1ELBA

Analogous inhibitors of elastase do not always bind analogously
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title Analogous inhibitors of elastase do not always bind analogously.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1993-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elbA01
1SG8B 1KTSB 3ITIA 3KQBA 3TK6A 3E0PB 2FOGA 3QZQA 3GICB 5LGOA 2ZHDA 1GVZA 1DSUA 1O2OA 1CVWH 1Z8JB 1KXCA 1T7CA 4TWWA 1CU1A 1UHBA 1P2JA 3HATH 1TBZH 3VXEH 5EW2H 4JZIA 1EB1H 1QHRB 3E0NB 3Q00A 1F2SE 3VB7A 3FZZA 1EXFA 1PFXC 1A46H 1Z8RA 5DKMA 5GWZA 3LH1A 1TRMA 2OD3B 5JYIA 1C1RA 4BXWA 4JZDH 3L3TA 2B9LA 1O2MA 1HFDA 3HKJB 3E1XB 5EQRA 4DW2U 1MAYA 3RC5A 4WMDA 3P6ZB 2OUAA 1RTFB 2ZTZA 4YO9A 2TGDA 3PO1B 3QGNB 4NA9H 4GHQA 1O39A 1UMAH 4ABGA 2BY8X 4NZLA 1QRZA 1C1PA 1TGTA 1DE7H 3K2UA 4X8UH 4U30A 1P05A 1D9IA 1WQVH 3LGUA 1EZUC 1HCGA 2BXUH 1CA8B 1RD3B 1YGCH 1ZMLA 1KXEA 1CT4E 3KIDU 1V6DA 1ZZZA 2BY9X 1AKSA 1MKXK 2A1DB 1SGFA 1Z7KA 1O3PB 3RXIA 1V2PT 4XFQA 1FZZA 4BAKB 3GISB 1TAWA 4U01A 1C5QA 4JYVH 5FBIA 4UE7H 1CGJE 1C1MA 1QB9A 3ZV9A 2VIPA 5LH8A 4H6SB 3ZZ6A 2Z3EA 2ZDMA 1EQ9A 5HGGA 1C1WH 3RXVA 4FUEA 2BDYA 1QB6A 2C8WB 2AMPA 3EE0B 2HNTF 1S5SA 5L30H 1QB1A 3M3SA 4GLYA 1SBWA 1C2KA 1SOTA 1Z6JH 2FP7B 2BDAA 2HNTC 3FAOA 1DWEH 5AF9H 1QIXB 5CHAC 1CO7E 1Y5BT 3AW1A 1KIGH 1RRKA 3TIUA 1NTPA 4AN7A 4CRDA 4A5TS 1XUFA 1ZMJA 4E05H 1ZJKA 1VITG 1YPLH 2W3IA 4WH6A 4AFQA 1LHFH 1F5LA 4TY6A 5C2ZA 4ABAA 1AI8H 1LVBA 1XKAC 4UFEH 1ZJDA 3STJA 4NWKA 3ATKA 3SBKA 1AMHA 1IQGA 4X6NA 3A7VA 3OYPA 2QF3A 1GBBA 1ACBE 1DS2E 3KQEA 4GCHG 4ZUHA 1GHBF 4K8BA 4B71A 1K1OA 1SC8U 1IQEA 2A32A 3PTNA 2FOCA 3BSQA 3VB6A 1F5KU 1O2ZA 3NKKA 2XCNA 2GCTC 4I31A 1YBWA 1CGIE 3BEFB 2ZHQH 1KXFA 4I8JA 8GCHF 3PYHA 5T3HA 1IQMA 1W2KH 1H9HE 2VIQA 4O97A 1HGTH 3DUXH 2VU8E 1B0FA 4M7GA 1XUGA 1JOUB 2V3OH 1XUJA 1A4WH 3BG4C 4OS2A 2AERH 6LPRA 4OS1A 3PROA 5JDUB 1O2YA 1BTZA 4DG4A 2CHAC 2ZTXA 1IOEA 1XX9A 3KQCA 1HAVA 1K2I1 2BX4A 3T25A 1DY9A 2Z9KA 2ZGCA 1XKBC 2G5VA 5FHTA 2W7UA 1QA7A 1HUTH 3SV2H 1IQJA 1MUEB 4PROA 5K0HA 3LGYA 1HAHH 1P57B 3U8RH 5DP4A 1OP8A 4MPVA 1GHYH 1UK3A 3E91A 2QAAA 5GXPA 3A89A 1Z8GA 2TIOA 2G00A 1LVOA 4DURA 2FX6A 1S83A 4Z0KA 2FIRH 4Y79A 1BTXA 4ZXXH 4ISHH 5HYOA 2VB0A 3ZVCA 1FY8E 4BAMB 4JZFH 1ZPCA 1WTGH 5EQQA 1J14A 4XE4A 2SFAA 2PGQB 2BVSH 2BY5X 2D1JA 4MPXA 1VCPA 1G3CA 2J95A 1BQYA 1X7AC 2ZQ2A 2XBWA 4Y7AA 1QL9A 1AZ8A 2NWNA 3P8GA 2FM2A 1EJAA 4TPYA 1FDPA 1BMMH 1IHTH 3ESTA 3RP2A 2STBE 3SNBA 4K1SA 1ELCA 2ZHFH 3VFEA 1DITH 1DOJA 1TQ0B 5FPYA 2XXLA 4GPGA 3S9BA 2QY0B 3SV8A 4X1QU 3LC5A 5JPMH 2WV4A 4FUHA 3CENA 2UUFB 1QGFA 5EGMA 2BY6X 1MAXA 1M9UA 5DP7A 1DWDH 1O5GH 1GGDB 3DFLA 1SB1H 5ESTE 3BTHE 2I6QA 2FODA 1CE5A 2BD3A 3C1KA 1O36A 4I33A 1ZGIA 1OS8A 2BDBA 1G32B 1V2LT 3SUFA 3RM2H 3F1SB 4D9QA 3PLBA 4FUCA 1VGCC 1IQNA 2WUCA 4ZKNU 1N8OB 1P2OA 1V2QT 1MCVA 1QL8A 1SHHB 3DFJA 1SFQB 5C67A 4A1XA 1SLVB 2PKSB 4ABFA 1AZZA 1O3OA 4B2BA 4Y71A 2Y7XA 2ZHWH 4WMFA 2BX3A 5FBEA 5FPTA 2ZU4A 1TWXB 1CHOG 3SZNA 1QCPA 1TNGA 4MNXA 3Q3XA 2VIVA 2ZGHA 2BLWA 2WPJS 1WSSH 2O8UA 5IDKA 1EP6A 1SGRE 1TNJA 2M5TA 3SU3A 5DO4H 1BBRE 3A8AA 2BD4A 1AIXH 2FYQA 1TBQH 3I77A 3I78A 2F83A 3IWMA 3RXJA 2FOAA 4BAOB 2P8OB 3QTVH 4Y76A 5C1XA 2GX4A 1UHBB 5TCAA 1JRSA 3H5CB 2V3HH 5A2MH 1HDTH 1C5YB 2FPZA 4ZXYH 2GDEH 1FPHH 3ENSB 4CR5A 7KMEH 1C5XB 1EOJA 5T6DA 1SLUB 3RXUA 2XBYA 2BVXH 1EJMA 1T8NA 1TOMH 3ZVFA 1Y3UA 3SJKA 1LO6A 2ZDVH 3GY5A 1C2EA 1LDTT 1PQ5A 3UOUA 2LPRA 4YTAA 1ELGA 1O3JA 1FUJA 2F9VA 2Z3CA 4ZROA 1O5DH 1QJ7B 4X1RU 2BB4A 1J16A 1SHYA 2C8YB 5C1UA 3W94A 1QL7A 1ZGVA 3RDZA 1CBWB 2EC9H 2HWLB 3H7TA 3M5MA 2ZC9H 1BZXE 1AU8A 1QBNA 3A83A 3BV9B 1AKSB 2BQ6B 3PLPA 2XRCA 1FAKH 1GHWH 2NU3E 1AWHB 4Q7XA 2BXTH 1BTUA 3ATLA 1BIOA 3GDVA 4WWYA 4XDEA 3RXOA 2GKVE 2QIQA 5E8EH 2HVXA 1S0QA 2AMDA 2RCEA 4HFPB 5DG6A 1BB0B 1EZXC 1TX8A 2JETB 3PV4A 3GYLB 3HK6B 4BAHB 1FY1A 1PPGE 1EPTC 4INLA 1AVWA 1O2NA 3PM3A 3P70B 2CMYA 1KLTA 4BTIB 1Y5UT 1XVOA 1GJ9B 1MBMA 2ZEBA 2VWMA 3GYMA 1C5OH 4JCNA 3GY6A 1DY8A 3KEEA 4J1YA 1O2IA 3TJOA 3S9CA 1OWEA 1C2LA 3ZZDA 1KLJH 2ZHEH 2J92A 3EQ0H 2WYJA 3BF6H 1C4Y2 2GT7A 4AORA 2Y5HA 4ISLA 3GCHC 4ISNA 1BMNH 1BHXB 1HV7A 1K21H 3MU0A 1YF4A 1ELBA 4NA8A 1YPEH 1C5NH 1HPGA 3RXMA 1W8BH 4FUDA 3SGBE 3UR6A 3T5FH 4XBCA 2FDAA 2Z6BD 3E3TA 2BQWB 2TGAA 4O3TA 1TGCA 3RXBA 3T2NA 2AYWA 3RLYH 3EA9A 1FIZA 5ETXA 2AH4X 3PWBA 1HJ9A 1GBJA 2ZF0H 2R0KA 1EAIA 2VWNA 1BBRH 2Z3DA 1LPZB 2BQ7B 3SNCA 1O3HA 4GVUA 5FX5A 1P8VC 3S7KB 3TH3H 1S0RA 4OGYA 2ZECA 3UNRA 4IS5A 1O32A 1SL3A 5DK1A 1GHAF 2QN5T 3UPEA 2YNAA 1RIWC 2NU2E 4I32A 1GWAA 1NU7B 2HPPH 4FVDA 5FPSA 5C1YA 7ESTE 1KXDA 1MTVA 1C2MA 2ZFSA 3MMGA 2Z94A 1BUIA 3FP6E 2OBQA 1P2NA 1FLEE 1O31A 1Y5AT 3RXQA 2STAE 3TK9A 2CGAA 4GSOA 6GCHG 1C2DA 1E0FD 3ZVGA 3S9AA 5DP9A 4DGJA 4LZ1H 2PHBA 1TA6A 4RSPA 1OWDA 1W12U 2HGTH 3SU6A 1UTOA 2B5TB 3RXKA 4CREA 2A0QB 2VH6A 4HI3A 4MDSA 1TNIA 1SGPE 1BJVA 1NFUA 1O3AA 1SR5C 1O3CA 1NRPH 1EPTA 3RXHA 3ATMA 4O9VA 1ANCA 4IN2A 4MNVA 1TGNA 2F9OA 3BTQE 4MVNA 2ZFTA 4B73A 3BEIB 3SGAE 5A8XA 1GJ4H 5CHAB 1Y3XA 5GJ4B 1NU9A 4RKOB 4X1PU 4H4FA 1THPB 2PTNA 3EA8A 1ZR0A 1SQAA 2ZI2H 1ARCA 2W5EA 3LDXH 1C1OA 2Z7FE 5PTPA 4B2CA 2VIWA 1GDNA 2Y5FA 1W14U 1VJAU 1TGSZ 3LH3A 2KAIA 4GCHF 2FLRH 5EQSA 1NFYA 1QRXA 5GDSH 1VR1H 3RC6A 1SGIB 3PTBA 1BBRK 3B23B 1BJUA 3GY8A 3MH5A 1P9SA 3RU4T 1TIOA 1GBHA 4Y0ZE 3QUMP 4RN6A 2P95A 1AE5A 4YT6H 3TGIE 1ESAA 1GI9B 1A5GH 2A31A 1RFNA 3ZZ3A 2P3TB 1LKAA 2GCTB 1ZSLA 3MTYA 3SW2B 1MMJN 1TLDA 3RU4D 2ZU1A 4ASHA 4KTCA 3U8TH 1L4DA 4B2AA 2O8TA 3MU8A 4AB8A 3TJNA 1TPOA 3EDXB 2XWBI 1ZPZA 3RMMH 1DX5M 1O5FH 5EW1H 3GDSA 4BTUB 3ODDA 1GI7B 3BG4B 1SVPA 4AOQA 1XXDA 3SOSA 5HXFA 1K1LA 1J9CH 1EKBB 1O5AB 1L1NA 1H9IE 2C3SA 2CHAB 1QQUA 2A5IA 1GJDB 1HXEH 1ARBA 2PSYA 1UTJA 1ZHRA 3SJ8A 3F68H 2GCHG 1ZYOA 3KCGH 3VB3A 1O2VA 3E90B 5L6NH 1MTNC 1O3EA 2G52A 4F4OC 2XW9A 2ZFRH 1P3CA 1YLCA 4UD9H 3SQEE 1W10U 3UNQA 1J17T 3A8DA 5A09A 1DT2A 1HLTH 2FMJA 1P2QA 1GVLA 3MWIU 3MO9A 5A0CA 1IQIA 2FTLE 1NRRH 1F0RA 3SQHE 1GI1A 3S7HB 2Z9JA 4KELA 4AGKA 1OPHB 3LGWA 1ZSJA 3TLOA 2FXRA 1THRH 1WQSA 1C2FA 1S81A 3M5LA 4ABJA 1HBTH 1NESE 1Y3WA 1O2JA 4DOQA 1SFIA 1A1RA 4DIIH 1RXPA 3NK8A 5GCHG 1VZQH 1SQOA 3SV6A 3SJOA 1K1NA 1UTKA 2OINA 3F9FA 1Z71A 3KGPA 4MPWA 1G30B 4FUJA 1IQFA 1TBRH 5H4IB 4ZMAH 3GDUA 4NSVA 3FP7E 2WPHS 1S82A 2IPHA 3EA7A 1S6HA 3SHAH 3K6ZA 1BMLA 4MPUA 2R0LA 1T4VH 2F91A 2QV1A 1BCUH 1PPHE 9LPRA 2EI6A 3A84A 3BG8A 4Q80A 1O2SA 3RXCA 3RC4A 1C5SA 1ZOMA 1CQQA 1MKWH 3ZZ9A 2G8TA 1G3EA 5EOKA 3V3MA 1EP5A 1C4V2 1O3BA 4LK4A 1ZLRA 1VGCB 2ODYB 1ETSH 2VINA 5A0AE 1C1TA 1PJPA 3A7YA 4I8GA 4NIVA 3TJUA 1VJ9U 1TMBH 1BMAA 5EODA 3ATWA 4Y11E 4UFFH 3IG6B 3F9HA 3DT0H 2VNTA 1RJXB 1Z1IA 2C8XB 1ZHPA 2HRVA 1H8DH 5TCCA 1ANEA 2A7JA 1V2OT 1ZTJA 1C5UA 1OYQA 3RU4E 3M36A 1O2GH 2J4IA 3LPRA 1KSNA 4LOYH 4AG2A 1C1NA 5AFYH 1CT2E 1GMDG 2FX4A 1P9UA 1UTLM 1ABJH 3LC3A 4KTSA 3ZYDA 1AE8H 2XC5A 3ZZ7A 4AGJA 1D3PB 1W11U 3A88A 1YPHE 1KTTB 3P95A 1SLWB 3P92A 1QQ4A 2RA0A 1JBUH 1W0ZU 2V35A 5BPEA 2BLQA 1P04A 1SGFG 1P12E 1ZRKA 4FUBA 1V2ST 2GZ8A 4D8NA 3BTFE 1O2QA 3L6PA 3GCNA 1NRSH 1OXGA 2C93B 2ZFFH 2GV6A 2VJ1A 1C2GA 3U9AH 3SNDA 3ZZ8A 2QA9E 4J2YB 1MBQA 1YPJH 3MO6A 1D3TB 1AD8H 2Q6GA 1SGNE 1ELTA 1C5TA 1GJ5H 1MKWK 5JBCS 1T4UH 1TA2A 3GY7A 1TGBA 4Y0YE 4ABDA 3MNCA 3V7TA 4FUGA 3ZZ4A 4LZ4B 1FONA 2J9NA 1H8IH 1GJAB 1C1UH 1LVMA 1ZHMA 3D23A 1DDJA 1BTWA 4ZKOU 1T8OA 1INCA 1GBLA 3VB5A 5E2OA 1ID5H 3Q3KA 1AFQC 5HM9A 1HJAC 1L0ZA 2ZO3H 3OY5U 3P17H 4GHTA 3TITA 4E06H 1C2HA 2OLGA 3VGCC 4X6MA 1EOLA 3M3VA 4X2WA 1O3KA 4NA7A 1HAPH 1O30A 3PB1E 2QGRA 4CRBA 1DLKB 2VGCC 1ELAA 4YOGA 4CH8B 2BZ6H 3RMNH 3V13A 2Y7ZA 4I8KA 3K9XB 1WBGB 1FPCH 3T62A 1S84A 1DUAA 2H5DA 4OS5A 3SU5A 3PMJA 8LPRA 2GZ9A 3A7TA 1EPTB 3ELAH 3LKWA 5LPFA 1SSXA 1A0JA 2GV7A 1P06A 1V2VT 2GMTC 4B1TA 2P16A 2BYAX 4IBLH 3LIWA 2R3YA 3TVJB 2UUJB 1VITH 1GBKA 1K1MA 3TGKE 1IQLA 1C9TA 1UVUH 3VXFH 5E2PA 1ZSKA 1L1JA 1PPCE 3ZVDA 4AYYB 1HNEE 2FZZA 2IJOB 5L2ZH 1ANBA 1J15A 2B0FA 4H42U 4ZHLU 4IC5A 1HAGE 4ABEA 2KAIB 1BTYA 3GCHB 1C5VA 1D4PB 2D8WA 1QA0A 4DY7B 2O8LA 1QRWA 3A80A 4WH8A 2HPQH 1K9OE 4O03A 1UJ1A 2W3KA 1C2IA 2J2UA 2WUBA 3SO3A 3WY8A 5EU8A 4SGAE 1KLIH 3BTTE 3P8FA 2H6MA 2ZDLA 1AQ7A 1FV9A 2PSXA 1KY9A 1WU1A 2G55A 1AHTH 3MFJA 1TE0A 2PGBB 5C5NA 1DLEA 2O9QA 2VIDA 2J94A 1Z6EA 4FU8A 3DA9B 2A5KA 2G4UA 3SI3H 1KXAA 5A8YA 1GCTC 3LONA 1RIWB 1P2KA 1MH0A 1TOCB 3AAUA 4FVBA 5EXMA 1TB6H 1H1BA 6GCHF 1UVOA 2SGPE 1TABE 1UK4A 1YPGH 1ZMNA 4OGXA 3MH4A 2Q6FA 5F6MA 2AGEX 1Q3XA 1ELVA 1A5IA 1P02A 8KME2 4DT7B 1T32A 1O2HA 1TMTH 1KYNA 1OWJA 4AFSA 1G2MA 1TPSA 3QTOH 2LNCA 1A3EH 3BTEE 1EAXA 2VWOA 2CXVA 1RTKA 3RLWH 1TRYA 4ISOA 3UOPA 1OP2A 1TX7A 1KXBA 2ALVA 4I8LA 1TMUH 3TU7H 4CH2B 1YPKH 2FI5E 3V0XA 1ELEE 1RTLA 4YZUA 1Y59T 3QDZB 3RXPA 1P03A 4JZ1A 1XUKA 2ZU5A 5B6OA 1TQ7B 4IN1A 4RKJB 4Y8YA 1MTWA 3EAJA 3FP8E 3RXLA 4KKDA 1GMHF 1PYTD 3GCTG 3FFGA 5DP6A 4YOJA 2PUQH 1T31A 3SORA 1V3XA 3MO3A 4WVPE 4X8TH 1AFEH 1D3QB 1A0LA 1PPZA 3A82A 4H6TA 1T8LA 1AY6H 2BOKA 1VCQA 3Q76A 2HALA 2P3FH 3GCOA 4TPIZ 1EZQA 2BD9A 4X0WU 1FI8A 3RXAA 1V2NT 2QC2A 2QF0A 3LU9B 2BD7A 4UONA 1G36A 1B0EA 1BRCE 1IQKA 1XVMA 3TH4H 1UVTH 1TYNA 1JXPA 3AAVA 2OQ5A 3E16B 3MOCA 1NZQH 4X2XA 1GMCF 3LOXA 2ZP0H 2ZGXH 2OCVB 5AFZH 1V2KT 1YYY1 1JRTA 1TNLA 5BRRE 4X6PA 3SU2A 1WOFA 3NPSA 4I8HA 3F6UH 1O5EH 2PTCE 9ESTA 3A86A 1A7SA 1NY22 2YNBA 2RDLA 1SI5H 5EXNA 5CE1A 5I25A 1FY3A 5JBAS 5F8ZA 3UR9A 1AVXA 1EATA 2VWLA 1G3DA 4BNRA 2VVCA 4DCDA 1MTNB 2OC1A 3A8BA 1MTUA 3MU5A 4UFGH 5E0HA 4UDWH 3QGJA 4TY7A 3UWIA 2F9UA 1G9IE 3BN9A 5CMXH 3URDA 1MQ6A 2BDGA 1BT7A 4VGCC 2AS9A 5G4BA 4AFZA 3BIUH 3VB4A 4ZHMU 1GDUA 2TRMA 1ELFA 4LXBH 7LPRA 2WPIS 1WUNH 5F03A 4YLUA 1HJ8A 5ESBA 1NS3A 1DANH 3HGNA 5GCHF 1E34B 1GI3A 1C5WB 2UUKB 5FAHA 4NCYA 4ZKSU 1JIRA 3Q3YA 2GD4B 3TNTA 1GHZA 2VH0A 2PUXB 3KF2A 1UTNA 3M5OA 3NZIA 2ZA5A 4OS7A 1GHXH 2NU1E 2W7SA 2ZDAH 3OTJE 4TWYA 4CRFA 1GJBB 1PPEE 2FOHA 4BANB 3SGQE 3ATIA 1E37B 1F0SA 2VVUA 4FUFA 3EYDA 1XMNB 1DM4B 1GI2A 1HAVB 1F0UA 4U32A 5EG4A 2THFB 4FXGH 1LMWB 3UQOA 1BDAA 1P3EA 1MZAA 3ZVEA 1H4WA 2P93A 3MU4A 1YKTA 4JYUH 2BLOA 1V2WT 2JH6D 1SMFE 3SUEA 3HKIB 2ZKSA 1GJ6A 1P11E 3BTME 4KTUA 2P3UB 3V12A 2TGPZ 1O3LA 4HGCA 1P10A 3ZZCA 4IC6A 1MQ5A 4X8VH 1FAXA 4YESB 2A4QA 3QZRA 2UWLA 3KL6A 2SGQE 4JZEH 1VITF 1O34A 1WTHD 1H9LB 1D6RA 2A45B 3MI4A 4D76A 8ESTE 3HGPA 1CA0C 6CHAC 1DXWA 3LGIA 1OOKB 1LHEH 1O2LA 1C1SA 2GT8A 1TALA 1LHDH 4YLQH 2WPKS 2VVVA 3OY6U 4ESTE 4NGAH 4XOJA 3E6PH 1A2CH 4JK6A 2FESH 3SU4A 2H9EH 2Y81A 1E36B 2GGVB 1AB9C 2SGEE 4JYTA 5C5OA 1CGHA 1MZDA 2XBXA 4XSKU 1QFKH 5T6FA 4JMYA 1FQ3A 2JKHA 4ABBA 3ZZAA 1GG6C 4Q7YA 1QTFA 2V0BA 2PW8H 2A5AA 1O38A 2C90B 5DP3A 3P8NA 1MU8B 2QYIA 5IYTA 1QJ1B 4CHAC 4Y8XA 2BM2A 7GCHG 2OBOA 4WY3A 2BDCA 4SGBE 2ZPQA 1F92A 3MU1A 1THSH 2D26C 3URCA 2FS9A 3D49H 1YPHC 3OSYA 2SNWA 3UFAA 3O8CA 2FOBA 2RG3A 1Y8TA 4INHA 1ESBA 2OC7A 4A92A 1TPPA 2Z9LA 2ZNKH 3D62A 2UUYA 1C5RA 1VCWA 3O8RA 2ZCLP 1DPOA 3UWJH 4K8YA 1IAUA 1EAWA 4R0IA 4E7NA 4OS4A 2OQUA 1DFPA 3A7ZA 2ODPA 1C9PA 1SGEE 3SV7A 2F9NA 2B7DH 1GVKB 2J34A 1AFQB 1HJAB 1QJ6B 1O33A 1FMGA 2Q6DA 3SHCH 1BHXF 1EASA 3VGCB 2BD2A 2BOHB 3QWCH 4K69A 5FCRA 2VGCB 3LT3A 1XUHA 1GHVH 3A8CA 2ZTYA 4DVAU 1SGYE 1OX1A 1NRNH 3SUGA 3I29A 3MNBA 2CN0H 3SJ9A 5AHGH 1O2UA 2Q1JA 4NZQA 1GBFA 2TPIZ 1KDQA 1O3DA 2NU0E 2Y5GA 1GL0E 4K3JA 2WYGA 2ZWLH 3TGJE 3U8OH 1YP9A 2D2DA 2GMTB 3PMBB 5JB8S 2O8WA 2WINI 1K22H 2SGFE 4ABIA 1OSSA 2AIPA 5J4SA 3CP7A 2A4OA 4AG1A 2BVRH 1JWTA 2ZFQH 2ZQ1A 2ZZUH 2ASUB 1DVAH 1LHGH 2OP9A 2CF9H 1AUJA 1GHAG 3B9FH 4K1EA 2XWAA 1A61H 1TNKA 1WV7H 4CBNA 1A3BH 4AX9H 1LVYA 2HOBA 2FOEA 3SI4H 2EI7A 1CHOF 5JBBS 4CRCA 3LJOA 1GDQA 1YCPH 1GBDA 2PKAA 1F7ZA 4Y8ZA 3QO6A 4U2WA 3QK1A 3SN8A 1FY5A 1HYLA 1K28D 2RA3A 3BTWE 2QXHA 4DIHH 1GPZA 2P59A 3ZYEA 1TONA 2JH5D 3U1IB 1Y3YA 1O2KA 1TFXA 5FCKA 1HRTH 4YM9A 3M61U 4IGDA 3TJVA 1GCTB 1Q2WA 2HLCA 3AASA 2J38A 5A8ZA 4B75A 1PQAA 2QXIA 1QBOA 4Z6AH 3O8BA 3QN7A 1B5GH 3EGKH 1BTHH 2XYAA 1P01A 2ZDNA 4FU7A 2BLVA 4Y6DA 3GOVB 2A2QH 2WPLS 5DJ7A 1V2TT 1GCDA 1GJCB 3VPKA 1FXYA 1MD8A 1F5RA 1OKXA 1BA8B 3M35A 1W7GH 1UCYE 1IQHA 3M7UA 3MH6A 3TPIZ 1OWHA 1T8MA 5K7RA 1ZTKA 2WPMS 3UREA 3M7TA 2PFEA 3JZ2B 1QBVH 2PR3A 4DJZB 1Y3VA 1NPMA 4BOHA 1S85A 1EX3A 4NWLA 5E0JA 1RGQA 3NXPA 1E35B 3RM0H 1CHGA 1OP0A 2P94A 3T29A 3KN2A 1L4ZA 1XXFA 2FWWA 4IMZA 2EI8A 3OU0A 3GCTF 1AN1E 1O2PA 5DGJA 2ZU2A 3STIA 1P09A 3SUDA 4YT7H 1AUTC 2AIQA 1NROH 4GAWA 1HAXB 3RMOH 1HIAA 2BD8A 3FZDA 2H2ZA 1GI6A 1K1IA 1W3CA 4UEHH 5FXLA 4X2YA 4CRAA 4NIYA 1YCPK 2SGDE 5ABWA 1W7XH 3MNXA 1O2RA 3A7WA 4WXVA 3N7OA 3DHKH 5TJXA 2ANWA 1ELDE 3UNSA 2TBSA 2A7CA 2ZDKA 1UTPA 3S69A 1N6YA 1JIMA 4Y7BA 4IMQA 2CF8H 2ZFPH 1EJNA 4K5ZA 4AFUA 1YPMH 3H7OA 4HZHA 3RXEA 2H9HA 1WCZA 4CRGA 1ZRBA 3KNXA 2AGIX 4NSYA 4ABHA 4XBDA 2QXGA 3ODFA 3ZV8A 1L2EA 1DICA 1DSTA 1OWIA 3G01A 3NCLA 1YCPM 1YM0A 4ZAEA 2Y80A 3M7QA 1ANDA 1MTSA 1DWCH 1EB2A 4NFFA 2ZGBH 4ZH8A 2AFQB 3PO1C 3PWCA 3FVFB 3MH7A 3T26A 4NG9H 3M37A 1NFWA 4THNH 5EPYA 2SGAA 5J4QA 4QT8C 1ESTA 1PQ8A 4K60A 1NO9H 3P8OA 1FN6A 4A7IB 4VGCB 3RXFA 1HAZB 6ESTA 1O3MA 1O3IA 1FIWA 2DUCA 2EA3A 3K65B 3ZZ5A 4UFDH 5C20A 4AB9A 2UWPA 1DWBH 2PV9B 2HNTE 1SGQE 1K1JA 2IN2A 1DXPA 3FANA 4R8TB 1NN6A 1RS0A 4KP0A 4MNYA 1BITA 4JK5A 4OS6A 3UTUH 3QX5H 1C5ZB 1GBCA 1YC0A 4TYDA 2F9PA 4MLFB 1P2MA 2BMGB 2ZIQH 2AMQA 3BTDE 3U69H 1A5HA 3MNSA 2ZCHP 2R2MB 3KQDA 4ZKRU 4WXIA 1UCYH 1LHCH 1C5MD 3HK3B 4YOIA 2EEKA 1OYTH 1GJ8B 2ZPRA 4X1SU 1FY4A 1NC6A 2GVFA 1EAUA 1LCYA 2BHGA 1G3BA 1GBEA 1HAOH 1G37A 4NIWA 3M5NA 2FTMA 2GP9B 1JMOH 2XC4A 1GBAA 5JBTA 1MCTA 3Q77A 3T27A 3AW0A 5JB9S 1G2LA 2C8ZB 1O2TA 5A0BA 2XTTB 2QCYA 1ABIH 2H5CA 1E38B 1SGCA 2Y82A 2BTCE 5HM2A 1GHBG 2ANKH 5L2YH 2VIOA 1FJSA 4MNWA 4GUXA 2G51A 1P0SH 2CV3A 1SGTA 2FEQH 2I6SA 4O3UA 2Z9IA 2ZG0H 1FNIA 1ETTH 1CA0B 1MD7A 6CHAB 8GCHG 1PYTC 2BZAA 2ZU3A 5LPEA 3SU1A 1KDQB 2B8OH 3PLKA 4Q7ZA 3A81A 2SNVA 4Q2KA 2ANYA 1EUFA 1TRNA 2A2XH 1NT1A 5GIBA 3RXRA 3L33A 1SQTA 2UWOA 2GTBA 2XBVA 4E7RG 2ZGJA 1AB9B 2ANMH 1GI0A 3B8JA 3U1JB 1Q31A 4A1VA 1GG6B 5F8XA 1UVSH 4FU9A 3HPTB 2GDDA 2DE8A 2FYRA 3OX7U 4KGAA 7GCHF 1LPKB 3RMLH 4IW4E 3A7XA 1BOQA 1UCYK 3R0FA 3W95A 4XBBA 4CHAB 1ETRH 3LGTA 4K1TA 4X2VA 3M3TA 1AWFH 2H1UA 3K6YA 5AVDA 2A4GA 1O0DH 4K2YA 1NFXA 4WF8A 5DPAA 2AGGX 3RXDA 1QNJA 2FOFA 2JH0D 2AEIH 2PKAB 2R3UA 3ZZBA 2GCHF 4ZHAA 3QLPH 2XNIA 3PMHB 3NUMA 3ZVBA 2CJIA 2OXSA 1MU6B 3SJIA 3LJJA 5SGAE 2A7HA 1O3NA 3JZ1B 1B7XB 3F9EA 1LPGB 1W13U 4AZ2B 2Y6TA 3BEUA 3BIVH 4BTTB 3ZVAA 4D9RA 5HMAA 3VEQB 3BTKE 2ZPSA 5DP8A 4HTCH 3CS0A 1HB0B 3F9GA 3TH2H 1C2JA 4Y10E 1BRBE 3CS7A 3TNSA 4I7YH 1QR3E 1CSOE 1GGDC 2XC0A 3MHWU 2WV5A 4B76A 2GZ7A 1SOZA 2W26A 2ALPA 3A87A 4WMEA 5EXLA 1V2JT 2OTVA 1GI4A 2FI4E 1HAIH 1F0TA 2H9TH 1TX6A 1GBIA 1P2IA 1SGDE 2BY7X 1N8OC 2IOTA 3GY3A 2BDIA 1UO6A 2PKSC 1SPJA 1AO5A 1OWKA 1XUIA 2FO9A 2F3CE 2YOLA 3UY9A 5LPRA 1AGJA 1TNHA 1UK2A 3SV9A 4MG3A 2ZCKP 4MTBA 2PLXA 1L1GA 1PQ7A 1C1VH 2QXJA 3KHVA 4B74A 5EPNA 1LTOA 4ISIH 3RXSA 1WYKA 1SLXB 3UUZA 2G5NA 2FI3E 1HIAB 1O2WA 2Z9GA 3BTGE 5FX6A 4X1NU 5DP5A 1BRUP 1Z1JA 2XCFA 1UVPA 1ORFA 1TPAE 1V2RT 3IITA 2F9BH 1O3GA 2P8OC 1GJ7B 1PPBH 2FLBH 2ILNA 3T28A 1XM1A 2R9PA 1IHSH 4A1TA 2OC0A 1K1PA 1C5PA 1O3FA 3GY4A 2O8MA 1CT0E 3NWUA 4NIXA 5C3NA 1D6WA 1LQEA 3E8LA 1QURH 1PPFE 3RXTA 2K1QA 4CBOA 4X8SH 4CR9A 1AVGH 3O8DA 1QY6A 2C4FH 4NFEA 1NM6A 3A85A 1BTPA 3UIRA 1V2UT 1GBMA 1GMDF 1LKBA 1A0HB 3D65E 5I46H 1ZPBA 1GI8B 1UTQA 1WAYB 3LGVA 3SNAA 3PMAB 2OC8A 1C5LH 2A4RA 2FS8A 2ULLA 1DUEA 3SU0A 1GL1A 4INKA 2G4TA 1Z8IB 1V2MT 3DD2H 3S0NA 1CBWC 1O5BB 1GMHG 1LQDB 1W0YH 1YLDA 1UTMA 1J8AA 3TK5A 1HAYB 1NRQH 1ZTLA 2TGTA 4WJG2 1O35A 1N6XA 3MYWA 2ESTE 2FOMB 3RXGA 4D7FA 2NU4E 5T6GA 2V6NA 1C4U2 2BDHA 2DE9A 1BRAA 4A6LA 1O2XA 3U98H 3RUOA 2PWXA 4BAQB 1GBTA 3GY2A 2R2WU 3R3GB 3C27B 1O37A 5GPIB 1HXFH 1O5CB 1D3DB 1GI5A 2JETC 1MKXH 4X6OA 2G81E 1FN8A 1S6FA 4BXSA 1GMCG 5E0GA 1EZSC 2BD5A 5F8TA 4AYVB 3UQVA 1U6QA 1N1LA 1C1QA 4FUIA 2ODQA 4F49A 4MQAA 3AVZA 3SNEA 4D7GA
chains in the Genus database with same CATH superfamily
1SG8B 1KTSB 3ITIA 3KQBA 3TK6A 3E0PB 2FOGA 3QZQA 3GICB 5LGOA 2ZHDA 1GVZA 1DSUA 1O2OA 1CVWH 1Z8JB 1KXCA 1T7CA 4TWWA 1CU1A 1UHBA 1P2JA 3HATH 1TBZH 3VXEH 5EW2H 4JZIA 1EB1H 2V3MA 1QHRB 4DT4A 3E0NB 3Q00A 1F2SE 3VB7A 3FZZA 1EXFA 1PFXC 1A46H 1Z8RA 5DKMA 5GWZA 3LH1A 1TRMA 2OD3B 5JYIA 1C1RA 4BXWA 4JZDH 3L3TA 2B9LA 1O2MA 1HFDA 3HKJB 3E1XB 5EQRA 4DW2U 1MAYA 3RC5A 4WMDA 3P6ZB 2OUAA 1RTFB 2ZTZA 4YO9A 2TGDA 3PO1B 3QGNB 4NA9H 4GHQA 1O39A 1UMAH 4ABGA 2BY8X 4NZLA 1QRZA 1C1PA 1TGTA 1DE7H 3K2UA 4X8UH 4U30A 1P05A 1D9IA 1WQVH 3LGUA 1EZUC 1HCGA 2BXUH 1CA8B 1RD3B 1YGCH 1ZMLA 1KXEA 1CT4E 3KIDU 1V6DA 1ZZZA 2BY9X 1AKSA 4M9FA 1MKXK 2A1DB 1SGFA 1Z7KA 1O3PB 3RXIA 1V2PT 4XFQA 1FZZA 4BAKB 3GISB 2L74A 1TAWA 4U01A 1C5QA 4JYVH 5FBIA 4UE7H 1CGJE 1C1MA 1QB9A 3ZV9A 2VIPA 5LH8A 4H6SB 3ZZ6A 2Z3EA 2ZDMA 1EQ9A 5HGGA 1C1WH 3RXVA 4FUEA 2BDYA 1QB6A 2C8WB 2AMPA 3EE0B 2HNTF 1S5SA 5L30H 1QB1A 3M3SA 4GLYA 1SBWA 1C2KA 1SOTA 1Z6JH 2FP7B 2BDAA 2HNTC 3FAOA 5EJ1A 1DWEH 5AF9H 1QIXB 5CHAC 1CO7E 1Y5BT 3AW1A 1KIGH 1RRKA 3TIUA 1NTPA 4AN7A 4CRDA 4A5TS 1XUFA 1ZMJA 4E05H 2HVYB 1ZJKA 1VITG 1YPLH 3WWFA 2W3IA 4WH6A 4AFQA 1LHFH 1F5LA 4TY6A 5C2ZA 4ABAA 1AI8H 1LVBA 1XKAC 4UFEH 1ZJDA 3STJA 4NWKA 3OE7D 3ATKA 3SBKA 1AMHA 1IQGA 4X6NA 3OEHD 3A7VA 3OYPA 2QF3A 1GBBA 1ACBE 1DS2E 3KQEA 4GCHG 4ZUHA 1GHBF 4K8BA 4B71A 1K1OA 1SC8U 1IQEA 2A32A 3PTNA 2FOCA 3BSQA 3VB6A 1F5KU 1O2ZA 3NKKA 2XCNA 2GCTC 4I31A 1YBWA 1CGIE 3BEFB 2ZHQH 1KXFA 4I8JA 8GCHF 3PYHA 5T3HA 1IQMA 1W2KH 1H9HE 2VIQA 4O97A 1HGTH 3DUXH 2VU8E 1B0FA 4M7GA 1XUGA 1JOUB 2V3OH 1XUJA 1K0HA 1A4WH 3BG4C 4OS2A 2AERH 6LPRA 4OS1A 3PROA 5JDUB 1O2YA 1BTZA 4DG4A 2PP6A 2CHAC 2ZTXA 1IOEA 1XX9A 1YWUA 3KQCA 1HAVA 1K2I1 2BX4A 3T25A 1DY9A 2Z9KA 2ZGCA 1XKBC 2G5VA 5FHTA 2W7UA 1QA7A 4TSFD 1HUTH 3SV2H 1IQJA 1MUEB 4PROA 5K0HA 3LGYA 1HAHH 1P57B 3U8RH 5DP4A 1OP8A 2IJD1 4MPVA 1GHYH 1UK3A 3E91A 2QAAA 5GXPA 3A89A 1Z8GA 4P00A 2TIOA 2G00A 1LVOA 4DURA 2FX6A 1S83A 4Z0KA 2FIRH 4Y79A 1BTXA 4ZXXH 4ISHH 5HYOA 3U28C 3UB0A 2VB0A 2CK3D 3ZVCA 1FY8E 4BAMB 4JZFH 1ZPCA 1WTGH 5EQQA 1J14A 4XE4A 2SFAA 2PGQB 2BVSH 2BY5X 2D1JA 4MPXA 1VCPA 1G3CA 2J95A 1BQYA 1X7AC 2ZQ2A 2XBWA 4Y7AA 1QL9A 1AZ8A 2NWNA 3P8GA 2FM2A 1EJAA 3FKSD 4RT1A 4TPYA 1FDPA 1BMMH 1IHTH 3ESTA 3RP2A 2STBE 3SNBA 4FOUC 4K1SA 1ELCA 5HIZA 2ZHFH 3VFEA 1DITH 1DOJA 1TQ0B 5FPYA 2XXLA 4GPGA 3S9BA 2QY0B 3SV8A 4X1QU 3LC5A 5JPMH 2WV4A 4FUHA 3CENA 2UUFB 1QGFA 5EGMA 2BY6X 5C0TA 1MAXA 1M9UA 5DP7A 1DWDH 1O5GH 1GGDB 3DFLA 1SB1H 5ESTE 3BTHE 2I6QA 2FODA 1CE5A 2BD3A 3C1KA 1O36A 4I33A 1S6LA 1ZGIA 1OS8A 2BDBA 1G32B 1V2LT 3SUFA 3RM2H 3F1SB 4D9QA 3PLBA 4FUCA 1VGCC 1IQNA 2WUCA 4ZKNU 1N8OB 1P2OA 1V2QT 1MCVA 1QL8A 1SHHB 3DFJA 4FETA 5KGOA 1SFQB 5C67A 4A1XA 1SLVB 2PKSB 4ABFA 1AZZA 1O3OA 4B2BA 4Y71A 2Y7XA 2ZHWH 4TT3D 4WMFA 2BX3A 5FBEA 1COWD 5FPTA 2ZU4A 1TWXB 1CHOG 3SZNA 1QCPA 3DSOA 1TNGA 4MNXA 3Q3XA 2VIVA 2ZGHA 2JDID 2BLWA 2WPJS 1WSSH 2O8UA 5IDKA 1EP6A 1SGRE 1TNJA 2M5TA 3SU3A 5DO4H 1BBRE 3A8AA 2BD4A 1AIXH 2W6JD 2FYQA 1TBQH 3I77A 3I78A 2F83A 3IWMA 3RXJA 2FOAA 4BAOB 2P8OB 3QTVH 4Y76A 5C1XA 2GX4A 1UHBB 5TCAA 1JRSA 3H5CB 2V3HH 5A2MH 2KCPA 1HDTH 1C5YB 2LP6A 2FPZA 4ZXYH 2GDEH 1FPHH 3ENSB 4CR5A 7KMEH 1C5XB 1EOJA 5T6DA 1SLUB 3RXUA 2XBYA 2BVXH 1EJMA 1T8NA 1TOMH 2YMSB 3ZVFA 1Y3UA 3SJKA 1LO6A 2ZDVH 3GY5A 1C2EA 1LDTT 1PQ5A 3UOUA 2LPRA 4YTAA 1ELGA 1O3JA 1FUJA 2F9VA 2Z3CA 4ZROA 1O5DH 1QJ7B 4X1RU 2WV9A 2BB4A 1J16A 1SHYA 2C8YB 5C1UA 3W94A 1QL7A 1ZGVA 3RDZA 1CBWB 2EC9H 2HWLB 1YY3A 3H7TA 3M5MA 2ZC9H 1BZXE 1AU8A 1W0KD 5FL7D 1QBNA 3A83A 3BV9B 1AKSB 2BQ6B 3PLPA 2XRCA 1FAKH 1GHWH 2NU3E 1AWHB 4Q7XA 2BXTH 4P02A 1BTUA 3ATLA 1BIOA 3GDVA 4WWYA 4XDEA 3RXOA 4ZCNA 2GKVE 2QIQA 5E8EH 2HVXA 1S0QA 2AMDA 2JJ1D 1NBMD 4ACBA 2RCEA 4HFPB 5DG6A 4XRNA 1BB0B 1EZXC 1TX8A 2JETB 3PV4A 3GYLB 3HK6B 4BAHB 1FY1A 1PPGE 1EPTC 4INLA 1AVWA 1O2NA 3PM3A 3P70B 2CMYA 1KLTA 4BTIB 1Y5UT 1XVOA 1GJ9B 1MBMA 2ZEBA 2VWMA 3GYMA 1C5OH 4JCNA 3GY6A 1DY8A 3KEEA 4J1YA 1O2IA 3TJOA 3S9CA 1OWEA 1C2LA 3ZZDA 1KLJH 2ZHEH 3WWBA 2J92A 3EQ0H 2WYJA 3BF6H 1C4Y2 2GT7A 4AORA 2Y5HA 4ISLA 3GCHC 4ISNA 1BMNH 1BHXB 1HV7A 1K21H 3MU0A 1YF4A 1ELBA 4NA8A 1YPEH 1C5NH 1HPGA 2JJ2D 3RXMA 1EFRD 1W8BH 4FUDA 3SGBE 3UR6A 3T5FH 4XBCA 2FDAA 2Z6BD 3E3TA 2BQWB 2TGAA 4O3TA 1TGCA 3RXBA 3T2NA 2AYWA 3RLYH 3EA9A 1FIZA 5ETXA 2AH4X 3PWBA 1HJ9A 1GBJA 2ZF0H 2R0KA 1EAIA 2VWNA 1BBRH 3FN8A 2Z3DA 1LPZB 2BQ7B 3SNCA 1O3HA 4GVUA 2JIZD 1P8VC 5FX5A 3S7KB 3TH3H 1S0RA 1H8HD 4OM9A 4OGYA 2ZECA 3UNRA 2K8IA 4IS5A 1O32A 1SL3A 5DK1A 1GHAF 2QN5T 3UPEA 2YNAA 3F0OA 1RIWC 4B6FA 2NU2E 4I32A 1GWAA 1NU7B 2HPPH 4FVDA 5FPSA 5C1YA 7ESTE 1KXDA 3MQKC 1MTVA 1C2MA 2ZFSA 3MMGA 2Z94A 1BUIA 3FP6E 2OBQA 1P2NA 1FLEE 1O31A 1Y5AT 3FOAA 2STAE 3RXQA 2CGAA 4GSOA 3TK9A 6GCHG 1C2DA 1E0FD 3ZVGA 3S9AA 5DP9A 4DGJA 4LZ1H 2PHBA 1TA6A 4RSPA 1OWDA 1W12U 4F55A 2HGTH 3SU6A 1UTOA 2B5TB 3RXKA 4CREA 2A0QB 2VH6A 4HI3A 4MDSA 1TNIA 1SGPE 1BJVA 1NFUA 1O3AA 1SR5C 1O3CA 1NRPH 1EPTA 3RXHA 3ATMA 4O9VA 1ANCA 4IN2A 4MNVA 1TGNA 2F9OA 3BTQE 4MVNA 2ZFTA 4B73A 3BEIB 3SGAE 5A8XA 1GJ4H 5CHAB 1Y3XA 5GJ4B 1NU9A 4RKOB 4X1PU 4H4FA 1THPB 2PTNA 3EA8A 1ZR0A 1SQAA 2ZI2H 1ARCA 2W5EA 3LDXH 1C1OA 2Z7FE 5PTPA 4B2CA 2VIWA 1GDNA 2Y5FA 1NBME 3GS9A 1W14U 1VJAU 1TGSZ 3LH3A 2KAIA 4GCHF 2FLRH 5EQSA 1NFYA 1QRXA 5GDSH 1VR1H 3RC6A 1SGIB 3PTBA 1BBRK 3B23B 1BJUA 3GY8A 3MH5A 1P9SA 3RU4T 1TIOA 1GBHA 4Y0ZE 3QUMP 4RN6A 2P95A 1AE5A 4YT6H 3TGIE 1ESAA 1GI9B 1A5GH 2A31A 1RFNA 3ZZ3A 2P3TB 1LKAA 2GCTB 1ZSLA 3MTYA 3SW2B 1MMJN 1TLDA 3RU4D 2ZU1A 4ASHA 4KTCA 3U8TH 1L4DA 4B2AA 2O8TA 3MU8A 4AB8A 3TJNA 1TPOA 3EDXB 2XWBI 1ZPZA 3RMMH 1DX5M 1O5FH 5EW1H 3GDSA 4BTUB 3ODDA 1GI7B 3BG4B 1SVPA 4AOQA 1XXDA 3SOSA 5HXFA 1K1LA 1J9CH 1EKBB 1O5AB 1L1NA 1H9IE 2C3SA 2CHAB 1QQUA 2A5IA 1GJDB 1HXEH 1ARBA 2PSYA 1UTJA 1ZHRA 3SJ8A 3F68H 2GCHG 1ZYOA 3KCGH 3VB3A 1O2VA 3E90B 5L6NH 1MTNC 1O3EA 2G52A 4F4OC 2XW9A 2ZFRH 1P3CA 1YLCA 4UD9H 3SQEE 1W10U 3UNQA 1J17T 3A8DA 5A09A 1DT2A 1HLTH 2FMJA 1P2QA 1GVLA 3MWIU 3MO9A 5A0CA 1IQIA 3SZEA 2FTLE 1NRRH 1F0RA 3SQHE 1GI1A 1FX0B 3S7HB 2Z9JA 4KELA 4AGKA 1OPHB 3LGWA 1ZSJA 3TLOA 2FXRA 1THRH 1WQSA 5CHBA 1C2FA 1S81A 3M5LA 4ABJA 1HBTH 1NESE 1Y3WA 1O2JA 4DOQA 1SFIA 2J98A 1A1RA 5B6LA 4DIIH 1RXPA 3NK8A 5GCHG 3ZIAD 1VZQH 1SQOA 3SV6A 3SJOA 1K1NA 1UTKA 2OINA 3F9FA 5EJLA 1Z71A 3KGPA 4MPWA 1G30B 4FUJA 1IQFA 1TBRH 5H4IB 4ZMAH 3GDUA 4NSVA 3FP7E 2WPHS 1S82A 2IPHA 3EA7A 1S6HA 3SHAH 3K6ZA 1BMLA 1W0JD 4MPUA 2R0LA 1T4VH 2F91A 2QV1A 3OAAD 1BCUH 1PPHE 9LPRA 2EI6A 3A84A 3BG8A 4Q80A 1O2SA 3RXCA 3RC4A 1C5SA 2WSSD 1ZOMA 1CQQA 1UW7A 1MKWH 3ZZ9A 2G8TA 1G3EA 5EOKA 3V3MA 1EP5A 1C4V2 1O3BA 3F2HA 4LK4A 1ZLRA 1VGCB 2ODYB 1ETSH 2VINA 5A0AE 1C1TA 2VBCA 1PJPA 3PRBA 5HIYA 3A7YA 4I8GA 4NIVA 3TJUA 1VJ9U 1TMBH 1BMAA 5EODA 1E1QD 3ATWA 2RDEA 2KCAA 4Y11E 4UFFH 3IG6B 3F9HA 3DT0H 3VG8A 2VNTA 1RJXB 1Z1IA 2C8XB 1ZHPA 2HRVA 1H8DH 5TCCA 1ANEA 2A7JA 1V2OT 1ZTJA 1C5UA 1OYQA 3RU4E 3M36A 1O2GH 2J4IA 3LPRA 1KSNA 4LOYH 4AG2A 1C1NA 5AFYH 1CT2E 1GMDG 2FX4A 1P9UA 1UTLM 1ABJH 3LC3A 4KTSA 3ZYDA 1AE8H 2XC5A 3ZZ7A 2WHXA 4AGJA 1D3PB 1W11U 3A88A 1YPHE 1KTTB 3P95A 1SLWB 3P92A 1QQ4A 2RA0A 1JBUH 1W0ZU 2K0QA 2V35A 5BPEA 2BLQA 1P04A 1SGFG 1P12E 1ZRKA 4FUBA 1V2ST 2GZ8A 4D8NA 3BTFE 1O2QA 3L6PA 3GCNA 1NRSH 1OXGA 2C93B 2ZFFH 2GV6A 2VJ1A 1C2GA 3U9AH 3SNDA 3ZZ8A 2QA9E 4J2YB 1MBQA 1YPJH 3MO6A 1D3TB 1AD8H 2Q6GA 1SGNE 1ELTA 1C5TA 1GJ5H 1MKWK 5JBCS 1T4UH 1TA2A 3GY7A 1TGBA 4Y0YE 4ABDA 3MNCA 3V7TA 4HG6A 5C0UA 4FUGA 3ZZ4A 4LZ4B 1FONA 2J9NA 1H8IH 1GJAB 1C1UH 1LVMA 1ZHMA 3D23A 1DDJA 1BTWA 4ZKOU 1T8OA 1INCA 3PV5A 1GBLA 3VB5A 5E2OA 1ID5H 3Q3KA 2KX4A 1AFQC 5HM9A 4B6EA 1HJAC 1L0ZA 2ZO3H 3OY5U 3P17H 4GHTA 3TITA 4E06H 1C2HA 2OLGA 3VGCC 4X6MA 1EOLA 3M3VA 4X2WA 1O3KA 4NA7A 1HAPH 1O30A 3PB1E 2QGRA 4CRBA 1DLKB 2VGCC 1ELAA 4YOGA 4CH8B 2BZ6H 3RMNH 3V13A 2Y7ZA 4I8KA 3K9XB 1WBGB 1FPCH 3T62A 1S84A 1DUAA 2H5DA 4OS5A 3SU5A 3PMJA 8LPRA 2GZ9A 3A7TA 1EPTB 3ELAH 3LKWA 5LPFA 1SSXA 1A0JA 4I86A 2GV7A 1P06A 3EE7A 1V2VT 2GMTC 4B1TA 2P16A 2BYAX 4IBLH 3LIWA 2AHME 2R3YA 3TVJB 2UUJB 1VITH 1GBKA 1K1MA 3TGKE 1IQLA 1C9TA 1UVUH 3VXFH 5E2PA 1ZSKA 1L1JA 1PPCE 3ZVDA 4AYYB 1HNEE 2FZZA 2IJOB 5L2ZH 1ANBA 1J15A 4RT0A 2B0FA 4H42U 4ZHLU 3W1EA 4IC5A 1HAGE 4ABEA 2KAIB 1BTYA 3GCHB 1C5VA 1D4PB 2D8WA 1QA0A 4DY7B 2O8LA 1QRWA 3A80A 4WH8A 2HPQH 1K9OE 4O03A 1UJ1A 2W3KA 1C2IA 2J2UA 2WUBA 3SO3A 3WY8A 5EU8A 4SGAE 1KLIH 3BTTE 3P8FA 2H6MA 2ZDLA 1AQ7A 1FV9A 2PSXA 1KY9A 1WU1A 2G55A 1AHTH 3MFJA 1TE0A 2PGBB 5C5NA 1DLEA 2O9QA 2VIDA 2J94A 1Z6EA 4FU8A 3DA9B 2A5KA 2G4UA 3SI3H 1KXAA 5A8YA 1GCTC 3LONA 1RIWB 1P2KA 1MH0A 1TOCB 3AAUA 4FVBA 5EXMA 5KEDA 1TB6H 1H1BA 6GCHF 1UVOA 2SGPE 1TABE 3F2FA 1UK4A 1YPGH 1ZMNA 4OGXA 1YLNA 3MH4A 2Q6FA 5F6MA 2AGEX 1Q3XA 1ELVA 1A5IA 1P02A 8KME2 4DT7B 1T32A 1O2HA 1TMTH 1KYNA 1OWJA 4AFSA 1G2MA 1OHHD 1TPSA 3QTOH 2LNCA 1A3EH 3BTEE 1EAXA 2VWOA 2CXVA 1RTKA 3RLWH 1TRYA 4ISOA 3UOPA 1OP2A 1TX7A 1KXBA 2ALVA 4I8LA 1TMUH 4YXWD 3TU7H 4CH2B 1YPKH 2FI5E 3V0XA 1ELEE 1RTLA 4YZUA 1Y59T 3KYGA 3QDZB 1P03A 4JZ1A 3RXPA 1XUKA 2ZU5A 5B6OA 1TQ7B 4IN1A 2J98B 4RKJB 4Y8YA 1MTWA 3EAJA 3FP8E 3RXLA 2J5UA 4KKDA 1GMHF 1PYTD 3GCTG 3FFGA 5DP6A 4YOJA 2PUQH 1T31A 3SORA 1V3XA 3MO3A 4WVPE 4X8TH 1AFEH 1D3QB 1A0LA 1PPZA 3A82A 4H6TA 1T8LA 1AY6H 2BOKA 1VCQA 3Q76A 2HALA 2P3FH 3GCOA 4TPIZ 1EZQA 2BD9A 4X0WU 1FI8A 3RXAA 4ACAA 1V2NT 2QC2A 2QF0A 3LU9B 2BD7A 4UONA 1G36A 1B0EA 1BRCE 1IQKA 1XVMA 3TH4H 1UVTH 1TYNA 1JXPA 3AAVA 2OQ5A 3E16B 3MOCA 1NZQH 4X2XA 1GMCF 3LOXA 2ZP0H 2ZGXH 2QF5A 2OCVB 5AFZH 1V2KT 3DSGA 1YYY1 1JRTA 1TNLA 5BRRE 4X6PA 3SU2A 1WOFA 3NPSA 2J97A 4I8HA 3F6UH 1O5EH 2PTCE 9ESTA 3A86A 1A7SA 1NY22 2YNBA 2RDLA 1SI5H 5EXNA 5CE1A 5I25A 1FY3A 5JBAS 5F8ZA 3UR9A 1AVXA 1EATA 2VWLA 1G3DA 4BNRA 2VVCA 4DCDA 1MTNB 2OC1A 3A8BA 1MTUA 3MU5A 4UFGH 5E0HA 4UDWH 3QGJA 4TY7A 3UWIA 2F9UA 1G9IE 2KCYA 3BN9A 5CMXH 3URDA 1MQ6A 2BDGA 1BT7A 4VGCC 2AS9A 5G4BA 4AFZA 3BIUH 3VB4A 4ZHMU 1GDUA 2TRMA 1ELFA 4LXBH 7LPRA 2WPIS 1WUNH 5F03A 4YLUA 1HJ8A 5ESBA 1NS3A 1DANH 3HGNA 5GCHF 1E34B 1GI3A 1C5WB 2UUKB 3SYJA 5FAHA 4NCYA 4ZKSU 1JIRA 3Q3YA 2GD4B 3TNTA 1GHZA 2VH0A 2PUXB 3KYFA 3KF2A 1UTNA 3M5OA 3NZIA 2ZA5A 4OS7A 1GHXH 2NU1E 2W7SA 2ZDAH 3OTJE 4TWYA 4CRFA 1GJBB 1PPEE 2FOHA 4BANB 3SGQE 3ATIA 1E37B 1F0SA 2VVUA 4FUFA 3EYDA 1XMNB 1DM4B 5EJZA 1GI2A 1HAVB 1F0UA 4U32A 5EG4A 2THFB 2WZQA 1LMWB 4FXGH 1BDAA 3UQOA 1P3EA 1MZAA 3ZVEA 1H4WA 2P93A 3MU4A 1YKTA 4JYUH 2BLOA 1V2WT 2JH6D 1SMFE 3SUEA 3HKIB 2ZKSA 1GJ6A 1P11E 3BTME 4KTUA 2P3UB 3V12A 2TGPZ 1O3LA 4HGCA 1P10A 3ZZCA 4IC6A 1MQ5A 4X8VH 1FAXA 4YESB 2A4QA 3QZRA 2UWLA 3KL6A 2SGQE 4JZEH 1VITF 1O34A 1WTHD 1H9LB 1D6RA 2A45B 3MI4A 4D76A 8ESTE 3HGPA 1CA0C 1VKYA 6CHAC 1DXWA 2YMSD 3LGIA 1OOKB 5C94A 1LHEH 1O2LA 1C1SA 1WDIA 2GT8A 1TALA 1LHDH 5T1VA 4YLQH 2WPKS 2VVVA 3OY6U 4ESTE 1SKYE 4NGAH 4XOJA 3E6PH 1A2CH 4JK6A 2FESH 3SU4A 2H9EH 2Y81A 1E36B 2GGVB 1AB9C 1BMFD 2SGEE 4JYTA 5C5OA 1CGHA 1MZDA 4Q63A 2XBXA 4XSKU 1QFKH 5T6FA 4JMYA 1FQ3A 2JKHA 4ABBA 3ZZAA 1GG6C 4Q7YA 1QTFA 2V0BA 2PW8H 2IPQX 2A5AA 1O38A 2C90B 5DP3A 3P8NA 1MU8B 2QYIA 5IYTA 1QJ1B 4CHAC 4Y8XA 2BM2A 7GCHG 2OBOA 4WY3A 2BDCA 4SGBE 2ZPQA 1F92A 3MU1A 1THSH 2D26C 3URCA 2FS9A 3D49H 1YPHC 3OSYA 2SNWA 3UFAA 3O8CA 2FOBA 2RG3A 2KCOA 1Y8TA 4INHA 1ESBA 2OC7A 4A92A 1TPPA 2Z9LA 2ZNKH 3D62A 2UUYA 1C5RA 1VCWA 3O8RA 2ZCLP 1DPOA 3UWJH 4K8YA 1IAUA 1EAWA 4R0IA 4E7NA 5KECA 4OS4A 2OQUA 3CNRA 1DFPA 3A7ZA 1C9PA 1SGEE 2ODPA 3SV7A 2F9NA 2B7DH 1GVKB 2J34A 1AFQB 1WXRA 1HJAB 1QJ6B 1O33A 1FMGA 2Q6DA 3SHCH 2QF4A 1BHXF 1EASA 3VGCB 2BD2A 2BOHB 3QWCH 4K69A 5FCRA 2VGCB 3LT3A 1XUHA 2RFKC 1GHVH 3A8CA 2ZTYA 2HLDD 4DVAU 1SGYE 3F2GA 1OX1A 1NRNH 3SUGA 3I29A 3MNBA 2CN0H 3SJ9A 5AHGH 1O2UA 2Q1JA 4NZQA 1GBFA 2TPIZ 1KDQA 1O3DA 2NU0E 2Y5GA 1GL0E 4K3JA 2KZ4A 2WYGA 2ZWLH 3TGJE 3U8OH 1YP9A 2D2DA 2GMTB 3PMBB 5JB8S 2O8WA 2WINI 1K22H 2SGFE 4ABIA 1OSSA 2AIPA 5J4SA 3CP7A 2A4OA 4AG1A 2BVRH 1JWTA 2ZFQH 2ZQ1A 2ZZUH 2ASUB 1DVAH 1LHGH 2OP9A 2CF9H 1AUJA 2F43B 1GHAG 3B9FH 4K1EA 2XWAA 1A61H 1TNKA 1WV7H 4CBNA 1A3BH 5F53A 1LVYA 2HOBA 4AX9H 2FOEA 3SI4H 2EI7A 1CHOF 5JBBS 4CRCA 3LJOA 1GDQA 1YCPH 1GBDA 2PKAA 1F7ZA 4Y8ZA 3QO6A 4U2WA 3QK1A 3SN8A 1FY5A 1HYLA 1K28D 2RA3A 3BTWE 2QXHA 4DIHH 1GPZA 2P59A 3ZYEA 1TONA 2JH5D 3U1IB 1Y3YA 1O2KA 1TFXA 5FCKA 1HRTH 4YM9A 2GJGA 3M61U 4IGDA 2QE7D 3TJVA 1GCTB 1Q2WA 2HLCA 3AASA 2J38A 5A8ZA 3PV2A 4B75A 1PQAA 2QXIA 5HKKD 1QBOA 4Z6AH 3O8BA 3QN7A 1B5GH 3EGKH 1BTHH 2XYAA 1P01A 2ZDNA 3UAIC 4FU7A 2BLVA 4Y6DA 3GOVB 2A2QH 2WPLS 5DJ7A 1V2TT 1GCDA 1GJCB 3VPKA 1FXYA 1MD8A 1F5RA 1OKXA 1BA8B 3M35A 3OFND 1W7GH 1UCYE 1IQHA 3M7UA 3MH6A 3TPIZ 1OWHA 1T8MA 5K7RA 1ZTKA 2WPMS 3UREA 3M7TA 2PFEA 3JZ2B 4Z1MD 1QBVH 2PR3A 4DJZB 1Y3VA 1NPMA 4BOHA 1S85A 1EX3A 4NWLA 5E0JA 1RGQA 3NXPA 1E35B 3RM0H 1CHGA 1OP0A 2P94A 3T29A 3KN2A 1L4ZA 1XXFA 2FWWA 4IMZA 2EI8A 3OU0A 3GCTF 5CDFE 1AN1E 1O2PA 5DGJA 2ZU2A 3STIA 1P09A 3SUDA 4YT7H 1AUTC 2AIQA 1NROH 4GAWA 1HAXB 3RMOH 1HIAA 2BD8A 3FZDA 2H2ZA 1GI6A 1K1IA 1W3CA 4UEHH 5FXLA 1E79D 4X2YA 4CRAA 4NIYA 1YCPK 2SGDE 5ABWA 1W7XH 3MNXA 1O2RA 3DCLA 3A7WA 4WXVA 3N7OA 3DHKH 5TJXA 2ANWA 1ELDE 3UNSA 5DSFA 2TBSA 2A7CA 2ZDKA 1UTPA 3S69A 1N6YA 1JIMA 4Y7BA 4IMQA 3OTPA 2CF8H 2ZFPH 1EJNA 4K5ZA 4AFUA 1YPMH 3H7OA 4HZHA 3RXEA 2H9HA 1WCZA 4CRGA 1ZRBA 3KNXA 2AGIX 4XD7D 4NSYA 4ABHA 4XBDA 2QXGA 5DN6D 3ODFA 3ZV8A 1L2EA 1DICA 1DSTA 1OWIA 3G01A 3NCLA 1YCPM 1YM0A 4ZAEA 2Y80A 3F0PA 3M7QA 1ANDA 1E1RD 1MTSA 1DWCH 1EB2A 4NFFA 2ZGBH 4ZH8A 2AFQB 3PO1C 3PWCA 3FVFB 3MH7A 3N99A 2KFWA 3T26A 4NG9H 3M37A 2M2AA 1NFWA 4THNH 5EPYA 2KR7A 2SGAA 5J4QA 4QT8C 1ESTA 1PQ8A 4K60A 1NO9H 3P8OA 1FN6A 4A7IB 4VGCB 3RXFA 1HAZB 6ESTA 1O3MA 1O3IA 2OK5A 1FIWA 2DUCA 2EA3A 3K65B 3ZZ5A 4Q4LA 4UFDH 5C20A 4AB9A 2UWPA 1DWBH 2PV9B 2HNTE 1SGQE 1K1JA 2IN2A 1DXPA 3FANA 4R8TB 1NN6A 1RS0A 4KP0A 4MNYA 1BITA 4JK5A 4OS6A 3UTUH 3QX5H 1C5ZB 1GBCA 1YC0A 3OEED 4TYDA 2F9PA 4MLFB 1P2MA 2BMGB 2ZIQH 2AMQA 3BTDE 3U69H 1A5HA 3MNSA 2ZCHP 2R2MB 3KQDA 4ZKRU 4WXIA 1UCYH 1LHCH 1C5MD 3HK3B 4YOIA 2EEKA 1OYTH 1GJ8B 2ZPRA 4X1SU 1FY4A 2L6OA 2EQNA 1NC6A 2GVFA 1EAUA 1LCYA 2BHGA 1G3BA 1GBEA 1HAOH 1G37A 4NIWA 3M5NA 2FTMA 3F3BA 2GP9B 1JMOH 2XC4A 1MABB 2XOKD 1GBAA 5JBTA 1MCTA 3Q77A 3T27A 3AW0A 5JB9S 1G2LA 2C8ZB 1O2TA 5A0BA 2XTTB 2QCYA 1ABIH 2H5CA 1E38B 1SGCA 2Y82A 2BTCE 5HM2A 3NRLA 1GHBG 2ANKH 5L2YH 2VIOA 1FJSA 4MNWA 4GUXA 2G51A 1P0SH 1SQRA 2CV3A 1SGTA 2FEQH 2I6SA 4O3UA 2Z9IA 4RI0A 2ZG0H 1FNIA 1ETTH 1CA0B 1MD7A 6CHAB 8GCHG 5IK2D 1PYTC 2BZAA 2ZU3A 5LPEA 3SU1A 1KDQB 2B8OH 3PLKA 4Q7ZA 3A81A 2SNVA 4Q2KA 5GNDA 2ANYA 1EUFA 1TRNA 2A2XH 1NT1A 2WPDD 5GIBA 3FO8D 3RXRA 3L33A 1SQTA 2UWOA 2GTBA 2XBVA 4E7RG 2ZGJA 1AB9B 2ANMH 1GI0A 3B8JA 3U1JB 1Q31A 4A1VA 2W6ID 1GG6B 5F8XA 1UVSH 4FU9A 3HPTB 2GDDA 2DE8A 2FYRA 3OX7U 4KGAA 7GCHF 1LPKB 3RMLH 4IW4E 3A7XA 1BOQA 1UCYK 3R0FA 3W95A 4XBBA 4CHAB 1ETRH 3LGTA 4K1TA 4X2VA 3M3TA 1AWFH 2H1UA 3K6YA 4ASUD 5AVDA 2A4GA 1O0DH 4K2YA 1NFXA 4WF8A 5DPAA 2AGGX 3RXDA 1QNJA 2FOFA 2JH0D 2AEIH 2PKAB 2R3UA 3ZZBA 2GCHF 4ZHAA 5EIYA 3QLPH 2XNIA 3PMHB 3NUMA 2F4LA 3ZVBA 2CJIA 2OXSA 1MU6B 3SJIA 3LJJA 5SGAE 2A7HA 1O3NA 3JZ1B 1B7XB 3KQ5A 3F9EA 1LPGB 1W13U 4AZ2B 2Y6TA 3BEUA 3BIVH 4BTTB 3ZVAA 4D9RA 5HMAA 3VEQB 3BTKE 2ZPSA 5DP8A 4HTCH 3CS0A 1HB0B 3F9GA 3TH2H 1C2JA 4Y10E 1BRBE 3CS7A 3TNSA 4I7YH 1QR3E 1CSOE 1GGDC 2XC0A 3MHWU 2WV5A 4B76A 2GZ7A 1SOZA 2W26A 2ALPA 3A87A 4WMEA 5EXLA 1V2JT 1KMHB 2OTVA 1GI4A 2FI4E 2XNDD 1HAIH 1F0TA 2H9TH 1TX6A 1GBIA 1P2IA 1SGDE 2BY7X 1N8OC 2IOTA 3GY3A 2BDIA 1UO6A 1SPJA 2PKSC 1AO5A 1OWKA 1XUIA 2FO9A 2F3CE 2YOLA 3UY9A 5LPRA 1AGJA 1TNHA 5C17A 1UK2A 3SV9A 4MG3A 2ZCKP 4MTBA 2PLXA 1L1GA 1PQ7A 1C1VH 2QXJA 3WW7A 3KHVA 4B74A 5EPNA 1LTOA 4ISIH 3RXSA 1WYKA 1SLXB 3UUZA 3N7EA 2G5NA 2FI3E 1HIAB 4F48B 1O2WA 2Z9GA 3BTGE 5FX6A 4X1NU 5DP5A 1BRUP 1Z1JA 2XCFA 1UVPA 1ORFA 1TPAE 1V2RT 3IITA 2F9BH 1O3GA 2P8OC 1GJ7B 2EY4C 1PPBH 2FLBH 3PRDA 2ILNA 3T28A 1XM1A 2R9PA 3DSPA 1IHSH 4AC9A 4A1TA 2OC0A 1K1PA 1C5PA 1O3FA 3GY4A 2O8MA 1CT0E 3NWUA 4NIXA 5C3NA 1D6WA 1LQEA 3E8LA 1QURH 1PPFE 3RXTA 2YMSC 2K1QA 4CBOA 4X8SH 4CR9A 1AVGH 3O8DA 1QY6A 2C4FH 4NFEA 1NM6A 3A85A 1BTPA 3UIRA 3AK5A 1V2UT 1GBMA 1GMDF 1LKBA 1A0HB 3D65E 5I46H 1ZPBA 1GI8B 1UTQA 1QZ8A 1WAYB 3LGVA 3SNAA 3PMAB 2OC8A 1C5LH 2A4RA 2FS8A 2ULLA 1DUEA 3SU0A 1GL1A 4INKA 2G4TA 1Z8IB 1V2MT 3DD2H 2V7QD 3S0NA 1CBWC 1O5BB 3N7DA 1GMHG 1LQDB 1W0YH 1YLDA 1UTMA 1J8AA 3TK5A 1HAYB 1NRQH 1ZTLA 2TGTA 4WJG2 1O35A 2LELA 1N6XA 3MYWA 2ESTE 2FOMB 3RXGA 4D7FA 2NU4E 5T6GA 2V6NA 3H09A 1C4U2 2BDHA 2DE9A 1BRAA 4A6LA 1O2XA 3U98H 3RUOA 2PWXA 4BAQB 1GBTA 3GY2A 2R2WU 3R3GB 1H8ED 3C27B 1O37A 5GPIB 1HXFH 1O5CB 1D3DB 1GI5A 2JETC 1MKXH 4X6OA 2G81E 1FN8A 1S6FA 2KM0A 4BXSA 1GMCG 5E0GA 1EZSC 2BD5A 5F8TA 4AYVB 3UQVA 1U6QA 1N1LA 1C1QA 4FUIA 2ODQA 4F49A 4MQAA 3AVZA 3SNEA 4D7GA
chains in the Genus database with same CATH topology
1SG8B 1KTSB 3ITIA 3KQBA 3TK6A 3E0PB 2FOGA 3QZQA 3GICB 5LGOA 2ZHDA 1GVZA 1DSUA 1O2OA 1CVWH 1Z8JB 1KXCA 1T7CA 4TWWA 1CU1A 1UHBA 1P2JA 3HATH 1TBZH 3VXEH 5EW2H 4JZIA 1EB1H 1QHRB 3E0NB 3Q00A 1F2SE 3VB7A 3FZZA 1EXFA 1PFXC 1A46H 1Z8RA 5DKMA 5GWZA 3LH1A 1TRMA 2OD3B 5JYIA 1C1RA 4BXWA 4JZDH 3L3TA 2B9LA 1O2MA 1HFDA 3HKJB 3E1XB 5EQRA 4DW2U 1MAYA 3RC5A 4WMDA 3P6ZB 2OUAA 1RTFB 2ZTZA 4YO9A 2TGDA 3PO1B 3QGNB 4NA9H 4GHQA 1O39A 1UMAH 4ABGA 2BY8X 4NZLA 1QRZA 1C1PA 1TGTA 1DE7H 3K2UA 4X8UH 4U30A 1P05A 1D9IA 1WQVH 3LGUA 1EZUC 1HCGA 2BXUH 1CA8B 1RD3B 1YGCH 1ZMLA 1KXEA 1CT4E 3KIDU 1V6DA 1ZZZA 2BY9X 1AKSA 1MKXK 2A1DB 1SGFA 1Z7KA 1O3PB 3RXIA 1V2PT 4XFQA 1FZZA 4BAKB 3GISB 1TAWA 4U01A 1C5QA 4JYVH 5FBIA 4UE7H 1CGJE 1C1MA 1QB9A 3ZV9A 2VIPA 5LH8A 4H6SB 3ZZ6A 2Z3EA 2ZDMA 1EQ9A 5HGGA 1C1WH 3RXVA 4FUEA 2BDYA 1QB6A 2C8WB 2AMPA 3EE0B 2HNTF 1S5SA 5L30H 1QB1A 3M3SA 4GLYA 1SBWA 1C2KA 1SOTA 1Z6JH 2FP7B 2BDAA 2HNTC 3FAOA 1DWEH 5AF9H 1QIXB 5CHAC 1CO7E 1Y5BT 3AW1A 1KIGH 1RRKA 3TIUA 1NTPA 4AN7A 4CRDA 4A5TS 1XUFA 1ZMJA 4E05H 1ZJKA 1VITG 1YPLH 2W3IA 4WH6A 4AFQA 1LHFH 1F5LA 4TY6A 5C2ZA 4ABAA 1AI8H 1LVBA 1XKAC 4UFEH 1ZJDA 3STJA 4NWKA 3ATKA 3SBKA 1AMHA 1IQGA 4X6NA 3A7VA 3OYPA 2QF3A 1GBBA 1ACBE 1DS2E 3KQEA 4GCHG 4ZUHA 1GHBF 4K8BA 4B71A 1K1OA 1SC8U 1IQEA 2A32A 3PTNA 2FOCA 3BSQA 3VB6A 1F5KU 1O2ZA 3NKKA 2XCNA 2GCTC 4I31A 1YBWA 1CGIE 3BEFB 2ZHQH 1KXFA 4I8JA 8GCHF 3PYHA 5T3HA 1IQMA 1W2KH 1H9HE 2VIQA 4O97A 1HGTH 3DUXH 2VU8E 1B0FA 4M7GA 1XUGA 1JOUB 2V3OH 1XUJA 1A4WH 3BG4C 4OS2A 2AERH 6LPRA 4OS1A 3PROA 5JDUB 1O2YA 1BTZA 4DG4A 2CHAC 2ZTXA 1IOEA 1XX9A 3KQCA 1HAVA 1K2I1 2BX4A 3T25A 1DY9A 2Z9KA 2ZGCA 1XKBC 2G5VA 5FHTA 2W7UA 1QA7A 1HUTH 3SV2H 1IQJA 1MUEB 4PROA 5K0HA 3LGYA 1HAHH 1P57B 3U8RH 5DP4A 1OP8A 4MPVA 1GHYH 1UK3A 3E91A 2QAAA 5GXPA 3A89A 1Z8GA 2TIOA 2G00A 1LVOA 4DURA 2FX6A 1S83A 4Z0KA 2FIRH 4Y79A 1BTXA 4ZXXH 4ISHH 5HYOA 2VB0A 3ZVCA 1FY8E 4BAMB 4JZFH 1ZPCA 1WTGH 5EQQA 1J14A 4XE4A 2SFAA 2PGQB 2BVSH 2BY5X 2D1JA 4MPXA 1VCPA 1G3CA 2J95A 1BQYA 1X7AC 2ZQ2A 2XBWA 4Y7AA 1QL9A 1AZ8A 2NWNA 3P8GA 2FM2A 1EJAA 4TPYA 1FDPA 1BMMH 1IHTH 3ESTA 3RP2A 2STBE 3SNBA 4K1SA 1ELCA 2ZHFH 3VFEA 1DITH 1DOJA 1TQ0B 5FPYA 2XXLA 4GPGA 3S9BA 2QY0B 3SV8A 4X1QU 3LC5A 5JPMH 2WV4A 4FUHA 3CENA 2UUFB 1QGFA 5EGMA 2BY6X 1MAXA 1M9UA 5DP7A 1DWDH 1O5GH 1GGDB 3DFLA 1SB1H 5ESTE 3BTHE 2I6QA 2FODA 1CE5A 2BD3A 3C1KA 1O36A 4I33A 1ZGIA 1OS8A 2BDBA 1G32B 1V2LT 3SUFA 3RM2H 3F1SB 4D9QA 3PLBA 4FUCA 1VGCC 1IQNA 2WUCA 4ZKNU 1N8OB 1P2OA 1V2QT 1MCVA 1QL8A 1SHHB 3DFJA 1SFQB 5C67A 4A1XA 1SLVB 2PKSB 4ABFA 1AZZA 1O3OA 4B2BA 4Y71A 2Y7XA 2ZHWH 4WMFA 2BX3A 5FBEA 5FPTA 2ZU4A 1TWXB 1CHOG 3SZNA 1QCPA 1TNGA 4MNXA 3Q3XA 2VIVA 2ZGHA 2BLWA 2WPJS 1WSSH 2O8UA 5IDKA 1EP6A 1SGRE 1TNJA 2M5TA 3SU3A 5DO4H 1BBRE 3A8AA 2BD4A 1AIXH 2FYQA 1TBQH 3I77A 3I78A 2F83A 3IWMA 3RXJA 2FOAA 4BAOB 2P8OB 3QTVH 4Y76A 5C1XA 2GX4A 1UHBB 5TCAA 1JRSA 3H5CB 2V3HH 5A2MH 1HDTH 1C5YB 2FPZA 4ZXYH 2GDEH 1FPHH 3ENSB 4CR5A 7KMEH 1C5XB 1EOJA 5T6DA 1SLUB 3RXUA 2XBYA 2BVXH 1EJMA 1T8NA 1TOMH 3ZVFA 1Y3UA 3SJKA 1LO6A 2ZDVH 3GY5A 1C2EA 1LDTT 1PQ5A 3UOUA 2LPRA 4YTAA 1ELGA 1O3JA 1FUJA 2F9VA 2Z3CA 4ZROA 1O5DH 1QJ7B 4X1RU 2BB4A 1J16A 1SHYA 2C8YB 5C1UA 3W94A 1QL7A 1ZGVA 3RDZA 1CBWB 2EC9H 2HWLB 3H7TA 3M5MA 2ZC9H 1BZXE 1AU8A 1QBNA 3A83A 3BV9B 1AKSB 2BQ6B 3PLPA 2XRCA 1FAKH 1GHWH 2NU3E 1AWHB 4Q7XA 2BXTH 1BTUA 3ATLA 1BIOA 3GDVA 4WWYA 4XDEA 3RXOA 2GKVE 2QIQA 5E8EH 2HVXA 1S0QA 2AMDA 2RCEA 4HFPB 5DG6A 1BB0B 1EZXC 1TX8A 2JETB 3PV4A 3GYLB 3HK6B 4BAHB 1FY1A 1PPGE 1EPTC 4INLA 1AVWA 1O2NA 3PM3A 3P70B 2CMYA 1KLTA 4BTIB 1Y5UT 1XVOA 1GJ9B 1MBMA 2ZEBA 2VWMA 3GYMA 1C5OH 4JCNA 3GY6A 1DY8A 3KEEA 4J1YA 1O2IA 3TJOA 3S9CA 1OWEA 1C2LA 3ZZDA 1KLJH 2ZHEH 2J92A 3EQ0H 2WYJA 3BF6H 1C4Y2 2GT7A 4AORA 2Y5HA 4ISLA 3GCHC 4ISNA 1BMNH 1BHXB 1HV7A 1K21H 3MU0A 1YF4A 1ELBA 4NA8A 1YPEH 1C5NH 1HPGA 3RXMA 1W8BH 4FUDA 3SGBE 3UR6A 3T5FH 4XBCA 2FDAA 2Z6BD 3E3TA 2BQWB 2TGAA 4O3TA 1TGCA 3RXBA 3T2NA 2AYWA 3RLYH 3EA9A 1FIZA 5ETXA 2AH4X 3PWBA 1HJ9A 1GBJA 2ZF0H 2R0KA 1EAIA 2VWNA 1BBRH 2Z3DA 1LPZB 2BQ7B 3SNCA 1O3HA 4GVUA 5FX5A 1P8VC 3S7KB 3TH3H 1S0RA 4OGYA 2ZECA 3UNRA 4IS5A 1O32A 1SL3A 5DK1A 1GHAF 2QN5T 3UPEA 2YNAA 1RIWC 2NU2E 4I32A 1GWAA 1NU7B 2HPPH 4FVDA 5FPSA 5C1YA 7ESTE 1KXDA 1MTVA 1C2MA 2ZFSA 3MMGA 2Z94A 1BUIA 3FP6E 2OBQA 1P2NA 1FLEE 1O31A 1Y5AT 3RXQA 2STAE 3TK9A 2CGAA 4GSOA 6GCHG 1C2DA 1E0FD 3ZVGA 3S9AA 5DP9A 4DGJA 4LZ1H 2PHBA 1TA6A 4RSPA 1OWDA 1W12U 2HGTH 3SU6A 1UTOA 2B5TB 3RXKA 4CREA 2A0QB 2VH6A 4HI3A 4MDSA 1TNIA 1SGPE 1BJVA 1NFUA 1O3AA 1SR5C 1O3CA 1NRPH 1EPTA 3RXHA 3ATMA 4O9VA 1ANCA 4IN2A 4MNVA 1TGNA 2F9OA 3BTQE 4MVNA 2ZFTA 4B73A 3BEIB 3SGAE 5A8XA 1GJ4H 5CHAB 1Y3XA 5GJ4B 1NU9A 4RKOB 4X1PU 4H4FA 1THPB 2PTNA 3EA8A 1ZR0A 1SQAA 2ZI2H 1ARCA 2W5EA 3LDXH 1C1OA 2Z7FE 5PTPA 4B2CA 2VIWA 1GDNA 2Y5FA 1W14U 1VJAU 1TGSZ 3LH3A 2KAIA 4GCHF 2FLRH 5EQSA 1NFYA 1QRXA 5GDSH 1VR1H 3RC6A 1SGIB 3PTBA 1BBRK 3B23B 1BJUA 3GY8A 3MH5A 1P9SA 3RU4T 1TIOA 1GBHA 4Y0ZE 3QUMP 4RN6A 2P95A 1AE5A 4YT6H 3TGIE 1ESAA 1GI9B 1A5GH 2A31A 1RFNA 3ZZ3A 2P3TB 1LKAA 2GCTB 1ZSLA 3MTYA 3SW2B 1MMJN 1TLDA 3RU4D 2ZU1A 4ASHA 4KTCA 3U8TH 1L4DA 4B2AA 2O8TA 3MU8A 4AB8A 3TJNA 1TPOA 3EDXB 2XWBI 1ZPZA 3RMMH 1DX5M 1O5FH 5EW1H 3GDSA 4BTUB 3ODDA 1GI7B 3BG4B 1SVPA 4AOQA 1XXDA 3SOSA 5HXFA 1K1LA 1J9CH 1EKBB 1O5AB 1L1NA 1H9IE 2C3SA 2CHAB 1QQUA 2A5IA 1GJDB 1HXEH 1ARBA 2PSYA 1UTJA 1ZHRA 3SJ8A 3F68H 2GCHG 1ZYOA 3KCGH 3VB3A 1O2VA 3E90B 5L6NH 1MTNC 1O3EA 2G52A 4F4OC 2XW9A 2ZFRH 1P3CA 1YLCA 4UD9H 3SQEE 1W10U 3UNQA 1J17T 3A8DA 5A09A 1DT2A 1HLTH 2FMJA 1P2QA 1GVLA 3MWIU 3MO9A 5A0CA 1IQIA 2FTLE 1NRRH 1F0RA 3SQHE 1GI1A 3S7HB 2Z9JA 4KELA 4AGKA 1OPHB 3LGWA 1ZSJA 3TLOA 2FXRA 1THRH 1WQSA 1C2FA 1S81A 3M5LA 4ABJA 1HBTH 1NESE 1Y3WA 1O2JA 4DOQA 1SFIA 1A1RA 4DIIH 1RXPA 3NK8A 5GCHG 1VZQH 1SQOA 3SV6A 3SJOA 1K1NA 1UTKA 2OINA 3F9FA 1Z71A 3KGPA 4MPWA 1G30B 4FUJA 1IQFA 1TBRH 5H4IB 4ZMAH 3GDUA 4NSVA 3FP7E 2WPHS 1S82A 2IPHA 3EA7A 1S6HA 3SHAH 3K6ZA 1BMLA 4MPUA 2R0LA 1T4VH 2F91A 2QV1A 1BCUH 1PPHE 9LPRA 2EI6A 3A84A 3BG8A 4Q80A 1O2SA 3RXCA 3RC4A 1C5SA 1ZOMA 1CQQA 1MKWH 3ZZ9A 2G8TA 1G3EA 5EOKA 3V3MA 1EP5A 1C4V2 1O3BA 4LK4A 1ZLRA 1VGCB 2ODYB 1ETSH 2VINA 5A0AE 1C1TA 1PJPA 3A7YA 4I8GA 4NIVA 3TJUA 1VJ9U 1TMBH 1BMAA 5EODA 3ATWA 4Y11E 4UFFH 3IG6B 3F9HA 3DT0H 2VNTA 1RJXB 1Z1IA 2C8XB 1ZHPA 2HRVA 1H8DH 5TCCA 1ANEA 2A7JA 1V2OT 1ZTJA 1C5UA 1OYQA 3RU4E 3M36A 1O2GH 2J4IA 3LPRA 1KSNA 4LOYH 4AG2A 1C1NA 5AFYH 1CT2E 1GMDG 2FX4A 1P9UA 1UTLM 1ABJH 3LC3A 4KTSA 3ZYDA 1AE8H 2XC5A 3ZZ7A 4AGJA 1D3PB 1W11U 3A88A 1YPHE 1KTTB 3P95A 1SLWB 3P92A 1QQ4A 2RA0A 1JBUH 1W0ZU 2V35A 5BPEA 2BLQA 1P04A 1SGFG 1P12E 1ZRKA 4FUBA 1V2ST 2GZ8A 4D8NA 3BTFE 1O2QA 3L6PA 3GCNA 1NRSH 1OXGA 2C93B 2ZFFH 2GV6A 2VJ1A 1C2GA 3U9AH 3SNDA 3ZZ8A 2QA9E 4J2YB 1MBQA 1YPJH 3MO6A 1D3TB 1AD8H 2Q6GA 1SGNE 1ELTA 1C5TA 1GJ5H 1MKWK 5JBCS 1T4UH 1TA2A 3GY7A 1TGBA 4Y0YE 4ABDA 3MNCA 3V7TA 4FUGA 3ZZ4A 4LZ4B 1FONA 2J9NA 1H8IH 1GJAB 1C1UH 1LVMA 1ZHMA 3D23A 1DDJA 1BTWA 4ZKOU 1T8OA 1INCA 1GBLA 3VB5A 5E2OA 1ID5H 3Q3KA 1AFQC 5HM9A 1HJAC 1L0ZA 2ZO3H 3OY5U 3P17H 4GHTA 3TITA 4E06H 1C2HA 2OLGA 3VGCC 4X6MA 1EOLA 3M3VA 4X2WA 1O3KA 4NA7A 1HAPH 1O30A 3PB1E 2QGRA 4CRBA 1DLKB 2VGCC 1ELAA 4YOGA 4CH8B 2BZ6H 3RMNH 3V13A 2Y7ZA 4I8KA 3K9XB 1WBGB 1FPCH 3T62A 1S84A 1DUAA 2H5DA 4OS5A 3SU5A 3PMJA 8LPRA 2GZ9A 3A7TA 1EPTB 3ELAH 3LKWA 5LPFA 1SSXA 1A0JA 2GV7A 1P06A 1V2VT 2GMTC 4B1TA 2P16A 2BYAX 4IBLH 3LIWA 2R3YA 3TVJB 2UUJB 1VITH 1GBKA 1K1MA 3TGKE 1IQLA 1C9TA 1UVUH 3VXFH 5E2PA 1ZSKA 1L1JA 1PPCE 3ZVDA 4AYYB 1HNEE 2FZZA 2IJOB 5L2ZH 1ANBA 1J15A 2B0FA 4H42U 4ZHLU 4IC5A 1HAGE 4ABEA 2KAIB 1BTYA 3GCHB 1C5VA 1D4PB 2D8WA 1QA0A 4DY7B 2O8LA 1QRWA 3A80A 4WH8A 2HPQH 1K9OE 4O03A 1UJ1A 2W3KA 1C2IA 2J2UA 2WUBA 3SO3A 3WY8A 5EU8A 4SGAE 1KLIH 3BTTE 3P8FA 2H6MA 2ZDLA 1AQ7A 1FV9A 2PSXA 1KY9A 1WU1A 2G55A 1AHTH 3MFJA 1TE0A 2PGBB 5C5NA 1DLEA 2O9QA 2VIDA 2J94A 1Z6EA 4FU8A 3DA9B 2A5KA 2G4UA 3SI3H