1O5BB 1GHBG 3U8OH 3ZZ6A 5L2YH 4Q80A 3RXJA 3PTNA 3LGYA 1C2EA 1C2FA 2R2MB 2V3OH 1OKXA 5E0HA 1C2JA 1LPGB 5K7RA 2O8MA 3QN7A 4YM9A 2BZ6H 1EJMA 1XUFA 2QAAA 1PPZA 8GCHG 1MZDA 4WY3A 3A82A 4E7NA 4OS7A 2XBWA 1TPAE 3NPSA 4RN6A 5L2ZH 2ZGHA 4UFFH 3L3TA 1QB1A 1SGEE 4U32A 1IAUA 2Y81A 2BQ7B 3P8NA 4ESTE 2R0LA 4LZ1H 4OS4A 1G2LA 2TBSA 2SNWA 2OTVA 3KNXA 1O3BA 1EKBB 4ZHMU 1TGTA 2H1UA 1WSSH 4D76A 2UUKB 3U8RH 1VCWA 1ANDA 2W5EA 2P59A 1IQHA 1GMCF 1Z6JH 1O3KA 2C90B 2J94A 2D1JA 3RXLA 1EB1H 1A0JA 2STBE 2Z94A 4UD9H 4X8UH 1V2NT 2TGPZ 1GJ8B 3RLYH 1XKBC 2P16A 2HOBA 1Q2WA 1GCDA 1C4Y2 3A7WA 3PO1C 4HGCA 3P95A 1KXBA 2V6NA 1V2ST 2Y82A 1IQGA 6ESTA 1LVBA 1GJAB 1AFQC 4ZAEA 4DT7B 2A7CA 3SNEA 4UONA 1ESAA 3GY5A 2GP9B 2ODQA 1C1QA 1XXFA 1GBMA 1NN6A 4Y79A 1H8IH 4BANB 4CHAB 4ABEA 2PSYA 1FZZA 1O2GH 4ZXYH 1S6HA 5T6GA 5A0BA 2GZ8A 1QCPA 1TRNA 3SJ8A 1RFNA 3V12A 3MO3A 1TOCB 3GYMA 3FANA 4ABGA 3RMOH 1FNIA 1EQ9A 1ELEE 1PPEE 1GI3A 1GMDF 1LKBA 4NWLA 1GHYH 3RXTA 2PKAB 1C1SA 1Z8IB 3LC3A 3D49H 4ZKSU 3SNCA 3GCTG 3SV7A 1BBRK 2P3FH 1XM1A 1O5CB 1HJAC 3PYHA 2ZC9H 4MLFB 4YOJA 3E1XB 2HNTF 4DJZB 4F4OC 2VWLA 1O2MA 1WQSA 1OWEA 3ZZ8A 5EPYA 3ATIA 1ACBE 4K69A 4Y7BA 1PPCE 2RCEA 3PMBB 1P3EA 3BN9A 1TWXB 1CA0B 1DSTA 2A7JA 1O2OA 3E8LA 6GCHG 1T7CA 1CT0E 1N6YA 5A8ZA 2AFQB 1YPLH 5DP5A 3SV6A 2R0KA 1L1JA 2FI3E 4K3JA 9LPRA 1UVUH 1ANBA 4TYDA 1GI0A 1Y5BT 1HNEE 4AGJA 4DIHH 3HGPA 5EW1H 1UTLM 1ZPCA 4O03A 1E38B 1ANCA 1KXDA 1SGTA 3RXAA 3PMAB 1YLDA 4GAWA 4JK5A 2BD5A 1XUGA 2EI8A 2GCHF 1QRWA 1C1MA 2BM2A 3SW2B 2H5DA 1RXPA 2YNBA 1O33A 3P8OA 3V3MA 4F49A 2OBOA 3FFGA 4XBBA 4BAKB 2W3IA 2TGDA 1C5LH 1FMGA 2AMDA 2VIWA 1A5GH 3LOXA 1W3CA 2XWAA 1PPHE 1DWEH 1IHTH 2Q6GA 1XUJA 3S9BA 5LGOA 1P9UA 1OP0A 1D6RA 5EXMA 3PROA 1ZGVA 1GI2A 2ANKH 5AFZH 3SQHE 3NKKA 2UWLA 2H9TH 1DVAH 4WMEA 1ZRKA 1G3EA 2Y7ZA 1VCQA 3BG4B 4I8JA 3TNSA 2F91A 4B76A 1GGDB 3M5NA 1ZSKA 4I7YH 1LPKB 3MU5A 1RRKA 2XNIA 4XDEA 1IQJA 4JZEH 2G52A 3K6YA 1D9IA 1C5RA 4K1EA 5FAHA 3SJOA 3I78A 3GOVB 2JKHA 1GBIA 1YLCA 3VB3A 3OY6U 2OBQA 5I46H 2A2QH 2C4FH 5FX6A 4IC6A 1HIAA 5DP8A 3LC5A 4GSOA 1O2KA 1C5PA 1ZTKA 1TE0A 1BJUA 1MZAA 1ZTJA 3FP8E 3BTQE 1P09A 1ELAA 1DFPA 2ZQ2A 1EZXC 2OC0A 4Z0KA 3GY4A 2PTCE 3QZQA 3RXMA 1C5NH 2R3UA 1EAWA 2VH0A 3EA7A 3LU9B 2A4RA 1EASA 3STIA 2SFAA 1F5KU 2BQ6B 1RGQA 1THSH 1QA7A 3V13A 1BTPA 2PR3A 1AE5A 1O2IA 2V3HH 2WINI 2ZQ1A 4IC5A 5FX5A 4OS5A 3VB5A 1NFUA 3DD2H 1T8LA 4Y71A 3UPEA 2TIOA 4ISIH 1Y3UA 1ARCA 3MNSA 2ODPA 3A86A 1SR5C 3H7OA 2AS9A 1C5XB 1CT2E 1ZPZA 2GCHG 5EQRA 3RDZA 4RKOB 2XCNA 3OY5U 2FOEA 4K60A 1UVTH 1V2QT 4X0WU 1HAIH 1O3AA 1FPCH 2JH0D 4A92A 1P2JA 2PFEA 2BZAA 1MD7A 1QNJA 2GGVB 1QFKH 1FN6A 2BY9X 3BV9B 3ZVDA 3RXFA 4B2CA 3U98H 2ZTYA 3AAUA 4CHAC 4DIIH 3GDUA 3MMGA 1BBRH 4VGCB 4D7FA 2BB4A 2FP7B 1MKWK 4LXBH 1FY8E 2W7UA 1V2MT 1LO6A 2FYRA 3ZVGA 3A7ZA 3ATWA 3TNTA 5FBIA 1LPZB 3ZVEA 4KTCA 2A5AA 2VU8E 3RP2A 1WTGH 4XSKU 1W10U 2ASUB 1Y3XA 1ABJH 1BTHH 1GBEA 1O3OA 5BRRE 3MU0A 4FUIA 3MU4A 4BAMB 3S9CA 2BD9A 3A8AA 1GI9B 1QURH 2J2UA
chains in the Genus database with same CATH superfamily
3K65B 4CRCA 1ZMLA 1OXGA 1P0SH 3LPRA 1F2SE 1GBAA 1O34A 1HYLA 1VGCC 1WQVH 2HLCA 2BDAA 2NU3E 1Y5AT 1P12E 1BCUH 3T28A 3Q3YA 3CP7A 3T26A 1XVOA 1WXRA 2O8WA 1AWFH 3F6UH 1H1BA 4R8TB 3RXPA 1CA0C 1S83A 2BVSH 2O9QA 2B8OH 1NY22 2BDYA 3EGKH 3MU1A 3GY3A 3EE7A 2OXSA 1QJ1B 1SPJA 4NFFA 4Q7YA 1A5IA 1ORFA 4CRAA 4I8KA 3SUGA 1GMHG 3MQKC 1QBOA 2M5TA 2FDAA 1GJCB 3FN8A 5C2ZA 4Z6AH 2WV4A 1JBUH 3KF2A 5E0JA 2L6OA 1SGIB 1MH0A 2ZHDA 3GCHB 5J4SA 2QGRA 5HMAA 1DY9A 2Z3CA 3F9FA 2OCVB 1LKAA 2ZTZA 4KKDA 1OPHB 3TITA 2FOMB 1CHOF 5ETXA 4NIVA 2Z7FE 2JIZD 1A3EH 5C17A 1C5WB 2JDID 1UO6A 4WMFA 1QIXB 2CJIA 2Z9GA 2CF8H 2C8XB 5CHAC 2P3TB 2ZHWH 5A8YA 1C5SA 2AERH 2FIRH 1DUEA 3A85A 1VR1H 3QX5H 1W0JD 2R3YA 3TIUA 4ABIA 3TK5A 1TPSA 2Z9KA 4K1SA 4BNRA 1BUIA 3P92A 2IJOB 5LPFA 4B2BA 3F9GA 1HGTH 4GHTA 2B0FA 2ZHQH 4WJG2 4DURA 2UWPA 2JETC 3H7TA 2PKSB 2KCAA 2ZU2A 1HAVA 1HAXB 1P57B 2V3MA 2VNTA 3SYJA 3L33A 2WPMS 4MNWA 1O2RA 1PYTC 2FS8A 4JYUH 1S82A 2J38A 4IMZA 1C2KA 3GY6A 1MTSA 4I86A 4X6MA 4B73A 1YPMH 2H5CA 1GVZA 3E6PH 3WWFA 1BRAA 4ASUD 1TX6A 2THFB 1MAYA 1AI8H 5K0HA 5FBEA 4M9FA 4YO9A 3ZYEA 3T62A 1UTJA 2PUQH 4AFQA 4WH6A 4SGAE 2BD3A 2SGFE 3BTTE 1P8VC 1J8AA 1TONA 3C1KA 2GX4A 5C0UA 1JRSA 3M3SA 1BBRE 1THRH 3AAVA 1HAHH 2BLVA 1RTLA 1QB6A 1ZHRA 2GCTB 1P11E 3SU4A 5HXFA 1D3TB 4MTBA 2H6MA 1BZXE 4K8BA 5EQSA 3SGAE 1FONA 1HJAB 2PHBA 3RMLH 1FDPA 1T4VH 1MUEB 2Z9JA 3BTME 3MFJA 4CREA 1GI7B 3SI4H 5A09A 2NU1E 4I8GA 5E2PA 2KZ4A 2QV1A 1TBRH 2XC0A 3TJUA 1XUIA 3T5FH 2H9HA 4ABBA 1KXAA 1MKWH 1O32A 2ANYA 2YMSC 2W3KA 1DM4B 2RDLA 1GBBA 1OX1A 1BHXF 2FO9A 4WXIA 4DG4A 1GI1A 4FU8A 4KTSA 4UEHH 1NROH 2OC8A 1CHOG 3V0XA 2ILNA 1MU8B 1Y3VA 1P10A 2BY7X 3RU4T 1KXCA 1ZOMA 4FVBA 4MPWA 3DSGA 1AD8H 1ZGIA 2BLOA 1NRNH 2VIQA 3IWMA 5DK1A 4X6OA 3HATH 1HB0B 2I6SA 3TGKE 1XX9A 4ZUHA 3ZYDA 5C1UA 3LONA 5JPMH 1TPOA 1KLTA 3UR6A 4DOQA 1J17T 5C5NA 3VXFH 1S0RA 1UTNA 1AZZA 1BMLA 1SGNE 3PLPA 1XKAC 1QL7A 2F3CE 2W7SA 3P17H 3F68H 4Y0ZE 7LPRA 2PP6A 4B2AA 1GBKA 2VIPA 1SLVB 2ODYB 3NK8A 3PLKA 1O3MA 3SN8A 3UY9A 2F43B 1SOTA 4NGAH 4UFEH 2BY6X 4FUBA 4M7GA 3NCLA 4OGYA 3P6ZB 2A7HA 2OQ5A 1UTOA 1C5OH 1NC6A 1J9CH 1O5AB 2A4GA 2UUYA 1GHVH 2J5UA 1S6FA 1EP5A 1EAXA 1GPZA 2J9NA 2ZNKH 3GDSA 1ZTLA 3RXRA 1P2QA 4MQAA 5IK2D 1D3PB 1CQQA 1NRRH 4MNXA 1GHXH 4H6SB 1DLKB 5EGMA 5CHBA 2ZWLH 2BDIA 2G4TA 1BMFD 2ANMH 2J4IA 1ZSJA 3OTJE 1C5VA 1W7XH 3TPIZ 1P04A 3SV9A 1OWJA 2JH6D 2ZDNA 4ISOA 2JJ1D 1SGPE 4YT6H 4ISLA 2A32A 4Z1MD 3BSQA 5H4IB 3HGNA 3W94A 1A46H 1IOEA 1BMMH 2EI6A 3ATKA 3BTFE 4I8LA 1O2TA 1SL3A 1TGCA 2Y5GA 4NCYA 2ZPQA 4XFQA 4B1TA 3GCHC 1Z8GA 2DUCA 1HUTH 1GCTC 1MCVA 5EQQA 4KTUA 1W8BH 1C5UA 2XOKD 4IS5A 2G8TA 5FPYA 2M2AA 1ELCA 1O38A 1D4PB 2ZTXA 3H5CB 2FS9A 1AUTC 1CT4E 1K28D 1FPHH 1MKXK 1LHCH 1G37A 3F0PA 3R3GB 2FM2A 3P8GA 3M7TA 4BTUB 4AFSA 2WYJA 2GZ9A 3RM0H 2ZU3A 1J16A 2PTNA 2G5VA 3U8TH 6CHAB 2VWOA 5HM2A 3RUOA 1O2YA 1TPPA 1ZMJA 4O97A 1ZYOA 2WPIS 1CHGA 1H4WA 4X2XA 2Z9LA 5C3NA 2ZO3H 3FZZA 5DP3A 3ESTA 1SQTA 1H8ED 1ELFA 2OC1A 2ZP0H 1TMUH 3M5OA 1PQAA 1TBZH 1KIGH 3TH3H 1SOZA 4D7GA 2QXGA 3ENSB 1Y59T 3M37A 4NSVA 5C1XA 1YP9A 2TGTA 2PKSC 1AY6H 2FX6A 1ZJKA 1V2OT 3LGUA 1EJAA 5PTPA 1TA2A 3MNXA 1P2IA 2GT7A 2OD3B 3B8JA 3C27B 3UNRA 2NU2E 4TPIZ 3SHAH 1BB0B 2OP9A 3E91A 5E0GA 3GCOA 1GBFA 4RKJB 1UCYK 1TRMA 1OSSA 2D2DA 3SQEE 3I77A 2G5NA 1F0RA 1GHZA 5HGGA 1VJ9U 3DFJA 3VB4A 2KFWA 2AGEX 2XC5A 4A1VA 2WUBA 2P95A 1L0ZA 3PV4A 4IBLH 8ESTE 5DJ7A 1K1PA 1GBCA 3OEHD 1ZZZA 2QCYA 1HLTH 1NBMD 5HIYA 1SC8U 2GCTC 3U1IB 2FOAA 2V0BA 2ZFPH 1WAYB 1GI4A 3K9XB 4JCNA 2ZG0H 3P8FA 1BIOA 4X1QU 5DPAA 3UWJH 1E0FD 4E06H 2IOTA 2GMTB 4OS2A 2WPKS 1Y3WA 1SGDE 4GHQA 3MOCA 2FOFA 1O2UA 2ZFTA 5F03A 3U9AH 1EXFA 1TYNA 2J92A 1AIXH 4CH2B 1ESTA 2G4UA 1HAOH 1SMFE 4LK4A 3ZZBA 1A4WH 1IQLA 1S81A 5F6MA 1VGCB 2Z6BD 2QXIA 3TJNA 3Q77A 1V2TT 4ABFA 2WPJS 1KDQA 5EW2H 1IQFA 1MMJN 1K9OE 1EZUC 1DY8A 2XXLA 2BOKA 5F8TA 2Z3EA 2IJD1 2Y80A 2W6JD 4ISNA 2HALA 1VZQH 3K6ZA 1Y5UT 2G55A 1C1UH 4YXWD 4TY6A 1GMCG 3UNQA 5AF9H 1O2XA 1XVMA 1YPHE 1QTFA 4ZH8A 3E0PB 1V2LT 3SJ9A 1DX5M 4Q2KA 4FUDA 9ESTA 3SUEA 2KX4A 1DSUA 3B9FH 1WYKA 1KXEA 4ZXXH 7KMEH 1K1MA 1V2PT 1XXDA 1J15A 1LHGH 1ARBA 5EJZA 2AH4X 1O5FH 4B74A 1K0HA 1T8MA 3MNCA 4K2YA 1BJVA 3F0OA 2EA3A 3TK9A 3TJVA 2SGPE 2XCFA 2J95A 4NA7A 2VIOA 1HCGA 1QQUA 1C5MD 1YC0A 1LCYA 2P8OC 1BMAA 2VVUA 3BEFB 5CHAB 1C2MA 2BXTH 1TMBH 3A8CA 3OEED 3UQOA 5KEDA 3UAIC 1Z71A 4J1YA 4DCDA 4X1SU 1LVYA 3HK3B 2BD7A 5HM9A 1BRUP 8LPRA 2PSXA 2PWXA 1K1JA 2ZGXH 3FP6E 1BRCE 2A2XH 3R0FA 1K1IA 4NSYA 2JETB 4MPVA 1EPTA 1XUKA 3O8BA 2HNTE 5DP4A 4BXWA 4FUEA 4ASHA 1GMDG 1AFEH 1F5RA 1F0UA 2XBXA 1L4ZA 3DT0H 1P2KA 1MKXH 4LOYH 2Q1JA 1O2JA 1UTPA 2ANWA 3UUZA 3ZZ9A 5L6NH 4ZKOU 2BYAX 5F8XA 1CA8B 5FL7D 5DSFA 1X7AC 4ZHLU 5EOKA 3EA8A 1EAIA 2UUJB 3E0NB 3RXUA 2F83A 4PROA 2AMPA 1FLEE 4JK6A 1ZHPA 1U6QA 2A45B 2LP6A 3JZ2B 2QN5T 3F2HA 3M3TA 5GCHF 2WZQA 3GY7A 2WPHS 2P3UB 1T31A 1O3CA 5EG4A 1F5LA 1SQOA 1P05A 2ZDAH 5IYTA 1TGNA 1O2WA 2JH5D 3BEIB 3KQEA 3QTVH 2PKAA 1VITH 5EJLA 1V3XA 2IPHA 3VGCB 3AK5A 2PGBB 6CHAC 3LGIA 1C5YB 3QUMP 3SU3A 1QGFA 1AKSB 2FZZA 2BQWB 5JB9S 1EJNA 3O8DA 4BAOB 4YLQH 1SG8B 3SORA 1O5GH 1NRSH 4MNVA 2A4QA 3S69A 1UCYH 5JBTA 1A5HA 2YMSB 2OK5A 2TRMA 1O5EH 3A81A 4WWYA 3U69H 1K1OA 4A1TA 1ZHMA 5DP7A 1QB9A 4FUCA 1T8NA 1WDIA 3FP7E 5HIZA 4YLUA 1Q3XA 4I8HA 4ABAA 3UFAA 4MNYA 4NZQA 1GDUA 3LDXH 4NIWA 1C1NA 4XBCA 1MU6B 2FEQH 2FOBA 2GZ7A 1AB9C 5EODA 5T1VA 2ZU4A 1C5TA 3RXBA 1Z8RA 4ZKNU 1TNGA 1OP8A 1DOJA 3OU0A 1UJ1A 1CGIE 1HAVB 3B23B 3FZDA 2FOCA 2VH6A 2D8WA 1GVKB 1QBVH 4ACBA 4Q63A 1HAYB 4Y11E 2ZGBH 1V2UT 3QTOH 3N7DA 5LPEA 1PYTD 1ELVA 5CE1A 4BXSA 1NFXA 3A8BA 1EFRD 2FWWA 2ZEBA 3GCNA 1ELTA 2CGAA 4ABDA 1QR3E 1RTKA 4AFZA 4I33A 4RSPA 3SNDA 2F9OA 1SHHB 1O36A 1ZRBA 1YM0A 3RC5A 4ABHA 3OAAD 3QGJA 1JRTA 1TX7A 2Y5HA 1GHAF 1W12U 4RT1A 1NPMA 4Q7XA 1FIZA 3FAOA 3RC4A 4CR9A 2Y7XA 2HVYB 3DFLA 3U1JB 4IW4E 4YZUA 2GMTC 3VB7A 1AUJA 2EC9H 5DKMA 1BITA 4KELA 5FCRA 3FOAA 1TALA 1LVMA 1VITF 1ZPBA 2B5TB 4GUXA 3BF6H 3ATLA 5B6LA 1LMWB 2ZFRH 4TWWA 4Y8ZA 1D3DB 2FI5E 3LKWA 1OOKB 4DVAU 4RT0A 1DLEA 3W95A 5GCHG 3KHVA 3EE0B 3VEQB 2CHAC 3E16B 4ZROA 3RXCA 2Q6DA 2ZA5A 3VXEH 2V35A 1S5SA 3UR9A 2B9LA 4KP0A 3QGNB 2BVXH 3OYPA 2YMSD 1FY3A 2EI7A 2ZCLP 1FAKH 1FJSA 3A8DA 5GPIB 3TGJE 1E35B 3UREA 3M61U 1TQ7B 2LELA 1C1TA 2NU4E 3M3VA 1CGHA 2HPQH 3ZZ5A 4D8NA 5GXPA 2ZDLA 3BIUH 3A84A 5C1YA 1GCTB 3MH7A 2AIPA 1QJ6B 1RIWB 2ZFQH 1DWDH 1DE7H 5ABWA 3GY2A 2HWLB 1TMTH 1AGJA 1TABE 5JBCS 1HDTH 2Z9IA 3SU5A 5A8XA 3BIVH 2VB0A 3WW7A 1G36A 1JOUB 3BEUA 1O2SA 3LJJA 1CSOE 1GJ9B 1LDTT 2Y5FA 4CR5A 1DT2A 1DITH 4CRDA 4AX9H 3MH4A 1TNJA 3A7YA 4NZLA 2PLXA 1C1PA 3PWCA 2ZFSA 1YCPM 3KYGA 1T4UH 1RS0A 1VCPA 3EYDA 3LH1A 1QJ7B 5A0AE 2FYQA 3WY8A 1NU9A 2QA9E 1KLIH 2F9PA 5AHGH 4JYVH 3UNSA 1QRXA 4JZDH 3MU8A 5TCCA 1H9HE 3BTKE 2VWMA 3MHWU 3GDVA 1W7GH 1GHAG 2JJ2D 4IMQA 1TAWA 4GCHF 1UCYE 1BRBE 1ESBA 2ZDVH 5T6FA 2ZFFH 2ZZUH 4SGBE 2TGAA 5JYIA 3SJIA 2HGTH 1SI5H 2FI4E 1CVWH 3LGVA 1VITG 2OINA 2G81E 2WPDD 1AU8A 4CRGA 1KY9A 1ELGA 4FXGH 2DE9A 1BTWA 5KECA 1C4U2 3TH2H 2Z3DA 5JBBS 4DW2U 1ABIH 1Z8JB 3BG8A 1GBJA 1G2MA 1DUAA 2G51A 4GLYA 2XWBI 3TLOA 1AHTH 1TQ0B 5C20A 1EZSC 3VGCC 1EOLA 3TH4H 1GHBF 2F9VA 1O2LA 3SO3A 4THNH 4BTTB 5DP6A 1FY1A 1NRQH 1ETTH 1WBGB 1P06A 4JYTA 2CK3D 1GI8B 4DY7B 2C8WB 2O8LA 1SGCA 1F7ZA 1TNIA 4TPYA 4AC9A 8GCHF 1PQ5A 2KAIA 1Z1IA 3DHKH 3TJOA 1F0SA 1V2WT 3HKJB 3LT3A 4X2VA 4FU9A 3ZVFA 2BXUH 2H9EH 3G01A 3ZZ7A 1GDQA 1T32A 2UUFB 3RXIA 1D3QB 1GI5A 3ELAH 1HV7A 3MYWA 1ETRH 3BTHE 4FUHA 2LNCA 2WV5A 1TLDA 2ZDMA 1LHEH 3ITIA 1O30A 3LH3A 3SUFA 3KQ5A 5FCKA 1KYNA 3GISB 4XBDA 4AZ2B 2B7DH 1BQYA 2VWNA 1G3BA 3OE7D 4Y6DA 4IN1A 1NFWA 3VPKA 2ZPSA 3KQBA 2RA3A 1UHBA 1BTUA 3MTYA 5GWZA 3RLWH 1A61H 1C1VH 1YY3A 4X1RU 1UK4A 1HPGA 4Q7ZA 1C1WH 1UTQA 3RXHA 4MG3A 2WYGA 2WUCA 1NT1A 3BTWE 1MTUA 1TBQH 3DSOA 5JB8S 2PGQB 2BMGB 4AGKA 1IHSH 4Y8XA 3RXVA 1K22H 2QC2A 1OYQA 1GJ4H 2XW9A 3ZVCA 1CBWC 1TOMH 1F92A 1K1LA 2P8OB 2QE7D 2WSSD 5JBAS 1FY5A 2BD4A 2A1DB 1DANH 2SGAA 1SGFA 5L30H 1BTYA 1P3CA 2Y6TA 1O0DH 3A7XA 3LGTA 1C2DA 3ZV9A 2QF3A 1GJ7B 3SJKA 2PW8H 4IGDA 1MTWA 2J34A 1FV9A 1ZLRA 1UVPA 1GJ6A 2A0QB 5EU8A 3TGIE 1BOQA 2ZGCA 3SGBE 2FX4A 2FOGA 5FPSA 1PQ8A 1TNLA 3DSPA 1WV7H 1P2MA 4X1NU 5EXNA 3M7UA 1W13U 3UIRA 3PTBA 1SBWA 4ACAA 4ZKRU 2GT8A 3TK6A 2XBVA 1A0HB 3KCGH 4CBNA 1N8OB 1UK3A 3A7VA 5GDSH 4K8YA 3UOPA 2ESTE 2HLDD 3MH5A 1W0ZU 1EZQA 4LZ4B 1IQKA 3NUMA 3CS0A 3GCTF 4AG1A 1YBWA 1RIWC 5EXLA 1INCA 1GI6A 3MWIU 3KN2A 3RU4E 1FXYA 1JWTA 3EA9A 3LGWA 2VINA 1SLWB 1AE8H 1GVLA 1G32B 2GV6A 4XRNA 1MTNB 2A5KA 1DPOA 3GS9A 2AHME 1P9SA 3CNRA 4J2YB 3KQDA 3EAJA 3SBKA 1Z1JA 1JIRA 2XC4A 1OYTH 3Q3KA 3SOSA 3V7TA 4A7IB 6GCHF 2K0QA 4OS6A 1DXPA 1V2JT 4NG9H 2Q6FA 4MVNA 3W1EA 1DXWA 1H9LB 1O3PB 6LPRA 5LPRA 2I6QA 5GIBA 1O35A 3IG6B 5C5OA 3NXPA 3HPTB 1O3NA 5CMXH 1UK2A 1WTHD 1SGRE 2F9UA 3F9HA 3URCA 4AN7A 1SGFG 3T29A 3STJA 3OFND 1GBHA 1QZ8A 2BDCA 2OQUA 1GG6B 3FVFB 3RMMH 1Y8TA 2RA0A 2GKVE 4HFPB 1IQMA 1EPTB 1S0QA 2J98A 2OC7A 3NZIA 3FO8D 1AB9B 5FXLA 1W14U 5T6DA 2ZHFH 1HJ8A 3PB1E 1P01A 1CE5A 1QRZA 3HKIB 1AVXA 3QLPH 1E37B 2O8UA 3A83A 4OM9A 1EATA 2ZPRA 4HTCH 2NWNA 4X6PA 1Y3YA 4K5ZA 3UOUA 1S85A 1HIAB 1QA0A 2BX4A 1P2OA 3Q00A 4XE4A 3RXSA 2KCYA 3RXQA 4WH8A 1SFIA 5ESTE 2CF9H 4Y76A 5HYOA 1A0LA 2ZKSA 5FPTA 1FI8A 1V2VT 1B0FA 2GDEH 3S7KB 1C5QA 2LPRA 2BDGA 2A31A 1NU7B 4P00A 1BDAA 1PPGE 1PJPA 3OX7U 3ZV8A 1AN1E 1AO5A 3ATMA 1ZJDA 1IQNA 2FXRA 1HXEH 1BTZA 5AVDA 3LJOA 7GCHF 2TPIZ 2CHAB 2VGCC 3F1SB 3FKSD 1NFYA 1WOFA 2QIQA 2ZU5A 5DN6D 1OWHA 4FVDA 1JMOH 3F9EA 3SU0A 4AB8A 1EAUA 2PV9B 1PPFE 1HAZB 2VVVA 2BY8X 3ZVAA 1NO9H 1SQAA 4INLA 2BOHB 1N6XA 1KXFA 3PLBA 5DP9A 2EY4C 2FPZA 4HI3A 3SHCH 1G30B 1YPGH 3PRDA 1K21H 3QWCH 1TX8A 2ZGJA 2ALVA 1KTSB 1YPJH 1OWIA 1ZMNA 3T25A 4BAHB 3AW1A 2YNAA 2GD4B 1RD3B 3MI4A 4JZ1A 4WXVA 4A5TS 1EOJA 5AFYH 1O2HA 4TWYA 2O8TA 1YPHC 1UTKA 1QL9A 5E2OA 1QBNA 2ZI2H 1WUNH 3QDZB 1O37A 4FUJA 5TJXA 1IQIA 4X8SH 1HXFH 2BLWA 2NU0E 3T27A 1LQEA 3MO6A 2DE8A 1P02A 1AMHA 4CBOA 1BT7A 2FLRH 1N1LA 7ESTE 1W0YH 1CGJE 1TGSZ 3D65E 2P93A 1OWDA 3KQCA 4Q4LA 3O8RA 3RXKA 4K1TA 3GICB 1O2NA 3M5LA 3RMNH 1C1RA 2ZIQH 1MTVA 1W11U 1YCPK 3KYFA 4U01A 4INHA 1THPB 2VIDA 3PRBA 1TB6H 4TY7A 3T2NA 1GJDB 2ZCHP 2SGEE 4BTIB 1B5GH 1B0EA 1NM6A 1N8OC 1NBME 5TCAA 2FESH 5LH8A 4WMDA 1YPKH 4NIXA 3QZRA 1GBTA 3HK6B 3P70B 5EIYA 2BDBA 2PUXB 2OUAA 1O3LA 4R0IA 2A4OA 1FN8A 3A88A 2SNVA 2HNTC 1PQ7A 1TNKA 1E36B 1BA8B 3SU2A 4X8VH 2FOHA 3PM3A 3ZVBA 3LIWA 4BAQB 1BMNH 2VIVA 1Z7KA 1M9UA 1C5ZB 2HPPH 7GCHG 2GTBA 1AQ7A 1MTNC 5J4QA 2R2WU 1A2CH 1O3FA 1AWHB 2RG3A 2FMJA 4A1XA 1GBDA 2QYIA 4ZHAA 4BOHA 1B7XB 4O3UA 2ZDKA 3ODDA 4X8TH 3Q76A 1KTTB 3RXEA 3SU6A 2C93B 2AYWA 3BTDE 3F2FA 4X2YA 5ESBA 4AYYB 1GL0E 1O2ZA 3DCLA 2QXJA 1C2IA 3ODFA 4JMYA 1GMHF 2BVRH 2C8YB 4FUGA 3GYLB 4OGXA 1ETSH 4FUFA 3D62A 4NFEA 1IQEA 2WHXA 1S6LA 1GG6C 1YKTA 2AGIX 1NS3A 1FQ3A 3DUXH 5DGJA 4CRFA 3URDA 2BD2A 1EPTC 1YPEH 2CMYA 4F55A 1L1GA 4KGAA 1MABB 3KIDU 3PMHB 4AORA 4FU7A 4GPGA 1JIMA 3JZ1B 1QHRB 3SV2H 3GY8A 5FHTA 1O39A 1P03A 3Q3XA 4NA8A 3DA9B 1O2QA 2EEKA 3BTEE 1NESE 1SGQE 1ZR0A 2BX3A 1ANEA 1MAXA 4E05H 4GVUA 2BHGA 1O5DH 1O2VA 2F9BH 4ISHH 2QF4A 1O3GA 4Y0YE 1T8OA 1ZSLA 1UVOA 1A1RA 3SUDA 2G00A 1CBWB 1SFQB 5C0TA 1TIOA 1H8DH 3ZZDA 1DWCH 3RXDA 1YYY1 1GJ5H 1DICA 1K1NA 8KME2 1DS2E 3QO6A 1GWAA 2BLQA 4H6TA 4YOIA 4YT7H 1RJXB 2AMQA 3SNAA 5T3HA 3ZZAA 1SLUB 3SV8A 3RM2H 1PFXC 1O3JA 2ZF0H 3SNBA 3CS7A 1VJAU 3M36A 1AVGH 1MBQA 3CENA 1O2PA 2ZHEH 2CN0H 3D23A 1GL1A 4ZCNA 2KAIB 3UWIA 1C9PA 1MCTA 2P94A 4Y7AA 1H9IE 3MNBA 1FUJA 3N7OA 4DT4A 1ELBA 2BD8A 1GHWH 3ZZ3A 2SGQE 4YESB 3IITA 4I31A 2A5IA 1OWKA 1MQ5A 1QQ4A 3KL6A 4Y8YA 1EUFA 3A7TA 2VJ1A 4H42U 2FTLE 2XBYA 2C8ZB 1MQ6A 3PWBA 5E8EH 4Y10E 5A0CA 4JZIA 4X6NA 5BPEA 1BHXB 1G3DA 1C2LA 4D9QA 1DWBH 1UHBB 1UVSH 3O8CA 3MO9A 1SHYA 3A87A 1JXPA 2K8IA 1YCPH 1J14A 1S84A 1UMAH 1HJ9A 1HAGE 4RI0A 3VFEA 1L2EA 4CH8B 1G3CA 3A80A 1O3HA 3RXOA 3L6PA 2XRCA 4B6FA 5G4BA 3QK1A 1TGBA 1AKSA 2H2ZA 4AG2A 1V6DA 3N99A 1FAXA 4UDWH 3RC6A 4MDSA 1GBLA 4AOQA 1XMNB 1LHFH 3E90B 5EPNA 2GJGA 4P02A 3S9AA 1NRPH 1EP6A 1MD8A 1L1NA 3MH6A 2UWOA 3EQ0H 3M7QA 4UE7H 2K1QA 1TA6A 3UQVA 1C4V2 2KCOA 3BG4C 1NZQH 4U2WA 4D9RA 3PO1B 3ZZ4A 2FLBH 1GGDC 4B75A 3OTPA 1AZ8A 2QY0B 2FTMA 5A2MH 3KEEA 1AFQB 2CV3A 2QF0A 2C3SA 1GJBB 2YOLA 2FODA 4H4FA 1COWD 1WCZA 1FIWA 1CO7E 4E7RG 4X2WA 5I25A 3SGQE 2EQNA 3AW0A 4UFDH 1XUHA 4QT8C 4UFGH 4YTAA 4O3TA 3M5MA 3SZEA 3SU1A 2XTTB 4I32A 1C1OA 3KGPA 5SGAE 2WPLS 1C2HA 3UB0A 3I29A 1SKYE 1YF4A 4HZHA 4MPXA 5B6OA 1YWUA 4A6LA 1KSNA 2GVFA 1O3DA 1D6WA 1L4DA 2BY5X 3A89A 4IN2A 4YOGA 3EDXB 1PPBH 2BDHA 4NWKA 4AB9A 1UTMA 4WVPE 1SLXB 1QY6A 1Q31A 2CXVA 1VKYA 4AFUA 1QL8A 2AIQA 3SI3H 5DG6A 4OS1A 4XOJA 2OLGA 4AYVB 1TNHA 3S7HB 3BTGE 1E34B 1ELDE 1DDJA 3E3TA 1KLJH 1W0KD 2VGCB 1LHDH 2ZU1A 3RU4D 1RTFB 3UTUH 1K2I1 4MPUA 3AASA 3VB6A 2VVCA 4O9VA 3AVZA 1HFDA 2R9PA 5JDUB 1NTPA 2ZCKP 2XYAA 4B71A 2D26C 1LTOA 1AVWA 5C67A 1Z6EA 1OP2A 3WWBA 4U30A 2HVXA 1C2GA 4WF8A 2J98B 2F9NA 2AGGX 4DGJA 3K2UA 3RXGA 2BTCE 3ZIAD 1V2RT 2QXHA 2HRVA 3ZZCA 3OSYA 2ULLA 1O3EA 4VGCC 3F2GA 3SZNA 3VG8A 1W2KH 2AEIH 2IN2A 1LVOA 2WV9A 2ALPA 1YGCH 2ZECA 4X1PU 1G9IE 2SGDE 1OS8A 4NA9H 1EX3A 1ID5H 1V2KT 3NWUA 1A7SA 5F53A 1CU1A 1TRYA 4GCHG 1SVPA 5IDKA 1O31A 1A3BH 1WU1A 4JZFH 3TU7H 1TFXA 1C9TA 1HBTH 1UW7A 1SSXA 5GJ4B 1FY4A 3TVJB 1O3IA 2GV7A 1HRTH 1HAPH 3PMJA 1GDNA 2STAE 4ZMAH 1SB1H 2GDDA 4INKA 4CRBA 1F0TA 5F8ZA 3S0NA 4NIYA 3F3BA 1MBMA 4ABJA 1LQDB 1SGYE 5DO4H 3M35A 1EB2A 1KDQB 1BTXA 2W26A 2RFKC 1P2NA 3U28C 1O5BB 1GHBG 3U8OH 3ZZ6A 5L2YH 4Q80A 3RXJA 3PTNA 3LGYA 1C2EA 1C2FA 2R2MB 2V3OH 1OKXA 5E0HA 1C2JA 1LPGB 5K7RA 2O8MA 3QN7A 4YM9A 2BZ6H 1EJMA 1XUFA 2QAAA 1PPZA 8GCHG 1FX0B 1MZDA 4WY3A 2W6ID 3A82A 4E7NA 4OS7A 2XBWA 1TPAE 3NPSA 4RN6A 5L2ZH 2ZGHA 2IPQX 4UFFH 3L3TA 1QB1A 1SGEE 4U32A 1IAUA 2Y81A 2BQ7B 3P8NA 4ESTE 2R0LA 4LZ1H 4OS4A 1G2LA 2TBSA 2SNWA 2OTVA 3KNXA 1O3BA 1EKBB 4ZHMU 1TGTA 2H1UA 1WSSH 4D76A 2UUKB 3U8RH 1VCWA 1ANDA 2W5EA 2P59A 1IQHA 1GMCF 1Z6JH 1O3KA 5KGOA 2C90B 2J94A 2D1JA 3RXLA 1E79D 1EB1H 1A0JA 2STBE 2Z94A 4UD9H 4X8UH 1V2NT 2TGPZ 1GJ8B 3RLYH 1XKBC 2P16A 2HOBA 1Q2WA 1GCDA 1C4Y2 3H09A 3A7WA 3PO1C 4HGCA 3P95A 1KXBA 2V6NA 1V2ST 2Y82A 1IQGA 6ESTA 1LVBA 1GJAB 1AFQC 4ZAEA 5C94A 4DT7B 2A7CA 3SNEA 4UONA 1ESAA 1KMHB 3GY5A 2GP9B 2ODQA 1C1QA 1XXFA 1GBMA 1NN6A 4Y79A 1H8IH 4BANB 4F48B 4CHAB 4ABEA 1E1QD 2PSYA 1FZZA 1O2GH 4ZXYH 1S6HA 2L74A 5T6GA 5A0BA 2GZ8A 1QCPA 4FETA 5HKKD 1TRNA 3SJ8A 1RFNA 3V12A 2RDEA 3MO3A 1TOCB 3GYMA 3FANA 3N7EA 4ABGA 3RMOH 1FNIA 1EQ9A 1ELEE 1PPEE 1GI3A 1GMDF 1LKBA 4NWLA 1GHYH 3RXTA 2PKAB 1C1SA 1Z8IB 3LC3A 3D49H 4ZKSU 3SNCA 3GCTG 4B6EA 3SV7A 1BBRK 2P3FH 1XM1A 1O5CB 1HJAC 3PYHA 2ZC9H 3NRLA 4MLFB 4YOJA 3E1XB 4FOUC 2HNTF 4DJZB 4F4OC 2VWLA 1O2MA 1WQSA 1OWEA 3ZZ8A 5EPYA 5CDFE 3ATIA 1ACBE 4K69A 4Y7BA 1PPCE 2RCEA 3PMBB 2KCPA 1P3EA 3BN9A 1TWXB 1CA0B 1DSTA 2A7JA 3PV5A 1O2OA 3E8LA 6GCHG 1T7CA 1CT0E 1N6YA 5A8ZA 2AFQB 1YPLH 5DP5A 3SV6A 2R0KA 1L1JA 2FI3E 4K3JA 9LPRA 1UVUH 2VBCA 1ANBA 4TYDA 1GI0A 1Y5BT 1HNEE 4AGJA 4DIHH 3HGPA 5EW1H 1UTLM 1ZPCA 4O03A 1E38B 1ANCA 1KXDA 1SGTA 3RXAA 3PMAB 1YLDA 4GAWA 4JK5A 2BD5A 1XUGA 2EI8A 2GCHF 1QRWA 1C1MA 2BM2A 3SW2B 2H5DA 1RXPA 2YNBA 1O33A 3P8OA 3V3MA 4F49A 2OBOA 3FFGA 4XBBA 4BAKB 2W3IA 2TGDA 1C5LH 2QF5A 1FMGA 2KM0A 2AMDA 2VIWA 1A5GH 3LOXA 1W3CA 2XWAA 1PPHE 1DWEH 1IHTH 2Q6GA 1XUJA 3S9BA 5LGOA 1P9UA 1OP0A 1D6RA 5EXMA 3PROA 1ZGVA 1GI2A 2ANKH 5AFZH 3SQHE 3NKKA 2UWLA 2H9TH 1DVAH 4WMEA 1ZRKA 1G3EA 2Y7ZA 1VCQA 3BG4B 4I8JA 3TNSA 2F91A 4B76A 1GGDB 3M5NA 1ZSKA 4I7YH 1LPKB 3MU5A 1RRKA 2XNIA 4XDEA 1SQRA 2KR7A 4XD7D 1IQJA 4JZEH 2G52A 2J97A 3K6YA 1D9IA 1C5RA 4K1EA 5FAHA 3SJOA 3I78A 5GNDA 1YLNA 3GOVB 2JKHA 1GBIA 1YLCA 3VB3A 3OY6U 2OBQA 5I46H 2A2QH 2C4FH 5FX6A 4IC6A 1HIAA 5DP8A 3LC5A 4GSOA 1O2KA 1C5PA 1ZTKA 1TE0A 1BJUA 1MZAA 1ZTJA 3FP8E 3BTQE 1P09A 1ELAA 1DFPA 2ZQ2A 1EZXC 2OC0A 4Z0KA 4HG6A 3GY4A 2PTCE 3QZQA 3RXMA 1C5NH 2R3UA 1EAWA 2VH0A 3EA7A 3LU9B 4TT3D 1H8HD 2A4RA 1EASA 3STIA 2SFAA 1F5KU 2BQ6B 1RGQA 1THSH 1QA7A 3V13A 1BTPA 2PR3A 1AE5A 1O2IA 2V3HH 2WINI 2ZQ1A 4IC5A 5FX5A 4OS5A 3VB5A 1NFUA 3DD2H 1T8LA 3PV2A 4Y71A 3UPEA 2TIOA 4ISIH 1Y3UA 1ARCA 3MNSA 2V7QD 2F4LA 2ODPA 3A86A 1SR5C 3H7OA 2AS9A 1C5XB 1CT2E 1ZPZA 2GCHG 5EQRA 3RDZA 4RKOB 2XCNA 3OY5U 2FOEA 4K60A 1UVTH 1V2QT 4X0WU 1HAIH 1O3AA 1FPCH 2JH0D 4A92A 1P2JA 2PFEA 2BZAA 1MD7A 1QNJA 2GGVB 1QFKH 1FN6A 2BY9X 3BV9B 3ZVDA 3RXFA 4B2CA 3U98H 2ZTYA 3AAUA 4CHAC 4DIIH 3GDUA 3MMGA 1E1RD 1BBRH 4VGCB 2XNDD 4D7FA 2BB4A 2FP7B 1MKWK 4LXBH 1FY8E 2W7UA 1V2MT 1LO6A 2FYRA 3ZVGA 3A7ZA 5EJ1A 3ATWA 3TNTA 5FBIA 1LPZB 3ZVEA 4KTCA 2A5AA 2VU8E 3RP2A 1WTGH 4XSKU 1W10U 2ASUB 1Y3XA 1ABJH 1BTHH 1GBEA 1O3OA 5BRRE 3MU0A 4FUIA 3MU4A 4TSFD 4BAMB 3S9CA 2BD9A 3A8AA 1GI9B 1QURH 1OHHD 2J2UA
chains in the Genus database with same CATH topology
3K65B 4CRCA 1ZMLA 1OXGA 1P0SH 3LPRA 1F2SE 1GBAA 1O34A 1HYLA 1VGCC 1WQVH 2HLCA 2BDAA 2NU3E 1Y5AT 1P12E 1BCUH 3T28A 3Q3YA 3CP7A 3T26A 1XVOA 2O8WA 1AWFH 3F6UH 1H1BA 4R8TB 3RXPA 1CA0C 1S83A 2BVSH 2O9QA 2B8OH 1NY22 2BDYA 3EGKH 3MU1A 3GY3A 2OXSA 1QJ1B 1SPJA 4NFFA 4Q7YA 1A5IA 1ORFA 4CRAA 4I8KA 3SUGA 1GMHG 1QBOA 2M5TA 2FDAA 1GJCB 5C2ZA 4Z6AH 2WV4A 1JBUH 3KF2A 5E0JA 1SGIB 1MH0A 2ZHDA 3GCHB 5J4SA 2QGRA 5HMAA 1DY9A 2Z3CA 3F9FA 2OCVB 1LKAA 2ZTZA 4KKDA 1OPHB 3TITA 2FOMB 1CHOF 5ETXA 4NIVA 2Z7FE 1A3EH 1C5WB 1UO6A 4WMFA 1QIXB 2CJIA 2Z9GA 2CF8H 2C8XB 5CHAC 2P3TB 2ZHWH 5A8YA 1C5SA 2AERH 2FIRH 1DUEA 3A85A 1VR1H 3QX5H 2R3YA 3TIUA 4ABIA 3TK5A 1TPSA 2Z9KA 4K1SA 4BNRA 1BUIA 3P92A 2IJOB 5LPFA 4B2BA 3F9GA 1HGTH 4GHTA 2B0FA 2ZHQH 4WJG2 4DURA 2UWPA 2JETC 3H7TA 2PKSB 2ZU2A 1HAVA 1HAXB 1P57B 2VNTA 3L33A 2WPMS 4MNWA 1O2RA 1PYTC 2FS8A 4JYUH 1S82A 2J38A 4IMZA 1C2KA 3GY6A 1MTSA 4X6MA 4B73A 1YPMH 2H5CA 1GVZA 3E6PH 1BRAA 1TX6A 2THFB 1MAYA 1AI8H 5K0HA 5FBEA 4YO9A 3ZYEA 3T62A 1UTJA 2PUQH 4AFQA 4WH6A 4SGAE 2BD3A 2SGFE 3BTTE 1P8VC 1J8AA 1TONA 3C1KA 2GX4A 1JRSA 3M3SA 1BBRE 1THRH 3AAVA 1HAHH 2BLVA 1RTLA 1QB6A 1ZHRA 2GCTB 1P11E 3SU4A 5HXFA 1D3TB 4MTBA 2H6MA 1BZXE 4K8BA 5EQSA 3SGAE 1FONA 1HJAB 2PHBA 3RMLH 1FDPA 1T4VH 1MUEB 2Z9JA 3BTME 3MFJA 4CREA 1GI7B 3SI4H 5A09A 2NU1E 4I8GA 5E2PA 2QV1A 2XC0A 1TBRH 3TJUA 4ABBA 1XUIA 3T5FH 2H9HA 1KXAA 1MKWH 1O32A 2ANYA 2W3KA 1DM4B 2RDLA 1GBBA 1OX1A 1BHXF 2FO9A 4WXIA 4DG4A 1GI1A 4FU8A 4KTSA 4UEHH 1NROH 2OC8A 1CHOG 3V0XA 2ILNA 1MU8B 1Y3VA 1P10A 2BY7X 3RU4T 1KXCA 1ZOMA 4FVBA 4MPWA 1AD8H 1ZGIA 2BLOA 1NRNH 2VIQA 3IWMA 5DK1A 4X6OA 3HATH 1HB0B 2I6SA 3TGKE 1XX9A 4ZUHA 3ZYDA 5C1UA 3LONA 5JPMH 1TPOA 1KLTA 3UR6A 4DOQA 1J17T 5C5NA 3VXFH 1S0RA 1UTNA 1AZZA 1BMLA 1SGNE 3PLPA 1XKAC 1QL7A 2F3CE 2W7SA 3P17H 3F68H 4Y0ZE 7LPRA 4B2AA 1GBKA 2VIPA 1SLVB 2ODYB 3NK8A 3PLKA 1O3MA 3SN8A 3UY9A 1SOTA 4NGAH 4UFEH 2BY6X 4FUBA 4M7GA 3NCLA 4OGYA 3P6ZB 2A7HA 2OQ5A 1UTOA 1C5OH 1NC6A 1J9CH 1O5AB 2A4GA 2UUYA 1GHVH 1S6FA 1EP5A 1EAXA 1GPZA 2J9NA 2ZNKH 3GDSA 1ZTLA 3RXRA 1P2QA 4MQAA 1D3PB 1CQQA 1NRRH 4MNXA 1GHXH 4H6SB 1DLKB 5EGMA 2ZWLH 2BDIA 2G4TA 2ANMH 2J4IA 1ZSJA 3OTJE 1C5VA 1W7XH 3TPIZ 1P04A 3SV9A 1OWJA 2JH6D 2ZDNA 4ISOA 1SGPE 4YT6H 4ISLA 2A32A 3BSQA 5H4IB 3HGNA 3W94A 1A46H 1IOEA 1BMMH 2EI6A 3ATKA 3BTFE 4I8LA 1O2TA 1SL3A 1TGCA 2Y5GA 4NCYA 2ZPQA 4XFQA 4B1TA 3GCHC 1Z8GA 2DUCA 1HUTH 1GCTC 1MCVA 5EQQA 4KTUA 1W8BH 1C5UA 4IS5A 2G8TA 5FPYA 1ELCA 1O38A 1D4PB 2ZTXA 3H5CB 2FS9A 1AUTC 1CT4E 1K28D 1FPHH 1MKXK 1LHCH 1G37A 3R3GB 2FM2A 3P8GA 3M7TA 4BTUB 4AFSA 2WYJA 2GZ9A 3RM0H 2ZU3A 1J16A 2PTNA 2G5VA 3U8TH 6CHAB 2VWOA 5HM2A 3RUOA 1O2YA 1TPPA 1ZMJA 4O97A 1ZYOA 2WPIS 1CHGA 1H4WA 4X2XA 2Z9LA 5C3NA 2ZO3H 3FZZA 5DP3A 3ESTA 1SQTA 1ELFA 2OC1A 2ZP0H 1TMUH 3M5OA 1PQAA 1TBZH 1KIGH 3TH3H 1SOZA 4D7GA 2QXGA 3ENSB 1Y59T 3M37A 4NSVA 5C1XA 1YP9A 2TGTA 2PKSC 1AY6H 2FX6A 1ZJKA 1V2OT 3LGUA 1EJAA 5PTPA 1TA2A 3MNXA 1P2IA 2GT7A 2OD3B 3B8JA 3C27B 3UNRA 2NU2E 4TPIZ 3SHAH 1BB0B 2OP9A 3E91A 5E0GA 3GCOA 1GBFA 4RKJB 1UCYK 1TRMA 1OSSA 2D2DA 3SQEE 3I77A 2G5NA 1F0RA 1GHZA 5HGGA 1VJ9U 3DFJA 3VB4A 2AGEX 2XC5A 4A1VA 2WUBA 2P95A 1L0ZA 3PV4A 4IBLH 8ESTE 5DJ7A 1K1PA 1GBCA 1ZZZA 2QCYA 1HLTH 1SC8U 2GCTC 3U1IB 2FOAA 2V0BA 2ZFPH 1WAYB 1GI4A 3K9XB 4JCNA 2ZG0H 3P8FA 1BIOA 4X1QU 5DPAA 3UWJH 1E0FD 4E06H 2IOTA 2GMTB 4OS2A 2WPKS 1Y3WA 1SGDE 4GHQA 3MOCA 2FOFA 1O2UA 2ZFTA 5F03A 3U9AH 1EXFA 1TYNA 2J92A 1AIXH 4CH2B 1ESTA 2G4UA 1HAOH 1SMFE 4LK4A 3ZZBA 1A4WH 1IQLA 1S81A 5F6MA 1VGCB 2Z6BD 2QXIA 3TJNA 3Q77A 1V2TT 4ABFA 2WPJS 1KDQA 5EW2H 1IQFA 1MMJN 1K9OE 1EZUC 1DY8A 2XXLA 2BOKA 5F8TA 2Z3EA 2Y80A 4ISNA 2HALA 1VZQH 3K6ZA 1Y5UT 2G55A 1C1UH 4TY6A 1GMCG 3UNQA 5AF9H 1O2XA 1XVMA 1YPHE 1QTFA 4ZH8A 3E0PB 1V2LT 3SJ9A 1DX5M 4Q2KA 4FUDA 9ESTA 3SUEA 1DSUA 3B9FH 1WYKA 1KXEA 4ZXXH 7KMEH 1K1MA 1V2PT 1XXDA 1J15A 1LHGH 1ARBA 2AH4X 1O5FH 4B74A 1T8MA 3MNCA 4K2YA 1BJVA 2EA3A 3TK9A 3TJVA 2SGPE 2XCFA 2J95A 4NA7A 2VIOA 1HCGA 1QQUA 1C5MD 1YC0A 1LCYA 2P8OC 1BMAA 2VVUA 3BEFB 5CHAB 1C2MA 2BXTH 1TMBH 3A8CA 3UQOA 1Z71A 4J1YA 4DCDA 4X1SU 1LVYA 3HK3B 2BD7A 5HM9A 1BRUP 8LPRA 2PSXA 2PWXA 1K1JA 2ZGXH 3FP6E 1BRCE 2A2XH 3R0FA 1K1IA 4NSYA 2JETB 4MPVA 1EPTA 1XUKA 3O8BA 2HNTE 5DP4A 4BXWA 4FUEA 4ASHA 1GMDG 1AFEH 1F5RA 1F0UA 2XBXA 1L4ZA 3DT0H 1P2KA 1MKXH 4LOYH 2Q1JA 1O2JA 1UTPA 2ANWA 3UUZA 3ZZ9A 5L6NH 4ZKOU 2BYAX 5F8XA 1CA8B 1X7AC 4ZHLU 5EOKA 3EA8A 1EAIA 2UUJB 3E0NB 3RXUA 2F83A 4PROA 2AMPA 1FLEE 4JK6A 1ZHPA 1U6QA 2A45B 3JZ2B 2QN5T 3M3TA 5GCHF 3GY7A 2WPHS 2P3UB 1T31A 1O3CA 5EG4A 1F5LA 1SQOA 1P05A 2ZDAH 5IYTA 1TGNA 1O2WA 2JH5D 3BEIB 3KQEA 3QTVH 2PKAA 1VITH 1V3XA 2IPHA 3VGCB 2PGBB 6CHAC 3LGIA 1C5YB 3QUMP 3SU3A 1QGFA 1AKSB 2FZZA 2BQWB 5JB9S 1EJNA 3O8DA 4BAOB 4YLQH 1SG8B 3SORA 1O5GH 1NRSH 4MNVA 2A4QA 3S69A 1UCYH 5JBTA 1A5HA 2TRMA 1O5EH 3A81A 4WWYA 3U69H 1K1OA 4A1TA 1ZHMA 5DP7A 1QB9A 4FUCA 1T8NA 3FP7E 4YLUA 1Q3XA 4I8HA 4ABAA 3UFAA 4MNYA 4NZQA 1GDUA 3LDXH 4NIWA 1C1NA 4XBCA 1MU6B 2FEQH 2FOBA 2GZ7A 1AB9C 5EODA 2ZU4A 1C5TA 3RXBA 1Z8RA 4ZKNU 1TNGA 1OP8A 1DOJA 3OU0A 1UJ1A 1CGIE 1HAVB 3B23B 3FZDA 2FOCA 2VH6A 2D8WA 1GVKB 1QBVH 1HAYB 4Y11E 2ZGBH 1V2UT 3QTOH 5LPEA 1PYTD 1ELVA 5CE1A 4BXSA 1NFXA 3A8BA 2FWWA 2ZEBA 3GCNA 1ELTA 2CGAA 4ABDA 1QR3E 1RTKA 4AFZA 4I33A 4RSPA 3SNDA 2F9OA 1SHHB 1O36A 1ZRBA 1YM0A 3RC5A 4ABHA 3QGJA 1JRTA 1TX7A 2Y5HA 1GHAF 1W12U 1NPMA 4Q7XA 1FIZA 3FAOA 3RC4A 4CR9A 2Y7XA 3DFLA 3U1JB 4IW4E 4YZUA 2GMTC 3VB7A 1AUJA 2EC9H 5DKMA 1BITA 4KELA 5FCRA 1TALA 1LVMA 1VITF 1ZPBA 2B5TB 4GUXA 3BF6H 3ATLA 1LMWB 2ZFRH 4TWWA 4Y8ZA 1D3DB 2FI5E 3LKWA 1OOKB 4DVAU 1DLEA 3W95A 5GCHG 3KHVA 3EE0B 3VEQB 2CHAC 3E16B 4ZROA 3RXCA 2Q6DA 2ZA5A 3VXEH 2V35A 1S5SA 3UR9A 2B9LA 4KP0A 3QGNB 2BVXH 3OYPA 1FY3A 2EI7A 2ZCLP 1FAKH 1FJSA 3A8DA 5GPIB 3TGJE 1E35B 3UREA 3M61U 1TQ7B 1C1TA 2NU4E 3M3VA 1CGHA 2HPQH 3ZZ5A 4D8NA 5GXPA 2ZDLA 3BIUH 3A84A 5C1YA 1GCTB 3MH7A 2AIPA 1QJ6B 1RIWB 2ZFQH 1DWDH 1DE7H 5ABWA 3GY2A 2HWLB 1TMTH 1AGJA 1TABE 5JBCS 1HDTH 2Z9IA 3SU5A 5A8XA 3BIVH 2VB0A 1G36A 1JOUB 3BEUA 1O2SA 3LJJA 1CSOE 1GJ9B 1LDTT 2Y5FA 4CR5A 1DT2A 1DITH 4CRDA 4AX9H 3MH4A 1TNJA 3A7YA 4NZLA 2PLXA 1C1PA 3PWCA 2ZFSA 1YCPM 1T4UH 1RS0A 1VCPA 3EYDA 3LH1A 1QJ7B 5A0AE 2FYQA 3WY8A 1NU9A 2QA9E 1KLIH 2F9PA 5AHGH 4JYVH 3UNSA 1QRXA 4JZDH 3MU8A 5TCCA 1H9HE 3BTKE 2VWMA 3MHWU 3GDVA 1W7GH 1GHAG 4IMQA 1TAWA 4GCHF 1UCYE 1BRBE 1ESBA 2ZDVH 5T6FA 2ZFFH 2ZZUH 4SGBE 2TGAA 5JYIA 3SJIA 2HGTH 1SI5H 2FI4E 1CVWH 3LGVA 1VITG 2OINA 2G81E 1AU8A 4CRGA 1KY9A 1ELGA 4FXGH 2DE9A 1BTWA 1C4U2 3TH2H 2Z3DA 5JBBS 4DW2U 1ABIH 1Z8JB 3BG8A 1GBJA 1G2MA 1DUAA 2G51A 4GLYA 2XWBI 3TLOA 1AHTH 1TQ0B 5C20A 1EZSC 3VGCC 1EOLA 3TH4H 1GHBF 2F9VA 1O2LA 3SO3A 4THNH 4BTTB 5DP6A 1FY1A 1NRQH 1ETTH 1WBGB 1P06A 4JYTA 1GI8B 4DY7B 2C8WB 2O8LA 1SGCA 1F7ZA 1TNIA 4TPYA 8GCHF 1PQ5A 2KAIA 1Z1IA 3DHKH 3TJOA 1F0SA 1V2WT 3HKJB 3LT3A 4X2VA 4FU9A 3ZVFA 2BXUH 2H9EH 3G01A 3ZZ7A 1GDQA 1T32A 2UUFB 3RXIA 1D3QB 1GI5A 3ELAH 1HV7A 3MYWA 1ETRH 3BTHE 4FUHA 2LNCA 2WV5A 1TLDA 2ZDMA 1LHEH 3ITIA 1O30A 3LH3A 3SUFA 5FCKA 1KYNA 3GISB 4XBDA 4AZ2B 2B7DH 1BQYA 2VWNA 1G3BA 4Y6DA 4IN1A 1NFWA 3VPKA 2ZPSA 3KQBA 2RA3A 1UHBA 1BTUA 3MTYA 5GWZA 3RLWH 1A61H 1C1VH 4X1RU 1UK4A 1HPGA 4Q7ZA 1C1WH 1UTQA 3RXHA 4MG3A 2WYGA 2WUCA 1NT1A 3BTWE 1MTUA 1TBQH 5JB8S 2PGQB 2BMGB 4AGKA 1IHSH 4Y8XA 3RXVA 1K22H 2QC2A 1OYQA 1GJ4H 2XW9A 3ZVCA 1CBWC 1TOMH 1F92A 1K1LA 2P8OB 5JBAS 1FY5A 2BD4A 2A1DB 1DANH 2SGAA 1SGFA 5L30H 1BTYA 1P3CA 2Y6TA 1O0DH 3A7XA 3LGTA 1C2DA 3ZV9A 2QF3A 1GJ7B 3SJKA 2PW8H 4IGDA 1MTWA 2J34A 1FV9A 1ZLRA 1UVPA 1GJ6A 2A0QB 5EU8A 3TGIE 1BOQA 2ZGCA 3SGBE 2FX4A 2FOGA 5FPSA 1PQ8A 1TNLA 1WV7H 1P2MA 4X1NU 5EXNA 3M7UA 1W13U 3UIRA 3PTBA 1SBWA 4ZKRU 2GT8A 3TK6A 2XBVA 1A0HB 3KCGH 4CBNA 1N8OB 1UK3A 3A7VA 5GDSH 4K8YA 3UOPA 2ESTE 3MH5A 1W0ZU 1EZQA 4LZ4B 1IQKA 3NUMA 3CS0A 3GCTF 4AG1A 1YBWA 1RIWC 5EXLA 1INCA 1GI6A 3MWIU 3KN2A 3RU4E 1FXYA 1JWTA 3EA9A 3LGWA 2VINA 1SLWB 1AE8H 1GVLA 1G32B