1YKTA

Trypsin/bpti complex mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDAGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin II
publication title Partially folded bovine pancreatic trypsin inhibitor analogues attain fully native structures when co-crystallized with S195A rat trypsin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yktA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yktA02
1GBKA 4GCHG 4IGDA 1UVUH 2O8MA 2ZGBH 1CA8B 3P8FA 2HRVA 1BMLA 2A4RA 2AMPA 1JMOH 1QJ6B 3NUMA 1K2I1 3TNSA 1HAVB 1UK2A 4U30A 2RCEA 3OY5U 3ZZ8A 3OSYA 3UWJH 5G4BA 2ZP0H 2CV3A 2XNIA 3QZQA 1C5XB 1ZMJA 7GCHF 1UVOA 2B8OH 1O2MA 3SQEE 1BT7A 4A6LA 1E37B 1GPZA 1MTNC 1C5RA 1QR3E 2FIRH 2ZFTA 1F0SA 1NM6A 4ABDA 1INCA 2O9QA 1TNGA 3SJIA 2BOKA 3LU9B 4KGAA 1BB0B 2O8LA 4NWKA 2O8TA 1P2MA 2GVFA 3RXIA 4BAKB 4ZMAH 1ESBA 2ZGXH 1O2TA 2EI7A 1VGCC 2BY7X 3LPRA 1O5CB 2TRMA 1TRYA 1YBWA 1RD3B 4X2WA 3RC6A 3I77A 3S9BA 2BLWA 1NU9A 4ESTE 5HMAA 1WOFA 1O2XA 4MVNA 5JBAS 4Y11E 1ZPCA 3L3TA 2FTLE 3QO6A 3S69A 3CS0A 1EPTB 3LT3A 3RXHA 2C8ZB 2Y7XA 4FUJA 3GCHB 4YM9A 1O2SA 1ZHRA 1FQ3A 5JBCS 1MKXH 1PPGE 1ZGVA 2ZZUH 1QB6A 1VJ9U 2XCNA 3SJ8A 3BIVH 1A0LA 5DP5A 1P2KA 4ZKSU 1HGTH 3TPIZ 1MBMA 5LPEA 3ZZ7A 1GMDF 2PTNA 4IC6A 8ESTE 3SUDA 1KXFA 1PPZA 1WTGH 1BHXB 4MQAA 1A61H 1C5SA 1CT0E 1NC6A 1T4UH 1ZSJA 1ZLRA 4Z6AH 1UCYK 4ZKOU 4M7GA 3SQHE 3T2NA 2Q1JA 2UWPA 3VXFH 2OUAA 4CRBA 4JK5A 3BTKE 2AFQB 4D7FA 2P8OB 1BMMH 2ZTXA 1HUTH 2NU2E 1V2RT 4CR5A 2XBWA 3A7TA 4SGAE 2VU8E 5FCRA 1GJCB 3A7ZA 3JZ2B 1FAKH 2R0KA 5IDKA 1ZTJA 1S0RA 2ZFRH 1XX9A 4WF8A 4KELA 2AMQA 2GX4A 4INLA 4F4OC 1TGBA 1BJUA 4U01A 4WMEA 4AFZA 7GCHG 2QIQA 2WPLS 1Q31A 2H6MA 2AH4X 2TPIZ 4NCYA 2H2ZA 3URDA 4FUHA 4KKDA 2ZFQH 1ZHMA 4Y71A 1EJAA 1XM1A 2GV6A 5F8XA 1HAVA 1CGJE 3ATKA 1KXEA 1P2QA 3STIA 1MUEB 1SGRE 2XCFA 2GDEH 2GCTC 4XDEA 4Y7BA 2RA0A 1GI5A 4ABBA 2AS9A 1AVWA 2XXLA 3KN2A 1HRTH 4NG9H 2ESTE 1C4U2 1ELCA 1TA2A 2A7HA 1LKBA 2QF0A 5T6FA 1VZQH 1RTLA 1S83A 3F1SB 3UR9A 4AFQA 1BMNH 4K2YA 1WV7H 1V2JT 3BG4C 3PMHB 1FPCH 2VWMA 5EXLA 2ZPRA 1TX8A 2QV1A 3RXUA 3PO1B 1DANH 3RXTA 1H9HE 5E0GA 3QK1A 4CRAA 1DSTA 1OP2A 2P59A 5F6MA 1GMDG 1BRBE 1EPTA 1C9PA 3RM0H 4BOHA 6CHAC 2J95A 1RFNA 3EDXB 3LGVA 3UNRA 4YESB 3A7WA 2JH5D 3RXGA 4X8SH 6ESTA 1IQNA 1C1SA 2ZQ1A 3WY8A 1QHRB 3B9FH 1LVBA 3ZZ9A 2WUBA 3ZZ3A 3MO6A 2PKAB 2H5CA 1O30A 3P95A 2VIOA 3TNTA 3MH5A 3BF6H 3PTNA 3B8JA 4GAWA 2A32A 3U69H 2FEQH 5T3HA 4NFEA 1GBCA 4X2VA 2WPHS 3SHCH 3GCOA 4MG3A 1CT4E 3BTWE 3BTQE 4MNYA 4FUIA 4A1VA 3F9EA 3RXEA 1C1OA 1BTYA 5JB8S 2HPQH 3SNEA 1X7AC 1QL7A 4Q2KA 1HAOH 2FOCA 1HIAA 1VITH 1Z8GA 2ANWA 2PR3A 3UOUA 1HAZB 1CHGA 2FI3E 4KTCA 3A8BA 1A3BH 1MBQA 2C4FH 2TGDA 1O33A 2EI6A 1QBNA 3K9XB 1TBRH 2Z9KA 1SI5H 2DUCA 2FLBH 1IQKA 2BXTH 1O31A 4IBLH 2A0QB 4VGCB 1Q3XA 2ODPA 2ZFPH 4X6NA 2FOFA 5H4IB 3AASA 3K2UA 1YPKH 4DY7B 4I7YH 5AFYH 2R0LA 1TB6H 2ANKH 3SNBA 4AYYB 1CU1A 1S6FA 2BX4A 1QURH 4Y8YA 4YO9A 3MO9A 1LCYA 3PROA 2IN2A 3M5OA 4Y7AA 2PTCE 5L6NH 3HGPA 1GMCF 2G52A 1EAUA 1TGSZ 1V2VT 1GI0A 4FUEA 5FX6A 1ANEA 1W12U 2ZF0H 4CH8B 1BBRH 2BOHB 1AWHB 1GDUA 5HYOA 2Y81A 1NRQH 1XUKA 5FPSA 1AN1E 3NK8A 4GSOA 2W7UA 4BAOB 1PYTD 3MNXA 1HAHH 2GT7A 1TE0A 4YOGA 1MKWH 1AVXA 3TH3H 1HNEE 1T8OA 2A7CA 4D8NA 3TGJE 1VCQA 1TALA 1ELVA 2ZHWH 3GY8A 1IQLA 3AW0A 1K21H 4Q7XA 3UFAA 2ZTYA 1P3CA 1GI3A 4AGKA 1GCDA 4E06H 1HLTH 2WPIS 4NA8A 3ZYEA 3U98H 5C5NA 3K65B 1LHFH 1RIWC 4E7RG 3UR6A 3M37A 1JXPA 3M3VA 4I8JA 3QUMP 1NFWA 2FLRH 1NFYA 1Z6EA 3UWIA 3KHVA 5GIBA 5C2ZA 8GCHF 1YF4A 4YT6H 2FDAA 1TA6A 1CQQA 4ISLA 1BDAA 5PTPA 5GXPA 3U9AH 1A1RA 3CENA 1AMHA 4AOQA 3PMAB 1NROH 2A4OA 2BDIA 2FP7B 1OX1A 1YLDA 3SOSA 1F0UA 3D62A 4ZKNU 4J1YA 1QNJA 3MOCA 4NIXA 3STJA 1TQ7B 4WJG2 4JYTA 4LZ1H 1ZZZA 2HWLB 1C1VH 2F9VA 2XWAA 3ZZ4A 1BMAA 4X6OA 4A7IB 3LDXH 1GJ6A 1NN6A 1AZ8A 2XTTB 4ABAA 1EASA 1CO7E 2ZGHA 3TVJB 5DP6A 1EJNA 3F68H 1O3LA 4UEHH 2SNVA 2Z9GA 1O37A 3Q77A 2R2MB 3QWCH 1GMCG 2PUXB 4I8GA 3RXQA 3SJOA 3BTME 2BD7A 3FZDA 4CBNA 4Y76A 1JRSA 1TPOA 1VJAU 1NPMA 1UTMA 3GY5A 5EXMA 3RXJA 1MKXK 2PKSC 1GDNA 4X1RU 3P92A 4DG4A 4O3TA 1DFPA 3PMBB 7KMEH 1S5SA 1O3BA 4MPWA 4ABIA 1AIXH 1S0QA 4X6PA 3O8BA 1P03A 1RTKA 1ETRH 1MCVA 2G81E 1Y3WA 2FS9A 3BV9B 2NU4E 1TNKA 1PPEE 1SHHB 1D4PB 1C2GA 1OPHB 1ZMNA 4DIIH 3BEUA 1HAYB 1QA7A 1YPHE 3MI4A 3U1IB 1GBDA 2D8WA 2FOEA 2ZDLA 1O2VA 3N7OA 3RP2A 2STAE 1C4V2 1P9UA 1GBMA 1DWDH 3M35A 3B23B 1XUIA 1UTJA 5JB9S 1VCWA 2XYAA 4BTUB 4H6TA 4IMZA 4FUBA 5TCAA 2JH0D 1GG6B 1OP0A 3KQCA 1TPAE 2Y80A 1SGNE 2C8XB 2ZEBA 1DVAH 4UDWH 3BG8A 3M5NA 5DKMA 3RXOA 1YPLH 2ZU2A 4LOYH 1GWAA 1YPGH 8GCHG 3MU5A 1RS0A 2ZDAH 1E35B 1SOTA 4RKJB 1SG8B 1PQ8A 3NKKA 5I25A 1D3QB 3CS7A 1AKSB 1C5LH 1V2UT 1GI6A 4NWLA 1MTUA 7ESTE 4MPVA 2BHGA 1SQTA 4ZHLU 1O3AA 3V13A 4BANB 4Y0YE 4J2YB 2BD8A 2H9TH 1MAYA 3PM3A 4FVBA 4JZDH 3U8TH 1DWCH 3VB6A 3NCLA 5GJ4B 4TWWA 1HJ9A 3A85A 1LQEA 3PTBA 4Z0KA 3RXAA 1Z71A 2J92A 4R8TB 2ULLA 1F2SE 3RXLA 3ZVCA 5GDSH 3A8DA 2WPJS 1UTLM 1DX5M 1GI2A 2AERH 4TYDA 5C20A 1P01A 1LTOA 2CHAC 1FPHH 5DO4H 1XMNB 1KLJH 2FI4E 5J4SA 2OTVA 2W26A 3RXVA 4GVUA 1XXFA 4CREA 1KSNA 1GJ7B 1MD7A 1UVPA 1CSOE 1MU6B 3M3SA 2BY5X 3E1XB 2OP9A 2ZU5A 1K1NA 2BZAA 1OWIA 3K6YA 1O5BB 3U8RH 1YPEH 1O5DH 1W3CA 2O8UA 1CVWH 1IHSH 4UFEH 1O3JA 2FM2A 3A8AA 2ZHQH 3C27B 3V7TA 5AFZH 1BTUA 3A8CA 2VIQA 1C1MA 4X0WU 3LGWA 1F5LA 2ZDKA 2QF3A 3MYWA 2YNAA 5EQQA 4D9QA 3A87A 2F9UA 3MH7A 1O39A 4IN1A 2ZDMA 1XKBC 2OC0A 1IQGA 3SU3A 4ZAEA 4KTSA 1MMJN 1ELEE 3VB7A 1HPGA 1LPGB 1TIOA 5K7RA 2A1DB 1O2NA 3RMMH 4FUFA 1C4Y2 4AYVB 1P2OA 4B76A 5CHAB 1YCPM 2A4QA 1FMGA 2OINA 4INKA 2Y7ZA 1Z6JH 2BDYA 2Z6BD 1MQ6A 5A8ZA 1AUTC 1TMUH 3SV6A 1HAGE 3SU2A 1P11E 3M36A 1P06A 1HJ8A 1T32A 3RU4D 2XW9A 1AVGH 5A0BA 2V0BA 1JRTA 2H1UA 9ESTA 1NU7B 1GCTB 3TJUA 1PJPA 1CGHA 2VINA 3RXSA 4NIYA 1MU8B 1EB1H 4JYVH 2OC1A 4D76A 2EI8A 4WWYA 4AG1A 1H4WA 2H5DA 1GI1A 5JBTA 1Y59T 5JPMH 2SNWA 1FN6A 1OXGA 2BQ6B 3S9CA 3ZVGA 2B0FA 2JETB 1GBAA 1WSSH 5E2OA 1SGPE 1AKSA 1B5GH 4X1SU 3RU4E 1U6QA 1XUHA 1G3BA 3A82A 5TJXA 1AB9B 3S9AA 3VFEA 5FAHA 1BBRK 1EZUC 4YLQH 2WV4A 4ZXXH 2OXSA 3UOPA 1GVZA 1AQ7A 1DLKB 1H9LB 5EQSA 3BTEE 5FBIA 1OSSA 1ZRKA 1C1NA 3PO1C 2FOHA 2PUQH 1V2WT 3GISB 2Z9JA 5DP9A 4NSVA 3RDZA 2SGQE 2BY6X 1O3GA 3M7UA 4I31A 2W3IA 1GBTA 5EQRA 3AAUA 2OD3B 1SGQE 1SGFA 1O3FA 5C1XA 1GBEA 1K28D 5L2YH 1LHGH 1FY1A 3GYLB 1GI8B 1E34B 5C1UA 2SFAA 3HATH 3TJNA 1ZPZA 1OWEA 1ARCA 4MNWA 2VGCC 2QXJA 2ZU1A 1BTPA 3SUEA 1V2ST 2Z3EA 5HGGA 5ABWA 5A8YA 2J34A 1QQUA 2VWOA 2V35A 2ODQA 2BDGA 4DCDA 1NFXA 1VITF 1YKTA 3KIDU 1CA0B 2FWWA 3MWIU 4CR9A 4X8TH 2WYGA 3BTDE 5EODA 3A81A 3GYMA 2GD4B 2P3TB 3IWMA 2NU1E 2XC0A 3UTUH 1D3PB 1N8OC 1O2UA 2VWLA 1J9CH 2VVUA 1V2KT 2GMTB 2BDHA 1EKBB 3S7KB 4TY7A 1L1JA 1TQ0B 1GBFA 1Y5AT 2Y6TA 3BEFB 3RXMA 2P16A 4B2CA 1QL8A 2F9PA 4B1TA 3MU4A 4JZEH 4DURA 1L4ZA 3BTHE 3H7TA 1XVOA 1UTNA 1V2QT 1AE5A 1SMFE 1J14A 2AGEX 5K0HA 2QY0B 3F9HA 5DP7A 1KXCA 2A31A 2NWNA 4PROA 1UTPA 2EEKA 1UHBB 4HI3A 4K1EA 4Q7ZA 5E8EH 3AVZA 1GJAB 3FP6E 3PLKA 1F5RA 4TY6A 1AFQB 4LK4A 3LIWA 3GY6A 3FVFB 1ZJDA 3GY3A 1QB9A 3RMOH 3ZVBA 5C67A 1W7GH 1IQHA 3QGJA 1HJAC 1DY8A 1SR5C 3M61U 5IYTA 1C1QA 5DGJA 4DIHH 5L30H 3ZZDA 2FO9A 3SGBE 4GHQA 1SGDE 1MTNB 1FN8A 2AIQA 3Q76A 1F0RA 2LNCA 2ASUB 4AORA 1M9UA 1FDPA 4NA9H 4CBOA 1EB2A 1TMBH 2QGRA 1IAUA 1CT2E 1OWHA 4YTAA 2AGIX 2D26C 1XUFA 2BZ6H 2UUJB 2J38A 3E0NB 4XE4A 1RXPA 3V0XA 4FU7A 1YPMH 2Z9IA 1VITG 5F03A 1EATA 2OQUA 2XRCA 3O8DA 4YOJA 1P8VC 2AEIH 3MO3A 1TYNA 4ASHA 3TGIE 3TJOA 1C5NH 2HALA 1LVYA 1GJ5H 1H8DH 1LMWB 4K5ZA 2ZPSA 1C5MD 1O5EH 1P2NA 4WVPE 4ABFA 1P57B 2VIWA 1V3XA 1P3EA 3QDZB 1K1MA 3SV9A 4ABJA 1P05A 5FPTA 1LDTT 3HK3B 1O5GH 1O2ZA 2YNBA 1SLUB 2ZIQH 1Y5BT 5L2ZH 1W11U 1DUAA 1RRKA 1C1UH 4O3UA 3P8NA 4FUCA 4INHA 3C1KA 3S7HB 1YYY1 5FCKA 3SV8A 2PGQB 4ABGA 1PQ7A 3E16B 3HKIB 4CHAC 2QCYA 3ATIA 1N1LA 3ATWA 2J2UA 5CMXH 3SBKA 1A7SA 1NT1A 3NWUA 2Z9LA 3OY6U 2W7SA 5AVDA 1KLIH 1TPSA 2SGEE 4Y6DA 5A0AE 4WMFA 3T26A 1AGJA 2ZHDA 2IJOB 8KME2 1UHBA 1GGDB 1ZYOA 4NZLA 5A2MH 1NRPH 6GCHF 2ZI2H 5E0HA 1TOCB 2CF8H 4A1XA 1IOEA 3GY2A 4JZFH 1C5QA 1SQAA 3MNSA 3ATMA 1C2LA 1ZR0A 2QC2A 4BXSA 1G36A 1SQOA 1TOMH 2SGPE 5JDUB 3V12A 1SL3A 1AFEH 2Z3CA 4I32A 1Z8JB 1K9OE 3M7TA 2HVXA 2GCTB 6LPRA 4K8BA 2ZGJA 1P09A 1QA0A 1O2PA 3GCTF 5EG4A 4I8HA 2C8YB 2SGAA 2F9NA 4F49A 3S0NA 3ZV9A 3ODFA 1G3CA 1C2FA 3UPEA 1C1PA 7LPRA 3G01A 1W0ZU 4TWYA 3UNSA 1GJ9B 3BG4B 3D23A 4ZROA 1CBWC 2DE8A 4RKOB 4OGYA 4JK6A 1J16A 3RLWH 1KY9A 2ZTZA 3DFLA 3PYHA 1W13U 2B9LA 1J17T 2FS8A 2PKAA 5JBBS 2XWBI 1GJ4H 1C5UA 6CHAB 3ZVDA 1DWBH 1ZPBA 3TH2H 3RUOA 1AHTH 1LO6A 2G4TA 2EC9H 4UONA 1TGTA 1DSUA 3JZ1B 1AO5A 1QJ7B 1QFKH 2ILNA 5A0CA 3DA9B 3RXCA 1IQJA 3TK6A 3KQEA 2G8TA 3TGKE 4YZUA 2RG3A 4CH2B 2BXUH 1EOLA 4WH6A 2AGGX 3DT0H 1HXFH 1LPZB 2D1JA 2BD2A 1V2TT 3EGKH 1TONA 4CRCA 4DT7B 4FXGH 1YGCH 1P04A 1B0EA 1A0JA 1ELAA 3SU5A 5EOKA 2GZ9A 4NFFA 1SGYE 6GCHG 3ZZAA 3NXPA 2VIPA 3SGQE 2DE9A 2FESH 2B5TB 4B73A 1DOJA 4SGBE 2RDLA 1FY4A 2UWOA 1ARBA 2BQWB 1SFQB 4DW2U 1GHAF 1GMHF 1PPHE 1WCZA 5DK1A 1TGNA 1GHBF 1O2IA 2ZWLH 1THPB 2FTMA 2BX3A 1ZSLA 3NPSA 2HLCA 2C93B 3OX7U 3GY4A 4MLFB 1Y3YA 1MTVA 3VGCC 1SLVB 3KL6A 4LZ4B 4ZXYH 1O2RA 2G4UA 1L4DA 1BHXF 1ACBE 3TK5A 2J94A 3ATLA 2GZ8A 2HOBA 5DP3A 3GCTG 1VCPA 3GDVA 4OS2A 1FNIA 1W2KH 2GP9B 4IW4E 1HV7A 2R2WU 1UVSH 4IC5A 2I6SA 1C2MA 1ETSH 5C3NA 2IPHA 2PLXA 3SNCA 2BYAX 1FY8E 3VEQB 1NZQH 3MU8A 4NZQA 2PHBA 2F9BH 2BLVA 1DUEA 1OS8A 2FYQA 2VB0A 4FUDA 2BD5A 1TABE 1Q2WA 1SVPA 1TNHA 1V2MT 4THNH 1O3DA 2A2QH 2BY9X 3IG6B 1QRZA 3U1JB 4BAQB 4CRFA 2TGAA 1T4VH 4K69A 1H1BA 3SGAE 4OGXA 3A7XA 3P6ZB 4A1TA 2FOAA 2BDBA 1ANCA 2R9PA 5F8TA 1NRSH 1GBBA 3ZZ5A 2ZFFH 1C2KA 3LGIA 3T29A 2VH6A 5T6GA 2XBVA 3GDUA 1IQEA 1S85A 2VWNA 3DD2H 1QQ4A 2UWLA 4O9VA 4IMQA 3FP7E 5ESTE 2WPMS 1RIWB 1P2JA 5AHGH 1ZGIA 3SV7A 1DM4B 3TK9A 1LKAA 1P2IA 2Y82A 1ZSKA 2ZQ2A 1BTXA 1ZMLA 1BTWA 3RMNH 4H42U 2A2XH 2J4IA 3UQOA 1DXWA 1HAXB 4B2BA 3BIUH 4YLUA 1PQAA 3QGNB 2GCHF 2XBYA 1BBRE 3KGPA 1NS3A 2V6NA 5EW1H 1O3KA 4FUGA 3URCA 1GHAG 1GMHG 1HXEH 1HB0B 1GHBG 1EPTC 2FMJA 3M5MA 1V2LT 3A89A 2BD4A 3PLBA 1TRMA 2P3FH 3GCHC 1TAWA 4YT7H 1C5TA 2HGTH 2YOLA 1G9IE 1DICA 2BQ7B 3SORA 1C2IA 2M5TA 2FOMB 3PWCA 3SNDA 1FZZA 2AIPA 2Q6DA 1OYTH 1BJVA 1C2HA 1TLDA 1YP9A 1OWJA 1GBLA 4ZUHA 3RXDA 3ZVAA 1P0SH 2Z7FE 2GZ7A 2ZKSA 1ORFA 1ZJKA 2G51A 1H8IH 3TH4H 1FI8A 1EZXC 3A7VA 3ZZCA 3F9FA 2PKSB 3MNCA 1EAXA 2VVVA 3FZZA 4Y79A 1LPKB 2P8OC 5HXFA 1NFUA 3GDSA 3R0FA 2CF9H 3SW2B 1O38A 4ISNA 1SLWB 3LKWA 1O3MA 4XSKU 1UCYE 4LXBH 1B0FA 3E91A 2F3CE 1Z8RA 1ID5H 3Q3XA 1WYKA 1IQIA 3PWBA 1BOQA 2ZDVH 1DITH 3UREA 1QBVH 4ISIH 1DS2E 4BXWA 1SSXA 2IOTA 1O2QA 2F83A 1EP5A 1H9IE 2AMDA 1HDTH 1FONA 3AAVA 1LVOA 4FU8A 3HK6B 1LHDH 3ZZ6A 3SN8A 3Q3YA 4RSPA 3SI4H 3T5FH 3SZNA 4NIWA 1YPJH 3TIUA 2ZCLP 2ZCKP 5BPEA 4JYUH 1JIMA 5CE1A 2HPPH 1CE5A 1JBUH 2ODYB 1D6RA 4KP0A 4DJZB 3BEIB 1WTHD 4ISHH 1S82A 3MU0A 1J15A 2GCHG 1SLXB 1GHXH 1ELFA 1G2MA 1O3IA 2GDDA 5E0JA 3EYDA 2V3OH 1IQFA 3EA7A 1AY6H 5A8XA 1O5FH 1FY5A 3MFJA 1LHCH 3MH4A 1LVMA 1ANBA 3TJVA 4Q80A 1FJSA 4GHTA 2J9NA 4OS4A 1RGQA 1C2EA 1GL0E 3VB4A 1MQ5A 1GI4A 1YCPH 5EGMA 4AN7A 1MKWK 4CRGA 3QN7A 5GPIB 5DPAA 2ZDNA 4HZHA 2BD3A 2TGTA 4JZ1A 4AB9A 2UUKB 1HFDA 4DVAU 3W95A 2GT8A 1C9TA 1OP8A 3MTYA 3T27A 1D3TB 5FX5A 3LC3A 1GDQA 4Q7YA 1F7ZA 2CHAB 2ZC9H 4O03A 3DUXH 4NGAH 1PQ5A 3OTJE 1O34A 3A83A 4XBBA 3LH1A 2WPKS 4OS6A 2TBSA 4GUXA 2CN0H 1GHZA 3E90B 1PPBH 1YC0A 1P10A 3A86A 5T6DA 3QX5H 5GCHF 1ZTKA 3EA9A 2P95A 1E38B 1BCUH 4X1PU 1UJ1A 5DP8A 1O2JA 1AE8H 1BITA 1G3EA 1C5YB 1BZXE 1FXYA 2SGDE 5DG6A 4TPYA 2H9EH 4JCNA 4UD9H 3LJJA 5AF9H 4GPGA 4H4FA 1PFXC 4NIVA 1EZSC 1TMTH 3LH3A 3Q3KA 1O32A 3LGUA 3AW1A 1VR1H 1TBZH 2BTCE 3E8LA 2PSXA 1O3EA 1PYTC 4VGCC 4WMDA 3ENSB 1THRH 1HIAB 1Z7KA 1O0DH 2CMYA 2OLGA 1AWFH 1QBOA 1O2LA 5C5OA 2EA3A 4OS7A 2FODA 3F9GA 1IHTH 4MPXA 2ZHEH 4K8YA 1A4WH 5DJ7A 3ODDA 1EUFA 2QAAA 1KIGH 1QJ1B 2ZPQA 1QL9A 1GGDC 1GI7B 2ZCHP 3P8OA 9LPRA 5BRRE 3E0PB 5HM2A 3FP8E 1TX7A 3KQBA 4HTCH 2C90B 1AUJA 1FAXA 2SGFE 1UMAH 1G37A 3P8GA 2A5AA 3LGTA 3U8OH 1WAYB 4WH8A 1O2OA 4WXIA 4ZHAA 2GTBA 3KCGH 2CGAA 3ZYDA 2LPRA 1JOUB 1RTFB 1SB1H 3SU6A 1O2YA 1TPPA 2FI5E 5E2PA 1KXBA 2G5VA 3BN9A 1MAXA 1W7XH 2ZG0H 5ESBA 1D3DB 5I46H 4MNXA 1C5VA 1J8AA 5GWZA 3FFGA 1L1GA 1HAIH 2CXVA 1WUNH 2ALPA 2WV5A 4OS5A 3T25A 3KNXA 3FAOA 2BY8X 1VGCB 1EX3A 4MPUA 3ZVFA 5GCHG 3P17H 1TX6A 4AX9H 1NO9H 2KAIB 1V2NT 1C1RA 4BNRA 3CP7A 2Z3DA 4X2YA 1D6WA 1TFXA 2ZO3H 2VJ1A 1ZHPA 3SNAA 4ABHA 2ALVA 1O2HA 3BTFE 1DT2A 1V6DA 2P93A 1XVMA 1NY22 2C8WB 1C5PA 1MTWA 3MNBA 1LHEH 1SGIB 2BVRH 4B71A 1G3DA 2PSYA 3ITIA 4B75A 1GBJA 2P3UB 2ZHFH 1G30B 1YPHC 5LH8A 1QCPA 3EA8A 3EQ0H 1K1JA 3KQDA 4MTBA 3VB5A 3RM2H 1A5HA 1E0FD 2A5IA 3RXRA 3GICB 2STBE 3UNQA 1XKAC 2D2DA 1HCGA 1KXDA 4BTTB 2CJIA 2HNTF 4MDSA 3L33A 1ABJH 2VGCB 1ESTA 2XBXA 4U2WA 1L1NA 4WXVA 2XC4A 3T28A 1AI8H 3RXFA 4R0IA 1C1TA 4O97A 1DXPA 4BAMB 1GVKB 5F8ZA 3Q00A 3OU0A 2BDCA 1GHWH 2FXRA 1ELDE 2QN5T 2R3UA 3D65E 1KXAA 4XBCA 1GBIA 1SFIA 2K1QA 5EU8A 3ELAH 1HYLA 2Q6FA 1N8OB 1L2EA 1EP6A 5EW2H 1O3NA 1RJXB 1KYNA 1O3PB 1Y5UT 3UY9A 4DOQA 1B7XB 2WUCA 1EQ9A 3P70B 1T8NA 1E36B 3GCNA 2BDAA 2NU0E 2G00A 3A84A 1ELTA 1UTQA 5HM9A 1S81A 2Z94A 1ZRBA 1DY9A 1SBWA 3LC5A 1ANDA 1T8LA 2ANMH 1NESE 1OWDA 1A3EH 2Y5FA 4X1QU 3T62A 2RA3A 4I8LA 3NZIA 4AZ2B 2VNTA 4AFSA 3LJOA 3LOXA 1FY3A 4DGJA 3SHAH 4Y8ZA 1Z8IB 1GG6C 4K60A 3O8CA 5FPYA 2BLQA 5A09A 1Z1JA 1QGFA 3H5CB 3VPKA 1DWEH 1NRRH 1MZDA 1ABIH 1HJAB 1BRUP 1C1WH 1TWXB 1K1PA 2WYJA 2QYIA 2A5KA 3R3GB 1P9SA 1L0ZA 4K1SA 2GV7A 1ZTLA 2FPZA 2THFB 2WINI 2KAIA 3IITA 4HGCA 3TITA 4QT8C 3HKJB 4JZIA 4A5TS 1C2JA 3ESTA 3SU4A 3BTTE 1T8MA 2R3YA 1O5AB 1FV9A 1DPOA 1KLTA 1TNIA 1TGCA 1WBGB 2FOBA 1QIXB 4X2XA 3SJ9A 3LGYA 1KTTB 1BTHH 3PLPA 1FUJA 5FHTA 1IQMA 1CGIE 1O3CA 1UTOA 3I29A 4JMYA 3F6UH 1BQYA 2BLOA 3TLOA 1Z1IA 1D9IA 1ELBA 2HNTC 3SO3A 1CHOF 2QXGA 2F91A 3O8RA 1SGFG 1C5WB 1UCYH 4TPIZ 5EPNA 1KTSB 1EOJA 1V2OT 2G55A 4CRDA 3UQVA 1SHYA 1YCPK 1G2LA 1DDJA 3GY7A 1YM0A 2PGBB 4K3JA 1W0YH 1P02A 3EE0B 1Y3XA 1GL1A 1K1OA 2I6QA 4H6SB 1G32B 3FANA 4AB8A 1TRNA 3KEEA 1SGEE 1EZQA 1TNJA 2C3SA 2ZU3A 2B7DH 3A88A 2VVCA 4ZH8A 1THSH 1XUGA 1BTZA 2OBOA 1F5KU 2A4GA 2FZZA 4WY3A 4NA7A 4ZHMU 2BD9A 1GVLA 4BTIB 3GOVB 1HAPH 1F92A 1O36A 1GJ8B 4UFGH 3RU4T 2ZFSA 4AGJA 4B2AA 4RN6A 1W10U 1O35A 2FX6A 2BVXH 2QXIA 2V3HH 4CHAB 1TNLA 1GI9B 1TBQH 4XOJA 4K1TA 2ZGCA 1EXFA 1OOKB 3I78A 5CHAC 1NTPA 2OBQA 1GBHA 2W3KA 2GKVE 2ZECA 2FOGA 4ZKRU 3KF2A 3K6ZA 1MD8A 1A2CH 3RMLH 1A0HB 1GJBB 1SPJA 3SJKA 4AG2A 1BIOA 5SGAE 2Y5GA 4FVDA 5DP4A 5ETXA 1ESAA 1GCTC 2GGVB 1KDQB 1T31A 4BAHB 5TCCA 3RXPA 2FX4A 1C5OH 2OCVB 3SU0A 1A5GH 1QRWA 1EAWA 4UE7H 1SOZA 1GHVH 2P94A 1W14U 4HFPB 4X6MA 2JH6D 2ANYA 1K1LA 2W5EA 3PB1E 3OYPA 1C2DA 4A92A 1OWKA 1ELGA 2QXHA 1MTSA 1BRAA 1UK4A 2FYRA 4U32A 2JETC 2TIOA 3M3TA 4Y10E 1AZZA 1XUJA 2VIDA 1BUIA 3PMJA 2Y5HA 3SV2H 3M5LA 1ZOMA 1CHOG 1P12E 3E3TA 1O2KA 4GLYA 3E6PH 1F0TA 3EAJA 1AB9C 1O2GH 3RLYH 1YLCA 3H7OA 3QLPH 5EXNA 1N6XA 2UUFB 2JKHA 3RXKA 1GJDB 4MNVA 2O8WA 1CBWB 3RC4A 1JIRA 4D9RA 4I33A 3BTGE 2BB4A 1BA8B 4D7GA 2G5NA 3PV4A 2OC7A 4GCHF 1O3HA 3HPTB 3ZV8A 1EJMA 4FU9A 2F9OA 1O2WA 1UVTH 2PW8H 1SGCA 2OC8A 1LQDB 1MZAA 1JWTA 3MU1A 1S84A 1S6HA 1MH0A 1QTFA 5FXLA 5LPRA 1PPCE 2AYWA 1GHYH 4XBDA 3QTOH 3SUGA 1UO6A 1K1IA 3DHKH 3MMGA 3VXEH 3DFJA 8LPRA 1Y8TA 1UK3A 5B6OA 1A5IA 3A7YA 5EPYA 2UUYA 1A46H 1QY6A 1DLEA 5FBEA 4E05H 4KTUA 1XXDA 1V2PT 2A45B 1OKXA 2PV9B 5LPFA 2ZU4A 4NSYA 3RC5A 4E7NA 2XC5A 3L6PA 1AU8A 1O3OA 1SC8U 2A7JA 2ZA5A 3LONA 4Y0ZE 5J4QA 1CA0C 1FLEE 1ETTH 2BMGB 1AD8H 4OS1A 3SUFA 1DE7H 2NU3E 4ISOA 2QA9E 1BRCE 4ABEA 1PPFE 5C1YA 1FIZA 2VIVA 2BVSH 4YOIA 1QRXA 1SGTA 1WQSA 2GMTC 4X8UH 2TGPZ 3VGCB 4IS5A 3MHWU 3A80A 1UTKA 4Y8XA 1MCTA 1QB1A 2VH0A 4UFDH 1T7CA 3TU7H 4X1NU 3SU1A 1WU1A 4IN2A 5JYIA 3HGNA 3VB3A 1Y3UA 4XFQA 3ZVEA 3D49H 3RXBA 3V3MA 1KDQA 3ZZBA 1W8BH 2PFEA 1N6YA 1OYQA 2BM2A 4UFFH 4B74A 1FIWA 3M7QA 3UIRA 3SI3H 3W94A 1EAIA 4AFUA 3QTVH 1Y3VA 4X8VH 5LGOA 3QZRA 1HBTH 2H9HA 2HNTE 1NRNH 1K22H 2OQ5A 3MH6A 2ZNKH 2Q6GA 3UUZA 1WQVH 2PWXA 3BSQA 1AFQC 1C5ZB 4I8KA
chains in the Genus database with same CATH superfamily
1GBKA 4GCHG 4IGDA 1UVUH 2O8MA 2ZGBH 1CA8B 3P8FA 2WZQA 2HRVA 1BMLA 2A4RA 2AMPA 1JMOH 1QJ6B 3NUMA 1K2I1 3PRDA 3TNSA 1HAVB 2AHME 1UK2A 4U30A 2RCEA 3OY5U 3ZZ8A 3OSYA 3UWJH 5G4BA 1SQRA 2CV3A 2XNIA 2ZP0H 3QZQA 1C5XB 1ZMJA 7GCHF 1UVOA 2B8OH 1O2MA 3SQEE 1BT7A 4A6LA 1E37B 1GPZA 1MTNC 1C5RA 1QR3E 2FIRH 2ZFTA 1F0SA 1NM6A 4ABDA 1INCA 2O9QA 1TNGA 3SJIA 2BOKA 3LU9B 4KGAA 1BB0B 2O8LA 4NWKA 2O8TA 1P2MA 2GVFA 3RXIA 4BAKB 4ZMAH 1ESBA 2ZGXH 1O2TA 2EI7A 1VGCC 2QE7D 2BY7X 3LPRA 1O5CB 2TRMA 1TRYA 1YBWA 1RD3B 5DSFA 4X2WA 3RC6A 3I77A 3S9BA 2BLWA 1NU9A 4ESTE 5HMAA 1WOFA 1O2XA 4MVNA 5JBAS 4Y11E 1ZPCA 3L3TA 5HIZA 3EE7A 2FTLE 3QO6A 3S69A 3CS0A 1EPTB 3LT3A 3RXHA 2C8ZB 2Y7XA 4FUJA 3GCHB 4YM9A 1O2SA 1ZHRA 1FQ3A 5JBCS 1MKXH 1PPGE 1ZGVA 2ZZUH 1QB6A 1VJ9U 2XCNA 3SJ8A 3BIVH 1A0LA 5DP5A 1P2KA 4ZKSU 1HGTH 1S6LA 3TPIZ 1MBMA 5LPEA 3ZZ7A 2L6OA 1GMDF 2PTNA 4IC6A 8ESTE 3SUDA 1KXFA 1PPZA 1WTGH 1BHXB 4MQAA 1A61H 1C5SA 1CT0E 1NC6A 1T4UH 1ZSJA 1ZLRA 4Z6AH 1UCYK 4ZKOU 4M7GA 3SQHE 3T2NA 2Q1JA 2JIZD 2UWPA 3VXFH 2OUAA 3DSGA 4JK5A 4CRBA 3BTKE 3N7DA 2AFQB 4D7FA 2P8OB 1BMMH 2ZTXA 1HUTH 2NU2E 1V2RT 4CR5A 2XBWA 3A7TA 4SGAE 2VU8E 5FCRA 1GJCB 3A7ZA 3JZ2B 1FAKH 2R0KA 5IDKA 1ZTJA 1S0RA 2ZFRH 1XX9A 4WF8A 4KELA 4TT3D 2AMQA 2GX4A 4INLA 4F4OC 1TGBA 1BJUA 4U01A 4WMEA 2LELA 4AFZA 7GCHG 2QIQA 2WPLS 1Q31A 2H6MA 5KGOA 2AH4X 2TPIZ 4NCYA 2H2ZA 3URDA 4FUHA 4KKDA 2ZFQH 1ZHMA 4Y71A 1EJAA 1XM1A 2GV6A 2OK5A 5F8XA 1HAVA 1CGJE 3ATKA 1KXEA 1P2QA 3STIA 1MUEB 1SGRE 2XCFA 2GDEH 2GCTC 4XDEA 4Y7BA 2RA0A 1GI5A 4ABBA 2AS9A 1AVWA 2XXLA 3KN2A 1HRTH 4NG9H 2ESTE 1C4U2 1ELCA 1TA2A 2A7HA 1LKBA 2QF0A 5T6FA 1VZQH 1RTLA 1S83A 2WHXA 3F1SB 3UR9A 4AFQA 1BMNH 4K2YA 1WV7H 1V2JT 3BG4C 3PMHB 1FPCH 2VWMA 5EXLA 2ZPRA 1TX8A 2QV1A 3RXUA 3PO1B 1DANH 3RXTA 1H9HE 5E0GA 3QK1A 4CRAA 1DSTA 1OP2A 2P59A 5F6MA 1GMDG 1BRBE 1EPTA 1C9PA 3RM0H 4BOHA 6CHAC 2J95A 1RFNA 3EDXB 3LGVA 3UNRA 4YESB 3A7WA 2JH5D 3RXGA 4X8SH 6ESTA 1IQNA 1C1SA 2ZQ1A 3N99A 3WY8A 1QHRB 3B9FH 1LVBA 3ZZ9A 2WUBA 1WXRA 3ZZ3A 5C17A 3MO6A 2PKAB 2H5CA 1O30A 3P95A 2VIOA 3TNTA 3MH5A 3BF6H 3PTNA 3B8JA 4GAWA 2A32A 3U69H 2FEQH 4XD7D 5T3HA 4NFEA 1GBCA 3OTPA 4X2VA 2WPHS 3SHCH 3GCOA 4MG3A 1CT4E 3BTWE 3BTQE 4MNYA 3H09A 4FUIA 4A1VA 3F9EA 3RXEA 1E1RD 1C1OA 1BTYA 5JB8S 2HPQH 3SNEA 2LP6A 1X7AC 1QL7A 4Q2KA 1HAOH 2FOCA 1HIAA 1VITH 1Z8GA 2ANWA 2PR3A 3UOUA 1HAZB 1CHGA 2FI3E 3FOAA 4KTCA 3A8BA 1A3BH 1MBQA 2C4FH 2TGDA 1O33A 2EI6A 5B6LA 1QBNA 3K9XB 1YWUA 1TBRH 2Z9KA 1SI5H 2DUCA 2FLBH 1IQKA 2BXTH 1O31A 4IBLH 2A0QB 4VGCB 3OE7D 1Q3XA 2ODPA 2ZFPH 4X6NA 4ZCNA 2FOFA 5H4IB 3AASA 3K2UA 1YPKH 4DY7B 4I7YH 5AFYH 2R0LA 1TB6H 2ANKH 3PV2A 3SNBA 4AYYB 1CU1A 1S6FA 2BX4A 4XRNA 1QURH 4Y8YA 4YO9A 3MO9A 1LCYA 3PROA 2IN2A 3M5OA 4Y7AA 2PTCE 5L6NH 3HGPA 1GMCF 2G52A 1EAUA 1TGSZ 1V2VT 1GI0A 4FUEA 5FX6A 1ANEA 1W12U 2ZF0H 4CH8B 1BBRH 2BOHB 1AWHB 1GDUA 5HYOA 2Y81A 1NRQH 1XUKA 5FPSA 1AN1E 1NBMD 3NK8A 4GSOA 2W7UA 4BAOB 1PYTD 3MNXA 1HAHH 2GT7A 1TE0A 4YOGA 1E1QD 1MKWH 1AVXA 3TH3H 1HNEE 1T8OA 2A7CA 4D8NA 3TGJE 1VCQA 1TALA 1ELVA 2ZHWH 3GY8A 1IQLA 3AW0A 1K21H 4Q7XA 3UFAA 2ZTYA 1P3CA 1GI3A 4AGKA 1GCDA 4E06H 1HLTH 2WPIS 1SKYE 4NA8A 3ZYEA 3U98H 3OEHD 5C5NA 3K65B 1LHFH 1RIWC 4E7RG 3UR6A 3W1EA 3CNRA 3M37A 1JXPA 3M3VA 4I8JA 3QUMP 1NFWA 2FLRH 1NFYA 1Z6EA 3UWIA 3KHVA 5GIBA 5C2ZA 1OHHD 8GCHF 1YF4A 4YT6H 2FDAA 1TA6A 1CQQA 4ISLA 1BDAA 5PTPA 5GXPA 3U9AH 1A1RA 3CENA 1AMHA 4AOQA 3PMAB 1NROH 2A4OA 2BDIA 2FP7B 1OX1A 1YLDA 3SOSA 1F0UA 3D62A 4ZKNU 4J1YA 1H8HD 1QNJA 3MOCA 4NIXA 3STJA 1TQ7B 4WJG2 4JYTA 4LZ1H 1ZZZA 2HWLB 1C1VH 2F9VA 2XWAA 3ZZ4A 1BMAA 2IPQX 4X6OA 4A7IB 3LDXH 1GJ6A 1NN6A 1AZ8A 2XTTB 4ABAA 1EASA 1CO7E 2ZGHA 3TVJB 5DP6A 1EJNA 3F68H 1O3LA 4UEHH 2SNVA 2Z9GA 1O37A 3Q77A 2R2MB 3QWCH 1GMCG 2PUXB 4I8GA 3RXQA 3SJOA 3BTME 2BD7A 3FZDA 4CBNA 4Y76A 1JRSA 2YMSB 1TPOA 1VJAU 1NPMA 1UTMA 3GY5A 5EXMA 3RXJA 1MKXK 2PKSC 1GDNA 4X1RU 3P92A 2V7QD 4DG4A 4O3TA 1DFPA 3PMBB 7KMEH 1S5SA 1O3BA 4MPWA 4ABIA 1AIXH 1S0QA 4X6PA 3O8BA 1P03A 4YXWD 1KMHB 1RTKA 2PP6A 1ETRH 1MCVA 2G81E 3WWBA 1Y3WA 2FS9A 3BV9B 2NU4E 1TNKA 4F55A 1PPEE 1SHHB 1D4PB 1C2GA 1OPHB 1ZMNA 4DIIH 3BEUA 1HAYB 1QA7A 1YPHE 3MI4A 3U1IB 4ACBA 1GBDA 2D8WA 2FOEA 2ZDLA 1O2VA 3N7OA 3RP2A 2STAE 1C4V2 1P9UA 1GBMA 1DWDH 3M35A 3B23B 1XUIA 1UTJA 5JB9S 1VCWA 2XYAA 4BTUB 4H6TA 4IMZA 4FUBA 5TCAA 2JH0D 1GG6B 1OP0A 3KQCA 1TPAE 2Y80A 1SGNE 2C8XB 2ZEBA 1DVAH 4UDWH 3BG8A 3M5NA 5DKMA 3RXOA 1YPLH 2ZU2A 4LOYH 1BMFD 1GWAA 1YPGH 8GCHG 3MU5A 1RS0A 2ZDAH 1E35B 1SOTA 4RKJB 1SG8B 1PQ8A 3NKKA 5I25A 1D3QB 3UAIC 3CS7A 1AKSB 1C5LH 5HIYA 1V2UT 1GI6A 4NWLA 1MTUA 7ESTE 4MPVA 2BHGA 1SQTA 4ZHLU 1O3AA 3V13A 4BANB 4Y0YE 4J2YB 2BD8A 2H9TH 1MAYA 3PM3A 4FVBA 4JZDH 3U8TH 1DWCH 3VB6A 3NCLA 5GJ4B 4TWWA 1HJ9A 3A85A 1LQEA 3PTBA 4Z0KA 3RXAA 1Z71A 2J92A 4R8TB 2ULLA 1F2SE 3RXLA 3ZVCA 5GDSH 3A8DA 2WPJS 1UTLM 1DX5M 1GI2A 2AERH 4TYDA 5C20A 1P01A 1LTOA 2CHAC 1FPHH 5DO4H 1XMNB 5F53A 1KLJH 2FI4E 5J4SA 2OTVA 2W26A 3RXVA 4GVUA 1XXFA 4CREA 1KSNA 1GJ7B 1MD7A 1UVPA 2KM0A 1CSOE 1MU6B 3M3SA 2BY5X 3E1XB 2OP9A 2ZU5A 1K1NA 2BZAA 1OWIA 3K6YA 1O5BB 3U8RH 1YPEH 1O5DH 1W3CA 2O8UA 1CVWH 1IHSH 4UFEH 1O3JA 2FM2A 3A8AA 2ZHQH 2F43B 3C27B 3V7TA 5AFZH 1BTUA 3A8CA 2VIQA 1C1MA 4X0WU 3LGWA 1F5LA 2ZDKA 2QF3A 3MYWA 2YNAA 5EQQA 4D9QA 3A87A 2F9UA 3MH7A 1O39A 4IN1A 2ZDMA 1XKBC 2OC0A 1IQGA 3SU3A 4ZAEA 4KTSA 1MMJN 1ELEE 3VB7A 1HPGA 1LPGB 1TIOA 5K7RA 2A1DB 1O2NA 3RMMH 4FUFA 1C4Y2 4AYVB 1P2OA 3N7EA 5CHAB 4B76A 1YCPM 2A4QA 1FMGA 2OINA 4INKA 2Y7ZA 1Z6JH 2BDYA 2Z6BD 1MQ6A 5A8ZA 1AUTC 1TMUH 3SV6A 1HAGE 3SU2A 3OAAD 1P11E 3M36A 1P06A 1HJ8A 1T32A 3RU4D 2XW9A 1AVGH 2EY4C 5A0BA 2V0BA 1JRTA 2H1UA 9ESTA 1NU7B 1GCTB 3TJUA 1PJPA 1CGHA 4RT0A 2VINA 3RXSA 4NIYA 1MU8B 1EB1H 4JYVH 2OC1A 4D76A 2EI8A 4WWYA 4AG1A 1H4WA 2H5DA 1GI1A 5JBTA 1Y59T 5JPMH 2SNWA 1FN6A 1OXGA 5EIYA 2BQ6B 3S9CA 3ZVGA 2B0FA 2JETB 1GBAA 1WSSH 5E2OA 1SGPE 1AKSA 1B5GH 4X1SU 3RU4E 1U6QA 1XUHA 1G3BA 3A82A 5TJXA 1AB9B 3S9AA 3VFEA 1W0KD 5FAHA 1BBRK 1EZUC 4YLQH 2WV4A 4ZXXH 2OXSA 3UOPA 1GVZA 1AQ7A 1DLKB 1H9LB 5EQSA 3BTEE 2WSSD 5FBIA 1OSSA 1ZRKA 2J5UA 1C1NA 2VBCA 3PO1C 2FOHA 3KYGA 2PUQH 1V2WT 3GISB 2Z9JA 5DP9A 4NSVA 3RDZA 2SGQE 2BY6X 1O3GA 3M7UA 4I31A 2W3IA 1GBTA 1QZ8A 5EQRA 3AAUA 2OD3B 1SGQE 3F2GA 1SGFA 1O3FA 5C1XA 1GBEA 1K28D 5L2YH 1LHGH 1FY1A 5T1VA 3GYLB 1GI8B 1E34B 5C1UA 2SFAA 3HATH 3TJNA 1ZPZA 1OWEA 1ARCA 4MNWA 2VGCC 2QXJA 2ZU1A 1BTPA 3SUEA 1V2ST 2KCPA 2Z3EA 5HGGA 5ABWA 5A8YA 2J34A 1QQUA 2K8IA 2VWOA 2V35A 2ODQA 2BDGA 4DCDA 1MABB 2XOKD 1NFXA 1VITF 1YKTA 3KIDU 1CA0B 2FWWA 3MWIU 4CR9A 4X8TH 2WYGA 3BTDE 5EODA 3A81A 3GYMA 3DSPA 2GD4B 2P3TB 3IWMA 2NU1E 2XC0A 3UTUH 1D3PB 1N8OC 1O2UA 2VWLA 1J9CH 2VVUA 1V2KT 2GMTB 2BDHA 1EKBB 3S7KB 4AC9A 4TY7A 1L1JA 1TQ0B 1GBFA 4RT1A 1Y5AT 2Y6TA 3BEFB 3RXMA 2P16A 4B2CA 1QL8A 2F9PA 4B1TA 3MU4A 4JZEH 4DURA 1L4ZA 3BTHE 2KX4A 4Z1MD 3H7TA 1XVOA 1UTNA 1V2QT 1AE5A 1SMFE 1J14A 2AGEX 5K0HA 2QY0B 3F9HA 5DP7A 1KXCA 2A31A 2NWNA 2WV9A 4PROA 1UTPA 2EEKA 1UHBB 4HI3A 4K1EA 4Q7ZA 5E8EH 3AVZA 1GJAB 3FP6E 3PLKA 1F5RA 4TY6A 1AFQB 4LK4A 3LIWA 3GY6A 3FO8D 3FVFB 1ZJDA 1EFRD 3GY3A 1QB9A 3RMOH 3ZVBA 3GS9A 4Q63A 5C67A 3OFND 4I86A 1W7GH 1IQHA 3QGJA 2IJD1 1HJAC 1DY8A 1SR5C 3M61U 5IYTA 1C1QA 5DGJA 4DIHH 4RI0A 5L30H 3ZZDA 2FO9A 2RDEA 3SGBE 4GHQA 1SGDE 1MTNB 1FN8A 2AIQA 3Q76A 1F0RA 2LNCA 2ASUB 4AORA 1M9UA 1FDPA 4NA9H 4CBOA 1EB2A 1TMBH 4DT4A 2QGRA 1IAUA 1CT2E 1OWHA 3KQ5A 4YTAA 2AGIX 2D26C 1XUFA 2BZ6H 2UUJB 2J38A 3MQKC 3E0NB 4XE4A 1RXPA 3V0XA 4FU7A 1YPMH 2Z9IA 1VITG 5F03A 1EATA 2OQUA 2XRCA 3O8DA 4YOJA 1P8VC 2AEIH 3MO3A 1TYNA 4ASHA 3TGIE 3TJOA 1C5NH 2HALA 1LVYA 1GJ5H 1H8DH 1LMWB 4K5ZA 3U28C 2ZPSA 1C5MD 1O5EH 1P2NA 4WVPE 4ABFA 1P57B 2VIWA 1V3XA 3F0PA 1P3EA 4ACAA 3QDZB 1K1MA 3SV9A 4ABJA 1P05A 5FPTA 1LDTT 3HK3B 1O5GH 1O2ZA 2YNBA 1SLUB 2ZIQH 1Y5BT 3PRBA 5L2ZH 1W11U 1DUAA 1RRKA 3DSOA 1C1UH 4O3UA 3P8NA 4FUCA 4INHA 3C1KA 3S7HB 1YYY1 5FCKA 3SV8A 2PGQB 4ABGA 1PQ7A 3E16B 3HKIB 4CHAC 2QCYA 3ATIA 1N1LA 3ATWA 2J2UA 5CMXH 3SBKA 1A7SA 1NT1A 3NWUA 2Z9LA 3OY6U 2W7SA 5AVDA 1KLIH 1TPSA 2SGEE 4Y6DA 5A0AE 4WMFA 3T26A 1AGJA 2ZHDA 2IJOB 8KME2 1UHBA 1GGDB 1ZYOA 4NZLA 5A2MH 1NRPH 6GCHF 2ZI2H 5E0HA 1TOCB 2CF8H 4A1XA 1IOEA 3GY2A 4JZFH 1C5QA 1SQAA 3MNSA 3ATMA 1C2LA 1ZR0A 2QC2A 4BXSA 1G36A 1SQOA 1TOMH 2SGPE 5JDUB 3V12A 1SL3A 1AFEH 2Z3CA 2WPDD 4I32A 1Z8JB 1K9OE 3M7TA 2HVXA 2GCTB 6LPRA 4K8BA 2ZGJA 1P09A 1QA0A 1O2PA 3GCTF 5EG4A 4I8HA 2C8YB 2SGAA 2F9NA 4F49A 3S0NA 3ZV9A 3ODFA 1G3CA 1C2FA 3UPEA 1C1PA 1YY3A 7LPRA 3G01A 1W0ZU 4TWYA 3UNSA 1GJ9B 3BG4B 3D23A 4ZROA 1CBWC 2DE8A 4RKOB 4OGYA 4JK6A 1J16A 3RLWH 1KY9A 1H8ED 2ZTZA 3DFLA 4P00A 3PYHA 1W13U 2B9LA 1J17T 2FS8A 2PKAA 5JBBS 2XWBI 3FN8A 1GJ4H 1C5UA 6CHAB 3ZVDA 1DWBH 1ZPBA 3TH2H 3RUOA 3WWFA 1AHTH 1LO6A 2G4TA 2EC9H 4UONA 1TGTA 1DSUA 3JZ1B 1AO5A 1QJ7B 2JJ1D 1QFKH 2ILNA 5A0CA 3DA9B 3RXCA 1IQJA 3TK6A 3KQEA 2G8TA 3TGKE 4YZUA 2RG3A 4CH2B 2BXUH 1EOLA 4WH6A 2AGGX 5KECA 1COWD 1HXFH 1LPZB 3DT0H 2D1JA 2BD2A 1V2TT 3EGKH 1TONA 4CRCA 4DT7B 4FXGH 1YGCH 1P04A 1B0EA 1A0JA 1ELAA 3F2FA 3SU5A 5EOKA 2GZ9A 4NFFA 1SGYE 6GCHG 3ZZAA 3NXPA 2VIPA 3SGQE 2DE9A 2FESH 2B5TB 2JDID 4B73A 1DOJA 4SGBE 2RDLA 1FY4A 2UWOA 1ARBA 2BQWB 5DN6D 1SFQB 4DW2U 1GHAF 1GMHF 1PPHE 1WCZA 5DK1A 3F2HA 1TGNA 1GHBF 1O2IA 2ZWLH 1THPB 2FTMA 2BX3A 1ZSLA 3NPSA 2HLCA 2C93B 3OX7U 3GY4A 4MLFB 1Y3YA 1MTVA 3VGCC 1SLVB 3KL6A 4LZ4B 4ZXYH 1O2RA 2G4UA 1L4DA 1BHXF 1ACBE 3TK5A 2J94A 3ATLA 2GZ8A 2HOBA 5DP3A 3GCTG 1VCPA 3GDVA 4OS2A 1FNIA 1W2KH 2GP9B 4IW4E 1HV7A 2R2WU 1UVSH 4IC5A 3SZEA 2W6ID 2I6SA 1C2MA 2YMSD 1ETSH 5C3NA 2IPHA 2PLXA 3SNCA 2BYAX 1FY8E 5C0UA 3VEQB 1NZQH 3MU8A 4NZQA 2PHBA 2F9BH 2BLVA 1DUEA 1OS8A 2FYQA 2VB0A 3AK5A 4FUDA 2BD5A 1TABE 1Q2WA 1SVPA 2J97A 2HLDD 1TNHA 1V2MT 4THNH 1O3DA 2A2QH 2BY9X 3IG6B 1QRZA 3U1JB 4BAQB 4CRFA 2TGAA 1T4VH 4K69A 1H1BA 3SGAE 4OGXA 3A7XA 3P6ZB 4A1TA 2FOAA 2BDBA 1ANCA 2R9PA 2KCOA 5F8TA 1NRSH 1GBBA 3ZZ5A 2ZFFH 1C2KA 3LGIA 3T29A 2VH6A 5T6GA 2XBVA 3GDUA 1IQEA 1S85A 2VWNA 3DD2H 1QQ4A 2UWLA 4O9VA 4FOUC 4OM9A 4IMQA 3FP7E 5ESTE 1YLNA 2WPMS 1RIWB 1P2JA 5AHGH 1ZGIA 3SV7A 1DM4B 3TK9A 1LKAA 1P2IA 2Y82A 1ZSKA 2ZQ2A 1BTXA 1ZMLA 1BTWA 3RMNH 4H42U 2A2XH 2J4IA 3UQOA 1DXWA 1HAXB 4B2BA 3BIUH 4YLUA 1PQAA 3QGNB 2GCHF 2XBYA 1BBRE 3KGPA 1NS3A 2V6NA 5EW1H 1O3KA 4FUGA 3URCA 1GHAG 1GMHG 1HXEH 1HB0B 1GHBG 1EPTC 2FMJA 3M5MA 1V2LT 3A89A 2BD4A 3PLBA 1K0HA 1TRMA 2P3FH 3GCHC 1TAWA 5C0TA 4YT7H 1C5TA 2HGTH 2YOLA 1G9IE 1DICA 2BQ7B 3SORA 1C2IA 2M5TA 2FOMB 3PWCA 3SNDA 1FZZA 2AIPA 2Q6DA 1OYTH 1BJVA 1C2HA 1TLDA 1YP9A 1OWJA 1GBLA 4ZUHA 3RXDA 3ZVAA 1P0SH 2Z7FE 2GZ7A 2ZKSA 1ORFA 1ZJKA 2G51A 1H8IH 3TH4H 1FI8A 1EZXC 3A7VA 3ZZCA 3FKSD 3F9FA 2PKSB 3MNCA 1EAXA 2VVVA 3FZZA 4Y79A 1LPKB 2P8OC 5HXFA 1NFUA 3GDSA 3R0FA 2CF9H 3SW2B 1O38A 4ISNA 1SLWB 3LKWA 1O3MA 4XSKU 1UCYE 4LXBH 1B0FA 3E91A 2F3CE 1Z8RA 1ID5H 3Q3XA 1WYKA 1IQIA 3PWBA 1BOQA 2ZDVH 1DITH 3UREA 1QBVH 4ISIH 1DS2E 4BXWA 1SSXA 2IOTA 1O2QA 2F83A 1EP5A 1H9IE 2AMDA 1HDTH 1FONA 3AAVA 1LVOA 4FU8A 3HK6B 1FX0B 1LHDH 3ZZ6A 3SN8A 3Q3YA 4RSPA 3SI4H 3T5FH 3SZNA 4NIWA 1YPJH 3TIUA 2ZCLP 2ZCKP 5BPEA 1W0JD 4JYUH 1JIMA 5CE1A 2HPPH 1CE5A 1JBUH 2ODYB 2GJGA 1D6RA 4KP0A 4DJZB 3BEIB 1WTHD 4ISHH 1S82A 3MU0A 1J15A 2GCHG 1SLXB 1GHXH 1ELFA 1G2MA 1O3IA 2GDDA 5E0JA 3EYDA 2V3OH 1IQFA 3EA7A 1AY6H 5A8XA 1O5FH 1FY5A 3MFJA 1LHCH 3MH4A 1LVMA 1ANBA 3TJVA 4Q80A 1FJSA 4GHTA 2J9NA 4OS4A 1RGQA 1C2EA 1GL0E 3VB4A 1MQ5A 4TSFD 1GI4A 1YCPH 5EGMA 4AN7A 1MKWK 4CRGA 3QN7A 5GPIB 5DPAA 2ZDNA 4HZHA 2BD3A 2TGTA 4JZ1A 4AB9A 2UUKB 1HFDA 4DVAU 3W95A 2GT8A 2M2AA 1C9TA 3NRLA 1OP8A 3MTYA 3T27A 1D3TB 5FX5A 3LC3A 3F0OA 1GDQA 4Q7YA 2F4LA 1F7ZA 2CHAB 2ZC9H 4O03A 3DUXH 4NGAH 1PQ5A 3OTJE 1O34A 3A83A 4XBBA 3LH1A 2WPKS 4OS6A 2TBSA 4GUXA 2KCAA 2CN0H 1GHZA 3E90B 4B6FA 1PPBH 1YC0A 1P10A 3A86A 5T6DA 3QX5H 5GCHF 4B6EA 1ZTKA 3EA9A 2P95A 1E38B 5CHBA 2RFKC 1BCUH 4X1PU 1UJ1A 5DP8A 1O2JA 1AE8H 1BITA 1G3EA 1C5YB 1BZXE 1FXYA 2SGDE 5DG6A 4TPYA 2H9EH 4JCNA 4UD9H 3LJJA 5AF9H 4GPGA 4H4FA 1PFXC 4NIVA 1EZSC 1TMTH 3LH3A 3Q3KA 1O32A 5C94A 3LGUA 3AW1A 2QF5A 1VR1H 1TBZH 2BTCE 3E8LA 2PSXA 1O3EA 1PYTC 4VGCC 4WMDA 3ENSB 1THRH 1HIAB 1Z7KA 1O0DH 2CMYA 2OLGA 1AWFH 1QBOA 1O2LA 5C5OA 2EA3A 2QF4A 4OS7A 2FODA 3F9GA 1IHTH 4MPXA 2ZHEH 4K8YA 1A4WH 5DJ7A 3ODDA 1EUFA 2QAAA 1KIGH 1QJ1B 2ZPQA 2EQNA 1QL9A 5EJ1A 1GGDC 1GI7B 2ZCHP 3P8OA 9LPRA 5GNDA 5BRRE 3E0PB 5HM2A 3FP8E 1TX7A 3KQBA 4HTCH 2C90B 1AUJA 1FAXA 2SGFE 1UMAH 1G37A 3P8GA 2A5AA 3LGTA 1UW7A 3U8OH 1WAYB 4WH8A 1O2OA 4WXIA 4ZHAA 2GTBA 3KCGH 2CGAA 3ZYDA 2LPRA 1JOUB 1RTFB 1SB1H 3SU6A 1O2YA 1TPPA 2FI5E 5E2PA 1KXBA 2G5VA 3BN9A 1MAXA 1W7XH 2ZG0H 5ESBA 1D3DB 5I46H 4MNXA 1C5VA 1J8AA 5GWZA 3FFGA 1L1GA 1HAIH 2CXVA 1WUNH 2ALPA 2WV5A 4OS5A 3T25A 3KNXA 3FAOA 2BY8X 1VGCB 1E79D 1EX3A 4MPUA 3ZVFA 5GCHG 3P17H 1TX6A 4AX9H 1NO9H 2KAIB 1V2NT 4M9FA 1C1RA 4BNRA 3CP7A 2Z3DA 4X2YA 1D6WA 1TFXA 2ZO3H 2VJ1A 1ZHPA 3SNAA 4ABHA 2ALVA 1O2HA 3BTFE 1DT2A 1V6DA 2P93A 1XVMA 1NY22 2C8WB 1C5PA 1MTWA 3MNBA 1LHEH 1SGIB 2BVRH 4B71A 2CK3D 1G3DA 2PSYA 3ITIA 4B75A 1GBJA 2P3UB 2ZHFH 1G30B 1YPHC 5LH8A 1QCPA 3EA8A 3EQ0H 1K1JA 3KQDA 4MTBA 3VB5A 3RM2H 1A5HA 1E0FD 2A5IA 3RXRA 3GICB 2STBE 4FETA 3UNQA 1XKAC 2D2DA 1HCGA 1KXDA 4BTTB 2CJIA 2HNTF 4MDSA 2L74A 3L33A 1ABJH 2VGCB 1ESTA 2XBXA 4U2WA 1L1NA 4WXVA 2XC4A 3T28A 1AI8H 3RXFA 4R0IA 1C1TA 4O97A 1DXPA 4BAMB 1GVKB 5F8ZA 3Q00A 3OU0A 2BDCA 3DCLA 1GHWH 2FXRA 1ELDE 2QN5T 2R3UA 3D65E 1KXAA 4XBCA 1GBIA 2YMSC 1SFIA 2K1QA 5EU8A 3ELAH 4Q4LA 1HYLA 2Q6FA 1N8OB 1L2EA 1EP6A 3PV5A 5KEDA 5EW2H 1O3NA 1RJXB 1KYNA 1O3PB 1Y5UT 3UY9A 4DOQA 1B7XB 2WUCA 1EQ9A 3P70B 1T8NA 1E36B 3GCNA 2BDAA 2NU0E 3OEED 2G00A 3A84A 1ELTA 1UTQA 3UB0A 5HM9A 1S81A 2Z94A 1ZRBA 1DY9A 1SBWA 3LC5A 3ZIAD 1ANDA 1T8LA 2ANMH 1NESE 1OWDA 1A3EH 2Y5FA 4X1QU 3T62A 2RA3A 4I8LA 3NZIA 4AZ2B 2VNTA 4AFSA 3LJOA 3LOXA 1FY3A 4DGJA 3SHAH 4Y8ZA 1Z8IB 1GG6C 4K60A 2JJ2D 3O8CA 5FPYA 2BLQA 5A09A 1Z1JA 1QGFA 3H5CB 3VPKA 1DWEH 1NRRH 1MZDA 1ABIH 1HJAB 1BRUP 1C1WH 1TWXB 1K1PA 2WYJA 2QYIA 2A5KA 3R3GB 1P9SA 1L0ZA 4K1SA 2GV7A 1ZTLA 2FPZA 2THFB 2WINI 2KAIA 3IITA 4HGCA 3TITA 4QT8C 3HKJB 4JZIA 4A5TS 1C2JA 3ESTA 3SU4A 3BTTE 1T8MA 2R3YA 1O5AB 1FV9A 1NBME 1DPOA 1KLTA 1TNIA 1TGCA 1WBGB 2FOBA 1QIXB 4X2XA 3SJ9A 3LGYA 1KTTB 1BTHH 3PLPA 1FUJA 5FHTA 1WDIA 1IQMA 1CGIE 1O3CA 1UTOA 3I29A 4JMYA 3F6UH 1BQYA 2BLOA 3TLOA 1Z1IA 1D9IA 1ELBA 2HNTC 3SO3A 1CHOF 2QXGA 2F91A 3O8RA 1SGFG 1C5WB 1UCYH 4TPIZ 5EPNA 1KTSB 1EOJA 1V2OT 2G55A 4CRDA 3UQVA 1SHYA 1YCPK 1G2LA 2J98B 1DDJA 3GY7A 1YM0A 2PGBB 4K3JA 1W0YH 1P02A 3EE0B 1Y3XA 1GL1A 1K1OA 2I6QA 3F3BA 4H6SB 1G32B 3FANA 4AB8A 1TRNA 3KEEA 1SGEE 1EZQA 1TNJA 2C3SA 3WW7A 2ZU3A 2B7DH 3A88A 2VVCA 4ZH8A 1THSH 1XUGA 1BTZA 2OBOA 1F5KU 2A4GA 2FZZA 4WY3A 4NA7A 4ZHMU 2BD9A 1GVLA 4BTIB 3GOVB 1HAPH 1F92A 1O36A 1GJ8B 4UFGH 3RU4T 2ZFSA 4AGJA 4B2AA 4RN6A 1W10U 1O35A 2FX6A 2BVXH 2QXIA 2V3HH 4CHAB 1TNLA 1GI9B 1TBQH 4XOJA 4K1TA 2ZGCA 1EXFA 1OOKB 1VKYA 3I78A 5CHAC 1NTPA 2OBQA 1GBHA 2W3KA 2GKVE 2ZECA 2FOGA 4ZKRU 3KF2A 2K0QA 3K6ZA 1MD8A 1A2CH 3RMLH 1A0HB 1GJBB 1SPJA 3SJKA 4AG2A 1BIOA 5SGAE 2Y5GA 4FVDA 5DP4A 5ETXA 1ESAA 1GCTC 2GGVB 1KDQB 2XNDD 1T31A 4P02A 4BAHB 5TCCA 3RXPA 2FX4A 1C5OH 2OCVB 3SU0A 1A5GH 1QRWA 1EAWA 4UE7H 1SOZA 1GHVH 2P94A 1W14U 4HFPB 4X6MA 2JH6D 2ANYA 1K1LA 2W5EA 3PB1E 3OYPA 1C2DA 4A92A 1OWKA 1ELGA 2KFWA 2QXHA 1MTSA 3SYJA 1BRAA 1UK4A 2FYRA 4U32A 2JETC 2TIOA 3M3TA 4Y10E 1AZZA 1XUJA 2VIDA 1BUIA 3PMJA 2Y5HA 3SV2H 3M5LA 1ZOMA 1CHOG 1P12E 3E3TA 1O2KA 4GLYA 3E6PH 1F0TA 3EAJA 1AB9C 1O2GH 3RLYH 1YLCA 3H7OA 3QLPH 5EXNA 1N6XA 2UUFB 2JKHA 3RXKA 1GJDB 4MNVA 2O8WA 1CBWB 3RC4A 1JIRA 4D9RA 4I33A 3BTGE 2BB4A 1BA8B 4D7GA 2G5NA 3PV4A 2OC7A 4GCHF 1O3HA 3HPTB 3ZV8A 1EJMA 4FU9A 4ASUD 2F9OA 1O2WA 1UVTH 2PW8H 1SGCA 2OC8A 1LQDB 1MZAA 1JWTA 2J98A 3MU1A 1S84A 1S6HA 1MH0A 1QTFA 5FXLA 5LPRA 1PPCE 2AYWA 1GHYH 4XBDA 3QTOH 3SUGA 1UO6A 1K1IA 3DHKH 3MMGA 3VXEH 2HVYB 3DFJA 8LPRA 1Y8TA 1UK3A 5B6OA 1A5IA 3A7YA 5EPYA 3KYFA 2UUYA 1A46H 1QY6A 1DLEA 5FBEA 4E05H 4KTUA 1XXDA 1V2PT 2A45B 5EJZA 1OKXA 2PV9B 5LPFA 2ZU4A 4NSYA 2V3MA 3RC5A 4E7NA 2XC5A 3L6PA 1AU8A 1O3OA 1SC8U 2A7JA 2ZA5A 3LONA 4HG6A 4Y0ZE 5J4QA 1CA0C 1FLEE 1ETTH 2BMGB 1AD8H 4OS1A 3SUFA 1DE7H 2NU3E 4ISOA 2QA9E 2W6JD 2KCYA 1BRCE 2KZ4A 4ABEA 5HKKD 1PPFE 5C1YA 1FIZA 2VIVA 2BVSH 5EJLA 4YOIA 1QRXA 1SGTA 1WQSA 2GMTC 4X8UH 2TGPZ 3VGCB 4IS5A 3MHWU 3A80A 1UTKA 4Y8XA 1MCTA 1QB1A 2VH0A 4UFDH 1T7CA 3TU7H 4X1NU 3SU1A 1WU1A 2KR7A 4IN2A 5JYIA 3HGNA 3VB3A 1Y3UA 4XFQA 5FL7D 3ZVEA 3D49H 3RXBA 3V3MA 1KDQA 3ZZBA 1W8BH 2PFEA 1N6YA 1OYQA 2BM2A 4UFFH 5IK2D 4B74A 1FIWA 3M7QA 3UIRA 3SI3H 3W94A 1EAIA 4AFUA 3QTVH 1Y3VA 4X8VH 5LGOA 3QZRA 1HBTH 2H9HA 2HNTE 3VG8A 1NRNH 1K22H 5CDFE 2OQ5A 3MH6A 2ZNKH 2Q6GA 3UUZA 1WQVH 2PWXA 3BSQA 1AFQC 1C5ZB 4F48B 4I8KA
chains in the Genus database with same CATH topology
1GBKA 4GCHG 4IGDA 1UVUH 2O8MA 2ZGBH 1CA8B 3P8FA 2HRVA 1BMLA 2A4RA 2AMPA 1JMOH 1QJ6B 3NUMA 1K2I1 3TNSA 1HAVB 1UK2A 4U30A 2RCEA 3OY5U 3ZZ8A 3OSYA 3UWJH 5G4BA 2ZP0H 2CV3A 2XNIA 3QZQA 1C5XB 1ZMJA 7GCHF 1UVOA 2B8OH 1O2MA 3SQEE 1BT7A 4A6LA 1E37B 1GPZA 1MTNC 1C5RA 1QR3E 2FIRH 2ZFTA 1F0SA 1NM6A 4ABDA 1INCA 2O9QA 1TNGA 3SJIA 2BOKA 3LU9B 4KGAA 1BB0B 2O8LA 4NWKA 2O8TA 1P2MA 2GVFA 3RXIA 4BAKB 4ZMAH 1ESBA 2ZGXH 1O2TA 2EI7A 1VGCC 2BY7X 3LPRA 1O5CB 2TRMA 1TRYA 1YBWA 1RD3B 4X2WA 3RC6A 3I77A 3S9BA 2BLWA 1NU9A 4ESTE 5HMAA 1WOFA 1O2XA 4MVNA 5JBAS 4Y11E 1ZPCA 3L3TA 2FTLE 3QO6A 3S69A 3CS0A 1EPTB 3LT3A 3RXHA 2C8ZB 2Y7XA 4FUJA 3GCHB 4YM9A 1O2SA 1ZHRA 1FQ3A 5JBCS 1MKXH 1PPGE 1ZGVA 2ZZUH 1QB6A 1VJ9U 2XCNA 3SJ8A 3BIVH 1A0LA 5DP5A 1P2KA 4ZKSU 1HGTH 3TPIZ 1MBMA 5LPEA 3ZZ7A 1GMDF 2PTNA 4IC6A 8ESTE 3SUDA 1KXFA 1PPZA 1WTGH 1BHXB 4MQAA 1A61H 1C5SA 1CT0E 1NC6A 1T4UH 1ZSJA 1ZLRA 4Z6AH 1UCYK 4ZKOU 4M7GA 3SQHE 3T2NA 2Q1JA 2UWPA 3VXFH 2OUAA 4CRBA 4JK5A 3BTKE 2AFQB 4D7FA 2P8OB 1BMMH 2ZTXA 1HUTH 2NU2E 1V2RT 4CR5A 2XBWA 3A7TA 4SGAE 2VU8E 5FCRA 1GJCB 3A7ZA 3JZ2B 1FAKH 2R0KA 5IDKA 1ZTJA 1S0RA 2ZFRH 1XX9A 4WF8A 4KELA 2AMQA 2GX4A 4INLA 4F4OC 1TGBA 1BJUA 4U01A 4WMEA 4AFZA 7GCHG 2QIQA 2WPLS 1Q31A 2H6MA 2AH4X 2TPIZ 4NCYA 2H2ZA 3URDA 4FUHA 4KKDA 2ZFQH 1ZHMA 4Y71A 1EJAA 1XM1A 2GV6A 5F8XA 1HAVA 1CGJE 3ATKA 1KXEA 1P2QA 3STIA 1MUEB 1SGRE 2XCFA 2GDEH 2GCTC 4XDEA 4Y7BA 2RA0A 1GI5A 4ABBA 2AS9A 1AVWA 2XXLA 3KN2A 1HRTH 4NG9H 2ESTE 1C4U2 1ELCA 1TA2A 2A7HA 1LKBA 2QF0A 5T6FA 1VZQH 1RTLA 1S83A 3F1SB 3UR9A 4AFQA 1BMNH 4K2YA 1WV7H 1V2JT 3BG4C 3PMHB 1FPCH 2VWMA 5EXLA 2ZPRA 1TX8A 2QV1A 3RXUA 3PO1B 1DANH 3RXTA 1H9HE 5E0GA 3QK1A 4CRAA 1DSTA 1OP2A 2P59A 5F6MA 1GMDG 1BRBE 1EPTA 1C9PA 3RM0H 4BOHA 6CHAC 2J95A 1RFNA 3EDXB 3LGVA 3UNRA 4YESB 3A7WA 2JH5D 3RXGA 4X8SH 6ESTA 1IQNA 1C1SA 2ZQ1A 3WY8A 1QHRB 3B9FH 1LVBA 3ZZ9A 2WUBA 3ZZ3A 3MO6A 2PKAB 2H5CA 1O30A 3P95A 2VIOA 3TNTA 3MH5A 3BF6H 3PTNA 3B8JA 4GAWA 2A32A 3U69H 2FEQH 5T3HA 4NFEA 1GBCA 4X2VA 2WPHS 3SHCH 3GCOA 4MG3A 1CT4E 3BTWE 3BTQE 4MNYA 4FUIA 4A1VA 3F9EA 3RXEA 1C1OA 1BTYA 5JB8S 2HPQH 3SNEA 1X7AC 1QL7A 4Q2KA 1HAOH 2FOCA 1HIAA 1VITH 1Z8GA 2ANWA 2PR3A 3UOUA 1HAZB 1CHGA 2FI3E 4KTCA 3A8BA 1A3BH 1MBQA 2C4FH 2TGDA 1O33A 2EI6A 1QBNA 3K9XB 1TBRH 2Z9KA 1SI5H 2DUCA 2FLBH 1IQKA 2BXTH 1O31A 4IBLH 2A0QB 4VGCB 1Q3XA 2ODPA 2ZFPH 4X6NA 2FOFA 5H4IB 3AASA 3K2UA 1YPKH 4DY7B 4I7YH 5AFYH 2R0LA 1TB6H 2ANKH 3SNBA 4AYYB 1CU1A 1S6FA 2BX4A 1QURH 4Y8YA 4YO9A 3MO9A 1LCYA 3PROA 2IN2A 3M5OA 4Y7AA 2PTCE 5L6NH 3HGPA 1GMCF 2G52A 1EAUA 1TGSZ 1V2VT 1GI0A 4FUEA 5FX6A 1ANEA 1W12U 2ZF0H 4CH8B 1BBRH 2BOHB 1AWHB 1GDUA 5HYOA 2Y81A 1NRQH 1XUKA 5FPSA 1AN1E 3NK8A 4GSOA 2W7UA 4BAOB 1PYTD 3MNXA 1HAHH 2GT7A 1TE0A 4YOGA 1MKWH 1AVXA 3TH3H 1HNEE 1T8OA 2A7CA 4D8NA 3TGJE 1VCQA 1TALA 1ELVA 2ZHWH 3GY8A 1IQLA 3AW0A 1K21H 4Q7XA 3UFAA 2ZTYA 1P3CA 1GI3A 4AGKA 1GCDA 4E06H 1HLTH 2WPIS 4NA8A 3ZYEA 3U98H 5C5NA 3K65B 1LHFH 1RIWC 4E7RG 3UR6A 3M37A 1JXPA 3M3VA 4I8JA 3QUMP 1NFWA 2FLRH 1NFYA 1Z6EA 3UWIA 3KHVA 5GIBA 5C2ZA 8GCHF 1YF4A 4YT6H 2FDAA 1TA6A 1CQQA 4ISLA 1BDAA 5PTPA 5GXPA 3U9AH 1A1RA 3CENA 1AMHA 4AOQA 3PMAB 1NROH 2A4OA 2BDIA 2FP7B 1OX1A 1YLDA 3SOSA 1F0UA 3D62A 4ZKNU 4J1YA 1QNJA 3MOCA 4NIXA 3STJA 1TQ7B 4WJG2 4JYTA 4LZ1H 1ZZZA 2HWLB 1C1VH 2F9VA 2XWAA 3ZZ4A 1BMAA 4X6OA 4A7IB 3LDXH 1GJ6A 1NN6A 1AZ8A 2XTTB 4ABAA 1EASA 1CO7E 2ZGHA 3TVJB 5DP6A 1EJNA 3F68H 1O3LA 4UEHH 2SNVA 2Z9GA 1O37A 3Q77A 2R2MB 3QWCH 1GMCG 2PUXB 4I8GA 3RXQA 3SJOA 3BTME 2BD7A 3FZDA 4CBNA 4Y76A 1JRSA 1TPOA 1VJAU 1NPMA 1UTMA 3GY5A 5EXMA 3RXJA 1MKXK 2PKSC 1GDNA 4X1RU 3P92A 4DG4A 4O3TA 1DFPA 3PMBB 7KMEH 1S5SA 1O3BA 4MPWA 4ABIA 1AIXH 1S0QA 4X6PA 3O8BA 1P03A 1RTKA 1ETRH 1MCVA 2G81E 1Y3WA 2FS9A 3BV9B 2NU4E 1TNKA 1PPEE 1SHHB 1D4PB 1C2GA 1OPHB 1ZMNA 4DIIH 3BEUA 1HAYB 1QA7A 1YPHE 3MI4A 3U1IB 1GBDA 2D8WA 2FOEA 2ZDLA 1O2VA 3N7OA 3RP2A 2STAE 1C4V2 1P9UA 1GBMA 1DWDH 3M35A 3B23B 1XUIA 1UTJA 5JB9S 1VCWA 2XYAA 4BTUB 4H6TA 4IMZA 4FUBA 5TCAA 2JH0D 1GG6B 1OP0A 3KQCA 1TPAE 2Y80A 1SGNE 2C8XB 2ZEBA 1DVAH 4UDWH 3BG8A 3M5NA 5DKMA 3RXOA 1YPLH 2ZU2A 4LOYH 1GWAA 1YPGH 8GCHG 3MU5A 1RS0A 2ZDAH 1E35B 1SOTA 4RKJB 1SG8B 1PQ8A 3NKKA 5I25A 1D3QB 3CS7A 1AKSB 1C5LH 1V2UT 1GI6A 4NWLA 1MTUA 7ESTE 4MPVA 2BHGA 1SQTA 4ZHLU 1O3AA 3V13A 4BANB 4Y0YE 4J2YB 2BD8A 2H9TH 1MAYA 3PM3A 4FVBA 4JZDH 3U8TH 1DWCH 3VB6A 3NCLA 5GJ4B 4TWWA 1HJ9A 3A85A 1LQEA 3PTBA 4Z0KA 3RXAA 1Z71A 2J92A 4R8TB 2ULLA 1F2SE 3RXLA 3ZVCA 5GDSH 3A8DA 2WPJS 1UTLM 1DX5M 1GI2A 2AERH 4TYDA 5C20A 1P01A 1LTOA 2CHAC 1FPHH 5DO4H 1XMNB 1KLJH 2FI4E 5J4SA 2OTVA 2W26A 3RXVA 4GVUA 1XXFA 4CREA 1KSNA 1GJ7B 1MD7A 1UVPA 1CSOE 1MU6B 3M3SA 2BY5X 3E1XB 2OP9A 2ZU5A 1K1NA 2BZAA 1OWIA 3K6YA 1O5BB 3U8RH 1YPEH 1O5DH 1W3CA 2O8UA 1CVWH 1IHSH 4UFEH 1O3JA 2FM2A 3A8AA 2ZHQH 3C27B 3V7TA 5AFZH 1BTUA 3A8CA 2VIQA 1C1MA 4X0WU 3LGWA 1F5LA 2ZDKA 2QF3A 3MYWA 2YNAA 5EQQA 4D9QA 3A87A 2F9UA 3MH7A 1O39A 4IN1A 2ZDMA 1XKBC 2OC0A 1IQGA 3SU3A 4ZAEA 4KTSA 1MMJN 1ELEE 3VB7A 1HPGA 1LPGB 1TIOA 5K7RA 2A1DB 1O2NA 3RMMH 4FUFA 1C4Y2 4AYVB 1P2OA 4B76A 5CHAB 1YCPM 2A4QA 1FMGA 2OINA 4INKA 2Y7ZA 1Z6JH 2BDYA 2Z6BD 1MQ6A 5A8ZA 1AUTC 1TMUH 3SV6A 1HAGE 3SU2A 1P11E 3M36A 1P06A 1HJ8A 1T32A 3RU4D 2XW9A 1AVGH 5A0BA 2V0BA 1JRTA 2H1UA 9ESTA 1NU7B 1GCTB 3TJUA 1PJPA 1CGHA 2VINA 3RXSA 4NIYA 1MU8B 1EB1H 4JYVH 2OC1A 4D76A 2EI8A 4WWYA 4AG1A 1H4WA 2H5DA 1GI1A 5JBTA 1Y59T 5JPMH 2SNWA 1FN6A 1OXGA 2BQ6B 3S9CA 3ZVGA 2B0FA 2JETB 1GBAA 1WSSH 5E2OA 1SGPE 1AKSA 1B5GH 4X1SU 3RU4E 1U6QA 1XUHA 1G3BA 3A82A 5TJXA 1AB9B 3S9AA 3VFEA 5FAHA 1BBRK 1EZUC 4YLQH 2WV4A 4ZXXH 2OXSA 3UOPA 1GVZA 1AQ7A 1DLKB 1H9LB 5EQSA 3BTEE 5FBIA 1OSSA 1ZRKA 1C1NA 3PO1C 2FOHA 2PUQH 1V2WT 3GISB 2Z9JA 5DP9A 4NSVA 3RDZA 2SGQE 2BY6X 1O3GA 3M7UA 4I31A 2W3IA 1GBTA 5EQRA 3AAUA 2OD3B 1SGQE 1SGFA 1O3FA 5C1XA 1GBEA 1K28D 5L2YH 1LHGH 1FY1A 3GYLB 1GI8B 1E34B 5C1UA 2SFAA 3HATH 3TJNA 1ZPZA 1OWEA 1ARCA 4MNWA 2VGCC 2QXJA 2ZU1A 1BTPA 3SUEA 1V2ST 2Z3EA 5HGGA 5ABWA 5A8YA 2J34A 1QQUA 2VWOA 2V35A 2ODQA 2BDGA 4DCDA 1NFXA 1VITF 1YKTA 3KIDU 1CA0B 2FWWA 3MWIU 4CR9A 4X8TH 2WYGA 3BTDE 5EODA 3A81A 3GYMA 2GD4B 2P3TB 3IWMA 2NU1E 2XC0A 3UTUH 1D3PB 1N8OC 1O2UA 2VWLA 1J9CH 2VVUA 1V2KT 2GMTB 2BDHA 1EKBB 3S7KB 4TY7A 1L1JA 1TQ0B 1GBFA 1Y5AT 2Y6TA 3BEFB 3RXMA 2P16A 4B2CA 1QL8A 2F9PA 4B1TA 3MU4A 4JZEH 4DURA 1L4ZA 3BTHE 3H7TA 1XVOA 1UTNA 1V2QT 1AE5A 1SMFE 1J14A 2AGEX 5K0HA 2QY0B 3F9HA 5DP7A 1KXCA 2A31A 2NWNA 4PROA 1UTPA 2EEKA 1UHBB 4HI3A 4K1EA 4Q7ZA 5E8EH 3AVZA 1GJAB 3FP6E 3PLKA 1F5RA 4TY6A 1AFQB 4LK4A 3LIWA 3GY6A 3FVFB 1ZJDA 3GY3A 1QB9A 3RMOH 3ZVBA 5C67A 1W7GH 1IQHA 3QGJA 1HJAC 1DY8A 1SR5C 3M61U 5IYTA 1C1QA 5DGJA 4DIHH 5L30H 3ZZDA 2FO9A 3SGBE 4GHQA 1SGDE 1MTNB 1FN8A 2AIQA 3Q76A 1F0RA 2LNCA 2ASUB 4AORA 1M9UA 1FDPA 4NA9H 4CBOA 1EB2A 1TMBH 2QGRA 1IAUA 1CT2E 1OWHA 4YTAA 2AGIX 2D26C 1XUFA 2BZ6H 2UUJB 2J38A 3E0NB 4XE4A 1RXPA 3V0XA 4FU7A 1YPMH 2Z9IA 1VITG 5F03A 1EATA 2OQUA 2XRCA 3O8DA 4YOJA 1P8VC 2AEIH 3MO3A 1TYNA 4ASHA 3TGIE 3TJOA 1C5NH 2HALA 1LVYA 1GJ5H 1H8DH 1LMWB 4K5ZA 2ZPSA 1C5MD 1O5EH 1P2NA 4WVPE 4ABFA 1P57B 2VIWA 1V3XA 1P3EA 3QDZB 1K1MA 3SV9A 4ABJA 1P05A 5FPTA 1LDTT 3HK3B 1O5GH 1O2ZA 2YNBA 1SLUB 2ZIQH 1Y5BT 5L2ZH 1W11U 1DUAA 1RRKA 1C1UH 4O3UA 3P8NA 4FUCA 4INHA 3C1KA 3S7HB 1YYY1 5FCKA 3SV8A 2PGQB 4ABGA 1PQ7A 3E16B 3HKIB 4CHAC 2QCYA 3ATIA 1N1LA 3ATWA 2J2UA 5CMXH 3SBKA 1A7SA 1NT1A 3NWUA 2Z9LA 3OY6U 2W7SA 5AVDA 1KLIH 1TPSA 2SGEE 4Y6DA 5A0AE 4WMFA 3T26A 1AGJA 2ZHDA 2IJOB 8KME2 1UHBA 1GGDB 1ZYOA 4NZLA 5A2MH 1NRPH 6GCHF 2ZI2H 5E0HA 1TOCB 2CF8H 4A1XA 1IOEA 3GY2A 4JZFH 1C5QA 1SQAA 3MNSA 3ATMA 1C2LA 1ZR0A 2QC2A 4BXSA 1G36A 1SQOA 1TOMH 2SGPE 5JDUB 3V12A 1SL3A 1AFEH 2Z3CA 4I32A 1Z8JB 1K9OE 3M7TA 2HVXA 2GCTB 6LPRA 4K8BA 2ZGJA 1P09A 1QA0A 1O2PA 3GCTF 5EG4A 4I8HA 2C8YB 2SGAA 2F9NA 4F49A 3S0NA 3ZV9A 3ODFA 1G3CA 1C2FA 3UPEA 1C1PA 7LPRA 3G01A 1W0ZU 4TWYA 3UNSA 1GJ9B 3BG4B 3D23A 4ZROA 1CBWC 2DE8A 4RKOB 4OGYA 4JK6A 1J16A