1H4WA

Structure of human trypsin iv (brain trypsin)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAVKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRYPSIN IVA
publication title Crystal structure reveals basis for the inhibitor resistance of human brain trypsin.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1h4wA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1h4wA02
2FX4A 1GL1A 4K69A 2GD4B 3TK6A 1RJXB 3QO6A 3ZVFA 2A4QA 4TYDA 1PPEE 4O9VA 1C5SA 2BQ6B 4ISIH 1YKTA 5LH8A 4LOYH 2A2QH 5C5OA 1GMCF 3WY8A 2C8ZB 1O32A 1T32A 1QL7A 1GMCG 5G4BA 1T4VH 2ZTYA 1O3CA 2QY0B 1C2EA 2K1QA 1GBFA 1T31A 3SV7A 3NWUA 2HLCA 1DVAH 1ZHMA 3SU2A 2P16A 1C2DA 2BD2A 4DCDA 1RTLA 4AFUA 3ITIA 3OYPA 2ZQ2A 1C2HA 1BTYA 2A7JA 2ZU3A 5F8XA 1TA6A 2UUJB 4I8GA 1P12E 3EQ0H 1GMDF 3HATH 2CJIA 1GG6C 3HK6B 4B76A 8GCHF 3FFGA 8GCHG 2ZDKA 3U8OH 1DE7H 3KL6A 1W12U 2LNCA 3KGPA 5DP6A 2A5KA 3JZ1B 5C1YA 1IQJA 4ZMAH 2J2UA 3DA9B 3U98H 1BTXA 5FPYA 4UONA 3O8RA 3L33A 2ZIQH 2JETC 1VZQH 4LXBH 1XUFA 5L2ZH 1T7CA 1KXAA 1ESTA 2ZDMA 1C2IA 1O2NA 3OY6U 1HAXB 4NFFA 3E1XB 3SUDA 3TPIZ 3VGCC 1GJCB 3VXEH 4XBCA 3MMGA 4JZIA 2R3UA 3DD2H 2Q1JA 3NK8A 2ZU5A 3NUMA 2NU4E 2PGBB 1ELBA 4B73A 1UTPA 1O5FH 3UQOA 1P09A 3TH2H 2GGVB 1P0SH 4A6LA 4U2WA 3D23A 1TFXA 1QB6A 3MO9A 3V7TA 4ABJA 2FWWA 2XC5A 5EXNA 1TIOA 4GCHF 1GI5A 2QV1A 4GCHG 3RMOH 2A45B 4WWYA 2GKVE 1T4UH 3ATLA 3U8RH 2VGCB 4FUJA 1CA0B 5EODA 3FZDA 1DSTA 1ZHPA 1Z6EA 4KTCA 1A3EH 2GDDA 1EOLA 4HGCA 1NN6A 1LQEA 1T8OA 2PFEA 3KHVA 3UNSA 1GDUA 3A7WA 1Z8RA 2ZPSA 3PMJA 1EPTC 2ANWA 4OS2A 2PTNA 5LPEA 2TGAA 1C5QA 1XKBC 3U8TH 2W3KA 1C1RA 2G4TA 1GCTB 1BDAA 1DWBH 1O3BA 1O2XA 2XBVA 1QFKH 2C3SA 4Y8XA 3SI4H 1S81A 3PMAB 4CH2B 2WPMS 3E6PH 1GGDB 2ALPA 1NRQH 3RC4A 5GIBA 2G5NA 4D9QA 1H9IE 1H1BA 2Y80A 1TQ7B 2BDBA 3K6YA 3QK1A 1HV7A 1O2VA 1EZUC 3S7KB 2ZHEH 2ZDLA 5B6OA 3PYHA 4NCYA 3GY5A 3ZZAA 9LPRA 4XFQA 1O3HA 2THFB 1GWAA 2O8WA 3EYDA 4A7IB 1MAXA 3FAOA 1AE8H 1C5UA 5JDUB 3IWMA 4MLFB 3H5CB 4ABEA 2AGIX 3SHCH 2STBE 3BTQE 1FY5A 1EX3A 4XE4A 1A0LA 1TE0A 1WSSH 3PMHB 1HFDA 4BAHB 1QY6A 1HJ9A 1VJ9U 2ZCHP 1JOUB 1ZPCA 3F9GA 1E36B 2J4IA 4U01A 4ZUHA 1T8LA 1Z1IA 2TPIZ 3Q76A 2CV3A 1IQNA 1HAVA 1L0ZA 4ZH8A 5JYIA 4WMDA 2JH5D 2CHAB 4IC5A 3SV6A 2VIWA 4MPXA 1BHXB 1PQ5A 1SGPE 1BUIA 5DP4A 1J17T 4FVBA 1BA8B 4DIIH 2ODQA 3ZVAA 1RFNA 3SHAH 2D2DA 2QIQA 3I29A 2OTVA 2JKHA 3RXQA 4A92A 1YPHE 1BB0B 1NTPA 1AQ7A 2QN5T 2FI5E 1EZSC 1DUEA 1GMHF 1PFXC 5DJ7A 1GMHG 1VITH 1GHYH 4MQAA 2NU3E 1ZTKA 5PTPA 1ANEA 2W7UA 2NU0E 2XC4A 2WINI 1VCPA 2SGEE 1EOJA 2BY8X 3A87A 5DP5A 3RXPA 2YNAA 2ZDVH 6GCHG 5DP8A 3P92A 3ZZ9A 3BIUH 1BRUP 1CT4E 3TJNA 1GBKA 4AX9H 6ESTA 2VWOA 1ANCA 2BDGA 1KXFA 2H5DA 2FOMB 4TWYA 2A0QB 2BYAX 1Z6JH 1MUEB 1YPGH 4ISNA 1O5CB 1V2KT 5A0CA 1KXEA 2HOBA 1GJ9B 1INCA 2V0BA 1A5IA 4ISLA 5C2ZA 1Y8TA 3GY3A 1MTVA 2GZ7A 1KTSB 2TBSA 1TPOA 4JCNA 5LPFA 3O8DA 3Q00A 3JZ2B 4FU9A 1GDNA 1TWXB 1P2MA 4CH8B 3BEFB 3K6ZA 3S9BA 3E90B 2ZCKP 4E7NA 1SGNE 2SGDE 4M7GA 1YPHC 1V2VT 4GSOA 3S0NA 1LKBA 1HRTH 5TJXA 3SNEA 1DITH 4KELA 2OQUA 1MD7A 5JBCS 5EW2H 1OP8A 4NWKA 1S6HA 2NU1E 2BD5A 1HXFH 3TJVA 4BAQB 2P8OC 7GCHF 3EA9A 1FXYA 3VGCB 1UCYK 1C1NA 4YM9A 1QJ6B 2R0LA 1P10A 1O33A 3RXDA 1K2I1 5T6DA 4Q2KA 1AY6H 5A2MH 1EAXA 1PQ7A 1RRKA 2FOCA 1QB1A 2TRMA 1JWTA 3RMNH 1THPB 3FP6E 4J1YA 1RIWC 1SQOA 3A88A 1DY8A 1V2NT 4TWWA 5E0HA 1EXFA 2ZO3H 1XUIA 1GVLA 4ZAEA 4KP0A 3SJ9A 2ZG0H 1ABIH 2ZNKH 3MWIU 3ENSB 3PROA 3QZRA 1F0UA 1O2SA 1PPHE 1C1SA 4B75A 1O3GA 1AVXA 4JYTA 3GY4A 1C5MD 1ELTA 4FU8A 4AORA 3T25A 2FYQA 1TPSA 5E2OA 5EQSA 3A8BA 3VB6A 1OXGA 3M61U 2HGTH 1XMNB 5IDKA 1G3BA 1SQTA 4Q7ZA 1Z8GA 4CR9A 2Y6TA 2H6MA 4ISHH 2ZTZA 3HPTB 1C5TA 1BBRH 3ZVDA 1H8IH 2ALVA 1O3FA 4Y71A 1CVWH 1QBVH 3RXIA 1S6FA 1K1LA 1GVZA 1NZQH 3UWJH 1TGBA 4X2WA 1K22H 1LPKB 2FS9A 2J9NA 4X1QU 3RXMA 4I33A 1DS2E 2AIPA 3E8LA 2AMPA 3NCLA 2XXLA 3ATIA 2ZU1A 3BTME 3SNCA 2H2ZA 1V2ST 2HNTE 3BTDE 2ZC9H 3RXVA 1O5DH 1O3NA 2QGRA 4GLYA 1C5NH 1ZGIA 1Y5UT 1GI4A 2ANYA 1MTWA 2A7CA 1LCYA 1MTNC 2FZZA 1G2LA 1KXCA 4YOIA 1WTHD 2EEKA 2VIQA 1GI1A 1YPKH 3SUEA 1DOJA 1EAUA 2P93A 2Y5HA 4OS6A 4JZ1A 2ZKSA 3U9AH 4AZ2B 1O3OA 1ZHRA 2AS9A 1EASA 1TNIA 1AZZA 2FOHA 3ODDA 2ZFRH 1DANH 3KCGH 4U30A 1V2JT 2XRCA 3W94A 4GAWA 1IHTH 6CHAC 1SG8B 1QR3E 1G9IE 3Q3KA 4AGKA 3GY7A 1AFQB 3LKWA 1CT0E 1O3LA 2BY5X 2VWLA 1SOTA 1D9IA 3SQHE 2BDYA 1AKSA 3SNBA 1MKWK 3RM0H 1U6QA 2YNBA 2ZFSA 3MNXA 3UR9A 4TPYA 5HGGA 2Z9KA 1S5SA 4Y11E 3BTTE 3UR6A 4NZQA 1N8OB 5L2YH 3BV9B 4Y79A 2R2MB 3TH4H 4RN6A 2HNTC 2W26A 3RLYH 4Y76A 2GMTB 2D26C 4DT7B 2ZECA 1EJMA 5EG4A 1Q2WA 1EZXC 4NFEA 3A7TA 1O5GH 2XNIA 4MNYA 2C8YB 1CT2E 1UVOA 4GVUA 4WMEA 2FXRA 1SR5C 4UFFH 4TY7A 3U1IB 1HYLA 5GCHF 1MTSA 4DW2U 5GCHG 1GVKB 5E2PA 1UVTH 1BIOA 2F9VA 5I25A 1GCTC 1Y3WA 2Z3EA 3O8CA 1P06A 1O2JA 3MNBA 2PGQB 1O2GH 5L6NH 1HIAA 4YO9A 4MVNA 1O5EH 1C1QA 1GGDC 1P02A 5JBTA 1UCYH 1SLVB 1O5BB 1LHGH 1QNJA 3H7TA 3AVZA 3MFJA 3QGNB 4K2YA 1MQ5A 2G8TA 1GBTA 1OS8A 5C5NA 1K1MA 1FIWA 2P8OB 2WPKS 3RC6A 1GBEA 2XTTB 1ARBA 4Q7YA 2QXHA 1WQVH 1W0YH 1GI3A 2HVXA 3Q77A 1NFXA 3ODFA 1P9UA 1AU8A 3NPSA 2B8OH 1WAYB 2H9EH 4X8SH 2RA0A 2FIRH 3MH6A 1LHCH 1A0HB 2P3TB 1DUAA 2BX3A 2DE8A 5HYOA 5A09A 1CE5A 1GDQA 1RIWB 1WQSA 3VB4A 1GBDA 1A2CH 1J14A 2P95A 4GHTA 1HAGE 2FO9A 1TX6A 1S0RA 2CHAC 2BX4A 5ESTE 1HIAB 1XM1A 2DE9A 4XDEA 3TVJB 2I6QA 1B5GH 3FVFB 4O3TA 4BAKB 4YLUA 4SGBE 1K9OE 3L3TA 5EQQA 2UUFB 1V2TT 1BMNH 3Q3YA 1LHFH 1THRH 5C3NA 3EAJA 1C2MA 4WVPE 2SGPE 1P9SA 1KLJH 3FP7E 3BG4C 1OP0A 2OLGA 3RXCA 1H4WA 1WU1A 1IHSH 1CGHA 4PROA 4WH8A 4WF8A 1NESE 1Q31A 5DK1A 1ELFA 3LGWA 1BTUA 1ORFA 1SSXA 3IG6B 1UTOA 2ZZUH 1KIGH 4JZDH 2ZFQH 1EQ9A 2XC0A 2BOHB 1UHBA 1UJ1A 2F9NA 2XWAA 1GPZA 5ESBA 1W0ZU 2Z7FE 1GHVH 4ZXXH 1SMFE 1UK2A 1EB2A 1FPHH 2Z9LA 4R8TB 3V0XA 1MZDA 1CA8B 1KTTB 4JZFH 2FODA 3M5NA 2BQWB 1ZJDA 1GI7B 2IOTA 2WYJA 1GJ6A 1NC6A 3A7ZA 2M5TA 1A3BH 3MOCA 3NKKA 4JZEH 1SGDE 2F9OA 4OS7A 1YPMH 4MG3A 5E8EH 4DY7B 1DDJA 2PKAA 1AWHB 2HALA 1E35B 1YC0A 4Y7AA 3PLPA 1TNKA 1DLEA 2ZHQH 1OWEA 2XCNA 3UWIA 4MPUA 3TGJE 3SNAA 2XWBI 4YTAA 3GICB 2CF9H 1O36A 1MTNB 1DFPA 3FP8E 4FUDA 5F6MA 2Y5GA 1L1NA 4AFSA 3VXFH 1IOEA 4AG2A 3A83A 1F7ZA 1ZJKA 1DM4B 1P8VC 2GV6A 6LPRA 1IQEA 1C9PA 1UHBB 4AG1A 3AW1A 1MKWH 3SI3H 1AFEH 5FHTA 5LGOA 5LPRA 1ZPBA 5JBAS 5F8ZA 6CHAB 5SGAE 3MO6A 4Y10E 2PKSB 1KXDA 1GHBF 4ABGA 1GHBG 1C5PA 1GBBA 3E3TA 1ZZZA 2IJOB 1XXDA 3RXRA 1QBNA 4ZHAA 2BZ6H 3SU6A 2Y7XA 4D8NA 1K28D 1QRWA 3UQVA 5EPYA 4KTUA 1KLIH 2G5VA 2XW9A 1QGFA 1QL8A 3BG8A 1GBJA 2KAIA 1ANDA 1GJ5H 3QDZB 3A7VA 4AN7A 5C20A 1MCTA 1IQMA 3QGJA 3MNSA 1XX9A 4CRGA 2B7DH 2STAE 1BMMH 2VVCA 1TGCA 1FDPA 1AMHA 1HGTH 1EAWA 2AGGX 2J38A 3D65E 4BNRA 4XOJA 1O31A 3RXTA 2V3HH 5EPNA 3SO3A 3RXUA 4IS5A 3V13A 3TNTA 1HUTH 1AGJA 4QT8C 1XKAC 3A80A 1O34A 4LK4A 2V35A 1SLXB 4MTBA 2VINA 3E16B 3ZZCA 1AI8H 5FXLA 3MH4A 1TBZH 3ZYEA 1W8BH 2XBYA 2R2WU 1J8AA 3ATWA 3F1SB 1G3DA 1S85A 3RXGA 1DXPA 3M36A 2BLVA 4B1TA 4JK5A 1NPMA 1BRAA 4NWLA 3UOUA 2ZF0H 3OY5U 2FOBA 2A32A 2HRVA 3KIDU 3M37A 1TNJA 5AFZH 1BBRK 4AFZA 3KQDA 2QA9E 8KME2 1P3CA 2F83A 1V2LT 1AIXH 2JH6D 1SHHB 1MH0A 2PSYA 2OBOA 3BTHE 3T62A 1ZYOA 5A8ZA 4JYUH 2P3UB 3ZZ6A 2J34A 5EXMA 5J4QA 1QIXB 1FUJA 4H42U 1KLTA 4FUFA 1ZMJA 4RKJB 3UFAA 1OOKB 1ID5H 1O3KA 1LPGB 1ZSLA 2CGAA 4VGCB 1CHOF 3GCHB 1FNIA 1SGQE 1P2QA 1CHOG 5AVDA 1GI9B 1ACBE 1ESBA 4INLA 4YLQH 2BB4A 1F92A 2F9UA 1EZQA 3RXHA 3ZZ5A 4E7RG 1C5YB 1P05A 1ZLRA 1W2KH 1C1PA 4X8VH 1BOQA 3C27B 4YESB 7KMEH 1DSUA 4DG4A 1GI6A 2P59A 4NG9H 3QLPH 1J16A 4Z6AH 2ZCLP 3BEIB 2GCTC 2XBXA 3M35A 2VH0A 2G52A 3KF2A 1UVUH 1AFQC 2Z9GA 4WXIA 1FJSA 1QRZA 2ZI2H 2BD4A 4JYVH 1OYQA 2OP9A 3LGYA 5C1UA 1GHAG 5FCRA 3BG4B 1EATA 3BIVH 4DIHH 1DWDH 2GT7A 3D49H 2O8LA 4F49A 1D3QB 2ZGCA 4O03A 1E37B 4DGJA 3ZZ7A 3K9XB 1VITF 3ZVBA 1N8OC 1W13U 1VITG 3GISB 6GCHF 1YGCH 4X8TH 3P8NA 1AWFH 2GMTC 2R0KA 1FAKH 1J15A 1C1VH 1O3DA 1HAVB 1IQIA 3PWCA 2TGTA 4X6MA 2P94A 3A7XA 3DHKH 4CR5A 1OYTH 3UPEA 4K60A 3BTGE 3RMLH 3BTWE 3A81A 4D7FA 1AN1E 3SGQE 3BTFE 5EOKA 1CGIE 1O0DH 3URCA 1JBUH 1C5VA 4K3JA 5L30H 1YLDA 4DVAU 4RKOB 2FLBH 4MNWA 3PTBA 1YBWA 2AGEX 4IMZA 5DP9A 3N7OA 3MU4A 2BLOA 3KEEA 5FPTA 2ULLA 3VB3A 5F03A 4FU7A 1ELCA 2PW8H 4JMYA 1O2KA 3HKIB 3SJ8A 4FUIA 1NROH 2R9PA 4K1TA 1SFQB 1K21H 1TBQH 2RA3A 1SQAA 3TLOA 1TX7A 2OINA 3A85A 3GY8A 5AFYH 1HNEE 1CSOE 3B9FH 1ELDE 1NFWA 1TOCB 2H9HA 3A89A 1HAYB 2VNTA 1BTHH 3ESTA 2BY9X 1RGQA 2ZPQA 4YOJA 2EA3A 2ZWLH 3EA7A 4BTUB 3TJUA 3W95A 3GDSA 1XVOA 1HLTH 3TK5A 2A1DB 2ASUB 1EPTA 2AMDA 1AB9C 4CRFA 3GYLB 5A0BA 1MKXH 1C5XB 1P57B 3VEQB 3MU8A 1BTPA 1SGIB 4Q7XA 1QA7A 4WY3A 1ELEE 1FLEE 1LVMA 3DT0H 3MI4A 1BITA 4X6PA 1UVSH 4NA7A 2G55A 4ZKRU 5FCKA 1A4WH 4XBBA 1XUGA 1B0EA 1SHYA 3HGPA 1HPGA 1A0JA 1HDTH 2Y5FA 3GCOA 1D3TB 1DY9A 5DO4H 1ZSJA 4U32A 1K1PA 3M5MA 5JB8S 1TONA 4OGYA 1A61H 1C5WB 1EJAA 2BTCE 2V6NA 4H4FA 2WV4A 5ETXA 4LZ1H 1GBAA 1ZRKA 1K1OA 4FXGH 1GJ7B 1Y3YA 1FY1A 4WXVA 2ZHFH 1SGYE 2BLWA 1F5RA 4K1SA 1Z71A 4MPWA 1GCDA 1O2WA 1S83A 2FOGA 3F68H 3M5OA 2FYRA 5CMXH 4J2YB 1GHZA 1LHEH 2UUKB 4CRCA 3QWCH 4NGAH 3RC5A 2OC8A 4K5ZA 1AD8H 1V6DA 9ESTA 2A4OA 4YZUA 2VVVA 2QC2A 3KQCA 3P6ZB 4HI3A 1DX5M 1TABE 2UUYA 2EI7A 1C2JA 1WCZA 4CRDA 2TGPZ 4NZLA 1ELGA 3UIRA 3G01A 2GDEH 2Z9IA 4X6OA 2ZU4A 3RXEA 3RU4D 2RCEA 3UOPA 3VB5A 3ZZ3A 3M5LA 1YCPH 2ZPRA 3RP2A 1GI0A 3PO1C 1C2KA 1FQ3A 5HMAA 4ABIA 2GCTB 3GCTF 4A1TA 2PKSC 1MZAA 3LJOA 3GCTG 1O3JA 4AB9A 2FOAA 1OWDA 1P01A 1YF4A 3HGNA 2D8WA 4X2YA 3TITA 4MDSA 1LDTT 1O39A 3UREA 2WUCA 1P2JA 3BTKE 1LKAA 1O3AA 2PUXB 1ZTLA 2CMYA 1E34B 1UVPA 1PQAA 1W7GH 1UTQA 3E91A 2Z6BD 2JH0D 1E0FD 1TNLA 4THNH 1GBHA 3QN7A 4OS4A 1BMAA 2PR3A 2HPPH 1DWEH 3SV2H 5HM9A 2QAAA 4ZKOU 3RXJA 1SL3A 1YPEH 3A82A 1XUKA 4IN2A 3SN8A 4ZHLU 1ARCA 2GT8A 3IITA 1NRNH 5FBEA 3SZNA 2Q6DA 1HAZB 5GDSH 1TALA 3RU4T 3SW2B 3MO3A 4UFDH 1Y5BT 3P70B 5CHAB 1KY9A 2ZTXA 1MTUA 4I8HA 4Y6DA 1O2IA 1ZR0A 2OXSA 3B8JA 2QF0A 2ZHDA 2UWPA 4KTSA 2GX4A 1EP5A 2VH6A 2BDHA 3MH5A 1RS0A 1CO7E 1C1TA 1AKSB 1GJ4H 1W14U 2R3YA 2SGAA 2Z9JA 3FZZA 1C2LA 3BF6H 1PYTD 1IAUA 1ZMNA 4NIVA 4CRBA 3E0PB 5T6GA 4FUBA 1S0QA 1Z1JA 3M3TA 1UTKA 1FAXA 4CBOA 3S9AA 1D6WA 3STJA 1TBRH 4NA8A 5IYTA 1KYNA 1SI5H 3CS7A 5BPEA 1OP2A 2ZGBH 4NIWA 5EW1H 1HBTH 1BZXE 1UMAH 4BXSA 3TJOA 4AYVB 1C5RA 1ZRBA 3KQBA 1G37A 1KDQA 2O8TA 3URDA 1MU8B 4VGCC 2WPHS 4B2BA 3GCHC 5JBBS 1L4ZA 2ANKH 3GDUA 2ZGHA 1XUHA 4Y7BA 1QJ7B 4INHA 3UTUH 4D9RA 1LVBA 1N6YA 3P8GA 2PTCE 3FANA 1AB9B 3S69A 3T26A 1O2LA 1ZTJA 3ZZBA 1FV9A 4K1EA 2WPIS 2FS8A 3LH1A 1YM0A 3CENA 2ZQ1A 3R0FA 3O8BA 2FI3E 2VB0A 2GVFA 1TGSZ 4A5TS 3DUXH 1HAHH 4WMFA 4OGXA 1BHXF 2GCHG 4GPGA 2VWMA 1TNHA 3B23B 2C93B 1DPOA 4O97A 1L2EA 4NSVA 2ZU2A 5EQRA 2ZA5A 4ZKNU 1HAIH 5F8TA 1RTKA 1NS3A 1G30B 3VB7A 4FVDA 4ABFA 3ELAH 1QTFA 1UTNA 1KDQB 3LGUA 1VCWA 2ZEBA 2QXIA 1ETTH 2A5AA 2TGDA 2NWNA 2OUAA 2BHGA 1T8MA 2A2XH 1TGTA 2BXTH 3ZVGA 4FUGA 1O5AB 4Z0KA 3ZZ4A 1EB1H 1QJ1B 2J92A 3UUZA 2J95A 5DPAA 1OX1A 2FP7B 3PTNA 3T2NA 4I7YH 2O9QA 2VIOA 1JXPA 3MU0A 1LHDH 2FESH 4ZHMU 3I77A 5H4IB 2SFAA 2WV5A 2OC0A 2EC9H 2W3IA 2PUQH 1SGFG 3RXFA 5C67A 1ESAA 2BZAA 3KQEA 1LPZB 5TCCA 4BAMB 4TPIZ 5JPMH 1QBOA 1HB0B 1O3MA 2XCFA 1TYNA 1E38B 1M9UA 1FZZA 1PPBH 1GMDG 1DXWA 1TOMH 1GJBB 4ABAA 4MNVA 2OD3B 1O2HA 3ZV9A 4F4OC 2BVXH 4WH6A 3CS0A 1YLCA 1F5LA 1GBCA 1YP9A 2DUCA 3QZQA 4LZ4B 2Z3DA 3PO1B 1BTZA 3SGAE 1O3EA 2QYIA 3LIWA 1O38A 2A31A 1SFIA 1FN8A 2ZFTA 1F0RA 2B0FA 3QX5H 4YT7H 2H5CA 1MD8A 4UFGH 3ZZ8A 5EXLA 3F9FA 4A1VA 2PKAB 1C1WH 1P2KA 1O35A 1TX8A 1ZGVA 1C4V2 1PPCE 3DFJA 1BMLA 4CHAC 1NU7B 1WYKA 1ELAA 3T27A 4BXWA 4Y8YA 3PLBA 3SORA 1A5GH 3M7QA 4TY6A 1O2TA 4GHQA 5HXFA 1ETSH 4CBNA 5DKMA 1MU6B 1C9TA 4GUXA 2J94A 3I78A 4B74A 1C1UH 2AMQA 1LO6A 1JRTA 1MKXK 4HZHA 5FX5A 3LH3A 3TK9A 2OCVB 3T29A 3SUGA 1CGJE 2C8XB 2A7HA 5FX6A 3SQEE 1O2MA 1OKXA 4E06H 5CE1A 1O3IA 2H1UA 1P03A 1PQ8A 3ATKA 4UD9H 4B71A 3UNRA 2A4RA 1MCVA 2D1JA 2FPZA 1EUFA 1HJ8A 2WYGA 2PHBA 1C2FA 2AYWA 5AF9H 2AIQA 2BD7A 3M3VA 1NM6A 1O2QA 1UTLM 1BRCE 5HM2A 5GXPA 2BD3A 1WBGB 3RMMH 4UDWH 2AEIH 2C4FH 3GY2A 1SGRE 5C1XA 2VIPA 4K8BA 1AVGH 2KAIB 1FN6A 1VCQA 3SU0A 2QXGA 2BD8A 2BLQA 2F91A 1VJAU 1YCPM 4B2AA 1TAWA 5DG6A 1ZPZA 2BXUH 3TIUA 1TPAE 2BMGB 3BEUA 1LMWB 2BOKA 3CP7A 1UK3A 1BQYA 5EGMA 3SV8A 3LOXA 2I6SA 1C1OA 2LPRA 3RXSA 1MAYA 1V2UT 1NO9H 3BN9A 3RU4E 1C5OH 4X0WU 2UWOA 1GBLA 3GYMA 1OWKA 2VIDA 3RUOA 4INKA 2FDAA 1K1IA 3A8DA 2VVUA 1P2NA 2AH4X 3VFEA 2IN2A 2UWLA 2G51A 3LGTA 1D6RA 1HAOH 3SOSA 3S7HB 3RM2H 2C8WB 4SGAE 4HFPB 1SOZA 4DOQA 1ZOMA 1QQ4A 2ZGXH 3Q3XA 4ABBA 2CXVA 1QB9A 1SGCA 1SPJA 3LC5A 1BJVA 2BQ7B 2O8UA 2FI4E 5A8YA 1T8NA 2ZFFH 1RD3B 1JMOH 3SU5A 1K1NA 4OS5A 4IMQA 5FPSA 5A0AE 4FUCA 2BVRH 1SLUB 2G00A 1GHAF 1VGCC 1YCPK 3PLKA 4H6SB 4X1RU 3SU1A 1P2IA 1O30A 3P8OA 3ATMA 3ZZDA 1S84A 1FY4A 1SGFA 1QHRB 1TGNA 2V3OH 5GPIB 1KXBA 1EP6A 3H7OA 4IGDA 3T5FH 1D3DB 3AW0A 2G81E 4ESTE 5EU8A 4A1XA 2FOEA 1BRBE 1EJNA 4OS1A 3UNQA 2Y7ZA 2ZGJA 4DURA 2A5IA 2OC7A 2FEQH 2H9TH 1Y3VA 5AHGH 4UFEH 4FUHA 3M7UA 3K65B 5A8XA 2OBQA 4NA9H 4I8JA 3DFLA 1SBWA 1V2MT 5I46H 1S82A 1D3PB 1NFYA 3LPRA 1QL9A 3QUMP 5CHAC 1N1LA 1XVMA 2ODPA 1A5HA 2BY6X 2FLRH 1ANBA 1O2OA 3EA8A 1OWHA 2QF3A 2WUBA 1DWCH 1KSNA 3A7YA 3OSYA 4X6NA 4BTTB 2PWXA 2BY7X 2F9PA 4XBDA 5GWZA 1NY22 1W3CA 4H6TA 2GTBA 1J9CH 4NIXA 3TU7H 3LGIA 4BAOB 1O37A 2ILNA 1H9HE 2ZFPH 3PV4A 2GZ8A 4MNXA 1GG6B 1GJAB 1IQFA 3SU4A 1QA0A 1UO6A 3F9EA 1WV7H 4BOHA 1GI2A 3EDXB 1QCPA 1GBIA 4ZROA 2ESTE 2B5TB 3TNSA 3P17H 4R0IA 3LC3A 1XXFA 2W5EA 2JETB 1GHWH 3SJKA 3EE0B 1HXEH 2BDAA 4AGJA 1JRSA 1NRSH 1B0FA 1BT7A 1TLDA 1CBWC 3ZYDA 1GBMA 5FBIA 1BBRE 7GCHG 1GL0E 2HPQH 2NU2E 8ESTE 5K0HA 1EKBB 1HJAC 2EI6A 1AZ8A 1TNGA 3L6PA 3U69H 7ESTE 3MHWU 3MH7A 4CHAB 2PSXA 1YPLH 1MBMA 1PJPA 5BRRE 1AUJA 4ZXYH 2GZ9A 3A86A 1NT1A 2WPJS 4D76A 4I8LA 1SLWB 2CN0H 1PYTC 3SV9A 4Y8ZA 1ABJH 1DICA 3SBKA 2RG3A 4HTCH 1YYY1 1FI8A 3OX7U 2SNVA 4BTIB 1Z7KA 3MU5A 2FTLE 3HK3B 1IQKA 4CRAA 1L4DA 1TMBH 2FOFA 4ISOA 1LVOA 4Q80A 3R3GB 3U1JB 3TH3H 2BDIA 1UTJA 4X2XA 1NFUA 4AFQA 1GI8B 2OQ5A 1P04A 3E0NB 1O2PA 1ETRH 1WOFA 2AFQB 2VWNA 1L1JA 4WJG2 4B2CA 1V2RT 1V2OT 2Z94A 4UEHH 3TGIE 2AERH 5DP3A 3UY9A 1LQDB 1BTWA 1PPFE 4YT6H 2W7SA 1CU1A 4RSPA 1ZMLA 1EPTB 4X1PU 5J4SA 1O3PB 3RXOA 1AUTC 4MPVA 1FIZA 1WUNH 1HAPH 2Q6GA 2F3CE 1K1JA 1A46H 2F9BH 4AB8A 1C4U2 1B7XB 3AAVA 3NXPA 3AAUA 2VU8E 2BD9A 2Q6FA 4NIYA 3GDVA 1DT2A 1TA2A 1TMTH 1QQUA 2IPHA 2RDLA 2Z3CA 4UE7H 4X1NU 1UTMA 1W11U 3ZVEA 1Y3UA 3GY6A 4YOGA 1C5LH 1O2ZA 3LT3A 5ABWA 5FAHA 1C2GA 2FX6A 3P8FA 2YOLA 1W10U 2SNWA 1ELVA 5K7RA 1FMGA 3AASA 1FY8E 1P11E 4Y0YE 1JIRA 1O2YA 1OWIA 3F9HA 5DGJA 3D62A 3A84A 1VR1H 4E05H 1OPHB 1F5KU 2TIOA 3KN2A 1EAIA 3KNXA 2Y81A 1F2SE 1F0TA 3M3SA 3MTYA 3GOVB 2GV7A 1Y5AT 2A4GA 4X2VA 1QURH 1CHGA 3LJJA 1SVPA 2P3FH 1C5ZB 4IC6A 1ZSKA 4ZKSU 1LTOA 1VGCB 2Y82A 3GCNA 2BVSH 4CREA 1G3CA 1D4PB 1C1MA 1MBQA 5T6FA 1FY3A 1V2QT 4KGAA 3HKJB 3SJIA 3K2UA 3T28A 1NU9A 1UCYE 4I31A 2SGQE 3A8AA 3RDZA 3VPKA 2QCYA 1O2UA 3SNDA 1TB6H 3S9CA 2CF8H 3RXBA 2FMJA 1G36A 1Z8JB 4Y0ZE 1H9LB 1HCGA 1V3XA 2HNTF 4XSKU 4ABHA 1H8DH 1V2PT 2QXJA 3SUFA 1MQ6A 4O3UA 1TMUH 1C4Y2 4AYYB 2VGCC 5JB9S 4I32A 4IBLH 1RTFB 1IQLA 5E0JA 1TPPA 1CA0C 3LONA 1YPJH 1P2OA 3OU0A 3LU9B 4IN1A 2VIVA 3V12A 1TQ0B 1G3EA 3PWBA 3RXKA 1Q3XA 1QRXA 5GJ4B 3A8CA 2PLXA 1Y59T 3RLWH 1AO5A 1N6XA 3BSQA 4KKDA 1TRYA 5TCAA 2G4UA 1V2WT 4DJZB 2XBWA 2EI8A 4JK6A 7LPRA 2OC1A 2O8MA 3PMBB 4K8YA 3OTJE 3RXLA 2FTMA 1GJDB 1XUJA 1AVWA 3LGVA 5DP7A 4AOQA 2BDCA 4X8UH 1NRRH 1OWJA 1Z8IB 2ZDAH 2PV9B 4I8KA 3SU3A 3BTEE 3TGKE 1UK4A 1IQGA 1THSH 1PPGE 2ODYB 1P3EA 1SC8U 3QTVH 4ABDA 3SJOA 1LVYA 1CBWB 1CQQA 5T3HA 1FPCH 1F0SA 1SGTA 4D7GA 1HJAB 3ZV8A 8LPRA 1TRNA 3MYWA 1Y3XA 1A7SA 1RXPA 1TRMA 4FUEA 3STIA 3P95A 2B9LA 3ZVCA 1SB1H 2XYAA 4BANB 1A1RA 1NRPH 2GCHF 2SGFE 2HWLB 3M7TA 3NZIA 3SGBE 2ANMH 1BJUA 1BCUH 3LDXH 1SGEE 2C90B 3C1KA 1G2MA 3QTOH 1OSSA 3MU1A 2GP9B 1W7XH 1L1GA 1WTGH 3V3MA 1AE5A 1IQHA 1GJ8B 1AHTH 1MMJN 2VJ1A 1PPZA 3F6UH 2ZHWH 3MNCA 2WPLS 3PB1E 4ASHA 2BM2A 2ZP0H 2FM2A 1O2RA 1DLKB 4NSYA 1FONA 4IW4E 3PM3A 4X1SU 1X7AC 5E0GA 3EGKH 3RXAA 1JIMA 1G32B 2ZDNA 1GHXH
chains in the Genus database with same CATH superfamily
2FX4A 1GL1A 4K69A 2GD4B 3TK6A 1RJXB 1MABB 3QO6A 3ZVFA 2A4QA 3KYFA 4TYDA 1PPEE 4O9VA 4RT1A 1C5SA 2BQ6B 4ISIH 1YKTA 5LH8A 4LOYH 2A2QH 5C5OA 1GMCF 3WY8A 2C8ZB 1O32A 1T32A 1QL7A 1GMCG 5G4BA 1T4VH 2ZTYA 1O3CA 2QY0B 1C2EA 2K1QA 1GBFA 5KGOA 1T31A 3WW7A 3SV7A 3NWUA 2HLCA 1DVAH 1ZHMA 3SU2A 2P16A 1C2DA 2BD2A 4DCDA 1RTLA 4AFUA 3ITIA 3OYPA 4ACBA 2ZQ2A 1C2HA 1BTYA 2A7JA 2ZU3A 5F8XA 1TA6A 2UUJB 4I8GA 1P12E 3EQ0H 1GMDF 3HATH 2CJIA 1GG6C 3HK6B 4B76A 8GCHF 3FFGA 8GCHG 2ZDKA 3U8OH 1DE7H 3KL6A 1W12U 2LNCA 3KGPA 5DP6A 2A5KA 3JZ1B 5C1YA 1IQJA 4ZMAH 2J2UA 3DA9B 3U98H 1BTXA 5FPYA 4UONA 3O8RA 3FN8A 3L33A 2ZIQH 2JETC 1VZQH 4LXBH 1XUFA 5L2ZH 1T7CA 1KXAA 1ESTA 2ZDMA 1C2IA 4FETA 1O2NA 3OY6U 1NBME 1HAXB 4NFFA 3E1XB 3SUDA 3TPIZ 3VGCC 1GJCB 3VXEH 4XBCA 3MMGA 4JZIA 2R3UA 2K0QA 3DD2H 2Q1JA 3NK8A 2ZU5A 3NUMA 2NU4E 2PGBB 1ELBA 3PRBA 4B73A 1UTPA 1O5FH 3UQOA 1P09A 5C94A 3TH2H 2GGVB 1P0SH 4A6LA 4AC9A 4U2WA 3F0OA 3D23A 1TFXA 1QB6A 3MO9A 3V7TA 4ABJA 2FWWA 2XC5A 5EXNA 1TIOA 4GCHF 1GI5A 5HIZA 2QV1A 4GCHG 3RMOH 2A45B 4WWYA 2GKVE 1T4UH 3ATLA 3U8RH 2VGCB 3SYJA 4FUJA 1CA0B 5EODA 3FZDA 1DSTA 1ZHPA 1Z6EA 4KTCA 1A3EH 2GDDA 1EOLA 4HGCA 1NN6A 1LQEA 1T8OA 2PFEA 3KHVA 3UNSA 1GDUA 3A7WA 5KECA 1Z8RA 1W0KD 2ZPSA 3PMJA 1EPTC 2ANWA 4OS2A 2PTNA 5LPEA 2TGAA 1C5QA 2KR7A 1XKBC 3U8TH 2W3KA 1C1RA 2G4TA 1GCTB 1BDAA 1DWBH 1O3BA 1O2XA 2XBVA 1QFKH 2C3SA 4Y8XA 3SI4H 1S81A 3PMAB 4CH2B 2WPMS 3E6PH 1VKYA 1GGDB 2ALPA 1NRQH 3RC4A 5GIBA 2QF5A 2WHXA 2G5NA 4D9QA 1H9IE 1H1BA 2Y80A 1TQ7B 2BDBA 3K6YA 3OTPA 3QK1A 1HV7A 1O2VA 1EZUC 3S7KB 2ZHEH 2ZDLA 5B6OA 3PYHA 4NCYA 3GY5A 3ZZAA 9LPRA 4XFQA 1O3HA 2THFB 1GWAA 2O8WA 3EYDA 4A7IB 1MAXA 3FAOA 1AE8H 1C5UA 5JDUB 3IWMA 4MLFB 3H5CB 4ABEA 2AGIX 3SHCH 2STBE 3BTQE 1FY5A 1EX3A 4XE4A 1A0LA 1TE0A 1WSSH 3PMHB 1HFDA 4BAHB 1QY6A 1HJ9A 1VJ9U 2ZCHP 1JOUB 1ZPCA 3F9GA 1E36B 2J4IA 4U01A 4ZUHA 1T8LA 1Z1IA 2TPIZ 5IK2D 1H8HD 3Q76A 2CV3A 1IQNA 1HAVA 1L0ZA 4ZH8A 5JYIA 4WMDA 2JH5D 2CHAB 4IC5A 3SV6A 2VIWA 4MPXA 1BHXB 1PQ5A 1SGPE 1BUIA 5DP4A 1J17T 4FVBA 1BA8B 4DIIH 2ODQA 3ZVAA 3PV5A 1RFNA 3SHAH 2D2DA 2QIQA 3I29A 2OTVA 2JKHA 3RXQA 4A92A 1YPHE 1BB0B 1NTPA 1AQ7A 2QN5T 2FI5E 1EZSC 1DUEA 1GMHF 1PFXC 5DJ7A 1GMHG 1VITH 1GHYH 4MQAA 2NU3E 1ZTKA 5PTPA 4OM9A 1ANEA 2W7UA 2NU0E 2XC4A 2WINI 1VCPA 2SGEE 1EOJA 2BY8X 3A87A 5DP5A 3RXPA 2YNAA 2ZDVH 6GCHG 5DP8A 3P92A 3ZZ9A 3BIUH 1BRUP 2L74A 1CT4E 3TJNA 1GBKA 2W6JD 4AX9H 2WSSD 6ESTA 2VWOA 1ANCA 2BDGA 1KXFA 2H5DA 2FOMB 4TWYA 2A0QB 2BYAX 1Z6JH 1MUEB 1YPGH 4ISNA 5HIYA 1O5CB 1V2KT 5A0CA 1KXEA 2HOBA 1GJ9B 1INCA 2V0BA 1A5IA 4ISLA 5C2ZA 1Y8TA 3GY3A 1MTVA 2GZ7A 1KTSB 2TBSA 1TPOA 4JCNA 5LPFA 3O8DA 3Q00A 3JZ2B 4FU9A 1GDNA 1TWXB 2WZQA 1P2MA 4CH8B 3BEFB 3K6ZA 3S9BA 3E90B 1UW7A 2ZCKP 4E7NA 1SGNE 2SGDE 4M7GA 1YPHC 1V2VT 4GSOA 2V7QD 3S0NA 1LKBA 1HRTH 5TJXA 3SNEA 1DITH 4KELA 2OQUA 1MD7A 5JBCS 3CNRA 5EW2H 1OP8A 4NWKA 1S6HA 2NU1E 2BD5A 1HXFH 3TJVA 4BAQB 2P8OC 7GCHF 3EA9A 1FXYA 3VGCB 1UCYK 1C1NA 4YM9A 1QJ6B 2R0LA 1P10A 1O33A 3RXDA 1K2I1 5T6DA 4Q2KA 1AY6H 5A2MH 1EAXA 1PQ7A 1RRKA 2FOCA 1QB1A 2TRMA 1JWTA 3RMNH 1THPB 5DN6D 3FP6E 4J1YA 1RIWC 1SQOA 3A88A 1DY8A 1V2NT 4TWWA 5E0HA 3UB0A 1EXFA 2ZO3H 1XUIA 1GVLA 4ACAA 4ZAEA 4KP0A 3SJ9A 2ZG0H 2L6OA 1ABIH 2ZNKH 3MWIU 3ENSB 3PROA 3QZRA 1F0UA 1O2SA 1PPHE 1C1SA 5FL7D 4B75A 1O3GA 1AVXA 3OEHD 4JYTA 3GY4A 1C5MD 1ELTA 4FU8A 4AORA 3T25A 2FYQA 3FOAA 4TSFD 1TPSA 5E2OA 5EQSA 3A8BA 3VB6A 1OXGA 3M61U 2HGTH 1XMNB 5IDKA 1G3BA 1SQTA 4Q7ZA 1Z8GA 4CR9A 2Y6TA 2H6MA 4ISHH 1EFRD 2KX4A 2ZTZA 3HPTB 1C5TA 1BBRH 5HKKD 3ZVDA 1H8IH 2ALVA 1O3FA 4Y71A 1CVWH 1QBVH 3RXIA 1S6FA 1YY3A 1K1LA 1GVZA 1NZQH 3UWJH 1TGBA 4X2WA 1K22H 1LPKB 2FS9A 2J9NA 4X1QU 3RXMA 4I33A 1DS2E 2AIPA 3E8LA 2AMPA 3NCLA 2XXLA 3ATIA 2ZU1A 3BTME 3SNCA 2H2ZA 1V2ST 2HNTE 3BTDE 2ZC9H 4XD7D 1O5DH 3RXVA 1O3NA 2QGRA 4GLYA 1C5NH 1ZGIA 1Y5UT 1GI4A 2ANYA 2LP6A 1MTWA 2A7CA 1LCYA 1MTNC 2FZZA 1G2LA 1KXCA 4YOIA 5EIYA 1WTHD 2EEKA 2VIQA 1GI1A 1YPKH 3SUEA 1DOJA 1EAUA 2P93A 2Y5HA 4OS6A 4JZ1A 2ZKSA 3U9AH 4AZ2B 1O3OA 1ZHRA 2AS9A 1EASA 1TNIA 1AZZA 2FOHA 3ODDA 2ZFRH 1DANH 3KCGH 4U30A 1V2JT 2XRCA 3W94A 4GAWA 1IHTH 6CHAC 1SG8B 1QR3E 1G9IE 3Q3KA 4AGKA 2RDEA 3GY7A 1AFQB 3LKWA 3MQKC 1CT0E 1O3LA 2BY5X 2VWLA 1SOTA 1D9IA 3SQHE 2BDYA 1AKSA 3SNBA 1MKWK 3RM0H 1U6QA 2YNBA 2ZFSA 3MNXA 3UR9A 4TPYA 5HGGA 2Z9KA 1S5SA 4Y11E 3BTTE 3UR6A 4NZQA 1N8OB 5L2YH 3BV9B 4Y79A 2JJ2D 2YMSB 2R2MB 3TH4H 4RN6A 2HNTC 2W26A 3RLYH 4Y76A 2GMTB 2D26C 4DT7B 2ZECA 1EJMA 5EG4A 1Q2WA 1EZXC 4NFEA 3A7TA 1O5GH 2XNIA 3H09A 4MNYA 2C8YB 1CT2E 1UVOA 4GVUA 4WMEA 2FXRA 1SR5C 4UFFH 4TY7A 3U1IB 1HYLA 5GCHF 1MTSA 4DW2U 5GCHG 1GVKB 5E2PA 1UVTH 1BIOA 2F9VA 5I25A 1GCTC 1Y3WA 2Z3EA 3O8CA 1P06A 1O2JA 3MNBA 2PGQB 1O2GH 5L6NH 1HIAA 4YO9A 4MVNA 3GS9A 1O5EH 1C1QA 1GGDC 1P02A 5JBTA 1UCYH 1SLVB 1O5BB 1YLNA 1LHGH 5GNDA 1QNJA 3H7TA 3AVZA 3MFJA 2J98A 3QGNB 4K2YA 1MQ5A 2G8TA 1GBTA 1OS8A 5C5NA 1K1MA 1FIWA 2P8OB 2WPKS 3RC6A 1GBEA 2XTTB 1ARBA 4Q7YA 2QXHA 1WQVH 1W0YH 1GI3A 2HVXA 3Q77A 1NFXA 2QF4A 3ODFA 1P9UA 1AU8A 3NPSA 2B8OH 1WAYB 2H9EH 4X8SH 2RA0A 2FIRH 3MH6A 1LHCH 1A0HB 2P3TB 1DUAA 2BX3A 2DE8A 5HYOA 3PRDA 5A09A 1CE5A 1GDQA 1RIWB 1WQSA 3VB4A 1GBDA 1A2CH 1J14A 2P95A 4GHTA 1HAGE 2FO9A 1TX6A 1S0RA 2CHAC 2BX4A 5ESTE 1HIAB 1XM1A 2DE9A 4XDEA 3TVJB 2I6QA 1B5GH 3FVFB 4O3TA 4BAKB 4YLUA 4SGBE 1K9OE 2IPQX 3L3TA 5EQQA 2UUFB 1V2TT 1BMNH 3Q3YA 1LHFH 1THRH 5C3NA 3EAJA 1H8ED 1C2MA 4WVPE 2SGPE 1P9SA 1KLJH 3FP7E 3BG4C 1OP0A 2OLGA 3RXCA 1H4WA 1WU1A 1IHSH 1CGHA 4PROA 4WH8A 4WF8A 1SQRA 1NESE 1Q31A 5DK1A 1ELFA 3LGWA 1BTUA 1ORFA 1SSXA 3IG6B 1UTOA 2ZZUH 1KIGH 3WWBA 4JZDH 2ZFQH 1EQ9A 2XC0A 2BOHB 1UHBA 1UJ1A 2F9NA 3WWFA 2XWAA 1GPZA 5ESBA 1W0ZU 2Z7FE 5C0TA 1GHVH 4ZXXH 1SMFE 1UK2A 1EB2A 1FPHH 2Z9LA 4R8TB 3V0XA 1MZDA 1CA8B 1KTTB 4JZFH 4P00A 2FODA 3M5NA 2BQWB 1ZJDA 1GI7B 2IOTA 4TT3D 2WYJA 1GJ6A 1NC6A 3A7ZA 2M5TA 1A3BH 3MOCA 3NKKA 4JZEH 1SGDE 2F9OA 4OS7A 1YPMH 4MG3A 5E8EH 3FKSD 4DY7B 1DDJA 2PKAA 1AWHB 2HALA 1E35B 1YC0A 4Y7AA 3PLPA 1TNKA 1DLEA 2ZHQH 1OWEA 2XCNA 3UWIA 4MPUA 3TGJE 3SNAA 2XWBI 4YTAA 3GICB 2CF9H 1O36A 1MTNB 1DFPA 3FP8E 4FUDA 5F6MA 2Y5GA 1L1NA 4AFSA 3VXFH 1IOEA 4AG2A 3A83A 1F7ZA 1KMHB 1ZJKA 2RFKC 1DM4B 1P8VC 2GV6A 6LPRA 1IQEA 1C9PA 1UHBB 4AG1A 3AW1A 1MKWH 3SI3H 1AFEH 2GJGA 5FHTA 5LGOA 5LPRA 1ZPBA 5JBAS 5F8ZA 6CHAB 5SGAE 3MO6A 4Y10E 2PKSB 1KXDA 1GHBF 4ABGA 1GHBG 1C5PA 1GBBA 3E3TA 1ZZZA 2IJOB 1XXDA 3RXRA 1QBNA 4ZHAA 2BZ6H 3SU6A 2Y7XA 4D8NA 1K28D 1QRWA 3UQVA 5EPYA 4KTUA 1KLIH 2G5VA 2XW9A 1QGFA 1QL8A 3BG8A 1GBJA 2KAIA 1ANDA 1GJ5H 2HLDD 3QDZB 3A7VA 4AN7A 5C20A 1MCTA 1IQMA 3QGJA 3MNSA 1XX9A 4CRGA 2B7DH 2STAE 3AK5A 1BMMH 2VVCA 1TGCA 1FDPA 1AMHA 1HGTH 1EAWA 2AGGX 2J38A 3D65E 4BNRA 4XOJA 1O31A 2QE7D 3RXTA 2V3HH 5EPNA 3SO3A 3RXUA 4IS5A 3V13A 3TNTA 1HUTH 1AGJA 4QT8C 1XKAC 3A80A 1O34A 4LK4A 2V35A 3F0PA 1SLXB 4F55A 4MTBA 2VINA 3E16B 3ZZCA 1AI8H 4ASUD 5FXLA 3MH4A 1TBZH 3ZYEA 1W8BH 2CK3D 2R2WU 2XBYA 1J8AA 3ATWA 3F1SB 1G3DA 1S85A 3RXGA 1DXPA 3M36A 2BLVA 2M2AA 4B1TA 4JK5A 1NPMA 1BRAA 4NWLA 3UOUA 2ZF0H 3OY5U 2FOBA 2A32A 2HRVA 3KIDU 3DSOA 3M37A 1TNJA 5AFZH 1BBRK 4AFZA 3KQDA 2QA9E 8KME2 1P3CA 2J5UA 2F83A 1V2LT 1AIXH 2JH6D 1SHHB 1MH0A 2PSYA 2OBOA 3BTHE 3T62A 1ZYOA 5A8ZA 4JYUH 2P3UB 3ZZ6A 2J34A 2F4LA 5EXMA 5J4QA 1QIXB 1FUJA 4H42U 1KLTA 4FUFA 1ZMJA 4RKJB 3UFAA 1OOKB 1ID5H 1O3KA 1LPGB 1ZSLA 2CGAA 4VGCB 1CHOF 3GCHB 1FNIA 1SGQE 1P2QA 1CHOG 2KM0A 5AVDA 1GI9B 1ACBE 1ESBA 4INLA 4YLQH 2BB4A 1F92A 2F9UA 1EZQA 3RXHA 3ZZ5A 4E7RG 1C5YB 1P05A 1ZLRA 1W2KH 1C1PA 2KFWA 4X8VH 1BOQA 3C27B 4YESB 7KMEH 1DSUA 4DG4A 1GI6A 2P59A 4NG9H 3QLPH 1J16A 4Z6AH 2ZCLP 3BEIB 2GCTC 2XBXA 3M35A 2VH0A 2G52A 3KF2A 2XNDD 1UVUH 1AFQC 2Z9GA 4WXIA 1FJSA 1QRZA 2ZI2H 2BD4A 4JYVH 1OYQA 2OP9A 3LGYA 5C1UA 1GHAG 1WXRA 5FCRA 3BG4B 1EATA 3BIVH 4DIHH 1DWDH 2GT7A 3D49H 2O8LA 4F49A 1D3QB 4RT0A 2ZGCA 4O03A 1E37B 4DGJA 3ZZ7A 3K9XB 1VITF 3ZVBA 1N8OC 1W13U 1VITG 3GISB 6GCHF 1YGCH 4X8TH 3P8NA 2YMSC 1AWFH 5C0UA 2GMTC 2R0KA 1FAKH 1J15A 1C1VH 1O3DA 1HAVB 1IQIA 3PWCA 2TGTA 4X6MA 2P94A 3A7XA 3DHKH 4CR5A 1OYTH 3UPEA 4K60A 3BTGE 3RMLH 3BTWE 3A81A 4D7FA 1AN1E 3SGQE 3BTFE 5EOKA 1CGIE 1O0DH 3URCA 1JBUH 1C5VA 4K3JA 5L30H 1YLDA 4DVAU 4RKOB 2FLBH 4MNWA 3PTBA 2PP6A 1YBWA 2AGEX 4IMZA 5DP9A 2V3MA 3N7OA 3MU4A 2BLOA 3KEEA 5FPTA 2ULLA 3VB3A 5F03A 4FU7A 1ELCA 2PW8H 4JMYA 2KCPA 3ZIAD 5DSFA 1O2KA 3HKIB 3SJ8A 4FUIA 1NROH 2R9PA 4K1TA 1SFQB 1K21H 1TBQH 2RA3A 1SQAA 3TLOA 1TX7A 2OINA 3A85A 2OK5A 3GY8A 4HG6A 5AFYH 1HNEE 1CSOE 3B9FH 1ELDE 1NFWA 1TOCB 2H9HA 3A89A 1HAYB 2WV9A 2J97A 2VNTA 1BTHH 3ESTA 2BY9X 1RGQA 2ZPQA 5CDFE 4YOJA 2EA3A 2ZWLH 3FO8D 3EA7A 4BTUB 3TJUA 3W95A 3GDSA 1XVOA 1HLTH 3TK5A 2A1DB 2ASUB 1EPTA 2AMDA 1AB9C 4CRFA 3GYLB 5A0BA 5KEDA 1MKXH 1C5XB 1P57B 3VEQB 3MU8A 1BTPA 1SGIB 4Q7XA 1QA7A 1NBMD 4WY3A 1ELEE 1FLEE 1LVMA 3DT0H 3MI4A 1BITA 4X6PA 1UVSH 4NA7A 1WDIA 2G55A 2LELA 4ZKRU 3F2GA 5FCKA 1A4WH 4XBBA 1XUGA 1B0EA 1SHYA 3HGPA 1HPGA 1A0JA 1HDTH 2Y5FA 3GCOA 1D3TB 1DY9A 5DO4H 2KCYA 2KZ4A 1ZSJA 4U32A 1K1PA 3M5MA 5JB8S 1TONA 4OGYA 1A61H 1C5WB 1EJAA 2BTCE 2V6NA 4H4FA 2WV4A 5ETXA 4LZ1H 2JJ1D 1GBAA 1ZRKA 1K1OA 4FXGH 1GJ7B 2WPDD 1Y3YA 1FY1A 4WXVA 2ZHFH 1SGYE 2BLWA 1F5RA 4K1SA 1Z71A 4MPWA 1GCDA 1O2WA 1S83A 2FOGA 3F68H 3M5OA 2FYRA 5CMXH 4J2YB 1GHZA 1LHEH 2UUKB 4CRCA 3QWCH 4NGAH 3RC5A 2OC8A 4K5ZA 1AD8H 1V6DA 9ESTA 2A4OA 4YZUA 2VVVA 2QC2A 3DSPA 3KQCA 3P6ZB 4HI3A 1DX5M 1TABE 3OAAD 2UUYA 2EI7A 1C2JA 1WCZA 4CRDA 2TGPZ 4NZLA 1ELGA 5T1VA 3UIRA 3G01A 2GDEH 2Z9IA 2XOKD 4X6OA 2ZU4A 3RXEA 3RU4D 2RCEA 3UOPA 3VB5A 3ZZ3A 3M5LA 1YCPH 2ZPRA 3RP2A 1GI0A 3PO1C 1C2KA 1FQ3A 5HMAA 4ABIA 2GCTB 3GCTF 4A1TA 2PKSC 1MZAA 3LJOA 3GCTG 1O3JA 4AB9A 2FOAA 1OWDA 1P01A 1YF4A 3HGNA 2D8WA 4X2YA 3TITA 4MDSA 1LDTT 1O39A 3UREA 2WUCA 1P2JA 3BTKE 1LKAA 3F2FA 1O3AA 2PUXB 1ZTLA 2CMYA 1E34B 1UVPA 1PQAA 1W7GH 1UTQA 3E91A 2Z6BD 1K0HA 2JH0D 1E0FD 1TNLA 4THNH 1GBHA 3QN7A 4OS4A 1BMAA 2PR3A 2HPPH 1DWEH 3SV2H 5HM9A 4YXWD 2QAAA 4ZKOU 3RXJA 1SL3A 1YPEH 3A82A 1XUKA 4IN2A 3SN8A 4ZHLU 2JDID 1ARCA 2GT8A 3IITA 1NRNH 5FBEA 3SZNA 2Q6DA 1HAZB 3NRLA 5GDSH 1TALA 2F43B 3RU4T 3SW2B 3MO3A 4UFDH 1Y5BT 3P70B 5CHAB 1KY9A 2ZTXA 1MTUA 4I8HA 3UAIC 4Y6DA 1O2IA 1ZR0A 2OXSA 3B8JA 3PV2A 2QF0A 2ZHDA 2UWPA 4KTSA 2GX4A 2W6ID 1EP5A 2VH6A 2BDHA 3MH5A 1RS0A 4RI0A 3KQ5A 1CO7E 3F2HA 1C1TA 1AKSB 1GJ4H 1W14U 2R3YA 2SGAA 2Z9JA 3FZZA 1C2LA 3BF6H 1PYTD 1QZ8A 1IAUA 2EQNA 1ZMNA 4NIVA 4CRBA 3E0PB 5T6GA 4FUBA 1S0QA 1Z1JA 3M3TA 1UTKA 1FAXA 4CBOA 3S9AA 3DCLA 1D6WA 3OE7D 3STJA 1TBRH 4NA8A 5IYTA 1KYNA 1SI5H 3CS7A 5BPEA 1OP2A 2ZGBH 4NIWA 5EW1H 1HBTH 1BZXE 1UMAH 4BXSA 3TJOA 4AYVB 1C5RA 1SKYE 1ZRBA 3KQBA 1G37A 1KDQA 2O8TA 3URDA 1MU8B 4VGCC 2WPHS 4B2BA 3GCHC 5JBBS 1L4ZA 2ANKH 3GDUA 2ZGHA 1XUHA 4Q4LA 1QJ7B 4Y7BA 4INHA 3UTUH 4D9RA 1LVBA 1N6YA 3P8GA 2PTCE 3FANA 1AB9B 3S69A 3T26A 1O2LA 3N7EA 1ZTJA 3ZZBA 1FV9A 4K1EA 2WPIS 2FS8A 3LH1A 1YM0A 3CENA 2ZQ1A 3R0FA 3O8BA 2FI3E 2VB0A 2GVFA 3EE7A 1TGSZ 4A5TS 3DUXH 1HAHH 4WMFA 4OGXA 1BHXF 2GCHG 4GPGA 2J98B 3W1EA 2VWMA 1TNHA 3B23B 2C93B 1W0JD 1DPOA 4O97A 1L2EA 4NSVA 2ZU2A 5EQRA 2ZA5A 4ZKNU 1HAIH 2K8IA 5F8TA 1RTKA 3VG8A 1NS3A 1G30B 3VB7A 4FVDA 4Z1MD 4ABFA 3ELAH 1QTFA 1UTNA 1KDQB 3LGUA 1VCWA 2ZEBA 2QXIA 1ETTH 2A5AA 2TGDA 2NWNA 2OUAA 2BHGA 1T8MA 2A2XH 1TGTA 2BXTH 3ZVGA 4FUGA 1O5AB 4Z0KA 3ZZ4A 1EB1H 1QJ1B 2J92A 4I86A 3UUZA 2J95A 5DPAA 1OX1A 2FP7B 3PTNA 3T2NA 4I7YH 2O9QA 2VIOA 1JXPA 3MU0A 1LHDH 2FESH 4ZHMU 3I77A 3KYGA 3DSGA 5H4IB 2SFAA 2WV5A 2OC0A 2EC9H 2W3IA 2PUQH 1SGFG 3RXFA 5C67A 1OHHD 1ESAA 2BZAA 3KQEA 1LPZB 5TCCA 4BAMB 4TPIZ 5JPMH 1QBOA 1HB0B 1O3MA 2XCFA 1TYNA 1E38B 1M9UA 1FZZA 1PPBH 1GMDG 1DXWA 1TOMH 1GJBB 4ABAA 4MNVA 2OD3B 1O2HA 3ZV9A 4F4OC 2BVXH 4WH6A 3CS0A 1YLCA 1F5LA 1GBCA 1YP9A 2DUCA 3QZQA 4LZ4B 2Z3DA 3PO1B 1BTZA 3SGAE 1O3EA 2QYIA 3LIWA 1O38A 2A31A 1SFIA 1FN8A 2ZFTA 1F0RA 2B0FA 3QX5H 4YT7H 2H5CA 1MD8A 4UFGH 1S6LA 3ZZ8A 5EXLA 3F9FA 4A1VA 2PKAB 1C1WH 1P2KA 1O35A 1TX8A 1ZGVA 1C4V2 1PPCE 3DFJA 1BMLA 4CHAC 1NU7B 1WYKA 2KCAA 1ELAA 3T27A 4BXWA 4Y8YA 3PLBA 3SORA 1A5GH 3M7QA 4TY6A 1O2TA 4GHQA 5HXFA 1ETSH 4CBNA 5DKMA 1E1QD 1MU6B 1C9TA 4GUXA 2J94A 3I78A 4B74A 1C1UH 2AMQA 1LO6A 1JRTA 1MKXK 4HZHA 5FX5A 3LH3A 3TK9A 2OCVB 3T29A 3SUGA 1CGJE 2C8XB 2A7HA 5FX6A 3SQEE 1O2MA 1OKXA 4E06H 5CE1A 1O3IA 2H1UA 1P03A 1PQ8A 3ATKA 4UD9H 4B71A 3UNRA 2A4RA 1MCVA 2D1JA 2FPZA 1EUFA 1HJ8A 2WYGA 2PHBA 1C2FA 2AYWA 5AF9H 2AIQA 2BD7A 3M3VA 1NM6A 1O2QA 3U28C 1UTLM 1BRCE 5HM2A 5GXPA 2BD3A 1WBGB 3RMMH 4UDWH 2AEIH 2C4FH 3GY2A 1SGRE 5C1XA 2VIPA 4K8BA 2EY4C 1AVGH 2KAIB 5F53A 1FN6A 1VCQA 3SU0A 2QXGA 2BD8A 2BLQA 2F91A 1VJAU 1YCPM 5CHBA 4B2AA 1TAWA 5DG6A 1ZPZA 2BXUH 3TIUA 5C17A 1TPAE 2BMGB 3BEUA 1LMWB 2BOKA 3CP7A 1UK3A 1BQYA 5EGMA 3SV8A 3LOXA 2VBCA 2I6SA 1C1OA 2LPRA 3RXSA 1MAYA 1V2UT 1NO9H 3BN9A 3RU4E 1C5OH 4X0WU 2UWOA 1GBLA 3GYMA 1OWKA 2VIDA 3RUOA 4INKA 2FDAA 1K1IA 3A8DA 1COWD 2VVUA 1P2NA 2AH4X 3VFEA 2IN2A 2UWLA 2G51A 3LGTA 1D6RA 1HAOH 3SOSA 3S7HB 3RM2H 2C8WB 4SGAE 4HFPB 1SOZA 4DOQA 1ZOMA 1QQ4A 2ZGXH 3Q3XA 4ABBA 2CXVA 3OFND 1QB9A 1SGCA 1SPJA 3LC5A 1BJVA 2BQ7B 2O8UA 2FI4E 5A8YA 1T8NA 2ZFFH 3F3BA 1FX0B 1RD3B 1JMOH 3SU5A 1K1NA 4OS5A 4IMQA 5FPSA 5A0AE 4FUCA 2BVRH 1SLUB 2G00A 1GHAF 1VGCC 1YCPK 3PLKA 4H6SB 4X1RU 3SU1A 1P2IA 1O30A 3P8OA 3ATMA 3ZZDA 1S84A 1FY4A 1SGFA 1QHRB 1TGNA 2V3OH 5GPIB 1KXBA 1EP6A 3H7OA 4IGDA 3T5FH 1D3DB 3AW0A 2G81E 4ESTE 5EU8A 5EJ1A 4A1XA 2FOEA 1BRBE 1EJNA 4OS1A 3UNQA 2Y7ZA 2ZGJA 4DURA 2A5IA 2OC7A 1E79D 2FEQH 2H9TH 1Y3VA 5AHGH 4UFEH 4FUHA 3M7UA 3K65B 5A8XA 2OBQA 4NA9H 4I8JA 3DFLA 1SBWA 1V2MT 5I46H 1S82A 1D3PB 1NFYA 3LPRA 1QL9A 3QUMP 5CHAC 1N1LA 1XVMA 2ODPA 1A5HA 2BY6X 2FLRH 1ANBA 1O2OA 3EA8A 1OWHA 2QF3A 2WUBA 1DWCH 1KSNA 3A7YA 3OSYA 4X6NA 4BTTB 2PWXA 2BY7X 2F9PA 4XBDA 5GWZA 1NY22 1W3CA 4H6TA 2GTBA 1J9CH 4NIXA 3TU7H 3LGIA 4BAOB 1O37A 2ILNA 1H9HE 2ZFPH 3PV4A 2GZ8A 4MNXA 1GG6B 1GJAB 1IQFA 3SU4A 1QA0A 1BMFD 1UO6A 3F9EA 1WV7H 4ZCNA 4BOHA 1GI2A 3EDXB 1QCPA 1GBIA 4ZROA 2ESTE 2JIZD 2B5TB 3TNSA 3P17H 4R0IA 3LC3A 1XXFA 2W5EA 2JETB 1GHWH 3SJKA 3EE0B 1HXEH 2BDAA 4AGJA 1JRSA 1NRSH 1B0FA 1BT7A 1TLDA 1CBWC 3ZYDA 1GBMA 5FBIA 1BBRE 7GCHG 1GL0E 2HPQH 2NU2E 8ESTE 5K0HA 1EKBB 1HJAC 2EI6A 1AZ8A 1TNGA 3L6PA 3U69H 7ESTE 3MHWU 3MH7A 4CHAB 2PSXA 1YPLH 1MBMA 1PJPA 5BRRE 1AUJA 4ZXYH 2GZ9A 3A86A 1NT1A 2WPJS 4D76A 4I8LA 1SLWB 2CN0H 1PYTC 3SV9A 4Y8ZA 1ABJH 1DICA 3SBKA 2RG3A 4HTCH 1YYY1 1FI8A 3OX7U 2SNVA 4BTIB 1Z7KA 3MU5A 2FTLE 3HK3B 2IJD1 1IQKA 4CRAA 1L4DA 1TMBH 2FOFA 4ISOA 1LVOA 4Q80A 3R3GB 3U1JB 3TH3H 2BDIA 1UTJA 4X2XA 1NFUA 5EJZA 1GI8B 4AFQA 1P04A 2OQ5A 3E0NB 1O2PA 1ETRH 1WOFA 2AFQB 2VWNA 1L1JA 4WJG2 4B2CA 1V2RT 1V2OT 2Z94A 4UEHH 3TGIE 2AERH 5DP3A 3UY9A 1LQDB 1BTWA 1PPFE 4YT6H 4B6EA 2W7SA 1CU1A 4RSPA 1ZMLA 1EPTB 4X1PU 5J4SA 1O3PB 3RXOA 1AUTC 4MPVA 1FIZA 1WUNH 1HAPH 2HVYB 2Q6GA 2F3CE 1K1JA 1A46H 2F9BH 4AB8A 1C4U2 1B7XB 3AAVA 3NXPA 3AAUA 2VU8E 2BD9A 2Q6FA 4NIYA 3GDVA 1DT2A 1TA2A 1TMTH 1QQUA 2IPHA 2RDLA 2Z3CA 4UE7H 4X1NU 1UTMA 1YWUA 1W11U 2AHME 3ZVEA 1Y3UA 3GY6A 4YOGA 1C5LH 1O2ZA 3LT3A 5ABWA 5FAHA 1C2GA 2FX6A 3P8FA 2YOLA 1W10U 2SNWA 1ELVA 5K7RA 1FMGA 3AASA 1FY8E 1P11E 4Y0YE 1JIRA 1O2YA 1OWIA 3OEED 3F9HA 5DGJA 3D62A 3A84A 1VR1H 4E05H 1OPHB 1F5KU 2TIOA 3KN2A 2YMSD 1EAIA 3KNXA 2Y81A 1F2SE 1F0TA 3M3SA 3MTYA 3GOVB 2GV7A 3N7DA 1Y5AT 2A4GA 4X2VA 1QURH 4XRNA 1CHGA 3LJJA 1SVPA 2P3FH 1C5ZB 4IC6A 1ZSKA 4ZKSU 1LTOA 1VGCB 2Y82A 3GCNA 2BVSH 4CREA 1G3CA 1D4PB 1C1MA 1MBQA 5T6FA 1FY3A 1V2QT 4KGAA 3HKJB 3SJIA 3K2UA 3T28A 1NU9A 1UCYE 4I31A 2SGQE 3A8AA 3RDZA 3VPKA 2QCYA 1O2UA 3SNDA 1TB6H 3S9CA 2CF8H 3SZEA 3RXBA 2FMJA 1G36A 1Z8JB 4Y0ZE 1H9LB 1HCGA 1V3XA 2HNTF 4XSKU 4ABHA 4F48B 1H8DH 1V2PT 2QXJA 3SUFA 1MQ6A 4O3UA 1TMUH 1C4Y2 4AYYB 2VGCC 4P02A 4B6FA 5JB9S 4I32A 4IBLH 1RTFB 1IQLA 5E0JA 1TPPA 1CA0C 3LONA 1YPJH 1P2OA 3OU0A 3LU9B 4IN1A 2VIVA 3V12A 1TQ0B 1G3EA 3PWBA 3RXKA 1Q3XA 1QRXA 5GJ4B 3A8CA 2PLXA 1Y59T 5EJLA 3RLWH 1AO5A 1N6XA 3BSQA 4KKDA 1TRYA 5TCAA 2G4UA 1V2WT 4DJZB 2XBWA 2EI8A 4JK6A 7LPRA 4DT4A 2OC1A 2O8MA 3PMBB 4K8YA 3OTJE 3RXLA 2FTMA 1GJDB 1XUJA 1AVWA 3LGVA 5DP7A 4AOQA 2BDCA 4X8UH 1NRRH 1OWJA 1Z8IB 2ZDAH 2PV9B 4I8KA 3SU3A 3BTEE 3TGKE 1E1RD 1UK4A 1IQGA 1THSH 1PPGE 2ODYB 1P3EA 1SC8U 3QTVH 4ABDA 3SJOA 1LVYA 1CBWB 1CQQA 5T3HA 1FPCH 1F0SA 1SGTA 4D7GA 1HJAB 3ZV8A 8LPRA 1TRNA 3N99A 3MYWA 1Y3XA 1A7SA 2KCOA 1RXPA 1TRMA 4FUEA 4Q63A 3STIA 3P95A 2B9LA 3ZVCA 1SB1H 2XYAA 4BANB 1A1RA 1NRPH 2GCHF 2SGFE 2HWLB 3M7TA 3NZIA 3SGBE 2ANMH 1BJUA 1BCUH 3LDXH 1SGEE 2C90B 3C1KA 4FOUC 1G2MA 3QTOH 1OSSA 3MU1A 2GP9B 1W7XH 1L1GA 1WTGH 3V3MA 1AE5A 1IQHA 1GJ8B 1AHTH 1MMJN 2VJ1A 1PPZA 3F6UH 2ZHWH 3MNCA 2WPLS 3PB1E 4ASHA 2BM2A 2ZP0H 2FM2A 1O2RA 1DLKB 4NSYA 1FONA 5B6LA 4IW4E 3PM3A 4X1SU 1X7AC 5E0GA 3EGKH 4M9FA 3RXAA 1JIMA 1G32B 2ZDNA 1GHXH
chains in the Genus database with same CATH topology
2FX4A 1GL1A 4K69A 2GD4B 3TK6A 1RJXB 3QO6A 3ZVFA 2A4QA 4TYDA 1PPEE 4O9VA 1C5SA 2BQ6B 4ISIH 1YKTA 5LH8A 4LOYH 2A2QH 5C5OA 1GMCF 3WY8A 2C8ZB 1O32A 1T32A 1QL7A 1GMCG 5G4BA 1T4VH 2ZTYA 1O3CA 2QY0B 1C2EA 2K1QA 1GBFA 1T31A 3SV7A 3NWUA 2HLCA 1DVAH 1ZHMA 3SU2A 2P16A 1C2DA 2BD2A 4DCDA 1RTLA 4AFUA 3ITIA 3OYPA 2ZQ2A 1C2HA 1BTYA 2A7JA 2ZU3A 5F8XA 1TA6A 2UUJB 4I8GA 1P12E 3EQ0H 1GMDF 3HATH 2CJIA 1GG6C 3HK6B 4B76A 8GCHF 3FFGA 8GCHG 2ZDKA 3U8OH 1DE7H 3KL6A 1W12U 2LNCA 3KGPA 5DP6A 2A5KA 3JZ1B 5C1YA 1IQJA 4ZMAH 2J2UA 3DA9B 3U98H 1BTXA 5FPYA 4UONA 3O8RA 3L33A 2ZIQH 2JETC 1VZQH 4LXBH 1XUFA 5L2ZH 1T7CA 1KXAA 1ESTA 2ZDMA 1C2IA 1O2NA 3OY6U 1HAXB 4NFFA 3E1XB 3SUDA 3TPIZ 3VGCC 1GJCB 3VXEH 4XBCA 3MMGA 4JZIA 2R3UA 3DD2H 2Q1JA 3NK8A 2ZU5A 3NUMA 2NU4E 2PGBB 1ELBA 4B73A 1UTPA 1O5FH 3UQOA 1P09A 3TH2H 2GGVB 1P0SH 4A6LA 4U2WA 3D23A 1TFXA 1QB6A 3MO9A 3V7TA 4ABJA 2FWWA 2XC5A 5EXNA 1TIOA 4GCHF 1GI5A 2QV1A 4GCHG 3RMOH 2A45B 4WWYA 2GKVE 1T4UH 3ATLA 3U8RH 2VGCB 4FUJA 1CA0B 5EODA 3FZDA 1DSTA 1ZHPA 1Z6EA 4KTCA 1A3EH 2GDDA 1EOLA 4HGCA 1NN6A 1LQEA 1T8OA 2PFEA 3KHVA 3UNSA 1GDUA 3A7WA 1Z8RA 2ZPSA 3PMJA 1EPTC 2ANWA 4OS2A 2PTNA 5LPEA 2TGAA 1C5QA 1XKBC 3U8TH 2W3KA 1C1RA 2G4TA 1GCTB 1BDAA 1DWBH 1O3BA 1O2XA 2XBVA 1QFKH 2C3SA 4Y8XA 3SI4H 1S81A 3PMAB 4CH2B 2WPMS 3E6PH 1GGDB 2ALPA 1NRQH 3RC4A 5GIBA 2G5NA 4D9QA 1H9IE 1H1BA 2Y80A 1TQ7B 2BDBA 3K6YA 3QK1A 1HV7A 1O2VA 1EZUC 3S7KB 2ZHEH 2ZDLA 5B6OA 3PYHA 4NCYA 3GY5A 3ZZAA 9LPRA 4XFQA 1O3HA 2THFB 1GWAA 2O8WA 3EYDA 4A7IB 1MAXA 3FAOA 1AE8H 1C5UA 5JDUB 3IWMA 4MLFB 3H5CB 4ABEA 2AGIX 3SHCH 2STBE 3BTQE 1FY5A 1EX3A 4XE4A 1A0LA 1TE0A 1WSSH 3PMHB 1HFDA 4BAHB 1QY6A 1HJ9A 1VJ9U 2ZCHP 1JOUB 1ZPCA 3F9GA 1E36B 2J4IA 4U01A 4ZUHA 1T8LA 1Z1IA 2TPIZ 3Q76A 2CV3A 1IQNA 1HAVA 1L0ZA 4ZH8A 5JYIA 4WMDA 2JH5D 2CHAB 4IC5A 3SV6A 2VIWA 4MPXA 1BHXB 1PQ5A 1SGPE 1BUIA 5DP4A 1J17T 4FVBA 1BA8B 4DIIH 2ODQA 3ZVAA 1RFNA 3SHAH 2D2DA 2QIQA 3I29A 2OTVA 2JKHA 3RXQA 4A92A 1YPHE 1BB0B 1NTPA 1AQ7A 2QN5T 2FI5E 1EZSC 1DUEA 1GMHF 1PFXC 5DJ7A 1GMHG 1VITH 1GHYH 4MQAA 2NU3E 1ZTKA 5PTPA 1ANEA 2W7UA 2NU0E 2XC4A 2WINI 1VCPA 2SGEE 1EOJA 2BY8X 3A87A 5DP5A 3RXPA 2YNAA 2ZDVH 6GCHG 5DP8A 3P92A 3ZZ9A 3BIUH 1BRUP 1CT4E 3TJNA 1GBKA 4AX9H 6ESTA 2VWOA 1ANCA 2BDGA 1KXFA 2H5DA 2FOMB 4TWYA 2A0QB 2BYAX 1Z6JH 1MUEB 1YPGH 4ISNA 1O5CB 1V2KT 5A0CA 1KXEA 2HOBA 1GJ9B 1INCA 2V0BA 1A5IA 4ISLA 5C2ZA 1Y8TA 3GY3A 1MTVA 2GZ7A 1KTSB 2TBSA 1TPOA 4JCNA 5LPFA 3O8DA 3Q00A 3JZ2B 4FU9A 1GDNA 1TWXB 1P2MA 4CH8B 3BEFB 3K6ZA 3S9BA 3E90B 2ZCKP 4E7NA 1SGNE 2SGDE 4M7GA 1YPHC 1V2VT 4GSOA 3S0NA 1LKBA 1HRTH 5TJXA 3SNEA 1DITH 4KELA 2OQUA 1MD7A 5JBCS 5EW2H 1OP8A 4NWKA 1S6HA 2NU1E 2BD5A 1HXFH 3TJVA 4BAQB 2P8OC 7GCHF 3EA9A 1FXYA 3VGCB 1UCYK 1C1NA 4YM9A 1QJ6B 2R0LA 1P10A 1O33A 3RXDA 1K2I1 5T6DA 4Q2KA 1AY6H 5A2MH 1EAXA 1PQ7A 1RRKA 2FOCA 1QB1A 2TRMA 1JWTA 3RMNH 1THPB 3FP6E 4J1YA 1RIWC 1SQOA 3A88A 1DY8A 1V2NT 4TWWA 5E0HA 1EXFA 2ZO3H 1XUIA 1GVLA 4ZAEA 4KP0A 3SJ9A 2ZG0H 1ABIH 2ZNKH 3MWIU 3ENSB 3PROA 3QZRA 1F0UA 1O2SA 1PPHE 1C1SA 4B75A 1O3GA 1AVXA 4JYTA 3GY4A 1C5MD 1ELTA 4FU8A 4AORA 3T25A 2FYQA 1TPSA 5E2OA 5EQSA 3A8BA 3VB6A 1OXGA 3M61U 2HGTH 1XMNB 5IDKA 1G3BA 1SQTA 4Q7ZA 1Z8GA 4CR9A 2Y6TA 2H6MA 4ISHH 2ZTZA 3HPTB 1C5TA 1BBRH 3ZVDA 1H8IH 2ALVA 1O3FA 4Y71A 1CVWH 1QBVH 3RXIA 1S6FA 1K1LA 1GVZA 1NZQH 3UWJH 1TGBA 4X2WA 1K22H 1LPKB 2FS9A 2J9NA 4X1QU 3RXMA 4I33A 1DS2E 2AIPA 3E8LA 2AMPA 3NCLA 2XXLA 3ATIA 2ZU1A 3BTME 3SNCA 2H2ZA 1V2ST 2HNTE 3BTDE 2ZC9H 3RXVA 1O5DH 1O3NA 2QGRA 4GLYA 1C5NH 1ZGIA 1Y5UT 1GI4A 2ANYA 1MTWA 2A7CA 1LCYA 1MTNC 2FZZA 1G2LA 1KXCA 4YOIA 1WTHD 2EEKA 2VIQA 1GI1A 1YPKH 3SUEA 1DOJA 1EAUA 2P93A 2Y5HA 4OS6A 4JZ1A 2ZKSA 3U9AH 4AZ2B 1O3OA 1ZHRA 2AS9A 1EASA 1TNIA 1AZZA 2FOHA 3ODDA 2ZFRH 1DANH 3KCGH 4U30A 1V2JT 2XRCA 3W94A 4GAWA 1IHTH 6CHAC 1SG8B 1QR3E 1G9IE 3Q3KA 4AGKA 3GY7A 1AFQB 3LKWA 1CT0E 1O3LA 2BY5X 2VWLA 1SOTA 1D9IA 3SQHE 2BDYA 1AKSA 3SNBA 1MKWK 3RM0H 1U6QA 2YNBA 2ZFSA 3MNXA 3UR9A 4TPYA 5HGGA 2Z9KA 1S5SA 4Y11E 3BTTE 3UR6A 4NZQA 1N8OB 5L2YH 3BV9B 4Y79A 2R2MB 3TH4H 4RN6A 2HNTC 2W26A 3RLYH 4Y76A 2GMTB 2D26C 4DT7B 2ZECA 1EJMA 5EG4A 1Q2WA 1EZXC 4NFEA 3A7TA 1O5GH 2XNIA 4MNYA 2C8YB 1CT2E 1UVOA 4GVUA 4WMEA 2FXRA 1SR5C 4UFFH 4TY7A 3U1IB 1HYLA 5GCHF 1MTSA 4DW2U 5GCHG 1GVKB 5E2PA 1UVTH 1BIOA 2F9VA 5I25A 1GCTC 1Y3WA 2Z3EA 3O8CA 1P06A 1O2JA 3MNBA 2PGQB 1O2GH 5L6NH 1HIAA 4YO9A 4MVNA 1O5EH 1C1QA 1GGDC 1P02A 5JBTA 1UCYH 1SLVB 1O5BB 1LHGH 1QNJA 3H7TA 3AVZA 3MFJA 3QGNB 4K2YA 1MQ5A 2G8TA 1GBTA 1OS8A 5C5NA 1K1MA 1FIWA 2P8OB 2WPKS 3RC6A 1GBEA 2XTTB 1ARBA 4Q7YA 2QXHA 1WQVH 1W0YH 1GI3A 2HVXA 3Q77A 1NFXA 3ODFA 1P9UA 1AU8A 3NPSA 2B8OH 1WAYB 2H9EH 4X8SH 2RA0A 2FIRH 3MH6A 1LHCH 1A0HB 2P3TB 1DUAA 2BX3A 2DE8A 5HYOA 5A09A 1CE5A 1GDQA 1RIWB 1WQSA 3VB4A 1GBDA 1A2CH 1J14A 2P95A 4GHTA 1HAGE 2FO9A 1TX6A 1S0RA 2CHAC 2BX4A 5ESTE 1HIAB 1XM1A 2DE9A 4XDEA 3TVJB 2I6QA 1B5GH 3FVFB 4O3TA 4BAKB 4YLUA 4SGBE 1K9OE 3L3TA 5EQQA 2UUFB 1V2TT 1BMNH 3Q3YA 1LHFH 1THRH 5C3NA 3EAJA 1C2MA 4WVPE 2SGPE 1P9SA 1KLJH 3FP7E 3BG4C 1OP0A 2OLGA 3RXCA 1H4WA 1WU1A 1IHSH 1CGHA 4PROA 4WH8A 4WF8A 1NESE 1Q31A 5DK1A 1ELFA 3LGWA 1BTUA 1ORFA 1SSXA 3IG6B 1UTOA 2ZZUH 1KIGH 4JZDH 2ZFQH 1EQ9A 2XC0A 2BOHB 1UHBA 1UJ1A 2F9NA 2XWAA 1GPZA 5ESBA 1W0ZU 2Z7FE 1GHVH 4ZXXH 1SMFE 1UK2A 1EB2A 1FPHH 2Z9LA 4R8TB 3V0XA 1MZDA 1CA8B 1KTTB 4JZFH 2FODA 3M5NA 2BQWB 1ZJDA 1GI7B 2IOTA 2WYJA 1GJ6A 1NC6A 3A7ZA 2M5TA 1A3BH 3MOCA 3NKKA 4JZEH 1SGDE 2F9OA 4OS7A 1YPMH 4MG3A 5E8EH 4DY7B 1DDJA 2PKAA 1AWHB 2HALA 1E35B 1YC0A 4Y7AA 3PLPA 1TNKA 1DLEA 2ZHQH 1OWEA 2XCNA 3UWIA 4MPUA 3TGJE 3SNAA 2XWBI 4YTAA 3GICB 2CF9H 1O36A 1MTNB 1DFPA 3FP8E 4FUDA 5F6MA 2Y5GA 1L1NA 4AFSA 3VXFH 1IOEA 4AG2A 3A83A 1F7ZA 1ZJKA 1DM4B 1P8VC 2GV6A 6LPRA 1IQEA 1C9PA 1UHBB 4AG1A 3AW1A 1MKWH 3SI3H 1AFEH 5FHTA 5LGOA 5LPRA 1ZPBA 5JBAS 5F8ZA 6CHAB 5SGAE 3MO6A 4Y10E 2PKSB 1KXDA 1GHBF 4ABGA 1GHBG 1C5PA 1GBBA 3E3TA 1ZZZA 2IJOB 1XXDA 3RXRA 1QBNA 4ZHAA 2BZ6H 3SU6A 2Y7XA 4D8NA 1K28D 1QRWA 3UQVA 5EPYA 4KTUA 1KLIH 2G5VA 2XW9A 1QGFA 1QL8A 3BG8A 1GBJA 2KAIA 1ANDA 1GJ5H 3QDZB 3A7VA 4AN7A 5C20A 1MCTA 1IQMA 3QGJA 3MNSA 1XX9A 4CRGA 2B7DH 2STAE 1BMMH 2VVCA 1TGCA 1FDPA 1AMHA 1HGTH 1EAWA 2AGGX 2J38A 3D65E 4BNRA 4XOJA 1O31A 3RXTA 2V3HH 5EPNA 3SO3A 3RXUA 4IS5A 3V13A 3TNTA 1HUTH 1AGJA 4QT8C 1XKAC 3A80A 1O34A 4LK4A 2V35A 1SLXB 4MTBA 2VINA 3E16B 3ZZCA 1AI8H 5FXLA 3MH4A 1TBZH 3ZYEA 1W8BH 2XBYA 2R2WU 1J8AA 3ATWA 3F1SB 1G3DA 1S85A 3RXGA 1DXPA 3M36A 2BLVA 4B1TA 4JK5A 1NPMA 1BRAA 4NWLA 3UOUA 2ZF0H 3OY5U 2FOBA 2A32A 2HRVA 3KIDU 3M37A 1TNJA 5AFZH 1BBRK 4AFZA 3KQDA 2QA9E 8KME2 1P3CA 2F83A 1V2LT 1AIXH 2JH6D 1SHHB 1MH0A 2PSYA 2OBOA 3BTHE 3T62A 1ZYOA 5A8ZA 4JYUH 2P3UB 3ZZ6A 2J34A 5EXMA 5J4QA 1QIXB 1FUJA 4H42U 1KLTA 4FUFA 1ZMJA 4RKJB 3UFAA 1OOKB 1ID5H 1O3KA 1LPGB 1ZSLA 2CGAA 4VGCB 1CHOF 3GCHB 1FNIA 1SGQE 1P2QA 1CHOG 5AVDA 1GI9B 1ACBE 1ESBA 4INLA 4YLQH 2BB4A 1F92A 2F9UA 1EZQA 3RXHA 3ZZ5A 4E7RG 1C5YB 1P05A 1ZLRA 1W2KH 1C1PA 4X8VH 1BOQA 3C27B 4YESB 7KMEH 1DSUA 4DG4A 1GI6A 2P59A 4NG9H 3QLPH 1J16A 4Z6AH 2ZCLP 3BEIB 2GCTC 2XBXA 3M35A 2VH0A 2G52A 3KF2A 1UVUH 1AFQC 2Z9GA 4WXIA 1FJSA 1QRZA 2ZI2H 2BD4A 4JYVH 1OYQA 2OP9A 3LGYA 5C1UA 1GHAG 5FCRA 3BG4B 1EATA 3BIVH 4DIHH 1DWDH 2GT7A 3D49H 2O8LA 4F49A 1D3QB 2ZGCA 4O03A 1E37B 4DGJA 3ZZ7A 3K9XB 1VITF 3ZVBA 1N8OC 1W13U 1VITG 3GISB 6GCHF 1YGCH 4X8TH 3P8NA 1AWFH 2GMTC 2R0KA 1FAKH 1J15A 1C1VH 1O3DA 1HAVB 1IQIA 3PWCA 2TGTA 4X6MA 2P94A 3A7XA 3DHKH 4CR5A 1OYTH 3UPEA 4K60A 3BTGE 3RMLH 3BTWE 3A81A 4D7FA 1AN1E 3SGQE 3BTFE 5EOKA 1CGIE 1O0DH 3URCA 1JBUH 1C5VA 4K3JA 5L30H 1YLDA 4DVAU 4RKOB 2FLBH 4MNWA 3PTBA 1YBWA 2AGEX 4IMZA 5DP9A 3N7OA 3MU4A 2BLOA 3KEEA 5FPTA 2ULLA 3VB3A 5F03A 4FU7A 1ELCA 2PW8H 4JMYA 1O2KA 3HKIB 3SJ8A 4FUIA 1NROH 2R9PA 4K1TA 1SFQB 1K21H 1TBQH 2RA3A 1SQAA 3TLOA 1TX7A 2OINA 3A85A 3GY8A 5AFYH 1HNEE 1CSOE 3B9FH 1ELDE 1NFWA 1TOCB 2H9HA 3A89A 1HAYB 2VNTA 1BTHH 3ESTA 2BY9X 1RGQA 2ZPQA 4YOJA 2EA3A 2ZWLH