1ELBA

Analogous inhibitors of elastase do not always bind analogously
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ELASTASE
publication title Analogous inhibitors of elastase do not always bind analogously.
pubmed doi rcsb
source organism Sus scrofa
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1993-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elbA01
2P95A 1EJMA 1TWXB 1HBTH 1ZHPA 3ATMA 3E6PH 2EA3A 4Y0ZE 3MU5A 4Y8YA 1NRPH 1SGEE 1ELDE 1GBDA 3EAJA 3FP6E 5JBCS 1UMAH 4JZEH 3ZYEA 5E0HA 3RM2H 2FOAA 1O3AA 1TNHA 3TJOA 3SNCA 2HRVA 4X6NA 4AGKA 1FY3A 1LVOA 2OXSA 2WYJA 4X0WU 2SGFE 4NZQA 5A2MH 3U8RH 4I8HA 2ZCLP 2JH0D 3FZZA 1QURH 2YNAA 2FMJA 3DA9B 3UPEA 1LHFH 1O2JA 1LTOA 1GHAG 5DG6A 3S7HB 1C5NH 1UVPA 1GJ8B 3BEFB 1EP5A 2QY0B 1NRRH 2QF0A 1AI8H 2BDIA 4BTTB 2A4OA 8LPRA 1AVWA 3ESTA 3A8CA 1EASA 1RXPA 1QL9A 2PFEA 1FY1A 1OSSA 3RC4A 1O5EH 4VGCB 4F49A 1ARBA 4HI3A 1GMHF 1ELFA 1AQ7A 5EXLA 4THNH 3LGYA 1THPB 5TCCA 1RTFB 5DP4A 1V2LT 3IG6B 1HXEH 2HVXA 2VVUA 3D65E 1ANBA 1P9SA 2HOBA 3QGJA 3TK9A 1C5YB 1H8IH 2R9PA 2GZ9A 2CJIA 3O8RA 1C2IA 4Y71A 4NIWA 4ISIH 3ATIA 5DP3A 3SN8A 1ANEA 1SQOA 2XWAA 1VITG 3MHWU 4YZUA 3LKWA 3ZZ4A 1GWAA 3GCNA 3KL6A 1Z8GA 1SVPA 2VIQA 1HCGA 2C8YB 1C1WH 2UUYA 3ZVAA 4AB8A 1MTUA 5J4SA 1HFDA 1MKWK 1N6XA 3F68H 4AFSA 1PPHE 1TX7A 1GL1A 1C2KA 1C5ZB 1O2NA 3IWMA 5DP5A 3RMLH 2BXTH 2A7CA 3DHKH 5A8XA 2VJ1A 2XCFA 3A7XA 3F9FA 3E16B 2XC4A 2PW8H 1GMDF 1QHRB 1O38A 3Q3YA 2FX6A 1AB9B 1ELGA 3BTKE 2SGEE 2XBVA 1A5IA 1B0FA 3RXLA 1TMTH 3GDVA 1BHXF 2B9LA 1C2MA 1F92A 3RXKA 1H8DH 4UFFH 3NZIA 1Z7KA 1K21H 2AIPA 1TRNA 4DJZB 3M5NA 1Y5UT 1TA6A 2Q1JA 3A86A 3SU1A 1EB2A 4ABDA 1T8MA 1F0TA 1UTOA 1P3EA 1A0JA 1A5HA 2NU1E 4TY7A 5FX6A 3RXMA 4M7GA 3MWIU 1GHVH 1HDTH 1O2GH 4R0IA 1T8NA 4E7RG 3GY8A 2V35A 2AERH 2BDYA 1A3EH 5JBBS 1QR3E 2VIPA 4ISOA 2HLCA 1AVXA 4H4FA 5FBIA 2C3SA 4NA9H 4X1NU 1QJ7B 5GWZA 3OTJE 4ZHLU 2OTVA 1FLEE 3S69A 3ZZ5A 1QB6A 3QN7A 1RIWB 1LDTT 1LHGH 5EU8A 1JIMA 2OLGA 4GPGA 3KN2A 1SGFA 3GDSA 5SGAE 2G4TA 3ZVGA 3MH6A 4X2XA 2ZFPH 3ZZDA 7KMEH 4FUGA 1AWFH 5DO4H 1BRAA 3WY8A 4ZKRU 1SMFE 1FN8A 1Z6EA 1MAYA 1V2ST 4OS7A 2WPIS 4XBCA 1AFEH 2Z9IA 4CRCA 1MKXK 4MNXA 2W7UA 2H1UA 1BIOA 1GHZA 1FUJA 1D3DB 4FVDA 3BTHE 6CHAC 1PQ8A 1YPHE 2TGTA 4YO9A 5FHTA 1QTFA 1CBWB 1JOUB 5HGGA 3PWCA 1TFXA 4ZMAH 1EZQA 3RLYH 1ZRKA 2ZTYA 4ASHA 1FI8A 3LGTA 4D9QA 3E90B 4D7FA 1ZR0A 4X2VA 3SNEA 4NWLA 1JWTA 1KDQA 2FYQA 2BDHA 1G3EA 4HTCH 1Z1IA 1Z8IB 1DANH 3ZVDA 1F7ZA 1WSSH 1WUNH 2Z9GA 1GBAA 1EAWA 1UJ1A 2F91A 4FUDA 2WPMS 1FAXA 1ZMLA 1IQFA 2OD3B 2H9HA 3FVFB 3OY6U 2G81E 3I29A 1H1BA 1YC0A 1GVZA 1WV7H 3HPTB 4NIYA 5FBEA 1LHDH 1MTNB 2BVRH 2D2DA 3MTYA 2PKAA 4ZAEA 4KTCA 2BD8A 1C4V2 3DUXH 1EKBB 3QTVH 1WQVH 4NG9H 3SNBA 4NA8A 1S83A 1Q3XA 1QRZA 1UCYE 4RKJB 1N6YA 1JBUH 2Z9LA 5EW1H 5JPMH 1CA8B 1DT2A 1GJ9B 4WH8A 4U32A 1KXFA 2DE9A 1TGTA 1BRBE 3GYLB 4GVUA 1O3NA 1ANDA 3H7TA 3UTUH 4A7IB 2D26C 1BTYA 2O8WA 2A4RA 1EB1H 4WVPE 1Z71A 3JZ2B 3PV4A 5DP7A 1C1SA 3T2NA 3U98H 5C20A 2FIRH 2FDAA 3K2UA 1HAOH 2J95A 4GCHF 4X1QU 1S81A 2OINA 1RRKA 4GSOA 4NIVA 1QBVH 1SQAA 2BD3A 4J1YA 2G5VA 2ZHFH 1ZYOA 2Z3CA 1ZZZA 3QO6A 2ZDNA 2GCTB 1C2FA 3ZVBA 4B2AA 5J4QA 1TPAE 2GP9B 1ETRH 1GHXH 1DICA 4INKA 3A89A 2ZU3A 1CGJE 1K9OE 3Q77A 4BAMB 2A0QB 3QZRA 1W7GH 1TBZH 4BAKB 3SBKA 3A8AA 1MCVA 1V6DA 1HJAB 1HAYB 2F9OA 1O33A 1BMNH 4WXVA 2OC7A 5L2YH 1D3QB 1F2SE 4I8JA 1S5SA 4WY3A 4CR9A 3BTTE 2FTLE 2ZU5A 3GY4A 5F8TA 3KNXA 1HPGA 1S0QA 3SOSA 3SI4H 3VXFH 1GI3A 3O8DA 3T5FH 1JRTA 1L2EA 2ZDVH 3SHAH 1FONA 4DY7B 1HJ8A 1A61H 1IQGA 5FXLA 2FOHA 5FPYA 4ABIA 2A1DB 4NSVA 5PTPA 3EA9A 3A81A 1O2WA 2ESTE 1ZJKA 4ZHAA 3A7YA 3RXAA 3SV9A 2ODPA 1P06A 2W26A 3RXEA 1O3DA 1NPMA 2AMQA 2BZ6H 1ZJDA 3SW2B 1EJAA 2G52A 1RJXB 1HAVB 1P8VC 2FI5E 1C5WB 1GJCB 1OWHA 4MPUA 5ESTE 4NFEA 2J2UA 1J14A 3ZZBA 2R3UA 2ZC9H 3S9AA 1SBWA 1OYQA 1CHOF 1TABE 3BSQA 4HGCA 2GGVB 1OWKA 2HWLB 1CSOE 1O3BA 1AMHA 2F83A 4JYTA 3UWJH 2GZ8A 1K1LA 4NCYA 2BLOA 1XUGA 4CRBA 1N8OC 1P05A 3OY5U 1EPTB 1Y5BT 2BD7A 1T32A 2FI3E 1S0RA 2VVCA 3PLBA 1E35B 1BBRK 3HGPA 1XUJA 1FY4A 5IDKA 1HAHH 1LVYA 4YM9A 1W12U 4MQAA 3V3MA 3ZYDA 1C9TA 3CP7A 1UTPA 4SGAE 2JH6D 3TGKE 1SGYE 2ZF0H 2KAIB 2TGPZ 2XCNA 3MH7A 1L0ZA 1BHXB 1PPEE 1ZSLA 2H6MA 3LONA 3EQ0H 1ELEE 1NTPA 4JZ1A 4WMEA 5FCRA 3V0XA 1CT0E 1GJBB 1O2HA 1O2RA 1VCPA 1Z8JB 4GLYA 1FIZA 1G3CA 1FZZA 4UDWH 1CE5A 3QZQA 1O32A 3T27A 2GT8A 5AVDA 3AAUA 2ZHDA 2GVFA 4A1TA 3UQOA 1FN6A 1SI5H 1W11U 1NY22 4IW4E 4WMDA 1MZAA 3A82A 3SNDA 3ZV9A 2G5NA 4O03A 1QRWA 3VB3A 2PR3A 1ELCA 1KIGH 3HATH 1WTGH 1O2IA 3RU4D 1BZXE 1W3CA 4NFFA 5EG4A 3FAOA 1MKXH 3T28A 1GI4A 3IITA 3SNAA 4Y0YE 1CA0C 2ZECA 5CMXH 1S6FA 4BAOB 1GI8B 1JRSA 4Y8ZA 1BMLA 2J38A 1E37B 3BG4B 4IMZA 4O3TA 1ZOMA 2RG3A 3PMAB 3A83A 4BXSA 1EQ9A 5GJ4B 2BXUH 2OUAA 2SGDE 1UTJA 1A2CH 2V6NA 1QBOA 1MBQA 1V2TT 4I8LA 1GMHG 3LGWA 5L2ZH 1L1GA 3T62A 1UK2A 2ANKH 5HYOA 3PO1C 1JIRA 3ZZ6A 1E38B 1AU8A 2BM2A 1V2UT 1D6RA 2C8WB 1ANCA 3ENSB 1J16A 5GIBA 2A32A 1W7XH 4B2CA 1A7SA 2VU8E 1YLCA 3FZDA 3Q76A 3RXIA 1MZDA 1IOEA 1VR1H 1VJAU 1ELBA 2HNTC 4O3UA 4Q7YA 3P92A 3DD2H 1TONA 2B0FA 3ZZ3A 1NO9H 1K1OA 3EDXB 2PGBB 1S85A 1YGCH 2GD4B 1V2VT 5EQSA 3S9CA 2F9VA 3GCHB 2PKSC 2CV3A 1O2MA 5AHGH 1MTSA 1GBFA 1G3BA 2HPQH 3SV6A 4K2YA 1DSTA 2JETB 3NUMA 3TJUA 3A80A 1OS8A 1C1RA 1C5MD 3BTGE 3LOXA 1S84A 1HIAB 1ETTH 4NSYA 4MLFB 3R3GB 2FOEA 4B74A 1GMDG 1LKBA 4E05H 3UUZA 1BTHH 3SQEE 3RC5A 1C9PA 1FV9A 3RP2A 4YOJA 1CU1A 3K9XB 2FS9A 3B9FH 3UOPA 2Z6BD 1UTMA 4RKOB 1Y3UA 2VWOA 1GDUA 1XXDA 2XBXA 1PYTD 2O8UA 3VB5A 1SOTA 3ZZAA 5E2PA 5LPRA 2FO9A 4BAQB 2Y5FA 3NWUA 4UFEH 2BLVA 1GCTB 4X6OA 1TNGA 1EAIA 4JYVH 2ZGBH 3AW0A 1ABJH 2BD5A 2SGQE 2ZFQH 2RA0A 1LVMA 1EJNA 3MNCA 1P57B 4HZHA 1TQ0B 3DFJA 4YOIA 3SV7A 1F0UA 3M3TA 1UVSH 1ID5H 1Y3VA 3A8DA 1O2SA 1ZLRA 1UTLM 2FOCA 3RC6A 5L30H 1GG6C 2Z7FE 2BDBA 1L4ZA 4WH6A 2A45B 5T6GA 4ABFA 2XW9A 4A1VA 2NU3E 2EI6A 1QNJA 1UTNA 2ZKSA 5C1UA 1CT2E 1TGNA 4ZHMU 2H9TH 4MPWA 3O8BA 4J2YB 3GY2A 1C5LH 1ELVA 1K1MA 4E7NA 1A1RA 3K6ZA 3UWIA 2VGCC 1FJSA 4CHAB 4CH8B 2B7DH 1DUEA 3M5MA 3ZV8A 3MO3A 5C1XA 4IMQA 2GCHF 1G37A 3V12A 3P8FA 1OWEA 1NZQH 3ITIA 3QWCH 1BDAA 5A09A 1D9IA 1DLEA 2WPLS 1NRNH 1YLDA 1C5QA 3E3TA 3LJOA 3RM0H 2NU2E 1GJ7B 2OBOA 2Z3DA 4IGDA 1BBRH 2SNWA 4YT6H 2WPKS 4AOQA 2R2MB 3ZVEA 4BTUB 1TNJA 1KXAA 2PV9B 2A5KA 2QIQA 2PUQH 5C5OA 1BCUH 3RXRA 4ABHA 2SFAA 2ZZUH 1OKXA 1EATA 1LQEA 2LNCA 1RTKA 3R0FA 1H9IE 4FU9A 1Y8TA 2PLXA 4DGJA 2EEKA 1EZSC 1AVGH 1UHBB 1GDQA 2NU4E 3RU4T 1G2LA 3F6UH 4VGCC 2P93A 4ABEA 1BJUA 1YCPK 2ANWA 1SSXA 1UK3A 1BTUA 4MNYA 1TB6H 1P2JA 1F5LA 2VB0A 4I32A 1C5OH 3RLWH 1P11E 1DS2E 3HGNA 1XUHA 1SLWB 2BMGB 1QRXA 2WV5A 4KELA 4FXGH 1O0DH 3RXBA 2G55A 1UCYK 2ZHQH 3KQEA 3TK6A 4BAHB 1AD8H 1TNIA 1OXGA 1O2KA 3LH1A 3S9BA 1Q2WA 1TGSZ 4CR5A 4CRFA 2STBE 3Q3XA 4CBNA 5C2ZA 1HAVA 2TPIZ 3STIA 2W3IA 1TOCB 5C3NA 1W14U 1SLUB 3MMGA 1YP9A 2BVXH 4FU7A 1PQ7A 1TPPA 2TIOA 4MDSA 1NN6A 1DX5M 2Z3EA 3SUFA 1QB9A 1TLDA 1OP8A 3TJNA 1THRH 4Q7ZA 2VIDA 2OQUA 1HB0B 3SV2H 2WYGA 4GCHG 4OS2A 2XNIA 1VZQH 3ZVCA 1GI6A 5AF9H 1EZUC 3NKKA 3P8NA 2VNTA 1XKAC 1O3KA 3SUGA 1CT4E 1AB9C 1NC6A 1Y3XA 1KLIH 4XOJA 1C4Y2 1LPGB 3C27B 1ZTKA 3M7QA 3JZ1B 1P0SH 2QYIA 3QUMP 3PMHB 2ANYA 1T4UH 1XMNB 1V2NT 2VIVA 2ODQA 1QFKH 3LJJA 3P8OA 1BB0B 3UNRA 1QY6A 2EI7A 2BQ7B 1O3FA 2KAIA 1EAXA 2ZEBA 3RXVA 1GBTA 1U6QA 2G4UA 6ESTA 1L4DA 4U01A 1O37A 1XXFA 1UO6A 1SGRE 3F9EA 1D3PB 2Z9JA 1TIOA 2H5DA 1BTXA 3U8TH 2A5IA 1FQ3A 1O5BB 4CRDA 1CVWH 1SLVB 2WUBA 3ODDA 3SUEA 3SJOA 1GJ6A 3SJ9A 5C5NA 4UFDH 1NS3A 2ZP0H 2ZDAH 2G00A 6GCHG 4KKDA 2ZFSA 1NESE 5K7RA 4Z0KA 3CS0A 1UTKA 5LPEA 3T25A 1P2NA 4A5TS 4CBOA 1GBEA 3RXSA 3PYHA 2XC0A 1ZRBA 2IJOB 1MAXA 1DWBH 3PLPA 4Y10E 4I33A 2ZTZA 4UFGH 3M61U 1RIWC 4O97A 1TRYA 1VCQA 2XTTB 2AGIX 1DE7H 4FUIA 4A92A 3GICB 1AFQB 2OC0A 2P8OB 3F1SB 1WTHD 1CHOG 2ZU2A 1QJ1B 4BXWA 2BZAA 2P16A 1NU7B 4OS4A 3KIDU 4D7GA 1DSUA 3KF2A 3VEQB 1CHGA 1AN1E 1W10U 3ZZ8A 1AZ8A 2W7SA 3ZZ9A 3A84A 1AUTC 1D3TB 2TGDA 2BQWB 1A3BH 1BMAA 3GY7A 1CGIE 1LVBA 4AN7A 3M5OA 4Q2KA 1DY8A 4Y79A 4Q7XA 3GISB 1F0RA 2ZHEH 3PMJA 4IN1A 1W2KH 1YBWA 3TNSA 1DY9A 4IBLH 1P2OA 1DWEH 2FODA 2BY8X 2V3HH 3GY5A 3BTDE 3PMBB 3EA8A 2Y80A 1QJ6B 1CBWC 1LHEH 1W0ZU 1LO6A 1GI1A 2ZFRH 4I8KA 4KTSA 1VGCB 1TBRH 3LC5A 3BIUH 4RN6A 4MNVA 4MPXA 1IAUA 3VGCB 3FP7E 4RSPA 1P12E 1YCPM 4CRAA 3URDA 1O2QA 2Q6GA 1K1NA 2WINI 1T31A 2Z9KA 3TH4H 3SGBE 3AASA 2XYAA 4TPYA 5EODA 2D8WA 1QGFA 1KXBA 4NGAH 1O30A 1TMUH 1P10A 2GMTB 1ORFA 2Y5HA 2OP9A 2Y7XA 1W13U 3GCOA 4IC5A 1HIAA 2UWLA 2ZHWH 4IS5A 1MTNC 4K60A 3UIRA 3VB7A 1AO5A 4UE7H 1FAKH 1IQLA 2R0KA 2ULLA 3SU6A 1C5TA 2CHAB 1GVLA 3KCGH 3QTOH 8ESTE 4AYVB 1ZHRA 1MD8A 4B73A 1UVUH 4FUCA 1QBNA 1QA0A 1IQNA 1C5SA 2DE8A 5EXMA 1BTWA 3ELAH 6LPRA 1MKWH 5EGMA 1N8OB 2F9BH 8KME2 1V2OT 6GCHF 2IN2A 3GY6A 2ZPSA 9LPRA 7ESTE 1V2WT 2TRMA 1EOLA 2BY9X 1BRCE 2WV4A 1GBJA 2XWBI 4XBBA 3L6PA 1DWDH 2FOMB 4INLA 4AYYB 1TNLA 5A8ZA 2FEQH 3MI4A 3KHVA 3BTME 1C1QA 4B2BA 2BOHB 1SGIB 3SU2A 1TALA 1OYTH 4JZIA 3VPKA 1ELTA 3UREA 2GCTC 2SGAA 1UCYH 2FXRA 5T3HA 1J8AA 1C5RA 2RA3A 3A87A 5EPNA 3VXEH 2FOBA 1O5DH 4OS5A 1O2PA 5E0JA 2FS8A 1HJAC 4E06H 4ABBA 2OC8A 4I8GA 3Q00A 1V3XA 5I46H 1PPBH 1GI7B 5EQRA 1K28D 2ZG0H 3TITA 1XKBC 5B6OA 1G3DA 4H6SB 2QA9E 1GJDB 1BT7A 1V2KT 2LPRA 4AG1A 1LMWB 1AWHB 1SG8B 2HNTE 1O5AB 5T6FA 2FI4E 1QQUA 1ELAA 1VJ9U 5DP6A 3PLKA 2Q6DA 3AVZA 1ZMJA 1V2PT 3P95A 5CHAB 3VB6A 4KTUA 2IOTA 1ZGVA 3HKJB 5CE1A 1D6WA 3LT3A 2ZWLH 4DOQA 5A0CA 3V13A 1SGPE 1FPCH 1ZMNA 3UY9A 3A7TA 3RXJA 1Q31A 3RMNH 1A4WH 2R2WU 2Y5GA 2ANMH 3B23B 2ZFTA 2J4IA 1F5KU 1TBQH 1SB1H 2CF8H 4LXBH 7GCHF 1UHBA 2Z94A 1WU1A 4FUJA 2XXLA 2ZI2H 1GGDB 1UVTH 4OS6A 4JZFH 3O8CA 5EQQA 1NT1A 1FDPA 2OQ5A 4AZ2B 2G51A 1EX3A 5ESBA 2FOGA 3MO9A 1AY6H 5E0GA 4IN2A 4AFUA 1DWCH 1TPSA 4GHTA 1YPMH 3UFAA 2EC9H 1BITA 1KSNA 2SNVA 1PFXC 2AH4X 3SU0A 1MU8B 3ZVFA 1DITH 1LHCH 1B5GH 1GBBA 4LOYH 3RDZA 4I7YH 3TK5A 2SGPE 1O34A 3E1XB 1W8BH 2R3YA 3MH5A 3D23A 1ZPBA 1LPZB 1Y3WA 2BY6X 2UUJB 1XVMA 3KQCA 3PTNA 3TH3H 3VB4A 2PTCE 1K1PA 5JYIA 1BTPA 3D62A 3CS7A 2V0BA 3TVJB 1RFNA 4K5ZA 1GBIA 3HKIB 1RD3B 1KTTB 3LGUA 1C1NA 1H9HE 3BTEE 4Q80A 1M9UA 4YT7H 1TGCA 2C90B 1IQHA 1MTWA 3QGNB 4TPIZ 1KXCA 2GZ7A 2GCHG 5JB9S 2Y82A 1CGHA 1C1MA 1OWDA 2QN5T 2VWNA 3M5LA 1AE5A 2GDEH 4ABGA 3B8JA 1SHHB 1BQYA 3MNXA 1MQ5A 4U2WA 1C1UH 2AGEX 5FPTA 5T6DA 1YPEH 5EW2H 1O3OA 4JZDH 5E2OA 5EOKA 1B0EA 2BY7X 1C2DA 1O3PB 2ILNA 1C5UA 1Y3YA 2GDDA 4DCDA 2HGTH 4XDEA 3T29A 1ZTJA 1N1LA 3ZZ7A 2A2XH 8GCHF 1HAXB 4Y7AA 1LPKB 1YPJH 5DP8A 3TGJE 3BG4C 1YPLH 1Z8RA 4AG2A 3RU4E 1IQMA 4ZH8A 3GCTF 1OX1A 1O3CA 1KTSB 2B5TB 1KLJH 1MMJN 2J94A 3UR9A 4AFQA 4DT7B 1AIXH 3H7OA 1ZGIA 1LCYA 5F8XA 1ETSH 1GBKA 1A0LA 1HRTH 2VH0A 1F0SA 2GX4A 1MUEB 4H42U 4ZKNU 2PSXA 3MNBA 1GMCF 2F9NA 2BX4A 2BB4A 1GI0A 1TPOA 1P09A 3M37A 4MG3A 2ALPA 4Y7BA 3FP8E 2A7JA 3FANA 5GDSH 5C1YA 2VGCB 1UVOA 1ZHMA 5F8ZA 1VITH 1O3GA 5K0HA 3PTBA 4B1TA 5GCHF 1ZSKA 3RXCA 4ZUHA 3GCHC 2ZU1A 2BDAA 2P3FH 2XBYA 2XRCA 1GI5A 3W94A 1NRSH 4WXIA 1IQIA 5TCAA 1O3LA 1AGJA 3OSYA 3MU4A 3SORA 1GHBF 2F3CE 4FUHA 3UOUA 1PPCE 2JETC 2A4GA 3MNSA 5HXFA 2TGAA 1BTZA 4CRGA 4DURA 2QC2A 3BN9A 4YESB 1MTVA 3EYDA 3ATKA 1RS0A 1Y59T 1TNKA 1AKSB 1G30B 2FP7B 1O2ZA 1QA7A 3M3SA 1C4U2 4R8TB 3U9AH 1GI2A 2VWMA 1J9CH 1P02A 4NZLA 3EA7A 2W5EA 2AS9A 4AB9A 3BTFE 1SGQE 4YTAA 1FY8E 1OOKB 4INHA 9ESTA 1O3MA 3ATLA 2QXGA 5JB8S 1WQSA 1O3EA 4K1SA 2YOLA 1HYLA 2BYAX 5GXPA 1GCTC 5BRRE 2BQ6B 1NROH 1HLTH 2GV6A 2WPJS 1TOMH 4B76A 1A0HB 1KXDA 1QL7A 1AHTH 3GY3A 4LK4A 1C1PA 3MU0A 2O8TA 4I31A 4FU8A 4Y11E 1YM0A 3V7TA 3A85A 1WBGB 2ZQ1A 1O2LA 2P94A 1IQEA 1D4PB 1OWJA 1L1NA 1NFYA 1DXWA 3U69H 5EPYA 4A1XA 3QLPH 1SFIA 1UK4A 4ABJA 1TMBH 4TWYA 4B75A 5JDUB 3P70B 1K22H 4ZROA 2AIQA 2A2QH 3L33A 1K1IA 3VFEA 1TRMA 2CN0H 3SO3A 3BG8A 1MH0A 2ZDMA 4CHAC 1O35A 1P2IA 2O8MA 4F4OC 3M35A 4D9RA 5JBTA 4OGYA 2Q6FA 2FLBH 3F9HA 5HM9A 4Z6AH 2QXJA 1SOZA 1ZPZA 1OP2A 3EE0B 4X8UH 4MTBA 1O2XA 5GPIB 2RCEA 3OX7U 4ISHH 1MBMA 1O2YA 4MVNA 2AEIH 3KGPA 2QF3A 3BF6H 2ZPQA 3NK8A 2C8ZB 3E91A 2CMYA 1IHSH 3G01A 4GUXA 2ZQ2A 2BLWA 3BV9B 4DIHH 4BTIB 1G32B 2PUXB 1P03A 3M3VA 3RXUA 1HJ9A 1GHWH 3KQDA 1BJVA 1G36A 4K8BA 6CHAB 1C1TA 5A0BA 1GHAF 2HNTF 1O3IA 1ZSJA 1EPTA 2F9UA 4ZKSU 3TU7H 1NFXA 1GVKB 5HMAA 1BA8B 2PWXA 1P9UA 5LH8A 3ATWA 4GAWA 1GJ5H 2C4FH 1NFWA 1PYTC 2P3TB 1HGTH 2QCYA 3MU1A 5DK1A 1TX6A 2K1QA 1HAPH 2UWPA 3DT0H 4O9VA 1SGTA 2OCVB 2ZDKA 1FNIA 1W0YH 2XBWA 4ZXXH 3T26A 5DP9A 4XE4A 2P59A 2NWNA 4TY6A 1ESAA 2HPPH 1P2MA 4X6MA 1O5CB 2ZTXA 4LZ1H 2Y7ZA 5ABWA 1QQ4A 1GJAB 2AMPA 1YF4A 2A5AA 2ZDLA 3SHCH 1GI9B 1GJ4H 3SU3A 3QK1A 1C2LA 2OC1A 5FCKA 1VITF 2BD9A 1TAWA 3RXHA 2V3OH 1Z1JA 2FM2A 1HAZB 4AGJA 3KQBA 4KGAA 3GOVB 1EOJA 3CENA 3I78A 2FYRA 3TJVA 2M5TA 5ETXA 3I77A 2J34A 2C93B 1LQDB 1A46H 3QDZB 1DDJA 4FUEA 1O3JA 5IYTA 2BDCA 3E8LA 1TX8A 4DVAU 1YPKH 3W95A 4TYDA 1SFQB 2BDGA 3ZZCA 5H4IB 1H9LB 2ODYB 1C5PA 4ABAA 2FPZA 3MFJA 4X8TH 5DGJA 3RXFA 2R0LA 4K1EA 1E36B 1NFUA 1QIXB 5L6NH 2Y81A 2AMDA 4DG4A 2CXVA 1NU9A 2GT7A 4IC6A 3HK3B 1KXEA 4SGBE 1FY5A 3S7KB 4BOHA 3RXDA 3K65B 3SI3H 2H2ZA 2FLRH 1V2MT 1T8LA 3RXTA 2W3KA 2GKVE 1F5RA 1SL3A 1JXPA 1Y5AT 2TBSA 3SJ8A 4AX9H 1FMGA 2STAE 2QXHA 1ZPCA 1T4VH 5A8YA 4Y8XA 2OBQA 3A7VA 1FXYA 2G8TA 4MNWA 1OPHB 2ZCKP 3SJIA 2FX4A 1PPGE 1FPHH 5HM2A 1P04A 2AFQB 3LIWA 4AORA 2ZO3H 4JYUH 4Y6DA 2XC5A 4AFZA 1O2UA 3E0PB 2ZA5A 3SUDA 2A7HA 1ACBE 1AFQC 2NU0E 2P8OC 4JK6A 2BY5X 4BANB 4ZXYH 3TPIZ 1OWIA 4YLUA 1O2TA 3QX5H 3DFLA 4DW2U 4X8VH 3M7TA 3SU4A 5DJ7A 2ZGHA 1PPFE 1RGQA 4FUBA 3BIVH 1XUKA 2DUCA 2UUFB 4XFQA 7GCHG 3RUOA 4X6PA 3UQVA 3SU5A 1YPHC 1ESBA 5DKMA 3TGIE 4K3JA 1TYNA 2J92A 2QXIA 3SJKA 1K1JA 2J9NA 1HAGE 1TE0A 4OGXA 1KY9A 2RDLA 2BLQA 1FIWA 1QL8A 3A7ZA 4YOGA 1S6HA 1AE8H 5LGOA 1Z6JH 2IPHA 5JBAS 4X8SH 4TWWA 1SGNE 4X1RU 1C1OA 1VGCC 2FESH 3MYWA 1QB1A 1MD7A 4YLQH 3NPSA 1EP6A 4XSKU 1O5GH 2FZZA 1SR5C 4NWKA 5AFZH 4DIIH 3GDUA 1DLKB 3LDXH 5E8EH 3RXGA 3VGCC 3AAVA 1A5GH 1V2RT 1XX9A 3TIUA 1QCPA 1ARCA 2O9QA 1RTLA 3A88A 3UNQA 3TH2H 1BOQA 1YCPH 1O39A 4JMYA 5FX5A 7LPRA 3U1IB 1K2I1 3TLOA 2D1JA 2VIWA 3SGAE 4UD9H 1AZZA 1EZXC 1ABIH 1SGDE 1PPZA 3LH3A 2GMTC 3FFGA 4ESTE 4JK5A 1HUTH 4Y76A 3ODFA 4UONA 1NM6A 2H9EH 3AW1A 3MO6A 4D8NA 1P3CA 4X1SU 4WJG2 3PB1E 3MOCA 2CHAC 2ZGCA 1AKSA 4ISLA 2ALVA 4MPVA 1V2JT 1YYY1 2QV1A 1T7CA 3U1JB 4WF8A 2PHBA 4XBDA 1ESTA 5TJXA 4CH2B 3F9GA 4HFPB 1O3HA 5LPFA 1BRUP 3BEUA 1PQAA 4K8YA 8GCHG 1GPZA 3LGVA 4NIXA 2CF9H 1E34B 4PROA 1CA0B 5I25A 3PM3A 2P3UB 1DVAH 3GCTG 3P8GA 1GL0E 1HXFH 3SQHE 3NCLA 2ZU4A 3SGQE 3RXQA 4UEHH 1SC8U 1CO7E 2ZGXH 3LC3A 1T8OA 2EI8A 2VINA 5C67A 1SQTA 1DFPA 1WAYB 1P2KA 2UUKB 1DM4B 1GMCG 1MCTA 3NXPA 3U8OH 1THSH 1TQ7B 2VIOA 5G4BA 4X1PU 3RMMH 1GBLA 3PO1B 3SV8A 4KP0A 4X2WA 3P17H 1EXFA 1EAUA 2BHGA 3MH4A 2CGAA 1S82A 1PJPA 2ZPRA 1C2HA 1SPJA 1JMOH 2GV7A 1DXPA 1EPTC 1GBCA 1SGCA 3EGKH 3RXOA 4WWYA 1DUAA 5GCHG 3URCA 5AFYH 1HNEE 4LZ4B 1IQJA 2I6QA 4NA7A 2BTCE 5F6MA 1WYKA 5DPAA 4A6LA 4FVBA 1GBMA 2AGGX 1NRQH 1KDQB 1P01A 1O36A 1TA2A 1WOFA 3LPRA 1DPOA 3UR6A 1GHBG 1P2QA 1GHYH 2GTBA 4JCNA 4U30A 2PKSB 2BOKA 3D49H 1LKAA 2F9PA 3BTWE 2ZGJA 1J17T 2PGQB 1CQQA 3K6YA 2FTMA 2O8LA 2ZIQH 3N7OA 5CHAC 1HV7A 1B7XB 1O31A 2PSYA 1GBHA 1GDNA 1DOJA 2H5CA 2PKAB 2BX3A 3KEEA 3LU9B 4OS1A 4QT8C 2JKHA 3HK6B 1TGBA 4D76A 1O5FH 1J15A 3A8BA 1EUFA 2FOFA 2ZNKH 1O2OA 1XVOA 2VWLA 2ZFFH 5FPSA 1GGDC 1C2GA 2BD2A 1UTQA 3OYPA 5BPEA 4GHQA 5A0AE 3RMOH 5FAHA 1MQ6A 5F03A 1YPGH 3SZNA 1MU6B 1V2QT 2Y6TA 3P6ZB 1H4WA 1YKTA 2VH6A 2ZCHP 3OU0A 1INCA 3LGIA 1C1VH 1SHYA 1C2JA 2QAAA 3STJA 1SLXB 1C5XB 2UWOA 1C2EA 2YNBA 3TNTA 1IHTH 3M36A 2QGRA 3BTQE 1XUFA 1IQKA 1XUIA 2B8OH 4X2YA 1AUJA 3H5CB 1L1JA 3Q3KA 1ZTLA 2FWWA 4ISNA 2HALA 2ASUB 1G2MA 1E0FD 4K69A 1WCZA 2JH5D 4FUFA 3M7UA 4CREA 3MU8A 4BNRA 3E0NB 2THFB 2A31A 2C8XB 1GG6B 1BMMH 1KYNA 1OP0A 1GCDA 3C1KA 2WUCA 1BUIA 1KLTA 1G9IE 2AYWA 2I6SA 2WPHS 1BBRE 3UNSA 3BEIB 2BD4A 3GYMA 1C5VA 3S0NA 2A4QA 3L3TA 2BVSH 3PWBA 3PROA 4H6TA 5EXNA 1HAIH 2PTNA 3RXPA 1VCWA 3A7WA 2VVVA 4WMFA 1XM1A 1X7AC 1SGFG 4ZKOU 4B71A 4K1TA 1PQ5A 1O2VA
chains in the Genus database with same CATH superfamily
2P95A 1EJMA 1TWXB 1HBTH 1ZHPA 3ATMA 3E6PH 2EA3A 4Y0ZE 3MU5A 4Y8YA 1NRPH 1SGEE 1ELDE 1GBDA 3EAJA 3FP6E 5JBCS 1UMAH 4JZEH 3ZYEA 1QZ8A 5E0HA 3RM2H 2FOAA 1O3AA 1TNHA 5C94A 3TJOA 3SNCA 2HRVA 4X6NA 4AGKA 1FY3A 1LVOA 2OXSA 2WYJA 4X0WU 2SGFE 4NZQA 5A2MH 3U8RH 4I8HA 2ZCLP 2JH0D 3FZZA 1QURH 2YNAA 2FMJA 3DA9B 3UPEA 1LHFH 1O2JA 1LTOA 1GHAG 5DG6A 3S7HB 1C5NH 1UVPA 1GJ8B 3BEFB 4RI0A 1EP5A 2QF4A 2QY0B 1NRRH 2QF0A 1AI8H 2BDIA 2VBCA 4BTTB 2A4OA 8LPRA 1AVWA 3ESTA 3A8CA 1EASA 1RXPA 1QL9A 2PFEA 1FY1A 1OSSA 3RC4A 1O5EH 4VGCB 2HVYB 4F49A 1ARBA 3UAIC 4HI3A 1GMHF 1ELFA 1AQ7A 5EXLA 4THNH 3LGYA 1THPB 5TCCA 1RTFB 5DP4A 1V2LT 3IG6B 1HXEH 2HVXA 2VVUA 3D65E 1ANBA 1P9SA 2HOBA 3QGJA 3TK9A 1C5YB 1H8IH 2R9PA 4ACBA 2GZ9A 2CJIA 3O8RA 1C2IA 4Y71A 1VKYA 4NIWA 4ISIH 3ATIA 5DP3A 3SN8A 1ANEA 1SQOA 2XWAA 1VITG 3MHWU 4YZUA 3LKWA 3ZZ4A 1GWAA 3GCNA 3KL6A 1Z8GA 1SVPA 2VIQA 1YLNA 1HCGA 2C8YB 1C1WH 2UUYA 3ZVAA 4AB8A 1MTUA 5J4SA 1HFDA 1MKWK 1N6XA 3F68H 4AFSA 1PPHE 1TX7A 1GL1A 1C2KA 1C5ZB 1O2NA 3IWMA 5DP5A 3RMLH 2BXTH 2LELA 2A7CA 3DHKH 2WZQA 2VJ1A 5A8XA 2XCFA 3A7XA 3F9FA 2KZ4A 3E16B 2XC4A 2PW8H 1GMDF 1BMFD 1QHRB 1O38A 3Q3YA 2FX6A 1AB9B 1ELGA 3BTKE 2SGEE 2XBVA 1A5IA 1B0FA 3RXLA 1TMTH 3GDVA 1BHXF 2B9LA 1C2MA 1F92A 3RXKA 1H8DH 4UFFH 3NZIA 1Z7KA 1K21H 2AIPA 1TRNA 4DJZB 3M5NA 1Y5UT 1TA6A 2Q1JA 3A86A 3SU1A 1EB2A 4ABDA 1T8MA 1F0TA 1UTOA 1P3EA 1A0JA 1A5HA 2NU1E 4TY7A 5FX6A 3RXMA 4M7GA 3MWIU 1GHVH 1HDTH 1O2GH 4R0IA 1T8NA 4E7RG 3GY8A 2V35A 2JJ2D 2AERH 2BDYA 2J5UA 1H8ED 1A3EH 2K0QA 5JBBS 4P02A 1QR3E 2VIPA 4ISOA 2HLCA 1AVXA 4H4FA 5FBIA 2C3SA 4NA9H 4X1NU 1QJ7B 5GWZA 3OTJE 4ZHLU 2OTVA 1FLEE 3S69A 3ZZ5A 1QB6A 3QN7A 1RIWB 1LDTT 1LHGH 5EU8A 1JIMA 2OLGA 4GPGA 3KN2A 1SGFA 3GDSA 5SGAE 2G4TA 3ZVGA 3MH6A 4X2XA 2ZFPH 3ZZDA 7KMEH 4FUGA 2RFKC 1AWFH 5DO4H 1BRAA 3WY8A 2JIZD 4ZKRU 1SMFE 1FN8A 1Z6EA 1MAYA 1V2ST 4OS7A 2WPIS 4XBCA 3KYFA 1AFEH 2Z9IA 4CRCA 1MKXK 4MNXA 2W7UA 2H1UA 1BIOA 1GHZA 1FUJA 1D3DB 4FVDA 3BTHE 6CHAC 1PQ8A 1YPHE 2TGTA 4YO9A 5FHTA 1QTFA 1CBWB 1JOUB 5HGGA 3PWCA 1TFXA 4ZMAH 1EZQA 3RLYH 1ZRKA 5IK2D 2ZTYA 4ASHA 1FI8A 3LGTA 4D9QA 3E90B 4TSFD 4D7FA 1ZR0A 5FL7D 5HIZA 4X2VA 3SNEA 4NWLA 1JWTA 1KDQA 2FYQA 2BDHA 1G3EA 4HTCH 1Z1IA 4Q63A 1Z8IB 1DANH 3ZVDA 1F7ZA 1WSSH 1WUNH 2Z9GA 1GBAA 1EAWA 1UJ1A 2F91A 4FUDA 2WPMS 1FAXA 1ZMLA 1IQFA 2OD3B 2H9HA 3FVFB 3OY6U 2G81E 3I29A 1H1BA 1YC0A 1GVZA 1WV7H 3HPTB 4NIYA 5FBEA 1LHDH 1MTNB 2BVRH 2D2DA 3MTYA 2PKAA 4ZAEA 4KTCA 2BD8A 1C4V2 5B6LA 3DUXH 1EKBB 3QTVH 1WQVH 4NG9H 3SNBA 4NA8A 1S83A 1Q3XA 1QRZA 1UCYE 4RKJB 1N6YA 1JBUH 2Z9LA 5EW1H 5JPMH 1CA8B 1DT2A 1GJ9B 4WH8A 4U32A 1KXFA 2DE9A 1TGTA 1BRBE 3GYLB 4GVUA 1O3NA 1ANDA 3H7TA 5KGOA 3UTUH 4A7IB 2D26C 1BTYA 2O8WA 2A4RA 4Q4LA 2KM0A 1EB1H 4WVPE 1Z71A 3JZ2B 3PV4A 5DP7A 1C1SA 3T2NA 3U98H 5C20A 2FIRH 2FDAA 2W6JD 3K2UA 1HAOH 2J95A 4GCHF 4X1QU 1S81A 2OINA 2LP6A 1RRKA 4GSOA 4NIVA 1W0KD 1QBVH 1SQAA 2BD3A 4J1YA 2G5VA 2ZHFH 1ZYOA 2Z3CA 1ZZZA 3F2GA 3QO6A 2ZDNA 2GCTB 1C2FA 3ZVBA 4B2AA 5J4QA 1TPAE 2GP9B 1ETRH 1GHXH 1DICA 4INKA 3A89A 2ZU3A 1CGJE 5KECA 1K9OE 3Q77A 4BAMB 2A0QB 3QZRA 1W7GH 1TBZH 4BAKB 3SBKA 3A8AA 1MCVA 1V6DA 1HJAB 1HAYB 2F9OA 1O33A 1BMNH 4WXVA 2OC7A 5L2YH 1W0JD 1D3QB 1F2SE 3OEED 4I8JA 1S5SA 4WY3A 4RT1A 4CR9A 3BTTE 2FTLE 4FOUC 2ZU5A 3GY4A 4ACAA 5F8TA 3KNXA 1SQRA 1HPGA 1S0QA 2CK3D 3SOSA 3SI4H 3VXFH 3PV2A 1GI3A 3O8DA 3T5FH 1JRTA 1L2EA 2ZDVH 3SHAH 1FONA 4DY7B 1HJ8A 1A61H 1IQGA 3F3BA 5FXLA 2FOHA 5FPYA 4ABIA 2A1DB 4NSVA 5PTPA 3EA9A 3A81A 1O2WA 2ESTE 1ZJKA 4ZHAA 3A7YA 3RXAA 3SV9A 2ODPA 1P06A 2W26A 3RXEA 1O3DA 1NPMA 2AMQA 2BZ6H 1ZJDA 3SW2B 1EJAA 2G52A 1RJXB 1HAVB 1P8VC 2FI5E 3PRDA 5C0TA 1C5WB 1GJCB 1OWHA 4MPUA 5ESTE 4NFEA 3U28C 2J2UA 1J14A 3ZZBA 2R3UA 2ZC9H 3S9AA 1SBWA 1OYQA 1CHOF 1TABE 3BSQA 4HGCA 2GGVB 1OWKA 2HWLB 1CSOE 1O3BA 1AMHA 2F83A 4JYTA 3UWJH 2GZ8A 1K1LA 4NCYA 2BLOA 1XUGA 4CRBA 4M9FA 1N8OC 1P05A 3OY5U 1EPTB 1Y5BT 2BD7A 1COWD 1T32A 2FI3E 1S0RA 2VVCA 3PLBA 1E35B 1BBRK 3HGPA 1XUJA 1FY4A 5IDKA 1HAHH 4HG6A 1LVYA 4YM9A 1W12U 4MQAA 3V3MA 3ZYDA 1C9TA 3CP7A 1UTPA 4SGAE 2JH6D 2YMSD 2WHXA 3TGKE 1SGYE 2ZF0H 2KAIB 2TGPZ 2XCNA 3MH7A 1L0ZA 1BHXB 1PPEE 1ZSLA 2H6MA 3LONA 3EQ0H 1ELEE 1NTPA 4JZ1A 4WMEA 5FCRA 3V0XA 1CT0E 1GJBB 1O2HA 1O2RA 1VCPA 1Z8JB 4GLYA 1FIZA 1G3CA 1FZZA 4UDWH 1CE5A 3QZQA 1O32A 3T27A 2GT8A 5AVDA 3AAUA 2ZHDA 2GVFA 4A1TA 3UQOA 1FN6A 1SI5H 1W11U 1NY22 3FKSD 4IW4E 4WMDA 1MZAA 3A82A 3SNDA 3ZV9A 3MQKC 2G5NA 4O03A 1QRWA 3VB3A 2PR3A 1ELCA 1KIGH 3HATH 1WTGH 1O2IA 3RU4D 1BZXE 1W3CA 4NFFA 5EG4A 3FAOA 1MKXH 3T28A 1GI4A 3IITA 3SNAA 4Y0YE 1CA0C 2V7QD 2ZECA 5CMXH 1S6FA 4BAOB 1GI8B 1JRSA 4Y8ZA 1MABB 1BMLA 2J38A 1E37B 3BG4B 4IMZA 4O3TA 1ZOMA 2RG3A 3PMAB 3A83A 4BXSA 1EQ9A 5GJ4B 2BXUH 2OUAA 2SGDE 1UTJA 1A2CH 2V6NA 1QBOA 1MBQA 1V2TT 4I8LA 1GMHG 3LGWA 5L2ZH 1L1GA 3T62A 1UK2A 2ANKH 5HYOA 3PO1C 1JIRA 3ZZ6A 1E38B 1AU8A 2BM2A 1V2UT 1D6RA 2C8WB 1ANCA 3ENSB 1J16A 5GIBA 2A32A 1W7XH 4B2CA 1A7SA 2VU8E 1YLCA 3FZDA 3Q76A 3RXIA 1MZDA 1IOEA 1VR1H 1VJAU 1ELBA 2HNTC 4O3UA 4Q7YA 3P92A 3DD2H 1TONA 2B0FA 3ZZ3A 1NO9H 1K1OA 3EDXB 2PGBB 1S85A 1YGCH 2GD4B 1V2VT 5EQSA 3S9CA 2F9VA 3GCHB 2PKSC 2CV3A 1O2MA 5AHGH 1MTSA 2JDID 1GBFA 1G3BA 2YMSB 2HPQH 1E79D 3SV6A 4K2YA 1DSTA 2JETB 3NUMA 3TJUA 3A80A 1OS8A 1C1RA 1C5MD 2IPQX 3BTGE 3LOXA 1S84A 1HIAB 1ETTH 4NSYA 3UB0A 4MLFB 3R3GB 2FOEA 4B74A 1GMDG 1LKBA 4E05H 3UUZA 1BTHH 3SQEE 3RC5A 1C9PA 1FV9A 3RP2A 4YOJA 1CU1A 3K9XB 2FS9A 3B9FH 3UOPA 2Z6BD 1NBMD 1UTMA 2GJGA 4RKOB 1Y3UA 2VWOA 1GDUA 1XXDA 2XBXA 1PYTD 2J98B 2O8UA 3VB5A 1SOTA 3ZZAA 5E2PA 5LPRA 2FO9A 4BAQB 2Y5FA 3NWUA 4UFEH 2BLVA 1GCTB 4X6OA 1TNGA 1EAIA 4JYVH 2ZGBH 3AW0A 1ABJH 2BD5A 2SGQE 2ZFQH 2RA0A 1LVMA 1EJNA 3MNCA 1P57B 4HZHA 1TQ0B 3DFJA 4YOIA 3SV7A 1F0UA 3M3TA 1UVSH 1ID5H 1Y3VA 3A8DA 1O2SA 1ZLRA 1UTLM 2FOCA 5DSFA 3RC6A 5L30H 1GG6C 2Z7FE 2BDBA 1L4ZA 4WH6A 2A45B 5T6GA 4ABFA 2XW9A 4A1VA 2NU3E 2EI6A 1QNJA 1UTNA 2ZKSA 5C1UA 2AHME 1CT2E 1TGNA 4ZHMU 2H9TH 4MPWA 3O8BA 4J2YB 3GY2A 1C5LH 1ELVA 1K1MA 4E7NA 1A1RA 3K6ZA 3UWIA 2VGCC 3OEHD 1FJSA 4CHAB 4CH8B 2B7DH 1DUEA 3M5MA 3ZV8A 3MO3A 5C1XA 4IMQA 2GCHF 1G37A 3V12A 5EIYA 4ASUD 3P8FA 1OWEA 1NZQH 3ITIA 3QWCH 1BDAA 5A09A 1D9IA 1DLEA 2WPLS 2KX4A 1NRNH 1YLDA 2WPDD 1C5QA 3E3TA 2KR7A 1E1QD 3LJOA 3RM0H 2NU2E 1GJ7B 2OBOA 2Z3DA 4IGDA 1BBRH 2SNWA 4YT6H 5C17A 2WPKS 4AOQA 2R2MB 3ZVEA 4BTUB 1TNJA 1KXAA 2PV9B 2A5KA 2QIQA 2PUQH 5C5OA 1BCUH 3RXRA 4ABHA 2SFAA 2ZZUH 1OKXA 1EATA 1LQEA 2LNCA 1RTKA 3R0FA 1H9IE 4FU9A 1Y8TA 2PLXA 4DGJA 2EEKA 1EZSC 1AVGH 1UHBB 1GDQA 3WWFA 2NU4E 3RU4T 3N7EA 1G2LA 3F6UH 4VGCC 2P93A 4ABEA 2F43B 1BJUA 1YCPK 2ANWA 1SSXA 1UK3A 1BTUA 4MNYA 1TB6H 1P2JA 1F5LA 2VB0A 4I32A 1C5OH 3RLWH 1P11E 1DS2E 3HGNA 1XUHA 1SLWB 2BMGB 1QRXA 2WV5A 4KELA 4FXGH 1O0DH 3RXBA 4F48B 2G55A 1UCYK 2ZHQH 3KQEA 3TK6A 1S6LA 3KYGA 4BAHB 1AD8H 1H8HD 1TNIA 1OXGA 1O2KA 3LH1A 3S9BA 1Q2WA 1TGSZ 4CR5A 4YXWD 4CRFA 2STBE 3Q3XA 4CBNA 5C2ZA 1HAVA 2TPIZ 3STIA 2W3IA 1TOCB 5C3NA 1W14U 1SLUB 3MMGA 1YP9A 2BVXH 4FU7A 1PQ7A 1TPPA 2TIOA 4MDSA 1NN6A 5GNDA 1DX5M 2Z3EA 3SUFA 1QB9A 1TLDA 1OP8A 3TJNA 1THRH 4Q7ZA 2VIDA 2OQUA 1HB0B 3SV2H 2WYGA 4GCHG 4OS2A 2XNIA 1VZQH 3ZVCA 1GI6A 5AF9H 1EZUC 3NKKA 3P8NA 2VNTA 1XKAC 1O3KA 3SUGA 1CT4E 1AB9C 1NC6A 1Y3XA 1KLIH 4XOJA 1C4Y2 1LPGB 3C27B 1ZTKA 2M2AA 3M7QA 3JZ1B 1P0SH 2QYIA 3QUMP 3PMHB 2ANYA 1T4UH 1XMNB 1V2NT 2VIVA 2ODQA 1QFKH 3LJJA 3P8OA 1BB0B 3UNRA 1QY6A 2EI7A 2BQ7B 1O3FA 2KAIA 1EAXA 2ZEBA 3RXVA 1GBTA 1U6QA 2G4UA 6ESTA 1EFRD 1L4DA 4Z1MD 4U01A 3OTPA 1O37A 1XXFA 1UO6A 1SGRE 3F9EA 1D3PB 2Z9JA 1TIOA 2H5DA 5C0UA 1BTXA 3U8TH 2A5IA 1FQ3A 1O5BB 1UW7A 4CRDA 5HKKD 1CVWH 1SLVB 2WUBA 3ODDA 3SUEA 3SJOA 1GJ6A 3SJ9A 5C5NA 4UFDH 1NS3A 2ZP0H 2ZDAH 2G00A 6GCHG 4KKDA 2ZFSA 1NESE 5K7RA 4Z0KA 3CS0A 1UTKA 5LPEA 3T25A 1P2NA 4A5TS 4CBOA 3OFND 3F0PA 1GBEA 3GS9A 3AK5A 3RXSA 3PYHA 2XC0A 1ZRBA 2IJOB 1MAXA 1DWBH 3PLPA 4Y10E 4I33A 2ZTZA 4UFGH 3M61U 1RIWC 4O97A 1TRYA 1YY3A 1VCQA 2XTTB 2AGIX 1DE7H 4FUIA 4A92A 3GICB 1AFQB 2OC0A 2P8OB 3F1SB 1WTHD 1CHOG 2ZU2A 1QJ1B 4BXWA 2BZAA 2P16A 1NU7B 4OS4A 3KQ5A 3KIDU 4D7GA 1DSUA 3KF2A 3VEQB 1CHGA 3F2FA 1AN1E 1W10U 3ZZ8A 1AZ8A 1KMHB 2W7SA 3A84A 1AUTC 1D3TB 2TGDA 3ZZ9A 2BQWB 1A3BH 1BMAA 3GY7A 1CGIE 1LVBA 4AN7A 3M5OA 4Q2KA 1DY8A 4Y79A 4Q7XA 3GISB 1F0RA 2ZHEH 3PMJA 4B6EA 4IN1A 1W2KH 1YBWA 3TNSA 1DY9A 4IBLH 1P2OA 1DWEH 2FODA 5EJLA 2BY8X 2V3HH 3GY5A 3BTDE 3PMBB 3EA8A 2Y80A 1QJ6B 1CBWC 1LHEH 1W0ZU 1LO6A 1GI1A 2ZFRH 4I8KA 4KTSA 1VGCB 1TBRH 3LC5A 3FN8A 3BIUH 4RN6A 4MNVA 4MPXA 1IAUA 3VGCB 5DN6D 3FP7E 4RSPA 1P12E 1YCPM 4CRAA 3URDA 1O2QA 2Q6GA 1K1NA 2WINI 1T31A 2Z9KA 3TH4H 3SGBE 3AASA 2KCYA 2XYAA 4TPYA 5EODA 3PV5A 2D8WA 1QGFA 1KXBA 4NGAH 1O30A 1TMUH 1P10A 2GMTB 1ORFA 2Y5HA 2OP9A 2Y7XA 1W13U 3GCOA 4IC5A 1HIAA 2UWLA 2ZHWH 4IS5A 1MTNC 4K60A 3UIRA 3VB7A 1AO5A 4UE7H 1FAKH 1IQLA 2R0KA 2ULLA 3SU6A 1C5TA 2CHAB 1GVLA 3KCGH 3QTOH 8ESTE 4AYVB 2W6ID 1ZHRA 1MD8A 4B73A 1UVUH 3F0OA 4FUCA 1QBNA 1QA0A 1IQNA 1C5SA 2DE8A 5EXMA 1BTWA 3ELAH 6LPRA 1MKWH 5EGMA 2J98A 1N8OB 2F9BH 8KME2 1V2OT 6GCHF 2IN2A 3GY6A 2ZPSA 9LPRA 5HIYA 7ESTE 1V2WT 2TRMA 1EOLA 2BY9X 1BRCE 2WV4A 3WWBA 1GBJA 2XWBI 4XBBA 3L6PA 1DWDH 2XNDD 2FOMB 4INLA 4AYYB 1TNLA 5A8ZA 2FEQH 3MI4A 3KHVA 3BTME 1C1QA 4B2BA 2BOHB 1SGIB 3SU2A 1TALA 1OYTH 4JZIA 3VPKA 1ELTA 3UREA 2GCTC 2SGAA 1UCYH 2FXRA 5T3HA 1J8AA 1C5RA 2RA3A 3A87A 5EPNA 3VXEH 2FOBA 1WDIA 1O5DH 3F2HA 1O2PA 4OS5A 2FS8A 1HJAC 5E0JA 4E06H 4ABBA 5EJZA 2OC8A 4I8GA 3Q00A 1V3XA 5I46H 1PPBH 3DCLA 1GI7B 5EQRA 1K28D 2ZG0H 3TITA 1XKBC 5B6OA 1G3DA 4H6SB 2QA9E 1GJDB 3H09A 1V2KT 1BT7A 2LPRA 4AG1A 1LMWB 1AWHB 1SG8B 2HNTE 1O5AB 5T6FA 2FI4E 1QQUA 1ELAA 1VJ9U 5DP6A 3PLKA 2Q6DA 4I86A 3AVZA 1ZMJA 1V2PT 3P95A 5CHAB 3SYJA 3VB6A 4KTUA 2IOTA 1ZGVA 3HKJB 5CE1A 1D6WA 3LT3A 2ZWLH 4DOQA 5A0CA 3V13A 1SGPE 1FPCH 1ZMNA 3UY9A 3A7TA 3RXJA 1Q31A 3RMNH 5CDFE 1A4WH 2R2WU 2Y5GA 2ANMH 3B23B 3W1EA 2ZFTA 2J4IA 1F5KU 1TBQH 1SB1H 5F53A 2CF8H 4LXBH 7GCHF 1UHBA 2Z94A 1WU1A 4FUJA 2XXLA 2ZI2H 1GGDB 1UVTH 4OS6A 4JZFH 3O8CA 5EQQA 1NT1A 1FDPA 2OQ5A 4AZ2B 2G51A 1EX3A 5ESBA 2FOGA 3MO9A 1AY6H 5E0GA 4IN2A 4AFUA 1DWCH 1TPSA 4GHTA 1YPMH 3UFAA 2EC9H 1BITA 1KSNA 2SNVA 1PFXC 2AH4X 3SU0A 1MU8B 3ZVFA 1DITH 2PP6A 1LHCH 4P00A 1B5GH 1GBBA 4LOYH 3RDZA 4I7YH 3TK5A 2SGPE 1O34A 3E1XB 1W8BH 2R3YA 3MH5A 3D23A 1ZPBA 1LPZB 1Y3WA 2BY6X 2UUJB 1XVMA 3KQCA 3PTNA 3TH3H 3VB4A 2PTCE 1K1PA 5JYIA 1BTPA 3D62A 3CS7A 2V0BA 3TVJB 1RFNA 4K5ZA 1GBIA 3HKIB 1RD3B 1KTTB 3LGUA 1C1NA 1H9HE 3BTEE 4Q80A 1M9UA 4YT7H 1TGCA 2C90B 1IQHA 1MTWA 3QGNB 4TPIZ 1KXCA 2GZ7A 2GCHG 5JB9S 2Y82A 1CGHA 1C1MA 1OWDA 2QN5T 2VWNA 3M5LA 1AE5A 2GDEH 4ABGA 3B8JA 1SHHB 1BQYA 3MNXA 1MQ5A 4U2WA 1C1UH 2AGEX 5FPTA 5T6DA 1YPEH 5EW2H 1O3OA 4JZDH 5E2OA 1FX0B 5EOKA 1B0EA 2BY7X 1C2DA 1O3PB 2ILNA 1C5UA 1Y3YA 2GDDA 4DCDA 2HGTH 4XDEA 3T29A 1ZTJA 1N1LA 3ZZ7A 3PRBA 2A2XH 8GCHF 1HAXB 4Y7AA 1LPKB 1K0HA 1YPJH 5DP8A 3TGJE 3BG4C 1YPLH 1Z8RA 4AG2A 3RU4E 1IQMA 4ZH8A 3GCTF 1OX1A 1O3CA 3VG8A 1KTSB 2B5TB 1KLJH 1MMJN 2J94A 3UR9A 4AFQA 4DT7B 1AIXH 3H7OA 1ZGIA 1LCYA 5F8XA 1ETSH 1GBKA 1A0LA 1HRTH 2VH0A 1F0SA 2GX4A 1MUEB 4H42U 1WXRA 4ZKNU 2PSXA 3MNBA 1GMCF 2F9NA 2F4LA 2BX4A 2BB4A 1GI0A 1TPOA 1P09A 3M37A 4MG3A 2ALPA 4Y7BA 3FP8E 2A7JA 3FANA 5GDSH 4B6FA 5C1YA 2VGCB 1UVOA 1ZHMA 5F8ZA 1VITH 1O3GA 5K0HA 3PTBA 4B1TA 5GCHF 1ZSKA 3RXCA 4ZUHA 3GCHC 2ZU1A 2BDAA 2P3FH 2XBYA 2XRCA 1GI5A 3W94A 1NRSH 4WXIA 1IQIA 5TCAA 1O3LA 1AGJA 3OSYA 3MU4A 2YMSC 4XD7D 1GHBF 3SORA 5EJ1A 2F3CE 4FUHA 3UOUA 1PPCE 2JETC 2A4GA 3MNSA 5HXFA 2TGAA 1BTZA 4CRGA 4DURA 2QC2A 3BN9A 4YESB 1MTVA 3EYDA 3ATKA 1RS0A 1Y59T 1TNKA 1AKSB 1G30B 2FP7B 1O2ZA 1QA7A 3M3SA 1C4U2 4R8TB 3U9AH 1GI2A 2VWMA 1J9CH 1P02A 4NZLA 3EA7A 2W5EA 2AS9A 4AB9A 3BTFE 1SGQE 4YTAA 1FY8E 1OOKB 4INHA 9ESTA 1O3MA 3ATLA 2QXGA 5JB8S 1WQSA 1O3EA 4K1SA 2YOLA 1HYLA 2BYAX 5GXPA 1GCTC 5BRRE 2BQ6B 1NROH 1HLTH 2GV6A 2WPJS 1TOMH 4B76A 1A0HB 4FETA 1KXDA 1QL7A 1AHTH 3GY3A 1NBME 4LK4A 1C1PA 3MU0A 2O8TA 4I31A 4FU8A 4Y11E 1YM0A 3V7TA 3A85A 1WBGB 2ZQ1A 1O2LA 2P94A 4ZCNA 2OK5A 1IQEA 1D4PB 1OWJA 1L1NA 1NFYA 1DXWA 2QF5A 3U69H 2XOKD 5EPYA 4A1XA 3QLPH 1SFIA 1UK4A 4ABJA 1TMBH 4TWYA 4B75A 5JDUB 3P70B 1K22H 4ZROA 2AIQA 2A2QH 3L33A 1K1IA 3VFEA 1TRMA 2CN0H 3SO3A 3BG8A 1MH0A 2ZDMA 4CHAC 3FO8D 1O35A 1P2IA 2O8MA 4F4OC 3M35A 4D9RA 5JBTA 4OGYA 2Q6FA 2FLBH 3F9HA 5HM9A 4Z6AH 2QXJA 1SOZA 1ZPZA 1OP2A 3EE0B 4X8UH 4MTBA 1O2XA 5GPIB 2RCEA 3OX7U 4ISHH 1MBMA 1O2YA 4MVNA 2AEIH 3KGPA 2QF3A 3BF6H 2QE7D 2J97A 2ZPQA 3NK8A 2C8ZB 3E91A 2CMYA 2HLDD 1IHSH 3G01A 3DSPA 4GUXA 2ZQ2A 2BLWA 3BV9B 4DIHH 4BTIB 1G32B 2PUXB 1P03A 3M3VA 3NRLA 3RXUA 1HJ9A 1E1RD 1GHWH 3KQDA 3FOAA 1BJVA 1G36A 4K8BA 6CHAB 1C1TA 5A0BA 1GHAF 2HNTF 1O3IA 1ZSJA 1EPTA 2F9UA 4ZKSU 3N99A 3TU7H 1OHHD 1NFXA 1GVKB 5HMAA 1BA8B 2PWXA 1P9UA 5LH8A 3ATWA 1YWUA 4GAWA 1GJ5H 2C4FH 1NFWA 1PYTC 2P3TB 1HGTH 2QCYA 3MU1A 5DK1A 1TX6A 2K1QA 1HAPH 2UWPA 3DT0H 4O9VA 1SGTA 2OCVB 2ZDKA 1FNIA 1W0YH 2XBWA 4ZXXH 3T26A 5DP9A 4XE4A 2P59A 2NWNA 4TY6A 1ESAA 2HPPH 1P2MA 4X6MA 1O5CB 2ZTXA 4LZ1H 2Y7ZA 5ABWA 1QQ4A 1GJAB 2AMPA 1YF4A 2A5AA 2ZDLA 3SHCH 4OM9A 1GI9B 1GJ4H 3SU3A 3QK1A 1C2LA 4DT4A 2OC1A 5FCKA 1VITF 2BD9A 1TAWA 3RXHA 2V3OH 1Z1JA 2FM2A 2KCOA 1HAZB 4AGJA 3EE7A 3KQBA 4KGAA 3GOVB 1EOJA 3CENA 3I78A 2FYRA 3TJVA 2M5TA 5ETXA 3I77A 2J34A 2C93B 1LQDB 1A46H 3QDZB 1DDJA 4FUEA 1O3JA 5IYTA 2BDCA 3E8LA 1TX8A 4DVAU 1YPKH 3W95A 4TYDA 1SFQB 2BDGA 3ZZCA 5H4IB 1H9LB 2ODYB 1C5PA 4ABAA 2FPZA 3MFJA 4X8TH 5DGJA 3RXFA 2R0LA 4K1EA 1E36B 1NFUA 1QIXB 5L6NH 2WV9A 2Y81A 2AMDA 4DG4A 2CXVA 1NU9A 2GT7A 1SKYE 4IC6A 3HK3B 1KXEA 4SGBE 2L74A 1FY5A 3S7KB 4BOHA 3RXDA 3K65B 3SI3H 2H2ZA 2FLRH 1V2MT 1T8LA 3RXTA 3ZIAD 2W3KA 2GKVE 1F5RA 1SL3A 1JXPA 1Y5AT 2TBSA 3SJ8A 4AX9H 1FMGA 2STAE 2QXHA 1ZPCA 1T4VH 5A8YA 4Y8XA 2OBQA 3A7VA 1FXYA 2G8TA 4MNWA 1OPHB 2ZCKP 3SJIA 2FX4A 1PPGE 5T1VA 1FPHH 5HM2A 1P04A 2AFQB 3LIWA 4AORA 2ZO3H 4JYUH 3DSGA 4Y6DA 2XC5A 4AFZA 1O2UA 3E0PB 2ZA5A 3SUDA 2A7HA 1ACBE 1AFQC 2NU0E 2P8OC 4JK6A 2BY5X 4BANB 4ZXYH 3TPIZ 1OWIA 4YLUA 1O2TA 3QX5H 5CHBA 3DFLA 4DW2U 4X8VH 3M7TA 3SU4A 5DJ7A 2ZGHA 1PPFE 1RGQA 4FUBA 3BIVH 1XUKA 2DUCA 2UUFB 4XFQA 7GCHG 3RUOA 4X6PA 3UQVA 3SU5A 1YPHC 1ESBA 5DKMA 3TGIE 4K3JA 1TYNA 2J92A 2QXIA 3SJKA 1K1JA 2J9NA 1HAGE 3WW7A 1TE0A 4OGXA 1KY9A 2RDLA 2BLQA 1FIWA 1QL8A 3A7ZA 4YOGA 1S6HA 1AE8H 5LGOA 1Z6JH 2IPHA 5JBAS 4X8SH 4TWWA 1SGNE 4X1RU 1C1OA 1VGCC 2FESH 3MYWA 1QB1A 1MD7A 4YLQH 3NPSA 1EP6A 4XSKU 1O5GH 2FZZA 1SR5C 2KFWA 4NWKA 5AFZH 4DIIH 2JJ1D 1DLKB 3GDUA 3LDXH 5E8EH 3RXGA 3AAVA 3VGCC 1A5GH 1V2RT 1XX9A 3TIUA 1QCPA 1ARCA 2O9QA 1RTLA 3A88A 3UNQA 3TH2H 1BOQA 1YCPH 1O39A 4JMYA 5FX5A 7LPRA 3U1IB 3OE7D 1K2I1 3TLOA 2D1JA 2VIWA 3SGAE 4UD9H 1AZZA 1EZXC 1ABIH 1SGDE 2L6OA 1PPZA 3LH3A 2GMTC 3FFGA 4ESTE 4JK5A 1HUTH 4Y76A 3ODFA 4UONA 1NM6A 2H9EH 3AW1A 3MO6A 4D8NA 2V3MA 1P3CA 4X1SU 4WJG2 3PB1E 3MOCA 2CHAC 2ZGCA 1AKSA 4ISLA 2ALVA 4MPVA 1V2JT 1YYY1 2QV1A 1T7CA 3U1JB 4WF8A 4TT3D 2PHBA 4XBDA 1ESTA 5TJXA 4CH2B 3F9GA 4HFPB 1O3HA 5LPFA 1BRUP 3BEUA 1PQAA 4K8YA 8GCHG 1GPZA 3LGVA 4NIXA 2CF9H 3N7DA 1E34B 4PROA 1CA0B 5I25A 3PM3A 2EQNA 2P3UB 1DVAH 3GCTG 3P8GA 1GL0E 1HXFH 3SQHE 2IJD1 3NCLA 2ZU4A 3SGQE 3RXQA 4UEHH 1SC8U 1CO7E 2ZGXH 3LC3A 1T8OA 2EI8A 2VINA 5C67A 1SQTA 1DFPA 1WAYB 1P2KA 2UUKB 1DM4B 1GMCG 1MCTA 3NXPA 3U8OH 1THSH 1TQ7B 2KCAA 2VIOA 5G4BA 4F55A 4X1PU 3RMMH 1GBLA 3PO1B 3SV8A 4KP0A 4X2WA 3P17H 1EXFA 1EAUA 2BHGA 3MH4A 4AC9A 2CGAA 1S82A 1PJPA 2ZPRA 2EY4C 1C2HA 1SPJA 1JMOH 2GV7A 1DXPA 1EPTC 1GBCA 1SGCA 3EGKH 3RXOA 4WWYA 1DUAA 5GCHG 3URCA 4XRNA 5AFYH 1HNEE 4LZ4B 1IQJA 2I6QA 4NA7A 2BTCE 5F6MA 1WYKA 5DPAA 4A6LA 4FVBA 1GBMA 2AGGX 1NRQH 1KDQB 1P01A 1O36A 1TA2A 1WOFA 2WSSD 3LPRA 1DPOA 3UR6A 1GHBG 1P2QA 1GHYH 2GTBA 4JCNA 4U30A 2PKSB 2BOKA 3D49H 1LKAA 2F9PA 3BTWE 2ZGJA 1J17T 2PGQB 1CQQA 3K6YA 2FTMA 2O8LA 5KEDA 2ZIQH 3N7OA 5CHAC 1HV7A 1B7XB 1O31A 2PSYA 3CNRA 1GBHA 1GDNA 1DOJA 2H5CA 2PKAB 2BX3A 3KEEA 3LU9B 4OS1A 4QT8C 2JKHA 3HK6B 1TGBA 4D76A 2K8IA 1O5FH 1J15A 3A8BA 1EUFA 2FOFA 2ZNKH 3OAAD 1O2OA 1XVOA 2VWLA 2ZFFH 5FPSA 1GGDC 1C2GA 2BD2A 1UTQA 3OYPA 5BPEA 4GHQA 5A0AE 3RMOH 5FAHA 1MQ6A 5F03A 1YPGH 3SZNA 1MU6B 1V2QT 2Y6TA 3P6ZB 1H4WA 1YKTA 2VH6A 2ZCHP 3OU0A 1INCA 4RT0A 3SZEA 3LGIA 1C1VH 1SHYA 1C2JA 2QAAA 3STJA 1SLXB 1C5XB 2UWOA 1C2EA 2YNBA 3TNTA 1IHTH 3M36A 2QGRA 3BTQE 1XUFA 1IQKA 1XUIA 2B8OH 4X2YA 1AUJA 3H5CB 1L1JA 3Q3KA 1ZTLA 2FWWA 4ISNA 2HALA 2ASUB 1G2MA 1E0FD 4K69A 1WCZA 2JH5D 2RDEA 4FUFA 3M7UA 4CREA 3MU8A 4BNRA 3E0NB 2THFB 2A31A 2C8XB 1GG6B 1BMMH 1KYNA 1OP0A 1GCDA 3C1KA 2WUCA 1BUIA 1KLTA 1G9IE 3DSOA 2KCPA 2AYWA 2I6SA 2WPHS 1BBRE 3UNSA 3BEIB 2BD4A 3GYMA 1C5VA 3S0NA 2A4QA 3L3TA 2BVSH 3PWBA 3PROA 4H6TA 5EXNA 1HAIH 2PTNA 3RXPA 1VCWA 3A7WA 2VVVA 4WMFA 1XM1A 1X7AC 1SGFG 4ZKOU 4B71A 4K1TA 1PQ5A 1O2VA
chains in the Genus database with same CATH topology
2P95A 1EJMA 1TWXB 1HBTH 1ZHPA 3ATMA 3E6PH 2EA3A 4Y0ZE 3MU5A 4Y8YA 1NRPH 1SGEE 1ELDE 1GBDA 3EAJA 3FP6E 5JBCS 1UMAH 4JZEH 3ZYEA 5E0HA 3RM2H 2FOAA 1O3AA 1TNHA 3TJOA 3SNCA 2HRVA 4X6NA 4AGKA 1FY3A 1LVOA 2OXSA 2WYJA 4X0WU 2SGFE 4NZQA 5A2MH 3U8RH 4I8HA 2ZCLP 2JH0D 3FZZA 1QURH 2YNAA 2FMJA 3DA9B 3UPEA 1LHFH 1O2JA 1LTOA 1GHAG 5DG6A 3S7HB 1C5NH 1UVPA 1GJ8B 3BEFB 1EP5A 2QY0B 1NRRH 2QF0A 1AI8H 2BDIA 4BTTB 2A4OA 8LPRA 1AVWA 3ESTA 3A8CA 1EASA 1RXPA 1QL9A 2PFEA 1FY1A 1OSSA 3RC4A 1O5EH 4VGCB 4F49A 1ARBA 4HI3A 1GMHF 1ELFA 1AQ7A 5EXLA 4THNH 3LGYA 1THPB 5TCCA 1RTFB 5DP4A 1V2LT 3IG6B 1HXEH 2HVXA 2VVUA 3D65E 1ANBA 1P9SA 2HOBA 3QGJA 3TK9A 1C5YB 1H8IH 2R9PA 2GZ9A 2CJIA 3O8RA 1C2IA 4Y71A 4NIWA 4ISIH 3ATIA 5DP3A 3SN8A 1ANEA 1SQOA 2XWAA 1VITG 3MHWU 4YZUA 3LKWA 3ZZ4A 1GWAA 3GCNA 3KL6A 1Z8GA 1SVPA 2VIQA 1HCGA 2C8YB 1C1WH 2UUYA 3ZVAA 4AB8A 1MTUA 5J4SA 1HFDA 1MKWK 1N6XA 3F68H 4AFSA 1PPHE 1TX7A 1GL1A 1C2KA 1C5ZB 1O2NA 3IWMA 5DP5A 3RMLH 2BXTH 2A7CA 3DHKH 5A8XA 2VJ1A 2XCFA 3A7XA 3F9FA 3E16B 2XC4A 2PW8H 1GMDF 1QHRB 1O38A 3Q3YA 2FX6A 1AB9B 1ELGA 3BTKE 2SGEE 2XBVA 1A5IA 1B0FA 3RXLA 1TMTH 3GDVA 1BHXF 2B9LA 1C2MA 1F92A 3RXKA 1H8DH 4UFFH 3NZIA 1Z7KA 1K21H 2AIPA 1TRNA 4DJZB 3M5NA 1Y5UT 1TA6A 2Q1JA 3A86A 3SU1A 1EB2A 4ABDA 1T8MA 1F0TA 1UTOA 1P3EA 1A0JA 1A5HA 2NU1E 4TY7A 5FX6A 3RXMA 4M7GA 3MWIU 1GHVH 1HDTH 1O2GH 4R0IA 1T8NA 4E7RG 3GY8A 2V35A 2AERH 2BDYA 1A3EH 5JBBS 1QR3E 2VIPA 4ISOA 2HLCA 1AVXA 4H4FA 5FBIA 2C3SA 4NA9H 4X1NU 1QJ7B 5GWZA 3OTJE 4ZHLU 2OTVA 1FLEE 3S69A 3ZZ5A 1QB6A 3QN7A 1RIWB 1LDTT 1LHGH 5EU8A 1JIMA 2OLGA 4GPGA 3KN2A 1SGFA 3GDSA 5SGAE 2G4TA 3ZVGA 3MH6A 4X2XA 2ZFPH 3ZZDA 7KMEH 4FUGA 1AWFH 5DO4H 1BRAA 3WY8A 4ZKRU 1SMFE 1FN8A 1Z6EA 1MAYA 1V2ST 4OS7A 2WPIS 4XBCA 1AFEH 2Z9IA 4CRCA 1MKXK 4MNXA 2W7UA 2H1UA 1BIOA 1GHZA 1FUJA 1D3DB 4FVDA 3BTHE 6CHAC 1PQ8A 1YPHE 2TGTA 4YO9A 5FHTA 1QTFA 1CBWB 1JOUB 5HGGA 3PWCA 1TFXA 4ZMAH 1EZQA 3RLYH 1ZRKA 2ZTYA 4ASHA 1FI8A 3LGTA 4D9QA 3E90B 4D7FA 1ZR0A 4X2VA 3SNEA 4NWLA 1JWTA 1KDQA 2FYQA 2BDHA 1G3EA 4HTCH 1Z1IA 1Z8IB 1DANH 3ZVDA 1F7ZA 1WSSH 1WUNH 2Z9GA 1GBAA 1EAWA 1UJ1A 2F91A 4FUDA 2WPMS 1FAXA 1ZMLA 1IQFA 2OD3B 2H9HA 3FVFB 3OY6U 2G81E 3I29A 1H1BA 1YC0A 1GVZA 1WV7H 3HPTB 4NIYA 5FBEA 1LHDH 1MTNB 2BVRH 2D2DA 3MTYA 2PKAA 4ZAEA 4KTCA 2BD8A 1C4V2 3DUXH 1EKBB 3QTVH 1WQVH 4NG9H 3SNBA 4NA8A 1S83A 1Q3XA 1QRZA 1UCYE 4RKJB 1N6YA 1JBUH 2Z9LA 5EW1H 5JPMH 1CA8B 1DT2A 1GJ9B 4WH8A 4U32A 1KXFA 2DE9A 1TGTA 1BRBE 3GYLB 4GVUA 1O3NA 1ANDA 3H7TA 3UTUH 4A7IB 2D26C 1BTYA 2O8WA 2A4RA 1EB1H 4WVPE 1Z71A 3JZ2B 3PV4A 5DP7A 1C1SA 3T2NA 3U98H 5C20A 2FIRH 2FDAA 3K2UA 1HAOH 2J95A 4GCHF 4X1QU 1S81A 2OINA 1RRKA 4GSOA 4NIVA 1QBVH 1SQAA 2BD3A 4J1YA 2G5VA 2ZHFH 1ZYOA 2Z3CA 1ZZZA 3QO6A 2ZDNA 2GCTB 1C2FA 3ZVBA 4B2AA 5J4QA 1TPAE 2GP9B 1ETRH 1GHXH 1DICA 4INKA 3A89A 2ZU3A 1CGJE 1K9OE 3Q77A 4BAMB 2A0QB 3QZRA 1W7GH 1TBZH 4BAKB 3SBKA 3A8AA 1MCVA 1V6DA 1HJAB 1HAYB 2F9OA 1O33A 1BMNH 4WXVA 2OC7A 5L2YH 1D3QB 1F2SE 4I8JA 1S5SA 4WY3A 4CR9A 3BTTE 2FTLE 2ZU5A 3GY4A 5F8TA 3KNXA 1HPGA 1S0QA 3SOSA 3SI4H 3VXFH 1GI3A 3O8DA 3T5FH 1JRTA 1L2EA 2ZDVH 3SHAH 1FONA 4DY7B 1HJ8A 1A61H 1IQGA 5FXLA 2FOHA 5FPYA 4ABIA 2A1DB 4NSVA 5PTPA 3EA9A 3A81A 1O2WA 2ESTE 1ZJKA 4ZHAA 3A7YA 3RXAA 3SV9A 2ODPA 1P06A 2W26A 3RXEA 1O3DA 1NPMA 2AMQA 2BZ6H 1ZJDA 3SW2B 1EJAA 2G52A 1RJXB 1HAVB 1P8VC 2FI5E 1C5WB 1GJCB 1OWHA 4MPUA 5ESTE 4NFEA 2J2UA 1J14A 3ZZBA 2R3UA 2ZC9H 3S9AA 1SBWA 1OYQA 1CHOF 1TABE 3BSQA 4HGCA 2GGVB 1OWKA 2HWLB 1CSOE 1O3BA 1AMHA 2F83A 4JYTA 3UWJH 2GZ8A 1K1LA 4NCYA 2BLOA 1XUGA 4CRBA 1N8OC 1P05A 3OY5U 1EPTB 1Y5BT 2BD7A 1T32A 2FI3E 1S0RA 2VVCA 3PLBA 1E35B 1BBRK 3HGPA 1XUJA 1FY4A 5IDKA 1HAHH 1LVYA 4YM9A 1W12U 4MQAA 3V3MA 3ZYDA 1C9TA 3CP7A 1UTPA 4SGAE 2JH6D 3TGKE 1SGYE 2ZF0H 2KAIB 2TGPZ 2XCNA 3MH7A 1L0ZA 1BHXB 1PPEE 1ZSLA 2H6MA 3LONA 3EQ0H 1ELEE 1NTPA 4JZ1A 4WMEA 5FCRA 3V0XA 1CT0E 1GJBB 1O2HA 1O2RA 1VCPA 1Z8JB 4GLYA 1FIZA 1G3CA 1FZZA 4UDWH 1CE5A 3QZQA 1O32A 3T27A 2GT8A 5AVDA 3AAUA 2ZHDA 2GVFA 4A1TA 3UQOA 1FN6A 1SI5H 1W11U 1NY22 4IW4E 4WMDA 1MZAA 3A82A 3SNDA 3ZV9A 2G5NA 4O03A 1QRWA 3VB3A 2PR3A 1ELCA 1KIGH 3HATH 1WTGH 1O2IA 3RU4D 1BZXE 1W3CA 4NFFA 5EG4A 3FAOA 1MKXH 3T28A 1GI4A 3IITA 3SNAA 4Y0YE 1CA0C 2ZECA 5CMXH 1S6FA 4BAOB 1GI8B 1JRSA 4Y8ZA 1BMLA 2J38A 1E37B 3BG4B 4IMZA 4O3TA 1ZOMA 2RG3A 3PMAB 3A83A 4BXSA 1EQ9A 5GJ4B 2BXUH 2OUAA 2SGDE 1UTJA 1A2CH 2V6NA 1QBOA 1MBQA 1V2TT 4I8LA 1GMHG 3LGWA 5L2ZH 1L1GA 3T62A 1UK2A 2ANKH 5HYOA 3PO1C 1JIRA 3ZZ6A 1E38B 1AU8A 2BM2A 1V2UT 1D6RA 2C8WB 1ANCA 3ENSB 1J16A 5GIBA 2A32A 1W7XH 4B2CA 1A7SA 2VU8E 1YLCA 3FZDA 3Q76A 3RXIA 1MZDA 1IOEA 1VR1H 1VJAU 1ELBA 2HNTC 4O3UA 4Q7YA 3P92A 3DD2H 1TONA 2B0FA 3ZZ3A 1NO9H 1K1OA 3EDXB 2PGBB 1S85A 1YGCH 2GD4B 1V2VT 5EQSA 3S9CA 2F9VA 3GCHB 2PKSC 2CV3A 1O2MA 5AHGH 1MTSA 1GBFA 1G3BA 2HPQH 3SV6A 4K2YA 1DSTA 2JETB 3NUMA 3TJUA 3A80A 1OS8A 1C1RA 1C5MD 3BTGE 3LOXA 1S84A 1HIAB 1ETTH 4NSYA 4MLFB 3R3GB 2FOEA 4B74A 1GMDG 1LKBA 4E05H 3UUZA 1BTHH 3SQEE 3RC5A 1C9PA 1FV9A 3RP2A 4YOJA 1CU1A 3K9XB 2FS9A 3B9FH 3UOPA 2Z6BD 1UTMA 4RKOB 1Y3UA 2VWOA 1GDUA 1XXDA 2XBXA 1PYTD 2O8UA 3VB5A 1SOTA 3ZZAA 5E2PA 5LPRA 2FO9A 4BAQB 2Y5FA 3NWUA 4UFEH 2BLVA 1GCTB 4X6OA 1TNGA 1EAIA 4JYVH 2ZGBH 3AW0A 1ABJH 2BD5A 2SGQE 2ZFQH 2RA0A 1LVMA 1EJNA 3MNCA 1P57B 4HZHA 1TQ0B 3DFJA 4YOIA 3SV7A 1F0UA 3M3TA 1UVSH 1ID5H 1Y3VA 3A8DA 1O2SA 1ZLRA 1UTLM 2FOCA 3RC6A 5L30H 1GG6C 2Z7FE 2BDBA 1L4ZA 4WH6A 2A45B 5T6GA 4ABFA 2XW9A 4A1VA 2NU3E 2EI6A 1QNJA 1UTNA 2ZKSA 5C1UA 1CT2E 1TGNA 4ZHMU 2H9TH 4MPWA 3O8BA 4J2YB 3GY2A 1C5LH 1ELVA 1K1MA 4E7NA 1A1RA 3K6ZA 3UWIA 2VGCC 1FJSA 4CHAB 4CH8B 2B7DH 1DUEA 3M5MA 3ZV8A 3MO3A 5C1XA 4IMQA 2GCHF 1G37A 3V12A 3P8FA 1OWEA 1NZQH 3ITIA 3QWCH 1BDAA 5A09A 1D9IA 1DLEA 2WPLS 1NRNH 1YLDA 1C5QA 3E3TA 3LJOA 3RM0H 2NU2E 1GJ7B 2OBOA 2Z3DA 4IGDA 1BBRH 2SNWA 4YT6H 2WPKS 4AOQA 2R2MB 3ZVEA 4BTUB 1TNJA 1KXAA 2PV9B 2A5KA 2QIQA 2PUQH 5C5OA 1BCUH 3RXRA 4ABHA 2SFAA 2ZZUH 1OKXA 1EATA 1LQEA 2LNCA 1RTKA 3R0FA 1H9IE 4FU9A 1Y8TA 2PLXA 4DGJA 2EEKA 1EZSC 1AVGH 1UHBB 1GDQA 2NU4E 3RU4T 1G2LA 3F6UH 4VGCC 2P93A 4ABEA 1BJUA 1YCPK 2ANWA 1SSXA 1UK3A 1BTUA 4MNYA 1TB6H 1P2JA 1F5LA 2VB0A 4I32A 1C5OH 3RLWH 1P11E 1DS2E 3HGNA 1XUHA 1SLWB 2BMGB 1QRXA 2WV5A 4KELA 4FXGH 1O0DH 3RXBA 2G55A 1UCYK 2ZHQH 3KQEA 3TK6A 4BAHB 1AD8H 1TNIA 1OXGA 1O2KA 3LH1A 3S9BA 1Q2WA 1TGSZ 4CR5A 4CRFA 2STBE 3Q3XA 4CBNA 5C2ZA 1HAVA 2TPIZ 3STIA 2W3IA 1TOCB 5C3NA 1W14U 1SLUB 3MMGA 1YP9A 2BVXH 4FU7A 1PQ7A 1TPPA 2TIOA 4MDSA 1NN6A 1DX5M 2Z3EA 3SUFA 1QB9A 1TLDA 1OP8A 3TJNA 1THRH 4Q7ZA 2VIDA 2OQUA 1HB0B 3SV2H 2WYGA 4GCHG 4OS2A 2XNIA 1VZQH 3ZVCA 1GI6A 5AF9H 1EZUC 3NKKA 3P8NA 2VNTA 1XKAC 1O3KA 3SUGA 1CT4E 1AB9C 1NC6A 1Y3XA 1KLIH 4XOJA 1C4Y2 1LPGB 3C27B 1ZTKA 3M7QA 3JZ1B 1P0SH 2QYIA 3QUMP 3PMHB 2ANYA 1T4UH 1XMNB 1V2NT 2VIVA 2ODQA 1QFKH 3LJJA 3P8OA 1BB0B 3UNRA 1QY6A 2EI7A 2BQ7B 1O3FA 2KAIA 1EAXA 2ZEBA 3RXVA 1GBTA 1U6QA 2G4UA 6ESTA 1L4DA 4U01A 1O37A 1XXFA 1UO6A 1SGRE 3F9EA 1D3PB 2Z9JA 1TIOA 2H5DA 1BTXA 3U8TH 2A5IA 1FQ3A 1O5BB 4CRDA 1CVWH 1SLVB 2WUBA 3ODDA 3SUEA 3SJOA 1GJ6A 3SJ9A 5C5NA 4UFDH 1NS3A 2ZP0H 2ZDAH 2G00A 6GCHG 4KKDA 2ZFSA 1NESE 5K7RA 4Z0KA 3CS0A 1UTKA 5LPEA 3T25A 1P2NA 4A5TS 4CBOA 1GBEA 3RXSA 3PYHA 2XC0A 1ZRBA 2IJOB 1MAXA 1DWBH 3PLPA 4Y10E 4I33A 2ZTZA 4UFGH 3M61U 1RIWC 4O97A 1TRYA 1VCQA 2XTTB 2AGIX 1DE7H 4FUIA 4A92A 3GICB 1AFQB 2OC0A 2P8OB 3F1SB 1WTHD 1CHOG 2ZU2A 1QJ1B 4BXWA 2BZAA 2P16A 1NU7B 4OS4A 3KIDU 4D7GA 1DSUA 3KF2A 3VEQB 1CHGA 1AN1E 1W10U 3ZZ8A 1AZ8A 2W7SA 3ZZ9A 3A84A 1AUTC 1D3TB 2TGDA 2BQWB 1A3BH 1BMAA 3GY7A 1CGIE 1LVBA 4AN7A 3M5OA 4Q2KA 1DY8A 4Y79A 4Q7XA 3GISB 1F0RA 2ZHEH 3PMJA 4IN1A 1W2KH 1YBWA 3TNSA 1DY9A 4IBLH 1P2OA 1DWEH 2FODA 2BY8X 2V3HH 3GY5A 3BTDE 3PMBB 3EA8A 2Y80A 1QJ6B 1CBWC 1LHEH 1W0ZU 1LO6A 1GI1A 2ZFRH 4I8KA 4KTSA 1VGCB 1TBRH 3LC5A 3BIUH 4RN6A 4MNVA 4MPXA 1IAUA 3VGCB 3FP7E 4RSPA 1P12E 1YCPM 4CRAA 3URDA 1O2QA 2Q6GA 1K1NA 2WINI 1T31A 2Z9KA 3TH4H 3SGBE 3AASA 2X