1H4WA

Structure of human trypsin iv (brain trypsin)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAVKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN IVA
publication title Crystal structure reveals basis for the inhibitor resistance of human brain trypsin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1h4wA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1h4wA02
4AGKA 1T8LA 2H1UA 4MPUA 2NWNA 3LDXH 1ETTH 2WYJA 3SV2H 2TGDA 4JZEH 1TNHA 1TMBH 2QF3A 1UMAH 2XXLA 2YOLA 4GUXA 1TMUH 1XXFA 3DT0H 1PQ7A 1WYKA 1JIMA 1TE0A 3S7KB 1A46H 1ZPCA 2OD3B 1Y3XA 1KXDA 1HAZB 5AHGH 1A7SA 1ETSH 1YPGH 1HAYB 1O2VA 3FP8E 1GVKB 2ESTE 5EPYA 1C1OA 3PLKA 4ZKOU 1AGJA 3QO6A 2HOBA 3MO3A 3GDSA 3RMNH 1SC8U 4Q7ZA 4KTCA 4UONA 2AEIH 2H9EH 3N7OA 2ZFQH 3M3SA 4KTSA 1GG6C 2ZPQA 4A1XA 2Z6BD 2ZHEH 2CXVA 3MU1A 4MPVA 4X1RU 1O39A 9ESTA 3IITA 2FXRA 1O31A 1RS0A 4DOQA 1SLWB 1C1NA 2WYGA 3BTDE 4FU8A 2OBQA 2P95A 4JK6A 4BAMB 3TJOA 1T8NA 3MU5A 3M5LA 1TOCB 1DFPA 5EXNA 4ASHA 4NZLA 1SLUB 3P6ZB 1BJVA 4SGAE 2H5CA 5JBTA 1H9LB 1V2QT 2XNIA 2UWLA 1ZRKA 2W26A 1ZGVA 1NC6A 1XMNB 1PPHE 1AKSB 3RXLA 2A2XH 3PYHA 1IQJA 4B2CA 2V6NA 4A92A 1PPBH 2GGVB 3UQVA 3RXBA 1G3DA 1O2XA 1C5UA 4DIIH 2HNTC 2HRVA 1UVSH 4X8SH 5GJ4B 3SUGA 2OC1A 1ACBE 1GBDA 1O3PB 1P11E 1CT0E 4QT8C 8LPRA 3BTTE 1GBFA 3MWIU 1HGTH 4CR9A 5DPAA 1BBRK 4TYDA 3EA8A 1AO5A 5LPFA 1C5WB 2WV4A 5FCRA 1YCPH 5A0CA 1Y3YA 1TONA 3RDZA 2JH5D 5TCCA 2GDDA 1EZXC 4B71A 1HNEE 1BTXA 1NFXA 4BXSA 2PW8H 2WV5A 3LU9B 5EGMA 3SHCH 3P70B 3SGAE 3VB4A 2KAIA 4JYTA 3VB6A 3RUOA 1V2TT 2R9PA 4F49A 1XM1A 1HJAB 1EAIA 2ZNKH 1CA0B 4Q7XA 1OS8A 5DJ7A 3FZZA 1QQUA 3ODDA 3C27B 1MBMA 2BX3A 3E1XB 3BIUH 3RXKA 2A0QB 2GZ9A 2ZKSA 3BF6H 4BAHB 1NPMA 2O8UA 3TH4H 2Z9IA 4YO9A 1NM6A 1C1WH 3EE0B 4R0IA 3ZZCA 2RCEA 3VXFH 1ZJDA 4SGBE 2FTLE 1IQMA 1YP9A 1BRAA 5DP6A 2NU1E 5AF9H 1HYLA 3ZVCA 3D23A 3SJ9A 1C2GA 2A4OA 1L1GA 3F1SB 1ID5H 1N8OC 3G01A 4HTCH 1O35A 2A31A 4AG2A 3NKKA 3OU0A 2Q6FA 4Z6AH 1O5CB 1ABJH 3NPSA 1HJ9A 1ZTKA 2OTVA 3MI4A 1Z8IB 1SL3A 4JZ1A 1YM0A 2BDGA 2R2MB 1MKXK 5GCHG 1Q2WA 2ZHDA 3PMHB 4B2AA 1GGDB 1KDQA 1V2OT 4K2YA 3UOUA 3K65B 5JB8S 3V13A 2Z3CA 4ZROA 7KMEH 3VXEH 3SW2B 1NESE 2Y7XA 1TX7A 5GDSH 3GDVA 4GLYA 1S82A 4Y71A 1B0EA 1KXAA 2O8MA 2VVCA 2I6SA 1FUJA 3KL6A 1IHSH 3A8DA 2VB0A 1S6HA 3TPIZ 3OY6U 5F8XA 3K6ZA 1GDNA 1J8AA 3QWCH 5I46H 1RD3B 1SFIA 2FOGA 3ZVBA 1GBBA 2OP9A 2J38A 2ZWLH 1UHBA 3GY7A 3S0NA 2CGAA 5DP5A 2XW9A 3H5CB 1EJMA 5FBEA 3WY8A 2D8WA 3MO9A 4R8TB 1TNIA 2O8LA 2VWLA 1O36A 4FUFA 2RDLA 3A87A 1NZQH 2HWLB 2Y6TA 4NSVA 1TA6A 1OWHA 1HCGA 2A7HA 2P8OB 1RFNA 2AMQA 3M36A 1GJBB 1NU9A 3CS0A 4AN7A 2OQ5A 5DP3A 1ANBA 1SI5H 4D7GA 2C8ZB 2H5DA 3GCTG 2VH0A 5HYOA 4O97A 1QBVH 1GMDF 2P3UB 2VWOA 4ABBA 1THPB 4A6LA 3D65E 4D9QA 3LGWA 4Y10E 1BIOA 1RTKA 1IQLA 1QGFA 5HM9A 1Y5BT 4ZXYH 1GJCB 2BD4A 3HATH 5AFZH 5A8ZA 2FI3E 3GICB 3RC4A 1Z7KA 5ESBA 1SGNE 1YF4A 3TK9A 3TJUA 2JETB 1GHYH 4Q2KA 1ESBA 2P59A 2ZGCA 3UIRA 3T29A 1OWKA 4Y7BA 2BDBA 3GCOA 2PLXA 1DXPA 3O8DA 4X6PA 3SNBA 4I8JA 1Z1IA 4WY3A 1FAXA 4YLUA 1B5GH 5EU8A 1KLIH 3RXFA 2ZC9H 1TX6A 5HXFA 5F03A 1V2WT 1TNKA 4GHQA 4I31A 4DVAU 2Y81A 5A8XA 1PPEE 4TPIZ 4K8YA 3RC6A 3LGUA 5E0JA 1RIWC 2DUCA 1DY9A 1BTZA 1FONA 1FN8A 2BD7A 3D49H 1LPKB 2ANWA 1KY9A 1F5RA 1HJAC 2OCVB 3P92A 4MNYA 1CA0C 2UWPA 4FUDA 2XBYA 1V2PT 2ZTZA 5E0HA 1Q3XA 2PFEA 2Z9KA 2ZFRH 3BTHE 3VFEA 4MNXA 1KIGH 1O2QA 4CRCA 3BTEE 4E7NA 3TK5A 4X1QU 1GWAA 3CP7A 4ISHH 1EZSC 2FPZA 1W13U 2P16A 4O3TA 5TCAA 5IDKA 2HPQH 3KQBA 1MKWH 1KXCA 2A4QA 2BY7X 4ESTE 2J94A 1P0SH 2W7UA 4NCYA 1UK2A 1TBRH 5JYIA 2GZ8A 3HKJB 2J4IA 1F5LA 3T2NA 2V0BA 3H7TA 1O3AA 3SNDA 1DWDH 1O2TA 1S6FA 2VGCC 1GGDC 1O2HA 3RXUA 2BMGB 3SJIA 1O0DH 1Y3WA 2Z3EA 1OP2A 4UEHH 1ZOMA 1CHGA 2BVRH 1W12U 2BM2A 2TGAA 4X1SU 1S5SA 2BDAA 3ZZ7A 4CRBA 1VCWA 2ZP0H 4IC5A 1NO9H 5EODA 4GVUA 1UTKA 3L33A 2UUKB 4OS7A 4E7RG 2BLOA 3O8BA 5DP9A 1YPEH 1LDTT 1LHDH 3KGPA 1FI8A 1BUIA 3PMBB 3U9AH 5EXMA 2OC8A 4K60A 1V2MT 3BTGE 4INLA 1A1RA 1G36A 2EA3A 4NGAH 1NS3A 1E37B 4OS6A 1GBLA 1XXDA 3E91A 2PKAA 1ELVA 1KLTA 3B8JA 1KTSB 1QB6A 4H6SB 1ANCA 1L2EA 1YBWA 1C2EA 2A5IA 1SLVB 4XOJA 1GMCG 1MU8B 1O2KA 5HM2A 4NWKA 3EA7A 1XKBC 1HAHH 5PTPA 1FY5A 3OY5U 4AFZA 3KIDU 2KAIB 1CSOE 1SFQB 3RLWH 4BOHA 2HVXA 1XX9A 4DIHH 3IG6B 3RU4E 1C9TA 4Y79A 4MDSA 1MQ5A 4XBBA 4K1EA 3VEQB 1KXEA 4X6MA 4A1VA 1C5MD 4AYYB 2JETC 2Y82A 3RXQA 3LOXA 1C5VA 1NT1A 5SGAE 1BQYA 1WSSH 3ZYEA 1GI5A 3BV9B 3KCGH 2G5VA 2ZU5A 4YOJA 1ZMJA 1W0ZU 1EATA 3HKIB 1XUGA 1QL9A 2O8WA 3SU4A 3SV8A 4CHAB 1CO7E 3M37A 3QTOH 2ZDKA 1QJ7B 4K3JA 4JZDH 3HK6B 3ZVGA 1IQKA 5F6MA 4DW2U 1GJ8B 5GCHF 2ZFTA 1SHHB 1XVMA 1EQ9A 4GCHG 1UTMA 3V12A 1SOZA 1E38B 1C5ZB 1VCQA 2F9BH 1QB1A 2AIQA 3AVZA 1AZ8A 2BY5X 4Y6DA 1KDQB 4WF8A 4X2WA 2FOHA 4YESB 2BDIA 2QY0B 2WPHS 1VGCB 1KXBA 3SJ8A 1SGFA 1ANDA 3S7HB 1UO6A 3TGKE 1F0UA 1P2QA 4ZHMU 1INCA 2BY8X 4Y76A 1DUEA 1H4WA 5E2OA 3DA9B 3GDUA 3M7QA 2ZFPH 2ZGHA 2JH6D 1ZLRA 4WXVA 1C1RA 2VH6A 3FP6E 5FPSA 1BRUP 2FX6A 1P09A 2VIQA 1ELAA 4KGAA 2B9LA 1DT2A 3FAOA 1OWEA 3SU1A 4UFEH 1GI2A 5G4BA 4ISNA 1TFXA 1SGIB 1HAIH 2GZ7A 1YLCA 3A81A 1UVPA 3TNTA 1GL0E 1C9PA 1ZHMA 5DG6A 1ZPZA 2J95A 2FDAA 3U1IB 2XWAA 4FUGA 1O3JA 2FOFA 3SORA 4I8GA 1N6YA 4MQAA 4FUIA 1HUTH 1MH0A 3URCA 3KF2A 4K1SA 3U98H 2IOTA 3VGCB 4AX9H 8ESTE 3BG8A 3ELAH 1SGYE 4Y7AA 1PYTC 1BMMH 1TNLA 1WTGH 4IBLH 2AH4X 1ZTLA 1GCTB 1HXFH 1O37A 2SGEE 4ABHA 5JB9S 4CRGA 1GBHA 3NXPA 4D76A 3I78A 1BT7A 1LQDB 1GI1A 3PLBA 3FZDA 1FN6A 2ZPRA 1Z8RA 1P02A 4MTBA 2H9HA 2AFQB 1IHTH 3SV9A 3SV7A 1BBRH 1MTSA 3DHKH 2PUXB 1FDPA 1GHZA 3GCHB 3SUDA 1QRWA 1C2HA 2FYRA 3KNXA 1DICA 1G3CA 4ZH8A 4TY6A 2FYQA 2AMPA 2QGRA 5EG4A 2R3UA 4O3UA 5K0HA 1XUIA 2ALPA 1OP8A 1OKXA 1EZUC 2XWBI 1CE5A 1B7XB 1O2YA 2WPLS 4U2WA 3F9FA 4TWWA 1W3CA 5GPIB 1J14A 1DM4B 2LPRA 2F9NA 4H4FA 2ZTXA 4ZHAA 3S9CA 1K1JA 4VGCC 1Y5UT 1D4PB 1IAUA 1GBEA 2ZTYA 1S0QA 4J2YB 1MQ6A 1V2RT 2ODPA 2PSYA 4XDEA 1SGPE 2OINA 3RXGA 1RGQA 4NA8A 1HAVB 1MAXA 5L2YH 3RXAA 4UDWH 2BDCA 1MTNB 1QHRB 1ZTJA 2GCTC 1QFKH 1H8DH 3T26A 4CHAC 3TH3H 2FIRH 2AMDA 1MKXH 1S83A 1C5TA 3RU4D 1MTWA 4ISIH 1QQ4A 5JBBS 3RXJA 1QBOA 1RTLA 1WOFA 1L1NA 4WJG2 1K2I1 1ZSKA 1CT4E 1ZHPA 5DP8A 3RXPA 1C4Y2 2H6MA 3P8OA 1BMNH 4B73A 1CHOG 2A7CA 3RP2A 1P57B 2ODQA 3U8RH 1HRTH 1A3BH 1VGCC 1C5SA 4TWYA 1C5LH 1GBJA 1VJAU 3VB3A 1O2WA 1G9IE 4MNVA 2BYAX 4WXIA 4HFPB 1PJPA 4Y8XA 2HLCA 4NIXA 1H9HE 2WUCA 1GI6A 3RXTA 8KME2 3TK6A 3TVJB 1O3MA 3A7XA 1OSSA 4FU9A 4ISLA 4IMQA 1TPSA 3LGYA 2HGTH 2FX4A 1TGCA 1HFDA 1MBQA 1O3BA 1FXYA 1QJ6B 3SGBE 4YM9A 3TGJE 2BD5A 1E36B 3A84A 5E8EH 1UK3A 1CA8B 2CJIA 2BLVA 3LIWA 3BEIB 1A5GH 1ELFA 3GYMA 4YT7H 2G52A 1NU7B 3RM0H 3GY5A 3JZ2B 3GCNA 3SJKA 3A7VA 1ELTA 1YYY1 2ZDMA 3DFJA 1S0RA 3BSQA 5AFYH 2STAE 3UR9A 1C5OH 1RRKA 1PPFE 1DSUA 1GMCF 1BA8B 4MG3A 3K9XB 2ZECA 3NWUA 1C2MA 3ZZ6A 4RKJB 2GVFA 1C5XB 4CRAA 4CH2B 4DY7B 1GCTC 1KTTB 2WINI 4RN6A 3ZV8A 1CGIE 3TJNA 3T28A 1QTFA 1W7GH 2TRMA 2NU3E 1EPTB 5ETXA 2AS9A 3PTNA 2EI8A 2BVSH 2V35A 3ZZ4A 3OYPA 4OS2A 3GOVB 1EB2A 1NRQH 1LVMA 1G2MA 4ABEA 2QC2A 3AW1A 1DUAA 4INKA 1C2KA 2SGAA 1BB0B 2BOKA 2VJ1A 2BD9A 3EGKH 2BD8A 4FUBA 1O5GH 1QCPA 4BAOB 1HIAA 4JMYA 1GI9B 3MH5A 1YGCH 5FXLA 1ORFA 3MNSA 4MPWA 1O5DH 1A5IA 1MD7A 3GY3A 4DT7B 1SBWA 2SGQE 3E8LA 4A5TS 5ABWA 1Z6JH 2FWWA 2NU2E 1TNGA 1HAOH 2VNTA 3V3MA 1G37A 2QAAA 3CENA 3PWBA 5DP4A 5GWZA 1GMHG 3RMLH 1ZMNA 3PMJA 2WPIS 2K1QA 3PLPA 2VIDA 4GCHF 1IQEA 2ZO3H 1OX1A 2VVVA 2P94A 4NA7A 4LOYH 1W14U 2CF9H 1NFUA 1LHEH 1A3EH 3ZZDA 1PQ8A 3O8RA 3A7WA 1FY1A 3MNCA 3HGNA 4BAKB 1VZQH 1AE5A 4NZQA 1ZHRA 1P2KA 3EAJA 5CE1A 1YPKH 1TB6H 4BTIB 2GT8A 2Q1JA 3BTME 1MTNC 1QR3E 1SGCA 2GP9B 2LNCA 2UUFB 3DFLA 3RMOH 3MYWA 3KHVA 2DE9A 2QXIA 5K7RA 5CMXH 7GCHG 1GBTA 5C1YA 3EYDA 1SGRE 1LQEA 1DX5M 3P8GA 3MFJA 1MAYA 1G2LA 3MOCA 1O2MA 4OS4A 1O3FA 2PTNA 1TQ0B 4ABFA 1HPGA 1NN6A 1UJ1A 6GCHG 1O32A 2CN0H 3SN8A 1T31A 1O5AB 3LPRA 1GBMA 1ZZZA 1K1LA 4X2XA 5BRRE 3H7OA 1TOMH 1PYTD 2PSXA 1LO6A 1O3GA 3TU7H 1UVOA 1C1UH 1AB9B 3AASA 1F0SA 1L1JA 6LPRA 1N6XA 1O3HA 1AQ7A 5C2ZA 3UUZA 1TBZH 1VJ9U 1JMOH 1UTQA 3UTUH 4I7YH 1V6DA 3P8NA 4GAWA 1GJ7B 4TPYA 1AFQB 4YLQH 2HPPH 2FTMA 2D2DA 3R3GB 1SQOA 5EPNA 1GHWH 3U69H 1FIZA 1CBWB 1GL1A 3W94A 1UTLM 5EOKA 2FLRH 4XSKU 4WMFA 1FMGA 2CHAB 4DJZB 1LMWB 3UOPA 4BTTB 3LONA 1GPZA 1MZAA 1V2KT 3FANA 4IS5A 3SI4H 2A45B 2A7JA 4ZUHA 2QCYA 3SNEA 2ODYB 1C5PA 3QZRA 1ZGIA 1K22H 3MH4A 3KN2A 6CHAB 1CGHA 3F6UH 4CH8B 4DGJA 1C2IA 1SGTA 1AUJA 1IQGA 1GI7B 3PTBA 1XUHA 1P2MA 3ESTA 3HK3B 3UQOA 2C3SA 5C5OA 1DANH 3ATIA 1C5QA 4JK5A 3F9HA 1M9UA 1C4V2 4FUEA 2ZCKP 1EPTC 4KTUA 4X6NA 4WVPE 1OWDA 2C8XB 1V2LT 3LGIA 1C5NH 1SGDE 2BQWB 2SGDE 3SHAH 2C93B 4GSOA 1AUTC 2H9TH 3QK1A 1ELEE 2ZEBA 1BDAA 2BY6X 1V2UT 4DURA 4Y0YE 1EAWA 2G51A 1GBIA 2BXUH 4PROA 1K9OE 5A8YA 1HJ8A 1P3EA 2FS9A 4FXGH 1K28D 4GHTA 3E6PH 2VU8E 1EP6A 1C2FA 1AKSA 1BHXF 1HXEH 1DVAH 1GHXH 3MU0A 4UFGH 4BTUB 4ZMAH 2AERH 1UK4A 2ZZUH 1HBTH 3UWIA 1AY6H 4KKDA 1O2IA 3T5FH 1NTPA 1QJ1B 4XBCA 2G81E 1IOEA 3KQDA 1SGQE 3STIA 2SGPE 3SBKA 1XUKA 3UWJH 1CHOF 2EEKA 2ZHWH 1BITA 3VB5A 3TH2H 1NFYA 1GHBG 1BTPA 3A7YA 1C5RA 3M35A 3I29A 2AGGX 1O33A 4ZKSU 1W0YH 4ISOA 1THSH 3ZVAA 5A2MH 1SQAA 1UVUH 5HMAA 3SV6A 2P8OC 1O5EH 4X8UH 4AOQA 3ENSB 3LGTA 1ABIH 1FPCH 1L4DA 1O34A 2ZHQH 1K1OA 4CBNA 3BTKE 4CR5A 2C90B 1DWBH 1YCPM 3A80A 3P17H 4UFDH 1GVZA 3UR6A 2F9PA 2FM2A 1H8IH 1RXPA 3NCLA 1FAKH 2FZZA 2PGQB 3LH1A 4LZ1H 1N1LA 4YOGA 4AORA 1WU1A 1DWEH 6ESTA 4I8LA 1EAXA 1DSTA 2ZU1A 4Q80A 4YZUA 1AB9C 2ZDVH 1VR1H 2WPMS 3ZVEA 1DWCH 1K1PA 1QIXB 1MD8A 2BDHA 3B23B 1W10U 1QNJA 1AU8A 4IW4E 3A8AA 1PPZA 2ASUB 1ELDE 3EDXB 1BTHH 1LPZB 1SG8B 2ALVA 1JRTA 2GDEH 3PO1B 2FLBH 1O5BB 4Y8ZA 1UCYE 1WQVH 1O2GH 2PHBA 3ZZ9A 2FOCA 1AFQC 1HV7A 2ZA5A 1P04A 1SSXA 2Y7ZA 4RKOB 5T3HA 1V2VT 1PQAA 5I25A 3LJJA 4ABDA 1HLTH 1F92A 2Y80A 4ABAA 5BPEA 4O03A 5E2PA 3M7UA 1FIWA 3SU3A 1ZPBA 4MLFB 4D7FA 3BG4B 5FHTA 3OTJE 3Q76A 3S9BA 2YNAA 4IN1A 4O9VA 1Y8TA 4U01A 4NFFA 3F9GA 3QTVH 3ZYDA 3TJVA 2HALA 2BQ6B 2VVUA 1C2JA 2VWNA 1P8VC 6CHAC 2NU4E 2BZ6H 2W5EA 1MTUA 1DE7H 1S81A 1GMHF 2GKVE 2SNVA 2ULLA 3UNSA 3BEFB 2XBWA 2FI5E 5F8ZA 1EAUA 2F9UA 3PWCA 3OSYA 1C5YB 2FOEA 3LGVA 1D9IA 1A4WH 1LHCH 3SU6A 2BLWA 2OUAA 5T6DA 1Z8GA 3A8BA 2QN5T 2SNWA 4NIYA 3DUXH 3ATKA 1UHBB 1T8OA 2GCHG 1DS2E 1YLDA 4YTAA 1AD8H 2C8WB 2ZHFH 2TIOA 4XBDA 1TALA 1TRMA 8GCHG 5A0BA 2HNTF 1FY8E 2QXJA 1NFWA 2V3OH 2BVXH 5DK1A 1A0JA 1A0HB 1S84A 7GCHF 2CMYA 2BY9X 5C20A 4CBOA 1YKTA 2PWXA 3GCTF 2ZDLA 3ZZBA 2BDYA 3M3TA 6GCHF 1Q31A 4B74A 1C2DA 2VWMA 1IQFA 4OGXA 3ZV9A 4AFSA 4X0WU 1NRPH 1O3EA 4A7IB 2Q6GA 4DG4A 3AW0A 2C4FH 4AFUA 1Y59T 1SGEE 1GDUA 3P8FA 4HGCA 2G5NA 5JBAS 3E3TA 1GHAG 1TGTA 1GHVH 3M61U 2CF8H 1O2RA 4UD9H 2F9OA 1TYNA 2Z9GA 1O3OA 3ZZ8A 4AB8A 1D6RA 1ZRBA 3JZ1B 3U8TH 1TWXB 2QA9E 1ETRH 1RTFB 5T6GA 1ZSLA 1LHGH 4D9RA 2B7DH 3M5OA 3P95A 3OX7U 2F9VA 3RXIA 1AVGH 3RXDA 1AN1E 1Y5AT 3E0NB 3RXRA 1TMTH 3ZZ5A 1O2JA 1AVWA 4K1TA 3MNBA 3RMMH 1VCPA 1TRNA 1YPHE 3IWMA 2EC9H 2EI6A 2DE8A 4WH6A 4YT6H 1WV7H 3K2UA 2TPIZ 1KLJH 3KQEA 4INHA 1O3LA 1C1TA 2UUJB 1TLDA 2ZGBH 3RXVA 3HGPA 4Z0KA 1FY4A 4NA9H 2Z7FE 3DD2H 1EZQA 4ZKNU 1O38A 1O5FH 3MU8A 3VPKA 1CVWH 3LT3A 1VITG 3Q3YA 2BQ7B 2BB4A 4LZ4B 2ZDAH 2TGPZ 1BRCE 1G3EA 1NRNH 2XCNA 1CGJE 1MCVA 3GISB 1HAPH 2O8TA 1GI3A 2R0KA 3PO1C 5FCKA 3UNRA 2FI4E 1QL8A 2C8YB 4BNRA 4H6TA 1WCZA 4TY7A 1P9UA 1F2SE 1PPGE 3MU4A 2QIQA 1QA7A 1GVLA 5C1XA 3SUEA 3RLYH 1DPOA 1DLKB 4I8KA 5C3NA 4DCDA 3SQEE 5T6FA 1LPGB 2SGFE 5TJXA 2BTCE 3BG4C 1IQHA 2PGBB 2FODA 4K8BA 5L6NH 3C1KA 3U1JB 1E0FD 2AIPA 3SJOA 4X8VH 1GJDB 1BMLA 2QV1A 1F7ZA 1H9IE 2WPJS 1MZDA 2ZPSA 4WH8A 3A82A 1TGSZ 5JPMH 2TBSA 1TX8A 2FOBA 1W7XH 4FUJA 2RA3A 4I33A 2ANYA 4GPGA 2XBXA 2A1DB 3SNCA 5FAHA 1SOTA 3MMGA 4ABJA 2M5TA 5DP7A 9LPRA 3RC5A 1EP5A 2GT7A 1KSNA 2J2UA 1GHBF 5FPTA 3SZNA 3K6YA 4X6OA 5GIBA 4Q7YA 1AE8H 2Z3DA 3UPEA 2GMTB 3A7ZA 3PM3A 1QB9A 4OS5A 1P06A 5F8TA 2JH0D 2EI7A 1D3QB 1O3KA 1EOJA 2PKAB 2A32A 3SU2A 3Q77A 1O2SA 1RIWB 1O30A 3MH6A 2A5AA 2XTTB 3KEEA 2W3KA 1V2ST 2ZCLP 3VGCC 4BXWA 1OXGA 2ZFFH 5CHAB 3EA9A 1EJAA 2BHGA 1O3DA 2ANMH 3BIVH 1HAGE 1O2UA 2QYIA 1ARBA 5J4SA 2OXSA 3HPTB 1LKAA 1C2LA 2VIPA 3Q3KA 4BANB 1JOUB 1AZZA 2OQUA 1XUJA 3MNXA 2ANKH 5ESTE 2OLGA 5C1UA 1A5HA 4K5ZA 1KXFA 2GV6A 3U8OH 5A09A 1DOJA 3QN7A 1V3XA 3TLOA 1P9SA 2HNTE 2ZQ2A 3GCHC 4ABIA 3A8CA 2ZU3A 3AAVA 1F0RA 2I6QA 4UE7H 4Y8YA 4WMEA 1SHYA 2B0FA 2UUYA 1UCYH 3GY6A 3BEUA 1GI4A 3V7TA 1O3CA 4AZ2B 3ITIA 1O2ZA 1WAYB 5L30H 4AG1A 2VGCB 2FOMB 1T8MA 4NSYA 5LH8A 1AHTH 2BX4A 1TQ7B 3SU0A 3M3VA 1SLXB 2B8OH 1MU6B 3LJOA 3PV4A 4JCNA 1NRSH 1YC0A 5EW2H 3QX5H 3RM2H 1GDQA 2FP7B 1O2PA 2Y5FA 1C1VH 2G00A 4OGYA 2YNBA 1A61H 1Y3VA 3LC5A 4ZAEA 2ZFSA 2ZG0H 1IQIA 2P3FH 4KP0A 1AWHB 1YPJH 1QRXA 5E0GA 1BCUH 2XRCA 4E06H 1OWJA 5GXPA 1RJXB 1XVOA 1YCPK 3GY8A 1EB1H 1GJ6A 1SVPA 4X8TH 1ELCA 1U6QA 1QBNA 2PUQH 1OOKB 2FESH 1TAWA 3QDZB 1AVXA 1K1NA 1J15A 5J4QA 1MUEB 2P3TB 2R0LA 4IC6A 4B1TA 3MH7A 1GJ4H 1L0ZA 4XE4A 3MHWU 5JBCS 1PPCE 1K1IA 5LGOA 2GCHF 1NY22 1BZXE 2XC4A 2BOHB 8GCHF 1AWFH 1TPOA 2Y5HA 3GYLB 3CS7A 1A0LA 4NG9H 1UTNA 3SOSA 3BTFE 4XFQA 1DY8A 2Z9JA 2BXTH 2FO9A 4AYVB 1DDJA 2VIOA 1O2NA 3UREA 2AYWA 4KELA 4IMZA 1BOQA 1NROH 1VITH 4FU7A 1JIRA 1FY3A 1UTOA 1ESAA 4UFFH 5IYTA 4NIWA 1HB0B 4MNWA 2A4GA 3BTWE 1BBRE 1O3NA 3ATWA 4X1NU 2VINA 1ZYOA 3PROA 1Z71A 4Y0ZE 1GJAB 1DXWA 4LXBH 1WTHD 1EUFA 2XC5A 2J9NA 2H2ZA 4FVDA 1UCYK 2O9QA 2XYAA 3MO6A 1GHAF 1Z1JA 1TRYA 2GMTC 1TGBA 2UWOA 3URDA 1K21H 1BTYA 1BRBE 2A4RA 1Y3UA 1GJ9B 1EX3A 2G55A 1HDTH 1EOLA 3SUFA 4A1TA 2VIWA 3M5MA 1EXFA 4ZXXH 3ZZ3A 1FLEE 1B0FA 3QZQA 2AGIX 3A89A 2ZU2A 1JXPA 2Z94A 1AI8H 5CHAC 4JYVH 3RXMA 3MTYA 1UTJA 1LVYA 1GCDA 4RSPA 1C1MA 1AIXH 1ZJKA 1T32A 4B76A 4D8NA 1TPAE 1DITH 1P2IA 1OYTH 1YPMH 2QXGA 3QUMP 4YOIA 5EW1H 1OWIA 1HAVA 1BHXB 3B9FH 1GI0A 1K1MA 2VIVA 1P12E 2SFAA 3R0FA 1VITF 1WBGB 3GY4A 2Q6DA 1BJUA 1QURH 3RXOA 1J9CH 1QRZA 1LKBA 1FV9A 2ZI2H 1TA2A 3D62A 2ZDNA 5H4IB 1P2JA 1O3IA 1V2JT 3FVFB 5FPYA 2BLQA 2ZIQH 3I77A 1ZMLA 4FUHA 1C4U2 2PKSB 2RA0A 3A88A 4AFQA 3LKWA 1D6WA 2ZU4A 3NK8A 4LK4A 2TGTA 1SR5C 5LPEA 1C1SA 2PR3A 4X2VA 1W11U 1SB1H 1GBCA 1JRSA 3A85A 3RXSA 3T62A 2XCFA 2IPHA 3TNSA 1CT2E 1S85A 2JKHA 4HI3A 4CREA 2OBOA 2F3CE 1FJSA 4NWLA 3E16B 1ARCA 3SO3A 3S69A 5DGJA 1GBAA 3STJA 1L4ZA 3F9EA 1P01A 4M7GA 1H1BA 1UTPA 3Q00A 5AVDA 3SU5A 1G32B 3TITA 3NUMA 1BTUA 3PB1E 5DO4H 1ELGA 3O8CA 3E90B 4BAQB 2PV9B 1V2NT 2XC0A 5C67A 4MPXA 4JZFH 4ZHLU 2FS8A 1PQ5A 2A5KA 3LH3A 3V0XA 2BZAA 1ESTA 1EKBB 1JWTA 2V3HH 1LVOA 3ZVDA 3NZIA 3QGJA 4NIVA 2BD2A 2IJOB 1P3CA 2QXHA 1NRRH 2ZQ1A 3A86A 1T4VH 1E35B 3TIUA 1QY6A 4F4OC 2BD3A 3ZVFA 1ANEA 3RXEA 7LPRA 1X7AC 1D3PB 1P2OA 2PTCE 5FX5A 1D3TB 5EQQA 2R3YA 2ZGXH 3UY9A 5LPRA 3VB7A 3GY2A 1TABE 1TGNA 2ZF0H 1GBKA 2J92A 1BMAA 1JBUH 4B2BA 1FZZA 4HZHA 4MVNA 2FMJA 1P10A 1EPTA 1P2NA 2ZGJA 4VGCB 5L2ZH 1OP0A 2G8TA 3AAUA 1EJNA 1MKWK 2IN2A 2OC7A 2AGEX 2G4TA 1TBQH 2W3IA 1IQNA 3ODFA 1C1QA 5DKMA 3UFAA 1GG6B 1AFEH 1E34B 1PFXC 1CBWC 1OYQA 1ZSJA 4IN2A 5EXLA 2B5TB 1QA0A 2GCTB 3SQHE 4WWYA 2STBE 4CRDA 3S9AA 2CHAC 4NFEA 3QGNB 1SQTA 5C5NA 1W8BH 1T4UH 3KQCA 5FBIA 3EQ0H 1HIAB 3W95A 4J1YA 1DLEA 3Q3XA 1SMFE 3L6PA 3BN9A 1TNJA 1MMJN 2D26C 3LC3A 5JDUB 3BTQE 3ATLA 4U32A 4THNH 1QL7A 4FVBA 3UNQA 1D3DB 1XUFA 7ESTE 4Y11E 2GX4A 2P93A 3M7TA 2R2WU 3SI3H 3A7TA 1F5KU 2CV3A 2FOAA 1J16A 2GV7A 1TIOA 4U30A 1J17T 1OPHB 2D1JA 5EQSA 2ILNA 4CRFA 3FP7E 1G30B 3F68H 3RXCA 1MTVA 2FEQH 2WPKS 1A2CH 1YPLH 3QLPH 1YPHC 1SPJA 4X2YA 5EQRA 5FX6A 3SNAA 3ZZAA 2OC0A 2THFB 2A2QH 1LCYA 1W2KH 1CU1A 2NU0E 3E0PB 4IGDA 3SGQE 4FUCA 1GMDG 2PKSC 3M5NA 4AB9A 1ELBA 4B75A 5B6OA 1TPPA 4I32A 1SGFG 1G3BA 4WMDA 1EASA 1FQ3A 1LTOA 1ZR0A 1GJ5H 2F83A 1FNIA 3ATMA 5A0AE 2XBVA 1P05A 1C1PA 1FPHH 2GTBA 1GI8B 3A83A 2Y5GA 3RXHA 3RU4T 2GD4B 4ABGA 1T7CA 3FFGA 5HGGA 4H42U 4JZIA 3TGIE 1CQQA 3T27A 1MCTA 2W7SA 1Z8JB 2RG3A 1LHFH 1LVBA 1HAXB 1O2LA 4X1PU 4JYUH 4E05H 3PMAB 1N8OB 2G4UA 2J34A 1XKAC 1KYNA 1WUNH 1BTWA 4AGJA 1P03A 1O2OA 1F0TA 3T25A 1WQSA 2QF0A 4K69A 1THRH 1UVTH 1Z6EA 4OS1A 2Z9LA 4ZKRU 2F91A 2WUBA 3L3TA 1AMHA 4I8HA 2ZCHP
chains in the Genus database with same CATH superfamily
4AGKA 1T8LA 2H1UA 4MPUA 2NWNA 3LDXH 1ETTH 2WYJA 3SV2H 2TGDA 4JZEH 1TNHA 1TMBH 2QF3A 1UMAH 2XXLA 2YOLA 4GUXA 1TMUH 1XXFA 3DT0H 1PQ7A 1WYKA 1JIMA 1TE0A 3S7KB 1A46H 1ZPCA 3CNRA 2OD3B 1Y3XA 1KXDA 1HAZB 5AHGH 1A7SA 1ETSH 1YPGH 1HAYB 3FN8A 1O2VA 3FP8E 1GVKB 2ESTE 5IK2D 5EPYA 1C1OA 3PLKA 4ZKOU 1AGJA 3QO6A 2HOBA 3MO3A 3GDSA 3RMNH 1SC8U 4Q7ZA 4KTCA 4UONA 2AEIH 2H9EH 3N7OA 2ZFQH 3M3SA 5GNDA 4KTSA 1GG6C 2ZPQA 4A1XA 2Z6BD 2ZHEH 2CXVA 3MU1A 4MPVA 4X1RU 1O39A 9ESTA 3IITA 2FXRA 1O31A 1RS0A 4DOQA 1SLWB 1C1NA 2WYGA 3BTDE 4FU8A 2OBQA 2P95A 4B6FA 4JK6A 4BAMB 3TJOA 1T8NA 3MU5A 3M5LA 1TOCB 1DFPA 5EXNA 4ASHA 4NZLA 1SLUB 3P6ZB 1BJVA 4SGAE 2H5CA 5JBTA 1H9LB 1V2QT 2XNIA 2UWLA 1ZRKA 2W26A 1ZGVA 1NC6A 4B6EA 1XMNB 1PPHE 1AKSB 3RXLA 2A2XH 3PYHA 1IQJA 4B2CA 2V6NA 4A92A 1PPBH 2GGVB 3UQVA 5HIZA 3RXBA 1MABB 1G3DA 1O2XA 1C5UA 4DIIH 2HNTC 2HRVA 1UVSH 4X8SH 2EY4C 5GJ4B 3SUGA 1VKYA 2OC1A 3DSOA 1ACBE 1GBDA 1BMFD 1O3PB 1P11E 1CT0E 4QT8C 8LPRA 3BTTE 1GBFA 3MWIU 1HGTH 4CR9A 5DPAA 1BBRK 4TYDA 3EA8A 1AO5A 5LPFA 1C5WB 2WV4A 5FCRA 1YCPH 5A0CA 1Y3YA 1TONA 3RDZA 2JH5D 5TCCA 2GDDA 1EZXC 4B71A 1HNEE 1NBMD 1BTXA 1NFXA 4BXSA 2PW8H 2WV5A 2M2AA 3LU9B 5EGMA 3P70B 3SHCH 3SGAE 3VB4A 2KAIA 4JYTA 3VB6A 3RUOA 1V2TT 2R9PA 4F49A 1XM1A 1HJAB 1EAIA 2ZNKH 1CA0B 3U28C 4P00A 4Q7XA 1OS8A 5DJ7A 3FZZA 1QQUA 3ODDA 3C27B 5C17A 1MBMA 2BX3A 3E1XB 3BIUH 3RXKA 3FOAA 2A0QB 2GZ9A 2ZKSA 3BF6H 4BAHB 1NPMA 2O8UA 3TH4H 2Z9IA 4YO9A 1NM6A 1C1WH 3EE0B 4R0IA 3ZZCA 2RCEA 3VXFH 1ZJDA 4SGBE 2FTLE 1IQMA 1YP9A 1BRAA 5DP6A 2NU1E 5AF9H 1HYLA 3ZVCA 3D23A 3SJ9A 1C2GA 2A4OA 1L1GA 3F1SB 1ID5H 1N8OC 3G01A 4HTCH 1O35A 2A31A 4AG2A 3NKKA 3OU0A 2Q6FA 4Z6AH 1O5CB 5T1VA 1ABJH 2CK3D 3NPSA 1H8HD 1E79D 1HJ9A 1ZTKA 2OTVA 3MI4A 3WW7A 1Z8IB 1SL3A 4JZ1A 1YM0A 2BDGA 2R2MB 1MKXK 5GCHG 1Q2WA 2ZHDA 3PMHB 1QZ8A 4B2AA 1GGDB 1KDQA 1V2OT 5CDFE 4K2YA 3UOUA 3K65B 5JB8S 3V13A 2Z3CA 4ZROA 7KMEH 3VXEH 3SW2B 1NESE 5C0UA 2Y7XA 1TX7A 5GDSH 3GDVA 4GLYA 1S82A 4Y71A 1B0EA 1KXAA 2O8MA 2VVCA 2I6SA 1FUJA 3KL6A 1IHSH 3A8DA 2VB0A 1S6HA 3TPIZ 3OY6U 5F8XA 3K6ZA 1GDNA 1J8AA 3QWCH 5I46H 1RD3B 1SFIA 2FOGA 3ZVBA 1GBBA 2OP9A 2J38A 2ZWLH 3F0PA 1UHBA 3GY7A 3S0NA 2CGAA 5DP5A 2XW9A 3H5CB 1EJMA 5FBEA 3WY8A 2D8WA 3MO9A 4R8TB 1TNIA 2O8LA 2VWLA 1O36A 4FUFA 2RDLA 3A87A 1NZQH 2HWLB 2Y6TA 4NSVA 1TA6A 1OWHA 1HCGA 2A7HA 2P8OB 1RFNA 2AMQA 3M36A 1GJBB 1NU9A 3CS0A 4F55A 4AN7A 2OQ5A 5DP3A 1ANBA 1SI5H 4D7GA 2C8ZB 2H5DA 3GCTG 2VH0A 5HYOA 4O97A 1QBVH 1GMDF 2P3UB 2VWOA 4I86A 4ABBA 1THPB 4A6LA 3D65E 4D9QA 3LGWA 4Y10E 3AK5A 1BIOA 1RTKA 1IQLA 1QGFA 5HM9A 1Y5BT 4ZXYH 1GJCB 2BD4A 3HATH 2LELA 5AFZH 5A8ZA 2FI3E 3GICB 3RC4A 1Z7KA 5ESBA 1SGNE 1YF4A 3TK9A 3TJUA 2JETB 1GHYH 4Q2KA 1ESBA 2P59A 2ZGCA 1K0HA 3UIRA 3T29A 1OWKA 4Y7BA 2BDBA 3GCOA 2PLXA 1DXPA 3O8DA 4X6PA 3SNBA 4I8JA 1Z1IA 4WY3A 1FAXA 4YLUA 1B5GH 5EU8A 1KLIH 1COWD 2ZC9H 3RXFA 1TX6A 5DSFA 5HXFA 5F03A 1V2WT 1TNKA 4GHQA 4I31A 4DVAU 2Y81A 5A8XA 1PPEE 4TPIZ 4K8YA 3RC6A 3LGUA 5E0JA 1H8ED 1RIWC 2DUCA 3PRDA 1DY9A 1BTZA 1FONA 3PV5A 1FN8A 2BD7A 3D49H 1LPKB 2ANWA 1KY9A 1F5RA 1HJAC 2OCVB 2RDEA 3P92A 4MNYA 1CA0C 2UWPA 4FUDA 2XBYA 1V2PT 2ZTZA 5E0HA 1Q3XA 2WZQA 2KCAA 2PFEA 2Z9KA 2ZFRH 3BTHE 3VFEA 2WPDD 4MNXA 1KIGH 1O2QA 4CRCA 3BTEE 4E7NA 3TK5A 4X1QU 1GWAA 3CP7A 4ISHH 1EZSC 2FPZA 1W13U 2P16A 4O3TA 5TCAA 5IDKA 2HPQH 3KQBA 1MKWH 4P02A 1KXCA 2A4QA 2BY7X 4ESTE 2J94A 1P0SH 2W7UA 4NCYA 1UK2A 1TBRH 5JYIA 2GZ8A 3HKJB 2J4IA 1F5LA 3T2NA 4M9FA 2V0BA 3H7TA 1O3AA 3SNDA 1DWDH 1O2TA 1S6FA 2VGCC 1GGDC 1O2HA 2IPQX 3RXUA 2BMGB 3SJIA 1O0DH 1Y3WA 2Z3EA 1FX0B 1OP2A 4UEHH 1ZOMA 1CHGA 2BVRH 1W12U 2BM2A 2TGAA 4X1SU 1S5SA 2BDAA 3ZZ7A 4CRBA 1VCWA 2ZP0H 4IC5A 1NO9H 5EODA 4GVUA 1UTKA 3L33A 2UUKB 4OS7A 4E7RG 2BLOA 3O8BA 5DP9A 1YPEH 1LDTT 1LHDH 3KGPA 1FI8A 1BUIA 2JJ1D 3PMBB 3U9AH 5EXMA 2OC8A 4K60A 1V2MT 3BTGE 4INLA 4TSFD 1A1RA 1G36A 2EA3A 4NGAH 1NS3A 1E37B 4OS6A 1GBLA 1XXDA 3E91A 2WSSD 2PKAA 1ELVA 1KLTA 3B8JA 1KTSB 1QB6A 4H6SB 1ANCA 1L2EA 1YBWA 1C2EA 2A5IA 1SLVB 4XOJA 1GMCG 1MU8B 1O2KA 5HM2A 4NWKA 3EA7A 1XKBC 1HAHH 5PTPA 1FY5A 3OY5U 4AFZA 3KIDU 2KAIB 1CSOE 1SFQB 3RLWH 4BOHA 2HVXA 1XX9A 4DIHH 3IG6B 3RU4E 1C9TA 4Y79A 4MDSA 1MQ5A 4XBBA 4K1EA 3VEQB 1KXEA 3F2FA 4X6MA 4A1VA 1C5MD 4AYYB 2JETC 2Y82A 3RXQA 3LOXA 1C5VA 1NT1A 5SGAE 1BQYA 1WSSH 3ZYEA 1GI5A 3BV9B 3KCGH 2G5VA 2ZU5A 4YOJA 1ZMJA 1W0ZU 1EATA 3HKIB 1XUGA 1QL9A 2O8WA 3SU4A 3SV8A 4CHAB 1CO7E 3M37A 3QTOH 2ZDKA 1QJ7B 4K3JA 4JZDH 3HK6B 3ZVGA 1IQKA 5F6MA 4DW2U 1GJ8B 5GCHF 2ZFTA 1SHHB 1XVMA 1EQ9A 4GCHG 1UTMA 3FKSD 3V12A 1SOZA 1E38B 1C5ZB 1VCQA 2F9BH 1QB1A 2AIQA 3AVZA 1AZ8A 2BY5X 4Y6DA 1KDQB 4WF8A 4X2WA 2FOHA 4YESB 2BDIA 2QY0B 2WPHS 1VGCB 1KXBA 3SJ8A 1SGFA 1ANDA 3S7HB 1UO6A 3TGKE 3F0OA 1F0UA 1P2QA 3KYGA 4ZHMU 3FO8D 1INCA 2YMSD 2BY8X 4Y76A 1DUEA 1H4WA 5E2OA 2XNDD 3DA9B 3GDUA 3M7QA 2ZFPH 2ZGHA 2JH6D 1ZLRA 4WXVA 1C1RA 2VH6A 3FP6E 5FPSA 1BRUP 2FX6A 1P09A 2VIQA 1ELAA 4KGAA 2B9LA 1DT2A 3FAOA 1OWEA 3SU1A 4UFEH 1GI2A 5G4BA 4ISNA 1TFXA 1SGIB 1HAIH 2GZ7A 1YLCA 3A81A 1UVPA 3TNTA 1GL0E 2QF5A 1C9PA 1ZHMA 5DG6A 1ZPZA 2J95A 2FDAA 3U1IB 2XWAA 4FUGA 1O3JA 2FOFA 3SORA 4I8GA 1N6YA 4MQAA 4FUIA 1HUTH 1MH0A 3URCA 3KF2A 4K1SA 5DN6D 3U98H 2IOTA 3VGCB 4AX9H 8ESTE 3BG8A 3ELAH 1SGYE 4Y7AA 1PYTC 1BMMH 1TNLA 1WTGH 4IBLH 2AH4X 1ZTLA 1GCTB 1HXFH 1O37A 2SGEE 4ABHA 5JB9S 4CRGA 1EFRD 5KECA 1GBHA 3NXPA 4D76A 3I78A 1BT7A 1LQDB 1GI1A 3PLBA 3FZDA 1FN6A 2ZPRA 1Z8RA 1P02A 4MTBA 2H9HA 5KGOA 2AFQB 1IHTH 3SV9A 3SV7A 1BBRH 1MTSA 3DHKH 2PUXB 1FDPA 1GHZA 3GCHB 3SUDA 1QRWA 1C2HA 2FYRA 3KNXA 1DICA 1G3CA 4ZH8A 4TY6A 2FYQA 2AMPA 2QGRA 5EG4A 2R3UA 4O3UA 5K0HA 1XUIA 2ALPA 1OP8A 1OKXA 2JDID 1EZUC 2XWBI 1CE5A 1B7XB 1O2YA 2WPLS 4U2WA 3F9FA 4TWWA 1W3CA 2WHXA 1J14A 5GPIB 1DM4B 2LPRA 2F9NA 4H4FA 2ZTXA 4ZHAA 3S9CA 1K1JA 4VGCC 3PV2A 1Y5UT 1D4PB 1IAUA 1WXRA 3SYJA 1GBEA 3N7DA 2ZTYA 1S0QA 4J2YB 1MQ6A 2YMSB 1V2RT 2ODPA 2PSYA 4XDEA 1SGPE 2OINA 3RXGA 1RGQA 4NA8A 1HAVB 1MAXA 5L2YH 3RXAA 4UDWH 2BDCA 1MTNB 1QHRB 1ZTJA 2GCTC 1QFKH 1H8DH 3T26A 4CHAC 3TH3H 2F43B 2FIRH 2AMDA 1MKXH 1S83A 1C5TA 3RU4D 1MTWA 4ISIH 1QQ4A 5JBBS 3RXJA 1QBOA 1RTLA 1WOFA 1L1NA 4WJG2 1K2I1 1ZSKA 1CT4E 1ZHPA 5DP8A 3RXPA 1C4Y2 2H6MA 3P8OA 1BMNH 4B73A 1CHOG 2A7CA 3RP2A 1P57B 2ODQA 3N99A 3U8RH 1HRTH 1A3BH 1VGCC 1C5SA 4TWYA 1C5LH 1GBJA 1VJAU 3VB3A 1O2WA 1G9IE 4MNVA 2BYAX 4WXIA 4HFPB 1PJPA 4Y8XA 2HLCA 4NIXA 1H9HE 2WUCA 1GI6A 2W6ID 3RXTA 8KME2 3TK6A 3TVJB 1O3MA 3A7XA 1OSSA 4FU9A 4ISLA 4IMQA 1TPSA 3LGYA 2HGTH 2FX4A 1TGCA 1HFDA 1MBQA 1O3BA 1FXYA 1QJ6B 3SGBE 4YM9A 3TGJE 2BD5A 1YLNA 1E36B 3A84A 5E8EH 1UK3A 1CA8B 2CJIA 2BLVA 3LIWA 3BEIB 1A5GH 1ELFA 3GYMA 4YT7H 2G52A 1NU7B 3RM0H 3GY5A 3JZ2B 3GCNA 3SJKA 3A7VA 1ELTA 1YYY1 2ZDMA 3DFJA 1S0RA 3BSQA 5AFYH 2STAE 3UR9A 1C5OH 1RRKA 1PPFE 1DSUA 1GMCF 1BA8B 4MG3A 3K9XB 2ZECA 3NWUA 1C2MA 3ZZ6A 4RKJB 2GVFA 1C5XB 4CRAA 2QF4A 4CH2B 4DY7B 1GCTC 1KTTB 1SKYE 2WINI 4RN6A 3ZV8A 1CGIE 3TJNA 3T28A 1QTFA 1W7GH 2TRMA 2NU3E 1EPTB 5ETXA 2AS9A 3PTNA 2EI8A 2BVSH 2V35A 3ZZ4A 3OYPA 4OS2A 3GOVB 1EB2A 1NRQH 1LVMA 1G2MA 4ABEA 2QC2A 3AW1A 4F48B 1DUAA 4INKA 1C2KA 2SGAA 1BB0B 2BOKA 2VJ1A 2BD9A 3EGKH 4Q4LA 2BD8A 3OE7D 4FUBA 1O5GH 1QCPA 4BAOB 1HIAA 4JMYA 2V3MA 1GI9B 3MH5A 1YGCH 5FXLA 1ORFA 2KR7A 3MNSA 4MPWA 1O5DH 1A5IA 1MD7A 3GY3A 4DT7B 1SBWA 2SGQE 3E8LA 4A5TS 5ABWA 1Z6JH 2FWWA 2NU2E 1TNGA 1HAOH 2VNTA 3V3MA 1G37A 2QAAA 3CENA 3PWBA 5DP4A 5GWZA 1GMHG 3RMLH 1ZMNA 3PMJA 2WPIS 4XD7D 1SQRA 2K1QA 3PLPA 2VIDA 4GCHF 1IQEA 2ZO3H 1OX1A 2VVVA 2P94A 4NA7A 4LOYH 1W14U 2CF9H 1NFUA 1LHEH 1A3EH 3ZZDA 1PQ8A 3O8RA 4DT4A 3A7WA 1FY1A 3MNCA 2YMSC 3HGNA 4BAKB 1VZQH 1AE5A 4NZQA 1ZHRA 1P2KA 3EAJA 5CE1A 1YPKH 1TB6H 4BTIB 2GT8A 2Q1JA 3BTME 4RT1A 1MTNC 1QR3E 1SGCA 2GP9B 2LNCA 2UUFB 3DFLA 3RMOH 3MYWA 3KHVA 2DE9A 2QXIA 5K7RA 5CMXH 5KEDA 7GCHG 1GBTA 5C1YA 3EYDA 1SGRE 1LQEA 4AC9A 1E1RD 1S6LA 1DX5M 3P8GA 4TT3D 3MFJA 1MAYA 1G2LA 3MOCA 1O2MA 4OS4A 5EIYA 1O3FA 2PTNA 1TQ0B 4ABFA 1HPGA 1NN6A 1UJ1A 6GCHG 1O32A 2CN0H 3SN8A 1T31A 1O5AB 3LPRA 1GBMA 1ZZZA 2OK5A 1K1LA 4X2XA 5BRRE 3H7OA 1TOMH 1PYTD 2PSXA 3PRBA 1LO6A 1O3GA 3TU7H 1UVOA 2J98B 1C1UH 1AB9B 3AASA 3N7EA 1F0SA 1L1JA 6LPRA 1N6XA 1O3HA 1AQ7A 5C2ZA 3UUZA 1TBZH 1VJ9U 1JMOH 1UTQA 3UTUH 4I7YH 1V6DA 3P8NA 4GAWA 1GJ7B 4TPYA 5EJZA 1AFQB 4YLQH 2HPPH 2HVYB 2FTMA 2D2DA 3R3GB 1SQOA 5EPNA 1GHWH 2XOKD 3U69H 1FIZA 1CBWB 1GL1A 3W94A 1UTLM 5EOKA 2FLRH 4XSKU 4WMFA 1FMGA 2CHAB 4DJZB 5EJLA 1LMWB 3UOPA 4BTTB 3LONA 1GPZA 1MZAA 1V2KT 3FANA 4IS5A 3SI4H 2A45B 2A7JA 4ZUHA 2QCYA 3SNEA 2ODYB 1C5PA 3QZRA 1ZGIA 1K22H 3MH4A 3KN2A 6CHAB 1CGHA 3F6UH 4CH8B 4DGJA 1C2IA 1SGTA 1AUJA 1IQGA 1GI7B 3PTBA 3WWBA 4RI0A 1XUHA 1P2MA 3ESTA 3HK3B 3UQOA 2C3SA 5C5OA 1DANH 3ATIA 1C5QA 4JK5A 3F9HA 1M9UA 3UB0A 4FETA 1C4V2 4FUEA 2ZCKP 1EPTC 4KTUA 4X6NA 4WVPE 1OWDA 3NRLA 2C8XB 1V2LT 3LGIA 1C5NH 1SGDE 2BQWB 2SGDE 3SHAH 2C93B 4GSOA 1AUTC 2H9TH 3QK1A 1ELEE 2ZEBA 1BDAA 2BY6X 1V2UT 4DURA 4Y0YE 1EAWA 2G51A 3OAAD 1GBIA 2BXUH 4PROA 1K9OE 5A8YA 1HJ8A 1P3EA 2FS9A 4FXGH 1K28D 4GHTA 3E6PH 2VU8E 1EP6A 3F2GA 2QE7D 1C2FA 1AKSA 1BHXF 1HXEH 1DVAH 1GHXH 3MU0A 4UFGH 4BTUB 4ZMAH 2IJD1 2AERH 1UK4A 2ZZUH 1HBTH 3UWIA 1AY6H 4KKDA 1O2IA 3T5FH 1NTPA 1QJ1B 4XBCA 2G81E 1IOEA 3KQDA 1SGQE 3STIA 2SGPE 3SBKA 1XUKA 3UWJH 1CHOF 2EEKA 2ZHWH 1BITA 3VB5A 3TH2H 1NFYA 1GHBG 1BTPA 2VBCA 3A7YA 1C5RA 3M35A 3I29A 2AGGX 1O33A 4ZKSU 1W0YH 4ISOA 1THSH 3ZVAA 3OEED 5A2MH 1SQAA 1UVUH 5HMAA 3SV6A 2P8OC 1O5EH 4X8UH 4AOQA 3ENSB 3LGTA 1ABIH 1FPCH 1L4DA 1O34A 2ZHQH 1K1OA 4CBNA 3BTKE 4CR5A 2W6JD 2C90B 1DWBH 1YCPM 3A80A 3P17H 4UFDH 1GVZA 3UR6A 2F9PA 2FM2A 1H8IH 1RXPA 3NCLA 1FAKH 2FZZA 2PGQB 3LH1A 4LZ1H 1N1LA 4YOGA 4AORA 1WU1A 1DWEH 6ESTA 4I8LA 1EAXA 1DSTA 2ZU1A 4Q80A 4YZUA 1AB9C 2ZDVH 1VR1H 2WPMS 3ZVEA 1DWCH 1K1PA 1QIXB 1MD8A 2BDHA 3B23B 2HLDD 1W10U 2F4LA 1QNJA 1AU8A 4IW4E 3A8AA 1PPZA 4ACAA 2ASUB 1ELDE 3EDXB 1BTHH 1LPZB 1SG8B 2ALVA 1JRTA 2GDEH 3PO1B 2FLBH 1O5BB 4Y8ZA 4Q63A 1UCYE 1WQVH 1O2GH 2PHBA 3ZZ9A 2FOCA 1AFQC 1HV7A 2ZA5A 1P04A 1SSXA 2Y7ZA 4RKOB 5T3HA 1V2VT 1PQAA 5I25A 3LJJA 4ABDA 1HLTH 1F92A 2Y80A 4ABAA 5BPEA 4O03A 2KCPA 5E2PA 3M7UA 1FIWA 3SU3A 1ZPBA 2KX4A 4MLFB 4D7FA 3BG4B 5FHTA 3OTJE 3Q76A 3S9BA 2YNAA 4IN1A 2V7QD 4O9VA 1Y8TA 4U01A 4NFFA 2RFKC 2KM0A 3F9GA 3QTVH 3ZYDA 3TJVA 2HALA 5C0TA 2BQ6B 2VVUA 1C2JA 2VWNA 3ZIAD 1P8VC 6CHAC 2NU4E 2BZ6H 2W5EA 1NBME 1MTUA 1DE7H 1S81A 1GMHF 2GKVE 2SNVA 2ULLA 3UNSA 3BEFB 2XBWA 2FI5E 5F8ZA 1EAUA 2F9UA 3PWCA 3OSYA 1C5YB 2FOEA 3LGVA 1D9IA 1A4WH 3SZEA 1LHCH 3SU6A 2BLWA 2OUAA 3DCLA 5T6DA 1Z8GA 3A8BA 2QN5T 2SNWA 4NIYA 3DUXH 3ATKA 1UHBB 1T8OA 2GCHG 1DS2E 1YLDA 4YTAA 1AD8H 2C8WB 2ZHFH 2TIOA 4XBDA 1TALA 1TRMA 8GCHG 5A0BA 2HNTF 1FY8E 2QXJA 1NFWA 2V3OH 2BVXH 5DK1A 1A0JA 1A0HB 1S84A 7GCHF 2CMYA 2BY9X 5C20A 4CBOA 1YKTA 2PWXA 2J97A 3GCTF 2ZDLA 3ZZBA 3UAIC 2BDYA 3M3TA 6GCHF 1Q31A 4B74A 1C2DA 2VWMA 1IQFA 4OGXA 3ZV9A 3OTPA 4AFSA 4X0WU 1NRPH 1O3EA 4A7IB 2Q6GA 4DG4A 3AW0A 2C4FH 4AFUA 1Y59T 1SGEE 1GDUA 3P8FA 4HGCA 2G5NA 5JBAS 3E3TA 1GHAG 1TGTA 1GHVH 3M61U 2CF8H 1O2RA 4UD9H 2F9OA 1TYNA 2Z9GA 1O3OA 1YY3A 3ZZ8A 4AB8A 1D6RA 1ZRBA 3JZ1B 3U8TH 2EQNA 1TWXB 2QA9E 1ETRH 1RTFB 5T6GA 1ZSLA 1LHGH 4D9RA 2B7DH 3M5OA 3P95A 3OX7U 2F9VA 3RXIA 1AVGH 3RXDA 1AN1E 1Y5AT 4FOUC 3E0NB 3RXRA 3KYFA 1TMTH 3ZZ5A 1O2JA 1AVWA 4K1TA 3MNBA 3RMMH 1VCPA 1TRNA 1YPHE 3IWMA 2EC9H 2EI6A 2DE8A 4WH6A 4YT6H 1WV7H 3K2UA 2TPIZ 1KLJH 3KQEA 4INHA 1O3LA 1C1TA 2UUJB 1TLDA 2ZGBH 3RXVA 3HGPA 4Z0KA 1FY4A 4NA9H 2Z7FE 3DD2H 1W0JD 1EZQA 4ZKNU 1O38A 1O5FH 3MU8A 3VPKA 1CVWH 3LT3A 1VITG 3Q3YA 2BQ7B 2BB4A 4LZ4B 2ZDAH 2TGPZ 1BRCE 1G3EA 1NRNH 2XCNA 1CGJE 1MCVA 3GISB 5HKKD 1HAPH 2O8TA 1GI3A 2R0KA 3MQKC 3PO1C 5FCKA 3UNRA 2FI4E 1QL8A 2C8YB 4BNRA 4H6TA 1WCZA 4TY7A 1P9UA 1F2SE 1PPGE 3MU4A 2QIQA 1QA7A 1GVLA 5C1XA 3SUEA 3RLYH 1DPOA 1DLKB 2WV9A 4I8KA 5C3NA 4DCDA 3SQEE 5T6FA 1LPGB 2SGFE 5TJXA 2BTCE 3BG4C 1IQHA 2PGBB 2FODA 4K8BA 5L6NH 3C1KA 3U1JB 1E0FD 2AIPA 3SJOA 4X8VH 1GJDB 1BMLA 2QV1A 4Z1MD 1F7ZA 3GS9A 1H9IE 2WPJS 1MZDA 2ZPSA 4WH8A 5EJ1A 3A82A 1TGSZ 5JPMH 2TBSA 1TX8A 2FOBA 1W7XH 4FUJA 2RA3A 4I33A 2ANYA 3DSPA 4GPGA 2XBXA 2A1DB 3SNCA 5FAHA 1SOTA 3MMGA 4ABJA 2M5TA 5DP7A 9LPRA 3RC5A 1EP5A 2GT7A 1KSNA 2J2UA 1GHBF 5FPTA 3SZNA 3K6YA 4X6OA 5GIBA 4Q7YA 1AE8H 2Z3DA 3UPEA 4RT0A 2GMTB 3A7ZA 3PM3A 1QB9A 4OS5A 1P06A 5F8TA 2JH0D 2EI7A 1D3QB 1O3KA 1EOJA 2PKAB 2A32A 3SU2A 3EE7A 3Q77A 1O2SA 1RIWB 1O30A 3MH6A 2A5AA 2XTTB 3KEEA 2W3KA 1V2ST 2ZCLP 3VGCC 4BXWA 1OXGA 2ZFFH 5CHAB 3EA9A 1EJAA 2BHGA 1O3DA 2ANMH 2KFWA 3BIVH 1HAGE 1O2UA 2QYIA 1ARBA 2AHME 5J4SA 2OXSA 3HPTB 1LKAA 1C2LA 2VIPA 2LP6A 3Q3KA 4BANB 1JOUB 1AZZA 2OQUA 1XUJA 3MNXA 2ANKH 5ESTE 2OLGA 5C1UA 1A5HA 4K5ZA 1KXFA 2GV6A 2K8IA 3U8OH 5A09A 1DOJA 3QN7A 1V3XA 3TLOA 1P9SA 2HNTE 2ZQ2A 3GCHC 4ABIA 3A8CA 5F53A 5B6LA 2ZU3A 3AAVA 1F0RA 4XRNA 2I6QA 4UE7H 4Y8YA 4WMEA 1SHYA 2B0FA 2UUYA 1UCYH 3GY6A 3BEUA 1GI4A 3V7TA 1O3CA 4AZ2B 4ASUD 3ITIA 1O2ZA 1WAYB 5L30H 4AG1A 2VGCB 2FOMB 1T8MA 4NSYA 5LH8A 3OEHD 2L6OA 1AHTH 2BX4A 1TQ7B 3SU0A 3M3VA 1SLXB 2B8OH 1MU6B 3LJOA 3PV4A 4JCNA 1NRSH 1YC0A 5EW2H 3QX5H 3RM2H 1GDQA 2FP7B 1O2PA 2Y5FA 1C1VH 2G00A 4OGYA 2YNBA 1A61H 1Y3VA 3LC5A 4ZAEA 2ZFSA 2JJ2D 2ZG0H 1IQIA 1YWUA 2P3FH 4KP0A 1AWHB 1YPJH 1QRXA 5E0GA 1BCUH 2XRCA 4E06H 1OWJA 5GXPA 1RJXB 1XVOA 1YCPK 3GY8A 1EB1H 1GJ6A 1SVPA 4X8TH 1ELCA 1U6QA 1QBNA 2PUQH 1OOKB 2J5UA 2FESH 1TAWA 3QDZB 3KQ5A 1AVXA 1K1NA 1J15A 5J4QA 1MUEB 2P3TB 2R0LA 4IC6A 4B1TA 3MH7A 1GJ4H 1L0ZA 4XE4A 3MHWU 5JBCS 1PPCE 1K1IA 5LGOA 2GCHF 1NY22 1BZXE 2XC4A 2BOHB 8GCHF 2KZ4A 1AWFH 1TPOA 2Y5HA 3GYLB 3CS7A 1A0LA 4NG9H 1UTNA 3SOSA 3BTFE 4XFQA 1DY8A 2Z9JA 2BXTH 2FO9A 4AYVB 1DDJA 2VIOA 1O2NA 3F2HA 3UREA 2AYWA 4KELA 4IMZA 1BOQA 1NROH 1VITH 4FU7A 1JIRA 1FY3A 1UTOA 1ESAA 4UFFH 5IYTA 4NIWA 1HB0B 4MNWA 3H09A 2A4GA 3BTWE 1BBRE 1O3NA 3ATWA 4X1NU 2VINA 1ZYOA 3PROA 1Z71A 4Y0ZE 1GJAB 1DXWA 4LXBH 1WTHD 1EUFA 2XC5A 2J9NA 2H2ZA 4FVDA 1UCYK 2O9QA 2XYAA 3MO6A 1GHAF 1Z1JA 1TRYA 2GMTC 1TGBA 2UWOA 3URDA 1K21H 1BTYA 1BRBE 2A4RA 1Y3UA 1GJ9B 1EX3A 2G55A 2K0QA 1HDTH 1EOLA 3VG8A 3SUFA 4ACBA 4A1TA 2VIWA 3M5MA 1EXFA 4ZXXH 1OHHD 3ZZ3A 1FLEE 1B0FA 2GJGA 3QZQA 2AGIX 3A89A 2ZU2A 1JXPA 2Z94A 1AI8H 5CHAC 4JYVH 3RXMA 3MTYA 1UW7A 1UTJA 1LVYA 1GCDA 4RSPA 1C1MA 1KMHB 1AIXH 1ZJKA 1T32A 4B76A 4D8NA 1TPAE 1DITH 1P2IA 1OYTH 1YPMH 2QXGA 3QUMP 4YOIA 5EW1H 1OWIA 1HAVA 1BHXB 3B9FH 1GI0A 1K1MA 2VIVA 1P12E 2SFAA 3R0FA 1VITF 1WBGB 3GY4A 2Q6DA 1BJUA 1QURH 3RXOA 2JIZD 1J9CH 1QRZA 1LKBA 1FV9A 2ZI2H 1TA2A 3D62A 2ZDNA 5H4IB 1P2JA 1O3IA 1V2JT 3FVFB 5FPYA 2BLQA 2ZIQH 2PP6A 3I77A 1ZMLA 4FUHA 1C4U2 2PKSB 2RA0A 3A88A 4AFQA 3LKWA 1D6WA 2ZU4A 3NK8A 4LK4A 2TGTA 1SR5C 5LPEA 1C1SA 2PR3A 4X2VA 1W11U 1SB1H 1GBCA 1JRSA 3A85A 3RXSA 3T62A 2XCFA 2IPHA 3TNSA 1CT2E 1S85A 2JKHA 4HI3A 4CREA 2OBOA 2F3CE 1FJSA 4NWLA 3E16B 5CHBA 1ARCA 3SO3A 3S69A 5DGJA 1GBAA 3STJA 2KCOA 1L4ZA 3F9EA 1P01A 4M7GA 1H1BA 1UTPA 3Q00A 5AVDA 3SU5A 1G32B 3TITA 3NUMA 3WWFA 1BTUA 3PB1E 5DO4H 1ELGA 3O8CA 3E90B 4BAQB 2PV9B 1V2NT 1E1QD 2XC0A 5C67A 4MPXA 4JZFH 4ZHLU 2FS8A 1PQ5A 2A5KA 3LH3A 4HG6A 3V0XA 2BZAA 1ESTA 1EKBB 1JWTA 2V3HH 1LVOA 5FL7D 3ZVDA 3NZIA 3QGJA 4NIVA 2BD2A 2IJOB 1P3CA 2QXHA 1NRRH 2ZQ1A 3A86A 1T4VH 1E35B 3TIUA 1QY6A 4F4OC 2BD3A 3ZVFA 1ANEA 3RXEA 7LPRA 1X7AC 1D3PB 1P2OA 2PTCE 5FX5A 1D3TB 5EQQA 2R3YA 2ZGXH 3UY9A 5LPRA 3VB7A 3GY2A 1TABE 1TGNA 2ZF0H 1GBKA 2J92A 1BMAA 1JBUH 4B2BA 1FZZA 4HZHA 4MVNA 2FMJA 1P10A 1EPTA 1P2NA 2ZGJA 4VGCB 5L2ZH 1OP0A 4OM9A 2G8TA 3AAUA 1EJNA 2KCYA 1MKWK 2IN2A 2OC7A 5C94A 2AGEX 2G4TA 1TBQH 2W3IA 1IQNA 3ODFA 1C1QA 5DKMA 3UFAA 1GG6B 1AFEH 1E34B 1PFXC 1CBWC 4ZCNA 1OYQA 1ZSJA 4IN2A 5EXLA 2B5TB 1QA0A 2GCTB 3SQHE 4WWYA 2STBE 4CRDA 3S9AA 2CHAC 4NFEA 3QGNB 1SQTA 5C5NA 1W8BH 1T4UH 3KQCA 5FBIA 3EQ0H 1HIAB 3W95A 4J1YA 1DLEA 2L74A 3Q3XA 5HIYA 1SMFE 3L6PA 3BN9A 1TNJA 1MMJN 2D26C 3LC3A 5JDUB 1WDIA 3BTQE 3ATLA 4U32A 3DSGA 4THNH 1QL7A 4FVBA 3UNQA 1D3DB 1XUFA 7ESTE 4Y11E 2GX4A 2P93A 3M7TA 2R2WU 3SI3H 3A7TA 1F5KU 2CV3A 2FOAA 1J16A 2GV7A 1TIOA 4U30A 1J17T 1OPHB 2D1JA 5EQSA 2ILNA 4CRFA 3FP7E 1G30B 3F68H 3RXCA 1MTVA 2FEQH 2WPKS 1A2CH 1YPLH 3QLPH 1YPHC 1SPJA 4X2YA 5EQRA 5FX6A 3SNAA 3ZZAA 2OC0A 2THFB 2A2QH 1LCYA 1W2KH 1CU1A 2NU0E 3E0PB 4IGDA 3SGQE 4FUCA 1GMDG 1W0KD 2PKSC 3M5NA 4AB9A 4YXWD 1ELBA 4B75A 5B6OA 1TPPA 4I32A 1SGFG 1G3BA 4WMDA 1EASA 1FQ3A 1LTOA 1ZR0A 1GJ5H 2F83A 2J98A 1FNIA 3ATMA 5A0AE 2XBVA 1P05A 1C1PA 1FPHH 3OFND 2GTBA 3F3BA 1GI8B 3A83A 2Y5GA 3RXHA 3RU4T 2GD4B 4ABGA 1T7CA 3FFGA 5HGGA 4H42U 4JZIA 3TGIE 1CQQA 3T27A 1MCTA 2W7SA 1Z8JB 2RG3A 1LHFH 1LVBA 1HAXB 1O2LA 4X1PU 4JYUH 4E05H 3PMAB 1N8OB 2G4UA 2J34A 1XKAC 1KYNA 1WUNH 1BTWA 4AGJA 1P03A 1O2OA 1F0TA 3T25A 1WQSA 2QF0A 4K69A 1THRH 1UVTH 3W1EA 1Z6EA 4OS1A 2Z9LA 4ZKRU 2F91A 2WUBA 3L3TA 1AMHA 4I8HA 2ZCHP
chains in the Genus database with same CATH topology
4AGKA 1T8LA 2H1UA 4MPUA 2NWNA 3LDXH 1ETTH 2WYJA 3SV2H 2TGDA 4JZEH 1TNHA 1TMBH 2QF3A 1UMAH 2XXLA 2YOLA 4GUXA 1TMUH 1XXFA 3DT0H 1PQ7A 1WYKA 1JIMA 1TE0A 3S7KB 1A46H 1ZPCA 2OD3B 1Y3XA 1KXDA 1HAZB 5AHGH 1A7SA 1ETSH 1YPGH 1HAYB 1O2VA 3FP8E 1GVKB 2ESTE 5EPYA 1C1OA 3PLKA 4ZKOU 1AGJA 3QO6A 2HOBA 3MO3A 3GDSA 3RMNH 1SC8U 4Q7ZA 4KTCA 4UONA 2AEIH 2H9EH 3N7OA 2ZFQH 3M3SA 4KTSA 1GG6C 2ZPQA 4A1XA 2Z6BD 2ZHEH 2CXVA 3MU1A 4MPVA 4X1RU 1O39A 9ESTA 3IITA 2FXRA 1O31A 1RS0A 4DOQA 1SLWB 1C1NA 2WYGA 3BTDE 4FU8A 2OBQA 2P95A 4JK6A 4BAMB 3TJOA 1T8NA 3MU5A 3M5LA 1TOCB 1DFPA 5EXNA 4ASHA 4NZLA 1SLUB 3P6ZB 1BJVA 4SGAE 2H5CA 5JBTA 1H9LB 1V2QT 2XNIA 2UWLA 1ZRKA 2W26A 1ZGVA 1NC6A 1XMNB 1PPHE 1AKSB 3RXLA 2A2XH 3PYHA 1IQJA 4B2CA 2V6NA 4A92A 1PPBH 2GGVB 3UQVA 3RXBA 1G3DA 1O2XA 1C5UA 4DIIH 2HNTC 2HRVA 1UVSH 4X8SH 5GJ4B 3SUGA 2OC1A 1ACBE 1GBDA 1O3PB 1P11E 1CT0E 4QT8C 8LPRA 3BTTE 1GBFA 3MWIU 1HGTH 4CR9A 5DPAA 1BBRK 4TYDA 3EA8A 1AO5A 5LPFA 1C5WB 2WV4A 5FCRA 1YCPH 5A0CA 1Y3YA 1TONA 3RDZA 2JH5D 5TCCA 2GDDA 1EZXC 4B71A 1HNEE 1BTXA 1NFXA 4BXSA 2PW8H 2WV5A 3LU9B 5EGMA 3SHCH 3P70B 3SGAE 3VB4A 2KAIA 4JYTA 3VB6A 3RUOA 1V2TT 2R9PA 4F49A 1XM1A 1HJAB 1EAIA 2ZNKH 1CA0B 4Q7XA 1OS8A 5DJ7A 3FZZA 1QQUA 3ODDA 3C27B 1MBMA 2BX3A 3E1XB 3BIUH 3RXKA 2A0QB 2GZ9A 2ZKSA 3BF6H 4BAHB 1NPMA 2O8UA 3TH4H 2Z9IA 4YO9A 1NM6A 1C1WH 3EE0B 4R0IA 3ZZCA 2RCEA 3VXFH 1ZJDA 4SGBE 2FTLE 1IQMA 1YP9A 1BRAA 5DP6A 2NU1E 5AF9H 1HYLA 3ZVCA 3D23A 3SJ9A 1C2GA 2A4OA 1L1GA 3F1SB 1ID5H 1N8OC 3G01A 4HTCH 1O35A 2A31A 4AG2A 3NKKA 3OU0A 2Q6FA 4Z6AH 1O5CB 1ABJH 3NPSA 1HJ9A 1ZTKA 2OTVA 3MI4A 1Z8IB 1SL3A 4JZ1A 1YM0A 2BDGA 2R2MB 1MKXK 5GCHG 1Q2WA 2ZHDA 3PMHB 4B2AA 1GGDB 1KDQA 1V2OT 4K2YA 3UOUA 3K65B 5JB8S 3V13A 2Z3CA 4ZROA 7KMEH 3VXEH 3SW2B 1NESE 2Y7XA 1TX7A 5GDSH 3GDVA 4GLYA 1S82A 4Y71A 1B0EA 1KXAA 2O8MA 2VVCA 2I6SA 1FUJA 3KL6A 1IHSH 3A8DA 2VB0A 1S6HA 3TPIZ 3OY6U 5F8XA 3K6ZA 1GDNA 1J8AA 3QWCH 5I46H 1RD3B 1SFIA 2FOGA 3ZVBA 1GBBA 2OP9A 2J38A 2ZWLH 1UHBA 3GY7A 3S0NA 2CGAA 5DP5A 2XW9A 3H5CB 1EJMA 5FBEA 3WY8A 2D8WA 3MO9A 4R8TB 1TNIA 2O8LA 2VWLA 1O36A 4FUFA 2RDLA 3A87A 1NZQH 2HWLB 2Y6TA 4NSVA 1TA6A 1OWHA 1HCGA 2A7HA 2P8OB 1RFNA 2AMQA 3M36A 1GJBB 1NU9A 3CS0A 4AN7A 2OQ5A 5DP3A 1ANBA 1SI5H 4D7GA 2C8ZB 2H5DA 3GCTG 2VH0A 5HYOA 4O97A 1QBVH 1GMDF 2P3UB 2VWOA 4ABBA 1THPB 4A6LA 3D65E 4D9QA 3LGWA 4Y10E 1BIOA 1RTKA 1IQLA 1QGFA 5HM9A 1Y5BT 4ZXYH 1GJCB 2BD4A 3HATH 5AFZH 5A8ZA 2FI3E 3GICB 3RC4A 1Z7KA 5ESBA 1SGNE 1YF4A 3TK9A 3TJUA 2JETB 1GHYH 4Q2KA 1ESBA 2P59A 2ZGCA 3UIRA 3T29A 1OWKA 4Y7BA 2BDBA 3GCOA 2PLXA 1DXPA 3O8DA 4X6PA 3SNBA 4I8JA 1Z1IA 4WY3A 1FAXA 4YLUA 1B5GH 5EU8A 1KLIH 3RXFA 2ZC9H 1TX6A 5HXFA 5F03A 1V2WT 1TNKA 4GHQA 4I31A 4DVAU 2Y81A 5A8XA 1PPEE 4TPIZ 4K8YA 3RC6A 3LGUA 5E0JA 1RIWC 2DUCA 1DY9A 1BTZA 1FONA 1FN8A 2BD7A 3D49H 1LPKB 2ANWA 1KY9A 1F5RA 1HJAC 2OCVB 3P92A 4MNYA 1CA0C 2UWPA 4FUDA 2XBYA 1V2PT 2ZTZA 5E0HA 1Q3XA 2PFEA 2Z9KA 2ZFRH 3BTHE 3VFEA 4MNXA 1KIGH 1O2QA 4CRCA 3BTEE 4E7NA 3TK5A 4X1QU 1GWAA 3CP7A 4ISHH 1EZSC 2FPZA 1W13U 2P16A 4O3TA 5TCAA 5IDKA 2HPQH 3KQBA 1MKWH 1KXCA 2A4QA 2BY7X 4ESTE 2J94A 1P0SH 2W7UA 4NCYA 1UK2A 1TBRH 5JYIA 2GZ8A 3HKJB 2J4IA 1F5LA 3T2NA 2V0BA 3H7TA 1O3AA 3SNDA 1DWDH 1O2TA 1S6FA 2VGCC 1GGDC 1O2HA 3RXUA 2BMGB 3SJIA 1O0DH 1Y3WA 2Z3EA 1OP2A 4UEHH 1ZOMA 1CHGA 2BVRH 1W12U 2BM2A 2TGAA 4X1SU 1S5SA 2BDAA 3ZZ7A 4CRBA 1VCWA 2ZP0H 4IC5A 1NO9H 5EODA 4GVUA 1UTKA 3L33A 2UUKB 4OS7A 4E7RG 2BLOA 3O8BA 5DP9A 1YPEH 1LDTT 1LHDH 3KGPA 1FI8A 1BUIA 3PMBB 3U9AH 5EXMA 2OC8A 4K60A 1V2MT 3BTGE 4INLA 1A1RA 1G36A 2EA3A 4NGAH 1NS3A 1E37B 4OS6A 1GBLA 1XXDA 3E91A 2PKAA 1ELVA 1KLTA 3B8JA 1KTSB 1QB6A 4H6SB 1ANCA 1L2EA 1YBWA 1C2EA 2A5IA 1SLVB 4XOJA 1GMCG 1MU8B 1O2KA 5HM2A 4NWKA 3EA7A 1XKBC 1HAHH 5PTPA 1FY5A 3OY5U 4AFZA 3KIDU 2KAIB 1CSOE 1SFQB 3RLWH 4BOHA 2HVXA 1XX9A 4DIHH 3IG6B 3RU4E 1C9TA 4Y79A 4MDSA 1MQ5A 4XBBA 4K1EA 3VEQB 1KXEA 4X6MA 4A1VA 1C5MD 4AYYB 2JETC 2Y82A 3RXQA 3LOXA 1C5VA 1NT1A 5SGAE 1BQYA 1WSSH 3ZYEA 1GI5A 3BV9B 3KCGH 2G5VA 2ZU5A 4YOJA 1ZMJA 1W0ZU 1EATA 3HKIB 1XUGA 1QL9A 2O8WA 3SU4A 3SV8A 4CHAB 1CO7E 3M37A 3QTOH 2ZDKA 1QJ7B 4K3JA 4JZDH 3HK6B 3ZVGA 1IQKA 5F6MA 4DW2U 1GJ8B 5GCHF 2ZFTA 1SHHB 1XVMA 1EQ9A 4GCHG 1UTMA 3V12A 1SOZA 1E38B 1C5ZB 1VCQA 2F9BH 1QB1A 2AIQA 3AVZA 1AZ8A 2BY5X 4Y6DA 1KDQB 4WF8A 4X2WA 2FOHA 4YESB 2BDIA 2QY0B 2WPHS 1VGCB 1KXBA 3SJ8A 1SGFA 1ANDA 3S7HB 1UO6A 3TGKE 1F0UA 1P2QA 4ZHMU 1INCA 2BY8X 4Y76A 1DUEA 1H4WA 5E2OA 3DA9B 3GDUA 3M7QA 2ZFPH 2ZGHA 2JH6D 1ZLRA 4WXVA 1C1RA 2VH6A 3FP6E 5FPSA 1BRUP 2FX6A 1P09A 2VIQA 1ELAA 4KGAA 2B9LA 1DT2A 3FAOA 1OWEA 3SU1A 4UFEH 1GI2A 5G4BA 4ISNA 1TFXA 1SGIB 1HAIH 2GZ7A 1YLCA 3A81A 1UVPA 3TNTA 1GL0E 1C9PA 1ZHMA 5DG6A 1ZPZA 2J95A 2FDAA 3U1IB 2XWAA 4FUGA 1O3JA 2FOFA 3SORA 4I8GA 1N6YA 4MQAA 4FUIA 1HUTH 1MH0A 3URCA 3KF2A 4K1SA 3U98H 2IOTA 3VGCB 4AX9H 8ESTE 3BG8A 3ELAH 1SGYE 4Y7AA 1PYTC 1BMMH 1TNLA 1WTGH 4IBLH 2AH4X 1ZTLA 1GCTB 1HXFH 1O37A 2SGEE 4ABHA 5JB9S 4CRGA 1GBHA 3NXPA 4D76A 3I78A 1BT7A 1LQDB 1GI1A 3PLBA 3FZDA 1FN6A 2ZPRA 1Z8RA 1P02A 4MTBA 2H9HA 2AFQB 1IHTH 3SV9A 3SV7A 1BBRH 1MTSA 3DHKH 2PUXB 1FDPA 1GHZA 3GCHB 3SUDA 1QRWA 1C2HA 2FYRA 3KNXA 1DICA 1G3CA 4ZH8A 4TY6A 2FYQA 2AMPA 2QGRA 5EG4A 2R3UA 4O3UA 5K0HA 1XUIA 2ALPA 1OP8A 1OKXA 1EZUC 2XWBI 1CE5A 1B7XB 1O2YA 2WPLS 4U2WA 3F9FA 4TWWA 1W3CA 5GPIB 1J14A 1DM4B 2LPRA 2F9NA 4H4FA 2ZTXA 4ZHAA 3S9CA 1K1JA 4VGCC 1Y5UT 1D4PB 1IAUA 1GBEA 2ZTYA 1S0QA 4J2YB 1MQ6A 1V2RT 2ODPA 2PSYA 4XDEA 1SGPE 2OINA 3RXGA 1RGQA 4NA8A 1HAVB 1MAXA 5L2YH 3RXAA 4UDWH 2BDCA 1MTNB 1QHRB 1ZTJA 2GCTC 1QFKH 1H8DH 3T26A 4CHAC 3TH3H 2FIRH 2AMDA 1MKXH 1S83A 1C5TA 3RU4D 1MTWA 4ISIH 1QQ4A 5JBBS 3RXJA 1QBOA 1RTLA 1WOFA 1L1NA 4WJG2 1K2I1 1ZSKA 1CT4E 1ZHPA 5DP8A 3RXPA 1C4Y2 2H6MA 3P8OA 1BMNH 4B73A 1CHOG 2A7CA 3RP2A 1P57B 2ODQA 3U8RH 1HRTH 1A3BH 1VGCC 1C5SA 4TWYA 1C5LH 1GBJA 1VJAU 3VB3A 1O2WA 1G9IE 4MNVA 2BYAX 4WXIA 4HFPB 1PJPA 4Y8XA 2HLCA 4NIXA 1H9HE 2WUCA 1GI6A 3RXTA 8KME2 3TK6A 3TVJB 1O3MA 3A7XA 1OSSA 4FU9A 4ISLA 4IMQA 1TPSA 3LGYA 2HGTH 2FX4A 1TGCA 1HFDA 1MBQA 1O3BA 1FXYA 1QJ6B 3SGBE 4YM9A 3TGJE 2BD5A 1E36B 3A84A 5E8EH 1UK3A 1CA8B 2CJIA 2BLVA 3LIWA 3BEIB 1A5GH 1ELFA 3GYMA 4YT7H 2G52A 1NU7B 3RM0H 3GY5A 3JZ2B 3GCNA 3SJKA 3A7VA 1ELTA 1YYY1 2ZDMA 3DFJA 1S0RA 3BSQA 5AFYH 2STAE 3UR9A 1C5OH 1RRKA 1PPFE 1DSUA 1GMCF 1BA8B 4MG3A 3K9XB 2ZECA 3NWUA 1C2MA 3ZZ6A 4RKJB 2GVFA 1C5XB 4CRAA 4CH2B 4DY7B 1GCTC 1KTTB 2WINI 4RN6A 3ZV8A 1CGIE 3TJNA 3T28A 1QTFA 1W7GH 2TRMA 2NU3E 1EPTB 5ETXA 2AS9A 3PTNA 2EI8A 2BVSH 2V35A 3ZZ4A 3OYPA 4OS2A 3GOVB 1EB2A 1NRQH 1LVMA 1G2MA 4ABEA 2QC2A 3AW1A 1DUAA 4INKA 1C2KA 2SGAA 1BB0B 2BOKA 2VJ1A 2BD9A 3EGKH 2BD8A 4FUBA 1O5GH 1QCPA 4BAOB 1HIAA 4JMYA 1GI9B 3MH5A 1YGCH 5FXLA 1ORFA 3MNSA 4MPWA 1O5DH 1A5IA 1MD7A 3GY3A 4DT7B 1SBWA 2SGQE 3E8LA 4A5TS 5ABWA 1Z6JH 2FWWA 2NU2E 1TNGA 1HAOH 2VNTA 3V3MA 1G37A 2QAAA 3CENA 3PWBA 5DP4A 5GWZA 1GMHG 3RMLH 1ZMNA 3PMJA 2WPIS 2K1QA 3PLPA 2VIDA 4GCHF 1IQEA 2ZO3H 1OX1A 2VVVA 2P94A 4NA7A 4LOYH 1W14U 2CF9H 1NFUA 1LHEH 1A3EH 3ZZDA 1PQ8A 3O8RA 3A7WA 1FY1A 3MNCA 3HGNA 4BAKB 1VZQH 1AE5A 4NZQA 1ZHRA 1P2KA 3EAJA 5CE1A 1YPKH 1TB6H 4BTIB 2GT8A 2Q1JA 3BTME 1MTNC 1QR3E 1SGCA 2GP9B 2LNCA 2UUFB 3DFLA 3RMOH 3MYWA 3KHVA 2DE9A 2QXIA 5K7RA 5CMXH 7GCHG 1GBTA 5C1YA 3EYDA 1SGRE 1LQEA 1DX5M 3P8GA 3MFJA 1MAYA 1G2LA 3MOCA 1O2MA 4OS4A 1O3FA 2PTNA 1TQ0B 4ABFA 1HPGA 1NN6A 1UJ1A 6GCHG 1O32A 2CN0H 3SN8A 1T31A 1O5AB 3LPRA 1GBMA 1ZZZA 1K1LA 4X2XA 5BRRE 3H7OA 1TOMH 1PYTD 2PSXA 1LO6A 1O3GA 3TU7H 1UVOA 1C1UH 1AB9B 3AASA 1F0SA 1L1JA 6LPRA 1N6XA 1O3HA 1AQ7A 5C2ZA 3UUZA 1TBZH 1VJ9U 1JMOH 1UTQA 3UTUH 4I7YH 1V6DA 3P8NA 4GAWA 1GJ7B 4TPYA 1AFQB 4YLQH 2HPPH 2FTMA 2D2DA 3R3GB 1SQOA 5EPNA 1GHWH 3U69H 1FIZA 1CBWB 1GL1A 3W94A 1UTLM 5EOKA 2FLRH 4XSKU 4WMFA 1FMGA 2CHAB 4DJZB 1LMWB 3UOPA 4BTTB 3LONA 1GPZA 1MZAA 1V2KT 3FANA 4IS5A 3SI4H 2A45B 2A7JA 4ZUHA 2QCYA 3SNEA 2ODYB 1C5PA 3QZRA 1ZGIA 1K22H 3MH4A 3KN2A 6CHAB 1CGHA 3F6UH 4CH8B