1O5EH

Dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
255
structure length
248
Chain Sequence
b'IVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFNSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease hepsin
publication title Dissecting and designing inhibitor selectivity determinants at the S1 site using an artificial Ala190 protease (Ala190 uPA).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Serine protease, hydrolase
total genus 58
structure length 248
sequence length 255
ec nomenclature ec 3.4.21.106: Hepsin.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o5eH01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o5eH02
1FJSA 3TGJE 1BCUH 2FX4A 1IQFA 1TX6A 3LGTA 2PSYA 1ZTJA 1RD3B 3T29A 4MG3A 2A4GA 1Z6EA 3S9BA 2ZPRA 3LH1A 1QQ4A 4O3UA 4UE7H 2ZHFH 4ZHMU 1TBRH 2BDBA 5DKMA 2EI6A 4BAMB 4ZAEA 4I31A 4NCYA 3L6PA 1C1RA 1SR5C 4YOGA 5EQSA 2ZC9H 3SUDA 1CVWH 2BOKA 1QBNA 5L2YH 1LKBA 5DG6A 3W95A 2ZA5A 8ESTE 2ANWA 4IC5A 1XVOA 4AG1A 5A2MH 4KKDA 1GI7B 1BMMH 1SGNE 1P2OA 1RTFB 4TWYA 4I7YH 1ARCA 1PYTC 2XWBI 1WTHD 7GCHF 4MQAA 3ZZAA 1JWTA 1JMOH 3UQOA 3P17H 4XBBA 1KY9A 1TLDA 3SU0A 1GI9B 1NRRH 1C5WB 1AFEH 3SNAA 1ZSJA 2B7DH 3MWIU 4J2YB 1T8NA 3SGAE 3TK6A 4X1QU 1SGTA 3MNBA 1RS0A 5FCRA 1MD8A 3GY7A 1YLDA 4AORA 3TIUA 3UNSA 3DFJA 4ZXXH 1PPCE 3BIUH 2CGAA 1HLTH 1Q31A 1SFIA 1V2OT 1XUHA 2B5TB 2FI5E 3QTOH 4WF8A 2G00A 3MFJA 1GG6C 3MH6A 1BTHH 2RCEA 1BBRK 5FX6A 3RXQA 4I32A 1KSNA 2J95A 4DW2U 4FUJA 1XUIA 1OWIA 3BTHE 3RXDA 1CHOF 1AY6H 1LPGB 1UVUH 1Y59T 1PQ5A 5EW2H 2Z9LA 3ZVCA 3LC3A 4ASHA 4CRDA 1BTPA 4K3JA 3ZV8A 3RM2H 1GBCA 2P94A 1ELDE 1C1VH 1K28D 5A09A 1ZYOA 2UWPA 4E7NA 1QL7A 2WUBA 4ISIH 2EC9H 3GCOA 3KCGH 3A83A 3SU4A 5F8XA 4X0WU 3OTJE 1AB9C 4OGYA 3TK9A 3S9AA 3OYPA 3QO6A 4X8SH 1O3OA 2ZPSA 3BTEE 4GSOA 1BMLA 5EXLA 1AFQB 2W7UA 1KXDA 4ABGA 3I77A 4X6NA 2B0FA 2Z94A 3QN7A 5E0HA 3CS7A 1JIMA 3UNRA 5AHGH 3SU3A 1GJDB 3LGVA 4GCHF 2BY5X 3K6ZA 4YLUA 4TYDA 1MAYA 1EPTC 2C8YB 2LNCA 1GHBF 2ZHEH 1O2ZA 1WAYB 2ZDMA 4ABHA 1LQDB 2QF0A 2XBVA 2HPQH 3SI3H 3GDVA 1LDTT 4DJZB 3TGIE 1L0ZA 4INLA 2GCHG 2ODPA 3SU2A 3E91A 1T7CA 2Q6FA 5ESTE 1G3DA 1MBQA 2VIOA 3EA7A 1GBLA 2WV4A 1T8LA 5JBCS 1GBBA 1S81A 3UUZA 3GY4A 3KNXA 2BLQA 2PKAB 1H1BA 1VITH 4JZDH 3A88A 1NY22 2HOBA 1RXPA 4BNRA 3D23A 4X6MA 5DP7A 1A4WH 1O2HA 2SGPE 1GI8B 1Y5AT 4ABFA 1C5XB 2P95A 3D49H 2F9VA 1G9IE 2QAAA 2ZCLP 1IQGA 2BD2A 4LOYH 1GJAB 1P11E 2G4UA 3SJ9A 1NFWA 2ESTE 3UPEA 1MD7A 4X2XA 2VWMA 4X1NU 9LPRA 3RXTA 1TNKA 2VIVA 1JXPA 3RXUA 3ZVAA 4B73A 5H4IB 2Z9KA 2VWOA 1QRZA 3URCA 1QY6A 2AFQB 5HXFA 3ZZ9A 1XVMA 3K2UA 4IC6A 2BQ6B 2C93B 3TVJB 1TOMH 3A7WA 4YM9A 3RC6A 4DG4A 5DP6A 2VB0A 1S85A 1E35B 1G2MA 1LHFH 3M61U 1TNJA 2WPMS 1LKAA 5C1YA 3R0FA 3TH4H 1MTVA 4D8NA 1AWFH 1TONA 1W7XH 1CBWB 1S6FA 3RU4E 3FZDA 1GCTB 1F92A 1LHCH 3ELAH 4NIYA 2CV3A 2H1UA 1YPHC 1OP0A 4TY6A 4B75A 1S5SA 1DPOA 5T3HA 1C2DA 4SGAE 1GDNA 1O32A 2O8UA 4Y8YA 4OGXA 2BYAX 2ALVA 3DD2H 1GHXH 3PROA 1EZUC 1C9TA 4ZKNU 1IQKA 3BN9A 2TPIZ 2J38A 2HLCA 5DP8A 3QWCH 1ZTKA 1YPEH 2BM2A 1UCYK 3PMHB 1A1RA 1ANBA 2TGTA 2ZTZA 1ZRKA 1HNEE 4Z0KA 1SQAA 3QDZB 2BXUH 2QXGA 4YESB 2JKHA 2BLOA 1BIOA 4B76A 1CGJE 4K1EA 3VFEA 5I46H 4DCDA 4Y0YE 3VB3A 3BIVH 1KIGH 2HGTH 2FI4E 3QK1A 2WYJA 1DVAH 2OC0A 1BRCE 3SOSA 3RUOA 2Y6TA 2WPJS 2LPRA 5A8ZA 1VITG 3OY5U 3SI4H 2AGIX 3BSQA 4FUCA 2HVXA 3A7YA 1JOUB 1QRWA 4FUIA 1DM4B 2PTNA 1TGBA 1SQOA 5EGMA 1QFKH 1HJAC 1EJAA 3K6YA 1FPHH 3RXOA 1W0ZU 2CN0H 4UFEH 4K8YA 3TNSA 1PQAA 2GKVE 3ZZ6A 1BDAA 2ZFTA 1LVBA 3KN2A 1EAXA 1DOJA 2Y5HA 4WMEA 4Q2KA 5JPMH 1EP5A 3A85A 4X8VH 1AWHB 1HRTH 4HTCH 4K2YA 4GAWA 4MNVA 4UEHH 3EDXB 1UTQA 3RXHA 3ZZ4A 3ATKA 3LPRA 1QB1A 2FOCA 3IWMA 2ZZUH 4O97A 1CE5A 2GCTB 2OUAA 3Q00A 2EI7A 1ABIH 3E6PH 5DPAA 3BTTE 1TNHA 2SGEE 5C5OA 4A5TS 1UO6A 2Z9JA 5EW1H 1C5SA 2ZIQH 5LH8A 1THSH 4FUBA 1BTZA 2PHBA 2OP9A 1UTKA 2XBXA 1SPJA 3RXLA 1T4VH 3BEUA 1QNJA 1V6DA 3ZVEA 4AX9H 3UWIA 3TJVA 1K21H 2Y5FA 2V3OH 1P2JA 4GLYA 4UFGH 1QRXA 2GT7A 4JMYA 4U01A 1KLJH 1DXPA 3RXEA 3EQ0H 3ZVBA 1AN1E 2BD7A 3MU4A 1VJAU 4DGJA 3F9HA 3BG4B 5LPFA 1FY8E 1GJCB 3HKIB 3NKKA 3MNCA 4X2WA 3VB5A 1GL1A 4BAKB 7GCHG 1HAXB 4GPGA 4A7IB 1WOFA 2SNWA 1LQEA 4Z6AH 2WINI 5T6GA 4MDSA 4RKOB 3A8BA 5JBAS 2OD3B 1ZHMA 2C90B 3RC5A 1QCPA 1XMNB 3Q3YA 1D3DB 1GBTA 5LPRA 1RTKA 1W7GH 1HAVA 2YNAA 2OXSA 1UTPA 4AFSA 1ELFA 4A6LA 4D76A 2H9TH 2QIQA 1SMFE 1Y3UA 1N6XA 1AIXH 1BUIA 3E90B 4GHQA 5EQQA 2FPZA 3ZZCA 1K22H 4MPXA 1SC8U 1QJ7B 3PMAB 3Q3XA 1GI1A 2ZDNA 1ACBE 4CRBA 1CA8B 1CHOG 3F6UH 5JDUB 1CSOE 1EPTB 1OWHA 4Y8ZA 2GZ7A 2I6SA 1FMGA 4ABBA 7KMEH 2VIWA 3MO6A 3BEFB 3C27B 3SNEA 4AYVB 1YCPH 2J2UA 2BDYA 2XBYA 1B7XB 6CHAC 1N8OB 2CF8H 1ANDA 2V6NA 1SHHB 3SJ8A 1EB2A 2F9PA 2TGDA 1A3BH 2IOTA 2HNTC 3GCTG 3TJNA 2JETB 5L2ZH 1P57B 1LCYA 3L33A 4LXBH 1QB9A 1TWXB 2XWAA 1EAWA 4WXVA 1RRKA 3TH3H 2G5NA 1WSSH 1J9CH 1MQ6A 3LH3A 2BY6X 4RSPA 1P2KA 2PUXB 1V2TT 1O35A 2ZG0H 2PLXA 3ATMA 1K1NA 3QUMP 3FFGA 1V2ST 5C1UA 1O34A 1A0JA 2R2MB 3EE0B 5T6FA 4X8TH 2VVUA 1GI4A 2VH0A 1O2SA 3E1XB 1OOKB 1H8DH 4JCNA 4MLFB 4B71A 1UJ1A 2V0BA 4IN2A 4GCHG 2BX4A 3PO1C 1XUKA 2C4FH 1ZPZA 2ZFSA 1NN6A 1K1PA 1C2MA 1NRSH 1GL0E 3CS0A 3ITIA 1DICA 1Q2WA 1KXAA 4H42U 1C5UA 1MMJN 1P05A 1VITF 5T6DA 1TBZH 1GGDB 1WUNH 4B74A 3HKJB 1ZGVA 1E0FD 4CH8B 3GY3A 4B2BA 2HWLB 1OWKA 5B6OA 3MNXA 1FONA 1MTSA 1HAGE 1E37B 2PKAA 1ELTA 1ZHPA 2BY8X 5C67A 1DUAA 1DS2E 1DWDH 1C2LA 4NSVA 1MCVA 3W94A 2NU4E 2ZHDA 1UK2A 2A4OA 4JYTA 1J17T 1IAUA 2Z3CA 1WCZA 2Y82A 1O3HA 1YM0A 1BJVA 2EEKA 1NFYA 3SBKA 1MTNB 4K69A 1QJ6B 4XDEA 1KTTB 2PUQH 1JRTA 1O3NA 3ODDA 5JBBS 3TLOA 1F5LA 4M7GA 1O3JA 2OC7A 2AGEX 1MCTA 4ZKRU 1BRAA 1DSUA 1V2WT 5EPYA 3BTKE 5AVDA 1C2JA 3RU4D 4ZXYH 3L3TA 3SNDA 1HV7A 1NRQH 1YF4A 1O2GH 1TYNA 2BVRH 4AG2A 1SBWA 1AGJA 1TFXA 2GDEH 3RXKA 2Z3EA 2G55A 2A45B 3ATWA 2ZDAH 3SUFA 1EX3A 2XTTB 3SV7A 4A1VA 3IITA 1DXWA 3BTQE 1YC0A 3GYLB 1D3TB 1W13U 1NESE 2BDAA 2RDLA 1UK4A 3LDXH 5TCAA 2RA0A 2WV5A 1C5PA 1TE0A 2ZI2H 2CHAB 3M5MA 1QA0A 2ZCKP 5FPYA 4AFQA 2G51A 3PWBA 2PW8H 5C3NA 1C5RA 5C5NA 2Z9IA 5A0BA 2AMDA 1EZXC 1EQ9A 3ZZ5A 1GHWH 1TALA 1O3EA 2FS9A 5ETXA 2SGQE 4WJG2 5EXMA 1HJAB 2NU2E 3LONA 1XUJA 1TRNA 3MO3A 1EB1H 1Y3WA 1GBAA 1ZMLA 1EZQA 3F9EA 2W7SA 3UIRA 3VB7A 2FO9A 1A5GH 4WY3A 2BD3A 3LKWA 3A81A 1Y3XA 1KXBA 2ZF0H 3NK8A 3ZV9A 3TJUA 2TRMA 1AHTH 1MKXK 1HAVB 1C2GA 4DURA 1ESTA 4WWYA 4B1TA 3Q3KA 4YOIA 4IGDA 2FXRA 2GV7A 1TQ0B 4B2AA 1RIWB 4BAOB 1O5FH 1ZHRA 4K8BA 1A61H 2XYAA 3TNTA 3ZZBA 2IPHA 1W10U 2VVCA 4ISOA 2H2ZA 2FLBH 2G5VA 4BAHB 1JIRA 1OWDA 3PLPA 1CT2E 1A0LA 1SL3A 4FU8A 1THRH 2BVSH 2BLWA 1O2QA 1O0DH 4IMQA 4X1SU 1OWJA 2WPLS 1G37A 3A87A 1VGCC 3G01A 3ZZ7A 4WH6A 4NA8A 3U1JB 1GI2A 1U6QA 1TGTA 3EA8A 2F9NA 2P3TB 4ZHLU 1YPJH 1AQ7A 4AN7A 3GCTF 4YT7H 2AIPA 3TPIZ 3ATIA 1ELGA 5GCHF 4BOHA 4BANB 2C8ZB 1LVYA 1O31A 5GXPA 5PTPA 2FESH 1GI6A 1GHVH 8GCHF 1YPKH 1WQSA 1WQVH 3MU8A 3D65E 4R8TB 1GJ5H 4MVNA 4Q80A 1SOZA 1GPZA 1SGCA 1DY9A 1TMUH 1P0SH 2GVFA 1K2I1 2PSXA 4F49A 1DLKB 4DOQA 4ABAA 4NZLA 3M36A 3SV9A 1YP9A 4CRFA 1PPFE 1FDPA 1FV9A 5FCKA 2O8MA 3C1KA 1TQ7B 1P04A 5EPNA 3NXPA 5C2ZA 2FYRA 4NFEA 2ODQA 4O9VA 1T31A 4DT7B 1V2VT 1C4V2 4KTCA 2XCFA 1ZLRA 1XXFA 1M9UA 4INHA 3SQEE 2A2QH 2P8OC 3ZYDA 4DIHH 2F91A 1NFXA 4JYVH 1HAPH 1O3IA 1UCYH 2Z9GA 2G4TA 2WYGA 2D2DA 2P3UB 3IG6B 4E7RG 4I8JA 1F0SA 4LZ1H 1CA0B 1BOQA 3P8NA 1Q3XA 4OS2A 1F0TA 2SFAA 4XSKU 2ANKH 3QZQA 2ZFRH 3PTBA 3P8OA 1O3FA 3MMGA 6ESTA 3HATH 1L1GA 2UWLA 2D1JA 2AERH 1A7SA 1GCDA 1ZJKA 2V3HH 1O3LA 2Z7FE 2ZFPH 3RP2A 2CXVA 3TITA 2GMTB 1HCGA 2IN2A 1GHAF 1QL8A 1LPZB 1W14U 1TGNA 3GY2A 2AMPA 3SU5A 4AGJA 1EJMA 2A32A 3SU1A 1FZZA 3A7XA 1O39A 2PKSC 3KQBA 3NWUA 3KQEA 4NGAH 3GDSA 5J4QA 3RLYH 2ODYB 1BMNH 2NU0E 6GCHF 2UWOA 2NU3E 3D62A 4NWLA 3DFLA 4UONA 1SG8B 2BY7X 4R0IA 1YBWA 4FXGH 1D6RA 1T8OA 1EPTA 4XOJA 9ESTA 3VGCC 4ZROA 1S0QA 1SB1H 4PROA 1FUJA 2IJOB 2FX6A 1S82A 2OC8A 1SGDE 2ANYA 1HFDA 2ZU2A 1VCWA 1Y5BT 2BLVA 2ZNKH 1MH0A 1GBFA 4XFQA 5E0GA 2J34A 3AAVA 2ZP0H 1ZMJA 3BEIB 2UUYA 4X8UH 1IQEA 2ZU3A 1O2LA 2TBSA 2WUCA 3O8CA 1K1IA 4OS4A 2FOMB 1NU7B 1GVLA 2STBE 4BTTB 4FVBA 3M5LA 4OS7A 2EI8A 1HXFH 2ZDLA 4IBLH 3SV8A 2ZCHP 1DDJA 1VCQA 1AVWA 3RXGA 1PPZA 1GHYH 1GI3A 3SN8A 1E36B 1LO6A 1H8IH 5GJ4B 2GV6A 1C5OH 3SUEA 1NU9A 2C3SA 4JK6A 1V2NT 2P93A 5DP4A 2BB4A 2PFEA 5FPTA 1TGCA 1KXCA 1YGCH 3T26A 4B2CA 1SLVB 4CRAA 1ANEA 2ZECA 2BDHA 4YLQH 3MOCA 1HIAB 2PGBB 8LPRA 4AGKA 4TY7A 5F03A 3UNQA 1E34B 3KL6A 3SORA 5ABWA 3GISB 1GBHA 1IQLA 3RC4A 4K1SA 1FLEE 1Z7KA 4DY7B 1ZR0A 2FM2A 1NM6A 3MH7A 3U8OH 2V35A 1QURH 4JZEH 2ZGBH 1LTOA 2P59A 2H5DA 2FIRH 3WY8A 3RXJA 1S6HA 2G8TA 4JK5A 2OCVB 1FIZA 3LOXA 1GBKA 3FVFB 4NIWA 1ELVA 2GZ8A 3LIWA 5L6NH 1ZRBA 4FUFA 3LJJA 1HPGA 3M37A 1OS8A 1NZQH 3MU0A 3STJA 1MKWH 1RFNA 1CGIE 1C2FA 2ZU4A 2FOHA 4Y0ZE 3EA9A 4ISLA 3LJOA 3Q77A 2B8OH 3NCLA 1FAXA 4HFPB 4YT6H 3ENSB 4K1TA 4CRGA 1XKBC 1K1LA 4A1TA 4DIIH 1ZSKA 3F9FA 4FUEA 1H4WA 2D8WA 1HJ8A 1D9IA 5DO4H 1EJNA 3V3MA 1PPGE 1V2RT 1MUEB 1KDQB 1P2MA 1G3EA 1QBVH 1N1LA 1GMDG 4X6OA 4ISHH 1F7ZA 2ZHWH 1GG6B 1L2EA 1O3BA 3I29A 2ILNA 4NIXA 1H9LB 2PV9B 1TX8A 1UTLM 5GWZA 4YTAA 1FY4A 3EAJA 1AUTC 2J9NA 1D3QB 1GBEA 4TWWA 2FTLE 3PYHA 2FOGA 1C5LH 1MQ5A 3SJOA 2FP7B 4IS5A 1YCPM 1UTNA 5DK1A 2WPIS 1T32A 5SGAE 1PFXC 1D6WA 2HALA 1P02A 2F9OA 3GY8A 1C1SA 1L4DA 1Z1IA 1O3CA 3SO3A 3PV4A 3RXPA 1LHGH 5L30H 1QB6A 4HI3A 1O2OA 1SHYA 2FTMA 1VGCB 1P06A 4CRCA 3E8LA 4NIVA 1V2KT 2SGDE 1KLIH 3RM0H 3UY9A 1Z8GA 5AF9H 4X6PA 3E0NB 2A1DB 1DWBH 4WXIA 1Y3VA 1ZTLA 4ISNA 3AW0A 1ELCA 2PR3A 3M3TA 4MPUA 1QBOA 3HK6B 3B23B 5FHTA 3TK5A 2FOFA 3RXCA 1AB9B 2D26C 1P9SA 2FOEA 4CR9A 4ABEA 1AFQC 2QF3A 2AIQA 4TPYA 1C1PA 1EATA 2ZQ2A 2A7JA 1IQHA 4I8GA 1A5HA 1NFUA 3B8JA 2KAIB 1W2KH 5JYIA 4HZHA 4FUGA 2VIQA 3A89A 3TJOA 1GBIA 1EP6A 1TB6H 4U30A 1SFQB 2RG3A 1TOCB 3JZ2B 1YPHE 4H4FA 2I6QA 5A0AE 3ATLA 3A7ZA 4SGBE 4O03A 2FOBA 4Q7ZA 2QXJA 4AZ2B 1HUTH 1X7AC 4J1YA 1TRMA 3RMLH 2BZ6H 3TGKE 2BD8A 4Y11E 1O3AA 2ZKSA 3P8GA 3P92A 2C8WB 2XC0A 2ZGCA 1T4UH 2ZTYA 1DSTA 1UTMA 1O5AB 2P8OB 3FP8E 4FU9A 4GUXA 1L1NA 3GDUA 1MU8B 1BRBE 2OBQA 1J14A 5DP3A 1O2IA 2XW9A 2GGVB 1V2MT 2BQ7B 5GCHG 1Z71A 3MHWU 3MYWA 1RTLA 1O2RA 3SNBA 1TNLA 1P3EA 4YZUA 5DP5A 2ASUB 2VIDA 1WTGH 8GCHG 4NFFA 3V13A 4MNYA 2UUKB 1SGQE 2A4RA 1QA7A 1W3CA 2G81E 5F6MA 3LC5A 4U2WA 1CU1A 2VJ1A 1NRNH 1SQTA 5C1XA 2Y81A 4ZH8A 1XM1A 4E05H 1UTJA 2C8XB 5ESBA 2TGPZ 2ZEBA 3ZVDA 3U69H 3A8DA 1GI0A 5IYTA 2AEIH 1WV7H 4KGAA 5FPSA 2A4QA 2O9QA 1GWAA 3PLKA 4AFUA 3FAOA 1WYKA 1O38A 5AFYH 1A3EH 2BDCA 2ZHQH 1SGYE 4NSYA 4NZQA 1PPEE 1K9OE 1AMHA 1GMHF 2BD9A 2ZU5A 4GVUA 1RGQA 3KHVA 1P2NA 2SGFE 5K7RA 5E2OA 2A5AA 2VGCC 1P01A 1C5QA 1AVGH 1DE7H 1O5DH 4AB9A 4ZKOU 1MKXH 1CBWC 2Q6GA 2BDIA 3A7VA 1BTXA 2G52A 1BBRH 1F0UA 3H7TA 4D9QA 1CT0E 1SGFA 2H6MA 1K1JA 5G4BA 4VGCC 1O5EH 1NTPA 1AD8H 5FBEA 1TPOA 1O2WA 1EAUA 2P16A 4Y6DA 1P8VC 3RXVA 3SHAH 3GOVB 4K5ZA 1SGEE 1TMTH 1AI8H 1G36A 1EOLA 2A5KA 1BMAA 1GHAG 3SGQE 1PYTD 1L1JA 1C1NA 1ZMNA 1GDUA 4MNWA 1C5YB 1GBJA 1SOTA 2BDGA 1UCYE 1Y5UT 5K0HA 1ORFA 3S0NA 6GCHG 2ZGJA 3ESTA 1GMDF 3PLBA 2Q6DA 1DANH 3M7TA 4KP0A 1UTOA 2XC5A 1YCPK 1ZGIA 1CGHA 2ULLA 2VINA 3GCHC 1C1WH 5AFZH 1INCA 2QN5T 1QGFA 1S0RA 3P70B 1GDQA 5EQRA 4INKA 1O30A 3STIA 1B0EA 5E2PA 1DUEA 1C4U2 1XKAC 2HNTF 3SJIA 4X2VA 3RXMA 5J4SA 1ETTH 4AYYB 1O5CB 1P9UA 1C5TA 1G32B 1AVXA 1ARBA 3GYMA 2PTCE 2XXLA 1DFPA 3M7QA 4KTSA 1W8BH 3MU1A 1HAHH 2FDAA 3P8FA 1YKTA 5DJ7A 1HYLA 1BRUP 1FNIA 1SVPA 3FZZA 1ETSH 4NA9H 4D7GA 1ZJDA 3DT0H 3KEEA 1O2KA 2AMQA 1O5GH 2W26A 4CR5A 1QQUA 1C9PA 1Z1JA 2GD4B 1MZDA 2F9BH 5LPEA 2H9HA 4WMDA 1OSSA 1UVTH 3PWCA 3FP6E 4Y7BA 4D9RA 1AUJA 2JH0D 1HIAA 1WBGB 3T5FH 1GBMA 3M7UA 1KTSB 1CHGA 2BX3A 3TH2H 1KYNA 3P6ZB 1GMCF 4BAQB 1DY8A 3O8BA 2ZDVH 2GCTC 3DHKH 3GY6A 1BT7A 5HM9A 4KTUA 1OWEA 1Y8TA 3MTYA 1FN8A 2PWXA 4DVAU 3UOUA 1JBUH 2SGAA 1XUGA 4WVPE 1ZOMA 2PGQB 3NPSA 4Y10E 1MBMA 3UR6A 3DA9B 1C5NH 4LZ4B 2HNTE 1ANCA 4CHAC 1HAYB 2R0LA 2TGAA 1EXFA 3V12A 2F83A 1EUFA 2FYQA 1SGRE 2R9PA 4OS1A 1UVPA 2FZZA 1OXGA 1AE5A 1O37A 1TRYA 2FODA 1OPHB 2BY9X 2AGGX 3BG4C 3QGJA 1F5KU 2Y7ZA 1V2PT 5DP9A 1ELEE 1Z8RA 1UVSH 1A2CH 1DITH 3S7HB 3M3VA 1FY5A 1ESAA 3M3SA 1DLEA 1IQJA 3SZNA 3MH4A 4U32A 1SI5H 2ZU1A 2FLRH 3RMMH 2R2WU 1YPMH 1BA8B 3TU7H 3GCNA 1O2MA 2W3IA 1GBDA 1HAOH 4FU7A 3JZ1B 3T2NA 2OINA 3AASA 1JRSA 1GJ9B 2BTCE 2QGRA 4WMFA 1V2LT 1KDQA 1A5IA 3PTNA 4MPWA 3P95A 3M5NA 2YOLA 3UQVA 1O2PA 1G2LA 1QTFA 1O3GA 1H9IE 1AKSA 2XCNA 3K9XB 5EODA 1QHRB 1W0YH 1VZQH 4MPVA 5HYOA 1UHBA 2CMYA 3BTDE 3QGNB 3HGPA 3KGPA 3M5OA 2FWWA 3MO9A 5FX5A 3ZVGA 3V7TA 1BITA 1J16A 1Z6JH 2J4IA 4BXSA 5FBIA 5GPIB 2VIPA 3RXAA 3ZZDA 1LPKB 1THPB 2GP9B 5F8ZA 2QXIA 4A1XA 1N8OC 1P03A 1OP8A 3QTVH 4UFFH 3BG8A 2YNBA 6CHAB 1ELAA 1EAIA 1C4Y2 1SLUB 2O8TA 1Z8JB 2BOHB 2JETC 5TCCA 1KXFA 5CHAC 2O8LA 3UREA 5IDKA 2OQ5A 1KLTA 3CENA 3SJKA 3F1SB 1MTWA 2AYWA 2JH5D 4F4OC 3S7KB 3RLWH 2M5TA 3ODFA 3BV9B 3VB6A 1GI5A 1H9HE 1TIOA 4Y76A 4AB8A 2BZAA 2KAIA 1O3DA 1NS3A 1BQYA 1O2XA 3NZIA 5GDSH 1PQ7A 1NRPH 2JH6D 1O3KA 2FOAA 4AFZA 2WPHS 3LGYA 3O8DA 3A84A 1VCPA 3QZRA 1OYTH 1SLWB 2QYIA 3M35A 5C20A 4ZKSU 1HJ9A 2ZFQH 4IMZA 4Y71A 1FPCH 3PO1B 3KIDU 3S69A 1NROH 1P09A 2EA3A 1GVKB 4JZ1A 1D4PB 2QV1A 1P10A 4UFDH 1C5ZB 4IW4E 3UOPA 5DGJA 3A8AA 2ZGXH 1TX7A 3UWJH 5JB8S 1GGDC 3BTME 2CJIA 1MU6B 3H5CB 1A0HB 4UDWH 4H6SB 1B0FA 1V2UT 1IQNA 3OX7U 5TJXA 3RXRA 1PPHE 2ZO3H 2ZFFH 4I33A 2VGCB 1P3CA 1BTYA 1HAIH 2Y80A 4LK4A 1GJ6A 2Z6BD 1Z8IB 3E16B 2O8WA 5EXNA 1TMBH 1P2QA 3A8CA 1KXEA 1W11U 1NC6A 1ETRH 3SW2B 3VPKA 2AS9A 4VGCB 2BD5A 1OYQA 2STAE 4CH2B 1B5GH 1BTUA 1MTNC 1Y3YA 2OLGA 3U8RH 2DE9A 1N6YA 5F8TA 3RDZA 2R3UA 3EYDA 2BVXH 2P3FH 1C2KA 1ABJH 5HM2A 1PQ8A 1C1OA 3EGKH 5BPEA 5I25A 2A5IA 4BTUB 1VR1H 2GZ9A 3U1IB 1O2YA 1C2IA 1DX5M 3PM3A 2ZPQA 1J8AA 1IHSH 1BB0B 1DWCH 2GX4A 2B9LA 2HPPH 3NUMA 1J15A 3SQHE 1L4ZA 3SNCA 1TBQH 1GMHG 4FVDA 4KELA 2FI3E 1C1UH 1W12U 1TPPA 2A7CA 3SHCH 3LGUA 4JZFH 5FAHA 3GCHB 1QIXB 4Y8XA 1EOJA 2RA3A 4Q7YA 2VWLA 1EKBB 2CHAC 2H9EH 4NA7A 1BJUA 1TNIA 4ZMAH 2VU8E 2OQUA 4ABDA 1GJ7B 2R0KA 2F3CE 1HGTH 4ZHAA 3I78A 1O2VA 1QL9A 3KQCA 3ZZ8A 2VH6A 1F2SE 4FUDA 1BHXF 2ZGHA 3QX5H 4JYUH 1FQ3A 3OU0A 1O3MA 3UR9A 4ABJA 1GJ8B 2OTVA 1ZPBA 2BXTH 4CBNA 5HMAA 3SGBE 4FUHA 3UFAA 2Q1JA 2CF9H 3AW1A 1YLCA 4I8LA 5E0JA 1A46H 1MZAA 1TGSZ 2W5EA 2QCYA 1P12E 1C2HA 4NWKA 3U98H 1LVMA 2ALPA 3BTGE 1UMAH 1BBRE 3A80A 1AO5A 3E3TA 4MNXA 2AH4X 1RIWC 3RU4T 3T28A 4OS5A 5BRRE 3A82A 2A2XH 2BQWB 3KF2A 1AKSB 7LPRA 2OBOA 3RMNH 3MNSA 1UHBB 2Y7XA 1SGFG 3U8TH 1O3PB 5EOKA 1MTUA 2QA9E 3BF6H 3DUXH 3MU5A 2R3YA 2GTBA 3MH5A 1TAWA 1LHEH 1FIWA 2A0QB 1O36A 4GHTA 2FEQH 4BXWA 3KQDA 1V2JT 3T62A 1C1QA 2QY0B 4CHAB 4XBCA 3MI4A 3B9FH 4AOQA 3RXBA 1O5BB 1OP2A 2GCHF 4I8HA 1NO9H 1LMWB 2QXHA 3SUGA 1ZPCA 1F0RA 4H6TA 1CQQA 1YYY1 1GVZA 5LGOA 4X2YA 3F68H 2Z3DA 1TABE 3A7TA 2SNVA 1YPGH 1MAXA 3PMJA 1C1MA 2H5CA 3A86A 3T27A 2ZWLH 2VNTA 2DUCA 1GHZA 3SU6A 1HXEH 5CE1A 3T25A 1NPMA 3GICB 1DT2A 4JZIA 2Y5GA 1ESBA 2VWNA 2FS8A 1GMCG 4NG9H 4XBDA 1IHTH 2NWNA 3O8RA 2NU1E 3VXEH 1OKXA 2WPKS 3E0PB 1HAZB 1XUFA 4O3TA 4E06H 1E38B 3ZYEA 5A0CA 2K1QA 2ZTXA 1BTWA 5E8EH 1OX1A 1GJBB 1YPLH 3U9AH 4BTIB 3RMOH 1LVOA 1PPBH 1WU1A 1G3BA 3URDA 5EU8A 1S83A 5A8XA 3BTWE 3CP7A 3OSYA 1XX9A 1FI8A 8KME2 1FY3A 1V3XA 1TPAE 1MKWK 1GJ4H 3LGIA 3FP7E 4X1RU 1SLXB 1SGPE 1TNGA 1AZ8A 2GT8A 1BZXE 4I8KA 5HGGA 3R3GB 1QJ1B 3H7OA 1CA0C 4XE4A 3OY6U 3LGWA 5CMXH 2BHGA 1FXYA 4WH8A 4Y7AA 3SV2H 2FMJA 4YOJA 2BMGB 3PMBB 1O2TA 1SSXA 5EG4A 2UUJB 3UTUH 3RXFA 1IQMA 3LU9B 3BTFE 1RJXB 2GMTC 2OC1A 2ZDKA 4HGCA 1AE8H 4K60A 5CHAB 3K65B 2XBWA 2UUFB 3ZZ3A 6LPRA 1AZZA 4ESTE 2DE8A 3GY5A 4OS6A 4TPIZ 1BHXB 1XXDA 3HK3B 4QT8C 4RKJB 1K1OA 1O2UA 2A31A 1NT1A 2W3KA 4MTBA 2PKSB 1V2QT 1CO7E 5JBTA 3VXFH 1TA2A 3ZVFA 4D7FA 3HGNA 1FAKH 1D3PB 4CBOA 3SV6A 4CREA 1AU8A 4ABIA 2HRVA 2QC2A 5FXLA 1UVOA 1HBTH 2F9UA 1G3CA 4RN6A 3VGCB 1C5MD 1HB0B 4YO9A 3AVZA 1UK3A 4X1PU 1GHBG 3F9GA 3FANA 1LHDH 3VEQB 3S9CA 4IN1A 1EZSC 5GIBA 1TA6A 1G30B 1GCTC 1FY1A 2A7HA 4Y79A 1CT4E 1F5RA 1C5VA 1O33A 1O2NA 1IQIA 3QLPH 1TPSA 1K1MA 2XC4A 4ZUHA 1FN6A 1PJPA 3AAUA 3Q76A 2BD4A 1EASA 2TIOA 2GDDA 1ZSLA 3V0XA 1DWEH 1C1TA 2J92A 1C2EA 3N7OA 2J94A 1IOEA 5JB9S 3RXIA 1ID5H 3LT3A 1S84A 2XRCA 4UD9H 4THNH 1T8MA 3HPTB 2XNIA 1SGIB 1O2JA 1ELBA 1QR3E 3VB4A 1ZZZA 1P2IA 4Q7XA 1HDTH 2ZQ1A 5A8YA 1VJ9U 2THFB 7ESTE 2VVVA 3PB1E 4A92A 2ANMH 3RXSA
chains in the Genus database with same CATH superfamily
1FJSA 3TGJE 1BCUH 2FX4A 1IQFA 1TX6A 3LGTA 2PSYA 3MQKC 1ZTJA 1RD3B 3T29A 4MG3A 2A4GA 1Z6EA 3S9BA 2ZPRA 3LH1A 1QQ4A 4O3UA 4UE7H 4FETA 2ZHFH 4ZHMU 1TBRH 2BDBA 5DKMA 2EI6A 4BAMB 4ZAEA 4I31A 1EFRD 4NCYA 3L6PA 1C1RA 1SR5C 2XNDD 4YOGA 5EQSA 2ZC9H 3SUDA 1CVWH 2BOKA 1QBNA 5L2YH 1LKBA 5DG6A 3W95A 2ZA5A 8ESTE 2ANWA 4IC5A 1XVOA 5HIYA 4AG1A 5A2MH 4KKDA 5C17A 1GI7B 1BMMH 1SGNE 1P2OA 1RTFB 4TWYA 4I7YH 1ARCA 1PYTC 2XWBI 1WTHD 7GCHF 4MQAA 3ZZAA 1JWTA 1JMOH 3UQOA 3P17H 4XBBA 1KY9A 1TLDA 3SU0A 1GI9B 1NRRH 1C5WB 1AFEH 3SNAA 1ZSJA 2B7DH 3MWIU 4J2YB 1T8NA 3SGAE 3TK6A 3F0PA 4X1QU 1SGTA 3MNBA 1RS0A 5FCRA 1MD8A 3GY7A 1YLDA 5FL7D 4AORA 3TIUA 3UNSA 3DFJA 4ZXXH 1PPCE 3BIUH 2CGAA 1HLTH 1Q31A 1SFIA 1V2OT 1XUHA 2B5TB 2FI5E 3QTOH 4WF8A 2G00A 3MFJA 1GG6C 3MH6A 1BTHH 2RCEA 3DSGA 1BBRK 5FX6A 3RXQA 2HVYB 4I32A 1KSNA 2J95A 4DW2U 4FUJA 1XUIA 1OWIA 3BTHE 3RXDA 2PP6A 1CHOF 1AY6H 1LPGB 1UVUH 2JJ2D 1Y59T 1PQ5A 5EW2H 2Z9LA 2W6ID 3ZVCA 3LC3A 4ASHA 4CRDA 1BTPA 4K3JA 3ZV8A 3RM2H 1GBCA 2P94A 1ELDE 1E1QD 2K8IA 1C1VH 1K28D 5B6LA 5A09A 1ZYOA 2UWPA 4E7NA 5DN6D 1QL7A 2WUBA 4ISIH 2EC9H 3GCOA 3KCGH 3A83A 3SU4A 5F8XA 4X0WU 3OTJE 1AB9C 4OGYA 3TK9A 3S9AA 3OYPA 3QO6A 4X8SH 1O3OA 2ZPSA 3BTEE 4GSOA 1BMLA 5EXLA 1AFQB 2W7UA 1KXDA 4ABGA 5DSFA 3I77A 4X6NA 2B0FA 4TSFD 2Z94A 3QN7A 5E0HA 3CS7A 1JIMA 3UNRA 5AHGH 3SU3A 1GJDB 3LGVA 4GCHF 2BY5X 3K6ZA 4YLUA 4TYDA 1MAYA 1EPTC 2C8YB 2LNCA 1GHBF 2ZHEH 1O2ZA 1WAYB 2ZDMA 4ABHA 1H8HD 1LQDB 2QF0A 4XRNA 2XBVA 2HPQH 3SI3H 3GDVA 1LDTT 4ACAA 4DJZB 3TGIE 1L0ZA 4INLA 2GCHG 2ODPA 3DCLA 3SU2A 3E91A 1T7CA 2Q6FA 5ESTE 1G3DA 1MBQA 2VIOA 3EA7A 1GBLA 2WV4A 2V3MA 1T8LA 5JBCS 1GBBA 1S81A 3UUZA 3GY4A 3KNXA 2BLQA 2PKAB 1H1BA 3N7DA 1VITH 4JZDH 3A88A 1NY22 2HOBA 1RXPA 4BNRA 3D23A 4X6MA 5DP7A 5HIZA 1A4WH 1O2HA 2SGPE 1GI8B 1Y5AT 4ABFA 1C5XB 2P95A 3D49H 2F9VA 1G9IE 2QAAA 2ZCLP 1IQGA 2BD2A 4LOYH 1GJAB 1P11E 2G4UA 3SJ9A 1NFWA 2ESTE 3UPEA 1MD7A 4X2XA 2VWMA 4X1NU 9LPRA 3RXTA 1TNKA 2VIVA 1JXPA 3RXUA 3ZVAA 4B73A 4Q63A 5H4IB 2Z9KA 2VWOA 1QRZA 3URCA 1QY6A 2AFQB 4Q4LA 5HXFA 3ZZ9A 1XVMA 3K2UA 4IC6A 2BQ6B 2C93B 3TVJB 1TOMH 3A7WA 4YM9A 3RC6A 4DG4A 5DP6A 2VB0A 1S85A 1E35B 1G2MA 1LHFH 3M61U 1TNJA 2WPMS 1LKAA 5C1YA 3R0FA 3TH4H 1MTVA 4D8NA 1AWFH 1TONA 1W7XH 1CBWB 1S6FA 3RU4E 3WWFA 3FZDA 1GCTB 1F92A 1LHCH 3ELAH 4NIYA 2CV3A 2H1UA 1YPHC 1OP0A 3PRBA 4TY6A 4B75A 1S5SA 1DPOA 5T3HA 1C2DA 4SGAE 1GDNA 1O32A 2O8UA 4Y8YA 4OGXA 2BYAX 2ALVA 3DD2H 1GHXH 3PROA 1EZUC 1C9TA 4ZKNU 1IQKA 3BN9A 2TPIZ 4RT1A 2J38A 5C0UA 2HLCA 5DP8A 3QWCH 1ZTKA 1YPEH 4ACBA 2BM2A 1UCYK 3PMHB 1A1RA 2YMSB 1ANBA 2TGTA 2ZTZA 1ZRKA 1HNEE 4Z0KA 1SQAA 3QDZB 2BXUH 5KGOA 2QXGA 3UAIC 4YESB 2JKHA 2BLOA 1BIOA 4B76A 1CGJE 4K1EA 3VFEA 5I46H 4DCDA 2L74A 4Y0YE 3VB3A 3BIVH 1KIGH 2HGTH 2FI4E 3QK1A 2WYJA 1DVAH 2OC0A 3F2FA 1BRCE 3SOSA 3RUOA 2LP6A 2Y6TA 2WPJS 2LPRA 5A8ZA 1VITG 3OY5U 3SI4H 2AGIX 3BSQA 4FUCA 2HVXA 3A7YA 1JOUB 1QRWA 4FUIA 1DM4B 2PTNA 1TGBA 1SQOA 3KQ5A 3NRLA 5EGMA 1QFKH 5C94A 1HJAC 1EJAA 3K6YA 1FPHH 1W0JD 3RXOA 1W0ZU 2CN0H 4UFEH 4K8YA 3TNSA 1PQAA 2GKVE 3ZZ6A 1BDAA 2ZFTA 1LVBA 2IPQX 3KN2A 1EAXA 1DOJA 2Y5HA 4WMEA 4Q2KA 5JPMH 1EP5A 3A85A 4X8VH 1AWHB 1HRTH 4HTCH 4K2YA 4GAWA 4MNVA 4UEHH 3EDXB 1UTQA 3RXHA 3ZZ4A 3ATKA 3LPRA 1QB1A 2FOCA 3IWMA 2ZZUH 4O97A 1CE5A 2GCTB 2OUAA 3Q00A 2EI7A 1ABIH 3E6PH 5DPAA 3BTTE 1TNHA 2SGEE 5C5OA 4A5TS 1UO6A 2Z9JA 5EW1H 1C5SA 2ZIQH 5LH8A 1THSH 2JJ1D 4FUBA 1BTZA 2PHBA 2OP9A 1UTKA 2XBXA 1SPJA 3RXLA 1T4VH 3BEUA 1QNJA 1V6DA 3ZVEA 4AX9H 3UWIA 3TJVA 1K21H 2Y5FA 2V3OH 1P2JA 4GLYA 4UFGH 1QRXA 2GT7A 4JMYA 4U01A 1KLJH 1DXPA 3RXEA 3EQ0H 3ZVBA 1AN1E 2BD7A 3MU4A 1VJAU 4DGJA 3F9HA 3BG4B 5LPFA 1FY8E 1GJCB 3HKIB 3NKKA 3MNCA 4X2WA 3VB5A 1GL1A 4BAKB 7GCHG 1HAXB 4GPGA 4A7IB 1WOFA 2SNWA 1LQEA 4Z6AH 2WINI 5T6GA 4MDSA 4RKOB 5EJ1A 3A8BA 5JBAS 2OD3B 1ZHMA 2C90B 3RC5A 1QCPA 1XMNB 3Q3YA 1D3DB 1GBTA 5LPRA 1RTKA 1W7GH 1HAVA 2YNAA 2OXSA 1UTPA 4AFSA 1ELFA 4A6LA 4D76A 2H9TH 2QIQA 1SMFE 1Y3UA 1N6XA 1AIXH 1BUIA 3E90B 4GHQA 5EQQA 2FPZA 3ZZCA 1K22H 4MPXA 1SC8U 1QJ7B 3PMAB 3Q3XA 1GI1A 2ZDNA 1ACBE 4CRBA 1CA8B 3VG8A 1CHOG 3F6UH 5JDUB 1CSOE 1EPTB 1OWHA 4Y8ZA 2GZ7A 2I6SA 1FMGA 4ABBA 7KMEH 2VIWA 3MO6A 3BEFB 3C27B 3SNEA 4AYVB 1YCPH 2J2UA 2BDYA 2XBYA 1B7XB 6CHAC 1N8OB 2CF8H 1ANDA 2V6NA 1SHHB 3SJ8A 1EB2A 2F9PA 3N99A 2TGDA 1A3BH 2IOTA 2VBCA 2HNTC 3GCTG 3TJNA 2JETB 2K0QA 5L2ZH 1P57B 1LCYA 3L33A 3OAAD 4LXBH 1QB9A 1TWXB 2XWAA 1EAWA 4WXVA 1RRKA 3TH3H 2G5NA 1WSSH 1J9CH 1MQ6A 3LH3A 2BY6X 4RSPA 1P2KA 2PUXB 1V2TT 1O35A 2ZG0H 2PLXA 3ATMA 1K1NA 3QUMP 3FFGA 2QF5A 1V2ST 5C1UA 1O34A 1A0JA 2R2MB 3EE0B 5T6FA 4X8TH 2VVUA 1GI4A 2VH0A 1O2SA 3E1XB 1OOKB 1H8DH 4JCNA 4AC9A 4MLFB 4B71A 1UJ1A 2V0BA 4IN2A 4GCHG 2BX4A 3PO1C 1XUKA 2C4FH 1ZPZA 2YMSD 2ZFSA 1NN6A 1K1PA 1C2MA 1NRSH 1GL0E 3CS0A 3ITIA 1DICA 1Q2WA 1KXAA 4H42U 1C5UA 1MMJN 1P05A 1VITF 5T6DA 1TBZH 1GGDB 1WUNH 4B74A 5CHBA 1QZ8A 3HKJB 1ZGVA 1E0FD 3EE7A 4CH8B 3GY3A 4B2BA 2HWLB 1OWKA 5B6OA 3MNXA 1FONA 1MTSA 1HAGE 1E37B 2PKAA 1ELTA 1ZHPA 2BY8X 5C67A 1DUAA 1DS2E 1DWDH 1C2LA 4NSVA 1MCVA 3W94A 2NU4E 2ZHDA 1UK2A 2A4OA 4JYTA 1J17T 1IAUA 2Z3CA 1WCZA 2LELA 2Y82A 1O3HA 1YM0A 2WSSD 1BJVA 2EEKA 1NFYA 3SBKA 1NBME 1MTNB 4K69A 1QJ6B 4XDEA 1KTTB 1VKYA 1JRTA 2PUQH 1O3NA 3ODDA 3PV2A 5JBBS 3TLOA 1F5LA 4M7GA 1O3JA 2AGEX 2OC7A 1MCTA 4ZKRU 1BRAA 1DSUA 1V2WT 5EPYA 3BTKE 5AVDA 1C2JA 3RU4D 4ZXYH 3L3TA 3SNDA 1HV7A 1NRQH 1YF4A 1O2GH 1TYNA 2BVRH 4AG2A 1SBWA 1AGJA 1TFXA 2GDEH 3RXKA 2Z3EA 2G55A 2A45B 3ATWA 2ZDAH 3SUFA 1EX3A 2XTTB 3SV7A 4A1VA 3IITA 1DXWA 3OFND 3BTQE 1YC0A 3GYLB 1D3TB 1W13U 1NESE 2BDAA 2RDLA 1UK4A 3LDXH 5TCAA 2RA0A 2WV5A 2KX4A 1C5PA 1TE0A 2ZI2H 2CHAB 3M5MA 1QA0A 2WV9A 2ZCKP 5FPYA 4AFQA 2G51A 3PWBA 2PW8H 5C3NA 2EY4C 1C5RA 5C5NA 2Z9IA 5A0BA 2AMDA 1EZXC 2OK5A 1EQ9A 3ZZ5A 1GHWH 1TALA 1O3EA 2FS9A 5ETXA 2SGQE 4WJG2 5EXMA 1HJAB 2NU2E 3LONA 1XUJA 1TRNA 3MO3A 1EB1H 1Y3WA 1GBAA 1ZMLA 1EZQA 3F9EA 2W7SA 3UIRA 3VB7A 2FO9A 1A5GH 4WY3A 2BD3A 3LKWA 3A81A 1Y3XA 1KXBA 2ZF0H 3NK8A 3ZV9A 3TJUA 1OHHD 1AHTH 2TRMA 3F2HA 1MKXK 1HAVB 1C2GA 4DURA 1ESTA 4WWYA 4B1TA 3Q3KA 4YOIA 4IGDA 1WDIA 4YXWD 2FXRA 2GV7A 1TQ0B 4B2AA 1RIWB 4BAOB 1O5FH 1ZHRA 4K8BA 1A61H 2XYAA 2KFWA 3TNTA 3ZZBA 2IPHA 1W10U 2VVCA 4ISOA 2H2ZA 2FLBH 2G5VA 4BAHB 1JIRA 1OWDA 3PLPA 1CT2E 1A0LA 1SL3A 4RI0A 4FU8A 1THRH 2BVSH 2BLWA 1O2QA 1O0DH 4IMQA 4X1SU 1OWJA 2WPLS 1G37A 3A87A 1VGCC 3G01A 3ZZ7A 4WH6A 4NA8A 3U1JB 1GI2A 1U6QA 1TGTA 3EA8A 2F9NA 2P3TB 4ZHLU 1YPJH 1AQ7A 2QE7D 1UW7A 4AN7A 3GCTF 4YT7H 2AIPA 3TPIZ 3ATIA 1ELGA 5GCHF 4BOHA 4BANB 2C8ZB 1LVYA 1O31A 5GXPA 5PTPA 2FESH 1GI6A 1GHVH 8GCHF 1YPKH 1WQSA 1WQVH 3MU8A 3D65E 4R8TB 1FX0B 1GJ5H 4MVNA 4Q80A 1SOZA 1GPZA 1SGCA 1DY9A 1TMUH 1P0SH 2GVFA 1K2I1 2PSXA 4F49A 1DLKB 4DOQA 4ABAA 4NZLA 3M36A 3SV9A 1YP9A 4CRFA 1PPFE 1FDPA 1FV9A 5FCKA 2O8MA 3C1KA 1TQ7B 1P04A 4FOUC 5EPNA 1KMHB 3NXPA 5C2ZA 2FYRA 4NFEA 2ODQA 4O9VA 1T31A 4DT7B 1V2VT 1C4V2 2HLDD 4KTCA 2XCFA 1ZLRA 1SQRA 1XXFA 3ZIAD 1M9UA 4INHA 3SQEE 2A2QH 2P8OC 3ZYDA 4DIHH 2F91A 1NFXA 4JYVH 5F53A 1HAPH 1O3IA 3WWBA 1UCYH 2Z9GA 2G4TA 2WYGA 2D2DA 2P3UB 3IG6B 4E7RG 4I8JA 1F0SA 2J5UA 4LZ1H 1CA0B 1BOQA 3P8NA 4Z1MD 1Q3XA 4OS2A 1F0TA 2SFAA 4XSKU 2ANKH 3QZQA 2ZFRH 3PTBA 3P8OA 4XD7D 1O3FA 3MMGA 6ESTA 3HATH 1L1GA 2UWLA 2D1JA 2AERH 1A7SA 1GCDA 1ZJKA 2V3HH 1O3LA 2Z7FE 2ZFPH 3RP2A 2CXVA 3TITA 2GMTB 1HCGA 2IN2A 1GHAF 1QL8A 1LPZB 1W14U 1TGNA 3GY2A 2AMPA 3SU5A 4AGJA 1EJMA 2A32A 2AHME 3SU1A 1FZZA 3A7XA 1O39A 2PKSC 3KQBA 3NWUA 3KQEA 4NGAH 3GDSA 5J4QA 3RLYH 2ODYB 1BMNH 2NU0E 6GCHF 2UWOA 2NU3E 3D62A 4NWLA 3DFLA 4UONA 1SG8B 2BY7X 4R0IA 1YBWA 4FXGH 3U28C 1D6RA 1T8OA 1EPTA 4XOJA 9ESTA 3VGCC 4ZROA 1S0QA 1SB1H 4PROA 1FUJA 2IJOB 2FX6A 1S82A 2OC8A 1SGDE 2ANYA 1HFDA 2ZU2A 1VCWA 1Y5BT 2BLVA 2ZNKH 1MH0A 1GBFA 4XFQA 5E0GA 3PV5A 2J34A 3AAVA 2ZP0H 1ZMJA 3BEIB 3KYFA 2UUYA 4X8UH 5T1VA 1IQEA 2ZU3A 1O2LA 2TBSA 2WUCA 3OE7D 3O8CA 1K1IA 4OS4A 2FOMB 1NU7B 1GVLA 1W0KD 2STBE 4BTTB 4FVBA 2J97A 3M5LA 4OS7A 2EI8A 1HXFH 2ZDLA 4IBLH 3SV8A 2ZCHP 1DDJA 1VCQA 1AVWA 4P02A 3RXGA 1PPZA 1GHYH 5GNDA 1GI3A 3SN8A 1E36B 1LO6A 1H8IH 5GJ4B 2GV6A 1C5OH 3SUEA 1NU9A 2M2AA 2C3SA 4JK6A 1V2NT 2P93A 5DP4A 2BB4A 2PFEA 5FPTA 1TGCA 1KXCA 1YGCH 3T26A 4B2CA 1SLVB 4CRAA 1ANEA 2ZECA 2BDHA 4YLQH 3MOCA 1HIAB 2PGBB 8LPRA 4AGKA 4TY7A 5F03A 3UNQA 1E34B 3KL6A 3SORA 5ABWA 3GISB 1GBHA 1IQLA 3RC4A 4K1SA 1FLEE 1Z7KA 4DY7B 1ZR0A 1WXRA 2FM2A 1NM6A 3MH7A 3U8OH 1NBMD 2V35A 1QURH 4JZEH 2ZGBH 1LTOA 2P59A 2H5DA 2FIRH 3WY8A 3RXJA 1S6HA 2G8TA 4JK5A 2OCVB 1FIZA 3LOXA 2WZQA 1GBKA 3FVFB 4NIWA 1ELVA 2GZ8A 3LIWA 4RT0A 5L6NH 1ZRBA 4FUFA 3LJJA 1HPGA 3M37A 1OS8A 1NZQH 3MU0A 3STJA 1MKWH 1RFNA 1CGIE 1C2FA 2ZU4A 2FOHA 4Y0ZE 3EA9A 4ISLA 3LJOA 3Q77A 2B8OH 3NCLA 3OEHD 1FAXA 4HFPB 4YT6H 3ENSB 4K1TA 4CRGA 1XKBC 1K1LA 4A1TA 4DIIH 1ZSKA 3F9FA 4FUEA 1H4WA 1YWUA 2D8WA 1HJ8A 1D9IA 5DO4H 1EJNA 3V3MA 5HKKD 1PPGE 1V2RT 1MUEB 1KDQB 1P2MA 1G3EA 1QBVH 1N1LA 1GMDG 4X6OA 4ISHH 1F7ZA 2ZHWH 1GG6B 1L2EA 1O3BA 3I29A 2ILNA 4NIXA 1H9LB 2PV9B 2RDEA 1TX8A 1UTLM 5GWZA 4YTAA 1FY4A 3EAJA 3WW7A 1AUTC 2J9NA 1D3QB 1GBEA 4TWWA 2FTLE 3PYHA 2FOGA 1C5LH 1MQ5A 3SJOA 2FP7B 4IS5A 1YCPM 1UTNA 5DK1A 2WPIS 1T32A 5SGAE 1PFXC 1D6WA 2HALA 1P02A 2F9OA 4F55A 3GY8A 1C1SA 1L4DA 1Z1IA 1O3CA 3SO3A 3PV4A 3RXPA 1LHGH 5L30H 1QB6A 4HI3A 1O2OA 1SHYA 2FTMA 1VGCB 1P06A 4CRCA 3E8LA 4NIVA 1V2KT 2SGDE 1KLIH 3RM0H 3UY9A 1Z8GA 5AF9H 4X6PA 3E0NB 2A1DB 1DWBH 4WXIA 1Y3VA 2J98B 1ZTLA 4ISNA 3AW0A 1ELCA 2KCOA 2PR3A 3M3TA 4MPUA 1QBOA 3HK6B 3B23B 5FHTA 3TK5A 2FOFA 3RXCA 1AB9B 2D26C 1P9SA 2FOEA 4CR9A 4ABEA 1AFQC 2QF3A 2AIQA 4TPYA 1C1PA 1EATA 2ZQ2A 2A7JA 1IQHA 4I8GA 1A5HA 1NFUA 3B8JA 2KAIB 1W2KH 5JYIA 4HZHA 4FUGA 2VIQA 3A89A 3TJOA 1GBIA 1EP6A 1TB6H 4U30A 1SFQB 2RG3A 1TOCB 3JZ2B 1YPHE 4H4FA 2I6QA 1K0HA 5A0AE 3ATLA 3A7ZA 4SGBE 4O03A 2FOBA 4Q7ZA 2QXJA 4AZ2B 1HUTH 1X7AC 4J1YA 1TRMA 2KZ4A 3RMLH 2BZ6H 3TGKE 2BD8A 4Y11E 1O3AA 2ZKSA 3P8GA 3P92A 2C8WB 2XC0A 2ZGCA 1T4UH 2ZTYA 1DSTA 1UTMA 1O5AB 2P8OB 3FP8E 4FU9A 4F48B 4GUXA 1L1NA 3GDUA 1MU8B 1BRBE 2OBQA 1J14A 5DP3A 1O2IA 2XW9A 2GGVB 1V2MT 2BQ7B 5GCHG 1Z71A 3MHWU 3MYWA 1E79D 1RTLA 1O2RA 3SNBA 1TNLA 1P3EA 4YZUA 5DP5A 4ASUD 2ASUB 2VIDA 1WTGH 8GCHG 4NFFA 3V13A 4MNYA 2UUKB 1SGQE 2A4RA 1QA7A 1W3CA 2G81E 5F6MA 3LC5A 4U2WA 1CU1A 2VJ1A 1NRNH 1SQTA 5C1XA 2Y81A 4ZH8A 1XM1A 4E05H 1UTJA 2C8XB 5ESBA 2TGPZ 2ZEBA 4B6FA 3ZVDA 3U69H 3A8DA 1GI0A 5IYTA 2AEIH 1WV7H 4KGAA 5FPSA 2A4QA 2O9QA 1GWAA 3DSPA 3PLKA 4AFUA 3FAOA 1WYKA 1H8ED 1O38A 5C0TA 5AFYH 1A3EH 2BDCA 2ZHQH 1SGYE 4NSYA 2EQNA 4NZQA 1PPEE 1K9OE 1AMHA 1GMHF 2BD9A 2ZU5A 4GVUA 1RGQA 3KHVA 3FN8A 5IK2D 1P2NA 2SGFE 5K7RA 2XOKD 5E2OA 2A5AA 2VGCC 1P01A 1C5QA 1AVGH 1DE7H 1O5DH 4AB9A 4ZKOU 1MKXH 1CBWC 2Q6GA 1BMFD 2BDIA 3A7VA 1BTXA 2G52A 1BBRH 1F0UA 3H7TA 4D9QA 1CT0E 1SGFA 2H6MA 1K1JA 5G4BA 4VGCC 1O5EH 1NTPA 1AD8H 5FBEA 1TPOA 1O2WA 1EAUA 2P16A 4Y6DA 1P8VC 3RXVA 3SHAH 3GOVB 4K5ZA 3H09A 1SGEE 1TMTH 1AI8H 1G36A 1EOLA 1E1RD 2A5KA 1BMAA 1GHAG 3UB0A 3SGQE 1PYTD 1L1JA 1C1NA 1ZMNA 1GDUA 4MNWA 1C5YB 1GBJA 1SOTA 2BDGA 1UCYE 1Y5UT 5K0HA 1ORFA 3S0NA 2YMSC 6GCHG 2ZGJA 3ESTA 1GMDF 3PLBA 2Q6DA 1DANH 3M7TA 4KP0A 1UTOA 2XC5A 1YCPK 1ZGIA 1CGHA 2ULLA 2VINA 3GCHC 1C1WH 5AFZH 1INCA 2QN5T 1QGFA 1S0RA 3P70B 1GDQA 5EQRA 2KCPA 4INKA 1O30A 4B6EA 2QF4A 3STIA 1B0EA 4M9FA 5E2PA 1DUEA 1C4U2 1XKAC 2HNTF 3SJIA 4X2VA 3RXMA 5J4SA 1ETTH 4AYYB 1O5CB 1P9UA 1C5TA 1G32B 1AVXA 1ARBA 3GYMA 2PTCE 2XXLA 1DFPA 3M7QA 4KTSA 1W8BH 3MU1A 1HAHH 2FDAA 3P8FA 1YKTA 5DJ7A 1HYLA 1BRUP 1FNIA 1SVPA 3FZZA 1ETSH 4NA9H 4D7GA 1ZJDA 3DT0H 3KEEA 1O2KA 2AMQA 1O5GH 2W26A 4CR5A 1QQUA 1C9PA 1Z1JA 2GD4B 1MZDA 2F9BH 5LPEA 2H9HA 1YY3A 4WMDA 1OSSA 1UVTH 3PWCA 3FP6E 4Y7BA 4D9RA 1AUJA 2JH0D 1HIAA 1WBGB 3T5FH 1GBMA 3M7UA 1KTSB 1CHGA 2BX3A 3TH2H 1KYNA 3P6ZB 1GMCF 4BAQB 1DY8A 3O8BA 2ZDVH 2GCTC 3DHKH 3GY6A 1BT7A 5HM9A 4KTUA 1OWEA 1Y8TA 3MTYA 1FN8A 2PWXA 4DVAU 3UOUA 1JBUH 2SGAA 1XUGA 4WVPE 1ZOMA 2PGQB 3NPSA 4Y10E 1MBMA 3UR6A 3DA9B 1C5NH 4LZ4B 2HNTE 1ANCA 4CHAC 1HAYB 2R0LA 2TGAA 1EXFA 3V12A 2F83A 1EUFA 2FYQA 3OTPA 3N7EA 1SGRE 2R9PA 4OS1A 1UVPA 2FZZA 1OXGA 1AE5A 1O37A 1TRYA 2FODA 1OPHB 2BY9X 2AGGX 3BG4C 3QGJA 1F5KU 2Y7ZA 1V2PT 5DP9A 1ELEE 1Z8RA 1UVSH 1A2CH 1DITH 3S7HB 3M3VA 1FY5A 1ESAA 3M3SA 1DLEA 1IQJA 3SZNA 3MH4A 4U32A 1SI5H 2ZU1A 2FLRH 3RMMH 2R2WU 1YPMH 1BA8B 3TU7H 3GCNA 1O2MA 2W3IA 1GBDA 1HAOH 4FU7A 3JZ1B 3T2NA 2OINA 2F4LA 3AASA 1JRSA 1GJ9B 2BTCE 2QGRA 4WMFA 1V2LT 1KDQA 1A5IA 3PTNA 4MPWA 3P95A 3M5NA 1YLNA 2YOLA 3UQVA 1O2PA 1G2LA 1QTFA 1O3GA 1H9IE 1AKSA 2V7QD 2XCNA 3K9XB 5EODA 1QHRB 1W0YH 1VZQH 2JIZD 4MPVA 5HYOA 1UHBA 2CMYA 3BTDE 3QGNB 3HGPA 3KGPA 3M5OA 4OM9A 2FWWA 3MO9A 5FX5A 3ZVGA 5EJZA 3V7TA 1BITA 1J16A 1Z6JH 2J4IA 4BXSA 5FBIA 5GPIB 2VIPA 3RXAA 3ZZDA 1LPKB 1THPB 2GP9B 5F8ZA 2QXIA 4A1XA 1N8OC 1P03A 1OP8A 3F0OA 3QTVH 4UFFH 3BG8A 2YNBA 6CHAB 1ELAA 1EAIA 2J98A 1C4Y2 1SLUB 2O8TA 1Z8JB 2BOHB 2JETC 5TCCA 1KXFA 5CHAC 2O8LA 3UREA 5IDKA 2OQ5A 3FO8D 1KLTA 3CENA 3SJKA 3F1SB 1MTWA 2AYWA 2JH5D 4F4OC 3S7KB 3RLWH 2M5TA 3ODFA 3BV9B 3VB6A 1GI5A 1H9HE 1TIOA 4Y76A 4AB8A 2BZAA 2KAIA 1O3DA 1NS3A 1BQYA 3CNRA 1O2XA 3NZIA 5GDSH 1PQ7A 1NRPH 2JH6D 1O3KA 2FOAA 4AFZA 2WPHS 3LGYA 3O8DA 3A84A 3W1EA 1VCPA 3QZRA 1OYTH 1SLWB 2RFKC 2QYIA 3M35A 5C20A 5EIYA 4ZKSU 1HJ9A 2ZFQH 4IMZA 4Y71A 1FPCH 3PO1B 3KIDU 3S69A 1NROH 1P09A 2EA3A 1GVKB 4JZ1A 1D4PB 2QV1A 1P10A 4UFDH 1C5ZB 4I86A 4IW4E 3UOPA 5DGJA 3A8AA 2ZGXH 1TX7A 3FOAA 3UWJH 5JB8S 1GGDC 3BTME 2CJIA 1MU6B 3H5CB 1A0HB 4UDWH 4H6SB 1B0FA 1V2UT 1IQNA 3OX7U 5TJXA 3RXRA 1PPHE 2ZO3H 2ZFFH 4I33A 2VGCB 1P3CA 1BTYA 2CK3D 1HAIH 1S6LA 2Y80A 1GJ6A 4LK4A 2Z6BD 1Z8IB 3E16B 2O8WA 5EXNA 1TMBH 1P2QA 3A8CA 1KXEA 1W11U 3SZEA 1NC6A 1ETRH 3SW2B 3VPKA 2AS9A 4VGCB 2BD5A 1OYQA 2STAE 4CH2B 1B5GH 1BTUA 1MTNC 1Y3YA 2OLGA 3U8RH 2DE9A 5EJLA 1N6YA 5F8TA 3F2GA 3RDZA 2R3UA 3EYDA 2BVXH 2P3FH 1C2KA 1ABJH 5HM2A 1PQ8A 1C1OA 3EGKH 5BPEA 5I25A 5KEDA 2A5IA 4BTUB 1VR1H 2GZ9A 3U1IB 1O2YA 1C2IA 1DX5M 2KCYA 3PM3A 2ZPQA 1J8AA 1IHSH 1BB0B 1DWCH 2GX4A 2B9LA 2HPPH 3NUMA 1J15A 3SQHE 1L4ZA 3SNCA 1TBQH 1GMHG 4FVDA 4KELA 2FI3E 1C1UH 1W12U 1TPPA 2A7CA 4HG6A 3LGUA 4JZFH 4TT3D 3SHCH 3GCHB 5FAHA 1QIXB 4Y8XA 1EOJA 2RA3A 4Q7YA 2VWLA 1EKBB 2CHAC 2H9EH 4NA7A 1BJUA 3SYJA 1TNIA 4ZMAH 2VU8E 2OQUA 4ABDA 1GJ7B 2R0KA 2F3CE 5CDFE 1HGTH 4ZHAA 3I78A 1O2VA 1QL9A 3KQCA 3ZZ8A 2VH6A 1F2SE 4FUDA 1BHXF 2ZGHA 3QX5H 4JYUH 1FQ3A 3OU0A 1O3MA 3UR9A 4ABJA 1GJ8B 2OTVA 1ZPBA 2BXTH 4CBNA 5HMAA 3SGBE 4FUHA 3UFAA 2Q1JA 2CF9H 3AW1A 1YLCA 4I8LA 5E0JA 1A46H 1MZAA 1TGSZ 5KECA 2W5EA 2QCYA 1P12E 1C2HA 1MABB 4NWKA 3KYGA 3U98H 1LVMA 2ALPA 3BTGE 1UMAH 1BBRE 3A80A 1AO5A 3E3TA 4MNXA 4DT4A 2AH4X 1RIWC 3RU4T 3T28A 4OS5A 5BRRE 3A82A 2A2XH 2BQWB 3KF2A 1AKSB 7LPRA 4P00A 2OBOA 3RMNH 3MNSA 1UHBB 2Y7XA 1SGFG 3U8TH 1O3PB 5EOKA 1MTUA 2QA9E 3BF6H 3DUXH 3MU5A 2R3YA 2GTBA 3MH5A 1TAWA 1LHEH 1FIWA 2A0QB 1O36A 4GHTA 2FEQH 4BXWA 3PRDA 3KQDA 1V2JT 3T62A 1C1QA 2QY0B 4CHAB 4XBCA 3MI4A 3B9FH 4AOQA 3RXBA 1O5BB 1OP2A 2GCHF 4I8HA 1NO9H 1LMWB 2QXHA 3SUGA 1ZPCA 1F0RA 4H6TA 3AK5A 1YYY1 1CQQA 1GVZA 5LGOA 4X2YA 3F68H 3OEED 2Z3DA 1TABE 3A7TA 2SNVA 1YPGH 1MAXA 3PMJA 1C1MA 2H5CA 3A86A 3T27A 2ZWLH 2VNTA 2W6JD 2DUCA 2WHXA 1GHZA 3SU6A 1HXEH 5CE1A 3T25A 1NPMA 3GICB 1DT2A 4JZIA 2Y5GA 1ESBA 2VWNA 2FS8A 1GMCG 4NG9H 4XBDA 1IHTH 2NWNA 3O8RA 2NU1E 3VXEH 1OKXA 2WPKS 3E0PB 1HAZB 1XUFA 4O3TA 4E06H 1E38B 3ZYEA 4ZCNA 5A0CA 2K1QA 2ZTXA 1BTWA 5E8EH 1OX1A 1GJBB 1YPLH 3U9AH 3FKSD 4BTIB 3RMOH 1LVOA 1PPBH 1WU1A 1G3BA 3URDA 5EU8A 1S83A 2WPDD 5A8XA 2L6OA 3BTWE 3CP7A 3OSYA 1XX9A 1FI8A 8KME2 1FY3A 1V3XA 1TPAE 1MKWK 1GJ4H 3LGIA 3FP7E 4X1RU 1SLXB 1SGPE 1TNGA 1AZ8A 2GT8A 1BZXE 4I8KA 5HGGA 3R3GB 1QJ1B 3H7OA 2F43B 1CA0C 4XE4A 3OY6U 3LGWA 5CMXH 2BHGA 2KCAA 1FXYA 4WH8A 4Y7AA 1SKYE 3SV2H 2FMJA 4YOJA 2BMGB 3PMBB 1O2TA 1SSXA 5EG4A 2KM0A 2UUJB 3UTUH 3RXFA 2JDID 1IQMA 3LU9B 3BTFE 1RJXB 2GMTC 2OC1A 2ZDKA 4HGCA 1AE8H 4K60A 5CHAB 3K65B 2XBWA 2UUFB 3ZZ3A 3GS9A 6LPRA 1AZZA 4ESTE 2DE8A 3GY5A 4OS6A 4TPIZ 1BHXB 1XXDA 3HK3B 4QT8C 4RKJB 1K1OA 1O2UA 2A31A 1NT1A 2W3KA 4MTBA 2PKSB 1V2QT 1CO7E 5JBTA 3VXFH 1TA2A 3ZVFA 4D7FA 3HGNA 1FAKH 1D3PB 4CBOA 3SV6A 4CREA 1AU8A 4ABIA 2HRVA 2QC2A 5FXLA 1UVOA 1HBTH 2F9UA 1G3CA 3DSOA 4RN6A 3VGCB 1C5MD 1HB0B 4YO9A 3AVZA 1UK3A 4X1PU 1GHBG 3F9GA 3FANA 1LHDH 3VEQB 3S9CA 4IN1A 1EZSC 5GIBA 1TA6A 1G30B 1GCTC 1FY1A 2A7HA 4Y79A 1CT4E 1F5RA 1C5VA 1O33A 1O2NA 1IQIA 3QLPH 1TPSA 1K1MA 1COWD 2XC4A 4ZUHA 1FN6A 1PJPA 2KR7A 3AAUA 3Q76A 2BD4A 1EASA 2TIOA 2GDDA 1ZSLA 3V0XA 1DWEH 1C1TA 2J92A 1C2EA 3N7OA 2J94A 1IOEA 5JB9S 3RXIA 1ID5H 3LT3A 1S84A 2XRCA 4UD9H 4THNH 1T8MA 3HPTB 2XNIA 1SGIB 1O2JA 1ELBA 1QR3E 3VB4A 1ZZZA 3F3BA 1P2IA 4Q7XA 2IJD1 1HDTH 2ZQ1A 5A8YA 1VJ9U 2THFB 7ESTE 2VVVA 3PB1E 4A92A 2GJGA 2ANMH 3RXSA
chains in the Genus database with same CATH topology
1FJSA 3TGJE 1BCUH 2FX4A 1IQFA 1TX6A 3LGTA 2PSYA 1ZTJA 1RD3B 3T29A 4MG3A 2A4GA 1Z6EA 3S9BA 2ZPRA 3LH1A 1QQ4A 4O3UA 4UE7H 2ZHFH 4ZHMU 1TBRH 2BDBA 5DKMA 2EI6A 4BAMB 4ZAEA 4I31A 4NCYA 3L6PA 1C1RA 1SR5C 4YOGA 5EQSA 2ZC9H 3SUDA 1CVWH 2BOKA 1QBNA 5L2YH 1LKBA 5DG6A 3W95A 2ZA5A 8ESTE 2ANWA 4IC5A 1XVOA 4AG1A 5A2MH 4KKDA 1GI7B 1BMMH 1SGNE 1P2OA 1RTFB 4TWYA 4I7YH 1ARCA 1PYTC 2XWBI 1WTHD 7GCHF 4MQAA 3ZZAA 1JWTA 1JMOH 3UQOA 3P17H 4XBBA 1KY9A 1TLDA 3SU0A 1GI9B 1NRRH 1C5WB 1AFEH 3SNAA 1ZSJA 2B7DH 3MWIU 4J2YB 1T8NA 3SGAE 3TK6A 4X1QU 1SGTA 3MNBA 1RS0A 5FCRA 1MD8A 3GY7A 1YLDA 4AORA 3TIUA 3UNSA 3DFJA 4ZXXH 1PPCE 3BIUH 2CGAA 1HLTH 1Q31A 1SFIA 1V2OT 1XUHA 2B5TB 2FI5E 3QTOH 4WF8A 2G00A 3MFJA 1GG6C 3MH6A 1BTHH 2RCEA 1BBRK 5FX6A 3RXQA 4I32A 1KSNA 2J95A 4DW2U 4FUJA 1XUIA 1OWIA 3BTHE 3RXDA 1CHOF 1AY6H 1LPGB 1UVUH 1Y59T 1PQ5A 5EW2H 2Z9LA 3ZVCA 3LC3A 4ASHA 4CRDA 1BTPA 4K3JA 3ZV8A 3RM2H 1GBCA 2P94A 1ELDE 1C1VH 1K28D 5A09A 1ZYOA 2UWPA 4E7NA 1QL7A 2WUBA 4ISIH 2EC9H 3GCOA 3KCGH 3A83A 3SU4A 5F8XA 4X0WU 3OTJE 1AB9C 4OGYA 3TK9A 3S9AA 3OYPA 3QO6A 4X8SH 1O3OA 2ZPSA 3BTEE 4GSOA 1BMLA 5EXLA 1AFQB 2W7UA 1KXDA 4ABGA 3I77A 4X6NA 2B0FA 2Z94A 3QN7A 5E0HA 3CS7A 1JIMA 3UNRA 5AHGH 3SU3A 1GJDB 3LGVA 4GCHF 2BY5X 3K6ZA 4YLUA 4TYDA 1MAYA 1EPTC 2C8YB 2LNCA 1GHBF 2ZHEH 1O2ZA 1WAYB 2ZDMA 4ABHA 1LQDB 2QF0A 2XBVA 2HPQH 3SI3H 3GDVA 1LDTT 4DJZB 3TGIE 1L0ZA 4INLA 2GCHG 2ODPA 3SU2A 3E91A 1T7CA 2Q6FA 5ESTE 1G3DA 1MBQA 2VIOA 3EA7A 1GBLA 2WV4A 1T8LA 5JBCS 1GBBA 1S81A 3UUZA 3GY4A 3KNXA 2BLQA 2PKAB 1H1BA 1VITH 4JZDH 3A88A 1NY22 2HOBA 1RXPA 4BNRA 3D23A 4X6MA 5DP7A 1A4WH 1O2HA 2SGPE 1GI8B 1Y5AT 4ABFA 1C5XB 2P95A 3D49H 2F9VA 1G9IE 2QAAA 2ZCLP 1IQGA 2BD2A 4LOYH 1GJAB 1P11E 2G4UA 3SJ9A 1NFWA 2ESTE 3UPEA 1MD7A 4X2XA 2VWMA 4X1NU 9LPRA 3RXTA 1TNKA 2VIVA 1JXPA 3RXUA 3ZVAA 4B73A 5H4IB 2Z9KA 2VWOA 1QRZA 3URCA 1QY6A 2AFQB 5HXFA 3ZZ9A 1XVMA 3K2UA 4IC6A 2BQ6B 2C93B 3TVJB 1TOMH 3A7WA 4YM9A 3RC6A 4DG4A 5DP6A 2VB0A 1S85A 1E35B 1G2MA 1LHFH 3M61U 1TNJA 2WPMS 1LKAA 5C1YA 3R0FA 3TH4H 1MTVA 4D8NA 1AWFH 1TONA 1W7XH 1CBWB 1S6FA 3RU4E 3FZDA 1GCTB 1F92A 1LHCH 3ELAH 4NIYA 2CV3A 2H1UA 1YPHC 1OP0A 4TY6A 4B75A 1S5SA 1DPOA 5T3HA 1C2DA 4SGAE 1GDNA 1O32A 2O8UA 4Y8YA 4OGXA 2BYAX 2ALVA 3DD2H 1GHXH 3PROA 1EZUC 1C9TA 4ZKNU 1IQKA 3BN9A 2TPIZ 2J38A 2HLCA 5DP8A 3QWCH 1ZTKA 1YPEH 2BM2A 1UCYK 3PMHB 1A1RA 1ANBA 2TGTA 2ZTZA 1ZRKA 1HNEE 4Z0KA 1SQAA 3QDZB 2BXUH 2QXGA 4YESB 2JKHA 2BLOA 1BIOA 4B76A 1CGJE 4K1EA 3VFEA 5I46H 4DCDA 4Y0YE 3VB3A 3BIVH 1KIGH 2HGTH 2FI4E 3QK1A 2WYJA 1DVAH 2OC0A 1BRCE 3SOSA 3RUOA 2Y6TA 2WPJS 2LPRA 5A8ZA 1VITG 3OY5U 3SI4H 2AGIX 3BSQA 4FUCA 2HVXA 3A7YA 1JOUB 1QRWA 4FUIA 1DM4B 2PTNA 1TGBA 1SQOA 5EGMA 1QFKH 1HJAC 1EJAA 3K6YA 1FPHH 3RXOA 1W0ZU 2CN0H 4UFEH 4K8YA 3TNSA 1PQAA 2GKVE 3ZZ6A 1BDAA 2ZFTA 1LVBA 3KN2A 1EAXA 1DOJA 2Y5HA 4WMEA 4Q2KA 5JPMH 1EP5A 3A85A 4X8VH 1AWHB 1HRTH 4HTCH 4K2YA 4GAWA 4MNVA 4UEHH 3EDXB 1UTQA 3RXHA 3ZZ4A 3ATKA 3LPRA 1QB1A 2FOCA 3IWMA 2ZZUH 4O97A 1CE5A 2GCTB 2OUAA 3Q00A 2EI7A 1ABIH 3E6PH 5DPAA 3BTTE 1TNHA 2SGEE 5C5OA 4A5TS 1UO6A 2Z9JA 5EW1H 1C5SA 2ZIQH 5LH8A 1THSH 4FUBA 1BTZA 2PHBA 2OP9A 1UTKA 2XBXA 1SPJA 3RXLA 1T4VH 3BEUA 1QNJA 1V6DA 3ZVEA 4AX9H 3UWIA 3TJVA 1K21H 2Y5FA 2V3OH 1P2JA 4GLYA 4UFGH 1QRXA 2GT7A 4JMYA 4U01A 1KLJH 1DXPA 3RXEA 3EQ0H 3ZVBA 1AN1E 2BD7A 3MU4A 1VJAU 4DGJA 3F9HA 3BG4B 5LPFA 1FY8E 1GJCB 3HKIB 3NKKA 3MNCA 4X2WA 3VB5A 1GL1A 4BAKB 7GCHG 1HAXB 4GPGA 4A7IB 1WOFA 2SNWA 1LQEA 4Z6AH 2WINI 5T6GA 4MDSA 4RKOB 3A8BA 5JBAS 2OD3B 1ZHMA 2C90B 3RC5A 1QCPA 1XMNB 3Q3YA 1D3DB 1GBTA 5LPRA 1RTKA 1W7GH 1HAVA 2YNAA 2OXSA 1UTPA 4AFSA 1ELFA 4A6LA 4D76A 2H9TH 2QIQA 1SMFE 1Y3UA 1N6XA 1AIXH 1BUIA 3E90B 4GHQA 5EQQA 2FPZA 3ZZCA 1K22H 4MPXA 1SC8U 1QJ7B 3PMAB 3Q3XA 1GI1A 2ZDNA 1ACBE 4CRBA 1CA8B 1CHOG 3F6UH 5JDUB 1CSOE 1EPTB 1OWHA 4Y8ZA 2GZ7A 2I6SA 1FMGA 4ABBA 7KMEH 2VIWA 3MO6A 3BEFB 3C27B 3SNEA 4AYVB 1YCPH 2J2UA 2BDYA 2XBYA 1B7XB 6CHAC 1N8OB 2CF8H 1ANDA 2V6NA 1SHHB 3SJ8A 1EB2A 2F9PA 2TGDA 1A3BH 2IOTA 2HNTC 3GCTG 3TJNA 2JETB 5L2ZH 1P57B 1LCYA 3L33A 4LXBH 1QB9A 1TWXB 2XWAA 1EAWA 4WXVA 1RRKA 3TH3H 2G5NA 1WSSH 1J9CH 1MQ6A 3LH3A 2BY6X 4RSPA 1P2KA 2PUXB 1V2TT 1O35A 2ZG0H 2PLXA 3ATMA 1K1NA 3QUMP 3FFGA 1V2ST 5C1UA 1O34A 1A0JA 2R2MB 3EE0B 5T6FA 4X8TH 2VVUA 1GI4A 2VH0A 1O2SA 3E1XB 1OOKB 1H8DH 4JCNA 4MLFB 4B71A 1UJ1A 2V0BA 4IN2A 4GCHG 2BX4A 3PO1C 1XUKA 2C4FH 1ZPZA 2ZFSA 1NN6A 1K1PA 1C2MA 1NRSH 1GL0E 3CS0A 3ITIA 1DICA 1Q2WA 1KXAA 4H42U 1C5UA 1MMJN 1P05A 1VITF 5T6DA 1TBZH 1GGDB 1WUNH 4B74A 3HKJB 1ZGVA 1E0FD 4CH8B 3GY3A 4B2BA 2HWLB 1OWKA 5B6OA 3MNXA 1FONA 1MTSA 1HAGE 1E37B 2PKAA 1ELTA 1ZHPA 2BY8X 5C67A 1DUAA 1DS2E 1DWDH 1C2LA 4NSVA 1MCVA 3W94A 2NU4E 2ZHDA 1UK2A 2A4OA 4JYTA 1J17T 1IAUA 2Z3CA 1WCZA 2Y82A 1O3HA 1YM0A 1BJVA 2EEKA 1NFYA 3SBKA 1MTNB 4K69A 1QJ6B 4XDEA 1KTTB 2PUQH 1JRTA 1O3NA 3ODDA 5JBBS 3TLOA 1F5LA 4M7GA 1O3JA 2OC7A 2AGEX 1MCTA 4ZKRU 1BRAA 1DSUA 1V2WT 5EPYA 3BTKE 5AVDA 1C2JA 3RU4D 4ZXYH 3L3TA 3SNDA 1HV7A 1NRQH 1YF4A 1O2GH 1TYNA 2BVRH 4AG2A 1SBWA 1AGJA 1TFXA 2GDEH 3RXKA 2Z3EA 2G55A 2A45B 3ATWA 2ZDAH 3SUFA 1EX3A 2XTTB 3SV7A 4A1VA 3IITA 1DXWA 3BTQE 1YC0A 3GYLB 1D3TB 1W13U 1NESE 2BDAA 2RDLA 1UK4A 3LDXH 5TCAA 2RA0A 2WV5A 1C5PA 1TE0A 2ZI2H 2CHAB 3M5MA 1QA0A 2ZCKP 5FPYA 4AFQA 2G51A 3PWBA 2PW8H 5C3NA 1C5RA 5C5NA 2Z9IA 5A0BA 2AMDA 1EZXC 1EQ9A 3ZZ5A 1GHWH 1TALA 1O3EA 2FS9A 5ETXA 2SGQE 4WJG2 5EXMA 1HJAB 2NU2E 3LONA 1XUJA 1TRNA 3MO3A 1EB1H 1Y3WA 1GBAA 1ZMLA 1EZQA 3F9EA 2W7SA 3UIRA 3VB7A 2FO9A 1A5GH 4WY3A 2BD3A 3LKWA 3A81A 1Y3XA 1KXBA 2ZF0H 3NK8A 3ZV9A 3TJUA 2TRMA 1AHTH 1MKXK 1HAVB 1C2GA 4DURA 1ESTA 4WWYA 4B1TA 3Q3KA 4YOIA 4IGDA 2FXRA 2GV7A 1TQ0B 4B2AA 1RIWB 4BAOB 1O5FH 1ZHRA 4K8BA 1A61H 2XYAA 3TNTA 3ZZBA 2IPHA 1W10U 2VVCA 4ISOA 2H2ZA 2FLBH 2G5VA 4BAHB 1JIRA 1OWDA 3PLPA 1CT2E 1A0LA 1SL3A 4FU8A 1THRH 2BVSH 2BLWA 1O2QA 1O0DH 4IMQA 4X1SU 1OWJA 2WPLS 1G37A 3A87A 1VGCC 3G01A 3ZZ7A 4WH6A 4NA8A 3U1JB 1GI2A 1U6QA 1TGTA 3EA8A 2F9NA 2P3TB 4ZHLU 1YPJH 1AQ7A 4AN7A 3GCTF 4YT7H 2AIPA 3TPIZ 3ATIA 1ELGA 5GCHF 4BOHA 4BANB 2C8ZB 1LVYA 1O31A 5GXPA 5PTPA 2FESH 1GI6A 1GHVH 8GCHF 1YPKH 1WQSA 1WQVH 3MU8A 3D65E 4R8TB 1GJ5H 4MVNA 4Q80A 1SOZA 1GPZA 1SGCA 1DY9A 1TMUH 1P0SH 2GVFA 1K2I1 2PSXA 4F49A 1DLKB 4DOQA 4ABAA 4NZLA 3M36A 3SV9A 1YP9A 4CRFA 1PPFE 1FDPA 1FV9A 5FCKA 2O8MA 3C1KA 1TQ7B 1P04A 5EPNA 3NXPA 5C2ZA 2FYRA 4NFEA 2ODQA 4O9VA 1T31A 4DT7B 1V2VT 1C4V2 4KTCA 2XCFA 1ZLRA 1XXFA 1M9UA 4INHA 3SQEE 2A2QH 2P8OC 3ZYDA 4DIHH 2F91A 1NFXA 4JYVH 1HAPH 1O3IA 1UCYH 2Z9GA 2G4TA 2WYGA 2D2DA 2P3UB 3IG6B 4E7RG 4I8JA 1F0SA 4LZ1H 1CA0B 1BOQA 3P8NA 1Q3XA 4OS2A 1F0TA 2SFAA 4XSKU 2ANKH 3QZQA 2ZFRH 3PTBA 3P8OA 1O3FA 3MMGA 6ESTA 3HATH 1L1GA 2UWLA 2D1JA 2AERH 1A7SA 1GCDA 1ZJKA 2V3HH 1O3LA 2Z7FE 2ZFPH 3RP2A 2CXVA 3TITA 2GMTB 1HCGA 2IN2A 1GHAF 1QL8A 1LPZB 1W14U 1TGNA 3GY2A 2AMPA 3SU5A 4AGJA 1EJMA 2A32A 3SU1A 1FZZA 3A7XA 1O39A 2PKSC 3KQBA 3NWUA 3KQEA 4NGAH 3GDSA 5J4QA 3RLYH 2ODYB 1BMNH 2NU0E 6GCHF 2UWOA 2NU3E 3D62A 4NWLA 3DFLA 4UONA 1SG8B 2BY7X 4R0IA 1YBWA 4FXGH 1D6RA 1T8OA 1EPTA 4XOJA 9ESTA 3VGCC 4ZROA 1S0QA 1SB1H 4PROA 1FUJA 2IJOB 2FX6A 1S82A 2OC8A 1SGDE 2ANYA 1HFDA 2ZU2A 1VCWA 1Y5BT 2BLVA 2ZNKH 1MH0A 1GBFA 4XFQA 5E0GA 2J34A 3AAVA 2ZP0H 1ZMJA 3BEIB 2UUYA 4X8UH 1IQEA 2ZU3A 1O2LA 2TBSA 2WUCA 3O8CA 1K1IA 4OS4A 2FOMB 1NU7B 1GVLA 2STBE 4BTTB 4FVBA 3M5LA 4OS7A 2EI8A 1HXFH 2ZDLA 4IBLH 3SV8A 2ZCHP 1DDJA 1VCQA 1AVWA 3RXGA 1PPZA 1GHYH 1GI3A 3SN8A 1E36B 1LO6A 1H8IH 5GJ4B 2GV6A 1C5OH 3SUEA 1NU9A 2C3SA 4JK6A 1V2NT 2P93A 5DP4A 2BB4A 2PFEA 5FPTA 1TGCA 1KXCA 1YGCH 3T26A 4B2CA 1SLVB 4CRAA 1ANEA 2ZECA 2BDHA 4YLQH 3MOCA 1HIAB 2PGBB 8LPRA 4AGKA 4TY7A 5F03A 3UNQA 1E34B 3KL6A 3SORA 5ABWA 3GISB 1GBHA 1IQLA 3RC4A 4K1SA 1FLEE 1Z7KA 4DY7B 1ZR0A 2FM2A 1NM6A 3MH7A 3U8OH 2V35A 1QURH 4JZEH 2ZGBH 1LTOA 2P59A 2H5DA 2FIRH 3WY8A 3RXJA 1S6HA 2G8TA 4JK5A 2OCVB 1FIZA 3LOXA 1GBKA 3FVFB 4NIWA 1ELVA 2GZ8A 3LIWA 5L6NH 1ZRBA 4FUFA 3LJJA <