1YKTA

Trypsin/bpti complex mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDAGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin II
publication title Partially folded bovine pancreatic trypsin inhibitor analogues attain fully native structures when co-crystallized with S195A rat trypsin
pubmed doi rcsb
source organism Rattus norvegicus
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yktA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yktA02
4JYVH 2Z3CA 1ID5H 2FOFA 1O30A 3FAOA 3TH3H 2ZP0H 2IPHA 4MQAA 2BX4A 2ZPRA 3SJKA 1QB9A 3TU7H 5JB8S 1IHTH 1AWFH 1C1VH 1UTMA 3JZ2B 4ZKNU 3KL6A 3TNSA 1GHAF 1MUEB 1S0QA 1NY22 3PMJA 1QRXA 2C8WB 1HJ9A 1O3AA 4X0WU 2VWOA 2BZ6H 4FU7A 1TIOA 4UFGH 1IQGA 3LPRA 2BB4A 4Q7YA 1XKAC 4WXVA 1XKBC 5L6NH 3P95A 3UUZA 2ZCHP 2NU3E 1ZMNA 2BD3A 3A7ZA 1GBKA 1WOFA 3E3TA 3U69H 1RJXB 5FPTA 5JB9S 5EGMA 3RMNH 3TJNA 2KAIA 3VXEH 2ZDNA 2F9VA 1BRUP 5GCHG 1C2JA 3KNXA 1QNJA 1TBZH 3FFGA 4Z0KA 2F9BH 4KGAA 4B76A 1MU8B 4NZQA 5C20A 2BY9X 1N8OC 1AFQB 3BIVH 1EAIA 3DT0H 1W10U 3LH1A 3PMHB 3ZVBA 1QRZA 1F5LA 2SGEE 1AHTH 1DUEA 1P2NA 3PO1C 1SQOA 1QIXB 1QJ6B 2BM2A 4RKOB 1QURH 3M3TA 2Z7FE 3ZVFA 1XXDA 1ELEE 2AMPA 5F8TA 3QUMP 2WPHS 1GBJA 4DCDA 1G32B 1C4Y2 2B8OH 1G9IE 4INLA 1DOJA 1EATA 3S69A 1UJ1A 1EKBB 3UNSA 1MAYA 2A5KA 2C8XB 3LKWA 1B0FA 2DUCA 3SU6A 4Y79A 4NWLA 1DSUA 2ZGCA 6LPRA 3ODDA 2OC7A 1BTHH 2CHAC 2GT7A 3G01A 3SNDA 1O2ZA 5DPAA 4BAKB 1PQAA 2UUJB 4YZUA 2HLCA 4DJZB 1HJAB 3ZVEA 2FWWA 3I77A 3RXUA 4B73A 3DHKH 5GXPA 3SHCH 5FX5A 2BLVA 3ZZ6A 1K1LA 2ODQA 1VJAU 2BD4A 4LK4A 1S0RA 3KQDA 1N6YA 1O3HA 2TPIZ 1BZXE 3BTEE 1QGFA 3BTGE 1O3GA 1ZRKA 1GJ7B 3TH2H 1VITH 1TPSA 3M7TA 2Y5GA 4NSVA 1QHRB 3QTVH 3MYWA 4LXBH 5HMAA 1L1NA 1UK2A 1CA0B 2P95A 3ZZ3A 2SGAA 2SFAA 1BHXB 1IQHA 5C1XA 1GBTA 2P3TB 2QXGA 3A8DA 1K1IA 2P8OC 1QBOA 2TBSA 4YESB 1KLJH 4I8GA 2PV9B 1AKSB 5LH8A 2PWXA 4NSYA 3NWUA 4INHA 1GCDA 1ZMJA 1WAYB 1L4ZA 4JCNA 2J9NA 3L33A 2XBYA 4OGXA 4ZMAH 1BDAA 2XWBI 1C2LA 1K1PA 1XX9A 1F0RA 3VB4A 1P9SA 1RTLA 1UTNA 1O3CA 4KELA 1ZSJA 1G3DA 1VCPA 1C9TA 1DY9A 1GI8B 3UWJH 1HAXB 3M5LA 3SU5A 1AWHB 1E37B 2V0BA 3Q77A 1UHBA 1FAKH 3GICB 4JK6A 1TFXA 4OGYA 4WY3A 1GMDF 1UTJA 2BY6X 3STIA 1BTYA 1MTNB 3LJJA 4X2YA 1TWXB 2FOAA 1AB9C 1AGJA 4U01A 5FBEA 4OS7A 4WXIA 4NFFA 4XDEA 3UOUA 9LPRA 4FUHA 3K6ZA 3U8RH 5DO4H 1HAPH 1PPZA 5FHTA 4FXGH 1C1MA 1Y5BT 1TGBA 1UTOA 1BBRE 3QO6A 2GVFA 1V2QT 3SU3A 3UTUH 3CS7A 2H9TH 2VB0A 3KQBA 1ANDA 2BQ7B 3ZZAA 5C1UA 1K22H 1XXFA 4SGBE 1H1BA 3GCNA 1GJ5H 1BRAA 1TRNA 1CVWH 1A5HA 1RGQA 5DP3A 1C5TA 1Q3XA 2ULLA 3A7TA 4J1YA 2WPKS 1EASA 2FX4A 1QB1A 3BF6H 1JXPA 1YF4A 3RU4E 1TQ7B 3UR6A 2C3SA 3ATIA 1GG6C 4O03A 4ZKSU 1O2TA 3ATMA 1A2CH 1EPTA 1TOMH 4AN7A 4MG3A 4RN6A 2A7JA 4GLYA 5AF9H 1AN1E 1ABJH 2STBE 1DWBH 4TYDA 1ZLRA 1AVWA 4TY7A 3MU8A 3KHVA 2VGCB 5EQSA 1GI5A 3MTYA 1SBWA 1AQ7A 1KSNA 3BIUH 1UCYH 1P3EA 3UNQA 4KTCA 1Z6JH 1BRBE 1MQ5A 5DP6A 1BT7A 2GKVE 2P94A 2HOBA 3M61U 1CT2E 1MCTA 3TK6A 3KN2A 2D8WA 4BAOB 4D8NA 3SV6A 2GGVB 1EOJA 4IMZA 4FVDA 3ATKA 1RTKA 2B5TB 5IYTA 2G5VA 1MZDA 2GMTC 4SGAE 5AVDA 1NRSH 1YCPH 2BX3A 3RMMH 2BVSH 1KXCA 1PPEE 2AGIX 1HAIH 3E16B 2ZPQA 1Z1IA 1H9LB 1GHYH 1J16A 1P02A 1QFKH 5EODA 2BD7A 1LHDH 1WBGB 1O2MA 1PPGE 1DM4B 4BTIB 1WYKA 1ZPBA 1GBIA 1GBLA 1K28D 2RG3A 4CR9A 1GJCB 5A0AE 2QAAA 4D76A 1O2VA 2P3FH 1CHOF 1V2WT 3AASA 1XVMA 2WPJS 4WH6A 2Y82A 4DVAU 3O8BA 2FYRA 4KKDA 1FQ3A 1Y5AT 1P04A 3MH5A 1A0HB 1ZR0A 3ESTA 5TJXA 5FPSA 1SGFA 4NWKA 3R3GB 1BRCE 1YGCH 1C5UA 2C8ZB 3GDVA 1GDNA 3B9FH 5AFZH 3U9AH 1AO5A 1C2EA 3KCGH 5FCRA 2ZFSA 2H9EH 1HB0B 2AGGX 1C5NH 2RDLA 2CF9H 2F9OA 2ZC9H 2Y7XA 3ZZ8A 1ZHMA 1VGCC 3H7TA 3PO1B 4WH8A 3RXMA 1ZRBA 2OD3B 1HAZB 3ZZ4A 3SJOA 5JBTA 2CV3A 2J34A 5T6DA 2YNBA 1DWCH 3BTME 3K9XB 3RXBA 2BOHB 1SR5C 1O2WA 1MBMA 1KDQA 2J92A 2HALA 1DUAA 1O3BA 1O5AB 2XNIA 1GDUA 2FLBH 3RXFA 3FANA 3CENA 1O39A 3KQEA 1P3CA 4K1EA 1GCTC 1W8BH 5H4IB 2FMJA 3GCHC 2K1QA 3VB7A 2M5TA 3D49H 1Z8IB 3V12A 3ZYDA 3EDXB 2CHAB 5J4SA 4H6TA 2C90B 1DXWA 1HYLA 2UWOA 4QT8C 3RXLA 5C67A 2QY0B 1OP0A 1FAXA 1SVPA 3D62A 4GHQA 1SLVB 4RSPA 3P8GA 4FUIA 3GISB 3KQCA 2HPQH 2QXJA 1DT2A 1QA7A 4YOIA 1THPB 1XVOA 1LHGH 2GCHG 2W3IA 1TGNA 8GCHG 7KMEH 1XM1A 2KAIB 2OC0A 3NCLA 3RXSA 1BB0B 2ZDLA 5EW1H 2NWNA 1AY6H 1GMCF 1NPMA 2D26C 1MBQA 2FODA 4MPVA 2A4GA 2VIWA 5E0HA 1QR3E 2FOMB 2C8YB 4F49A 3PTNA 1NRQH 1ABIH 2ZFPH 1QL8A 3SW2B 1NZQH 1BMNH 2BY8X 1O2LA 3P17H 2AERH 2NU1E 1A46H 2ZG0H 4KTUA 1O35A 3DFJA 1G37A 1CE5A 1GJ8B 1C2HA 1GMHG 1BTUA 1HV7A 4YOJA 2PW8H 1QJ1B 5LPRA 4K8BA 1FN6A 4X1SU 5HM2A 1GI4A 3GCTG 1ELVA 1SQAA 2PUQH 1OYQA 1F7ZA 1D9IA 2BVXH 2YNAA 2FDAA 4ABDA 1P2QA 1W7GH 1GGDC 2A4OA 2BY5X 2OQ5A 1P2IA 1IQIA 1F0SA 1ZTKA 2ZNKH 2P93A 2BDYA 3RUOA 1O2OA 1VZQH 1IQKA 5PTPA 1QCPA 3HPTB 2OINA 1SLXB 1DLKB 1J8AA 1FNIA 4CRGA 4MPUA 4BTTB 3R0FA 5F6MA 1GWAA 1T32A 2ZHFH 1VJ9U 1O5GH 3T26A 3GCOA 2XCFA 2ZWLH 4Q80A 3BTHE 1TB6H 4ZHAA 2ZCKP 5I46H 1AB9B 4CBOA 1HJ8A 2XW9A 2TGAA 4MNYA 3O8DA 4AG2A 1FONA 4HZHA 2WPLS 3RXAA 1DITH 1D6RA 5A2MH 1UCYE 2VINA 4BNRA 2BLOA 4MVNA 3A89A 4JYTA 4CRFA 4GUXA 1TPPA 1GL0E 3TGJE 1UTPA 1O0DH 4RKJB 5DKMA 3SI3H 1EOLA 4DIHH 1XMNB 2EI7A 2FX6A 4TWYA 2UWLA 3A7YA 1TX8A 2XBXA 2B9LA 3EA9A 4CR5A 3PLKA 1Q2WA 4UONA 1Y3XA 4O3UA 1CA8B 1UCYK 1SG8B 3Q3XA 3RM0H 1NFUA 3BG4C 3Q3KA 4ZXXH 2Z94A 3A80A 3RU4D 5A0CA 1S81A 1P9UA 3RMLH 4VGCB 2WUBA 4NG9H 5IDKA 1EB2A 1VITF 1JMOH 3MU4A 1AE8H 1TALA 3A82A 1H8DH 3E6PH 4MNWA 7LPRA 4H4FA 1C2DA 4ABEA 1Z8RA 1NC6A 1CO7E 3BEFB 3GDSA 2J2UA 2H5CA 2O8TA 3QTOH 1J9CH 1YCPK 1E38B 1FY1A 3PWCA 3PM3A 4Q7ZA 4D9RA 1UVTH 2ZHWH 1UHBB 2FOCA 2AYWA 1MD8A 1EJMA 1H9IE 1OSSA 1HIAA 1O2NA 1V2MT 4MDSA 3P70B 1E34B 2IJOB 2G8TA 5EQQA 1IHSH 4ASHA 2EI8A 1ELBA 3A8BA 1QBNA 1O36A 1T4VH 3BTTE 1JIRA 5FPYA 2WYGA 4GHTA 2TGTA 3GDUA 1DWEH 1FXYA 3LGUA 3RU4T 1FY4A 3E91A 1OP8A 1O31A 3UWIA 5EG4A 1E36B 2A45B 2ANWA 4D7GA 1O3NA 2EA3A 3ZZBA 4GCHF 3MNXA 5FXLA 1D4PB 1JIMA 4KTSA 1EJAA 2GMTB 3OYPA 1ESBA 1Z1JA 4TPYA 3O8CA 4THNH 3ELAH 3GY5A 2WV5A 1YP9A 2ILNA 2OQUA 2GZ7A 4CHAC 3M5MA 4A5TS 2PFEA 3DFLA 1W0ZU 3T2NA 4YM9A 1J15A 1FV9A 2ZKSA 1PFXC 5A8YA 3A8AA 1C5SA 3S7KB 2J94A 1EPTB 4J2YB 3ZZCA 2GCTC 4AORA 2GT8A 2VIQA 1G36A 3HKJB 2DE9A 1MAXA 1P2MA 5DK1A 2GD4B 1G3EA 2RA0A 2FP7B 3ZYEA 1INCA 1F2SE 1C4U2 1P09A 1Y3WA 1BITA 1QA0A 2HWLB 2BDBA 1YPKH 1SGYE 1D3TB 3TJOA 1LPKB 2NU0E 1W2KH 2FYQA 5G4BA 1GHZA 1NO9H 1O5FH 1PYTC 2OXSA 4X6MA 3VGCC 1T31A 1TYNA 1VR1H 5A09A 1DICA 2UUYA 2Q1JA 1VGCB 1ZJKA 3RDZA 1F0UA 1EZUC 5CMXH 2A5AA 2VIPA 5FAHA 2ZHDA 2G4TA 4MPXA 3SU4A 2XC4A 1ZZZA 3WY8A 2O8LA 3EYDA 4OS5A 3A87A 1TONA 1GBFA 5GCHF 2QC2A 3UIRA 1TMTH 1LVBA 2Q6DA 5DP4A 1E0FD 3DD2H 3CP7A 4JZ1A 4Y10E 1RIWC 1SOZA 3AW1A 1Z6EA 2BLWA 1CHGA 1OWHA 4XFQA 4XSKU 5C3NA 1C5WB 3ATLA 1GCTB 1TBRH 1HDTH 1L0ZA 4XBCA 2FOGA 4X1QU 2GDEH 5EOKA 1WUNH 2ODYB 2SNVA 4Y11E 1V2PT 7ESTE 1AZZA 2G00A 2OTVA 4AGKA 3ZZ5A 4FUCA 2A32A 4LOYH 2PKAB 1PQ8A 4INKA 3SNBA 1C5ZB 3MO3A 2G5NA 9ESTA 4MNXA 4I32A 3OX7U 6GCHG 1LO6A 1CU1A 2VWMA 4ISHH 3L3TA 5E2PA 1GHWH 2PSYA 2ZDMA 2AH4X 1OWDA 1DSTA 1ELCA 4CH2B 1ETSH 3STJA 1LMWB 4ZKRU 4DY7B 1V3XA 4NFEA 4ZUHA 1PPHE 2BDGA 2QV1A 1SHYA 2ZU5A 1C2MA 2ESTE 1BA8B 4GAWA 1CBWB 4ZAEA 3UQOA 1GBEA 2ZFRH 1O34A 1O5BB 4X6PA 1SI5H 1TRYA 1Z71A 2QXIA 4WMFA 4BAQB 1KDQB 1TRMA 2ZQ2A 1FY5A 1TA6A 1BTXA 2V3OH 2ZFTA 1LVYA 1KXDA 5JPMH 1RTFB 2FOBA 4AFUA 1TGCA 2G55A 8KME2 1LQEA 1NU7B 1OWKA 2ZGJA 1O2KA 1A1RA 1HCGA 4D7FA 1NM6A 4IC5A 3GY7A 1FI8A 1O5DH 1H9HE 1PYTD 2GV6A 4ISOA 1TOCB 2VVCA 1GGDB 1GJ6A 1MZAA 2OC1A 1P05A 3SU2A 1C4V2 1OWIA 5DP9A 4X8TH 5L2ZH 1GBDA 2WV4A 1TNKA 1BMMH 1AU8A 2R2MB 2BDHA 2OLGA 1FJSA 1D6WA 1KLTA 1P8VC 2ZFFH 5AHGH 2BD9A 3LJOA 1YKTA 5F8XA 1ZPZA 4WF8A 1P06A 1HFDA 3F9EA 1A5GH 1OS8A 5FCKA 3TNTA 1SC8U 1C5RA 4B71A 1XUGA 1S5SA 1O2XA 1ZGIA 1JWTA 1Y3VA 3SV9A 1O37A 1BQYA 1MKWH 3LC5A 3RXKA 3ZZDA 4Z6AH 3BTFE 3QZQA 1HBTH 1OXGA 1A0JA 2VVUA 4NIWA 1O3DA 1HXEH 4ZXYH 1UMAH 1O2GH 3FP6E 2SGQE 2BD8A 3SOSA 5JBBS 5C2ZA 1C1RA 2ZDAH 3SGAE 4AGJA 2WPMS 1NESE 5CHAC 4BOHA 1KTSB 2C93B 3V3MA 2Z9IA 3OY6U 1MTWA 3HGNA 4YO9A 4Y71A 4FUBA 3BG4B 5C5OA 4NA7A 3RXRA 1LHCH 4WJG2 1C2KA 3TK5A 3F6UH 1VCQA 1FLEE 1O2JA 3TJVA 2ZHQH 2Z3DA 4CRAA 3MO6A 4Y0YE 1TLDA 3A7WA 2FPZA 4K60A 1MKXH 1CHOG 1O2HA 1W3CA 5JYIA 1ZSKA 5ABWA 4HGCA 4OS4A 4X8VH 2V3HH 1SGPE 5E8EH 4OS6A 5DP5A 1OKXA 2A7CA 4Y6DA 7GCHG 1PPBH 2JH6D 1ANEA 3A86A 2FEQH 1WSSH 1YC0A 1HRTH 2QYIA 3GY8A 3MH6A 5LGOA 1TX6A 1ELAA 1O2UA 2SGPE 3A81A 3RMOH 4ZH8A 1C1SA 3S9BA 1VCWA 2QXHA 2ZDKA 3IITA 2Y7ZA 1GI9B 3VXFH 2CXVA 3GYLB 1C1OA 1ESAA 1O3JA 3T29A 2ODPA 5I25A 2ZA5A 4X1RU 1HGTH 2PKAA 1W12U 1BUIA 4WWYA 1KXBA 2CMYA 3RXPA 2ZEBA 3ZVGA 5JBCS 1YPGH 2JKHA 4K1TA 1XUJA 5EXNA 2WINI 2Q6FA 1C5MD 5JDUB 1T7CA 3RXHA 2ALPA 1NFXA 4UFEH 1AFQC 4Y8XA 1GHBF 2ZU2A 5EQRA 4DGJA 4CHAB 1O2YA 1TAWA 3GY2A 3W95A 1FMGA 1N8OB 3RLWH 3PB1E 4D9QA 3RXCA 3SQEE 1LHEH 4BXSA 2FZZA 4CRBA 1P0SH 4NIXA 1KIGH 3ITIA 1HPGA 1Z8GA 5EPNA 1H8IH 1PPCE 2VNTA 3RXIA 2GCTB 2GTBA 4X1NU 1O32A 3V7TA 1V2TT 3URDA 1THSH 1BMAA 1HIAB 1OWEA 4X6OA 1SGFG 4NA9H 1FN8A 2W7UA 3KEEA 4I31A 3RM2H 1UTQA 2ZTXA 1GJDB 1GHXH 1AD8H 1GJAB 2Y5FA 3VGCB 3F9HA 3M5OA 1NS3A 1N6XA 1AVXA 2J38A 4JMYA 3NK8A 2ZTYA 1HJAC 3SHAH 5F03A 2PKSC 1JBUH 4ZROA 1ETRH 1PPFE 1FIZA 1NRRH 4WMDA 2I6QA 1TQ0B 3A7XA 5L2YH 1YCPM 4AOQA 3LU9B 1CT0E 1GBMA 1RIWB 3H7OA 2VH6A 1L4DA 1QTFA 2BTCE 2BLQA 3MO9A 5E0JA 4B74A 3SORA 4A1TA 1G3BA 2WYJA 2Q6GA 3SQHE 1K9OE 4I8JA 2A1DB 1FY3A 1BTWA 1CA0C 1SGEE 2FESH 4R0IA 2LPRA 3LDXH 4PROA 3UNRA 1BHXF 3BTQE 2VWLA 1IQEA 3U1JB 1S83A 3K6YA 3LGWA 1QRWA 4ZHMU 1L1JA 4BAMB 2R2WU 1SGNE 1BIOA 3SZNA 1UK4A 3CS0A 2P8OB 4JYUH 1O3EA 2UUFB 5T3HA 4H42U 1LKBA 1K2I1 1UVSH 1O3MA 2BDIA 2Z6BD 3JZ1B 3T25A 3DUXH 1V2JT 1SLWB 3KGPA 2PGQB 1EAWA 1JOUB 2H2ZA 2BDAA 1MCVA 4NGAH 1FUJA 2HVXA 8ESTE 8GCHF 4NA8A 1ZYOA 1CT4E 2A2QH 3MU1A 1WTGH 5K0HA 1QQ4A 2XBWA 4MTBA 2ZGBH 4X1PU 2BXTH 3MFJA 3A83A 1CGHA 1TE0A 3ZZ7A 1QQUA 2O9QA 1C5VA 1FDPA 4YT6H 3S7HB 2Y81A 1OP2A 1C2IA 1MTNC 2A31A 3D23A 1ZHRA 4ZKOU 4DIIH 5J4QA 1SGQE 1NTPA 3UY9A 2Z9JA 1MKWK 2FI5E 1KTTB 4AZ2B 1NN6A 3NZIA 2JETC 3GY4A 2G4UA 4MPWA 2H6MA 1VITG 4AFQA 1TMUH 4O3TA 2PTCE 4U32A 4UE7H 2CF8H 3UOPA 3MNBA 3SBKA 1GMHF 2B7DH 1N1LA 2TRMA 5HYOA 1GI2A 1O3IA 1EB1H 1YPMH 3TVJB 3AAUA 2ZU4A 3N7OA 4I33A 2HRVA 1D3QB 3EQ0H 3F68H 3E0NB 1V2ST 1U6QA 4Y7BA 1J14A 3GCTF 4FU8A 4U2WA 3W94A 1T8MA 3Q76A 3BEIB 1WQVH 3LGYA 1GHAG 2Z3EA 1SFIA 1ZTLA 1Y3UA 2ZO3H 3NXPA 4FUGA 4YLUA 3BTDE 2GX4A 1EXFA 3A84A 1GJ9B 1W7XH 2PSXA 3P92A 4A6LA 3SJ9A 2BMGB 1GG6B 2I6SA 1O3KA 2PUXB 3TLOA 1H4WA 4R8TB 1UK3A 3VEQB 3D65E 3SN8A 1SGRE 5EW2H 1C5XB 3SU1A 1NU9A 2FTLE 4GCHG 4KP0A 1O3FA 5CHAB 1SGIB 4XOJA 1TPAE 4AFZA 2UUKB 1D3DB 2F83A 2SGDE 3TGKE 3A8CA 3BV9B 2VIDA 3NUMA 3VFEA 4IW4E 2R9PA 2BVRH 2ZU3A 1Y59T 4BANB 1O2SA 1L2EA 1YLDA 3RXGA 3TH4H 3SV2H 1BBRH 1UVUH 5TCAA 2VIOA 3EGKH 3SNEA 4AYVB 3TPIZ 1V2LT 2QIQA 4AB9A 1QJ7B 1QL9A 2BY7X 3RLYH 2GDDA 5FBIA 3RXTA 1MMJN 4GSOA 1ZOMA 2BQ6B 3PROA 1SLUB 1G2LA 1C9PA 3T5FH 4DG4A 2F9PA 3LOXA 1BTPA 2OP9A 2W5EA 2GP9B 4X8UH 4M7GA 2Y5HA 2F9NA 2SGFE 3A7VA 4YLQH 5HM9A 4O97A 3RC5A 2AIPA 1O38A 3L6PA 1X7AC 2AGEX 1C1UH 1BMLA 3P8FA 3S9CA 1DDJA 2FO9A 4YTAA 1G2MA 1TX7A 1ACBE 3PMAB 3SJ8A 3FVFB 1GBCA 1OWJA 4IS5A 2ZIQH 3NKKA 1MD7A 1CGIE 3RXQA 2EC9H 2W26A 1GVKB 2PLXA 4XBBA 2AMQA 3M3SA 1AUJA 3S9AA 1NFWA 2CJIA 3BSQA 3ZV9A 3LGIA 1KYNA 3E8LA 3UQVA 3NPSA 1O2PA 1P2JA 3QZRA 4ABHA 3M37A 4AFSA 1TGSZ 1HXFH 1OPHB 3TGIE 5A8XA 3OU0A 3GY6A 3P6ZB 4LZ1H 3A85A 1TMBH 1SPJA 2JH5D 2OBQA 3P8OA 3UREA 4CBNA 3UPEA 2HPPH 4Q2KA 5E2OA 5GJ4B 3ZZ9A 4A7IB 4DURA 5F8ZA 1GVZA 1A7SA 5ETXA 3OY5U 3QN7A 1TPOA 2OCVB 1G30B 3BG8A 1AE5A 2BYAX 1P2OA 2THFB 2BD5A 4JZFH 3RC4A 1S82A 1Y5UT 4GVUA 3VB3A 3B8JA 3U8TH 2BDCA 3GCHB 1WCZA 3TJUA 4ZHLU 1K1NA 1W14U 4ABBA 4X2WA 2O8WA 4K3JA 2OC8A 1C5PA 2FXRA 1DLEA 2PKSB 1NROH 2RA3A 2WUCA 4K5ZA 4FVBA 1AIXH 6CHAC 3BEUA 2PR3A 1XUIA 1BCUH 1YPHE 1GBBA 4I8KA 1S6FA 5BPEA 1TABE 5C5NA 2A0QB 3MH4A 1SSXA 3HKIB 1ORFA 2TIOA 4A92A 4FUDA 1DANH 1O3PB 4X2VA 3MNCA 1W13U 3F9FA 3MMGA 4IGDA 4FUEA 2FS9A 3M35A 4K69A 6ESTA 1GMDG 2BOKA 5DP7A 5TCCA 5EXMA 3ATWA 1RFNA 1A0LA 1OX1A 4JZDH 1KLIH 4Y76A 1EP5A 1F0TA 1C2GA 2BZAA 1MTSA 1GPZA 2A7HA 1JRSA 3PLBA 2ZQ1A 3OSYA 3I29A 3SUFA 4CH8B 2A4QA 1WU1A 3GY3A 3A88A 3K2UA 1SGTA 3EA7A 4Q7XA 1ARBA 4LZ4B 2G81E 3IWMA 1K1MA 3T62A 4TY6A 4HI3A 3BTWE 5LPFA 1SGDE 1TA2A 3GOVB 1XUHA 1YLCA 4H6SB 1V2KT 1IQJA 4Y0ZE 1KY9A 2VWNA 1XUKA 1IQLA 3FZZA 3MHWU 1QB6A 2QF0A 1IQNA 1Y3YA 3UR9A 4NIYA 6GCHF 4MNVA 1GI3A 3VPKA 2STAE 1C1QA 2RCEA 1QL7A 1AZ8A 1P57B 2H5DA 2XBVA 5HXFA 1LQDB 3OTJE 5T6FA 1O2IA 2BQWB 4YOGA 1AMHA 1RRKA 3QX5H 1LVMA 3LGTA 2EEKA 1OOKB 1YBWA 1O3LA 2VVVA 3MU5A 2NU2E 3PYHA 2D1JA 1UVPA 3QLPH 2AEIH 2R0LA 2H9HA 1T8OA 4NIVA 1JRTA 3U98H 1GBHA 3F1SB 3RP2A 2BD2A 4B75A 1V2UT 3B23B 1DVAH 2ANYA 3K65B 4Y8ZA 1HAVB 2H1UA 2YOLA 5LPEA 5DG6A 4ABJA 1K21H 3ZVAA 4B2CA 2OBOA 4CRDA 2JETB 2AMDA 1T8NA 1C5YB 1FZZA 2P59A 3ODFA 1TNLA 3UFAA 1QBVH 4BTUB 4XE4A 2D2DA 1C1WH 1SQTA 4MLFB 2ANMH 1ELGA 5DJ7A 3O8RA 3SGQE 3HGPA 1W0YH 1ZTJA 2XRCA 1P01A 4ABIA 1AI8H 5GDSH 3DA9B 4X8SH 2ZFQH 4UEHH 1FY8E 3SNAA 3EE0B 1CGJE 1KXFA 1LPZB 4K1SA 1DY8A 1TNJA 3SJIA 3ENSB 1YYY1 1BBRK 1SB1H 4VGCC 3SUEA 1ZHPA 2C4FH 2ASUB 1Q31A 3E0PB 4E06H 3SUGA 1EAXA 3HATH 1ZPCA 3Q3YA 1A5IA 3ZV8A 3ZVDA 1ELTA 4I7YH 1Y8TA 2QGRA 4K2YA 5CE1A 1LPGB 4AYYB 4Y8YA 1GVLA 2Y80A 4X2XA 1TBQH 1LDTT 1EZXC 1GI0A 3TK9A 1B5GH 2NU4E 1EJNA 1YM0A 3IG6B 4WVPE 4AX9H 2FI4E 2GZ8A 3AVZA 3HK3B 3FZDA 3S0NA 4JZIA 4JK5A 4A1VA 4NZLA 1HUTH 1CSOE 3PLPA 1LVOA 4U30A 1GI6A 3MNSA 2FIRH 1GHBG 1K1JA 1FIWA 1PJPA 2P16A 1TGTA 3VB5A 2OUAA 3RXJA 4B1TA 2BXUH 2TGDA 3SNCA 4IN2A 1S85A 1F5KU 1S84A 2QF3A 1YPHC 2A5IA 1A61H 1GJBB 1Z8JB 5AFYH 1RXPA 2J4IA 1NT1A 2Y6TA 3MWIU 4O9VA 1O2RA 4B2AA 1LTOA 1LHFH 3QGNB 2V6NA 5GIBA 2ZCLP 2GZ9A 2FTMA 2Z9KA 1AVGH 1T8LA 4E05H 1LCYA 2ZZUH 2XXLA 1GJ4H 1FPCH 1EZQA 1Z7KA 3M36A 4HFPB 1NRPH 3M3VA 1L1GA 4XBDA 1E35B 2R0KA 3AW0A 1SMFE 3I78A 3HK6B 3VB6A 1EPTC 4BXWA 2XC5A 3URCA 2G52A 3PTBA 1B0EA 1UO6A 2ZPSA 3TITA 1GL1A 5SGAE 1HAHH 2QN5T 7GCHF 3KF2A 4UDWH 2FI3E 2WPIS 3KIDU 1UTLM 3C1KA 2HNTE 2EI6A 3P8NA 3MH7A 1O3OA 1WQSA 2FOEA 1ELFA 2G51A 1O33A 3BTKE 1IOEA 1TNGA 5EU8A 4CREA 1GDQA 1RD3B 1IQFA 1TNHA 4X6NA 3RXVA 1AKSA 1MH0A 1YPEH 2FLRH 1P11E 2XWAA 1SGCA 1CQQA 1DXPA 3LH3A 1GHVH 1C1TA 4GPGA 1ZJDA 1J17T 2ZECA 1HAYB 1BJUA 1GMCG 1C5LH 4YT7H 1C1NA 2ALVA 1WTHD 1V2OT 4ABFA 3M5NA 4JZEH 2XCNA 1V2VT 4I8HA 2VJ1A 1OYTH 3LIWA 3SI4H 2ZDVH 1O5CB 2F91A 3LGVA 5K7RA 4WMEA 1PQ5A 1EX3A 1GI1A 4DT7B 3H5CB 2R3YA 1UVOA 3PMBB 1LKAA 1THRH 1UTKA 2P3UB 2Z9LA 4IBLH 4HTCH 3QGJA 4B2BA 2FOHA 1EQ9A 1WV7H 2DE8A 2SNWA 5C1YA 1P10A 1HAVA 1TNIA 1DE7H 3E1XB 4ISLA 2PHBA 2XC0A 2F9UA 2XYAA 1V6DA 2B0FA 3V0XA 5EPYA 1F92A 1MQ6A 2PGBB 2IOTA 2CGAA 3BN9A 2VH0A 6CHAB 1YPJH 2CN0H 3C27B 2ZI2H 2GV7A 3SO3A 3LONA 1B7XB 1HNEE 2PTNA 1ANCA 3RC6A 4FUJA 8LPRA 3SUDA 2TGPZ 4ISNA 3GYMA 4OS1A 2O8MA 1S6HA 1GBAA 1SOTA 1DS2E 5FX6A 4ABGA 1V2NT 1RS0A 5T6GA 1M9UA 2FS8A 3E90B 1CBWC 1DPOA 4AG1A 2V35A 3QWCH 4NCYA 1ELDE 3QK1A 1BTZA 2BHGA 3RXDA 1EUFA 4UFFH 2JH0D 3SV8A 1ARCA 3RXEA 1PQ7A 2ZTZA 4CRCA 4DW2U 2GCHF 2QCYA 3EA8A 5HGGA 2XTTB 3SU0A 1EP6A 4A1XA 1NRNH 4TWWA 2QA9E 3AAVA 1FPHH 3TIUA 1HAOH 2A2XH 4UFDH 2LNCA 2AS9A 1HLTH 1GI7B 4AB8A 3LC3A 1NFYA 4FU9A 1MTUA 3U8OH 1DX5M 1BJVA 2ZF0H 3SGBE 3M7UA 5A0BA 3QDZB 1SFQB 5L30H 4E7NA 5ESTE 1ZMLA 4ABAA 4DOQA 1KXEA 2A4RA 1W11U 2FM2A 3LT3A 4IC6A 1ZGVA 1IQMA 3M7QA 5A8ZA 1AUTC 1KXAA 4IMQA 1ESTA 1O5EH 2O8UA 4F4OC 3FP7E 1EAUA 3ZVCA 5DP8A 3Q00A 5BRRE 2ZHEH 3MI4A 1EZSC 2ZGXH 5EXLA 2W7SA 2R3UA 1V2RT 3PWBA 4FUFA 4E7RG 2VU8E 1C5OH 2Z9GA 3SV7A 4I8LA 3FP8E 3MU0A 1C1PA 1IAUA 1MTVA 5JBAS 5GWZA 1C2FA 3U1IB 1MKXK 1O2QA 1DWDH 3T27A 2HNTC 2W3KA 2UWPA 4K8YA 1A4WH 2HNTF 1ETTH 2AIQA 4TPIZ 3MOCA 4Y7AA 1T4UH 3T28A 1AFEH 5DGJA 2ZU1A 2J95A 2F3CE 5B6OA 1A3BH 1F5RA 1K1OA 3EAJA 1P2KA 1QY6A 1ANBA 1C5QA 5GPIB 1A3EH 2ANKH 4ESTE 5E0GA 2AFQB 2ZGHA 1SHHB 2HGTH 4IN1A 3RXOA 4ISIH 1SL3A 1G3CA 4BAHB 2VIVA 3PV4A 1HAGE 1P12E 2VGCC 4OS2A 1BOQA 1P03A 1D3PB 3F9GA 5ESBA 1MU6B 1YPLH 1ZSLA 3V13A 4UD9H 2IN2A 1DFPA 1XUFA
chains in the Genus database with same CATH superfamily
4JYVH 2Z3CA 1ID5H 2FOFA 1O30A 3FAOA 3TH3H 2ZP0H 2IPHA 4MQAA 2BX4A 2ZPRA 3SJKA 3SYJA 1QB9A 3TU7H 3N7DA 5JB8S 1IHTH 1AWFH 1C1VH 1UTMA 3JZ2B 4ZKNU 4DT4A 3KL6A 3TNSA 1GHAF 1MUEB 2IPQX 1S0QA 1NY22 3PMJA 1QRXA 2C8WB 1HJ9A 1O3AA 4X0WU 2VWOA 2BZ6H 4FU7A 1TIOA 4UFGH 1IQGA 3LPRA 2BB4A 3OE7D 4Q7YA 1XKAC 4WXVA 1XKBC 5L6NH 3P95A 3UUZA 2ZCHP 2NU3E 1ZMNA 2BD3A 3A7ZA 1GBKA 1WOFA 3E3TA 3U69H 1RJXB 5FPTA 5JB9S 5EGMA 3RMNH 3TJNA 2KAIA 3VXEH 2ZDNA 2F9VA 1BRUP 2RDEA 1C2JA 3KNXA 5GCHG 4RT1A 1QNJA 1TBZH 3FFGA 4Z0KA 2F9BH 4KGAA 4B76A 1MU8B 4NZQA 5C20A 2IJD1 3KQ5A 2BY9X 1N8OC 1H8HD 1AFQB 3BIVH 1EAIA 3DT0H 1W10U 3LH1A 3PMHB 3ZVBA 1QRZA 2HVYB 1F5LA 2SGEE 1AHTH 1DUEA 1KMHB 1P2NA 1COWD 3PO1C 4TT3D 1SQOA 1QIXB 1QJ6B 2BM2A 4RKOB 1QURH 3M3TA 2Z7FE 3ZVFA 1XXDA 1ELEE 2AMPA 5F8TA 3QUMP 2WPHS 1GBJA 4DCDA 1G32B 1C4Y2 2B8OH 1G9IE 4INLA 1DOJA 1EATA 3S69A 5HKKD 1UJ1A 1EKBB 3UNSA 1MAYA 1K0HA 2A5KA 2C8XB 3LKWA 2EQNA 1B0FA 2DUCA 3SU6A 4Y79A 4NWLA 1DSUA 2ZGCA 6LPRA 3ODDA 1YWUA 2OC7A 1BTHH 2CHAC 2GT7A 3G01A 3SNDA 1O2ZA 5DPAA 4BAKB 1SQRA 1PQAA 2AHME 2UUJB 4YZUA 2HLCA 4DJZB 1HJAB 5DN6D 3ZVEA 2FWWA 3I77A 3RXUA 3VG8A 4B73A 3DHKH 5GXPA 3SHCH 5FX5A 2BLVA 3ZZ6A 3DSPA 1K1LA 2ODQA 1VJAU 2BD4A 4LK4A 1S0RA 3KQDA 1N6YA 1O3HA 4F55A 2TPIZ 1BZXE 3BTEE 1QGFA 3BTGE 1O3GA 1ZRKA 1GJ7B 3TH2H 1VITH 1TPSA 3M7TA 2Y5GA 4NSVA 2HLDD 1QHRB 3QTVH 3MYWA 4LXBH 5HMAA 4Z1MD 1L1NA 1UK2A 1CA0B 2P95A 3ZZ3A 2SGAA 2SFAA 1BHXB 1IQHA 5C1XA 2K0QA 1GBTA 2XNDD 2P3TB 2QXGA 3A8DA 1K1IA 2P8OC 1QBOA 2TBSA 4YESB 1KLJH 4I8GA 2PV9B 1AKSB 5LH8A 2PWXA 4FETA 4NSYA 3NWUA 4INHA 1GCDA 1ZMJA 1WAYB 1L4ZA 4JCNA 2J9NA 3L33A 2XBYA 4OGXA 4ZMAH 1BDAA 2XWBI 1C2LA 1K1PA 1XX9A 1F0RA 3VB4A 1P9SA 1RTLA 1UTNA 1O3CA 4KELA 1ZSJA 1G3DA 1VCPA 1C9TA 1DY9A 1GI8B 3UWJH 1HAXB 3M5LA 3SU5A 1AWHB 1E37B 2V0BA 3Q77A 1UHBA 1FAKH 2JIZD 3GICB 4JK6A 1TFXA 4OGYA 4WY3A 1GMDF 1UTJA 2BY6X 3STIA 3SZEA 1BTYA 1MTNB 3LJJA 4X2YA 1TWXB 2FOAA 1AB9C 1AGJA 4U01A 5FBEA 4OS7A 4WXIA 4NFFA 4XDEA 3UOUA 9LPRA 4FUHA 2K8IA 3K6ZA 1E1RD 3U8RH 5DO4H 1HAPH 1PPZA 5FHTA 4FXGH 1C1MA 1Y5BT 1TGBA 1UTOA 1BBRE 3QO6A 2GVFA 1V2QT 3SU3A 3UTUH 3CS7A 2H9TH 2VB0A 3KQBA 1ANDA 2BQ7B 3ZZAA 5C1UA 1K22H 1XXFA 4SGBE 1H1BA 3GCNA 1GJ5H 1BRAA 1TRNA 1CVWH 1A5HA 1RGQA 5DP3A 1C5TA 1Q3XA 2ULLA 3A7TA 4J1YA 2WPKS 1EASA 2FX4A 1QB1A 3BF6H 1JXPA 1YF4A 3RU4E 1TQ7B 2LP6A 3UR6A 2C3SA 3ATIA 1GG6C 4O03A 4ZKSU 1O2TA 3ATMA 1A2CH 1EPTA 1TOMH 4AN7A 4MG3A 4RN6A 4TSFD 2A7JA 4GLYA 1E1QD 1H8ED 5AF9H 1AN1E 1ABJH 2STBE 1DWBH 4TYDA 1ZLRA 1AVWA 4TY7A 3MU8A 3KHVA 2VGCB 5EQSA 1GI5A 3MTYA 1SBWA 1AQ7A 1KSNA 3BIUH 1UCYH 1P3EA 3UNQA 4KTCA 1Z6JH 1BRBE 3FKSD 1MQ5A 3N99A 5DP6A 5FL7D 1BT7A 2GKVE 2P94A 2HOBA 3M61U 1CT2E 1MCTA 3TK6A 3KN2A 2D8WA 4BAOB 4D8NA 3SV6A 2GGVB 1EOJA 4IMZA 4FVDA 3ATKA 1RTKA 2B5TB 5IYTA 2G5VA 1MZDA 2GMTC 4SGAE 5AVDA 1NRSH 1YCPH 2BX3A 3RMMH 2BVSH 1KXCA 1PPEE 2AGIX 1HAIH 3E16B 2ZPQA 1Z1IA 1H9LB 1GHYH 1J16A 1P02A 1QFKH 5EODA 2BD7A 1LHDH 1WBGB 1O2MA 1PPGE 1DM4B 4BTIB 1WYKA 1ZPBA 1GBIA 1GBLA 1K28D 2RG3A 4CR9A 1GJCB 5A0AE 2QAAA 4D76A 1O2VA 2P3FH 1CHOF 1V2WT 3AASA 1XVMA 2WPJS 4WH6A 2Y82A 4DVAU 3O8BA 2FYRA 4KKDA 1FQ3A 1Y5AT 1P04A 3MH5A 1A0HB 1ZR0A 3ESTA 5TJXA 5FPSA 1SGFA 4NWKA 3R3GB 1BRCE 1YGCH 1C5UA 2C8ZB 3GDVA 1GDNA 3B9FH 5AFZH 3U9AH 1AO5A 1C2EA 3KCGH 1BMFD 3U28C 5FCRA 2ZFSA 2H9EH 1HB0B 2AGGX 1C5NH 2RDLA 2CF9H 2F9OA 2ZC9H 2Y7XA 3ZZ8A 1ZHMA 1VGCC 3H7TA 3PO1B 4WH8A 3RXMA 1ZRBA 2OD3B 1HAZB 3ZZ4A 3SJOA 5JBTA 2CV3A 2J34A 5T6DA 2YNBA 1DWCH 3BTME 3K9XB 3RXBA 2BOHB 1SR5C 1O2WA 1MBMA 1KDQA 2J92A 2HALA 1DUAA 1O3BA 1O5AB 2XNIA 1GDUA 2FLBH 3RXFA 3FANA 3CENA 1O39A 3KQEA 1P3CA 4K1EA 1GCTC 1W8BH 5H4IB 2FMJA 5GNDA 3GCHC 2K1QA 3VB7A 2M5TA 3D49H 1Z8IB 3V12A 3ZYDA 3EDXB 2CHAB 5J4SA 4H6TA 2C90B 1DXWA 1HYLA 2UWOA 4QT8C 3RXLA 5C67A 2QY0B 3F0OA 1OP0A 1FAXA 1SVPA 3D62A 2JDID 4GHQA 1SLVB 4RSPA 3P8GA 3OFND 4FUIA 3GISB 3KQCA 2HPQH 2QXJA 1DT2A 1QA7A 4YOIA 1THPB 1XVOA 1LHGH 2GCHG 2W3IA 1TGNA 8GCHG 7KMEH 1XM1A 2KAIB 2OC0A 3NCLA 3RXSA 1BB0B 2ZDLA 5EW1H 2NWNA 1AY6H 1GMCF 1NPMA 2D26C 1MBQA 2FODA 4MPVA 2A4GA 5C0UA 2VBCA 2VIWA 4XD7D 5E0HA 1QR3E 2FOMB 2C8YB 4F49A 3PTNA 1NRQH 1ABIH 2ZFPH 1QL8A 3SW2B 5KECA 1NZQH 1BMNH 2BY8X 2KX4A 1O2LA 3P17H 2AERH 2NU1E 1A46H 2ZG0H 4KTUA 1O35A 3DFJA 1G37A 2QE7D 1CE5A 1GJ8B 1C2HA 1GMHG 1BTUA 1HV7A 4YOJA 2PW8H 1QJ1B 5LPRA 4K8BA 1FN6A 4X1SU 5HM2A 1GI4A 3GCTG 1ELVA 1SQAA 2PUQH 1OYQA 1F7ZA 1D9IA 2BVXH 2YNAA 2FDAA 4ABDA 1P2QA 1W7GH 1GGDC 2A4OA 2BY5X 4B6FA 2OQ5A 1P2IA 1IQIA 1F0SA 1ZTKA 2ZNKH 2P93A 2BDYA 3RUOA 1O2OA 1VZQH 1IQKA 2KFWA 5PTPA 1QCPA 3HPTB 2OINA 1SLXB 1DLKB 1J8AA 1FNIA 4CRGA 4MPUA 4BTTB 3R0FA 5F6MA 1GWAA 1T32A 2ZHFH 1VJ9U 1O5GH 2WHXA 3GCOA 3T26A 2XCFA 2ZWLH 4Q80A 3BTHE 1TB6H 4ZHAA 2ZCKP 5I46H 1AB9B 4CBOA 1HJ8A 2XW9A 2TGAA 4MNYA 3O8DA 4AG2A 1FONA 4HZHA 2WPLS 3RXAA 1DITH 1D6RA 5A2MH 1UCYE 2VINA 4BNRA 2BLOA 4MVNA 3A89A 4JYTA 4CRFA 4GUXA 1TPPA 1GL0E 3TGJE 1UTPA 1O0DH 4RKJB 5DKMA 3SI3H 1EOLA 4DIHH 1XMNB 2EI7A 2FX6A 4TWYA 2UWLA 3A7YA 1TX8A 2XBXA 2B9LA 3EA9A 3KYFA 4CR5A 3PLKA 1Q2WA 4UONA 1Y3XA 4O3UA 1CA8B 1UCYK 1SG8B 3Q3XA 3RM0H 1NFUA 3BG4C 3Q3KA 4ZXXH 2Z94A 3A80A 3RU4D 5A0CA 1S81A 1P9UA 3RMLH 4VGCB 2WUBA 4NG9H 5IDKA 1EB2A 1VITF 1JMOH 3MU4A 1AE8H 1TALA 3A82A 2L74A 1H8DH 3E6PH 4MNWA 7LPRA 4H4FA 1C2DA 4ABEA 1Z8RA 1NC6A 1CO7E 3BEFB 3GDSA 2J2UA 2H5CA 2O8TA 2J5UA 1J9CH 1YCPK 3QTOH 1E38B 1FY1A 3PWCA 3PM3A 4Q7ZA 4D9RA 1UVTH 2ZHWH 1UHBB 2FOCA 2F4LA 2AYWA 1MD8A 1EJMA 1H9IE 1OSSA 1MABB 1HIAA 1O2NA 1V2MT 4MDSA 3P70B 1E34B 2IJOB 3W1EA 2G8TA 5EQQA 2JJ2D 1IHSH 4ASHA 2EI8A 1ELBA 3A8BA 1QBNA 1O36A 1T4VH 3BTTE 1JIRA 5FPYA 2WYGA 4GHTA 2TGTA 3GDUA 1DWEH 1FXYA 3LGUA 3RU4T 1FY4A 3E91A 1OP8A 1O31A 2KCPA 5EG4A 3UWIA 1E36B 2A45B 2ANWA 4D7GA 1O3NA 2EA3A 3ZZBA 4GCHF 3MNXA 5FXLA 1D4PB 1JIMA 4KTSA 1EJAA 2GMTB 3OYPA 1ESBA 1Z1JA 4TPYA 3O8CA 4THNH 3ELAH 3GY5A 2WV5A 1YP9A 2ILNA 3FOAA 2GZ7A 2OQUA 4CHAC 3M5MA 4A5TS 2PFEA 3DFLA 1W0ZU 3T2NA 4YM9A 1J15A 1FV9A 2ZKSA 1PFXC 5A8YA 3A8AA 1C5SA 3S7KB 2J94A 1EPTB 4J2YB 3ZZCA 2GCTC 4AORA 2GT8A 2VIQA 1G36A 3HKJB 2DE9A 1MAXA 1P2MA 5DK1A 2GD4B 1G3EA 1EFRD 2RA0A 2FP7B 3ZYEA 1INCA 1F2SE 1C4U2 1P09A 1Y3WA 1BITA 1QA0A 2HWLB 2BDBA 1YPKH 1SGYE 1D3TB 3TJOA 5C94A 1LPKB 1W2KH 2NU0E 2FYQA 5G4BA 1GHZA 1NO9H 1O5FH 1PYTC 2OXSA 4X6MA 3VGCC 1T31A 1TYNA 1VR1H 5A09A 1DICA 2UUYA 2Q1JA 1VGCB 1ZJKA 3RDZA 1F0UA 1EZUC 5CMXH 2A5AA 2VIPA 5FAHA 2ZHDA 2G4TA 4MPXA 3SU4A 2XC4A 1ZZZA 3WY8A 2O8LA 3EYDA 4OS5A 3A87A 2QF4A 1TONA 1GBFA 5GCHF 2V3MA 2QC2A 3UIRA 1TMTH 1LVBA 2Q6DA 5DP4A 1E0FD 3DD2H 3CP7A 4JZ1A 4Y10E 1RIWC 1SOZA 3AW1A 1Z6EA 2BLWA 1CHGA 1VKYA 1OWHA 4XFQA 4XSKU 5C3NA 1C5WB 2J98B 3ATLA 1GCTB 1TBRH 1HDTH 1L0ZA 4XBCA 2FOGA 4X1QU 2GDEH 5EOKA 1WUNH 2ODYB 2SNVA 4Y11E 1V2PT 7ESTE 3PRDA 1AZZA 2G00A 2OTVA 4AGKA 3ZZ5A 4FUCA 2A32A 4LOYH 2PKAB 1PQ8A 4INKA 3SNBA 1C5ZB 3MO3A 2G5NA 9ESTA 4MNXA 4I32A 3PRBA 3OX7U 6GCHG 1LO6A 1CU1A 2VWMA 4ISHH 3L3TA 3WWFA 2YMSC 5E2PA 1GHWH 2PSYA 2ZDMA 2AH4X 1OWDA 1DSTA 1ELCA 4CH2B 1ETSH 3STJA 1LMWB 4ZKRU 4DY7B 1V3XA 4NFEA 4ZUHA 1PPHE 2BDGA 2QV1A 1SHYA 2ZU5A 1C2MA 2ESTE 1BA8B 3DSGA 4GAWA 1CBWB 4ZAEA 3UQOA 1GBEA 2ZFRH 1O34A 3F0PA 1O5BB 4X6PA 1SI5H 1TRYA 1Z71A 2QXIA 4WMFA 4ACAA 4BAQB 1KDQB 1TRMA 2ZQ2A 1FY5A 1TA6A 1BTXA 2V3OH 2ZFTA 1LVYA 1KXDA 5JPMH 1RTFB 2FOBA 4AFUA 1TGCA 2G55A 8KME2 1LQEA 1NU7B 1OWKA 2ZGJA 1O2KA 1A1RA 1HCGA 4D7FA 1NM6A 4IC5A 3GY7A 1FI8A 1O5DH 1H9HE 1PYTD 2GV6A 4ISOA 3PV2A 1TOCB 2VVCA 1GGDB 1GJ6A 1MZAA 2OC1A 1P05A 3SU2A 1C4V2 1OWIA 5DP9A 4X8TH 5L2ZH 1GBDA 2WV4A 1TNKA 1BMMH 1AU8A 2R2MB 2BDHA 2OLGA 3WWBA 1FJSA 1D6WA 1KLTA 1P8VC 2ZFFH 5AHGH 2BD9A 3LJOA 1YKTA 5F8XA 1ZPZA 4WF8A 1P06A 1HFDA 3F9EA 1A5GH 1OS8A 5FCKA 5C17A 3TNTA 1SC8U 1C5RA 4B71A 1XUGA 1S5SA 1O2XA 1ZGIA 1JWTA 1Y3VA 4P02A 2M2AA 1SKYE 3SV9A 1O37A 3F2HA 1BQYA 1MKWH 3LC5A 5HIZA 3RXKA 3ZZDA 4Z6AH 3BTFE 3QZQA 1HBTH 1OXGA 1A0JA 2VVUA 4NIWA 1O3DA 1HXEH 4ZXYH 1UMAH 3PV5A 1O2GH 3FP6E 2SGQE 2BD8A 3SOSA 5JBBS 5C2ZA 1C1RA 2ZDAH 3SGAE 4AGJA 2WPMS 1NESE 4RI0A 5CHAC 4BOHA 1KTSB 2C93B 3V3MA 2Z9IA 3OY6U 1MTWA 3HGNA 4YO9A 4Y71A 4FUBA 3BG4B 5C5OA 4NA7A 2WV9A 1WDIA 3RXRA 1LHCH 4WJG2 1W0KD 1C2KA 3TK5A 3F6UH 1VCQA 1FLEE 1O2JA 3TJVA 2ZHQH 2Z3DA 4CRAA 3H09A 3MO6A 4Y0YE 1TLDA 3A7WA 2FPZA 4K60A 1MKXH 1CHOG 1O2HA 1W3CA 5JYIA 1ZSKA 5ABWA 4HGCA 4OS4A 4X8VH 2V3HH 4AC9A 1SGPE 5E8EH 4OS6A 5DP5A 1OKXA 2A7CA 4Y6DA 7GCHG 1PPBH 2JH6D 1ANEA 3A86A 2FEQH 1WSSH 1YC0A 1HRTH 2QYIA 3GY8A 3MH6A 5LGOA 1TX6A 1ELAA 1O2UA 2SGPE 2J98A 3A81A 3RMOH 4ZH8A 1C1SA 3S9BA 1VCWA 2QXHA 2ZDKA 3IITA 2Y7ZA 1GI9B 3VXFH 2CXVA 3GYLB 1C1OA 1ESAA 1O3JA 3T29A 2ODPA 5I25A 2ZA5A 4X1RU 2KZ4A 1HGTH 2PKAA 1W12U 1BUIA 4WWYA 1KXBA 2CMYA 4XRNA 3RXPA 2ZEBA 3ZVGA 5JBCS 1YPGH 2JKHA 4HG6A 1XUJA 4K1TA 2WINI 5EXNA 2Q6FA 1C5MD 5JDUB 1T7CA 3RXHA 2ALPA 1NFXA 4UFEH 1AFQC 4Y8XA 1GHBF 2ZU2A 5EQRA 4DGJA 4CHAB 1O2YA 1TAWA 3GY2A 3W95A 1FMGA 1N8OB 3OAAD 3PB1E 3RLWH 3RXCA 4D9QA 3SQEE 1LHEH 4BXSA 4FOUC 2FZZA 4CRBA 1P0SH 4NIXA 1KIGH 3ITIA 1HPGA 1Z8GA 5EPNA 1H8IH 1PPCE 2VNTA 3RXIA 2GCTB 2GTBA 4X1NU 4ASUD 1O32A 3V7TA 1V2TT 3URDA 1THSH 1BMAA 1HIAB 1OWEA 4X6OA 1SGFG 4NA9H 1FN8A 2W7UA 3KEEA 4I31A 3RM2H 1UTQA 2ZTXA 1GJDB 1GHXH 1AD8H 1GJAB 2Y5FA 5C0TA 3VGCB 3F9HA 3M5OA 1NS3A 1N6XA 1AVXA 2J38A 4JMYA 3NK8A 2ZTYA 3MQKC 1HJAC 3SHAH 5F03A 2PKSC 1JBUH 4ZROA 1ETRH 1PPFE 1FIZA 1NRRH 4WMDA 2I6QA 1TQ0B 3A7XA 5L2YH 1YCPM 4AOQA 3LU9B 1CT0E 1GBMA 1RIWB 3H7OA 2CK3D 2VH6A 1L4DA 1QTFA 2BTCE 2BLQA 3F3BA 3MO9A 5E0JA 4B74A 3SORA 4A1TA 1G3BA 2WYJA 1YLNA 2Q6GA 3SQHE 1K9OE 4I8JA 2A1DB 1FY3A 2FESH 1BTWA 1CA0C 1SGEE 4R0IA 2LPRA 3LDXH 4PROA 3UNRA 1BHXF 3BTQE 2VWLA 1IQEA 5T1VA 3U1JB 1S83A 3FO8D 3K6YA 3OEED 3LGWA 1QRWA 4ZHMU 2GJGA 1L1JA 4BAMB 2R2WU 1SGNE 1BIOA 3SZNA 1UK4A 3CS0A 2P8OB 4JYUH 1O3EA 2UUFB 5T3HA 2WZQA 4H42U 1LKBA 1K2I1 1UVSH 1O3MA 2BDIA 2Z6BD 5IK2D 2KM0A 3JZ1B 2KCOA 3T25A 3DUXH 1V2JT 1SLWB 3KGPA 2PGQB 1EAWA 1JOUB 2H2ZA 5CDFE 2BDAA 1MCVA 4NGAH 1FUJA 2HVXA 8ESTE 8GCHF 4NA8A 1ZYOA 1CT4E 2A2QH 3MU1A 1WTGH 5K0HA 1QQ4A 2XBWA 4MTBA 2ZGBH 4X1PU 2BXTH 3MFJA 3A83A 1CGHA 1TE0A 3ZZ7A 1QQUA 2O9QA 1C5VA 1FDPA 4YT6H 3S7HB 2Y81A 1OP2A 5B6LA 1C2IA 1MTNC 2A31A 3D23A 2XOKD 1ZHRA 4ZKOU 4DIIH 5J4QA 1SGQE 1NTPA 3UY9A 2Z9JA 1MKWK 2FI5E 1KTTB 4AZ2B 1NN6A 3NZIA 2JETC 3GY4A 3AK5A 2G4UA 4MPWA 2H6MA 1VITG 4AFQA 1TMUH 5HIYA 4O3TA 2PTCE 4U32A 4UE7H 2CF8H 3UOPA 3MNBA 3SBKA 1GMHF 2B7DH 1N1LA 2TRMA 5HYOA 1GI2A 1O3IA 1EB1H 1YPMH 3TVJB 3AAUA 2ZU4A 3N7OA 4I33A 2HRVA 1D3QB 3EQ0H 4F48B 3F68H 3E0NB 1V2ST 1U6QA 4Y7BA 1J14A 3GCTF 4FU8A 4U2WA 2OK5A 3W94A 1T8MA 3Q76A 3BEIB 1WQVH 3LGYA 1GHAG 2Z3EA 1SFIA 1ZTLA 1Y3UA 2ZO3H 3NXPA 4FUGA 4YLUA 3BTDE 2GX4A 1EXFA 3A84A 1GJ9B 1W7XH 2PSXA 3P92A 4A6LA 3SJ9A 2BMGB 1GG6B 2I6SA 1O3KA 2PUXB 1QZ8A 3TLOA 1H4WA 4R8TB 1UK3A 3VEQB 3D65E 3SN8A 1SGRE 5EW2H 1C5XB 3SU1A 1NU9A 2FTLE 4GCHG 4KP0A 1O3FA 5CHAB 1SGIB 4XOJA 1TPAE 4AFZA 2UUKB 1D3DB 2F83A 2SGDE 3ZIAD 3TGKE 3A8CA 3BV9B 2VIDA 3NUMA 3VFEA 4IW4E 2R9PA 2BVRH 2ZU3A 1Y59T 4BANB 1O2SA 1L2EA 1YLDA 3RXGA 3TH4H 3SV2H 1BBRH 1UVUH 5TCAA 2VIOA 3EGKH 3SNEA 4AYVB 3TPIZ 1V2LT 2QIQA 4AB9A 1QJ7B 1QL9A 2BY7X 3RLYH 2GDDA 4I86A 5FBIA 3RXTA 1MMJN 4GSOA 1ZOMA 2BQ6B 3PROA 2W6ID 1SLUB 3NRLA 5EJLA 1G2LA 1C9PA 3T5FH 4DG4A 2F9PA 3LOXA 1BTPA 2OP9A 2W5EA 2GP9B 4X8UH 4M7GA 2Y5HA 2F9NA 2SGFE 3A7VA 4YLQH 5HM9A 4O97A 3RC5A 2AIPA 1O38A 3L6PA 1X7AC 2AGEX 1C1UH 1BMLA 3P8FA 2EY4C 3S9CA 1DDJA 2FO9A 4YTAA 1G2MA 1TX7A 1ACBE 3PMAB 3SJ8A 3FVFB 1GBCA 1OWJA 4IS5A 2ZIQH 3NKKA 1MD7A 1CGIE 3RXQA 2EC9H 2W26A 1GVKB 2PLXA 4XBBA 2AMQA 3M3SA 3OTPA 1AUJA 3S9AA 1NFWA 2CJIA 3BSQA 3ZV9A 3LGIA 1KYNA 3E8LA 3UQVA 3NPSA 1NBME 1O2PA 1P2JA 3QZRA 4ABHA 3M37A 4AFSA 1TGSZ 1HXFH 1OPHB 4ACBA 3TGIE 2L6OA 5A8XA 3OU0A 3GY6A 3P6ZB 5F53A 4B6EA 4LZ1H 3A85A 1TMBH 1SPJA 2JH5D 2OBQA 3P8OA 3UREA 4CBNA 3UPEA 2HPPH 4Q2KA 1OHHD 5E2OA 5GJ4B 3ZZ9A 4A7IB 4DURA 5F8ZA 1GVZA 1A7SA 5ETXA 3OY5U 3QN7A 1TPOA 2OCVB 1G30B 3BG8A 1AE5A 2BYAX 1P2OA 2THFB 2BD5A 4JZFH 3RC4A 1S82A 1Y5UT 4GVUA 3VB3A 3B8JA 3U8TH 2BDCA 3GCHB 1WCZA 3TJUA 4ZHLU 1K1NA 1W14U 4ABBA 4X2WA 3FN8A 2O8WA 4K3JA 2OC8A 1C5PA 2FXRA 1DLEA 2PKSB 1NROH 2RA3A 2WUCA 4K5ZA 4FVBA 1AIXH 6CHAC 3BEUA 2PR3A 1XUIA 1BCUH 1YPHE 1GBBA 4I8KA 1S6FA 5BPEA 1TABE 5C5NA 2A0QB 3MH4A 1SSXA 3HKIB 1ORFA 2TIOA 4A92A 4FUDA 1DANH 1O3PB 4X2VA 3MNCA 1W13U 3F9FA 3MMGA 4IGDA 2KCAA 4FUEA 2FS9A 3M35A 4K69A 6ESTA 5EIYA 1GMDG 3UB0A 2BOKA 5DP7A 5TCCA 5EXMA 3ATWA 1RFNA 1A0LA 1OX1A 4JZDH 1KLIH 4Y76A 1EP5A 1F0TA 1C2GA 2BZAA 5KGOA 1MTSA 1GPZA 2A7HA 1JRSA 3PLBA 2ZQ1A 3OSYA 3I29A 3SUFA 4CH8B 2A4QA 2RFKC 1WU1A 3GY3A 3A88A 3K2UA 1SGTA 3EA7A 4Q7XA 1ARBA 4LZ4B 2G81E 3IWMA 1K1MA 3T62A 4TY6A 4OM9A 4HI3A 3BTWE 5LPFA 2KR7A 1SGDE 1TA2A 3GOVB 1XUHA 1YLCA 4H6SB 1V2KT 1IQJA 4Y0ZE 1KY9A 2VWNA 1XUKA 1IQLA 3FZZA 3MHWU 1QB6A 2QF0A 1IQNA 1Y3YA 3UR9A 4NIYA 6GCHF 4MNVA 1GI3A 3VPKA 2STAE 1C1QA 2RCEA 1QL7A 1AZ8A 1P57B 2H5DA 2XBVA 5HXFA 1LQDB 3OTJE 5T6FA 1O2IA 2BQWB 4YOGA 1AMHA 1RRKA 3QX5H 1LVMA 3LGTA 2EEKA 1OOKB 1YBWA 1O3LA 2VVVA 3MU5A 2NU2E 3PYHA 2D1JA 1UVPA 3QLPH 2AEIH 2R0LA 2H9HA 1T8OA 4NIVA 1JRTA 3U98H 1GBHA 3F1SB 4Q4LA 3RP2A 2BD2A 4B75A 1V2UT 3B23B 1DVAH 2ANYA 3K65B 4Y8ZA 1HAVB 2H1UA 2YOLA 5LPEA 5DG6A 4ABJA 1K21H 3ZVAA 4B2CA 2OBOA 4M9FA 4CRDA 2JETB 2AMDA 1T8NA 1C5YB 1FZZA 2JJ1D 2P59A 3ODFA 1TNLA 3UFAA 1QBVH 4BTUB 2WPDD 2W6JD 4XE4A 2D2DA 1C1WH 1SQTA 4MLFB 2ANMH 3DSOA 1ELGA 5DJ7A 3O8RA 3SGQE 1YY3A 3HGPA 1W0YH 1ZTJA 2XRCA 1P01A 4ABIA 1AI8H 5GDSH 3DA9B 4X8SH 2ZFQH 4UEHH 1FY8E 3SNAA 3EE0B 1CGJE 1KXFA 1LPZB 4K1SA 1DY8A 1TNJA 3SJIA 3ENSB 1YYY1 3EE7A 1BBRK 2YMSD 1SB1H 4VGCC 3SUEA 1ZHPA 2C4FH 2ASUB 1Q31A 3WW7A 3E0PB 4E06H 3SUGA 1EAXA 3HATH 1ZPCA 3GS9A 3Q3YA 1A5IA 3ZV8A 3ZVDA 1ELTA 4I7YH 1Y8TA 2QGRA 4K2YA 5CE1A 1LPGB 4AYYB 4Y8YA 2WSSD 1GVLA 2Y80A 5KEDA 4X2XA 1TBQH 5DSFA 1LDTT 1EZXC 1GI0A 3TK9A 1B5GH 2NU4E 1EJNA 1YM0A 3IG6B 4WVPE 4AX9H 2FI4E 2GZ8A 3AVZA 3HK3B 3FZDA 3S0NA 2QF5A 4JZIA 4JK5A 4A1VA 4NZLA 4ZCNA 1CSOE 3PLPA 1LVOA 4U30A 1GI6A 3UAIC 1HUTH 3MNSA 2FIRH 1GHBG 1K1JA 1FIWA 1PJPA 1S6LA 1TGTA 2P16A 3VB5A 2OUAA 3RXJA 4B1TA 2BXUH 2TGDA 3SNCA 4IN2A 1S85A 1F5KU 1S84A 2QF3A 1W0JD 1YPHC 2A5IA 1A61H 1GJBB 3F2FA 1Z8JB 5AFYH 1WXRA 1RXPA 2J4IA 1NT1A 2Y6TA 3MWIU 4O9VA 1O2RA 4B2AA 1LTOA 1LHFH 3QGNB 2V6NA 5GIBA 2ZCLP 2GZ9A 2FTMA 2Z9KA 1AVGH 1T8LA 4E05H 1LCYA 2ZZUH 2XXLA 1GJ4H 1FPCH 1EZQA 1Z7KA 3M36A 4HFPB 1NRPH 5EJ1A 3M3VA 1L1GA 4XBDA 1E35B 2R0KA 3AW0A 1SMFE 3I78A 3HK6B 3VB6A 1EPTC 4BXWA 2XC5A 3URCA 2G52A 3PTBA 1B0EA 1UO6A 2ZPSA 1UW7A 3TITA 1GL1A 5SGAE 1HAHH 2QN5T 7GCHF 3F2GA 3KF2A 2FI3E 2WPIS 4UDWH 3KIDU 1UTLM 3C1KA 2HNTE 2EI6A 3P8NA 3MH7A 1O3OA 1WQSA 2FOEA 1ELFA 2G51A 1O33A 3BTKE 1IOEA 1TNGA 5EU8A 4CREA 1GDQA 1RD3B 1IQFA 4Q63A 1TNHA 4X6NA 3RXVA 1AKSA 1MH0A 1YPEH 2FLRH 1P11E 2XWAA 1SGCA 1CQQA 1NBMD 1DXPA 3LH3A 3DCLA 1GHVH 1C1TA 4GPGA 1ZJDA 1J17T 2ZECA 1HAYB 1BJUA 1GMCG 1C5LH 4YT7H 1C1NA 2ALVA 1WTHD 1V2OT 4ABFA 2V7QD 3M5NA 4JZEH 2XCNA 1V2VT 4I8HA 2VJ1A 1OYTH 3LIWA 3SI4H 2ZDVH 1O5CB 2F91A 3LGVA 5K7RA 4WMEA 1PQ5A 1EX3A 1GI1A 4DT7B 3H5CB 2R3YA 1UVOA 3PMBB 1LKAA 1THRH 1UTKA 2P3UB 2Z9LA 4IBLH 4HTCH 3QGJA 4B2BA 2FOHA 1EQ9A 1WV7H 2DE8A 2SNWA 5C1YA 1P10A 1HAVA 1TNIA 1DE7H 3E1XB 4ISLA 2PHBA 2XC0A 2F9UA 2XYAA 1V6DA 2B0FA 3V0XA 5EPYA 1F92A 1MQ6A 2PGBB 2IOTA 2CGAA 3BN9A 2VH0A 6CHAB 1YPJH 2CN0H 3C27B 2ZI2H 2GV7A 3SO3A 3LONA 1B7XB 1HNEE 2PTNA 2J97A 1ANCA 3RC6A 4FUJA 8LPRA 3SUDA 2TGPZ 2YMSB 4ISNA 3GYMA 4OS1A 2O8MA 1S6HA 1GBAA 1SOTA 1DS2E 5FX6A 4ABGA 1V2NT 1RS0A 5T6GA 1M9UA 2FS8A 3E90B 1CBWC 1DPOA 4AG1A 2V35A 1FX0B 3QWCH 4NCYA 1ELDE 3QK1A 1BTZA 2BHGA 3RXDA 1EUFA 4UFFH 2JH0D 3SV8A 1ARCA 3RXEA 1PQ7A 2ZTZA 4CRCA 4DW2U 2GCHF 2QCYA 3EA8A 4RT0A 5HGGA 2XTTB 3SU0A 1EP6A 4A1XA 1NRNH 4YXWD 4TWWA 2QA9E 3AAVA 1FPHH 3TIUA 1HAOH 2A2XH 4UFDH 2LNCA 2AS9A 2F43B 1HLTH 1GI7B 4AB8A 3LC3A 1NFYA 4FU9A 1MTUA 3U8OH 1DX5M 1BJVA 1E79D 2ZF0H 3SGBE 3M7UA 5A0BA 3QDZB 1SFQB 5L30H 4E7NA 5ESTE 1ZMLA 5CHBA 4ABAA 4DOQA 1KXEA 2A4RA 1W11U 2LELA 2FM2A 3LT3A 4IC6A 1ZGVA 1IQMA 3M7QA 5A8ZA 1AUTC 1KXAA 4IMQA 1ESTA 1O5EH 2O8UA 3KYGA 4F4OC 3FP7E 1EAUA 3N7EA 2KCYA 3ZVCA 5DP8A 3Q00A 5BRRE 2ZHEH 3MI4A 1EZSC 2ZGXH 5EXLA 2W7SA 2R3UA 1V2RT 3OEHD 3PWBA 4FUFA 4E7RG 2VU8E 3CNRA 1C5OH 2Z9GA 3SV7A 4I8LA 3FP8E 3MU0A 1C1PA 1IAUA 1MTVA 5JBAS 5GWZA 1C2FA 3U1IB 1MKXK 1O2QA 1DWDH 3T27A 2HNTC 2W3KA 2UWPA 4K8YA 1A4WH 2HNTF 1ETTH 2AIQA 4TPIZ 3MOCA 4Y7AA 4P00A 1T4UH 3T28A 1AFEH 5DGJA 2ZU1A 2J95A 2F3CE 5B6OA 1A3BH 1F5RA 1K1OA 3EAJA 1P2KA 1QY6A 1ANBA 1C5QA 5EJZA 5GPIB 1A3EH 2ANKH 4ESTE 5E0GA 2AFQB 2ZGHA 1SHHB 2HGTH 4IN1A 3RXOA 4ISIH 1SL3A 1G3CA 4BAHB 2VIVA 3PV4A 1HAGE 1P12E 2VGCC 4OS2A 1BOQA 1P03A 1D3PB 3F9GA 5ESBA 1MU6B 1YPLH 1ZSLA 3V13A 4UD9H 2PP6A 2IN2A 1DFPA 1XUFA
chains in the Genus database with same CATH topology
4JYVH 2Z3CA 1ID5H 2FOFA 1O30A 3FAOA 3TH3H 2ZP0H 2IPHA 4MQAA 2BX4A 2ZPRA 3SJKA 1QB9A 3TU7H 5JB8S 1IHTH 1AWFH 1C1VH 1UTMA 3JZ2B 4ZKNU 3KL6A 3TNSA 1GHAF 1MUEB 1S0QA 1NY22 3PMJA 1QRXA 2C8WB 1HJ9A 1O3AA 4X0WU 2VWOA 2BZ6H 4FU7A 1TIOA 4UFGH 1IQGA 3LPRA 2BB4A 4Q7YA 1XKAC 4WXVA 1XKBC 5L6NH 3P95A 3UUZA 2ZCHP 2NU3E 1ZMNA 2BD3A 3A7ZA 1GBKA 1WOFA 3E3TA 3U69H 1RJXB 5FPTA 5JB9S 5EGMA 3RMNH 3TJNA 2KAIA 3VXEH 2ZDNA 2F9VA 1BRUP 5GCHG 1C2JA 3KNXA 1QNJA 1TBZH 3FFGA 4Z0KA 2F9BH 4KGAA 4B76A 1MU8B 4NZQA 5C20A 2BY9X 1N8OC 1AFQB 3BIVH 1EAIA 3DT0H 1W10U 3LH1A 3PMHB 3ZVBA 1QRZA 1F5LA 2SGEE 1AHTH 1DUEA 1P2NA 3PO1C 1SQOA 1QIXB 1QJ6B 2BM2A 4RKOB 1QURH 3M3TA 2Z7FE 3ZVFA 1XXDA 1ELEE 2AMPA 5F8TA 3QUMP 2WPHS 1GBJA 4DCDA 1G32B 1C4Y2 2B8OH 1G9IE 4INLA 1DOJA 1EATA 3S69A 1UJ1A 1EKBB 3UNSA 1MAYA 2A5KA 2C8XB 3LKWA 1B0FA 2DUCA 3SU6A 4Y79A 4NWLA 1DSUA 2ZGCA 6LPRA 3ODDA 2OC7A 1BTHH 2CHAC 2GT7A 3G01A 3SNDA 1O2ZA 5DPAA 4BAKB 1PQAA 2UUJB 4YZUA 2HLCA 4DJZB 1HJAB 3ZVEA 2FWWA 3I77A 3RXUA 4B73A 3DHKH 5GXPA 3SHCH 5FX5A 2BLVA 3ZZ6A 1K1LA 2ODQA 1VJAU 2BD4A 4LK4A 1S0RA 3KQDA 1N6YA 1O3HA 2TPIZ 1BZXE 3BTEE 1QGFA 3BTGE 1O3GA 1ZRKA 1GJ7B 3TH2H 1VITH 1TPSA 3M7TA 2Y5GA 4NSVA 1QHRB 3QTVH 3MYWA 4LXBH 5HMAA 1L1NA 1UK2A 1CA0B 2P95A 3ZZ3A 2SGAA 2SFAA 1BHXB 1IQHA 5C1XA 1GBTA 2P3TB 2QXGA 3A8DA 1K1IA 2P8OC 1QBOA 2TBSA 4YESB 1KLJH 4I8GA 2PV9B 1AKSB 5LH8A 2PWXA 4NSYA 3NWUA 4INHA 1GCDA 1ZMJA 1WAYB 1L4ZA 4JCNA 2J9NA 3L33A 2XBYA 4OGXA 4ZMAH 1BDAA 2XWBI 1C2LA 1K1PA 1XX9A 1F0RA 3VB4A 1P9SA 1RTLA 1UTNA 1O3CA 4KELA 1ZSJA 1G3DA 1VCPA 1C9TA 1DY9A 1GI8B 3UWJH 1HAXB 3M5LA 3SU5A 1AWHB 1E37B 2V0BA 3Q77A 1UHBA 1FAKH 3GICB 4JK6A 1TFXA 4OGYA 4WY3A 1GMDF 1UTJA 2BY6X 3STIA 1BTYA 1MTNB 3LJJA 4X2YA 1TWXB 2FOAA 1AB9C 1AGJA 4U01A 5FBEA 4OS7A 4WXIA 4NFFA 4XDEA 3UOUA 9LPRA 4FUHA 3K6ZA 3U8RH 5DO4H 1HAPH 1PPZA 5FHTA 4FXGH 1C1MA 1Y5BT 1TGBA 1UTOA 1BBRE 3QO6A 2GVFA 1V2QT 3SU3A 3UTUH 3CS7A 2H9TH 2VB0A 3KQBA 1ANDA 2BQ7B 3ZZAA 5C1UA 1K22H 1XXFA 4SGBE 1H1BA 3GCNA 1GJ5H 1BRAA 1TRNA 1CVWH 1A5HA 1RGQA 5DP3A 1C5TA 1Q3XA 2ULLA 3A7TA 4J1YA 2WPKS 1EASA 2FX4A 1QB1A 3BF6H 1JXPA 1YF4A 3RU4E 1TQ7B 3UR6A 2C3SA 3ATIA 1GG6C 4O03A 4ZKSU 1O2TA 3ATMA 1A2CH 1EPTA 1TOMH 4AN7A 4MG3A 4RN6A 2A7JA 4GLYA 5AF9H 1AN1E 1ABJH 2STBE 1DWBH 4TYDA 1ZLRA 1AVWA 4TY7A 3MU8A 3KHVA 2VGCB 5EQSA 1GI5A 3MTYA 1SBWA 1AQ7A 1KSNA 3BIUH 1UCYH 1P3EA 3UNQA 4KTCA 1Z6JH 1BRBE 1MQ5A 5DP6A 1BT7A 2GKVE 2P94A 2HOBA 3M61U 1CT2E 1MCTA 3TK6A 3KN2A 2D8WA 4BAOB 4D8NA 3SV6A 2GGVB 1EOJA 4IMZA 4FVDA 3ATKA 1RTKA 2B5TB 5IYTA 2G5VA 1MZDA 2GMTC 4SGAE 5AVDA 1NRSH 1YCPH 2BX3A 3RMMH 2BVSH 1KXCA 1PPEE 2AGIX 1HAIH 3E16B 2ZPQA 1Z1IA 1H9LB 1GHYH 1J16A 1P02A 1QFKH 5EODA 2BD7A 1LHDH 1WBGB 1O2MA 1PPGE 1DM4B 4BTIB 1WYKA 1ZPBA 1GBIA 1GBLA 1K28D 2RG3A 4CR9A 1GJCB 5A0AE 2QAAA 4D76A 1O2VA 2P3FH 1CHOF 1V2WT 3AASA 1XVMA 2WPJS 4WH6A 2Y82A 4DVAU 3O8BA 2FYRA 4KKDA 1FQ3A 1Y5AT 1P04A 3MH5A 1A0HB 1ZR0A 3ESTA 5TJXA 5FPSA 1SGFA 4NWKA 3R3GB 1BRCE 1YGCH 1C5UA 2C8ZB 3GDVA 1GDNA 3B9FH 5AFZH 3U9AH 1AO5A 1C2EA 3KCGH 5FCRA 2ZFSA 2H9EH 1HB0B 2AGGX 1C5NH 2RDLA 2CF9H 2F9OA 2ZC9H 2Y7XA 3ZZ8A 1ZHMA 1VGCC 3H7TA 3PO1B 4WH8A 3RXMA 1ZRBA 2OD3B 1HAZB 3ZZ4A 3SJOA 5JBTA 2CV3A 2J34A 5T6DA 2YNBA 1DWCH 3BTME 3K9XB 3RXBA 2BOHB 1SR5C 1O2WA 1MBMA 1KDQA 2J92A 2HALA 1DUAA 1O3BA 1O5AB 2XNIA 1GDUA 2FLBH 3RXFA 3FANA 3CENA 1O39A 3KQEA 1P3CA 4K1EA 1GCTC 1W8BH 5H4IB 2FMJA 3GCHC 2K1QA 3VB7A 2M5TA 3D49H 1Z8IB 3V12A 3ZYDA 3EDXB 2CHAB 5J4SA 4H6TA 2C90B 1DXWA 1HYLA 2UWOA 4QT8C 3RXLA 5C67A 2QY0B 1OP0A 1FAXA 1SVPA 3D62A 4GHQA 1SLVB 4RSPA 3P8GA 4FUIA 3GISB 3KQCA 2HPQH 2QXJA 1DT2A 1QA7A 4YOIA 1THPB 1XVOA 1LHGH 2GCHG 2W3IA 1TGNA 8GCHG 7KMEH 1XM1A 2KAIB 2OC0A 3NCLA 3RXSA 1BB0B 2ZDLA 5EW1H 2NWNA 1AY6H 1GMCF 1NPMA 2D26C 1MBQA 2FODA 4MPVA 2A4GA 2VIWA 5E0HA 1QR3E 2FOMB 2C8YB 4F49A 3PTNA 1NRQH 1ABIH 2ZFPH 1QL8A 3SW2B 1NZQH 1BMNH 2BY8X 1O2LA 3P17H 2AERH 2NU1E 1A46H 2ZG0H 4KTUA 1O35A 3DFJA 1G37A 1CE5A 1GJ8B 1C2HA 1GMHG 1BTUA 1HV7A 4YOJA 2PW8H 1QJ1B 5LPRA 4K8BA 1FN6A 4X1SU 5HM2A 1GI4A 3GCTG 1ELVA 1SQAA 2PUQH 1OYQA 1F7ZA 1D9IA 2BVXH 2YNAA 2FDAA 4ABDA 1P2QA 1W7GH 1GGDC 2A4OA 2BY5X 2OQ5A 1P2IA 1IQIA 1F0SA 1ZTKA 2ZNKH 2P93A 2BDYA 3RUOA 1O2OA 1VZQH 1IQKA 5PTPA 1QCPA 3HPTB 2OINA 1SLXB 1DLKB 1J8AA 1FNIA 4CRGA 4MPUA 4BTTB 3R0FA 5F6MA 1GWAA 1T32A 2ZHFH 1VJ9U 1O5GH 3T26A 3GCOA 2XCFA 2ZWLH 4Q80A 3BTHE 1TB6H 4ZHAA 2ZCKP 5I46H 1AB9B 4CBOA 1HJ8A 2XW9A 2TGAA 4MNYA 3O8DA 4AG2A 1FONA 4HZHA 2WPLS 3RXAA 1DITH 1D6RA 5A2MH 1UCYE 2VINA 4BNRA 2BLOA 4MVNA 3A89A 4JYTA 4CRFA 4GUXA 1TPPA 1GL0E 3TGJE 1UTPA 1O0DH 4RKJB 5DKMA 3SI3H 1EOLA 4DIHH 1XMNB 2EI7A 2FX6A 4TWYA 2UWLA 3A7YA 1TX8A 2XBXA 2B9LA 3EA9A 4CR5A 3PLKA 1Q2WA 4UONA 1Y3XA 4O3UA 1CA8B 1UCYK 1SG8B 3Q3XA 3RM0H 1NFUA 3BG4C 3Q3KA 4ZXXH 2Z94A 3A80A 3RU4D 5A0CA 1S81A 1P9UA 3RMLH 4VGCB 2WUBA 4NG9H 5IDKA 1EB2A 1VITF 1JMOH 3MU4A 1AE8H 1TALA 3A82A 1H8DH 3E6PH 4MNWA 7LPRA 4H4FA 1C2DA 4ABEA 1Z8RA 1NC6A 1CO7E 3BEFB 3GDSA 2J2UA 2H5CA 2O8TA 3QTOH 1J9CH 1YCPK 1E38B 1FY1A 3PWCA 3PM3A 4Q7ZA 4D9RA 1UVTH 2ZHWH 1UHBB 2FOCA 2AYWA 1MD8A 1EJMA 1H9IE 1OSSA 1HIAA 1O2NA 1V2MT 4MDSA 3P70B 1E34B 2IJOB 2G8TA 5EQQA 1IHSH 4ASHA 2EI8A 1ELBA 3A8BA 1QBNA 1O36A 1T4VH 3BTTE 1JIRA 5FPYA 2WYGA 4GHTA 2TGTA 3GDUA 1DWEH 1FXYA 3LGUA 3RU4T 1FY4A 3E91A 1OP8A 1O31A 3UWIA 5EG4A 1E36B 2A45B 2ANWA 4D7GA 1O3NA 2EA3A 3ZZBA 4GCHF 3MNXA 5FXLA 1D4PB 1JIMA 4KTSA 1EJAA 2GMTB 3OYPA 1ESBA 1Z1JA 4TPYA 3O8CA 4THNH 3ELAH 3GY5A 2WV5A 1YP9A 2ILNA 2OQUA 2GZ7A 4CHAC 3M5MA 4A5TS 2PFEA 3DFLA 1W0ZU 3T2NA 4YM9A 1J15A 1FV9A 2ZKSA 1PFXC 5A8YA 3A8AA 1C5SA 3S7KB 2J94A 1EPTB 4J2YB 3ZZCA 2GCTC 4AORA 2GT8A 2VIQA 1G36A 3HKJB 2DE9A 1MAXA 1P2MA 5DK1A 2GD4B 1G3EA 2RA0A 2FP7B 3ZYEA 1INCA 1F2SE 1C4U2 1P09A 1Y3WA 1BITA 1QA0A 2HWLB 2BDBA 1YPKH 1SGYE 1D3TB 3TJOA 1LPKB 2NU0E 1W2KH 2FYQA 5G4BA 1GHZA 1NO9H 1O5FH 1PYTC 2OXSA 4X6MA 3VGCC 1T31A 1TYNA 1VR1H 5A09A 1DICA 2UUYA 2Q1JA 1VGCB 1ZJKA 3RDZA 1F0UA 1EZUC 5CMXH 2A5AA 2VIPA 5FAHA 2ZHDA 2G4TA 4MPXA 3SU4A 2XC4A 1ZZZA 3WY8A 2O8LA 3EYDA 4OS5A 3A87A 1TONA 1GBFA 5GCHF 2QC2A 3UIRA 1TMTH 1LVBA 2Q6DA 5DP4A 1E0FD 3DD2H 3CP7A 4JZ1A 4Y10E 1RIWC 1SOZA 3AW1A 1Z6EA 2BLWA 1CHGA 1OWHA 4XFQA 4XSKU 5C3NA 1C5WB 3ATLA 1GCTB 1TBRH 1HDTH 1L0ZA 4XBCA 2FOGA 4X1QU 2GDEH 5EOKA 1WUNH 2ODYB 2SNVA 4Y11E 1V2PT 7ESTE 1AZZA 2G00A 2OTVA 4AGKA 3ZZ5A 4FUCA 2A32A 4LOYH 2PKAB 1PQ8A 4INKA 3SNBA 1C5ZB 3MO3A 2G5NA 9ESTA 4MNXA 4I32A 3OX7U 6GCHG 1LO6A 1CU1A 2VWMA 4ISHH 3L3TA 5E2PA 1GHWH 2PSYA 2ZDMA 2AH4X 1OWDA 1DSTA 1ELCA 4CH2B 1ETSH 3STJA 1LMWB 4ZKRU 4DY7B 1V3XA 4NFEA 4ZUHA 1PPHE 2BDGA 2QV1A 1SHYA 2ZU5A 1C2MA 2ESTE 1BA8B 4GAWA 1CBWB 4ZAEA 3UQOA 1GBEA 2ZFRH 1O34A 1O5BB 4X6PA 1SI5H 1TRYA 1Z71A 2QXIA 4WMFA 4BAQB 1KDQB 1TRMA 2ZQ2A 1FY5A 1TA6A 1BTXA 2V3OH 2ZFTA 1LVYA 1KXDA 5JPMH 1RTFB 2FOBA 4AFUA 1TGCA 2G55A 8KME2 1LQEA 1NU7B 1OWKA 2ZGJA 1O2KA 1A1RA 1HCGA 4D7FA 1NM6A 4IC5A 3GY7A 1FI8A 1O5DH 1H9HE 1PYTD 2GV6A 4ISOA 1TOCB 2VVCA 1GGDB 1GJ6A 1MZAA 2OC1A 1P05A 3SU2A 1C4V2 1OWIA 5DP9A 4X8TH 5L2ZH 1GBDA 2WV4A 1TNKA 1BMMH 1AU8A 2R2MB 2BDHA 2OLGA 1FJSA 1D6WA 1KLTA 1P8VC 2ZFFH 5AHGH 2BD9A 3LJOA 1YKTA 5F8XA 1ZPZA 4WF8A 1P06A 1HFDA 3F9EA 1A5GH 1OS8A 5FCKA 3TNTA 1SC8U 1C5RA 4B71A 1XUGA 1S5SA 1O2XA 1ZGIA 1JWTA 1Y3VA 3SV9A 1O37A 1BQYA 1MKWH 3LC5A 3RXKA 3ZZDA 4Z6AH 3BTFE 3QZQA 1HBTH 1OXGA 1A0JA 2VVUA 4NIWA 1O3DA 1HXEH 4ZXYH 1UMAH 1O2GH 3FP6E 2SGQE 2BD8A 3SOSA 5JBBS 5C2ZA 1C1RA 2ZDAH 3SGAE 4AGJA 2WPMS 1NESE 5CHAC 4BOHA 1KTSB 2C93B 3V3MA 2Z9IA 3OY6U 1MTWA 3HGNA 4YO9A 4Y71A 4FUBA 3BG4B 5C5OA 4NA7A 3RXRA 1LHCH 4WJG2 1C2KA 3TK5A 3F6UH 1VCQA 1FLEE 1O2JA 3TJVA 2ZHQH 2Z3DA 4CRAA 3MO6A 4Y0YE 1TLDA 3A7WA 2FPZA 4K60A 1MKXH 1CHOG 1O2HA 1W3CA 5JYIA 1ZSKA 5ABWA 4HGCA 4OS4A 4X8VH 2V3HH 1SGPE 5E8EH 4OS6A 5DP5A 1OKXA 2A7CA 4Y6DA 7GCHG 1PPBH 2JH6D 1ANEA 3A86A 2FEQH 1WSSH 1YC0A 1HRTH 2QYIA 3GY8A 3MH6A 5LGOA 1TX6A 1ELAA 1O2UA 2SGPE 3A81A 3RMOH 4ZH8A 1C1SA 3S9BA 1VCWA 2QXHA