1O5EH

Dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
255
structure length
248
Chain Sequence
IVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFNSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease, hydrolase
molecule keywords Serine protease hepsin
publication title Dissecting and designing inhibitor selectivity determinants at the S1 site using an artificial Ala190 protease (Ala190 uPA).
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 248
sequence length 255
ec nomenclature ec 3.4.21.106: Hepsin.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o5eH01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o5eH02
1KDQB 4DOQA 1C5QA 4UEHH 1P2JA 4FU9A 4FXGH 5DO4H 2PLXA 2P59A 2J34A 1GI3A 3E0NB 3RUOA 4OS4A 3EA8A 2ZQ1A 1EPTC 1CHGA 1K1LA 2ALVA 2VGCC 1KLTA 4ZKRU 2ZGXH 1SLXB 4WXVA 5FBEA 2A5AA 1GHAG 1EAUA 3A88A 2G8TA 2ZZUH 1IQNA 1QB6A 1O3FA 3DUXH 3W95A 5IDKA 3RXMA 3GYLB 1QY6A 1BITA 3RXUA 1DITH 2HRVA 1O36A 2XCFA 3E3TA 2W3KA 3TK5A 4PROA 1HIAA 1C5YB 1HV7A 3BTDE 4YT6H 4JYVH 1YPJH 1EZXC 2BY9X 3A7XA 2W7SA 3VFEA 1FY5A 3QTVH 1EOLA 3I29A 3GY2A 4FUCA 2HNTC 2F9VA 3T25A 3LH1A 1QBNA 2BVSH 3PO1B 4UE7H 2FOMB 5EOKA 4XDEA 2ZCLP 4CH2B 4I8KA 4MG3A 4K8BA 1GVKB 1KLIH 2A7CA 1H4WA 3F9EA 1MH0A 4X1QU 1P9SA 3VB3A 1XUGA 2DE8A 2VIPA 3SZNA 2DUCA 3NZIA 9LPRA 4UDWH 2AERH 4GHTA 1F5RA 1K1JA 2BY6X 3M3SA 2H9EH 5EXMA 1BZXE 1XVOA 1PPCE 1UVOA 2ANWA 4DG4A 1NROH 1OYTH 4WVPE 2VWLA 1T4UH 3Q77A 1DVAH 4KTSA 4I8HA 1BCUH 1KY9A 3VXFH 1SFQB 2XWBI 4RKOB 2P95A 1C5RA 1VJAU 2B5TB 2O8LA 2ILNA 5E0HA 1HIAB 1HAXB 1XXDA 3OY5U 4O3TA 1QL7A 1GBHA 4XBCA 1EJNA 3I78A 3LJOA 4Y71A 1WTGH 1GI1A 3RMNH 3RMMH 1O3EA 4ABBA 1QQ4A 1QRXA 3P70B 1UVSH 1WSSH 3FP6E 1WCZA 3TJUA 1RFNA 1O2WA 4YOIA 1JIRA 1NU7B 5JDUB 2BD4A 2FI5E 1S5SA 2GCTB 3RLWH 4R8TB 3L33A 4J1YA 5E8EH 5FPYA 3LIWA 1DFPA 2HALA 1KXCA 3MI4A 4M7GA 3M5OA 2W3IA 2ZGHA 3ZV9A 1EJAA 1GJCB 5A0AE 1OWEA 2GMTC 3RM0H 2AYWA 4UFGH 3GY6A 1AO5A 2W7UA 4WXIA 2FOFA 1FPCH 5C5NA 1AMHA 1TX8A 1CA0C 1GBKA 1GHBG 3UIRA 2BY8X 1AUJA 4AFQA 3U8TH 2I6SA 3PO1C 3BEUA 3TVJB 1CE5A 1PPHE 1F0RA 2ZFRH 1BJVA 4WH6A 1GCTB 1THSH 1N1LA 1NRSH 2IPHA 3S7HB 2FI3E 1ETSH 1Y3VA 4AN7A 2CN0H 1C1QA 2JETB 2I6QA 2QIQA 1NT1A 5GCHG 1UVTH 3B23B 3PV4A 1O2SA 5FPTA 2A7JA 1ELVA 1ARCA 2AS9A 1YCPM 4HFPB 4K1SA 1V2MT 3DD2H 4B73A 7LPRA 1KTSB 4YLQH 1QNJA 3GISB 3Q3KA 4A7IB 5C1XA 1JMOH 4AFSA 4FUGA 1GL1A 3KF2A 2HLCA 1F7ZA 2NU0E 1DPOA 1AB9B 1MBMA 2ZHFH 1ETTH 3TH3H 2AIPA 5DP3A 3ZZAA 1S83A 1QFKH 2ZA5A 2P94A 3SQHE 4FU7A 1HDTH 2Q6DA 3SN8A 1O33A 2Y82A 1UTOA 1MAYA 3UNSA 2EA3A 2VWNA 1TBZH 1J14A 1PPGE 1YCPK 3ZVCA 2V3HH 1GMCG 3ZZ8A 4ZROA 2XBXA 1K1OA 2C93B 3M35A 2B9LA 3E6PH 2VIWA 1S81A 3SV7A 4NIXA 5JPMH 1NRQH 1TB6H 5LPEA 2FDAA 2VH0A 2Q6GA 2GZ7A 2H9HA 3KQEA 2GCTC 2ODQA 1O31A 3D23A 5C3NA 4B71A 2NU2E 2Z9IA 3BTHE 1TOCB 3JZ1B 2BD7A 1O3JA 2QA9E 3TJVA 1GBEA 1BTYA 4CHAC 2H1UA 4MLFB 9ESTA 1G2LA 4ZKNU 3VB5A 2YNAA 1TWXB 2QY0B 4ESTE 3MWIU 2R3YA 4RN6A 2AH4X 5HMAA 1HXEH 3O8CA 3RXVA 1UVPA 3TH2H 1VR1H 2BXUH 1IQMA 1P06A 5E2OA 4BAMB 1C2LA 1TMBH 1ZHPA 3RXPA 1C2HA 3ZVBA 1SR5C 1ZGVA 3ZZ3A 1SGEE 4FVDA 1GHYH 3AW1A 4D8NA 2ZU1A 5J4QA 2JETC 1NFUA 1UTJA 1P2IA 3S9AA 5LPRA 1DT2A 1P05A 4I8JA 3E1XB 4INHA 1A5HA 2FYQA 1V2WT 3M5MA 1NY22 4BAHB 4CRFA 1SLWB 4K1EA 3UR9A 4VGCB 2C4FH 1WU1A 2BX4A 1FN8A 4NWLA 1AB9C 1O2MA 2GVFA 4YZUA 1XUHA 3FZDA 1TLDA 2V3OH 2A4QA 2ZU3A 3MU5A 3SO3A 3QDZB 1GBAA 4HTCH 4CRCA 1O2YA 3PLPA 1O3OA 3ZZCA 1SGRE 2BOHB 3F9FA 1JIMA 4IC5A 1O2OA 3VB4A 2ZPQA 4LOYH 1GJ7B 2ZU2A 3ZZ4A 5C20A 1YPKH 2G4TA 3MMGA 4UONA 6LPRA 2PKAA 5CMXH 2FOBA 1LVYA 1MZAA 1NRPH 2FI4E 3MNBA 1VITF 1ZRKA 2GCHF 2ZI2H 1FONA 1JBUH 2OUAA 3A7ZA 3ODDA 2TGPZ 3RXJA 4BTIB 1Z7KA 1WYKA 2SGDE 1UTQA 3TK6A 3BTEE 1IHTH 2GKVE 4UFEH 3HK3B 2VINA 4FVBA 2R2MB 2WPKS 4XFQA 1GBDA 3OY6U 1S6FA 3TH4H 2FO9A 2FS9A 2J4IA 4ISLA 1SQTA 1G3DA 3DHKH 1ID5H 1BTXA 2BQ7B 2BDBA 1AZZA 1T31A 1E37B 3HKJB 3MYWA 3LU9B 3EDXB 6ESTA 2UUFB 1XKAC 1O37A 3T27A 3UWIA 1SGNE 3PB1E 1UMAH 1GJ6A 1WTHD 2OBOA 3SV6A 1NTPA 1NRRH 4X2WA 1TGNA 5FAHA 1SLVB 2Z3EA 2C3SA 1SGPE 4X6OA 1QGFA 3ENSB 4YT7H 1SQOA 1O2VA 2D1JA 3GY7A 2P8OB 3URCA 2J95A 2D8WA 2PKAB 2STAE 3M7UA 2AGIX 2RDLA 5GXPA 1OP0A 2OLGA 2XXLA 1UHBB 2FOCA 2SNVA 2B0FA 1SHYA 1GWAA 1SGFG 1UTKA 5T6DA 1CT0E 3K6ZA 1INCA 4VGCC 1P2QA 2G4UA 1T32A 2IJOB 2GZ9A 1FIWA 2A45B 2QCYA 1O3GA 4OS2A 4WH8A 3F9HA 2CGAA 4HZHA 1MBQA 1GBMA 1QTFA 2PW8H 3V13A 2BX3A 2AMPA 1P8VC 4H6TA 4X6MA 3QWCH 1ZSJA 2BQWB 1KXAA 5CHAB 4AGJA 2AEIH 1MZDA 1C5MD 1HFDA 2BB4A 2PV9B 3ESTA 1P2MA 2P93A 1KSNA 2Z6BD 4TPIZ 1ZHMA 2BLOA 3SU1A 4BAKB 1QHRB 2BD2A 1EB1H 1YPHE 1DWCH 4CR9A 3K6YA 4ABDA 2HNTF 1O2PA 1TA2A 3A8CA 2VVUA 1CGIE 3SGQE 5C5OA 1OXGA 2PKSB 1SQAA 1QB1A 1C2GA 1EP5A 1FDPA 3SW2B 3LGYA 2RA3A 1LTOA 1A61H 4I32A 1W13U 2O8MA 5C67A 1EASA 5T6GA 2UWOA 3SBKA 3QZRA 5LGOA 3MNSA 5DP8A 2XWAA 2R2WU 5HYOA 2ZHEH 4JMYA 2BD8A 2WPJS 5FBIA 1Y59T 5FHTA 1KXEA 1HCGA 5G4BA 1UTLM 1DOJA 5FX6A 3LT3A 1EZQA 4INKA 1GBTA 1V2ST 3LKWA 1TA6A 3T26A 1TYNA 1ZTJA 2RA0A 2A1DB 4NGAH 1O3PB 1D3PB 2ZDVH 1Y5AT 4FUDA 2ZU5A 4MQAA 3MO9A 1YC0A 4BTUB 1HAOH 1O2JA 1AFEH 4X1NU 1L4ZA 1ZPCA 2P8OC 4U32A 1NESE 2F9BH 1NRNH 4NFFA 1SGQE 1GBBA 1SLUB 3MO6A 5E2PA 3S7KB 3UOUA 1O2RA 5EXNA 2Z94A 1MTNB 3MU4A 3RXBA 2F9PA 2BLQA 5AHGH 2P16A 3LGTA 4DVAU 2FWWA 1NO9H 1BUIA 1GVLA 3LGUA 3LPRA 1P12E 3BTGE 3D65E 4GUXA 5ESTE 5IYTA 3RC5A 3RXOA 2BVXH 1GHWH 5AFYH 1B5GH 1IQHA 5JBBS 1LVOA 3ODFA 2WINI 1UTNA 3PROA 1C1MA 4SGAE 4K2YA 5FX5A 4NZQA 4XBDA 1HJ8A 1Y3YA 4Q80A 1H9LB 1ZMLA 1P57B 5CHAC 1V2QT 2H6MA 1HUTH 2ZFTA 1XKBC 2KAIB 1J8AA 1ZSKA 4SGBE 2TGTA 2R0LA 3EE0B 4BAQB 2FOAA 1V2NT 1RTKA 3T62A 3SNDA 5GJ4B 3M7TA 2ZEBA 4INLA 3SU0A 3MNCA 4Q7YA 3A7VA 4KELA 1ABIH 1HPGA 2ZPRA 3TGIE 1FY8E 2VU8E 2XC5A 1LKAA 1GHZA 2PKSC 4X8UH 4A1XA 4UD9H 1WQSA 3IWMA 1BHXB 1V2JT 2OC8A 1GBFA 1ESAA 3TK9A 2PTNA 3TNTA 3SV9A 3M5LA 1ANBA 3BG4B 1J16A 1GBIA 3VXEH 2F9UA 1W2KH 1RXPA 1RGQA 4FUEA 5DP7A 5I25A 1UK4A 2QAAA 1LHCH 1Z8RA 2OC7A 4NA8A 2ZKSA 4Q7ZA 1CHOG 5DK1A 5A8XA 3STJA 4XBBA 5DKMA 5EXLA 4JZFH 5BRRE 2ZC9H 1C2KA 4Y6DA 2HPQH 1FY4A 1DWEH 1CGHA 4O3UA 2UUKB 3ZVGA 1OWHA 1BBRH 3U8OH 3V0XA 3LJJA 3K2UA 2J9NA 3GDUA 1LDTT 1DWDH 2PHBA 4Y8XA 4NCYA 1S6HA 1TQ0B 1AE8H 1TAWA 3ZZ7A 1A1RA 3LC3A 1SVPA 1QJ6B 1BRUP 1GJ9B 1O2IA 1K1NA 1C9TA 1EX3A 1MTNC 1L1GA 3N7OA 3BEFB 4ISNA 3S9CA 2WPHS 1L1JA 1MKWK 1A3BH 1E36B 1EB2A 2PGBB 2VB0A 1C2EA 3BTWE 5FCKA 4A1VA 5A2MH 1JRSA 5C2ZA 1OWKA 3QO6A 1IQKA 2AIQA 3MU1A 2P3UB 1HAIH 6CHAB 1LPKB 1OP8A 3UQVA 1A46H 2XBWA 2HWLB 2XTTB 3RXCA 3ZZ9A 1GMHF 5EU8A 1D3QB 1FNIA 1S85A 3HGPA 4MPUA 1DS2E 2R9PA 1N8OB 1MD7A 3RXFA 5EGMA 2PFEA 2F9OA 4ZHLU 1A4WH 2A31A 5JYIA 1LHEH 4ZXYH 2VVVA 1CGJE 4ZHMU 5DP5A 4DCDA 1A7SA 3CS0A 1ZLRA 5GDSH 3AVZA 1ZSLA 3GY4A 2VIDA 3RU4D 4CREA 1SGIB 7GCHG 1GI4A 1G3BA 4RSPA 2BD3A 2ANMH 3HK6B 1ZTKA 2QXIA 3SJ8A 2K1QA 4IN2A 3TJOA 3RXGA 1NS3A 1QCPA 1F5LA 2W5EA 4X2VA 3TLOA 4LXBH 1D3DB 3BG4C 1O2ZA 3SNCA 3GCTF 5SGAE 3ZV8A 1HYLA 2FMJA 1C1NA 1SC8U 1MUEB 2G5VA 1YBWA 2OD3B 1ZPZA 4B75A 1C4U2 1P04A 1ELBA 4AG1A 1N6YA 1Z6JH 4IC6A 5A0BA 1DX5M 5HM2A 1NZQH 1DSUA 1HNEE 4DY7B 2BDHA 1SHHB 3VPKA 1SG8B 3BTKE 1PPZA 1D9IA 3RXQA 1ORFA 2WPMS 1LCYA 3RDZA 1AKSB 1CT4E 4MNYA 3RXKA 3SUFA 3SU5A 1Q3XA 1W10U 1GI8B 3SNEA 2OCVB 3JZ2B 3MFJA 1G36A 2CHAB 2O9QA 2Y6TA 2ZQ2A 4WMFA 4UFDH 3RLYH 4MDSA 1H8DH 4QT8C 3UREA 2ZTYA 4ISIH 1CT2E 3URDA 5DPAA 1ELTA 3BSQA 3UFAA 2FS8A 2G81E 3VB6A 1VCQA 1HBTH 3SHCH 1AE5A 3A7WA 1A0HB 1TBQH 1GJ5H 4GCHF 1TNIA 3SU6A 1ESTA 3AW0A 6CHAC 3SJ9A 1W3CA 1MKXH 4AFUA 1GBJA 1DANH 1T8NA 2QN5T 5GWZA 2CV3A 4B76A 1MTSA 1V2OT 2ZFSA 3PTBA 1N8OC 3PLBA 3ZVAA 3A86A 1EXFA 1ACBE 1NC6A 4WY3A 1NFWA 3A8BA 1HAGE 3EA9A 4NWKA 1BTHH 5DP4A 8GCHF 5FPSA 1ABJH 1C2FA 1ELDE 3IITA 2GGVB 3AAVA 3PYHA 3LC5A 3Q00A 3BTQE 2ASUB 1LQEA 3HPTB 1Y5BT 3RMOH 1L2EA 4TPYA 1OWIA 1UK3A 1GG6B 4GSOA 4D76A 2GZ8A 1RD3B 4Y79A 1BDAA 3P8FA 3SUGA 2F3CE 5EQSA 1TPOA 1UCYK 2O8TA 1O5EH 1VGCB 1YPGH 3T5FH 2PTCE 5H4IB 3UWJH 1K22H 4AORA 1C1PA 4MNWA 4ABIA 4CRDA 3WY8A 3P95A 1WOFA 1AFQB 3F1SB 3FP8E 3HATH 3RXDA 1C5NH 2STBE 4D9RA 1QR3E 5F03A 4ZXXH 1GPZA 1TONA 2BDCA 2FESH 3L6PA 4FUBA 5HGGA 4E7RG 4TWWA 1GCTC 1K9OE 4X6NA 1CA8B 2CHAC 1O34A 1EZSC 1VJ9U 3GY5A 1BTWA 2ZCKP 1EP6A 2Y5GA 3NKKA 1HRTH 1YF4A 4ZUHA 1NFXA 1UCYE 6GCHF 1SGFA 1P01A 5GIBA 3OU0A 3MOCA 5C1YA 1TGCA 2QF3A 4IBLH 1O3NA 3EQ0H 1AWHB 3BIVH 4O97A 3RC4A 4NSVA 2HGTH 2OC1A 2ZDAH 1MQ5A 3DT0H 3SJIA 1C5WB 2O8UA 3GCHB 2PSXA 1O5FH 2Z3CA 4E7NA 1O3DA 1D6WA 2A2QH 1IHSH 2A4OA 4ABHA 3A87A 3NWUA 3P8OA 1HB0B 1NPMA 2BM2A 1TRMA 3MNXA 3PWCA 2ZO3H 2CJIA 5I46H 2LNCA 2ZF0H 1YLDA 3PWBA 2RG3A 1ZJKA 4JZEH 2EEKA 2VVCA 2H9TH 2VH6A 4KP0A 7ESTE 3GDSA 1O2QA 3OYPA 1C5PA 2SGQE 2GTBA 1IQEA 1SMFE 1AUTC 3QGJA 3U98H 2D2DA 3A8AA 1GL0E 1UHBA 3BTTE 1OKXA 1W14U 2BLWA 4XSKU 4GAWA 2XW9A 2C90B 1WV7H 2FP7B 1GG6C 5JB9S 1GVZA 1AHTH 1A5GH 2Y5FA 3P6ZB 3D49H 1G37A 1O3AA 3GICB 2SNWA 5EW1H 3SV2H 4GLYA 3BF6H 1W0ZU 1P10A 4I33A 4GVUA 4JZDH 1FJSA 1C5SA 5EQQA 4U2WA 3V7TA 2IN2A 2XC4A 2ZHDA 4AX9H 1O30A 1FN6A 3OX7U 3U69H 1VGCC 1Z6EA 1V2KT 4Z6AH 1C5OH 2FTMA 2ZDLA 4MPWA 3VB7A 3BTME 1PJPA 3ATIA 1QL8A 2GD4B 3KQDA 4Y76A 3NCLA 1AFQC 2Z9KA 2OBQA 2FOEA 2AMDA 1CSOE 2ZDMA 4X1PU 1YGCH 3RXTA 1JOUB 1K2I1 4IMZA 3U1IB 2BVRH 1NU9A 1AIXH 4WF8A 3PMBB 1QJ7B 4XE4A 4DIHH 1EUFA 1PQ7A 2QXJA 1BTZA 1BTUA 1HJAB 1RTLA 2AGGX 4DIIH 1A0JA 1BMNH 2HNTE 4KTUA 3M3VA 2BLVA 2NWNA 5F8TA 1LPZB 3L3TA 4ABGA 4K1TA 2F91A 1ZTLA 4GHQA 3KNXA 1Y3UA 5F8XA 1OWJA 1MTWA 2GX4A 1TNLA 1DICA 2ZTZA 4BNRA 2EI6A 4ABJA 1TALA 3M7QA 4IMQA 1DUAA 2WUCA 1X7AC 2EC9H 1Z8JB 2GDDA 4XOJA 1JXPA 1BMAA 1P09A 3CS7A 3DFJA 5DP6A 4D7GA 7KMEH 8LPRA 1Y8TA 1ZMNA 2PUXB 3ZZBA 1H8IH 1O3KA 3V12A 1K1MA 1LHGH 2FLRH 3HGNA 4MNXA 4JYTA 3MO3A 1GHVH 3DFLA 2ESTE 4F49A 4ISOA 4RKJB 4U01A 3GCOA 2O8WA 2XNIA 1MU8B 3RXSA 5EG4A 1BTPA 1GMDF 2QGRA 2Y81A 8ESTE 2EI7A 1IQLA 4X1SU 1P2KA 4I31A 1BMLA 1ZGIA 2ZECA 4DJZB 4DGJA 5A8YA 5PTPA 2H5CA 3M61U 4AB9A 1GBCA 2YOLA 2A32A 1RTFB 1VITG 2XC0A 1SI5H 2GCHG 2A7HA 2WPLS 1GHAF 1T8OA 1YPMH 2TBSA 1E34B 3P17H 5DJ7A 1SPJA 1GI2A 1FQ3A 3PMJA 2KAIA 4A6LA 1VZQH 1CBWB 2FLBH 1O5DH 3SU2A 1PQAA 3FANA 2C8WB 1FAKH 2TPIZ 2XRCA 4E06H 1GBLA 2SGPE 2NU1E 3U9AH 2ZG0H 1TNKA 2Y5HA 4A5TS 2BDGA 2PWXA 1WQVH 1O2HA 2AMQA 2FX6A 2ZNKH 3SI3H 3ZYEA 1HJAC 1YKTA 1KIGH 1TE0A 2TRMA 1BQYA 5DGJA 1ELEE 3HKIB 3EAJA 2PR3A 3F68H 4ZAEA 4ABFA 1GI6A 3A7YA 1BHXF 3SOSA 5JB8S 4A1TA 1Z1JA 1SGCA 3TU7H 1PQ5A 3RM2H 4B74A 2JH0D 1OS8A 1YCPH 1Z1IA 3T28A 2ANYA 3RXIA 2FEQH 2ANKH 5B6OA 1LHFH 2ZIQH 1RRKA 3LDXH 1AGJA 3QZQA 1ESBA 1B0EA 1GI9B 3H7TA 2AFQB 1FUJA 3R3GB 1BRBE 2FPZA 2PUQH 3QGNB 1GDNA 3UUZA 1FI8A 5HM9A 3SUDA 1MCTA 1W8BH 1C2JA 4K5ZA 2ZWLH 3Q76A 3ZVEA 2F9NA 4MPVA 1CU1A 2QC2A 3UY9A 1C4V2 5JBCS 1OOKB 2OXSA 1HAVA 2BY5X 5ESBA 4DT7B 3KCGH 5GPIB 2Z9JA 1ELAA 4JZ1A 3E91A 1AVXA 2A2XH 5TJXA 1C1RA 1B0FA 1T8LA 3EA7A 1FLEE 1VITH 1E0FD 3MH6A 3S69A 1FIZA 3NPSA 4AOQA 1LVMA 1YPEH 2VIVA 3TGKE 1ANEA 1EAWA 1O5GH 1QBOA 1VCPA 4Y7AA 5J4SA 3W94A 3F6UH 5HXFA 1P3EA 3ATWA 2CF9H 1FZZA 2FOGA 4UFFH 2PSYA 1S0QA 2C8YB 2G51A 3FAOA 4WWYA 1IQIA 1GDQA 4BTTB 3Q3XA 1CBWC 1KXBA 1J15A 3BN9A 3FZZA 1QRZA 1TX6A 2UUYA 2SGAA 4HGCA 4NA9H 1THPB 1A0LA 1GHBF 2TGDA 3ELAH 3FP7E 4ZKSU 1C5VA 2QF0A 1TGSZ 1O3CA 5EPNA 2ULLA 3KL6A 1O5BB 3FVFB 2GMTB 2G52A 1O3MA 2CMYA 3MTYA 3TPIZ 1TGBA 1KYNA 2V35A 1AY6H 1O38A 1DLKB 1ZPBA 1O5CB 4X2XA 2Y80A 4ZH8A 1CA0B 4OGXA 4O03A 3PLKA 2QYIA 1HAVB 2ZDKA 1GI0A 5GCHF 4H42U 1L4DA 1WUNH 3O8DA 5BPEA 4OS5A 1ANDA 4AGKA 1PPEE 5L2ZH 5ABWA 2FM2A 4AFZA 1OWDA 2IOTA 3T2NA 2Y7XA 4BANB 1V2RT 1H1BA 1O5AB 1C2MA 3MU8A 4WMDA 2Z9GA 1W7XH 1C1TA 4ASHA 1GJDB 1DXWA 1DSTA 3ZYDA 1A3EH 3BEIB 1O2KA 3RXRA 3NK8A 3R0FA 1AKSA 1U6QA 1SOTA 3RU4E 1BB0B 4Q7XA 3C1KA 3BIUH 1TNGA 1O2NA 2BDIA 2FTLE 1HAPH 1JWTA 4B1TA 1Z8GA 1QURH 4X8SH 4NIYA 2JH5D 4Q2KA 5L2YH 5K7RA 1GMCF 3M5NA 1PQ8A 2ZDNA 4MPXA 1YPHC 2YNBA 5JBTA 2XYAA 4B2CA 1IQFA 1MD8A 3ATMA 3UPEA 2EI8A 3RU4T 2JKHA 4NIWA 1EQ9A 2VIQA 1TX7A 1AVGH 3D62A 2WV5A 1TABE 1VCWA 1SL3A 1O3BA 2VJ1A 4MTBA 2Z3DA 1C9PA 4E05H 3MH7A 2V0BA 1ANCA 1THRH 3GY8A 5LH8A 3UR6A 3A7TA 3QLPH 2WYGA 1SB1H 1C1SA 2BY7X 2GP9B 1Y3XA 3CENA 4OGYA 5F6MA 2GT7A 1QRWA 1Q31A 3AASA 4H6SB 1P2OA 1V2UT 1C5UA 4CR5A 1DUEA 4Y0ZE 1A2CH 1GDUA 3SI4H 1P02A 1C2DA 5TCCA 4FUJA 4CHAB 1HGTH 1P9UA 3RXLA 1CVWH 2AGEX 3RXAA 4DURA 1FPHH 1DXPA 3E8LA 3CP7A 5ETXA 1C1WH 2A0QB 1W7GH 5DG6A 1O32A 4B2BA 2BQ6B 2NU4E 1YPLH 3U8RH 3RXHA 3LOXA 3M37A 3NXPA 3ZZDA 3KHVA 1TFXA 4BAOB 3M3TA 1YP9A 1O2LA 3SHAH 1SGTA 4K8YA 4NIVA 3H5CB 3KQCA 1CQQA 3QUMP 1TRYA 1DY8A 3AAUA 1UTMA 5FCRA 1EOJA 4KTCA 3A8DA 1TNJA 1SFIA 4JK5A 2BMGB 2VIOA 3SJKA 3PMAB 8KME2 2ZP0H 3P8GA 5AFZH 1GJ4H 3RXEA 1ZYOA 2ZHWH 2LPRA 3UOPA 3SGAE 1QB9A 1TOMH 2J92A 2OINA 1ZZZA 3ZZ5A 3TJNA 2ODYB 4TY7A 3BG8A 1GMHG 1DWBH 1ELFA 1H9IE 2SGEE 2C8XB 3A81A 4OS1A 3V3MA 1F92A 2ZGJA 1BIOA 2J38A 3QTOH 3K65B 1UVUH 2D26C 2BOKA 3UTUH 2G5NA 4OS7A 1V2TT 4X8TH 1TBRH 1HLTH 4CRAA 1F0TA 1A5IA 4ZKOU 1Y5UT 3SORA 1D3TB 1W12U 4K3JA 1XX9A 5A0CA 4I8LA 4JK6A 2QXHA 1TIOA 1LQDB 1TPAE 1OPHB 1C1VH 4JZIA 1PPFE 1KTTB 1GJ8B 1EAIA 2RCEA 4TWYA 3EYDA 4Y8ZA 1FXYA 3STIA 3A80A 1G9IE 4THNH 4WJG2 3GCTG 4CH8B 1GGDB 3UNQA 3RC6A 4ZMAH 1XUFA 2HPPH 4IGDA 2QV1A 2ZPSA 1IQGA 5TCAA 3PMHB 1BOQA 1FY1A 1IQJA 1G32B 3TNSA 3SNBA 2H5DA 2CXVA 1FAXA 4O9VA 4F4OC 3TIUA 4X1RU 3SQEE 4I7YH 1XUKA 5EODA 4JYUH 4MNVA 3VGCB 3O8BA 1D6RA 3KGPA 1G30B 3MH5A 3SU3A 3GCNA 1ZRBA 2V6NA 3I77A 3QN7A 4X6PA 2OQ5A 3B8JA 1BBRK 1N6XA 4CBNA 1G2MA 1L0ZA 4NA7A 2OQUA 1TGTA 1HXFH 3SU4A 4K69A 2J94A 2ZTXA 3LONA 2BZ6H 4MVNA 2FOHA 1C4Y2 4FUHA 4CBOA 5E0GA 1C1OA 5FXLA 2Q1JA 1BT7A 4YESB 1O35A 2P3TB 1J17T 3KQBA 3LGVA 4GCHG 3A84A 1G3EA 1K28D 5CE1A 5A8ZA 5DP9A 1ZJDA 1E35B 3BTFE 1WAYB 2WYJA 1RIWB 3ZVFA 1V6DA 1C2IA 1HJ9A 1AZ8A 4LZ1H 3LGIA 1F0UA 1BBRE 3SUEA 1M9UA 1TPSA 3C27B 2A4RA 3QX5H 1FV9A 1Z8IB 1D4PB 1EAXA 3A82A 2VWMA 1DLEA 3M36A 2BYAX 2ZFFH 3U1JB 1MAXA 2ZFPH 1O3LA 5E0JA 1QJ1B 3ATLA 1P03A 8GCHG 1OSSA 5T6FA 3E16B 1QA7A 1MTVA 4GPGA 3KIDU 4IS5A 4Y8YA 3ZZ6A 3NUMA 4KKDA 2NU3E 2BDYA 3GOVB 4CRGA 2H2ZA 1TQ7B 1K1IA 1L1NA 2BTCE 2XBYA 4NSYA 1QIXB 2B7DH 3P92A 1GGDC 2A5IA 3H7OA 1SGDE 1O39A 4R0IA 3OSYA 3F9GA 3P8NA 2P3FH 3UQOA 1DE7H 4NG9H 4LZ4B 1Z71A 1GCDA 1XVMA 4Z0KA 4U30A 1EZUC 1PYTD 1H9HE 2OP9A 4H4FA 1Y3WA 4CRBA 4Y11E 1MKWH 2XBVA 1GHXH 1C5ZB 3MH4A 3S0NA 4FUFA 2R3UA 1LHDH 5AVDA 4OS6A 1KXFA 1RS0A 3VGCC 1K21H 4AYYB 2BHGA 1FMGA 1GI5A 1MQ6A 2F83A 2FYRA 1PPBH 1QA0A 1LPGB 1P0SH 3GCHC 1T7CA 2UWLA 1S0RA 3KEEA 2J2UA 5A09A 1HAYB 3IG6B 1SSXA 3OTJE 2THFB 1F2SE 1IAUA 1EKBB 4A92A 2ZGCA 4YOGA 4BXSA 6GCHG 2CF8H 2FIRH 1KXDA 1YYY1 1GI7B 2QXGA 4X0WU 1P11E 4BOHA 1EATA 1EPTA 3PTNA 1QQUA 1F0SA 1C5TA 1ETRH 4YM9A 1T8MA 1TMUH 5EW2H 3UNRA 4AYVB 2ODPA 1EJMA 1G3CA 2HVXA 2Z9LA 3Q3YA 4YOJA 4ABAA 2BD9A 3O8RA 2G55A 3LGWA 1RIWC 3A85A 3GYMA 2TGAA 1C5LH 1UO6A 1P2NA 2ZCHP 1MCVA 1Q2WA 2DE9A 1UK2A 1BJUA 1TNHA 1W11U 3MU0A 2GDEH 2SGFE 4Y7BA 1XXFA 2FXRA 1DY9A 1TPPA 3K9XB 4FUIA 2R0KA 3T29A 2Q6FA 1ELGA 5L6NH 3PM3A 4HI3A 4AZ2B 1T4VH 1ELCA 2WPIS 3SJOA 5AF9H 1MKXK 2M5TA 2OTVA 1IOEA 4ABEA 1JRTA 2FX4A 1KLJH 1HAHH 5JBAS 3S9BA 1HAZB 1TMTH 5LPFA 2B8OH 1GJBB 5C1UA 2XCNA 1GJAB 1CHOF 4I8GA 4B2AA 2FZZA 1ZMJA 4X8VH 1SBWA 3A83A 1AU8A 1OX1A 2TIOA 2VNTA 1EPTB 1YLCA 2VGCB 3B9FH 5EPYA 2WUBA 1QL9A 3RMLH 2A5KA 3ZVDA 1DDJA 2G00A 3KN2A 4FU8A 4Y10E 1BRAA 1LO6A 2FODA 3LH3A 1BMMH 4TYDA 5EQRA 1FY3A 1XM1A 2GV7A 1C5XB 3EGKH 2Y7ZA 5L30H 4J2YB 1XUIA 4X2YA 2BZAA 4WMEA 5T3HA 3SGBE 2ZGBH 4JCNA 1V3XA 3DA9B 1S82A 2PGQB 1O2TA 2OC0A 3G01A 3BV9B 4LK4A 1E38B 3ITIA 3GDVA 4AG2A 1NN6A 1ZOMA 4TY6A 1KDQA 2SFAA 4K60A 2BDAA 4YO9A 1UTPA 3TGJE 2A4GA 1W0YH 1V2LT 4BXWA 2JH6D 1AN1E 2BD5A 2UUJB 4IW4E 3VEQB 1AI8H 1F5KU 1V2PT 1BA8B 1B7XB 2W26A 1MMJN 3FFGA 1ZR0A 1O2GH 1J9CH 3GY3A 1K1PA 1V2VT 3TITA 1DM4B 1C1UH 1S84A 1MTUA 2VWOA 4KGAA 3A89A 2ALPA 1ZHRA 2GV6A 4D7FA 4DW2U 1PFXC 1OP2A 4NZLA 2C8ZB 1AWFH 1NFYA 1XUJA 2ZHQH 4ZHAA 4AB8A 1AQ7A 1XMNB 2ZU4A 1O2XA 3SV8A 1O0DH 1P3CA 1UJ1A 4NFEA 1CO7E 5F8ZA 3QK1A 1UCYH 2BXTH 7GCHF 1LKBA 1LVBA 2WV4A 3E90B 3SNAA 5K0HA 1NM6A 4ISHH 1RJXB 3RP2A 1O3IA 1PYTC 1SGYE 1TRNA 3MHWU 2Z7FE 1AD8H 1AVWA 1BRCE 1WBGB 4D9QA 4YLUA 4IN1A 1YM0A 2GT8A 2ZFQH 2HOBA 1SOZA 1QBVH 1MU6B 3ATKA 1OYQA 1O2UA 1O3HA 1LMWB 2UWPA 4Y0YE 4YTAA 1GMDG 1ARBA 3E0PB
chains in the Genus database with same CATH superfamily
1KDQB 4DOQA 1C5QA 4UEHH 1P2JA 4FU9A 4FXGH 5DO4H 2PLXA 2P59A 2J34A 1GI3A 3E0NB 3RUOA 4OS4A 3EA8A 2ZQ1A 1EPTC 1CHGA 1K1LA 2ALVA 2VGCC 1KLTA 4ZKRU 2ZGXH 3OTPA 1SLXB 4WXVA 5FBEA 2A5AA 1GHAG 1EAUA 3A88A 2G8TA 2ZZUH 1IQNA 1QB6A 1O3FA 3DUXH 3W95A 5IDKA 3RXMA 3GYLB 1QY6A 1BITA 2QE7D 3RXUA 1DITH 2HRVA 1O36A 2XCFA 3E3TA 2W3KA 3TK5A 4PROA 1HIAA 1C5YB 1HV7A 3BTDE 4YT6H 5T1VA 4JYVH 1YPJH 1EZXC 2BY9X 3A7XA 2W7SA 3VFEA 1FY5A 1WDIA 3QTVH 1EOLA 3I29A 3GY2A 4FUCA 2HNTC 2F9VA 3T25A 3LH1A 1QBNA 2BVSH 3PO1B 4UE7H 2FOMB 5EOKA 4XDEA 2ZCLP 4CH2B 4I8KA 4MG3A 4HG6A 4K8BA 1GVKB 1KLIH 2A7CA 1H4WA 3F9EA 1MH0A 4X1QU 1P9SA 3U28C 3VB3A 1XUGA 2DE8A 2VIPA 4AC9A 3SZNA 2DUCA 3NZIA 9LPRA 4UDWH 2AERH 4GHTA 1F5RA 5C0TA 1K1JA 2BY6X 3M3SA 2H9EH 5EXMA 1BZXE 1XVOA 1PPCE 1UVOA 2ANWA 4DG4A 1NROH 1OYTH 4WVPE 2VWLA 1T4UH 3Q77A 1DVAH 4KTSA 4I8HA 1BCUH 1KY9A 3VXFH 1SFQB 2XWBI 4RKOB 2P95A 1C5RA 3DSOA 1VJAU 2B5TB 2O8LA 2ILNA 5E0HA 1HIAB 1HAXB 1XXDA 3OY5U 4O3TA 1QL7A 5C0UA 1GBHA 4XBCA 1EJNA 3I78A 3LJOA 4Y71A 1WTGH 1GI1A 3RMNH 3RMMH 5IK2D 1O3EA 3F0PA 4ABBA 1QQ4A 1QRXA 3P70B 1UVSH 1WSSH 3FP6E 1WCZA 3TJUA 1RFNA 1O2WA 4YOIA 1JIRA 2J5UA 1NU7B 5JDUB 2BD4A 2FI5E 1S5SA 2GCTB 3RLWH 5CDFE 4R8TB 3L33A 4J1YA 5E8EH 5FPYA 3LIWA 1DFPA 2HALA 1KXCA 3MI4A 4M7GA 3M5OA 2W3IA 4F48B 2ZGHA 3ZV9A 1EJAA 1GJCB 5A0AE 1OWEA 2GMTC 3RM0H 2AYWA 4UFGH 3GY6A 1AO5A 2W7UA 4WXIA 2FOFA 1FPCH 5C5NA 1AMHA 1TX8A 1CA0C 3UB0A 3FOAA 1GBKA 1GHBG 3UIRA 2BY8X 1AUJA 4AFQA 3U8TH 2I6SA 2K0QA 3PO1C 3BEUA 3TVJB 1CE5A 1PPHE 1F0RA 2ZFRH 1BJVA 4WH6A 1GCTB 2HVYB 1THSH 1N1LA 1NRSH 2IPHA 3DSGA 3S7HB 2FI3E 1ETSH 1Y3VA 4AN7A 2CN0H 1C1QA 2JETB 2I6QA 2QIQA 1NT1A 5GCHG 1UVTH 3B23B 3PV4A 1O2SA 5FPTA 2A7JA 1ELVA 1ARCA 2AS9A 1YCPM 4HFPB 4K1SA 1V2MT 3DD2H 4B73A 7LPRA 1KTSB 4YLQH 1QNJA 3GISB 3Q3KA 4A7IB 5C1XA 1JMOH 4AFSA 4FUGA 1GL1A 3KF2A 2HLCA 1F7ZA 2NU0E 1DPOA 1AB9B 1MBMA 2ZHFH 1ETTH 3TH3H 2AIPA 5DP3A 3ZZAA 1S83A 1QFKH 2ZA5A 2P94A 1FX0B 3SQHE 4FU7A 1HDTH 2Q6DA 3SN8A 1O33A 2Y82A 1UTOA 1MAYA 3UNSA 2EA3A 2VWNA 1TBZH 1J14A 1PPGE 1YCPK 3ZVCA 1WXRA 2V3HH 1GMCG 3ZZ8A 4ZROA 2XBXA 1K1OA 2C93B 3M35A 2B9LA 3E6PH 2VIWA 1S81A 3SV7A 4NIXA 5JPMH 1NRQH 1TB6H 5LPEA 2FDAA 2VH0A 2Q6GA 2GZ7A 2H9HA 3KQEA 2GCTC 2EQNA 1O31A 2ODQA 3D23A 5C3NA 4B71A 5C17A 2NU2E 2Z9IA 3BTHE 1TOCB 3JZ1B 2BD7A 1O3JA 2QA9E 3TJVA 1GBEA 1BTYA 4CHAC 2H1UA 4MLFB 9ESTA 1G2LA 4ZKNU 3VB5A 2YNAA 1TWXB 2QY0B 4ESTE 3MWIU 2R3YA 4RN6A 3OAAD 2AH4X 5HMAA 1HXEH 3O8CA 3RXVA 1UVPA 3TH2H 1VR1H 2BXUH 1IQMA 1P06A 5E2OA 4BAMB 3PV2A 1C2LA 1TMBH 2YMSD 1ZHPA 3RXPA 1C2HA 3ZVBA 1SR5C 1ZGVA 3ZZ3A 1SGEE 4FVDA 1GHYH 3AW1A 4D8NA 2ZU1A 5J4QA 2JETC 1NFUA 1UTJA 1P2IA 3S9AA 5LPRA 1DT2A 1P05A 4I8JA 3E1XB 4INHA 1A5HA 2FYQA 1V2WT 3M5MA 1NY22 4BAHB 4CRFA 1SLWB 4K1EA 3H09A 3UR9A 2WSSD 4VGCB 2C4FH 1WU1A 2BX4A 1FN8A 4NWLA 1AB9C 1O2MA 2CK3D 2GVFA 4YZUA 1XUHA 3FZDA 1TLDA 2V3OH 2A4QA 2ZU3A 3MU5A 3SO3A 3QDZB 1GBAA 4HTCH 4CRCA 1O2YA 2W6ID 5KGOA 3PLPA 5DN6D 1O3OA 3FN8A 3ZZCA 1SGRE 2BOHB 3F9FA 1JIMA 4IC5A 1O2OA 3VB4A 2ZPQA 4LOYH 1GJ7B 2ZU2A 3ZZ4A 5C20A 1YPKH 2G4TA 3MMGA 4UONA 4F55A 6LPRA 2PKAA 5CMXH 2FOBA 1LVYA 1MZAA 1NRPH 5EJZA 2FI4E 3MNBA 1VITF 1ZRKA 2GCHF 2ZI2H 1FONA 1JBUH 1KMHB 2OUAA 3A7ZA 3ODDA 2V7QD 2TGPZ 3RXJA 4BTIB 1Z7KA 1WYKA 2SGDE 1UTQA 3TK6A 3BTEE 1IHTH 2GKVE 4UFEH 3HK3B 2VINA 5CHBA 4FVBA 2R2MB 2WV9A 1E1RD 2WPKS 4XFQA 1GBDA 3OY6U 1S6FA 3TH4H 2FO9A 2FS9A 2J4IA 4ISLA 1SQTA 1G3DA 3DHKH 1ID5H 4XRNA 1BTXA 2BQ7B 2BDBA 1AZZA 1T31A 1E37B 3HKJB 3MYWA 3LU9B 3EDXB 6ESTA 2UUFB 1XKAC 1O37A 3T27A 3UWIA 1SGNE 3PB1E 1UMAH 2F43B 1GJ6A 1WTHD 2OBOA 3PRDA 3SV6A 1NTPA 1NRRH 4X2WA 1TGNA 5FAHA 1SLVB 2KX4A 2Z3EA 2C3SA 1SGPE 4X6OA 1QGFA 3ENSB 4YT7H 1SQOA 1O2VA 2D1JA 3GY7A 2P8OB 3URCA 2J95A 2D8WA 1COWD 2PKAB 2STAE 3M7UA 2AGIX 2RDLA 5GXPA 1OP0A 2OLGA 2XXLA 1UHBB 2FOCA 2SNVA 5EIYA 2B0FA 1SHYA 1GWAA 1SGFG 1UTKA 5T6DA 1CT0E 3K6ZA 1INCA 4VGCC 1P2QA 2G4UA 1T32A 2IJOB 2GZ9A 1FIWA 2A45B 2QCYA 1O3GA 4OS2A 4WH8A 3F9HA 2CGAA 2IJD1 4HZHA 1VKYA 1MBQA 1GBMA 1QTFA 2PW8H 3V13A 2BX3A 2AMPA 1P8VC 4H6TA 4Q4LA 4X6MA 3QWCH 1ZSJA 1BMFD 2BQWB 1KXAA 5CHAB 4AGJA 2AEIH 1MZDA 1C5MD 1HFDA 2BB4A 2PV9B 3ESTA 1P2MA 2P93A 5B6LA 1KSNA 2Z6BD 4TPIZ 1ZHMA 2BLOA 3SU1A 4BAKB 1QHRB 2BD2A 1EB1H 1YPHE 1DWCH 4CR9A 3K6YA 4ABDA 2HNTF 1O2PA 1TA2A 3A8CA 2VVUA 1CGIE 3SGQE 5KECA 5C5OA 1OXGA 2PKSB 1SQAA 1QB1A 1C2GA 1EP5A 1FDPA 3SW2B 3LGYA 2RA3A 1LTOA 1A61H 1E1QD 4I32A 1W13U 2O8MA 5C67A 1EASA 5T6GA 2UWOA 3SBKA 3QZRA 5LGOA 3MNSA 3N7DA 5DP8A 2XWAA 2R2WU 4YXWD 5HYOA 2ZHEH 4JMYA 2BD8A 2WPJS 5FBIA 1Y59T 5FHTA 1SQRA 3PRBA 1KXEA 1HCGA 5G4BA 1UTLM 1DOJA 5FX6A 3WWFA 3LT3A 1EZQA 4INKA 1GBTA 1V2ST 3LKWA 1TA6A 3T26A 1TYNA 1ZTJA 2RA0A 2A1DB 4NGAH 1O3PB 1D3PB 2ZDVH 1Y5AT 4FUDA 2ZU5A 4MQAA 3MO9A 1YC0A 4BTUB 1HAOH 1O2JA 1AFEH 4X1NU 1L4ZA 1ZPCA 2P8OC 4U32A 1NESE 4DT4A 2F9BH 1NRNH 4NFFA 1SGQE 1GBBA 1SLUB 3MO6A 5E2PA 3S7KB 3UOUA 1O2RA 5EXNA 2Z94A 1MTNB 3MU4A 3RXBA 2F9PA 2BLQA 5AHGH 2P16A 3LGTA 4DVAU 2FWWA 1NO9H 1BUIA 1GVLA 3LGUA 3LPRA 1P12E 3BTGE 3D65E 4GUXA 5ESTE 5IYTA 3RC5A 3RXOA 2BVXH 1GHWH 5AFYH 1B5GH 1IQHA 5JBBS 1YLNA 1LVOA 3ODFA 2WINI 4OM9A 1UTNA 3PROA 1C1MA 4SGAE 3N99A 4K2YA 5FX5A 4NZQA 4XBDA 1HJ8A 1Y3YA 4Q80A 1H9LB 1ZMLA 1P57B 5CHAC 1V2QT 2H6MA 1HUTH 2ZFTA 1XKBC 2KAIB 1J8AA 1ZSKA 4SGBE 2TGTA 2R0LA 3EE0B 4BAQB 3WWBA 2FOAA 1V2NT 1RTKA 3T62A 3SNDA 5GJ4B 3M7TA 2ZEBA 4INLA 3SU0A 3MNCA 4Q7YA 3A7VA 4KELA 1ABIH 1HPGA 2ZPRA 3TGIE 1FY8E 2VU8E 2XC5A 1LKAA 4ASUD 1GHZA 2PKSC 4X8UH 4A1XA 4UD9H 1WQSA 3IWMA 1BHXB 1V2JT 2OC8A 3F2FA 1GBFA 1ESAA 3TK9A 2PTNA 3TNTA 3SV9A 3M5LA 1ANBA 3BG4B 1J16A 1GBIA 3VXEH 2F9UA 1W2KH 1RXPA 1RGQA 4FUEA 5DP7A 5I25A 1UK4A 2QAAA 1LHCH 1Z8RA 2OC7A 4NA8A 2ZKSA 4Q7ZA 1CHOG 5DK1A 5A8XA 3STJA 4XBBA 5DKMA 5EXLA 4JZFH 5BRRE 2ZC9H 1C2KA 4Y6DA 2HPQH 1FY4A 1DWEH 1CGHA 2LELA 4O3UA 2UUKB 3ZVGA 1OWHA 1BBRH 3U8OH 3V0XA 3LJJA 3K2UA 2J9NA 3GDUA 1LDTT 1DWDH 3SZEA 2VBCA 2PHBA 4Y8XA 2WHXA 4NCYA 1S6HA 1TQ0B 1AE8H 1TAWA 3ZZ7A 1A1RA 3LC3A 4B6FA 1SVPA 1QJ6B 1BRUP 1GJ9B 1O2IA 1K1NA 1C9TA 1EX3A 4Z1MD 1MTNC 1L1GA 3N7OA 3BEFB 4ISNA 2L74A 3S9CA 2WPHS 1L1JA 2J98B 1MKWK 1A3BH 1E36B 1EB2A 2PGBB 2VB0A 1C2EA 3BTWE 5FCKA 2XNDD 4A1VA 5A2MH 1JRSA 5C2ZA 1OWKA 3QO6A 1IQKA 2AIQA 3MU1A 2P3UB 1HAIH 6CHAB 1LPKB 1OP8A 3UQVA 1A46H 2XBWA 2HWLB 2XTTB 3RXCA 3ZZ9A 1GMHF 5EU8A 1D3QB 1FNIA 1S85A 3HGPA 4MPUA 1DS2E 2R9PA 1N8OB 1MD7A 3RXFA 5EGMA 2PFEA 1NBMD 2F9OA 4ZHLU 1A4WH 2A31A 5JYIA 1LHEH 4ZXYH 2VVVA 3GS9A 1CGJE 4ZHMU 5DP5A 4DCDA 3FKSD 1A7SA 3CS0A 1ZLRA 5GDSH 3AVZA 1ZSLA 3GY4A 2VIDA 3RU4D 4CREA 1SGIB 7GCHG 1GI4A 1G3BA 4RSPA 2BD3A 2ANMH 3HK6B 1ZTKA 2QXIA 3SJ8A 2K1QA 4IN2A 3TJOA 3RXGA 1NS3A 1QCPA 1F5LA 2W5EA 4X2VA 3TLOA 4LXBH 1D3DB 2W6JD 3BG4C 1O2ZA 3NRLA 3GCTF 3SNCA 5SGAE 3ZV8A 1HYLA 2FMJA 1C1NA 1SC8U 1MUEB 2G5VA 1YBWA 2OD3B 5HIZA 1ZPZA 4B75A 1C4U2 1P04A 1ELBA 4AG1A 1N6YA 1Z6JH 4IC6A 5A0BA 1DX5M 5HM2A 1NZQH 1DSUA 1HNEE 4DY7B 2BDHA 1SHHB 3VPKA 1SG8B 3BTKE 1PPZA 1D9IA 3RXQA 1ORFA 2K8IA 2WPMS 1LCYA 3RDZA 1AKSB 1CT4E 4MNYA 3RXKA 3SUFA 3SU5A 1Q3XA 1W10U 1GI8B 3SNEA 2OCVB 3JZ2B 3MFJA 1G36A 2CHAB 2O9QA 2Y6TA 2ZQ2A 4WMFA 4UFDH 3RLYH 2PP6A 4MDSA 1H8DH 4QT8C 3UREA 2ZTYA 4ISIH 1CT2E 3URDA 5DPAA 1ELTA 3BSQA 3UFAA 2FS8A 2G81E 3VB6A 1VCQA 1HBTH 3SHCH 1AE5A 3A7WA 1A0HB 1TBQH 1GJ5H 4GCHF 1S6LA 1TNIA 3SU6A 1ESTA 3AW0A 6CHAC 3SJ9A 1W3CA 1MKXH 4AFUA 1GBJA 1DANH 1T8NA 2QN5T 5GWZA 2CV3A 4B76A 1MTSA 1V2OT 2ZFSA 3PTBA 1N8OC 3PLBA 3ZVAA 3A86A 1EXFA 1ACBE 1NC6A 4WY3A 1NFWA 3A8BA 1HAGE 3EA9A 4NWKA 1BTHH 5DP4A 8GCHF 5FPSA 1ABJH 1C2FA 1ELDE 3IITA 2GGVB 3AAVA 3PYHA 3LC5A 3Q00A 3BTQE 2ASUB 1LQEA 3HPTB 1Y5BT 3RMOH 1L2EA 4TPYA 1OWIA 1UK3A 1GG6B 4GSOA 4ACBA 4D76A 3EE7A 2GZ8A 2KM0A 1RD3B 4Y79A 1BDAA 3P8FA 3SUGA 2F3CE 5EQSA 1TPOA 1UCYK 2O8TA 1O5EH 1VGCB 1YPGH 3T5FH 2PTCE 5H4IB 3UWJH 1K22H 4AORA 1C1PA 4MNWA 4ABIA 4CRDA 3WY8A 3P95A 1WOFA 1AFQB 3F1SB 3FP8E 3HATH 3RXDA 1C5NH 2STBE 4D9RA 1QR3E 5F03A 4ZXXH 1GPZA 1TONA 2BDCA 2FESH 3L6PA 4FUBA 5HGGA 4E7RG 2RFKC 4TWWA 1GCTC 1K9OE 4X6NA 1CA8B 2CHAC 1O34A 1EZSC 1VJ9U 3GY5A 1BTWA 2ZCKP 1EP6A 2Y5GA 3NKKA 1HRTH 1YF4A 2EY4C 4ZUHA 1NFXA 1UCYE 6GCHF 1SGFA 1P01A 5GIBA 3OU0A 3MOCA 5C1YA 1TGCA 2QF3A 4IBLH 1O3NA 3EQ0H 1AWHB 3BIVH 4O97A 3CNRA 3RC4A 4NSVA 2HGTH 2OC1A 2ZDAH 1MQ5A 3DT0H 3SJIA 1C5WB 2O8UA 3GCHB 2PSXA 1O5FH 2Z3CA 4E7NA 1O3DA 1D6WA 2A2QH 1IHSH 2A4OA 4ABHA 3A87A 3NWUA 3P8OA 1HB0B 1NPMA 2BM2A 1TRMA 3MNXA 3PWCA 2RDEA 2ZO3H 2CJIA 5I46H 2LNCA 2ZF0H 1YLDA 3PWBA 2RG3A 1ZJKA 4JZEH 2EEKA 1YY3A 2JJ1D 2VVCA 2H9TH 2VH6A 4KP0A 7ESTE 3GDSA 1O2QA 3OYPA 3OE7D 1C5PA 2SGQE 2GTBA 1IQEA 1SMFE 1AUTC 3QGJA 3U98H 2D2DA 3A8AA 1GL0E 1UHBA 3BTTE 1OKXA 1W14U 2BLWA 4XSKU 4GAWA 2XW9A 2C90B 1WV7H 3F0OA 2FP7B 1GG6C 5JB9S 1GVZA 1AHTH 1A5GH 2Y5FA 3P6ZB 3D49H 1G37A 1O3AA 3GICB 2SNWA 5EW1H 3SV2H 4GLYA 3BF6H 1W0ZU 1P10A 4I33A 4GVUA 4JZDH 5EJLA 1FJSA 1C5SA 1YWUA 5EQQA 4U2WA 3V7TA 2IN2A 2XC4A 2ZHDA 4AX9H 1O30A 1FN6A 3OX7U 3U69H 1VGCC 1Z6EA 1V2KT 4Z6AH 1C5OH 2FTMA 2ZDLA 4MPWA 3VB7A 3BTME 1PJPA 3ATIA 1QL8A 2GD4B 3KQDA 4Y76A 3NCLA 1AFQC 2WPDD 2Z9KA 2OBQA 2FOEA 2AMDA 1CSOE 2ZDMA 2KR7A 4X1PU 1YGCH 5GNDA 1JOUB 1K2I1 4IMZA 3RXTA 3U1IB 2BVRH 3UAIC 1NU9A 1AIXH 4WF8A 3PMBB 1QJ7B 4XE4A 4DIHH 1EUFA 1PQ7A 2QXJA 1BTZA 1BTUA 1HJAB 1RTLA 2AGGX 4DIIH 1A0JA 1BMNH 2HNTE 2JDID 4RT0A 4KTUA 3M3VA 2BLVA 2NWNA 5F8TA 1LPZB 3L3TA 4ABGA 4K1TA 2F91A 1ZTLA 2GJGA 3OEED 4GHQA 3KNXA 1Y3UA 5F8XA 1OWJA 1MTWA 2GX4A 5C94A 1TNLA 1DICA 2ZTZA 4BNRA 2EI6A 4ABJA 1TALA 3M7QA 4IMQA 1DUAA 2WUCA 1X7AC 2EC9H 1Z8JB 2GDDA 4FETA 4XOJA 1JXPA 3OFND 1BMAA 1P09A 3CS7A 3DFJA 5DP6A 4D7GA 7KMEH 8LPRA 1Y8TA 1ZMNA 2PUXB 3ZZBA 1H8IH 1O3KA 3V12A 1K1MA 1LHGH 2FLRH 3HGNA 4MNXA 4JYTA 3MO3A 1GHVH 3DFLA 2ESTE 4F49A 4ISOA 4RKJB 4U01A 3GCOA 2O8WA 2XNIA 1MU8B 5F53A 3RXSA 5EG4A 1BTPA 1GMDF 2QGRA 2KZ4A 2Y81A 4RI0A 8ESTE 2EI7A 1IQLA 4X1SU 1P2KA 4I31A 1BMLA 1ZGIA 2ZECA 4DJZB 4DGJA 5A8YA 5PTPA 2H5CA 3M61U 4AB9A 1GBCA 2YOLA 2A32A 1RTFB 1VITG 2XC0A 1SI5H 2GCHG 2A7HA 2WPLS 2J97A 1GHAF 1T8OA 1YPMH 2TBSA 1E34B 3P17H 5DJ7A 1SPJA 1GI2A 1FQ3A 3PMJA 4RT1A 1E79D 2KAIA 4A6LA 1VZQH 1CBWB 2FLBH 1O5DH 3SU2A 1PQAA 3FANA 2C8WB 1FAKH 2TPIZ 2XRCA 4E06H 1GBLA 1EFRD 2SGPE 2NU1E 3U9AH 2ZG0H 1TNKA 2Y5HA 3VG8A 4A5TS 2BDGA 4B6EA 2PWXA 1WQVH 1O2HA 2AMQA 2FX6A 2ZNKH 3SI3H 3ZYEA 1HJAC 1YKTA 1KIGH 1TE0A 2TRMA 1BQYA 5DGJA 1ELEE 3HKIB 3EAJA 4TT3D 2PR3A 3F68H 4Q63A 4ZAEA 4ABFA 1GI6A 3A7YA 1BHXF 3SOSA 5JB8S 4A1TA 1Z1JA 1SGCA 3TU7H 1PQ5A 3RM2H 4B74A 2JH0D 1OS8A 1YCPH 1Z1IA 3T28A 2ANYA 3RXIA 2FEQH 2ANKH 5B6OA 1LHFH 2ZIQH 1RRKA 3LDXH 1AGJA 3QZQA 1ESBA 1B0EA 1GI9B 3H7TA 2AFQB 1FUJA 3R3GB 1BRBE 2FPZA 2PUQH 3QGNB 1GDNA 3UUZA 1FI8A 5HM9A 3SUDA 1MCTA 1W8BH 1C2JA 4K5ZA 2ZWLH 3Q76A 3ZVEA 4P00A 2F9NA 4MPVA 1CU1A 2QC2A 3UY9A 1C4V2 5JBCS 1OOKB 2OXSA 1HAVA 2BY5X 5ESBA 4DT7B 3KCGH 5GPIB 2Z9JA 1ELAA 4JZ1A 3E91A 2J98A 1AVXA 2A2XH 5TJXA 1C1RA 1B0FA 5DSFA 1T8LA 3EA7A 1FLEE 1VITH 1E0FD 3MH6A 4M9FA 3S69A 1FIZA 3FO8D 3NPSA 4AOQA 1LVMA 1YPEH 2VIVA 3TGKE 1ANEA 1EAWA 1O5GH 1QBOA 4P02A 1VCPA 4Y7AA 5EJ1A 3W94A 3F6UH 5HXFA 5J4SA 1P3EA 3ATWA 2CF9H 1FZZA 2FOGA 4UFFH 2PSYA 1S0QA 2C8YB 2G51A 3FAOA 4WWYA 1IQIA 1GDQA 4BTTB 3Q3XA 1CBWC 1KXBA 1J15A 3BN9A 3FZZA 1QRZA 1TX6A 2UUYA 2SGAA 4HGCA 4NA9H 1THPB 1A0LA 1GHBF 2TGDA 3ELAH 3FP7E 4ZKSU 4TSFD 1C5VA 2QF0A 1TGSZ 1O3CA 5EPNA 2ULLA 3KL6A 1O5BB 3FVFB 2GMTB 2G52A 1O3MA 2CMYA 3MTYA 3TPIZ 1TGBA 1KYNA 2V35A 1AY6H 1O38A 1DLKB 1ZPBA 1O5CB 4X2XA 2Y80A 3PV5A 4ZH8A 1CA0B 4OGXA 4O03A 3PLKA 2QYIA 2HLDD 1HAVB 2ZDKA 1GI0A 5GCHF 4H42U 1K0HA 1L4DA 1WUNH 3O8DA 5BPEA 4OS5A 3W1EA 1ANDA 4AGKA 1PPEE 5L2ZH 5ABWA 2FM2A 4AFZA 1OWDA 1NBME 2IOTA 3T2NA 2Y7XA 4BANB 1V2RT 1H1BA 1O5AB 1C2MA 3MU8A 4WMDA 2Z9GA 1W7XH 1C1TA 4ASHA 1GJDB 1DXWA 1DSTA 3ZYDA 1A3EH 3BEIB 1O2KA 3RXRA 3NK8A 3R0FA 1AKSA 1U6QA 1SOTA 3RU4E 1BB0B 4Q7XA 3C1KA 3BIUH 1TNGA 1O2NA 2BDIA 2FTLE 1HAPH 1UW7A 1JWTA 4B1TA 1Z8GA 1QURH 4X8SH 4NIYA 2JH5D 4Q2KA 5L2YH 5K7RA 4ZCNA 1GMCF 3M5NA 1PQ8A 2ZDNA 4MPXA 1YPHC 2YNBA 5JBTA 2XYAA 4B2CA 5KEDA 1IQFA 1MD8A 3ATMA 3UPEA 2EI8A 3RU4T 2JKHA 4NIWA 1EQ9A 2VIQA 1TX7A 1AVGH 3D62A 2WV5A 1TABE 1VCWA 1SL3A 1O3BA 2VJ1A 4MTBA 2Z3DA 1C9PA 4E05H 3MH7A 3KQ5A 5HKKD 2V0BA 1ANCA 1THRH 3GY8A 5LH8A 3UR6A 3A7TA 3QLPH 2WYGA 1SB1H 1C1SA 2BY7X 3DSPA 2GP9B 1Y3XA 3CENA 4OGYA 5F6MA 2GT7A 2LP6A 1QRWA 2M2AA 1Q31A 3AASA 4H6SB 1P2OA 1V2UT 1C5UA 4CR5A 1DUEA 4Y0ZE 1A2CH 1GDUA 3SI4H 1P02A 1C2DA 5TCCA 4FUJA 1MABB 1OHHD 4CHAB 1HGTH 1P9UA 3RXLA 1CVWH 3DCLA 2AGEX 3RXAA 4DURA 1FPHH 1DXPA 3E8LA 3CP7A 5ETXA 1C1WH 2A0QB 5FL7D 1W7GH 5DG6A 1O32A 4B2BA 2BQ6B 2NU4E 1YPLH 3U8RH 3RXHA 3LOXA 3M37A 3NXPA 3ZZDA 3KHVA 1TFXA 4BAOB 3M3TA 1YP9A 1O2LA 3SHAH 1SGTA 4K8YA 4NIVA 2KCPA 3H5CB 3KQCA 1CQQA 3QUMP 2KCOA 1TRYA 1DY8A 3AAUA 1H8ED 1UTMA 5FCRA 1EOJA 4KTCA 3A8DA 1TNJA 1SFIA 4JK5A 2BMGB 2VIOA 3SJKA 3PMAB 8KME2 2ZP0H 3P8GA 5AFZH 1GJ4H 3RXEA 1ZYOA 2ZHWH 2LPRA 3UOPA 3SGAE 1QB9A 1TOMH 2J92A 2OINA 1ZZZA 5HIYA 2OK5A 3ZZ5A 3TJNA 2ODYB 4TY7A 3BG8A 1GMHG 1DWBH 1ELFA 1H9IE 2SGEE 2C8XB 3A81A 4OS1A 3V3MA 1F92A 2ZGJA 1BIOA 2J38A 3QTOH 3K65B 1UVUH 2D26C 2BOKA 3UTUH 2G5NA 4OS7A 1V2TT 4X8TH 1TBRH 1HLTH 4CRAA 1F0TA 1A5IA 4ZKOU 1Y5UT 3SORA 1D3TB 1W12U 4K3JA 1XX9A 5A0CA 4I8LA 4JK6A 2QXHA 2QF4A 1TIOA 1LQDB 1TPAE 1OPHB 1C1VH 2XOKD 4JZIA 1PPFE 1KTTB 1GJ8B 1EAIA 2RCEA 4TWYA 3EYDA 4Y8ZA 1FXYA 3STIA 3A80A 1G9IE 4THNH 1W0KD 4WJG2 3GCTG 4CH8B 1GGDB 1QZ8A 3UNQA 3RC6A 4ZMAH 1XUFA 2HPPH 4IGDA 2QV1A 2ZPSA 1IQGA 2V3MA 5TCAA 3PMHB 1BOQA 2IPQX 1FY1A 1IQJA 4I86A 1G32B 3TNSA 3SNBA 2H5DA 2CXVA 1FAXA 4O9VA 4F4OC 3TIUA 4X1RU 3SQEE 4I7YH 1XUKA 5EODA 4JYUH 4MNVA 3VGCB 3O8BA 2L6OA 1D6RA 3KGPA 1G30B 3MH5A 3SU3A 3GCNA 1ZRBA 2V6NA 3I77A 3QN7A 4X6PA 2OQ5A 3B8JA 1BBRK 1N6XA 4CBNA 2AHME 1G2MA 1L0ZA 4NA7A 2OQUA 1TGTA 1HXFH 3SU4A 4K69A 2J94A 2ZTXA 3LONA 2BZ6H 4MVNA 2FOHA 1C4Y2 4FUHA 4CBOA 5E0GA 1C1OA 5FXLA 2Q1JA 1BT7A 4YESB 1O35A 2P3TB 1J17T 3KQBA 3LGVA 4GCHG 3A84A 1G3EA 1K28D 5CE1A 5A8ZA 5DP9A 1ZJDA 1E35B 3BTFE 1WAYB 2WYJA 1RIWB 3ZVFA 1V6DA 1C2IA 2F4LA 1HJ9A 1AZ8A 4LZ1H 3LGIA 1F0UA 2JJ2D 1BBRE 3SUEA 1M9UA 1TPSA 3C27B 2A4RA 3QX5H 1FV9A 1Z8IB 2WZQA 1D4PB 1EAXA 3A82A 2VWMA 1DLEA 3M36A 2BYAX 2ZFFH 3U1JB 1MAXA 2ZFPH 1O3LA 5E0JA 1QJ1B 3ATLA 1P03A 8GCHG 1OSSA 5T6FA 3E16B 1QA7A 1MTVA 4GPGA 3KIDU 4IS5A 4Y8YA 3ZZ6A 3NUMA 4KKDA 1SKYE 2NU3E 2BDYA 3GOVB 4CRGA 2H2ZA 2KCYA 1TQ7B 3KYFA 1K1IA 1L1NA 2BTCE 2XBYA 4NSYA 1QIXB 2B7DH 3P92A 1GGDC 4ACAA 2A5IA 3H7OA 2YMSB 1SGDE 1O39A 4R0IA 3OSYA 3F9GA 3P8NA 2P3FH 3UQOA 1DE7H 4NG9H 4LZ4B 1Z71A 1GCDA 1XVMA 3KYGA 4Z0KA 4U30A 1EZUC 1PYTD 1H9HE 2OP9A 4H4FA 1Y3WA 4CRBA 4Y11E 1MKWH 2XBVA 1GHXH 1C5ZB 3MH4A 3S0NA 4FUFA 2R3UA 1LHDH 5AVDA 4OS6A 1KXFA 1RS0A 3VGCC 1K21H 4AYYB 2BHGA 1FMGA 1GI5A 2JIZD 1MQ6A 2F83A 2FYRA 1PPBH 1QA0A 1LPGB 1P0SH 3GCHC 1T7CA 2UWLA 1S0RA 3KEEA 2J2UA 5A09A 3F2HA 1HAYB 3IG6B 1SSXA 3OTJE 2THFB 1F2SE 1IAUA 1EKBB 4A92A 2ZGCA 4YOGA 4BXSA 6GCHG 2CF8H 2FIRH 1KXDA 1YYY1 1GI7B 2QXGA 4X0WU 1P11E 4BOHA 1EATA 1EPTA 3PTNA 1QQUA 1F0SA 1C5TA 3N7EA 1ETRH 4YM9A 3F2GA 1T8MA 1TMUH 5EW2H 3UNRA 4AYVB 1G3CA 1EJMA 2ODPA 2HVXA 2Z9LA 3Q3YA 4YOJA 4ABAA 2BD9A 3O8RA 2G55A 3LGWA 1RIWC 3A85A 3GYMA 2TGAA 1C5LH 1UO6A 1P2NA 2ZCHP 1MCVA 1Q2WA 2DE9A 3WW7A 1UK2A 1BJUA 1TNHA 1W11U 3MU0A 2GDEH 2SGFE 4Y7BA 1XXFA 2FXRA 1DY9A 1TPPA 3SYJA 3K9XB 4FUIA 2R0KA 3T29A 2Q6FA 3AK5A 1ELGA 5L6NH 3PM3A 4HI3A 4AZ2B 1T4VH 1ELCA 2WPIS 3SJOA 5AF9H 1MKXK 2M5TA 2OTVA 1IOEA 4ABEA 1JRTA 2FX4A 1KLJH 1HAHH 5JBAS 3S9BA 1HAZB 1TMTH 5LPFA 2B8OH 1GJBB 5C1UA 2XCNA 1H8HD 1GJAB 1CHOF 4I8GA 4B2AA 2YMSC 2FZZA 1ZMJA 4X8VH 1SBWA 3A83A 1AU8A 1OX1A 2TIOA 2VNTA 1EPTB 1YLCA 1W0JD 2VGCB 3B9FH 5EPYA 2WUBA 1QL9A 3RMLH 2A5KA 3ZVDA 1DDJA 2G00A 3KN2A 4FU8A 4Y10E 1BRAA 1LO6A 4FOUC 2FODA 3F3BA 1BMMH 3LH3A 4TYDA 5EQRA 1FY3A 1XM1A 3OEHD 2GV7A 1C5XB 3EGKH 2Y7ZA 5L30H 4J2YB 1XUIA 4X2YA 4XD7D 2BZAA 4WMEA 5T3HA 3SGBE 2ZGBH 4JCNA 1V3XA 3DA9B 1S82A 2PGQB 1O2TA 2OC0A 3G01A 3BV9B 4LK4A 1E38B 3ITIA 3GDVA 4AG2A 1NN6A 1ZOMA 2KCAA 1KDQA 4TY6A 2SFAA 4K60A 2BDAA 4YO9A 1UTPA 3TGJE 2A4GA 1W0YH 1V2LT 4BXWA 2JH6D 1AN1E 2BD5A 2UUJB 4IW4E 3VEQB 1AI8H 1F5KU 1V2PT 1BA8B 1B7XB 2W26A 1MMJN 3FFGA 1ZR0A 1O2GH 1J9CH 3GY3A 1K1PA 1V2VT 3TITA 1DM4B 1C1UH 1S84A 2KFWA 1MTUA 2VWOA 4KGAA 3A89A 3ZIAD 2ALPA 1ZHRA 2GV6A 4D7FA 4DW2U 1PFXC 1OP2A 4NZLA 2C8ZB 1AWFH 1NFYA 1XUJA 2ZHQH 4ZHAA 4AB8A 1AQ7A 1XMNB 2ZU4A 1O2XA 3SV8A 1O0DH 1P3CA 1UJ1A 4NFEA 1CO7E 5F8ZA 3QK1A 1UCYH 2BXTH 7GCHF 1LKBA 1LVBA 2WV4A 3E90B 3SNAA 5K0HA 3MQKC 1NM6A 4ISHH 1RJXB 3RP2A 1O3IA 1PYTC 1SGYE 1TRNA 3MHWU 2QF5A 2Z7FE 1AD8H 1AVWA 1BRCE 1WBGB 4D9QA 4YLUA 4IN1A 1YM0A 2GT8A 2ZFQH 2HOBA 1SOZA 1QBVH 1MU6B 3ATKA 1OYQA 1O2UA 1O3HA 1LMWB 2UWPA 4Y0YE 4YTAA 1GMDG 1ARBA 3E0PB
chains in the Genus database with same CATH topology
1KDQB 4DOQA 1C5QA 4UEHH 1P2JA 4FU9A 4FXGH 5DO4H 2PLXA 2P59A 2J34A 1GI3A 3E0NB 3RUOA 4OS4A 3EA8A 2ZQ1A 1EPTC 1CHGA 1K1LA 2ALVA 2VGCC 1KLTA 4ZKRU 2ZGXH 1SLXB 4WXVA 5FBEA 2A5AA 1GHAG 1EAUA 3A88A 2G8TA 2ZZUH 1IQNA 1QB6A 1O3FA 3DUXH 3W95A 5IDKA 3RXMA 3GYLB 1QY6A 1BITA 3RXUA 1DITH 2HRVA 1O36A 2XCFA 3E3TA 2W3KA 3TK5A 4PROA 1HIAA 1C5YB 1HV7A 3BTDE 4YT6H 4JYVH 1YPJH 1EZXC 2BY9X 3A7XA 2W7SA 3VFEA 1FY5A 3QTVH 1EOLA 3I29A 3GY2A 4FUCA 2HNTC 2F9VA 3T25A 3LH1A 1QBNA 2BVSH 3PO1B 4UE7H 2FOMB 5EOKA 4XDEA 2ZCLP 4CH2B 4I8KA 4MG3A 4K8BA 1GVKB 1KLIH 2A7CA 1H4WA 3F9EA 1MH0A 4X1QU 1P9SA 3VB3A 1XUGA 2DE8A 2VIPA 3SZNA 2DUCA 3NZIA 9LPRA 4UDWH 2AERH 4GHTA 1F5RA 1K1JA 2BY6X 3M3SA 2H9EH 5EXMA 1BZXE 1XVOA 1PPCE 1UVOA 2ANWA 4DG4A 1NROH 1OYTH 4WVPE 2VWLA 1T4UH 3Q77A 1DVAH 4KTSA 4I8HA 1BCUH 1KY9A 3VXFH 1SFQB 2XWBI 4RKOB 2P95A 1C5RA 1VJAU 2B5TB 2O8LA 2ILNA 5E0HA 1HIAB 1HAXB 1XXDA 3OY5U 4O3TA 1QL7A 1GBHA 4XBCA 1EJNA 3I78A 3LJOA 4Y71A 1WTGH 1GI1A 3RMNH 3RMMH 1O3EA 4ABBA 1QQ4A 1QRXA 3P70B 1UVSH 1WSSH 3FP6E 1WCZA 3TJUA 1RFNA 1O2WA 4YOIA 1JIRA 1NU7B 5JDUB 2BD4A 2FI5E 1S5SA 2GCTB 3RLWH 4R8TB 3L33A 4J1YA 5E8EH 5FPYA 3LIWA 1DFPA 2HALA 1KXCA 3MI4A 4M7GA 3M5OA 2W3IA 2ZGHA 3ZV9A 1EJAA 1GJCB 5A0AE 1OWEA 2GMTC 3RM0H 2AYWA 4UFGH 3GY6A 1AO5A 2W7UA 4WXIA 2FOFA 1FPCH 5C5NA 1AMHA 1TX8A 1CA0C 1GBKA 1GHBG 3UIRA 2BY8X 1AUJA 4AFQA 3U8TH 2I6SA 3PO1C 3BEUA 3TVJB 1CE5A 1PPHE 1F0RA 2ZFRH 1BJVA 4WH6A 1GCTB 1THSH 1N1LA 1NRSH 2IPHA 3S7HB 2FI3E 1ETSH 1Y3VA 4AN7A 2CN0H 1C1QA 2JETB 2I6QA 2QIQA 1NT1A 5GCHG 1UVTH 3B23B 3PV4A 1O2SA 5FPTA 2A7JA 1ELVA 1ARCA 2AS9A 1YCPM 4HFPB 4K1SA 1V2MT 3DD2H 4B73A 7LPRA 1KTSB 4YLQH 1QNJA 3GISB 3Q3KA 4A7IB 5C1XA 1JMOH 4AFSA 4FUGA 1GL1A 3KF2A 2HLCA 1F7ZA 2NU0E 1DPOA 1AB9B 1MBMA 2ZHFH 1ETTH 3TH3H 2AIPA 5DP3A 3ZZAA 1S83A 1QFKH 2ZA5A 2P94A 3SQHE 4FU7A 1HDTH 2Q6DA 3SN8A 1O33A 2Y82A 1UTOA 1MAYA 3UNSA 2EA3A 2VWNA 1TBZH 1J14A 1PPGE 1YCPK 3ZVCA 2V3HH 1GMCG 3ZZ8A 4ZROA 2XBXA 1K1OA 2C93B 3M35A 2B9LA 3E6PH 2VIWA 1S81A 3SV7A 4NIXA 5JPMH 1NRQH 1TB6H 5LPEA 2FDAA 2VH0A 2Q6GA 2GZ7A 2H9HA 3KQEA 2GCTC 2ODQA 1O31A 3D23A 5C3NA 4B71A 2NU2E 2Z9IA 3BTHE 1TOCB 3JZ1B 2BD7A 1O3JA 2QA9E 3TJVA 1GBEA 1BTYA 4CHAC 2H1UA 4MLFB 9ESTA 1G2LA 4ZKNU 3VB5A 2YNAA 1TWXB 2QY0B 4ESTE 3MWIU 2R3YA 4RN6A 2AH4X 5HMAA 1HXEH 3O8CA 3RXVA 1UVPA 3TH2H 1VR1H 2BXUH 1IQMA 1P06A 5E2OA 4BAMB 1C2LA 1TMBH 1ZHPA 3RXPA 1C2HA 3ZVBA 1SR5C 1ZGVA 3ZZ3A 1SGEE 4FVDA 1GHYH 3AW1A 4D8NA 2ZU1A 5J4QA 2JETC 1NFUA 1UTJA 1P2IA 3S9AA 5LPRA 1DT2A 1P05A 4I8JA 3E1XB 4INHA 1A5HA 2FYQA 1V2WT 3M5MA 1NY22 4BAHB 4CRFA 1SLWB 4K1EA 3UR9A 4VGCB 2C4FH 1WU1A 2BX4A 1FN8A 4NWLA 1AB9C 1O2MA 2GVFA 4YZUA 1XUHA 3FZDA 1TLDA 2V3OH 2A4QA 2ZU3A 3MU5A 3SO3A 3QDZB 1GBAA 4HTCH 4CRCA 1O2YA 3PLPA 1O3OA 3ZZCA 1SGRE 2BOHB 3F9FA 1JIMA 4IC5A 1O2OA 3VB4A 2ZPQA 4LOYH 1GJ7B 2ZU2A 3ZZ4A 5C20A 1YPKH 2G4TA 3MMGA 4UONA 6LPRA 2PKAA 5CMXH 2FOBA 1LVYA 1MZAA 1NRPH 2FI4E 3MNBA 1VITF 1ZRKA 2GCHF 2ZI2H 1FONA 1JBUH 2OUAA 3A7ZA 3ODDA 2TGPZ 3RXJA 4BTIB 1Z7KA 1WYKA 2SGDE 1UTQA 3TK6A 3BTEE 1IHTH 2GKVE 4UFEH 3HK3B 2VINA 4FVBA 2R2MB 2WPKS 4XFQA 1GBDA 3OY6U 1S6FA 3TH4H 2FO9A 2FS9A 2J4IA 4ISLA 1SQTA 1G3DA 3DHKH 1ID5H 1BTXA 2BQ7B 2BDBA 1AZZA 1T31A 1E37B 3HKJB 3MYWA 3LU9B 3EDXB 6ESTA 2UUFB 1XKAC 1O37A 3T27A 3UWIA 1SGNE 3PB1E 1UMAH 1GJ6A 1WTHD 2OBOA 3SV6A 1NTPA 1NRRH 4X2WA 1TGNA 5FAHA 1SLVB 2Z3EA 2C3SA 1SGPE 4X6OA 1QGFA 3ENSB 4YT7H 1SQOA 1O2VA 2D1JA 3GY7A 2P8OB 3URCA 2J95A 2D8WA 2PKAB 2STAE 3M7UA 2AGIX 2RDLA 5GXPA 1OP0A 2OLGA 2XXLA 1UHBB 2FOCA 2SNVA 2B0FA 1SHYA 1GWAA 1SGFG 1UTKA 5T6DA 1CT0E 3K6ZA 1INCA 4VGCC 1P2QA 2G4UA 1T32A 2IJOB 2GZ9A 1FIWA 2A45B 2QCYA 1O3GA 4OS2A 4WH8A 3F9HA 2CGAA 4HZHA 1MBQA 1GBMA 1QTFA 2PW8H 3V13A 2BX3A 2AMPA 1P8VC 4H6TA 4X6MA 3QWCH 1ZSJA 2BQWB 1KXAA 5CHAB 4AGJA 2AEIH 1MZDA 1C5MD 1HFDA 2BB4A 2PV9B 3ESTA 1P2MA 2P93A 1KSNA 2Z6BD 4TPIZ 1ZHMA 2BLOA 3SU1A 4BAKB 1QHRB 2BD2A 1EB1H 1YPHE 1DWCH 4CR9A 3K6YA 4ABDA 2HNTF 1O2PA 1TA2A 3A8CA 2VVUA 1CGIE 3SGQE 5C5OA 1OXGA 2PKSB 1SQAA 1QB1A 1C2GA 1EP5A 1FDPA 3SW2B 3LGYA 2RA3A 1LTOA 1A61H 4I32A 1W13U 2O8MA 5C67A 1EASA 5T6GA 2UWOA 3SBKA 3QZRA 5LGOA 3MNSA 5DP8A 2XWAA 2R2WU 5HYOA 2ZHEH 4JMYA 2BD8A 2WPJS 5FBIA 1Y59T 5FHTA 1KXEA 1HCGA 5G4BA 1UTLM 1DOJA 5FX6A 3LT3A 1EZQA 4INKA 1GBTA 1V2ST 3LKWA 1TA6A 3T26A 1TYNA 1ZTJA 2RA0A 2A1DB 4NGAH 1O3PB 1D3PB 2ZDVH 1Y5AT 4FUDA 2ZU5A 4MQAA 3MO9A 1YC0A 4BTUB 1HAOH 1O2JA 1AFEH 4X1NU 1L4ZA 1ZPCA 2P8OC 4U32A 1NESE 2F9BH 1NRNH 4NFFA 1SGQE 1GBBA 1SLUB 3MO6A 5E2PA 3S7KB 3UOUA 1O2RA 5EXNA 2Z94A 1MTNB 3MU4A 3RXBA 2F9PA 2BLQA 5AHGH 2P16A 3LGTA 4DVAU 2FWWA 1NO9H 1BUIA 1GVLA 3LGUA 3LPRA 1P12E 3BTGE 3D65E 4GUXA 5ESTE 5IYTA 3RC5A 3RXOA 2BVXH 1GHWH 5AFYH 1B5GH 1IQHA 5JBBS 1LVOA 3ODFA 2WINI 1UTNA 3PROA 1C1MA 4SGAE 4K2YA 5FX5A 4NZQA 4XBDA 1HJ8A 1Y3YA 4Q80A 1H9LB 1ZMLA 1P57B 5CHAC 1V2QT 2H6MA 1HUTH 2ZFTA 1XKBC 2KAIB 1J8AA 1ZSKA 4SGBE 2TGTA 2R0LA 3EE0B 4BAQB 2FOAA 1V2NT 1RTKA 3T62A 3SNDA 5GJ4B 3M7TA 2ZEBA 4INLA 3SU0A 3MNCA 4Q7YA 3A7VA 4KELA 1ABIH 1HPGA 2ZPRA 3TGIE 1FY8E 2VU8E 2XC5A 1LKAA 1GHZA 2PKSC 4X8UH 4A1XA 4UD9H 1WQSA 3IWMA 1BHXB 1V2JT 2OC8A 1GBFA 1ESAA 3TK9A 2PTNA 3TNTA 3SV9A 3M5LA 1ANBA 3BG4B 1J16A 1GBIA 3VXEH 2F9UA 1W2KH 1RXPA 1RGQA 4FUEA 5DP7A 5I25A 1UK4A 2QAAA 1LHCH 1Z8RA 2OC7A 4NA8A 2ZKSA 4Q7ZA 1CHOG 5DK1A 5A8XA 3STJA 4XBBA 5DKMA 5EXLA 4JZFH 5BRRE 2ZC9H 1C2KA 4Y6DA 2HPQH 1FY4A 1DWEH 1CGHA 4O3UA 2UUKB 3ZVGA 1OWHA 1BBRH 3U8OH 3V0XA 3LJJA 3K2UA 2J9NA 3GDUA 1LDTT 1DWDH 2PHBA 4Y8XA 4NCYA 1S6HA 1TQ0B 1AE8H 1TAWA 3ZZ7A 1A1RA 3LC3A 1SVPA 1QJ6B 1BRUP 1GJ9B 1O2IA 1K1NA 1C9TA 1EX3A 1MTNC 1L1GA 3N7OA 3BEFB 4ISNA 3S9CA 2WPHS 1L1JA 1MKWK 1A3BH 1E36B 1EB2A 2PGBB 2VB0A 1C2EA 3BTWE 5FCKA 4A1VA 5A2MH 1JRSA 5C2ZA 1OWKA 3QO6A 1IQKA 2AIQA 3MU1A 2P3UB 1HAIH 6CHAB 1LPKB 1OP8A 3UQVA 1A46H 2XBWA 2HWLB 2XTTB 3RXCA 3ZZ9A 1GMHF 5EU8A 1D3QB 1FNIA 1S85A 3HGPA 4MPUA 1DS2E 2R9PA 1N8OB 1MD7A 3RXFA 5EGMA 2PFEA 2F9OA 4ZHLU 1A4WH 2A31A 5JYIA 1LHEH 4ZXYH 2VVVA 1CGJE 4ZHMU 5DP5A 4DCDA 1A7SA 3CS0A 1ZLRA 5GDSH 3AVZA 1ZSLA 3GY4A 2VIDA 3RU4D 4CREA 1SGIB 7GCHG 1GI4A 1G3BA 4RSPA 2BD3A 2ANMH 3HK6B 1ZTKA 2QXIA 3SJ8A 2K1QA 4IN2A 3TJOA 3RXGA 1NS3A 1QCPA 1F5LA 2W5EA 4X2VA 3TLOA 4LXBH 1D3DB 3BG4C 1O2ZA 3SNCA 3GCTF 5SGAE 3ZV8A 1HYLA 2FMJA 1C1NA 1SC8U 1MUEB 2G5VA 1YBWA 2OD3B 1ZPZA 4B75A 1C4U2 1P04A 1ELBA 4AG1A 1N6YA 1Z6JH 4IC6A 5A0BA 1DX5M 5HM2A 1NZQH 1DSUA 1HNEE 4DY7B 2BDHA 1SHHB 3VPKA 1SG8B 3BTKE 1PPZA 1D9IA 3RXQA 1ORFA 2WPMS 1LCYA 3RDZA 1AKSB 1CT4E 4MNYA 3RXKA 3SUFA 3SU5A 1Q3XA 1W10U 1GI8B 3SNEA 2OCVB 3JZ2B 3MFJA 1G36A 2CHAB 2O9QA 2Y6TA 2ZQ2A 4WMFA 4UFDH 3RLYH 4MDSA 1H8DH 4QT8C 3UREA 2ZTYA 4ISIH 1CT2E 3URDA 5DPAA 1ELTA 3BSQA 3UFAA 2FS8A 2G81E 3VB6A 1VCQA 1HBTH 3SHCH 1AE5A 3A7WA 1A0HB 1TBQH 1GJ5H 4GCHF 1TNIA 3SU6A 1ESTA 3AW0A 6CHAC 3SJ9A 1W3CA 1MKXH 4AFUA 1GBJA 1DANH 1T8NA 2QN5T 5GWZA 2CV3A 4B76A 1MTSA 1V2OT 2ZFSA 3PTBA 1N8OC 3PLBA 3ZVAA 3A86A 1EXFA 1ACBE 1NC6A 4WY3A 1NFWA 3A8BA 1HAGE 3EA9A 4NWKA 1BTHH 5DP4A 8GCHF 5FPSA 1ABJH 1C2FA 1ELDE 3IITA 2GGVB 3AAVA 3PYHA 3LC5A 3Q00A 3BTQE 2ASUB 1LQEA 3HPTB 1Y5BT 3RMOH 1L2EA 4TPYA 1OWIA 1UK3A 1GG6B 4GSOA 4D76A 2GZ8A 1RD3B 4Y79A 1BDAA 3P8FA 3SUGA 2F3CE 5EQSA 1TPOA 1UCYK 2O8TA 1O5EH 1VGCB 1YPGH 3T5FH 2PTCE 5H4IB 3UWJH 1K22H 4AORA 1C1PA 4MNWA 4ABIA 4CRDA 3WY8A 3P95A 1WOFA 1AFQB 3F1SB 3FP8E 3HATH 3RXDA 1C5NH 2STBE 4D9RA 1QR3E 5F03A 4ZXXH 1GPZA 1TONA 2BDCA 2FESH 3L6PA 4FUBA 5HGGA 4E7RG 4TWWA 1GCTC 1K9OE 4X6NA 1CA8B 2CHAC 1O34A 1EZSC 1VJ9U 3GY5A 1BTWA 2ZCKP 1EP6A 2Y5GA 3NKKA 1HRTH 1YF4A 4ZUHA 1NFXA 1UCYE 6GCHF 1SGFA 1P01A 5GIBA 3OU0A 3MOCA 5C1YA 1TGCA 2QF3A 4IBLH 1O3NA 3EQ0H 1AWHB 3BIVH 4O97A 3RC4A 4NSVA 2HGTH 2OC1A 2ZDAH 1MQ5A 3DT0H 3SJIA 1C5WB 2O8UA 3GCHB 2PSXA 1O5FH 2Z3CA 4E7NA 1O3DA 1D6WA 2A2QH 1IHSH 2A4OA 4ABHA 3A87A 3NWUA 3P8OA 1HB0B 1NPMA 2BM2A 1TRMA 3MNXA 3PWCA 2ZO3H 2CJIA 5I46H 2LNCA 2ZF0H 1YLDA 3PWBA 2RG3A 1ZJKA 4JZEH 2EEKA 2VVCA 2H9TH 2VH6A