1ELBA

Analogous inhibitors of elastase do not always bind analogously
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title Analogous inhibitors of elastase do not always bind analogously.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1993-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elbA01
2P8OC 3QX5H 5E2OA 3SJIA 1A0HB 2EI7A 1CQQA 3RXMA 4B73A 2BVRH 4TPYA 1CGIE 3SQEE 2BVSH 1H9HE 2PKAA 5EXMA 1BTYA 1C5ZB 2BQ6B 5G4BA 1QBVH 3BEUA 1BBRK 2Z9GA 2FMJA 1GBCA 4X1RU 2ODYB 1ETSH 1SQTA 1AVWA 2SNVA 4H4FA 1QURH 2XBYA 3A88A 1S82A 4U2WA 1FQ3A 2BB4A 2HVXA 2NWNA 2W7SA 2VH6A 3ZVAA 3Q00A 3M3SA 1W12U 3RXIA 1W8BH 3HK3B 1GJ7B 1MCTA 1SLWB 3SNDA 3D23A 5GJ4B 2G81E 4R0IA 5FBEA 4GVUA 4UEHH 3ZZBA 3MO3A 1N8OB 4TY7A 4YT6H 3SHCH 1L0ZA 2VIVA 4B71A 4Y8ZA 1ANBA 2PSXA 1D6WA 1O3LA 2F83A 2D26C 4AYYB 5A8XA 1QJ7B 2H9HA 1JWTA 1G2LA 6LPRA 1EAXA 1FPHH 2Q6GA 5A09A 1UTLM 1O30A 1L1JA 1TPOA 1ELTA 2W26A 3V3MA 1LTOA 1MD7A 1O3MA 1C5RA 1UHBB 1A1RA 1OWIA 2A7HA 3LIWA 3S9BA 1QNJA 1WAYB 2EI6A 4B1TA 1C2IA 5BRRE 1MU8B 2VGCB 3L3TA 1TB6H 1BMAA 1HV7A 5EXNA 1P2OA 2G5NA 1IQHA 2ANYA 3F9EA 1ELGA 2CHAB 3GCHB 1TA2A 2P3TB 2Y82A 1VITG 4GPGA 4AFSA 1O2HA 3RXTA 1GI5A 3RXBA 1QJ6B 4GUXA 4CRCA 1D9IA 1P0SH 1XM1A 3R0FA 3O8CA 2K1QA 2FYQA 1ELEE 1H8IH 1A5IA 2FLRH 1EP5A 3QZRA 1INCA 2W3KA 1BTWA 1ETTH 5E8EH 4AX9H 1GI1A 3L33A 2A7JA 1GMCG 1T8OA 2WPHS 1J14A 5TCAA 1BITA 4OS6A 2C93B 1C1UH 2ODPA 5FX5A 2J95A 3MYWA 4DY7B 1AKSB 5CE1A 2Z3DA 2YNBA 5C5OA 3P17H 1V2RT 5L30H 1XXDA 2VWOA 1O33A 1ELBA 1GDQA 1V6DA 3DFLA 4I33A 3ZZ3A 4VGCC 2AS9A 1HAVB 2XC5A 5E0GA 1U6QA 1YLCA 2GZ8A 3RDZA 2SGAA 3GYMA 1Y5AT 1ZJDA 1GMHF 3TNSA 1HAZB 4A1XA 1JIMA 3GY8A 5JB9S 4CR5A 4B76A 3PTNA 7LPRA 3SU3A 2OTVA 4XSKU 3BTME 2Z94A 3ODDA 2C8XB 2Z3EA 1HXFH 3RXGA 1IQMA 4O9VA 4A5TS 2F9PA 2FYRA 1Y3YA 3Q3XA 1G2MA 5JYIA 1ZZZA 1F7ZA 2DE9A 2ZZUH 4Y0YE 2A45B 1W14U 1AB9C 1EPTC 3BG4C 1J8AA 1NFWA 1GJ8B 1SLXB 2AMQA 4OGYA 2BDYA 4MPXA 4O03A 5DK1A 4NA9H 1HJAB 3RXCA 4ABGA 1K1IA 3KNXA 2AGGX 1TNJA 1V2PT 1Z6JH 1W7XH 1MKWK 2ZFSA 1PPCE 3E16B 1O5CB 4IS5A 4WH8A 1DWEH 3MU5A 2ZCHP 4FUFA 4X2YA 4MLFB 1XUJA 1JMOH 2AH4X 1GBBA 2ZNKH 4SGAE 1K1OA 2JKHA 1ESTA 5H4IB 4ISHH 1YM0A 2JH5D 4CREA 3A7WA 4YOJA 3LT3A 3KQDA 3MTYA 3FZDA 4TPIZ 1O3BA 2H1UA 4INKA 4ZXYH 1AWHB 1TMUH 3VPKA 3EYDA 1PPGE 1AVXA 3QTOH 1B0EA 2VVVA 4HTCH 3GICB 1O5EH 3FFGA 3Q76A 4B74A 3RXHA 3RXAA 4GHQA 4I8GA 2A2QH 1YP9A 2BZAA 2ZHWH 5T6GA 2BLOA 3TGJE 1ELDE 1P09A 3GDSA 4WXVA 5JB8S 3VFEA 1HDTH 2O8UA 1P57B 5ABWA 2BD3A 1IQLA 1ZJKA 3CENA 4KTCA 3MOCA 5C2ZA 2WYGA 1ANDA 2IPHA 2J94A 2QF0A 3LDXH 4Q7ZA 2GD4B 1FONA 1LPKB 1WTHD 2BD9A 2IN2A 3SV7A 3E6PH 1K2I1 5A8ZA 3DT0H 5L6NH 1OOKB 5DKMA 3UNSA 5T3HA 4YT7H 2P59A 2CJIA 1WCZA 5A0CA 2Y7ZA 1ZGVA 2QXGA 3VEQB 4ABHA 3L6PA 1FZZA 1KXAA 3P8FA 1QL8A 7KMEH 1BZXE 4AYVB 2A4GA 1QCPA 4AG1A 1O2RA 1HAXB 4FVDA 5K7RA 1A3EH 1F2SE 2ZI2H 5DJ7A 1UJ1A 5C1YA 3GDVA 3UNRA 1P10A 1LKBA 8KME2 1HAPH 3KGPA 3M3VA 3MMGA 3PWBA 1YPJH 3SNAA 3ZVDA 3HGNA 1GMDF 1TE0A 1TPPA 5EW1H 3V12A 2BY9X 3ESTA 1J15A 2FIRH 3ITIA 4XDEA 4Y76A 1XUIA 2WV4A 2GCHG 1O34A 4IN2A 4NWLA 1BRBE 1UK3A 1F92A 3F1SB 4IMQA 4KTUA 2AMPA 4Q80A 1W2KH 1YPGH 6GCHG 1L2EA 2R0KA 2R3YA 1AGJA 1K9OE 3KF2A 3URCA 2BD2A 1SGPE 3RM0H 2G4TA 4ZROA 1QA7A 1Y3VA 4OGXA 1O2UA 2GMTB 2XBVA 3LC3A 1IQKA 1LHGH 1SGFG 1GHVH 4FUEA 1N1LA 2GZ7A 1OYQA 2HGTH 1HPGA 5FPYA 3E0PB 4K1EA 1GI3A 2VH0A 5HGGA 4DW2U 1BOQA 1IQEA 1B7XB 1ZRKA 3NK8A 1GJ9B 1BRAA 1P01A 2FTMA 4U32A 2TIOA 3MH4A 4YOGA 1AU8A 1HGTH 4X1QU 4X6OA 2VWNA 2V35A 4GSOA 1A4WH 2R9PA 3LONA 2ZU4A 4BAMB 1C4U2 3UWIA 2RCEA 4BTTB 1XKBC 3SUEA 2QAAA 1OS8A 4CRAA 3PLPA 1UVPA 3ATWA 1E0FD 3JZ2B 3MHWU 4AFUA 2OP9A 1Y5UT 2BXTH 1A61H 2G00A 1KLIH 2AYWA 1O5DH 3PO1B 3BTFE 1NRRH 4D7GA 1MKXH 1SPJA 2H5DA 3UFAA 2HALA 2CGAA 4ISOA 1V2JT 2SGFE 3DA9B 5EODA 4JZDH 3GCTF 1RTFB 2UUJB 3SU5A 1NC6A 1ZTLA 3STIA 1NPMA 3U9AH 4TWWA 1XUKA 2VIDA 1UTKA 4MDSA 1VR1H 3O8RA 1TMBH 4A6LA 3ATLA 4FVBA 1SGEE 1GDNA 1EOJA 2PGQB 4MTBA 1QB9A 1OWJA 4YZUA 1SMFE 1ORFA 1ZTJA 2ZHDA 3URDA 2FOFA 3TGKE 2HNTC 1GHWH 1C5MD 4ISNA 4AZ2B 1GHYH 2A32A 3TH3H 1XUHA 2BDBA 5FPSA 1HJ8A 1JIRA 4Y6DA 1A7SA 1YPHE 4MNXA 4AFQA 5F8XA 3AW0A 2Z3CA 1TA6A 3ZZ7A 1XUFA 2OC7A 5JBBS 1CT0E 1O2YA 5EQSA 3QGJA 1GJDB 4J1YA 5ETXA 1FXYA 2ZC9H 1QL9A 1KYNA 3W94A 1Z1JA 5PTPA 5EOKA 3V13A 1HCGA 1N6YA 1P06A 1BHXF 1GBDA 5AFYH 4K5ZA 1BTXA 2VGCC 3JZ1B 3CS0A 1O3AA 4YM9A 4ABFA 2GV7A 4ZAEA 3F68H 2FODA 2CHAC 3GCHC 4QT8C 4SGBE 5EGMA 4ZMAH 4XOJA 1SFIA 3PMAB 2BD4A 1KDQA 5C67A 4I8KA 1RD3B 3ZZ8A 2OBQA 1V2VT 3ZV8A 3UQVA 4NGAH 1W13U 2FOCA 3ENSB 4DIIH 1P12E 2ZFPH 1MKWH 2ZDNA 1QBOA 3KN2A 1ZHMA 2VIQA 3MU8A 3B23B 1TFXA 1AQ7A 3SGBE 2ZG0H 4NA7A 1FY4A 1H9LB 4BANB 2PGBB 4XBDA 1O37A 2FI5E 5LPEA 3BN9A 3TVJB 1YGCH 1LHFH 3QTVH 3VXFH 1OP2A 3ZVEA 3KQEA 2BY5X 3QGNB 4DVAU 1UCYK 1Y3WA 1C5VA 4X8TH 1A5GH 3BIUH 1O5GH 1F5KU 1IQJA 1L4DA 1GBMA 2WPMS 2QC2A 4E06H 1SGYE 3ZZ4A 1MAYA 1ZMLA 5TJXA 1C5WB 1O2IA 3SJ8A 1JXPA 1TX6A 1S84A 1TPAE 3HPTB 1IQFA 1AY6H 1GG6B 2PKSB 5AHGH 3SN8A 3GISB 1TQ0B 1HUTH 3F6UH 5E2PA 3UR9A 1XXFA 4NSVA 4Y71A 5E0JA 1QY6A 2ZHQH 2RG3A 2O8LA 1AZZA 1B5GH 4CRDA 2BY6X 1OWEA 3A8BA 4KELA 2ZFRH 3SU4A 3BTHE 3P92A 3UREA 3QDZB 2QYIA 2VIOA 5LPFA 3PLBA 1OYTH 1QRXA 2CMYA 3FZZA 3ELAH 1O35A 2BX4A 2SNWA 1GMHG 1ZLRA 1DE7H 2TPIZ 4H42U 1DICA 4ABBA 5GXPA 5ESTE 2OD3B 1DT2A 2Q6DA 1O2MA 7GCHG 3A7XA 2QY0B 3SZNA 4BAQB 3M5OA 2PUQH 3Q3YA 1HJAC 2O9QA 3CP7A 1DPOA 1H1BA 1GPZA 1GI4A 5HM2A 3RXSA 3OU0A 1BMLA 3SNBA 4UFEH 2ESTE 2EA3A 1NFUA 2F9VA 2ZWLH 4ZHLU 1LKAA 1CE5A 1DDJA 2UWLA 3KL6A 4IC5A 1C2EA 3PB1E 3EQ0H 1QTFA 1TNHA 2OC0A 5A8YA 1EJNA 2OBOA 1Z7KA 2AMDA 5FBIA 1QQUA 1BTUA 1G9IE 1O39A 2ZFTA 2DE8A 4JK5A 3O8DA 1CGHA 1ZPCA 2PFEA 6ESTA 1AE5A 4R8TB 1JOUB 1CO7E 1T4UH 2R2WU 4A7IB 1MTNB 5FHTA 9ESTA 4IMZA 4B2BA 1TONA 1KXBA 1THPB 3LH3A 2WINI 4WVPE 1S81A 2VIWA 2FS9A 1S0QA 1LPZB 2PUXB 1HLTH 5CHAB 1C1MA 2TGDA 1V2UT 1C2KA 1YKTA 1P11E 1CA0B 1NN6A 2BQ7B 4UD9H 2V3HH 3D62A 1Z8GA 1TGBA 1OWDA 4YLQH 1HB0B 4TY6A 1ZPBA 1NFXA 2XCFA 3LC5A 3ZZCA 4XE4A 1OXGA 1VZQH 5C5NA 1B0FA 1F0TA 1NRNH 4I8JA 3EDXB 1BBRE 2Z9LA 1RS0A 5EXLA 3M3TA 1N6XA 1CHGA 3SU2A 1AE8H 4MNYA 2Y5FA 1DWBH 1KSNA 1DXPA 2UUFB 1FLEE 1O3GA 1WV7H 2ZKSA 3I29A 4X8SH 2V3OH 4ABIA 3B9FH 2GP9B 1TOCB 3VB7A 2WPJS 1GHZA 2G8TA 4GCHF 1EP6A 1UTMA 1ZGIA 1TQ7B 3P6ZB 1O5BB 2SGQE 3Q3KA 2A4QA 5J4SA 1MH0A 1V2QT 3MNXA 1WBGB 1O2TA 1CGJE 1NT1A 1PQAA 2ZGXH 1CT4E 1YPKH 1C1VH 5LPRA 3M5NA 1FJSA 2BLVA 1SGIB 2GT7A 3ZZAA 2ZO3H 1AKSA 4WJG2 4NIYA 1PYTC 3FVFB 1O3DA 2TGPZ 3A80A 1DWCH 3PV4A 1SGDE 1C1TA 3ZVFA 5HM9A 3H5CB 2A31A 2P3FH 4MNVA 2BOHB 3RP2A 3GDUA 1GBLA 1HRTH 2ZTZA 1WQSA 3TITA 2VWLA 3LGIA 1BTPA 1FIWA 3BTDE 3SV2H 5EU8A 4AB9A 3ZYDA 3K6YA 1C4V2 1SLVB 3RXKA 1W10U 4D8NA 4XFQA 4U01A 2GMTC 1DWDH 5E0HA 2Y5HA 5FAHA 1GJAB 3SGAE 1ELFA 1K1JA 2A4OA 4NIVA 3EA7A 5ESBA 2RA0A 3RUOA 2C3SA 1ZOMA 1T32A 6CHAB 4X2WA 1E35B 1FMGA 2IOTA 3VGCB 1HIAA 2ZGJA 3TK6A 4GHTA 1Y5BT 2QV1A 1HAGE 2GZ9A 1AVGH 5AVDA 6GCHF 1KIGH 1SLUB 1F0RA 1V2MT 2Y80A 2BQWB 2C8ZB 2XW9A 4FU9A 1GVLA 3FAOA 1P04A 3BTTE 1C5XB 3OY6U 1LHCH 1NY22 2FOEA 2FS8A 2ODQA 3E0NB 4NCYA 2BY7X 4KP0A 1GI0A 5EQQA 2ZEBA 5DGJA 3TPIZ 5JBTA 3VB4A 4Y0ZE 2ZTXA 1AI8H 3M7TA 1TBQH 1CA8B 1O2GH 1TRMA 3PO1C 1O3JA 1SFQB 1EATA 3C27B 5FXLA 1AMHA 3MH6A 4J2YB 2KAIA 3IITA 1RFNA 2FESH 1T31A 3GYLB 3E8LA 1MU6B 5CMXH 1BA8B 1QRWA 3ZV9A 1NTPA 1C1OA 2GKVE 2M5TA 1XKAC 2BDAA 3AVZA 2F9BH 1GL0E 3SO3A 5DO4H 2P16A 1C9TA 3LGTA 4DG4A 4NIXA 1KXCA 2GGVB 4X0WU 1SB1H 1QB1A 1K21H 1C5TA 3ZZ5A 1UCYH 1UK4A 3P8NA 1GDUA 3SV6A 3U8RH 2PW8H 3NZIA 3OY5U 1MTSA 3NPSA 2B7DH 1TNLA 1NRPH 3SJOA 1HAIH 4MNWA 3SJKA 4HGCA 2ZF0H 1GJ6A 1O3OA 3GCTG 1TNGA 4WXIA 4BTUB 1NZQH 1DSTA 2H9EH 1Z6EA 1RXPA 1YLDA 3BTGE 3BTEE 4WF8A 4ZHAA 4JK6A 2F9OA 3VXEH 1FN6A 2Z9JA 1CVWH 1HAYB 2H9TH 3ATMA 3MU0A 2C90B 1DX5M 1DOJA 2B9LA 1FI8A 2BD8A 4YOIA 1MBMA 4AGKA 4D9QA 1O2WA 4O97A 1GHBF 4IGDA 1IAUA 2ZDAH 1SBWA 1SHHB 2ZDVH 2XRCA 2ZU1A 1A46H 3K65B 4Y79A 5IYTA 2ULLA 1F5LA 3UR6A 3RXRA 1ZMJA 3NCLA 4A1TA 2SGDE 1NROH 1GWAA 4BTIB 1KTTB 2RA3A 1S5SA 3M35A 5DP8A 1C5LH 1CBWB 2GVFA 1C2FA 1O3KA 1GI7B 2CXVA 2OQ5A 2A5IA 1Z8IB 1RTKA 2GTBA 3QO6A 2AERH 4YO9A 1ELCA 2W3IA 5JPMH 2FP7B 2THFB 1P2MA 3F9GA 1MTVA 1BBRH 1DLKB 3V7TA 1EZSC 1UVUH 2VB0A 3LJJA 4CRGA 3UY9A 2SGEE 3TLOA 1TYNA 2HRVA 3DHKH 3SI3H 2AEIH 2XTTB 4O3UA 3GY5A 5T6FA 1K22H 1UTJA 3VB3A 8GCHG 3M61U 3MNCA 2HWLB 1GHAF 1TX8A 1IQNA 3A7YA 4JYTA 4DCDA 2PWXA 2A5AA 1RIWB 1O5AB 1PQ8A 2QCYA 4Z6AH 1GG6C 2PKSC 2QXJA 1V2TT 4CR9A 1LQEA 3PLKA 1UMAH 3GY2A 3P8GA 1O3NA 1XMNB 3RU4D 2XXLA 4FU7A 2JETB 2HPQH 2BDCA 3U8OH 4CHAB 5DPAA 1TBZH 3RXUA 1EQ9A 3EGKH 1O31A 2ASUB 2ALVA 1XX9A 5TCCA 3P8OA 1EPTA 2QGRA 1O2PA 5F8ZA 4ASHA 2UUKB 1NM6A 1LMWB 5C20A 4YTAA 1GJCB 1ZTKA 1O2SA 2FZZA 1EAIA 2FXRA 2ZDLA 2JH6D 2BXUH 4ZKNU 3SU1A 1JBUH 3GCNA 3SV8A 4JZFH 1SC8U 4FUCA 2F9UA 1C5PA 1O2KA 1O38A 1E34B 1O2XA 2Y81A 2BOKA 1V2KT 1HAHH 1ZPZA 2Z6BD 1EZXC 5EPNA 3TJOA 3K9XB 4B75A 3K2UA 5GPIB 1IOEA 4NFEA 1CHOG 1LHDH 2ZDMA 1CU1A 1P2JA 2F91A 2C8WB 1X7AC 1WSSH 4YESB 1F5RA 3FP8E 1EUFA 4RKOB 3S7KB 2BY8X 4K1SA 4YLUA 1V2OT 5LGOA 1C2LA 1A0JA 1AO5A 3EE0B 4KGAA 4MPVA 1TIOA 4LZ1H 2HNTE 2PHBA 4LOYH 2BZ6H 1DVAH 1K1NA 2OINA 1AD8H 4INHA 1UO6A 2Y6TA 3TK5A 1WQVH 1O3HA 1MTNC 3PROA 4CBOA 1BIOA 3T62A 2CF9H 4FUDA 1O0DH 2WUCA 1P3CA 1NRSH 2NU0E 3RMMH 1C2DA 3TH2H 1F0UA 1L1GA 1AFEH 1S6FA 1D3TB 1FY3A 3A83A 5CHAC 5LH8A 1Z8JB 3E91A 4THNH 3RXJA 9LPRA 3PM3A 1TRNA 4RN6A 4X6NA 1CA0C 1LVBA 2ILNA 1T8LA 2P94A 1E38B 4X6PA 1C5UA 5J4QA 2PR3A 4UFFH 1BRCE 3S9AA 2A5KA 1P3EA 1G36A 3EAJA 1LDTT 3S7HB 3SHAH 1G3BA 2BHGA 1V2ST 1AIXH 2UWOA 1O3IA 2J92A 1BDAA 4OS5A 4U30A 1VITH 2GDEH 2CF8H 3VB5A 4M7GA 2ZA5A 4JYVH 3U98H 3TU7H 1S6HA 1UK2A 3BSQA 1L1NA 2ANKH 1C2JA 3TK9A 3ZZ9A 4AGJA 4UONA 1AZ8A 2FOHA 3SUGA 1UVOA 2OLGA 1K28D 4DIHH 3WY8A 1S0RA 3LGYA 1UTOA 1KLJH 4Q7XA 1HNEE 1TLDA 1KDQB 4IN1A 4I32A 1ZHRA 2BVXH 3B8JA 1ZMNA 1O3EA 4FU8A 3ATIA 3UQOA 3TJVA 1DUEA 3RU4E 3SJ9A 1P2QA 1G3DA 3QN7A 4WMDA 4AG2A 2WV5A 1IQGA 2FDAA 1LVYA 1PFXC 2XYAA 3UTUH 1BJVA 1MTWA 1G32B 1A3BH 2EC9H 1VGCB 3LJOA 2ZQ2A 2BLWA 2LPRA 1WOFA 4ABDA 4E05H 1LVMA 5BPEA 1PPHE 1OKXA 1THSH 3KEEA 1GBEA 1K1PA 5K0HA 4DJZB 3SOSA 1E37B 3VB6A 6CHAC 4I8HA 2UWPA 2CV3A 5L2ZH 5A0AE 1PQ5A 3VGCC 1P05A 4NA8A 2CN0H 1Y8TA 2QXIA 1C2MA 2ZPRA 4B2AA 4O3TA 4ABEA 3N7OA 3IWMA 2TGAA 4OS1A 1MZAA 1YBWA 4K3JA 3A8DA 1MAXA 3EA8A 4F4OC 1TGNA 3HKIB 1C5QA 1FN8A 2Y7XA 3SW2B 1QBNA 4NG9H 1GCTB 2BX3A 3A81A 3PMBB 2NU4E 1VJAU 1FAKH 1UCYE 1O32A 4CBNA 1ID5H 3UPEA 4Y7BA 4ISLA 2H6MA 1GI9B 1UVSH 1SL3A 3R3GB 2ZQ1A 1ESBA 3LGUA 5T6DA 2P3UB 4F49A 1G3CA 1V3XA 4ZH8A 5F03A 2PKAB 5EG4A 2RDLA 1EASA 1RJXB 3TGIE 3UOUA 1AFQB 1C5YB 2FM2A 2FOAA 2B8OH 1XUGA 3MO6A 1EKBB 1G30B 2FOBA 3BIVH 5C1UA 1PPEE 1BRUP 2ZU5A 4LK4A 1O5FH 1PJPA 3A86A 1C1WH 3I78A 3GY4A 4I8LA 2BDGA 7ESTE 1HAOH 1JRSA 1ANCA 3D49H 1LHEH 4BOHA 1OWHA 4CRFA 1ZR0A 3TIUA 3TJNA 5C1XA 5FCKA 1QA0A 5I25A 2PV9B 1W3CA 2PTCE 1DLEA 4HFPB 3UIRA 1CSOE 1FAXA 3P70B 2R2MB 5GCHF 5I46H 1SGTA 3LU9B 5L2YH 2A1DB 1K1LA 8ESTE 1NS3A 1Q31A 1TGTA 1YPMH 3MO9A 1AWFH 1RRKA 1AUJA 3LGWA 3W95A 5GDSH 3T28A 2WPKS 2FOMB 3RU4T 3U69H 1T7CA 2G51A 3AW1A 1UHBA 1OX1A 4JZ1A 1ACBE 1DS2E 4FUIA 4HZHA 1OP8A 1C2HA 1OWKA 2FX6A 4RSPA 1MMJN 1NFYA 4AFZA 1BHXB 1RTLA 1HXEH 1EJAA 4ESTE 3EA9A 1OSSA 1EB1H 1LCYA 2EI8A 1GBAA 1WUNH 5DP7A 4RKJB 1ZSKA 1MQ6A 3M36A 1GJ5H 1C1QA 3RLWH 5JBCS 3RXDA 1CBWC 3SBKA 1TMTH 1GGDB 3RXPA 1GBJA 1GHBG 1NESE 2GCTB 1BJUA 1W11U 3A84A 1GCDA 3RXLA 4X2VA 3RMOH 1O3PB 3GOVB 3T5FH 1ESAA 1J16A 1GHXH 4K2YA 1SGFA 1BTHH 3LGVA 1GJBB 1TAWA 1FUJA 1D3PB 1MKXK 2ZDKA 2FX4A 3ATKA 1ABJH 2WPLS 2JH0D 8LPRA 3ZZ6A 1BTZA 1C5SA 5F6MA 2AIPA 1WYKA 1NO9H 2A7CA 1HAVA 1QQ4A 1THRH 1P9UA 3V0XA 4MPUA 2J2UA 1GMDG 2O8MA 1BMNH 1IHSH 2ZHFH 3RXVA 5C3NA 2ZECA 2XC4A 1ZRBA 1Z71A 5HMAA 1W0YH 1RIWC 1H9IE 1TGSZ 1SI5H 1EJMA 1GBFA 1MQ5A 1P9SA 3MFJA 3NKKA 3S0NA 2FO9A 4X8UH 1A2CH 2YNAA 1MBQA 1L4ZA 4BAHB 5A2MH 4MVNA 3FP7E 4BXSA 1GHAG 2JETC 1EXFA 2ZTYA 2I6QA 4CHAC 2ZIQH 1C5OH 3BF6H 3GCOA 2QIQA 3SNCA 7GCHF 1GBKA 1GBTA 2HLCA 4GLYA 2Z7FE 3I77A 1GVZA 1GI8B 4Y7AA 3AASA 2XC0A 1S85A 1HIAB 1SOTA 2VIPA 2W7UA 3DFJA 1AN1E 3BEIB 1GI6A 1KTSB 4MQAA 2GV6A 3MWIU 1NRQH 2TGTA 3ZVGA 3MNSA 4WH6A 1OP0A 4INLA 3RC5A 1ABIH 3M7QA 1C1RA 2XBWA 1YPEH 3T2NA 3RM2H 2P8OB 2J4IA 1TNKA 4UE7H 1SHYA 1SQOA 3E90B 4Y11E 3DUXH 3T29A 3M37A 3MU4A 3H7OA 3SQHE 4JZIA 2FEQH 5DP5A 1C1PA 2Y5GA 3OX7U 3RC6A 1DY8A 4BNRA 3PTBA 1YCPM 3KHVA 2OQUA 3LOXA 3HATH 2O8WA 2BYAX 1GJ4H 5AFZH 3KIDU 4DGJA 3CS7A 1EAUA 1SGCA 4FUJA 1KY9A 4JZEH 2J38A 4D9RA 1O2OA 2KAIB 2Q6FA 3SGQE 3ODFA 1MZDA 1P2IA 3MNBA 2FLBH 1YYY1 2ANMH 1LQDB 4H6TA 5FPTA 1Y3UA 4KKDA 5DP4A 3UOPA 2H2ZA 4D76A 3G01A 3RMNH 3SUDA 3A89A 1ARCA 4AORA 2B0FA 2ANWA 1YPLH 1TRYA 3M5LA 2ZHEH 1C1NA 2D8WA 3F9HA 3S9CA 1AUTC 5B6OA 2UUYA 4OS7A 1FY1A 5GWZA 1DUAA 1D3DB 2BTCE 4WWYA 1Z1IA 4JCNA 4KTSA 4I31A 1IQIA 4AN7A 2OC8A 1Y59T 1VITF 1VCWA 3RLYH 2ZU3A 2G55A 4X2XA 1SG8B 2AIQA 2D1JA 2G4UA 3P95A 1ZYOA 1XVMA 4DURA 1YCPK 4ABAA 2F9NA 3D65E 1QHRB 2ZGCA 3UUZA 4K1TA 2HOBA 1UTNA 1P2KA 2D2DA 2NU2E 1FV9A 1SOZA 2O8TA 2VVUA 1QL7A 1BCUH 2WPIS 1GMCF 1GVKB 3OTJE 3QUMP 4CH2B 4NSYA 3T25A 2DUCA 4IW4E 1LO6A 2QN5T 2VJ1A 3GY3A 1SQAA 4WY3A 4Y8XA 1TX7A 4X1NU 4WMFA 3A7VA 1SVPA 1TWXB 3RXOA 4K60A 5DP3A 5DG6A 1HYLA 2P93A 1JRTA 1UTQA 4A1VA 3BEFB 1DSUA 2ZPQA 3STJA 4OS2A 2XWBI 4BAOB 3SU0A 4FUBA 1C5NH 3A85A 4X1PU 2ZCLP 1DFPA 1O2LA 4UDWH 1DITH 2B5TB 2AGEX 1C1SA 4Z0KA 1O2VA 3ZYEA 3A82A 5JBAS 5DP6A 4FXGH 5AF9H 3M5MA 4GAWA 3MH7A 4NFFA 1V2LT 2TBSA 1ELVA 3SU6A 4VGCB 1EZUC 2VVCA 1DM4B 2VINA 2ZPSA 3BTWE 2QXHA 1VGCC 3FP6E 1IHTH 1M9UA 1DANH 4DOQA 3RC4A 5A0BA 3S69A 1W7GH 2Z9IA 1J9CH 1NU9A 1BT7A 2QF3A 1P8VC 2PSYA 2C8YB 1KXFA 3SV9A 1VJ9U 2GX4A 2ALPA 5FX6A 1NU7B 3TH4H 5EPYA 1VCQA 4E7RG 1Q2WA 2FTLE 5IDKA 4DT7B 2PLXA 3QWCH 3RXQA 2BD7A 5EW2H 1GL1A 3DD2H 5HXFA 1HJ9A 3SUFA 3IG6B 3A8CA 4MPWA 2FPZA 4E7NA 1TALA 1P03A 1AB9B 1EPTB 3BG4B 1XVOA 2BMGB 2HPPH 1D4PB 4JYUH 1CT2E 2W5EA 2R0LA 3Q77A 3BG8A 2WYJA 1RGQA 1GCTC 4FUHA 1T8MA 3KCGH 4XBBA 1Z8RA 3ZVBA 4WMEA 1EOLA 3NXPA 3SNEA 2VNTA 1ARBA 2G5VA 1HFDA 2ZFQH 2V6NA 4Q7YA 3QLPH 1O2QA 1QGFA 4NZQA 1YF4A 2FWWA 5JDUB 1T8NA 3C1KA 1ANEA 4Y8YA 2AFQB 2YOLA 3GY7A 4TYDA 1AFQC 1O3FA 1O2JA 3UNQA 4D7FA 2OC1A 1QB6A 4UFGH 1FPCH 1UVTH 4IBLH 2EEKA 5F8TA 1Y3XA 4LXBH 2STBE 1QR3E 2VWMA 1ZSJA 2J34A 2V0BA 3LPRA 3A87A 3E3TA 1SGNE 2STAE 1GBHA 1D3QB 3K6ZA 4NWKA 5DP9A 2OCVB 4Q2KA 3KQBA 1PQ7A 3MU1A 1H8DH 1V2NT 2Q1JA 2XNIA 2A2XH 4ZHMU 2HNTF 2NU1E 1C4Y2 4Y10E 1KXEA 2BDHA 4NZLA 4JMYA 2XWAA 3F9FA 1BQYA 1TABE 3NUMA 2NU3E 1EX3A 2A4RA 1W0ZU 2QA9E 1FDPA 2GT8A 4ZUHA 3PYHA 2H5CA 3OSYA 3HKJB 1Q3XA 1N8OC 2A0QB 2BLQA 3A8AA 1O2NA 4MG3A 5HYOA 1O36A 1TNIA 1VCPA 3ZVCA 2WUBA 5GCHG 3MI4A 3RXFA 3T26A 3BV9B 1AHTH 3M7UA 4PROA 4ABJA 2ZU2A 1GI2A 2TRMA 3TJUA 4CRBA 1YPHC 1G3EA 3PWCA 2C4FH 4BAKB 3MH5A 1A0LA 3NWUA 1SGQE 4K69A 1G37A 2ZP0H 4A92A 4ISIH 1ETRH 4X8VH 3QZQA 4X1SU 2GCHF 4X6MA 1ELAA 1GGDC 2IJOB 1SSXA 4NIWA 4AB8A 2BM2A 4FUGA 3BTQE 1LPGB 4XBCA 5GIBA 2GCTC 2VU8E 5EQRA 1OPHB 1T4VH 1FNIA 1FY5A 1FY8E 1DY9A 3ZZDA 2XBXA 1C2GA 3FANA 8GCHF 2AGIX 1KXDA 3SI4H 1ZSLA 1E36B 1PPFE 4GCHG 1S83A 1BB0B 2FI3E 3T27A 2FOGA 4B2CA 1P2NA 2F3CE 4ZXXH 3RXEA 1QRZA 1PYTD 3RMLH 2ZCKP 1GBIA 3A7ZA 3HK6B 3E1XB 2LNCA 4ZKOU 1WU1A 1TBRH 2PTNA 3TNTA 1BUIA 2FI4E 1PPBH 2J9NA 2I6SA 1HBTH 1TGCA 4BXWA 3U8TH 3GY6A 1C9PA 2BD5A 3UWJH 1H4WA 1O3CA 1O2ZA 1MCVA 1QJ1B 4K8YA 1BMMH 1EZQA 1K1MA 1MTUA 4UFDH 3BTKE 3A7TA 2BDIA 1P02A 1SR5C 1EB2A 1LVOA 1QFKH 4ZKRU 2SFAA 2ZGBH 1UTPA 3SORA 4K8BA 2G52A 2ZGHA 3KQCA 2ZFFH 1ZHPA 1V2WT 5FCRA 4LZ4B 1WTGH 2XCNA 3AAVA 4H6SB 2OXSA 5SGAE 2OUAA 3O8BA 2R3UA 4AOQA 1FIZA 1SGRE 3HGPA 3U1JB 4TWYA 4HI3A 1TPSA 3LKWA 4CH8B 1DXWA 2Z9KA 1EAWA 2P95A 1D6RA 3U1IB 4OS4A 3AAUA 1MD8A 4I7YH 3H7TA 1YCPH 1PPZA 1MUEB 1CHOF 1F0SA 4IC6A 1QIXB 1KLTA 1J17T 3OYPA 1YC0A 3PMHB 4ZKSU 1A5HA 3PMJA 1TOMH 3QK1A 2GDDA 3LH1A 2SGPE
chains in the Genus database with same CATH superfamily
2P8OC 3QX5H 5E2OA 3SJIA 1A0HB 2EI7A 4OM9A 1CQQA 3RXMA 4B73A 2BVRH 4TPYA 1CGIE 3SQEE 2BVSH 1H9HE 2PKAA 5EXMA 1BTYA 1C5ZB 2BQ6B 5G4BA 1QBVH 3BEUA 1BBRK 2Z9GA 2FMJA 1GBCA 4X1RU 2ODYB 1ETSH 1SQTA 1AVWA 2SNVA 4H4FA 1QURH 2XBYA 3A88A 1S82A 4U2WA 1FQ3A 2BB4A 2HVXA 2NWNA 2W7SA 2VH6A 3ZVAA 3Q00A 3M3SA 1W12U 3RXIA 1W8BH 3HK3B 1GJ7B 1MCTA 1SLWB 3SNDA 3D23A 5GJ4B 3NRLA 2G81E 4R0IA 5FBEA 4GVUA 4UEHH 3ZZBA 3MO3A 1N8OB 4TY7A 4YT6H 3SHCH 1L0ZA 3W1EA 2VIVA 4B71A 4Y8ZA 1YY3A 1ANBA 2PSXA 1D6WA 1O3LA 2F83A 2D26C 4AYYB 5A8XA 2JDID 1QJ7B 2H9HA 1JWTA 1G2LA 6LPRA 1EAXA 1FPHH 2Q6GA 5A09A 1UTLM 1O30A 1L1JA 1TPOA 1ELTA 2W26A 3V3MA 1LTOA 1MD7A 1O3MA 1C5RA 1UHBB 1A1RA 1OWIA 2A7HA 3LIWA 3S9BA 1QNJA 1WAYB 2EI6A 4B1TA 1C2IA 5BRRE 1MU8B 2VGCB 3L3TA 1TB6H 1BMAA 1HV7A 5EXNA 1P2OA 2G5NA 1IQHA 2ANYA 3F9EA 1ELGA 2CHAB 3GCHB 1TA2A 2P3TB 2Y82A 1VITG 4GPGA 4AFSA 1O2HA 3RXTA 1GI5A 2HLDD 3RXBA 1QJ6B 4GUXA 4CRCA 1D9IA 1P0SH 1XM1A 3R0FA 3O8CA 2K1QA 2FYQA 1ELEE 1H8IH 1A5IA 2FLRH 1EP5A 3QZRA 1INCA 2W3KA 1BTWA 1ETTH 5E8EH 4AX9H 1GI1A 3L33A 2A7JA 1GMCG 1T8OA 2WPHS 1J14A 5TCAA 1BITA 4OS6A 5HIYA 2C93B 1C1UH 2ODPA 5FX5A 2J95A 3MYWA 4DY7B 1AKSB 5CE1A 2Z3DA 2YNBA 5C5OA 3P17H 1V2RT 4Z1MD 5L30H 1XXDA 2AHME 2VWOA 1O33A 1ELBA 1GDQA 1V6DA 3DFLA 4I33A 3ZZ3A 4VGCC 2AS9A 1HAVB 2XC5A 4RT0A 5E0GA 1U6QA 1YLCA 2GZ8A 3RDZA 2SGAA 3GYMA 1Y5AT 1ZJDA 1GMHF 3TNSA 1HAZB 4A1XA 1JIMA 3GY8A 5JB9S 4CR5A 4B76A 3PTNA 7LPRA 3SU3A 2OTVA 1WXRA 4XSKU 3BTME 2Z94A 3ODDA 2C8XB 2Z3EA 1HXFH 4M9FA 3RXGA 1IQMA 4O9VA 4A5TS 2F9PA 2FYRA 1Y3YA 3Q3XA 1G2MA 5JYIA 1ZZZA 1F7ZA 2DE9A 2ZZUH 4Y0YE 2A45B 1W14U 1AB9C 1EPTC 3BG4C 1J8AA 1NFWA 1GJ8B 1SLXB 2AMQA 4OGYA 2BDYA 4MPXA 4O03A 5DK1A 4NA9H 1HJAB 3RXCA 4ABGA 1K1IA 3KNXA 2AGGX 1TNJA 1V2PT 1Z6JH 1W7XH 1MKWK 2ZFSA 1PPCE 3E16B 1O5CB 4IS5A 4WH8A 1DWEH 3MU5A 2ZCHP 4FUFA 4X2YA 4MLFB 5C94A 1XUJA 1JMOH 2AH4X 1GBBA 2ZNKH 4SGAE 1K1OA 2JKHA 1ESTA 5H4IB 4ISHH 1YM0A 2JH5D 4CREA 3A7WA 4YOJA 3LT3A 3KQDA 3MTYA 3FZDA 4TPIZ 1O3BA 2H1UA 4INKA 4ZXYH 1AWHB 1TMUH 3F2HA 3EYDA 3VPKA 1PPGE 1AVXA 3QTOH 1B0EA 5F53A 2QF5A 2VVVA 4HTCH 3GICB 1O5EH 3FFGA 3Q76A 2W6ID 4B74A 3RXHA 3RXAA 4GHQA 4I8GA 2A2QH 1YP9A 2BZAA 2ZHWH 5T6GA 2BLOA 3TGJE 1ELDE 1P09A 3GDSA 4WXVA 5JB8S 3VFEA 1HDTH 2O8UA 1P57B 5ABWA 2BD3A 1IQLA 1ZJKA 3CENA 4KTCA 3MOCA 5C2ZA 2WYGA 1ANDA 2IPHA 2J94A 2QF0A 3LDXH 4Q7ZA 2GD4B 1FONA 1LPKB 1WTHD 2BD9A 2IN2A 3SV7A 1SQRA 3E6PH 1K2I1 5A8ZA 3DT0H 5L6NH 1OOKB 5DKMA 3UNSA 2YMSD 5T3HA 4YT7H 2P59A 2CJIA 1WCZA 5A0CA 3DSOA 2Y7ZA 1ZGVA 2QXGA 3VEQB 4ABHA 3L6PA 1FZZA 1KXAA 3P8FA 1QL8A 7KMEH 1BZXE 4AYVB 2A4GA 1QCPA 4AG1A 1O2RA 1HAXB 4FVDA 5K7RA 1A3EH 1F2SE 2ZI2H 5DJ7A 1FX0B 1UJ1A 5C1YA 3GDVA 3UNRA 1P10A 1LKBA 8KME2 5KEDA 1HAPH 3KGPA 3M3VA 3MMGA 3PWBA 2L74A 1YPJH 3SNAA 3ZVDA 3HGNA 1GMDF 1TE0A 1TPPA 5EW1H 3V12A 3PV2A 2BY9X 3ESTA 1J15A 2FIRH 3ITIA 4XDEA 4Y76A 1XUIA 2WV4A 2GCHG 1O34A 4IN2A 4NWLA 2KCYA 1BRBE 1UK3A 1F92A 3F1SB 4IMQA 4KTUA 2AMPA 4Q80A 1W2KH 1YPGH 4ACBA 6GCHG 5HKKD 1L2EA 2R0KA 2R3YA 1AGJA 1K9OE 3KF2A 3URCA 2BD2A 1SGPE 3RM0H 2G4TA 4ZROA 1QA7A 1Y3VA 4OGXA 1O2UA 2GMTB 2XBVA 3LC3A 1IQKA 1LHGH 3OAAD 1SGFG 1GHVH 4FUEA 1N1LA 2GZ7A 1OYQA 2HGTH 5C0TA 1HPGA 3KYFA 5FPYA 3E0PB 4K1EA 4I86A 1GI3A 2VH0A 5HGGA 4DW2U 1BOQA 1IQEA 1B7XB 1ZRKA 3NK8A 1GJ9B 1BRAA 1P01A 2FTMA 4U32A 2TIOA 3MH4A 4YOGA 1AU8A 1HGTH 4X1QU 4X6OA 2VWNA 2V35A 4GSOA 1A4WH 2R9PA 3LONA 2ZU4A 4B6FA 3PV5A 4BAMB 1C4U2 3UWIA 2RCEA 4BTTB 1XKBC 3SUEA 2QAAA 1OS8A 4CRAA 3PLPA 1UVPA 3ATWA 1E0FD 3JZ2B 3MHWU 4AFUA 2OP9A 1Y5UT 2BXTH 1A61H 2G00A 2CK3D 1KLIH 2AYWA 1O5DH 3PO1B 3BTFE 1NRRH 4D7GA 1MKXH 1SPJA 2H5DA 3UFAA 2HALA 2CGAA 4ISOA 1V2JT 2SGFE 3DA9B 5EODA 4JZDH 3GCTF 1RTFB 2UUJB 3SU5A 1NC6A 4HG6A 1ZTLA 3STIA 1NPMA 3U9AH 4TWWA 1XUKA 2GJGA 2VIDA 2EY4C 1UTKA 4MDSA 1VR1H 3O8RA 1TMBH 4A6LA 3ATLA 4FVBA 1SGEE 1GDNA 1EOJA 2PGQB 4MTBA 1QB9A 1OWJA 4YZUA 1SMFE 1ORFA 1ZTJA 2ZHDA 3URDA 2FOFA 3TGKE 2HNTC 1GHWH 1C5MD 4ISNA 4AZ2B 1GHYH 2A32A 1VKYA 3TH3H 1XUHA 2BDBA 5FPSA 1HJ8A 1JIRA 4Y6DA 1A7SA 4RT1A 1YPHE 4MNXA 4AFQA 5F8XA 3AW0A 2Z3CA 1TA6A 3ZZ7A 1XUFA 2OC7A 5JBBS 1CT0E 1O2YA 5EQSA 3QGJA 1GJDB 4J1YA 5ETXA 1FXYA 2ZC9H 2VBCA 1QL9A 1KYNA 3W94A 5EJ1A 1Z1JA 5PTPA 5EOKA 3V13A 1HCGA 1N6YA 1P06A 1BHXF 1GBDA 2XNDD 5AFYH 4K5ZA 1BTXA 2VGCC 3JZ1B 3CS0A 1O3AA 4YM9A 4ABFA 2GV7A 4ZAEA 5GNDA 3F68H 2FODA 2CHAC 3GCHC 4QT8C 4RI0A 4SGBE 5EGMA 4ZMAH 4XOJA 1SFIA 3PMAB 2BD4A 1KDQA 5C67A 4I8KA 1RD3B 3ZZ8A 2OBQA 1V2VT 3ZV8A 3UQVA 2F43B 4NGAH 2J98A 1W13U 2FOCA 3ENSB 4DIIH 2JJ1D 3H09A 1P12E 2ZFPH 1MKWH 2ZDNA 1QBOA 3KN2A 1ZHMA 2VIQA 3MU8A 3B23B 1TFXA 1AQ7A 3SGBE 2ZG0H 4NA7A 1FY4A 1H9LB 4BANB 2PGBB 4XBDA 1O37A 2FI5E 1SKYE 5LPEA 3BN9A 3TVJB 1YGCH 1LHFH 3QTVH 3VXFH 1OP2A 3ZVEA 3KQEA 4FETA 2BY5X 3QGNB 4DVAU 1UCYK 1Y3WA 1C5VA 4X8TH 1A5GH 1YWUA 3BIUH 1O5GH 1F5KU 1IQJA 1L4DA 1GBMA 2WPMS 2QC2A 4E06H 1SGYE 3ZZ4A 1MAYA 1ZMLA 5TJXA 1C5WB 1O2IA 3SJ8A 1JXPA 1TX6A 1S84A 1TPAE 3HPTB 1IQFA 1AY6H 1GG6B 2PKSB 5AHGH 3SN8A 3GISB 1TQ0B 1HUTH 3F6UH 5E2PA 3UR9A 1XXFA 4NSVA 4Y71A 3U28C 1UW7A 5E0JA 1QY6A 2ZHQH 2RG3A 2O8LA 1AZZA 1B5GH 4CRDA 5EJLA 2BY6X 1OWEA 3A8BA 4KELA 2ZFRH 3SU4A 3BTHE 3P92A 2WZQA 3UREA 3QDZB 2QYIA 1E79D 2VIOA 5LPFA 3PLBA 1OYTH 1QRXA 2CMYA 3FZZA 3ELAH 1O35A 2KCAA 2BX4A 2SNWA 1GMHG 1ZLRA 1DE7H 2TPIZ 4H42U 1DICA 4ABBA 5GXPA 5ESTE 2OD3B 1DT2A 2Q6DA 1O2MA 7GCHG 3A7XA 2QY0B 3SZNA 4BAQB 3M5OA 2PUQH 5DSFA 3Q3YA 1HJAC 2O9QA 3CP7A 1DPOA 1H1BA 1GPZA 1GI4A 5HM2A 3RXSA 3OU0A 1BMLA 3SNBA 4UFEH 2ESTE 2EA3A 1NFUA 2F9VA 2ZWLH 4ZHLU 1LKAA 1CE5A 1DDJA 2UWLA 3KL6A 3OEED 4IC5A 1C2EA 3PB1E 3EQ0H 1QTFA 1TNHA 2WV9A 4ZCNA 2OC0A 5EJZA 1KMHB 5A8YA 1EJNA 2OBOA 1Z7KA 3MQKC 2AMDA 5FBIA 1QQUA 5C0UA 1BTUA 1G9IE 1O39A 2ZFTA 2DE8A 4JK5A 3O8DA 1CGHA 1ZPCA 2PFEA 6ESTA 1AE5A 4XD7D 4R8TB 1JOUB 1CO7E 1T4UH 2R2WU 4A7IB 3ZIAD 1MTNB 5FHTA 9ESTA 4IMZA 4B2BA 1TONA 3FO8D 1KXBA 1THPB 3LH3A 2WINI 3OTPA 1S81A 4WVPE 2VIWA 2FS9A 1S0QA 1LPZB 2PUXB 1HLTH 5CHAB 1C1MA 2TGDA 1V2UT 1C2KA 4XRNA 1YKTA 1P11E 1CA0B 1NN6A 2BQ7B 4UD9H 2V3HH 2WSSD 3D62A 1Z8GA 1TGBA 1OWDA 4YLQH 1HB0B 4TY6A 1ZPBA 1NFXA 2XCFA 3LC5A 3ZZCA 4XE4A 1OXGA 1VZQH 5C5NA 1B0FA 1F0TA 1NRNH 4I8JA 3EDXB 1BBRE 2Z9LA 1RS0A 5EXLA 3M3TA 1N6XA 1CHGA 3SU2A 1AE8H 4ASUD 4MNYA 2Y5FA 1DWBH 1KSNA 1DXPA 2UUFB 1FLEE 1O3GA 1WV7H 2ZKSA 3I29A 4X8SH 2L6OA 2V3OH 2QF4A 4ABIA 3B9FH 2GP9B 1TOCB 3VB7A 1BMFD 2WPJS 1GHZA 2G8TA 4GCHF 1EP6A 1UTMA 1ZGIA 1TQ7B 3P6ZB 1O5BB 2SGQE 3Q3KA 2A4QA 5J4SA 1MH0A 1V2QT 3MNXA 2QE7D 1WBGB 1O2TA 1CGJE 1NT1A 1PQAA 2ZGXH 1CT4E 1YPKH 1C1VH 5LPRA 3M5NA 1FJSA 2BLVA 1SGIB 2GT7A 3ZZAA 2ZO3H 1AKSA 4WJG2 4NIYA 1PYTC 3FVFB 1O3DA 2TGPZ 3A80A 1DWCH 3PV4A 1SGDE 1C1TA 3ZVFA 5HM9A 3H5CB 2A31A 2P3FH 4MNVA 2BOHB 3RP2A 3GDUA 3N7EA 1GBLA 1HRTH 2ZTZA 1WQSA 3TITA 2VWLA 3LGIA 1BTPA 1FIWA 3BTDE 3SV2H 5EU8A 4AB9A 3ZYDA 3K6YA 1C4V2 1SLVB 3RXKA 1W10U 4D8NA 4XFQA 4U01A 2GMTC 1DWDH 5E0HA 2Y5HA 5FAHA 1GJAB 3SGAE 1ELFA 1K1JA 2A4OA 4NIVA 1H8ED 3EA7A 3F0OA 5ESBA 2RA0A 3RUOA 2C3SA 1ZOMA 1T32A 6CHAB 4X2WA 1E35B 1FMGA 2IOTA 3VGCB 1HIAA 2ZGJA 3TK6A 4GHTA 1Y5BT 2QV1A 1HAGE 2GZ9A 1AVGH 5AVDA 6GCHF 1KIGH 1SLUB 3WW7A 1F0RA 1V2MT 2Y80A 3WWFA 2BQWB 2C8ZB 2XW9A 4FU9A 1GVLA 3FAOA 1P04A 3BTTE 1E1RD 1C5XB 3OY6U 2KM0A 1LHCH 1NY22 2FOEA 2FS8A 2ODQA 3E0NB 4NCYA 2BY7X 4KP0A 1GI0A 2IJD1 5EQQA 2ZEBA 5DGJA 3TPIZ 5JBTA 3VB4A 4Y0ZE 2ZTXA 1AI8H 3M7TA 1TBQH 4P00A 1CA8B 1O2GH 3KYGA 1TRMA 3PO1C 1O3JA 1SFQB 1EATA 3C27B 5FXLA 1AMHA 3FKSD 3MH6A 4J2YB 2KAIA 3IITA 1RFNA 2FESH 1T31A 3GYLB 3E8LA 1MU6B 5CMXH 1BA8B 1QRWA 3ZV9A 1NTPA 4F48B 1C1OA 2GKVE 2M5TA 1XKAC 2BDAA 3AVZA 2F9BH 1GL0E 3DCLA 3SO3A 5DO4H 2P16A 1C9TA 3LGTA 4DG4A 4NIXA 1KXCA 2GGVB 4X0WU 1SB1H 1QB1A 2JIZD 1K21H 1W0KD 1C5TA 3ZZ5A 1UCYH 1UK4A 3P8NA 1GDUA 3SV6A 3U8RH 2PW8H 3NZIA 3OY5U 1MTSA 3NPSA 2B7DH 1TNLA 1NRPH 3SJOA 1HAIH 4MNWA 3SJKA 4HGCA 2ZF0H 1GJ6A 1O3OA 3GCTG 1TNGA 4WXIA 4BTUB 1NZQH 1DSTA 2H9EH 1Z6EA 1RXPA 1YLDA 3BTGE 3BTEE 4WF8A 4ZHAA 4JK6A 2F9OA 3VXEH 1FN6A 2Z9JA 1CVWH 1HAYB 2H9TH 3ATMA 3MU0A 2C90B 1DX5M 1DOJA 2B9LA 1FI8A 2BD8A 4YOIA 1MBMA 2W6JD 4AGKA 4D9QA 1O2WA 4O97A 1GHBF 4IGDA 1IAUA 2ZDAH 1SBWA 1SHHB 2ZDVH 2XRCA 2ZU1A 1A46H 3K65B 4Y79A 5IYTA 2ULLA 1F5LA 3UR6A 3RXRA 1ZMJA 3NCLA 2PP6A 4A1TA 2SGDE 1NROH 1GWAA 4BTIB 1KTTB 2RA3A 1S5SA 3M35A 5DP8A 1C5LH 1CBWB 2GVFA 1C2FA 1O3KA 1GI7B 2CXVA 2OQ5A 2A5IA 1Z8IB 1RTKA 2GTBA 3QO6A 2AERH 4YO9A 1ELCA 2W3IA 3OEHD 5JPMH 2FP7B 2THFB 1P2MA 3F9GA 1MTVA 1BBRH 3DSPA 1DLKB 3V7TA 1EZSC 1UVUH 2VB0A 3LJJA 4CRGA 3UY9A 2SGEE 3TLOA 1TYNA 2HRVA 3DHKH 3SI3H 2AEIH 2XTTB 4O3UA 3GY5A 5T6FA 1K22H 1UTJA 3VB3A 8GCHG 3M61U 3MNCA 2HWLB 4Q4LA 1GHAF 1TX8A 1IQNA 3A7YA 4JYTA 4DCDA 2PWXA 2A5AA 1RIWB 1O5AB 1PQ8A 2QCYA 2HVYB 4Z6AH 1GG6C 2PKSC 2QXJA 1V2TT 4CR9A 1LQEA 3PLKA 1UMAH 3GY2A 3P8GA 1S6LA 1O3NA 1XMNB 3RU4D 2XXLA 4FU7A 2JETB 2HPQH 2BDCA 3U8OH 4CHAB 5DPAA 1TBZH 3RXUA 1EQ9A 3EGKH 1O31A 2ASUB 2ALVA 1XX9A 5TCCA 3P8OA 1EPTA 2QGRA 1O2PA 5F8ZA 4ASHA 2UUKB 1NM6A 1LMWB 5C20A 4YTAA 1GJCB 1ZTKA 1O2SA 2K0QA 2FZZA 1EAIA 2FXRA 2ZDLA 2JH6D 2BXUH 4ZKNU 3SU1A 1JBUH 3GCNA 3SV8A 4JZFH 1SC8U 4FUCA 2F9UA 1C5PA 1O2KA 1O38A 4YXWD 1E34B 1O2XA 2Y81A 2BOKA 1V2KT 1HAHH 1ZPZA 2Z6BD 1EZXC 5EPNA 3TJOA 3K9XB 4B75A 3K2UA 5GPIB 2V7QD 1IOEA 4NFEA 3WWBA 1CHOG 1LHDH 2ZDMA 1CU1A 1P2JA 2F91A 2C8WB 1X7AC 1WSSH 4YESB 1F5RA 3FP8E 3AK5A 1EUFA 4RKOB 3S7KB 2BY8X 4K1SA 4YLUA 1V2OT 5LGOA 1C2LA 1A0JA 1AO5A 3EE0B 4KGAA 4MPVA 1TIOA 4LZ1H 2HNTE 2PHBA 4LOYH 2BZ6H 1DVAH 1K1NA 2OINA 1AD8H 4INHA 1UO6A 2Y6TA 3TK5A 1WQVH 1O3HA 1MTNC 3PROA 4CBOA 1BIOA 3T62A 2CF9H 4FUDA 1O0DH 2WUCA 1P3CA 1NRSH 2NU0E 3N7DA 1C2DA 3RMMH 1F0UA 3TH2H 1L1GA 1AFEH 1S6FA 1D3TB 1FY3A 3A83A 5CHAC 5LH8A 1Z8JB 3E91A 4THNH 3RXJA 9LPRA 3PM3A 1TRNA 4RN6A 2KCOA 4X6NA 1CA0C 1LVBA 2ILNA 1T8LA 2P94A 1E38B 4X6PA 1C5UA 5J4QA 2PR3A 4UFFH 1BRCE 3S9AA 2A5KA 1P3EA 1G36A 3EAJA 1LDTT 3S7HB 3SHAH 1G3BA 2BHGA 1V2ST 1AIXH 2UWOA 1O3IA 2J92A 1BDAA 4OS5A 4U30A 1VITH 2GDEH 2CF8H 3VB5A 5CDFE 4M7GA 2ZA5A 4JYVH 3U98H 3TU7H 1S6HA 1UK2A 3BSQA 1L1NA 2ANKH 1C2JA 3TK9A 3ZZ9A 4AGJA 4UONA 1AZ8A 2FOHA 3SUGA 1UVOA 2OLGA 1K28D 2KX4A 4DIHH 3WY8A 1S0RA 3LGYA 1UTOA 1KLJH 4Q7XA 4ACAA 1HNEE 1TLDA 4TT3D 1KDQB 4IN1A 4I32A 1ZHRA 2BVXH 3B8JA 1ZMNA 1O3EA 4FU8A 3ATIA 3UQOA 3TJVA 1DUEA 3RU4E 3SJ9A 1P2QA 1G3DA 3QN7A 3FN8A 4WMDA 5HIZA 4AG2A 2WV5A 1IQGA 2FDAA 1LVYA 1PFXC 2XYAA 3UTUH 2M2AA 1BJVA 1MTWA 1G32B 1A3BH 2EC9H 1VGCB 3LJOA 2ZQ2A 2BLWA 2LPRA 1WOFA 4ABDA 4E05H 1LVMA 5BPEA 1PPHE 1OKXA 1THSH 3KEEA 1GBEA 1K1PA 5K0HA 4DJZB 3SOSA 1E37B 3VB6A 6CHAC 4I8HA 2UWPA 2CV3A 5L2ZH 5A0AE 1PQ5A 3VGCC 1P05A 4NA8A 2CN0H 1Y8TA 2QXIA 1C2MA 2ZPRA 5CHBA 4O3TA 4B2AA 4ABEA 3N7OA 3IWMA 3DSGA 2TGAA 4OS1A 3OFND 1MZAA 1YBWA 4K3JA 3SZEA 3A8DA 1MAXA 3EA8A 4F4OC 1TGNA 3HKIB 1C5QA 1FN8A 2Y7XA 3SW2B 1QBNA 4NG9H 1GCTB 2BX3A 3A81A 3PMBB 2NU4E 1VJAU 1FAKH 1UCYE 1O32A 4CBNA 1ID5H 3UPEA 4Y7BA 4ISLA 2H6MA 1GI9B 1UVSH 1SL3A 3R3GB 2ZQ1A 1ESBA 3LGUA 5T6DA 2P3UB 4F49A 1G3CA 1V3XA 4ZH8A 5F03A 2PKAB 5EG4A 2RDLA 1EASA 1RJXB 4AC9A 3TGIE 3UOUA 1AFQB 3F2FA 5T1VA 1C5YB 2FM2A 3UAIC 5IK2D 2FOAA 2B8OH 1XUGA 3MO6A 2OK5A 1EKBB 1G30B 2FOBA 3BIVH 5C1UA 1PPEE 1BRUP 2ZU5A 4LK4A 1O5FH 1PJPA 3A86A 1C1WH 3I78A 2J97A 3GY4A 4I8LA 2BDGA 7ESTE 1HAOH 1JRSA 1ANCA 3D49H 1LHEH 4BOHA 1OWHA 4CRFA 1ZR0A 3TIUA 3TJNA 5C1XA 5FCKA 1WDIA 1QA0A 5I25A 2PV9B 1W3CA 2PTCE 2KFWA 1DLEA 4HFPB 3UIRA 1CSOE 1FAXA 3P70B 2R2MB 5GCHF 5I46H 1SGTA 3LU9B 5L2YH 2A1DB 1K1LA 8ESTE 1NS3A 1Q31A 1TGTA 1YPMH 3MO9A 1AWFH 1RRKA 1AUJA 3LGWA 3W95A 5GDSH 3T28A 2WPKS 2FOMB 3RU4T 3U69H 1T7CA 2G51A 2YMSB 1UHBA 3AW1A 1OX1A 4JZ1A 1ACBE 1DS2E 4FUIA 4HZHA 1OP8A 1C2HA 1OWKA 2FX6A 4RSPA 1MMJN 1NFYA 4AFZA 1BHXB 1RTLA 1HXEH 1EJAA 4ESTE 3EA9A 1OSSA 1EB1H 1LCYA 2EI8A 1GBAA 1WUNH 5DP7A 4RKJB 1ZSKA 3KQ5A 1MQ6A 3M36A 1GJ5H 1C1QA 3RLWH 5JBCS 3RXDA 1CBWC 3SBKA 1TMTH 1GGDB 3RXPA 1GBJA 1GHBG 3F2GA 1NESE 2GCTB 1BJUA 1W11U 3A84A 1GCDA 3RXLA 4X2VA 3RMOH 1O3PB 3GOVB 3T5FH 1ESAA 1J16A 1GHXH 4K2YA 1SGFA 1BTHH 3LGVA 1GJBB 1TAWA 1FUJA 1K0HA 1D3PB 1MKXK 2ZDKA 2FX4A 3ATKA 1ABJH 2WPLS 4TSFD 2JH0D 8LPRA 3ZZ6A 1BTZA 1C5SA 5F6MA 2AIPA 1WYKA 1NO9H 2A7CA 1HAVA 1QQ4A 1THRH 1P9UA 3V0XA 4MPUA 2J2UA 1GMDG 2O8MA 1BMNH 1QZ8A 1IHSH 2ZHFH 3RXVA 5C3NA 2ZECA 2XC4A 1W0JD 2LELA 1ZRBA 1Z71A 5HMAA 2K8IA 1W0YH 1RIWC 1H9IE 1TGSZ 1SI5H 1H8HD 1EJMA 1GBFA 1MQ5A 1P9SA 3MFJA 3NKKA 3S0NA 2FO9A 4X8UH 1A2CH 2YNAA 1MBQA 1L4ZA 4BAHB 5A2MH 4MVNA 3FP7E 4BXSA 5EIYA 1GHAG 2JETC 1EXFA 2ZTYA 2I6QA 4CHAC 2ZIQH 1C5OH 3BF6H 3GCOA 2QIQA 3SNCA 7GCHF 1GBKA 1GBTA 2HLCA 4GLYA 2Z7FE 3I77A 1GVZA 1GI8B 4Y7AA 3AASA 2XC0A 1S85A 1HIAB 1SOTA 2VIPA 2W7UA 3DFJA 1AN1E 3BEIB 1GI6A 1KTSB 4MQAA 2GV6A 3MWIU 1NRQH 2TGTA 3ZVGA 3MNSA 4WH6A 1OP0A 4INLA 3RC5A 1ABIH 3M7QA 1C1RA 2XBWA 1YPEH 3T2NA 3RM2H 2P8OB 5FL7D 2J4IA 1TNKA 4UE7H 1SHYA 1SQOA 3E90B 4Y11E 3DUXH 3T29A 3M37A 3MU4A 3H7OA 3SQHE 4JZIA 2FEQH 5DP5A 1C1PA 2Y5GA 3OX7U 3RC6A 1DY8A 4BNRA 3PTBA 1YCPM 3KHVA 2OQUA 3LOXA 3HATH 2O8WA 2BYAX 1GJ4H 5AFZH 3KIDU 4DGJA 3CS7A 1EAUA 1SGCA 4FUJA 1KY9A 4JZEH 2J38A 4D9RA 3SYJA 1O2OA 2KAIB 2Q6FA 3SGQE 3ODFA 1MZDA 1P2IA 3MNBA 3FOAA 2FLBH 1YYY1 2ANMH 1LQDB 4H6TA 5FPTA 1Y3UA 4KKDA 3CNRA 5DP4A 3UOPA 2H2ZA 4D76A 3G01A 3RMNH 3SUDA 3A89A 1ARCA 4AORA 2B0FA 2ANWA 1YPLH 1TRYA 3M5LA 2ZHEH 1C1NA 2D8WA 3F9HA 3S9CA 1AUTC 1COWD 5B6OA 2UUYA 4OS7A 1FY1A 5GWZA 1DUAA 4B6EA 1D3DB 2BTCE 3PRBA 4WWYA 1Z1IA 4JCNA 4KTSA 4I31A 1IQIA 4AN7A 2OC8A 1Y59T 1VITF 1VCWA 3RLYH 2ZU3A 2G55A 4X2XA 1SG8B 2AIQA 2D1JA 2G4UA 3P95A 1ZYOA 1XVMA 4Q63A 4DURA 1YCPK 3OE7D 4ABAA 2F9NA 3D65E 1QHRB 2ZGCA 3UUZA 4K1TA 2HOBA 1UTNA 1P2KA 1EFRD 2D2DA 2NU2E 1FV9A 1SOZA 2O8TA 2VVUA 1QL7A 1BCUH 2WPIS 1GMCF 1GVKB 3OTJE 3QUMP 4CH2B 2WHXA 4NSYA 3T25A 2RDEA 2DUCA 4IW4E 1LO6A 2QN5T 2VJ1A 3GY3A 1SQAA 4WY3A 4Y8XA 1TX7A 4X1NU 4WMFA 4DT4A 3A7VA 1SVPA 1TWXB 3RXOA 4K60A 5DP3A 5DG6A 1HYLA 2P93A 1JRTA 1UTQA 4A1VA 2F4LA 3BEFB 2WPDD 1DSUA 2ZPQA 3STJA 4OS2A 2XWBI 4BAOB 3SU0A 4FUBA 1C5NH 3A85A 4X1PU 4F55A 2ZCLP 1DFPA 1O2LA 4UDWH 1DITH 2B5TB 2AGEX 1C1SA 4Z0KA 1O2VA 5DN6D 1MABB 3ZYEA 3A82A 5JBAS 5DP6A 4FXGH 5AF9H 3M5MA 4GAWA 3MH7A 4NFFA 1V2LT 2TBSA 1ELVA 3SU6A 4VGCB 1EZUC 2VVCA 1DM4B 2VINA 2ZPSA 3BTWE 2QXHA 1VGCC 3FP6E 1IHTH 1M9UA 1DANH 4P02A 4DOQA 3RC4A 5A0BA 3S69A 1W7GH 2KZ4A 2Z9IA 1J9CH 1NU9A 1BT7A 2QF3A 1P8VC 2PSYA 2C8YB 1KXFA 3SV9A 1VJ9U 3GS9A 2GX4A 2ALPA 5FX6A 1NU7B 3TH4H 5EPYA 1VCQA 4E7RG 1Q2WA 2FTLE 5IDKA 4DT7B 2PLXA 3QWCH 3RXQA 2BD7A 5EW2H 1GL1A 3DD2H 5HXFA 1HJ9A 3SUFA 5KGOA 3IG6B 3A8CA 4MPWA 2FPZA 4E7NA 1TALA 2LP6A 2RFKC 1P03A 1AB9B 1EPTB 3BG4B 1XVOA 1NBMD 2BMGB 2HPPH 1D4PB 4JYUH 1CT2E 2W5EA 2R0LA 3Q77A 2KCPA 3BG8A 2J5UA 2WYJA 1RGQA 1GCTC 4FUHA 1T8MA 3KCGH 4XBBA 1Z8RA 3ZVBA 4WMEA 1EOLA 3NXPA 3SNEA 2VNTA 1ARBA 2G5VA 1HFDA 2ZFQH 2V6NA 4Q7YA 2JJ2D 3QLPH 1O2QA 1QGFA 4NZQA 1YF4A 2FWWA 5JDUB 1T8NA 3C1KA 1ANEA 4Y8YA 2AFQB 2YOLA 3GY7A 4TYDA 1AFQC 1O3FA 1O2JA 3UNQA 4D7FA 2OC1A 1QB6A 4UFGH 1FPCH 2EQNA 1UVTH 4IBLH 2EEKA 5F8TA 1Y3XA 4LXBH 1OHHD 2STBE 1QR3E 2VWMA 1ZSJA 2J34A 2V3MA 2V0BA 3LPRA 3A87A 3E3TA 1SGNE 2STAE 1GBHA 1D3QB 3K6ZA 4NWKA 5DP9A 2OCVB 4Q2KA 3KQBA 1PQ7A 3MU1A 1H8DH 1V2NT 2Q1JA 2XNIA 2A2XH 4ZHMU 2HNTF 2NU1E 1C4Y2 4Y10E 1KXEA 2BDHA 4NZLA 4JMYA 2XWAA 3F9FA 1BQYA 1TABE 3NUMA 2NU3E 1EX3A 2A4RA 1W0ZU 2QA9E 5B6LA 1FDPA 2GT8A 4ZUHA 3PYHA 2H5CA 3OSYA 3HKJB 1Q3XA 1N8OC 2A0QB 2BLQA 2YMSC 3A8AA 1O2NA 4MG3A 5HYOA 1O36A 1TNIA 1VCPA 3ZVCA 5KECA 2WUBA 5GCHG 3MI4A 3RXFA 3T26A 3BV9B 1AHTH 1E1QD 3M7UA 4PROA 4ABJA 2ZU2A 1GI2A 2IPQX 2TRMA 2KR7A 3TJUA 4CRBA 1YPHC 1G3EA 3PWCA 2C4FH 4BAKB 3MH5A 1A0LA 3NWUA 1SGQE 2XOKD 4K69A 1G37A 2ZP0H 4A92A 4ISIH 1ETRH 4X8VH 3QZQA 4X1SU 2GCHF 4X6MA 1ELAA 1GGDC 2IJOB 1SSXA 4NIWA 4AB8A 2BM2A 4FUGA 3BTQE 1LPGB 4XBCA 5GIBA 2GCTC 2VU8E 5EQRA 1OPHB 1T4VH 1FNIA 3F0PA 1FY5A 1FY8E 3VG8A 1DY9A 3ZZDA 2J98B 2XBXA 1C2GA 3N99A 3FANA 8GCHF 2AGIX 1KXDA 3SI4H 1ZSLA 1E36B 1PPFE 4GCHG 1S83A 1BB0B 3UB0A 2FI3E 3T27A 2FOGA 4B2CA 1P2NA 2F3CE 4ZXXH 3F3BA 3RXEA 1QRZA 1PYTD 3RMLH 2ZCKP 1GBIA 3A7ZA 3HK6B 3E1XB 2LNCA 4ZKOU 1WU1A 1TBRH 2PTNA 3TNTA 1BUIA 2FI4E 1PPBH 2J9NA 2I6SA 1HBTH 4FOUC 1TGCA 4BXWA 3U8TH 3GY6A 1C9PA 2BD5A 3UWJH 1H4WA 1O3CA 1O2ZA 1MCVA 1QJ1B 4K8YA 1BMMH 1EZQA 1K1MA 1MTUA 4UFDH 3BTKE 3A7TA 2BDIA 1P02A 1SR5C 1EB2A 1LVOA 1QFKH 4ZKRU 5C17A 2SFAA 2ZGBH 1UTPA 3SORA 1NBME 4K8BA 2G52A 2ZGHA 3KQCA 2ZFFH 1ZHPA 1V2WT 5FCRA 4LZ4B 1WTGH 2XCNA 3AAVA 4H6SB 2OXSA 5SGAE 2OUAA 3O8BA 2R3UA 4AOQA 1FIZA 1SGRE 3HGPA 3U1JB 4TWYA 4HI3A 1TPSA 3LKWA 4CH8B 1DXWA 2Z9KA 1EAWA 2P95A 1D6RA 3U1IB 4OS4A 3AAUA 1MD8A 4I7YH 1YLNA 3H7TA 1YCPH 1PPZA 1MUEB 1CHOF 1F0SA 4IC6A 1QIXB 1KLTA 1J17T 3OYPA 1YC0A 3EE7A 3PMHB 4ZKSU 1A5HA 3PMJA 1TOMH 3QK1A 2GDDA 3LH1A 3PRDA 2SGPE
chains in the Genus database with same CATH topology
2P8OC 3QX5H 5E2OA 3SJIA 1A0HB 2EI7A 1CQQA 3RXMA 4B73A 2BVRH 4TPYA 1CGIE 3SQEE 2BVSH 1H9HE 2PKAA 5EXMA 1BTYA 1C5ZB 2BQ6B 5G4BA 1QBVH 3BEUA 1BBRK 2Z9GA 2FMJA 1GBCA 4X1RU 2ODYB 1ETSH 1SQTA 1AVWA 2SNVA 4H4FA 1QURH 2XBYA 3A88A 1S82A 4U2WA 1FQ3A 2BB4A 2HVXA 2NWNA 2W7SA 2VH6A 3ZVAA 3Q00A 3M3SA 1W12U 3RXIA 1W8BH 3HK3B 1GJ7B 1MCTA 1SLWB 3SNDA 3D23A 5GJ4B 2G81E 4R0IA 5FBEA 4GVUA 4UEHH 3ZZBA 3MO3A 1N8OB 4TY7A 4YT6H 3SHCH 1L0ZA 2VIVA 4B71A 4Y8ZA 1ANBA 2PSXA 1D6WA 1O3LA 2F83A 2D26C 4AYYB 5A8XA 1QJ7B 2H9HA 1JWTA 1G2LA 6LPRA 1EAXA 1FPHH 2Q6GA 5A09A 1UTLM 1O30A 1L1JA 1TPOA 1ELTA 2W26A 3V3MA 1LTOA 1MD7A 1O3MA 1C5RA 1UHBB 1A1RA 1OWIA 2A7HA 3LIWA 3S9BA 1QNJA 1WAYB 2EI6A 4B1TA 1C2IA 5BRRE 1MU8B 2VGCB 3L3TA 1TB6H 1BMAA 1HV7A 5EXNA 1P2OA 2G5NA 1IQHA 2ANYA 3F9EA 1ELGA 2CHAB 3GCHB 1TA2A 2P3TB 2Y82A 1VITG 4GPGA 4AFSA 1O2HA 3RXTA 1GI5A 3RXBA 1QJ6B 4GUXA 4CRCA 1D9IA 1P0SH 1XM1A 3R0FA 3O8CA 2K1QA 2FYQA 1ELEE 1H8IH 1A5IA 2FLRH 1EP5A 3QZRA 1INCA 2W3KA 1BTWA 1ETTH 5E8EH 4AX9H 1GI1A 3L33A 2A7JA 1GMCG 1T8OA 2WPHS 1J14A 5TCAA 1BITA 4OS6A 2C93B 1C1UH 2ODPA 5FX5A 2J95A 3MYWA 4DY7B 1AKSB 5CE1A 2Z3DA 2YNBA 5C5OA 3P17H 1V2RT 5L30H 1XXDA 2VWOA 1O33A 1ELBA 1GDQA 1V6DA 3DFLA 4I33A 3ZZ3A 4VGCC 2AS9A 1HAVB 2XC5A 5E0GA 1U6QA 1YLCA 2GZ8A 3RDZA 2SGAA 3GYMA 1Y5AT 1ZJDA 1GMHF 3TNSA 1HAZB 4A1XA 1JIMA 3GY8A 5JB9S 4CR5A 4B76A 3PTNA 7LPRA 3SU3A 2OTVA 4XSKU 3BTME 2Z94A 3ODDA 2C8XB 2Z3EA 1HXFH 3RXGA 1IQMA 4O9VA 4A5TS 2F9PA 2FYRA 1Y3YA 3Q3XA 1G2MA 5JYIA 1ZZZA 1F7ZA 2DE9A 2ZZUH 4Y0YE 2A45B 1W14U 1AB9C 1EPTC 3BG4C 1J8AA 1NFWA 1GJ8B 1SLXB 2AMQA 4OGYA 2BDYA 4MPXA 4O03A 5DK1A 4NA9H 1HJAB 3RXCA 4ABGA 1K1IA 3KNXA 2AGGX 1TNJA 1V2PT 1Z6JH 1W7XH 1MKWK 2ZFSA 1PPCE 3E16B 1O5CB 4IS5A 4WH8A 1DWEH 3MU5A 2ZCHP 4FUFA 4X2YA 4MLFB 1XUJA 1JMOH 2AH4X 1GBBA 2ZNKH 4SGAE 1K1OA 2JKHA 1ESTA 5H4IB 4ISHH 1YM0A 2JH5D 4CREA 3A7WA 4YOJA 3LT3A 3KQDA 3MTYA 3FZDA 4TPIZ 1O3BA 2H1UA 4INKA 4ZXYH 1AWHB 1TMUH 3VPKA 3EYDA 1PPGE 1AVXA 3QTOH 1B0EA 2VVVA 4HTCH 3GICB 1O5EH 3FFGA 3Q76A 4B74A 3RXHA 3RXAA 4GHQA 4I8GA 2A2QH 1YP9A 2BZAA 2ZHWH 5T6GA 2BLOA 3TGJE 1ELDE 1P09A 3GDSA 4WXVA 5JB8S 3VFEA 1HDTH 2O8UA 1P57B 5ABWA 2BD3A 1IQLA 1ZJKA 3CENA 4KTCA 3MOCA 5C2ZA 2WYGA 1ANDA 2IPHA 2J94A 2QF0A 3LDXH 4Q7ZA 2GD4B 1FONA 1LPKB 1WTHD 2BD9A 2IN2A 3SV7A 3E6PH 1K2I1 5A8ZA 3DT0H 5L6NH 1OOKB 5DKMA 3UNSA 5T3HA 4YT7H 2P59A 2CJIA 1WCZA 5A0CA 2Y7ZA 1ZGVA 2QXGA 3VEQB 4ABHA 3L6PA 1FZZA 1KXAA 3P8FA 1QL8A 7KMEH 1BZXE 4AYVB 2A4GA 1QCPA 4AG1A 1O2RA 1HAXB 4FVDA 5K7RA 1A3EH 1F2SE 2ZI2H 5DJ7A 1UJ1A 5C1YA 3GDVA 3UNRA 1P10A 1LKBA 8KME2 1HAPH 3KGPA 3M3VA 3MMGA 3PWBA 1YPJH 3SNAA 3ZVDA 3HGNA 1GMDF 1TE0A 1TPPA 5EW1H 3V12A 2BY9X 3ESTA 1J15A 2FIRH 3ITIA 4XDEA 4Y76A 1XUIA 2WV4A 2GCHG 1O34A 4IN2A 4NWLA 1BRBE 1UK3A 1F92A 3F1SB 4IMQA 4KTUA 2AMPA 4Q80A 1W2KH 1YPGH 6GCHG 1L2EA 2R0KA 2R3YA 1AGJA 1K9OE 3KF2A 3URCA 2BD2A 1SGPE 3RM0H 2G4TA 4ZROA 1QA7A 1Y3VA 4OGXA 1O2UA 2GMTB 2XBVA 3LC3A 1IQKA 1LHGH 1SGFG 1GHVH 4FUEA 1N1LA 2GZ7A 1OYQA 2HGTH 1HPGA 5FPYA 3E0PB 4K1EA 1GI3A 2VH0A 5HGGA 4DW2U 1BOQA 1IQEA 1B7XB 1ZRKA 3NK8A 1GJ9B 1BRAA 1P01A 2FTMA 4U32A 2TIOA 3MH4A 4YOGA 1AU8A 1HGTH 4X1QU 4X6OA 2VWNA 2V35A 4GSOA 1A4WH 2R9PA 3LONA 2ZU4A 4BAMB 1C4U2 3UWIA 2RCEA 4BTTB 1XKBC 3SUEA 2QAAA 1OS8A 4CRAA 3PLPA 1UVPA 3ATWA 1E0FD 3JZ2B 3MHWU 4AFUA 2OP9A 1Y5UT 2BXTH 1A61H 2G00A 1KLIH 2AYWA 1O5DH 3PO1B 3BTFE 1NRRH 4D7GA 1MKXH 1SPJA 2H5DA 3UFAA 2HALA 2CGAA 4ISOA 1V2JT 2SGFE 3DA9B 5EODA 4JZDH 3GCTF 1RTFB 2UUJB 3SU5A 1NC6A 1ZTLA 3STIA 1NPMA 3U9AH 4TWWA 1XUKA 2VIDA 1UTKA 4MDSA 1VR1H 3O8RA 1TMBH 4A6LA 3ATLA 4FVBA 1SGEE 1GDNA 1EOJA 2PGQB 4MTBA 1QB9A 1OWJA 4YZUA 1SMFE 1ORFA 1ZTJA 2ZHDA 3URDA 2FOFA 3TGKE 2HNTC 1GHWH 1C5MD 4ISNA 4AZ2B 1GHYH 2A32A 3TH3H 1XUHA 2BDBA 5FPSA 1HJ8A 1JIRA 4Y6DA 1A7SA 1YPHE 4MNXA 4AFQA 5F8XA 3AW0A 2Z3CA 1TA6A 3ZZ7A 1XUFA 2OC7A 5JBBS 1CT0E 1O2YA 5EQSA 3QGJA 1GJDB 4J1YA 5ETXA 1FXYA 2ZC9H 1QL9A 1KYNA 3W94A 1Z1JA 5PTPA 5EOKA 3V13A 1HCGA 1N6YA 1P06A 1BHXF 1GBDA 5AFYH 4K5ZA 1BTXA 2VGCC 3JZ1B 3CS0A 1O3AA 4YM9A 4ABFA 2GV7A 4ZAEA 3F68H 2FODA 2CHAC 3GCHC 4QT8C 4SGBE 5EGMA 4ZMAH 4XOJA 1SFIA 3PMAB 2BD4A 1KDQA 5C67A 4I8KA 1RD3B 3ZZ8A 2OBQA 1V2VT 3ZV8A 3UQVA 4NGAH 1W13U 2FOCA 3ENSB 4DIIH 1P12E 2ZFPH 1MKWH 2ZDNA 1QBOA 3KN2A 1ZHMA 2VIQA 3MU8A 3B23B 1TFXA 1AQ7A 3SGBE 2ZG0H 4NA7A 1FY4A 1H9LB 4BANB 2PGBB 4XBDA 1O37A 2FI5E 5LPEA 3BN9A 3TVJB 1YGCH 1LHFH 3QTVH 3VXFH 1OP2A 3ZVEA 3KQEA 2BY5X 3QGNB 4DVAU 1UCYK 1Y3WA 1C5VA 4X8TH 1A5GH 3BIUH 1O5GH 1F5KU 1IQJA 1L4DA 1GBMA 2WPMS 2QC2A 4E06H 1SGYE 3ZZ4A 1MAYA 1ZMLA 5TJXA 1C5WB 1O2IA 3SJ8A 1JXPA 1TX6A 1S84A 1TPAE 3HPTB 1IQFA 1AY6H 1GG6B 2PKSB 5AHGH 3SN8A 3GISB 1TQ0B 1HUTH 3F6UH 5E2PA 3UR9A 1XXFA 4NSVA 4Y71A 5E0JA 1QY6A 2ZHQH 2RG3A 2O8LA 1AZZA 1B5GH 4CRDA 2BY6X 1OWEA 3A8BA 4KELA 2ZFRH 3SU4A 3BTHE 3P92A 3UREA 3QDZB 2QYIA 2VIOA 5LPFA 3PLBA 1OYTH 1QRXA 2CMYA 3FZZA 3ELAH 1O35A 2BX4A 2SNWA 1GMHG 1ZLRA 1DE7H 2TPIZ 4H42U 1DICA 4ABBA 5GXPA 5ESTE 2OD3B 1DT2A 2Q6DA 1O2MA 7GCHG 3A7XA 2QY0B 3SZNA 4BAQB 3M5OA 2PUQH 3Q3YA 1HJAC 2O9QA 3CP7A 1DPOA 1H1BA 1GPZA 1GI4A 5HM2A 3RXSA 3OU0A 1BMLA 3SNBA 4UFEH 2ESTE 2EA3A 1NFUA 2F9VA 2ZWLH 4ZHLU 1LKAA 1CE5A 1DDJA 2UWLA 3KL6A 4IC5A 1C2EA 3PB1E 3EQ0H 1QTFA 1TNHA 2OC0A 5A8YA 1EJNA 2OBOA 1Z7KA 2AMDA 5FBIA 1QQUA 1BTUA 1G9IE 1O39A 2ZFTA 2DE8A 4JK5A 3O8DA 1CGHA 1ZPCA 2PFEA 6ESTA 1AE5A 4R8TB 1JOUB 1CO7E 1T4UH 2R2WU 4A7IB 1MTNB 5FHTA 9ESTA 4IMZA 4B2BA 1TONA 1KXBA 1THPB 3LH3A 2WINI 4WVPE 1S81A 2VIWA 2FS9A 1S0QA 1LPZB 2PUXB 1HLTH 5CHAB 1C1MA 2TGDA 1V2UT 1C2KA 1YKTA 1P11E 1CA0B 1NN6A 2BQ7B 4UD9H 2V3HH 3D62A 1Z8GA 1TGBA 1OWDA 4YLQH 1HB0B 4TY6A 1ZPBA 1NFXA 2XCFA 3LC5A 3ZZCA 4XE4A 1OXGA 1VZQH 5C5NA 1B0FA 1F0TA 1NRNH 4I8JA 3EDXB 1BBRE 2Z9LA 1RS0A 5EXLA 3M3TA 1N6XA 1CHGA 3SU2A 1AE8H 4MNYA 2Y5FA 1DWBH 1KSNA 1DXPA 2UUFB 1FLEE 1O3GA 1WV7H 2ZKSA 3I29A 4X8SH 2V3OH 4ABIA 3B9FH 2GP9B 1TOCB 3VB7A 2WPJS 1GHZA 2G8TA 4GCHF 1EP6A 1UTMA 1ZGIA 1TQ7B 3P6ZB 1O5BB 2SGQE 3Q3KA 2A4QA 5J4SA 1MH0A 1V2QT 3MNXA 1WBGB 1O2TA 1CGJE 1NT1A 1PQAA 2ZGXH 1CT4E 1YPKH 1C1VH 5LPRA 3M5NA 1FJSA 2BLVA 1SGIB 2GT7A 3ZZAA 2ZO3H 1AKSA 4WJG2 4NIYA 1PYTC 3FVFB 1O3DA 2TGPZ 3A80A 1DWCH 3PV4A 1SGDE 1C1TA 3ZVFA 5HM9A 3H5CB 2A31A 2P3FH 4MNVA 2BOHB 3RP2A 3GDUA 1GBLA 1HRTH 2ZTZA 1WQSA 3TITA 2VWLA 3LGIA 1BTPA 1FIWA 3BTDE 3SV2H 5EU8A 4AB9A 3ZYDA 3K6YA 1C4V2 1SLVB 3RXKA 1W10U 4D8NA 4XFQA 4U01A 2GMTC 1DWDH 5E0HA 2Y5HA 5FAHA 1GJAB 3SGAE 1ELFA 1K1JA 2A4OA 4NIVA 3EA7A 5ESBA 2RA0A 3RUOA 2C3SA 1ZOMA 1T32A 6CHAB 4X2WA 1E35B 1FMGA 2IOTA 3VGCB 1HIAA 2ZGJA 3TK6A 4GHTA 1Y5BT 2QV1A 1HAGE 2GZ9A 1AVGH 5AVDA 6GCHF 1KIGH 1SLUB 1F0RA 1V2MT 2Y80A 2BQWB 2C8ZB 2XW9A 4FU9A 1GVLA 3FAOA 1P04A 3BTTE 1C5XB 3OY6U 1LHCH 1NY22 2FOEA 2FS8A 2ODQA 3E0NB 4NCYA 2BY7X 4KP0A 1GI0A 5EQQA 2ZEBA 5DGJA 3TPIZ 5JBTA 3VB4A 4Y0ZE 2ZTXA 1AI8H 3M7TA 1TBQH 1CA8B 1O2GH 1TRMA 3PO1C 1O3JA 1SFQB 1EATA 3C27B 5FXLA 1AMHA 3MH6A 4J2YB 2KAIA 3IITA 1RFNA 2FESH 1T31A 3GYLB 3E8LA 1MU6B 5CMXH 1BA8B 1QRWA 3ZV9A 1NTPA 1C1OA 2GKVE 2M5TA 1XKAC 2BDAA 3AVZA 2F9BH 1GL0E 3SO3A 5DO4H 2P16A 1C9TA 3LGTA 4DG4A 4NIXA 1KXCA 2GGVB 4X0WU 1SB1H 1QB1A 1K21H 1C5TA 3ZZ5A 1UCYH 1UK4A 3P8NA 1GDUA 3SV6A 3U8RH 2PW8H 3NZIA 3OY5U 1MTSA 3NPSA 2B7DH 1TNLA 1NRPH 3SJOA 1HAIH 4MNWA 3SJKA 4HGCA 2ZF0H 1GJ6A 1O3OA 3GCTG 1TNGA 4WXIA 4BTUB 1NZQH 1DSTA 2H9EH 1Z6EA 1RXPA 1YLDA 3BTGE 3BTEE 4WF8A 4ZHAA 4JK6A 2F9OA 3VXEH 1FN6A 2Z9JA 1CVWH 1HAYB 2H9TH 3ATMA 3MU0A 2C90B 1DX5M 1DOJA 2B9LA 1FI8A 2BD8A 4YOIA 1MBMA 4AGKA 4D9QA 1O2WA 4O97A 1GHBF 4IGDA 1IAUA 2ZDAH 1SBWA 1SHHB 2ZDVH 2XRCA 2ZU1A 1A46H 3K65B 4Y79A 5IYTA 2ULLA 1F5LA 3UR6A 3RXRA 1ZMJA 3NCLA 4A1TA 2SGDE 1NROH 1GWAA 4BTIB 1KTTB 2RA3A 1S5SA 3M35A 5DP8A 1C5LH 1CBWB 2GVFA 1C2FA 1O3KA 1GI7B 2CXVA 2OQ5A 2A5IA 1Z8IB 1RTKA 2GTBA 3QO6A 2AERH 4YO9A 1ELCA 2W3IA 5JPMH 2FP7B 2THFB 1P2MA 3F9GA 1MTVA 1BBRH 1DLKB 3V7TA 1EZSC 1UVUH 2VB0A 3LJJA 4CRGA 3UY9A 2SGEE 3TLOA 1TYNA 2HRVA 3DHKH 3SI3