1YKTA

Trypsin/bpti complex mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDAGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Partially folded bovine pancreatic trypsin inhibitor analogues attain fully native structures when co-crystallized with S195A rat trypsin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords Trypsin II
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yktA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yktA02
4K2YA 3RMMH 3M7TA 1F5RA 2YNBA 1HFDA 3P8FA 1KXBA 5GIBA 1AZ8A 1P0SH 3EDXB 4GVUA 1O2HA 1D3PB 1O5GH 2SGQE 1HLTH 5EPYA 2OCVB 2CF9H 1AFEH 3RC4A 2QC2A 3UIRA 1QBVH 1C5MD 1WV7H 1UTOA 3H7OA 1QL8A 3NUMA 5H4IB 4ZHAA 1W14U 1MAXA 4XBDA 3UR9A 1TE0A 1KXAA 1S6FA 1CA0B 1RXPA 4A1VA 2Z6BD 3U69H 5EXMA 2A5IA 2CJIA 1PPEE 3RU4E 3RXEA 3MO3A 1TNLA 1QNJA 2NU2E 1V2NT 5AVDA 2BD7A 4JZEH 2STAE 2LNCA 2H9TH 3RXIA 3OY5U 1ZMNA 2BB4A 1NU7B 1GBCA 1JRSA 3MU1A 2FESH 5HGGA 1PFXC 1UTQA 2C8WB 2Y81A 4ABIA 3CENA 1MU6B 3HGPA 4GHTA 3MU5A 2PKSB 3MNSA 3SO3A 1EJNA 1GMHG 4BAMB 2VGCB 1BRBE 4ABDA 1MD7A 3RXRA 2BD4A 2OP9A 3T28A 4NGAH 4OS6A 1S6HA 1FY4A 1YM0A 3UWJH 1C5XB 3K9XB 1ELDE 3TPIZ 1O2YA 2FWWA 2ZI2H 1AKSA 2FOMB 1TAWA 3KQCA 3RXOA 4E7NA 3TH3H 3NWUA 2J94A 1V2OT 1FIWA 1ZRKA 1P2KA 1GI1A 1YCPH 7GCHF 2BLVA 3FP6E 4X2XA 1GBTA 1LCYA 1AMHA 3SV2H 4MNVA 4X2WA 1SFQB 3CS7A 4FU9A 4TPIZ 3S7KB 2VVCA 2HRVA 4DURA 1J17T 1MKXK 4LXBH 2Z9IA 3MNBA 3VB4A 1C2MA 1DY8A 2UUKB 1YPKH 4JZDH 2ZGHA 1NRRH 2YNAA 4M7GA 1NO9H 1MD8A 2GV6A 5AFZH 5FX6A 4XFQA 1EATA 5C1XA 1AI8H 3V12A 1OPHB 1V3XA 5EODA 1AE5A 5PTPA 1V2MT 4F4OC 1SQAA 3TGIE 3N7OA 4I8HA 1C4U2 2TGTA 2FI3E 1ETRH 1P2MA 2GDDA 3BG8A 1AWFH 1Z8JB 3BTQE 2C3SA 1GBIA 2FLRH 6LPRA 1MCTA 3R3GB 2V0BA 3SJ8A 1T4VH 4FU7A 3D49H 1TA6A 4TWWA 5SGAE 2ZWLH 2AMPA 4RN6A 1O38A 1QL9A 2JH5D 3EGKH 1GI6A 1HYLA 2GKVE 3GY8A 2ZFRH 4KGAA 1MTUA 2Q6FA 4ISIH 2G4TA 1SPJA 3BIVH 1GL1A 4D7FA 2AIQA 1F0SA 1S5SA 1TPPA 4WMFA 2SGFE 3OU0A 3O8DA 2J2UA 1BRAA 3UNSA 2TPIZ 4IN2A 1HAGE 1QTFA 2ZGBH 3H5CB 4FVBA 5DP8A 6GCHG 4YZUA 4X8UH 3QN7A 3TJNA 3LOXA 1EKBB 2ODQA 1TX8A 3ZVGA 2ZFTA 1DWBH 1TPOA 3S69A 5DP4A 4ZXXH 1W12U 4LK4A 1O5CB 4X8VH 1GMCG 1UHBA 2PLXA 4THNH 5C2ZA 3BG4C 1AWHB 4K3JA 2J92A 1HJ9A 1NPMA 3P17H 7ESTE 1O2ZA 2FTLE 2ZHFH 4BTTB 1WUNH 4Y7AA 2BD3A 1EZXC 2SNVA 1NFYA 1O3OA 2BVSH 1EPTA 1XXFA 2PUXB 4X6MA 1V2JT 2M5TA 3HPTB 3ATWA 5A0CA 1L4DA 2PGBB 2PWXA 1GBBA 3FZZA 2A5KA 3A7ZA 3RXJA 1TQ7B 5EPNA 1TMBH 5K7RA 3URDA 1V2PT 1IQGA 1GBMA 1P2JA 1B0EA 4Y11E 1C5QA 3RXVA 2P94A 5FPTA 5L2YH 2F9NA 4AB9A 2P3FH 2QYIA 1QL7A 4A7IB 1B7XB 1FN6A 2IOTA 1TQ0B 4ASHA 2CGAA 5A0AE 1EXFA 1UVSH 2BTCE 1OYTH 1C2EA 2FDAA 2XXLA 5CHAC 4X1PU 4MNXA 2XBXA 1O2PA 4JK6A 1GJ5H 3SU0A 1TPSA 3ZZ6A 1C2HA 1HJ8A 3LGUA 3UOUA 4XBCA 3D23A 2ZFPH 1PPGE 4CRCA 2HGTH 4D7GA 8ESTE 1YF4A 3GCHB 1YLCA 1O5DH 1PQ8A 2PHBA 1GMDF 1BTWA 1A7SA 2BDGA 3GDSA 4TWYA 4A1XA 3LJJA 3GCHC 1ANBA 2BLOA 1WAYB 1KYNA 1V2VT 1RIWC 5EQSA 3LGTA 4OS7A 4H42U 2GP9B 3HGNA 2O8WA 1KSNA 1PQ5A 1G9IE 1O30A 2EEKA 3K6ZA 1O3KA 3A84A 1DPOA 2PKAA 3GY4A 1FZZA 1BJUA 4Z6AH 3JZ1B 1EOLA 1UO6A 1XM1A 1SB1H 3PO1C 3KEEA 1AIXH 2Y82A 2GZ8A 3NKKA 3RXKA 5LH8A 1BMNH 4DIIH 1Y5UT 1ZR0A 1XUFA 1KXDA 1O3NA 1RRKA 2FODA 1C1UH 4ZAEA 2BDIA 1BT7A 1HXFH 1O3PB 1V2ST 1C5PA 1ZHRA 3LH3A 2PSYA 5L30H 1C1OA 2A32A 5F03A 1GBLA 3TH2H 2A31A 2CXVA 4E06H 1NTPA 1G32B 1HIAA 3E90B 1FNIA 2P95A 4IW4E 2ZU1A 4X6NA 2VNTA 2F9BH 1UHBB 1IAUA 4R0IA 3H7TA 2G8TA 1OWIA 4X0WU 3ZV8A 1W0ZU 3MFJA 1GVZA 1O39A 5C20A 5C1UA 3LGWA 2TBSA 1C9PA 4BNRA 1SGPE 5CE1A 3DHKH 4DCDA 1QJ7B 3SQEE 1XXDA 2VU8E 3SHCH 2D26C 3GCTF 4WH6A 3RUOA 1O2VA 3M5LA 4AGJA 1SOZA 2BD9A 3U1IB 1GWAA 1YYY1 1F0RA 5T6GA 2XCFA 1EX3A 3UPEA 3UQOA 3BTME 4UFDH 1LPKB 2DE9A 1FUJA 4Y6DA 2OLGA 4X2YA 4AG2A 1Z8GA 4B75A 2FI4E 3BEUA 1TYNA 4HTCH 1GPZA 1QCPA 1O2JA 3A88A 5LPEA 3T2NA 2HVXA 4TY7A 1PPHE 1C9TA 2TIOA 2ZHQH 4K60A 1VITH 1TBQH 3BTEE 1O2SA 2ZCKP 3QTVH 1JOUB 2ZDVH 1GBEA 2BZAA 2OXSA 2O8MA 4RSPA 3BTKE 1RS0A 1NC6A 2BY5X 1DDJA 4RKJB 1A5IA 2GX4A 5A2MH 1GI9B 3AAUA 4I8GA 1PPZA 1VGCB 1PYTD 1SGDE 2A4QA 1YPMH 1GMDG 1K9OE 1TGCA 4AFSA 3I78A 4B74A 1LVYA 4DJZB 3PB1E 1CVWH 1D3DB 1EASA 4FUIA 5FBIA 4CREA 1GBHA 2R2MB 3GOVB 1IQNA 1JIRA 1FMGA 1UVUH 3ATKA 1AQ7A 3M37A 1OWDA 1QB6A 4Q7ZA 3HKJB 1ELAA 1THSH 2ZO3H 4ISHH 4AFZA 4MTBA 5TCAA 2AH4X 3HK6B 1Z1JA 1FY1A 3M5MA 2RDLA 1SOTA 5JYIA 1HUTH 3F9FA 4Y8ZA 1EZQA 4FUEA 3BEIB 3I77A 3F9GA 1TX6A 1SGQE 3MMGA 1ABJH 1VJ9U 2FXRA 2J9NA 1TB6H 5DP3A 1XUGA 1G36A 4NSYA 2ZTXA 2B5TB 1ESTA 3PMBB 1GDUA 1NRPH 5TJXA 1AD8H 1O2IA 4JZFH 2YOLA 2CHAB 5EW2H 4GAWA 1HAOH 3KCGH 1GCTB 3DA9B 1WTGH 3BN9A 1TONA 1V2WT 2F3CE 4FUDA 1O3MA 1O2LA 1YCPK 1GMCF 2XC5A 3VB7A 2H9HA 4NG9H 3LDXH 1DM4B 4UD9H 1ARBA 3M7QA 3DFLA 2BY6X 3A7TA 1PPBH 3SJIA 1AVWA 1A46H 2AGGX 2ZNKH 3RXHA 1LQEA 2F9OA 2WPLS 5E2PA 2FP7B 2H5DA 8GCHF 5GJ4B 2ZQ2A 4X8TH 4CH2B 2OINA 2XW9A 1SGFA 3SORA 1J15A 1T7CA 2BD2A 4O3TA 5E0HA 1GG6C 2F9PA 4K5ZA 1ZLRA 4X2VA 4YLUA 3SUEA 3V0XA 3RXMA 1BITA 1ANDA 4AX9H 1CGIE 4OS1A 2ANWA 1ANEA 4A5TS 1JMOH 1Z8RA 1O0DH 2ZC9H 1K22H 4ABAA 1P11E 2ILNA 1GBAA 2NU4E 1C5SA 3PWCA 4Q80A 5G4BA 1NROH 4KELA 2SGDE 2Y5HA 5E0JA 1OP8A 3VEQB 4XBBA 2PW8H 2VIOA 4TYDA 4WY3A 3T26A 1CT0E 3SGBE 4INHA 1UTKA 4KP0A 5HM2A 3P95A 1P3EA 4AGKA 2W7UA 3F6UH 2ZZUH 1AVGH 3LIWA 1O35A 5T3HA 1IHSH 1TOCB 1SG8B 1H9IE 1Z6JH 1QA0A 2A45B 4NZLA 1JXPA 5DP5A 1L0ZA 1GBJA 3SNEA 4FXGH 1O5FH 1FY5A 3U8TH 4KTSA 2C4FH 2QY0B 3QX5H 1GI7B 2QCYA 2KAIA 1K1IA 4UFEH 1A0HB 1ZPZA 3TNTA 2IJOB 1PYTC 5FHTA 2SGPE 1NU9A 2HOBA 1KLTA 2Y6TA 2BOKA 4X8SH 4VGCB 1LPZB 5GPIB 1LVMA 3PLPA 1ANCA 4MVNA 1DANH 1CBWC 1J16A 5A8YA 3BTDE 4JK5A 1P2IA 3L6PA 2VH6A 3MWIU 3ATMA 5EQQA 1S0QA 7GCHG 4MPXA 4JZ1A 3JZ2B 2XC4A 1K1OA 1UVPA 3RC5A 2BDYA 3QLPH 1GCTC 1LKBA 2ALPA 1GI2A 2RA0A 4UFGH 3PMJA 3QGJA 2K1QA 4I8KA 3BV9B 2ZDKA 1WYKA 2RG3A 1IQIA 1T8NA 1GJBB 1TGBA 5A8ZA 3ZVBA 1C5UA 3ZVEA 1HAIH 1GI5A 1HAZB 1TIOA 2CMYA 1Y3XA 4ZHLU 1GMHF 1FDPA 1Y8TA 5EU8A 1QBOA 4XSKU 1CE5A 2ZTZA 1VGCC 7LPRA 1ID5H 2A4RA 2BQ7B 2H9EH 4Y0ZE 1C4V2 3KIDU 2QXJA 1O3DA 2BD5A 1LPGB 1AUTC 1QHRB 3W94A 1RTLA 1ABIH 1FQ3A 4U30A 1D3TB 5L2ZH 3IWMA 1MBMA 1GHXH 3L3TA 1C2GA 1PQ7A 4WXIA 3MH7A 3SV9A 1CQQA 2B9LA 4FUCA 3UFAA 3QUMP 4BTUB 1M9UA 2C90B 4ISOA 3ZZCA 1G3EA 1FI8A 5F6MA 2XBYA 1GJ6A 1L1JA 1QJ6B 1C1PA 2ANKH 2G5VA 3RXQA 2P16A 1C5VA 1HAVA 1HV7A 3FP7E 3Q77A 3MU8A 1QRXA 1BHXB 1ZGVA 1K1NA 1ZTLA 2UUFB 2ZPSA 1BBRE 1FJSA 3ZV9A 4X1NU 1X7AC 3MNXA 1FAKH 1SGRE 2VWOA 5FBEA 1OP2A 3KNXA 3A85A 1ZHPA 1H1BA 3P8OA 4ZKNU 2JH0D 4I8LA 3LJOA 2ESTE 2FOFA 2BY9X 1TBRH 3LC5A 1O31A 2FOAA 1WU1A 1CT2E 3GY7A 3GCNA 2Q6GA 3T29A 1K21H 4OGYA 3E91A 3STIA 2A5AA 1UTNA 1K2I1 4CHAB 1P9SA 2NU1E 4AFQA 1GL0E 1SQTA 1E38B 5EOKA 1DFPA 2GT8A 2BM2A 3LT3A 1ZTKA 1HAPH 5DO4H 1EB1H 3ZZAA 2P93A 1DLEA 2ZDLA 1GHVH 1UTJA 3AVZA 1GJ4H 5JBBS 1IQFA 2P8OC 3ODFA 1ZGIA 4AFUA 1YPEH 1YLDA 5ABWA 2BQWB 5T6DA 4MPWA 4Y76A 2BYAX 2Z3EA 1EPTB 1FPHH 2QV1A 3M35A 3MH6A 1Z1IA 1P01A 2GCTC 1TALA 8LPRA 4HI3A 4NWKA 3RDZA 1P04A 3A7VA 5GCHG 2AEIH 1KIGH 4WWYA 1CA8B 1IHTH 3CS0A 1CHOG 4JCNA 3SW2B 1P09A 4AB8A 1UK4A 2BVXH 4GCHG 4X6OA 4YESB 1LMWB 1EJMA 1AGJA 4CR5A 6ESTA 4ZROA 1N1LA 1EP6A 4NA7A 2FEQH 2ZHEH 4ABJA 2SGEE 2FS9A 4MG3A 1VITF 5DP7A 3A80A 2H5CA 1KXFA 2UUJB 1O2WA 1O3AA 5CHAB 1B5GH 5AF9H 1P03A 1HAXB 3EA9A 2JKHA 1H9LB 3TK6A 4ABGA 1ELTA 4ZMAH 3U8OH 1E34B 3R0FA 4GPGA 2QF0A 1GBDA 1O37A 5EG4A 3SNCA 3RC6A 4DW2U 3OY6U 1C5WB 2WUBA 1Z7KA 3DT0H 1JIMA 2AGEX 5EQRA 1UK2A 4NFEA 3LU9B 2ANMH 2FI5E 4MPUA 4GHQA 3VPKA 3QK1A 1A3EH 1XUJA 2G55A 1BOQA 2V6NA 1BMMH 3M3SA 1H9HE 1FN8A 1F0UA 2D2DA 2Z7FE 3MTYA 1GJ9B 2ZIQH 5JBAS 2BXTH 1Q3XA 4JYUH 3RMNH 5CMXH 1CGJE 3PMAB 2A2XH 4WJG2 4JMYA 1THRH 1YPGH 5EGMA 1O3BA 4UDWH 3RXUA 2FYRA 3UWIA 1ZSJA 1LHFH 1S82A 1BMAA 2A0QB 2XTTB 1QFKH 1DSUA 3U9AH 3SUFA 5HMAA 3SN8A 2QIQA 1K1MA 1ETSH 1GJ7B 1AO5A 1BMLA 3L33A 3FANA 3ITIA 9ESTA 2FO9A 1KXEA 3AW1A 1C2FA 3MYWA 1MU8B 2Y5FA 1BBRH 2EA3A 1FLEE 2JETC 3MNCA 2WV4A 1P05A 2ZGCA 1EQ9A 3PLKA 4DGJA 2BQ6B 2EI8A 1AN1E 1A0JA 3W95A 1SGEE 1V2RT 3E0PB 2VJ1A 2AERH 3EA7A 2OBQA 2ZFQH 1OSSA 4UEHH 2NWNA 3ESTA 4WMDA 1T31A 5GXPA 2FMJA 1LHDH 2Q6DA 1P10A 1HDTH 3U98H 4HFPB 5TCCA 1RTFB 2B8OH 1MBQA 1MKWK 3F9EA 1GG6B 2QXHA 1C5NH 4Q2KA 1VZQH 1FXYA 1AE8H 1T8MA 2J4IA 1RJXB 2VIQA 1HCGA 2Y80A 3RLYH 4MPVA 5AHGH 4AN7A 1UCYH 1AU8A 4DG4A 1UTMA 1C1QA 1A1RA 3ENSB 1K1JA 3RM0H 1QR3E 4NZQA 5F8ZA 1J8AA 3Q3YA 4YT6H 2A1DB 3TNSA 1O32A 3GY5A 2BOHB 2G51A 2XYAA 1NT1A 1CHOF 2ZHWH 1O2TA 1SC8U 2UWPA 1MTWA 3KGPA 2QF3A 5EXNA 2Z9GA 2H1UA 1O2QA 3TGKE 3K2UA 3SUDA 2ZA5A 4B71A 1A5HA 3A7YA 2PKSC 3E1XB 1FV9A 3A8CA 3DUXH 3E6PH 4NIVA 1TOMH 1U6QA 1BTHH 4QT8C 4NA8A 2XWAA 4OS5A 2J38A 2FOEA 2ZCLP 1XMNB 4AYYB 4FUGA 3GICB 2PR3A 3P6ZB 5K0HA 1GHAG 4K1TA 1FY3A 4UE7H 2XCNA 3M5NA 1W13U 4WH8A 1HXEH 1WQSA 2ZGJA 2B0FA 2OUAA 2ZU3A 3ZYEA 1WTHD 3U1JB 4IC5A 3LPRA 4B73A 2HLCA 1YKTA 2G52A 1C1TA 1T32A 4MLFB 1C1RA 2BLWA 4OS2A 5JBCS 1H8IH 4NIYA 1LO6A 1UVTH 4CRFA 2OQUA 1LHGH 2XNIA 2ZP0H 1GJAB 3EYDA 3I29A 2AS9A 2Z3CA 3A83A 2VIVA 3MU4A 3ZZ9A 3B8JA 1QBNA 1GDNA 2AMQA 2AGIX 1L4ZA 1HIAB 3PLBA 1K28D 1YC0A 4Q7XA 1L1NA 1O2NA 1TBZH 1IQHA 1F0TA 1V2KT 1QQUA 3BIUH 3QO6A 3UNQA 3UQVA 1A61H 1O5AB 1A2CH 1SLWB 1VCPA 4GUXA 2FX4A 4DVAU 1OOKB 4WXVA 1SR5C 1UK3A 3C27B 2ZCHP 2BMGB 1O2UA 1SGIB 5T6FA 3GDUA 2GGVB 2XC0A 1BJVA 1CA0C 2GTBA 1PJPA 2TGDA 3SQHE 4YT7H 1GI8B 2J34A 1OX1A 3MOCA 1SLVB 3AASA 2R2WU 3KF2A 1KLIH 1O2GH 1TX7A 2ZFSA 3M61U 4D76A 2G81E 3PTNA 1ZMJA 1YP9A 1G30B 4LOYH 3S9CA 1MUEB 1KLJH 1MTNC 1O2RA 1Y3UA 1JRTA 1O3GA 2XBWA 2AYWA 1MQ5A 3GYMA 3A82A 1D9IA 1QB9A 1DVAH 2VB0A 1NM6A 4GSOA 2HPQH 4TY6A 5JBTA 3ZVCA 3ZZ8A 4VGCC 1C5YB 3UTUH 3FP8E 2H6MA 5JPMH 2OQ5A 2F9VA 2O8LA 4I32A 1GHBG 2GZ9A 1EP5A 1BTPA 2TRMA 1UTPA 1AY6H 1OWHA 3RU4D 1LKAA 1ACBE 4FVDA 2QA9E 2R9PA 1W11U 4NIWA 2ZU4A 1B0FA 1GJDB 3A7WA 4AYVB 4H6SB 2PV9B 2ZU5A 3ZZ7A 1HRTH 2PTNA 1ZYOA 1TNIA 3ZYDA 1VJAU 1A0LA 1BUIA 2FIRH 3RXSA 2P59A 2BLQA 2ODYB 3VGCC 3BTWE 1ETTH 2VGCC 1BZXE 1TRYA 3AAVA 4NA9H 2FOHA 4A92A 1AB9C 1OWKA 1WCZA 5ESBA 2I6SA 5ESTE 3EQ0H 2R0KA 4ZKOU 1ZPBA 3T5FH 5FPYA 5LPRA 1O3EA 4Y71A 5C3NA 2W7SA 3S7HB 4K69A 1Y59T 2Z9JA 3SGQE 3ATIA 2ZDMA 1LTOA 1GJ8B 1ZHMA 1C5LH 4MQAA 1DUEA 2HWLB 4AORA 1GDQA 1OKXA 2P3UB 4PROA 1Y3WA 3OYPA 4O9VA 4D8NA 4YO9A 1C1WH 2BVRH 2WUCA 4MNYA 1TA2A 4AG1A 2VINA 3A81A 3SU1A 1CO7E 2LPRA 1KTTB 4ZHMU 1O3IA 1V2UT 4MDSA 2QAAA 4FUBA 4OGXA 1SGTA 3RXBA 3RXAA 1EPTC 3PV4A 2I6QA 4DT7B 2F91A 3A7XA 2GT7A 3SI3H 2BDCA 1JBUH 3SJ9A 1ELGA 5L6NH 2GMTB 1TLDA 8GCHG 2R0LA 4U2WA 4FUJA 1C1MA 3FFGA 4ABHA 3OX7U 5EXLA 1EOJA 1LDTT 1ZOMA 3A87A 1TWXB 5FXLA 1MTVA 4YOJA 1H8DH 3SV7A 5JB9S 1O5BB 2QXIA 2VIDA 1RGQA 4CHAC 4B76A 2ULLA 3MI4A 1TGSZ 2ZKSA 1GI0A 2UUYA 2QXGA 4WVPE 6CHAC 1W8BH 1W7GH 5LGOA 4IBLH 2VVUA 1SI5H 5FCRA 1BRUP 1NFXA 3MH4A 2FS8A 1KTSB 1DICA 3RXTA 3BTFE 4JZIA 1CGHA 3SJOA 2GD4B 5C5NA 1C4Y2 1DY9A 3BTHE 1IQLA 1O36A 2EI6A 3ZVFA 3TGJE 3V7TA 4BAQB 1WQVH 2W26A 5E2OA 1F92A 4LZ4B 1AB9B 3T62A 1GJCB 1Q2WA 3ATLA 1GGDC 3LH1A 3RP2A 2OC1A 3TH4H 5F8XA 1MTSA 4CH8B 3D62A 2BDBA 2PGQB 2BD8A 5HXFA 1C2KA 1P12E 2PTCE 2ZDAH 4RKOB 2ZQ1A 2ZGXH 4D9QA 2PSXA 2WINI 1XVMA 1C1NA 5DP9A 3SUGA 2GCHF 3M7UA 1NRNH 1LQDB 1XKBC 1SGFG 3PTBA 1EZUC 1INCA 3ZZ5A 4A6LA 1ZJDA 3E0NB 2ZEBA 3MHWU 1N6YA 1JWTA 1SHYA 3NCLA 5A09A 2A7JA 1O2XA 5DG6A 4IMQA 4Y79A 5JB8S 3UY9A 2GCHG 4U01A 1G3DA 1THPB 2P8OB 2WYJA 3KQDA 1P02A 1W3CA 5DKMA 2QN5T 1V2LT 3RXGA 1GI3A 1BHXF 1IQMA 2O9QA 5E8EH 3UUZA 5DJ7A 2O8TA 4SGBE 1GCDA 4FUFA 1C5TA 1MCVA 4FUHA 2CHAC 3BTTE 1PQAA 3O8RA 3A89A 3LGVA 2ANYA 3M5OA 1GHYH 4K1SA 1DWDH 1E36B 1TRNA 1K1LA 3U8RH 1KDQA 1A3BH 5GDSH 3SI4H 2HNTE 2RA3A 5BPEA 4ZUHA 1YPHE 3SU6A 3KQBA 1XKAC 1C2LA 1CT4E 1KY9A 2ZFFH 2SNWA 5C1YA 2FYQA 1E35B 3BG4B 4Z0KA 5FAHA 1UCYK 2C93B 1O2MA 2R3YA 3KHVA 3T25A 1ZSKA 2FOCA 5DGJA 1BTZA 2HNTF 1SLXB 1NESE 4O03A 3S9BA 1G37A 1ORFA 3GCTG 3ZVDA 2Z94A 3BEFB 3RXCA 3VB6A 1O2OA 1QB1A 2NU3E 3UREA 2V3OH 3ZVAA 1LVBA 1DOJA 2IN2A 1Y3YA 4NIXA 1ZSLA 1G3CA 1TGNA 2ZDNA 1OS8A 3E8LA 1O3LA 1ZTJA 3SBKA 5C5OA 2BDHA 1HAYB 2XRCA 1RFNA 1AFQB 4O97A 1TFXA 3GY2A 3IITA 4X1SU 2RCEA 2NU0E 2UWOA 2WPKS 1C1VH 1XUIA 2VWLA 1BDAA 4MNWA 1VCWA 2FOBA 3LGYA 3VB5A 1O2KA 1QRZA 4BXSA 1SGNE 4CBOA 4DY7B 3P8GA 2BY7X 2Z9LA 1GVKB 2ZECA 2C8YB 5JDUB 1Z6EA 3E16B 1N8OB 4U32A 3PYHA 1BA8B 4IGDA 4XOJA 1CSOE 1V2TT 4HZHA 1DWCH 1EAXA 3OTJE 3A86A 4R8TB 1MQ6A 4WF8A 4Y7BA 5E0GA 1IQJA 1ZPCA 3S0NA 4BTIB 1SQOA 1QGFA 3PWBA 3QZRA 2TGAA 1HJAC 1H4WA 1YPLH 3LONA 4J2YB 4CR9A 1QIXB 2O8UA 1MKWH 1SBWA 1SLUB 4KTUA 2XWBI 5FX5A 4ABEA 3QWCH 2WPHS 4LZ1H 3GY6A 3VXFH 4J1YA 3MO9A 2ZHDA 4JYTA 4O3UA 2WPJS 1UVOA 3SZNA 1CBWB 2THFB 1TGTA 2GDEH 4B1TA 5ETXA 1J14A 4I31A 4K8BA 1SL3A 3RLWH 3IG6B 4A1TA 5GWZA 3S9AA 1NFWA 2D1JA 3UOPA 3ELAH 4CBNA 5IDKA 1MH0A 2JH6D 3RU4T 1EAUA 3PO1B 1YGCH 3SJKA 3HK3B 1BCUH 3FVFB 3QGNB 3PROA 2EI7A 1P2NA 5I25A 1O33A 4H4FA 3LGIA 5AFYH 4IN1A 2AIPA 1TMUH 2J95A 4BAHB 3G01A 1GHBF 1XUKA 1S85A 1QQ4A 1TABE 1P3CA 3GY3A 4IS5A 1HAVB 3ODDA 4H6TA 4ABBA 2IPHA 1RIWB 2FOGA 3SNAA 3VGCB 9LPRA 1RTKA 1PPFE 3P8NA 3SNBA 3TJOA 1XX9A 2B7DH 4HGCA 3DFJA 2HNTC 2PUQH 4Y8XA 1Q31A 3A8DA 1FIZA 3TITA 1O5EH 1AVXA 2GV7A 1MKXH 2HALA 2OBOA 1O3FA 3RXLA 2UWLA 2FTMA 2OD3B 4OS4A 5LPFA 3BF6H 1IQKA 1BRCE 3OSYA 3NZIA 1HBTH 1ESBA 3MU0A 1Y3VA 3M3TA 4JYVH 1DSTA 2BX4A 4X6PA 1P8VC 1E0FD 5A0BA 3STJA 3A8AA 1OYQA 2ZF0H 3C1KA 2FZZA 5BRRE 4TPYA 3SV8A 3TJVA 1GBFA 1HAHH 1DXPA 5J4SA 1P2OA 1DWEH 3QTOH 1UTLM 3Q76A 1UMAH 1ZJKA 2ZPRA 3RXDA 3NPSA 1FPCH 1DE7H 1IOEA 4GLYA 3SNDA 2GCTB 1EUFA 1ELVA 5DPAA 4D9RA 1IQEA 1BTXA 4NCYA 5FCKA 1D3QB 6GCHF 2FPZA 3MO6A 1W2KH 2EC9H 3HKIB 1TPAE 1QA7A 4B2AA 5C67A 3T27A 5J4QA 1HJAB 1BB0B 1BTYA 1FY8E 2SFAA 1LHCH 4BOHA 3VXEH 3GYLB 1QURH 3PM3A 1AFQC 1P9UA 1AKSB 3MH5A 1Z71A 4ZKSU 4DOQA 1O34A 1DS2E 2BHGA 2D8WA 5F8TA 2BZ6H 2VIWA 1ESAA 3K6YA 3P70B 4XDEA 2ZPQA 2V35A 3F1SB 2GVFA 1TNJA 1GVLA 1RD3B 2C8XB 3O8BA 1UCYE 1C2JA 1GHAF 1SMFE 1SFIA 3AW0A 2Q1JA 3TU7H 1TRMA 3EE0B 4ESTE 2R3UA 1DLKB 2Y7ZA 3Q3XA 1ELFA 1PPCE 3LKWA 3TK5A 1S0RA 4I33A 3SU5A 2AMDA 1HPGA 1AUJA 3WY8A 1CU1A 4YTAA 4Q7YA 2OC8A 1C2IA 1F5LA 1A5GH 1D4PB 1DXWA 4UONA 1MZAA 2A7CA 4ISNA 3KL6A 1L2EA 1MAYA 2A2QH 2W3IA 2Z3DA 2VWNA 2AFQB 5DP6A 3ZZ3A 4BAKB 2H2ZA 2STBE 1SGCA 2G00A 3ZZ4A 4Y10E 1SVPA 4E7RG 3TK9A 1VCQA 2QGRA 2FLBH 2ODPA 4IMZA 2WYGA 2SGAA 1XVOA 8KME2 1G3BA 2GZ7A 1T4UH 2Z9KA 4CRBA 1ELEE 1GBKA 2WPIS 3V13A 3F9HA 4K1EA 1GHZA 2FX6A 5HYOA 1TNHA 3QDZB 1WOFA 3A8BA 1F5KU 2Y7XA 4WMEA 3K65B 1AHTH 1F2SE 1VR1H 2PKAB 1NFUA 1Z8IB 2DUCA 5DK1A 1SGYE 3ZZDA 3QZQA 4AOQA 2ZTYA 2Y5GA 2PFEA 2A4OA 1TMTH 3RMLH 4ABFA 1P57B 1FAXA 1YPHC 3URCA 2A7HA 4ZXYH 1NRSH 2TGPZ 2WPMS 3V3MA 2CF8H 1MTNB 1S84A 1BBRK 3EA8A 1DUAA 4NFFA 3BSQA 3KN2A 1XUHA 2ASUB 2P3TB 4X1RU 3D65E 1HNEE 2A4GA 3ZZBA 3NXPA 1O3JA 1HB0B 1SHHB 4DIHH 3FAOA 4CRDA 5EW1H 3SGAE 1YBWA 1NY22 3FZDA 4B2BA 1N8OC 3VB3A 1W0YH 4K8YA 3RXPA 4ZH8A 4KTCA 1WSSH 1C1SA 3B9FH 4INKA 4X1QU 3B23B 1OWEA 1WBGB 1EAIA 2W3KA 1YPJH 1C5OH 3RXFA 4INLA 4I7YH 4KKDA 5IYTA 1GI4A 3SOSA 2G5NA 4CRAA 1GGDB 4BAOB 4FU8A 1QRWA 4ISLA 2CN0H 3DD2H 3O8CA 1HGTH 2ALVA 3F68H 4NSVA 2DE8A 2G4UA 2CV3A 3M36A 4SGAE 5B6OA 2JETB 1O3CA 1EB2A 3E3TA 1LVOA 3NK8A 1OWJA 1TNKA 1NZQH 4NWLA 4BXWA 2C8ZB 3TVJB 1QJ1B 1S81A 1DX5M 1N6XA 2VVVA 1V2QT 3UR6A 3SV6A 1W7XH 1Y5BT 1ELBA 3P92A 4YOIA 1EJAA 4Y8YA 1KDQB 1D6WA 1BIOA 2FM2A 1SSXA 4Y0YE 3Q00A 4YLQH 1ZMLA 2F83A 3EAJA 3Q3KA 1DITH 1MMJN 1CHGA 1VITG 5I46H 1NRQH 1AZZA 4I8JA 3M3VA 1V6DA 4F49A 1OP0A 1QY6A 3BTGE 1C5ZB 1ARCA 2BY8X 1C5RA 1W10U 2WV5A 3GDVA 1MZDA 3VFEA 3SU3A 1YCPM 2GMTC 2ZG0H 2VH0A 2V3HH 4GCHF 3RM2H 4YOGA 1E37B 1ELCA 2BXUH 1ZRBA 1Y5AT 4B2CA 5GCHF 1NN6A 3RMOH 3TIUA 4E05H 2KAIB 1P06A 1K1PA 2VWMA 1FONA 2W5EA 3HATH 4BANB 1KXCA 1J9CH 3SHAH 1ZZZA 2BDAA 1BQYA 1C2DA 2OTVA 1EAWA 1TNGA 3CP7A 2HPPH 4ZKRU 3GCOA 3SU2A 3TJUA 1BTUA 3KQEA 4IC6A 3LC3A 4XE4A 5A8XA 2VIPA 6CHAB 5HM9A 1S83A 5FPSA 1D6RA 1EZSC 1O3HA 2F9UA 1P2QA 2ZU2A 7KMEH 1G2MA 2XBVA 1L1GA 1A4WH 1UJ1A 3SU4A 3GISB 2BX3A 4CRGA 4UFFH 1GHWH 3PMHB 4YM9A 1LHEH 1F7ZA 2OC7A 1NS3A 1OXGA 2OC0A 1T8OA 4AZ2B 3UNRA 1G2LA 3TLOA 1T8LA 1DT2A
chains in the Genus database with same CATH superfamily
4K2YA 3RMMH 3M7TA 1F5RA 2YNBA 1HFDA 3P8FA 1KXBA 5GIBA 1AZ8A 1P0SH 3EDXB 4GVUA 1O2HA 1D3PB 1O5GH 2SGQE 1HLTH 5EPYA 2OCVB 2CF9H 1AFEH 3RC4A 2QC2A 3UIRA 1QBVH 1C5MD 1WV7H 1UTOA 3H7OA 1QL8A 3NUMA 5H4IB 4ZHAA 1W14U 1MAXA 4XBDA 3UR9A 1TE0A 1KXAA 1S6FA 1CA0B 1RXPA 4A1VA 2Z6BD 3U69H 5EXMA 2A5IA 2CJIA 1PPEE 1H8ED 3RU4E 3RXEA 3MO3A 1TNLA 1QNJA 2NU2E 1V2NT 5AVDA 2BD7A 4JZEH 2STAE 2LNCA 2H9TH 3RXIA 3OY5U 1ZMNA 2BB4A 1NU7B 1GBCA 1JRSA 3MU1A 2FESH 5HGGA 1PFXC 1UTQA 2C8WB 2Y81A 4ABIA 3CENA 1MU6B 3HGPA 4GHTA 3MU5A 2PKSB 3MNSA 3SO3A 1EJNA 1GMHG 2QF4A 4BAMB 2VGCB 1BRBE 4ABDA 1MD7A 3RXRA 2BD4A 2OP9A 3T28A 4NGAH 4OS6A 1S6HA 1FY4A 1YM0A 3UWJH 1C5XB 5EJZA 2WSSD 3K9XB 1ELDE 3TPIZ 1O2YA 2FWWA 2ZI2H 1AKSA 2FOMB 1TAWA 3KQCA 3RXOA 4E7NA 3TH3H 3NWUA 2J94A 1V2OT 1FIWA 1ZRKA 1P2KA 1GI1A 1YCPH 7GCHF 2BLVA 3FP6E 4X2XA 1GBTA 1LCYA 1SKYE 1AMHA 3SV2H 4MNVA 4X2WA 1SFQB 3CS7A 4FU9A 4TPIZ 3S7KB 2VVCA 2HRVA 4DURA 1J17T 1MKXK 4LXBH 2Z9IA 3MNBA 3VB4A 1C2MA 1DY8A 2UUKB 1YPKH 4JZDH 2ZGHA 1NRRH 2YNAA 3F2HA 1NO9H 4M7GA 1MD8A 2GV6A 5AFZH 5FX6A 4XFQA 1EATA 5C1XA 1AI8H 3V12A 1OPHB 1V3XA 5EODA 5T1VA 1AE5A 2EY4C 5PTPA 1V2MT 4F4OC 1SQAA 3TGIE 3N7OA 4I8HA 1C4U2 2TGTA 2FI3E 1ETRH 1P2MA 2GDDA 4F48B 3BG8A 1AWFH 1Z8JB 3BTQE 2C3SA 1GBIA 2FLRH 6LPRA 1MCTA 3R3GB 2V0BA 3SJ8A 1T4VH 4FU7A 3D49H 1TA6A 4TWWA 5SGAE 2ZWLH 2AMPA 4RN6A 1O38A 1QL9A 2JH5D 3EGKH 1GI6A 1HYLA 2GKVE 3GY8A 2HVYB 2ZFRH 2QE7D 1E1QD 4KGAA 1MTUA 2Q6FA 4ISIH 2G4TA 1SPJA 3BIVH 1GL1A 4D7FA 2AIQA 1F0SA 1S5SA 1TPPA 4WMFA 2SGFE 3OU0A 3O8DA 2J2UA 1BRAA 3UNSA 2TPIZ 4IN2A 1HAGE 1QTFA 2ZGBH 3H5CB 4FVBA 5DP8A 6GCHG 4YZUA 4X8UH 3QN7A 3TJNA 3LOXA 1EKBB 2LP6A 2ODQA 1TX8A 3ZVGA 2ZFTA 1DWBH 1TPOA 3S69A 5DP4A 4ZXXH 1W12U 4LK4A 1O5CB 4X8VH 1GMCG 1UHBA 2PLXA 4THNH 5C2ZA 3BG4C 1AWHB 4K3JA 2J92A 1HJ9A 1NPMA 3P17H 7ESTE 1O2ZA 2FTLE 2ZHFH 4BTTB 1WUNH 4Y7AA 2BD3A 1EZXC 2SNVA 1NFYA 1O3OA 2BVSH 4XRNA 1EPTA 1XXFA 2PUXB 4AC9A 4X6MA 1V2JT 2M5TA 3HPTB 3ATWA 5A0CA 1L4DA 1UW7A 2PGBB 2PWXA 1GBBA 5C17A 3FZZA 2A5KA 3A7ZA 3RXJA 1TQ7B 5EPNA 1TMBH 5K7RA 3URDA 1V2PT 1IQGA 1GBMA 2YMSB 1P2JA 1B0EA 4Y11E 1C5QA 3RXVA 2P94A 5FPTA 5L2YH 2F9NA 4AB9A 2P3FH 2QYIA 1QL7A 4A7IB 3AK5A 1B7XB 1FN6A 2IOTA 1TQ0B 4ASHA 2CGAA 5A0AE 1EXFA 1UVSH 2BTCE 1OYTH 1C2EA 2FDAA 2XXLA 5CHAC 4X1PU 4OM9A 4MNXA 2XBXA 1O2PA 4JK6A 1GJ5H 3SU0A 1TPSA 3ZZ6A 1C2HA 1HJ8A 3LGUA 3UOUA 4XBCA 3D23A 2ZFPH 4RT1A 1PPGE 4CRCA 2HGTH 4D7GA 8ESTE 1YF4A 3GCHB 1YLCA 1O5DH 1PQ8A 3ZIAD 2PHBA 1GMDF 1BTWA 1A7SA 2BDGA 3GDSA 4TWYA 4A1XA 3LJJA 3GCHC 1ANBA 2BLOA 1WAYB 1KYNA 1V2VT 1RIWC 5EQSA 3LGTA 4OS7A 4H42U 2GP9B 3HGNA 2O8WA 1KSNA 1PQ5A 1G9IE 1O30A 2EEKA 3K6ZA 1O3KA 3A84A 1DPOA 2PKAA 3GY4A 1FZZA 1BJUA 4Z6AH 3JZ1B 1EOLA 1UO6A 1XM1A 1SB1H 3PO1C 3KEEA 1AIXH 2Y82A 2GZ8A 3NKKA 3RXKA 5LH8A 1BMNH 4DIIH 1Y5UT 1ZR0A 1XUFA 1S6LA 1KXDA 1O3NA 1RRKA 2FODA 1C1UH 4ZAEA 2BDIA 1BT7A 1HXFH 1O3PB 1V2ST 1C5PA 1ZHRA 3LH3A 2PSYA 5L30H 1C1OA 2A32A 5F03A 1GBLA 5EIYA 3TH2H 2A31A 2CXVA 4E06H 1NTPA 1G32B 1HIAA 3E90B 1FNIA 2P95A 4IW4E 2WV9A 2ZU1A 4X6NA 2VNTA 5KECA 5HIYA 2F9BH 1UHBB 2AHME 1IAUA 4R0IA 3H7TA 2G8TA 1OWIA 4X0WU 3ZV8A 1W0ZU 3MFJA 1GVZA 1O39A 5C20A 5C1UA 3LGWA 2TBSA 1C9PA 4BNRA 1SGPE 5CE1A 3DHKH 4DCDA 1QJ7B 3OAAD 3SQEE 1XXDA 2VU8E 3SHCH 2D26C 3GCTF 4WH6A 3RUOA 1O2VA 3M5LA 4AGJA 1SOZA 2BD9A 3U1IB 1GWAA 1YYY1 1F0RA 5T6GA 2XCFA 1EX3A 3UPEA 3UQOA 3BTME 4UFDH 1LPKB 2DE9A 1FUJA 4Y6DA 2OLGA 4X2YA 4AG2A 1Z8GA 4B75A 2FI4E 3BEUA 1TYNA 4HTCH 1GPZA 1QCPA 1O2JA 3A88A 5LPEA 3T2NA 2HVXA 4TY7A 1PPHE 1C9TA 2TIOA 2ZHQH 4K60A 1VITH 1TBQH 3BTEE 2EQNA 1O2SA 2ZCKP 3QTVH 1JOUB 2ZDVH 1GBEA 2BZAA 2OXSA 2O8MA 4RSPA 3BTKE 1RS0A 1NC6A 2BY5X 1DDJA 4RKJB 1A5IA 2GX4A 5A2MH 1GI9B 3AAUA 4I8GA 1PPZA 1VGCB 1PYTD 1SGDE 2WZQA 2A4QA 1YPMH 1GMDG 1K9OE 1TGCA 4I86A 4AFSA 3I78A 4B74A 3DSPA 1LVYA 4DJZB 3PB1E 1CVWH 1D3DB 1EASA 4FUIA 5FBIA 4CREA 1GBHA 2R2MB 3GOVB 1IQNA 1JIRA 1FMGA 1UVUH 3ATKA 1AQ7A 3M37A 1OWDA 1QB6A 4Q7ZA 1W0JD 3HKJB 1ELAA 1THSH 2ZO3H 4ISHH 1COWD 4AFZA 4MTBA 5TCAA 4Q4LA 2AH4X 2J98A 3HK6B 1Z1JA 1FY1A 3M5MA 2RDLA 1SOTA 1YLNA 5JYIA 1HUTH 3F9FA 4Y8ZA 1EZQA 4FUEA 3BEIB 3I77A 3F9GA 1TX6A 1SGQE 3MMGA 1ABJH 1VJ9U 2FXRA 2J9NA 1TB6H 5DP3A 1XUGA 1G36A 4NSYA 2ZTXA 2B5TB 1ESTA 3PMBB 1GDUA 1NRPH 5TJXA 1AD8H 1O2IA 4JZFH 2YOLA 2CHAB 5EW2H 4GAWA 1HAOH 3KCGH 1GCTB 3DA9B 1WTGH 3BN9A 1TONA 1V2WT 2F3CE 4FUDA 1O3MA 1O2LA 1YCPK 1GMCF 2XC5A 3VB7A 2H9HA 4NG9H 3LDXH 1DM4B 4UD9H 1ARBA 3M7QA 3DFLA 2BY6X 3A7TA 1PPBH 3SJIA 1AVWA 1A46H 2AGGX 2ZNKH 3PV2A 3RXHA 1LQEA 2F9OA 2WPLS 5E2PA 2FP7B 2H5DA 8GCHF 5GJ4B 2ZQ2A 4X8TH 4CH2B 2OINA 2XW9A 1SGFA 1MABB 2VBCA 3SORA 1J15A 1T7CA 2BD2A 4O3TA 5E0HA 1GG6C 2F9PA 4K5ZA 1ZLRA 4X2VA 4YLUA 3SUEA 3V0XA 3RXMA 1BITA 1ANDA 4AX9H 1CGIE 4OS1A 2ANWA 1ANEA 4A5TS 1JMOH 1Z8RA 1O0DH 2ZC9H 1K22H 4ABAA 1P11E 2ILNA 1GBAA 2NU4E 1C5SA 3PWCA 4Q80A 5G4BA 1NROH 4KELA 2SGDE 2Y5HA 5E0JA 1OP8A 3GS9A 3VEQB 4XBBA 2PW8H 2VIOA 4TYDA 4WY3A 3T26A 1CT0E 3SGBE 4INHA 1UTKA 4KP0A 5HM2A 3P95A 1P3EA 4AGKA 2W7UA 3F6UH 2ZZUH 1AVGH 3LIWA 1O35A 5T3HA 1IHSH 5DN6D 1TOCB 1SG8B 1H9IE 1Z6JH 1QA0A 2A45B 4NZLA 1JXPA 5DP5A 1L0ZA 1GBJA 3SNEA 4FXGH 1O5FH 1FY5A 3U8TH 4KTSA 2C4FH 2QY0B 3QX5H 1GI7B 2QCYA 2KAIA 1K1IA 4UFEH 1A0HB 1ZPZA 3TNTA 2IJOB 1PYTC 5FHTA 2SGPE 1NU9A 2HOBA 1KLTA 4ACBA 2Y6TA 2BOKA 4X8SH 4VGCB 1LPZB 5GPIB 1LVMA 3PLPA 1ANCA 4MVNA 1DANH 1CBWC 1J16A 5A8YA 3BTDE 4JK5A 1P2IA 3L6PA 2VH6A 3MWIU 3ATMA 5HIZA 5EQQA 1S0QA 7GCHG 4MPXA 4JZ1A 3JZ2B 2XC4A 1K1OA 1UVPA 3RC5A 2BDYA 5F53A 3QLPH 1GCTC 4TT3D 1LKBA 2ALPA 1GI2A 2RA0A 4UFGH 3PMJA 3QGJA 2K1QA 4I8KA 3BV9B 2ZDKA 1WYKA 2RG3A 1IQIA 1T8NA 1GJBB 1TGBA 5A8ZA 3ZVBA 1C5UA 3ZVEA 1HAIH 5IK2D 1GI5A 1HAZB 1TIOA 2CMYA 1Y3XA 4ZHLU 1GMHF 2L74A 1FDPA 1Y8TA 5EU8A 1QBOA 4XSKU 1CE5A 2ZTZA 1VGCC 7LPRA 1ID5H 2A4RA 2BQ7B 2H9EH 4Y0ZE 1C4V2 3KIDU 2QXJA 1O3DA 2BD5A 1LPGB 1AUTC 1QHRB 3W94A 1RTLA 1ABIH 1FQ3A 4U30A 1D3TB 5L2ZH 3IWMA 1MBMA 1GHXH 3L3TA 1C2GA 1PQ7A 4WXIA 3MH7A 3SV9A 1CQQA 2B9LA 4FUCA 3UFAA 3QUMP 4BTUB 1M9UA 2C90B 4ISOA 3ZZCA 1G3EA 1FI8A 5F6MA 2XBYA 1GJ6A 1L1JA 1QJ6B 1C1PA 2ANKH 2G5VA 3RXQA 2P16A 1C5VA 1HAVA 3F0OA 1HV7A 3FP7E 3Q77A 3MU8A 4ZCNA 1QRXA 1BHXB 1ZGVA 1K1NA 1ZTLA 2UUFB 2ZPSA 1BBRE 2RFKC 1FJSA 3ZV9A 4X1NU 1X7AC 3MNXA 1FAKH 1SGRE 2VWOA 5FBEA 1OP2A 3NRLA 3KNXA 3A85A 1ZHPA 1H1BA 3P8OA 4ZKNU 2JH0D 4I8LA 3LJOA 2ESTE 2FOFA 2BY9X 1TBRH 3LC5A 1O31A 2FOAA 5DSFA 1WU1A 1CT2E 3GY7A 3GCNA 2Q6GA 3T29A 1K21H 4OGYA 3E91A 3STIA 2A5AA 1UTNA 1K2I1 4CHAB 1P9SA 2NU1E 4AFQA 1GL0E 1SQTA 1E38B 5EOKA 1DFPA 2PP6A 2GT8A 2BM2A 2V7QD 3LT3A 1ZTKA 1HAPH 5DO4H 1EB1H 3ZZAA 2P93A 1DLEA 2ZDLA 1GHVH 1UTJA 3AVZA 1GJ4H 5JBBS 1IQFA 2P8OC 3ODFA 1ZGIA 3F3BA 1YPEH 4AFUA 1YLDA 5ABWA 2BQWB 5T6DA 4MPWA 4Y76A 2BYAX 2Z3EA 1EPTB 1FPHH 2QV1A 3M35A 3MH6A 1Z1IA 1P01A 2GCTC 5C0UA 1TALA 8LPRA 4HI3A 4NWKA 3RDZA 1P04A 3A7VA 5GCHG 2AEIH 1KIGH 4WWYA 1CA8B 1IHTH 3CS0A 1CHOG 4JCNA 3SW2B 5GNDA 1P09A 4AB8A 1UK4A 4B6EA 2BVXH 4GCHG 4X6OA 4YESB 1LMWB 1EJMA 1AGJA 4CR5A 6ESTA 4ZROA 1QZ8A 1WDIA 1N1LA 1EP6A 4NA7A 2FEQH 2ZHEH 4ABJA 2SGEE 2FS9A 4MG3A 1VITF 5DP7A 3A80A 2H5CA 1KXFA 2UUJB 1O2WA 1O3AA 4RT0A 5CHAB 1B5GH 5AF9H 1P03A 1HAXB 3EA9A 2JKHA 1H9LB 3TK6A 4ABGA 1ELTA 4ZMAH 3U8OH 1E34B 3R0FA 4GPGA 2QF0A 1GBDA 1O37A 2KR7A 5EG4A 3WWFA 3SNCA 3RC6A 4DW2U 3OY6U 1C5WB 2WUBA 1Z7KA 3DT0H 1JIMA 2AGEX 5EQRA 1UK2A 4NFEA 3LU9B 2ANMH 2FI5E 4MPUA 4GHQA 3VPKA 3QK1A 1A3EH 1XUJA 2G55A 1BOQA 2V6NA 1BMMH 3M3SA 1H9HE 1FN8A 1F0UA 2D2DA 2Z7FE 4FOUC 3MTYA 1GJ9B 2ZIQH 5JBAS 2BXTH 1Q3XA 4JYUH 3RMNH 5CMXH 1CGJE 3PMAB 2A2XH 4WJG2 4JMYA 1THRH 1E79D 1YPGH 5EGMA 1O3BA 4UDWH 3RXUA 2FYRA 3UWIA 1ZSJA 1LHFH 1S82A 2IPQX 1BMAA 2A0QB 2XTTB 1QFKH 1DSUA 3U9AH 3SUFA 5HMAA 3SN8A 2QIQA 1K1MA 1ETSH 1GJ7B 3SZEA 1AO5A 1BMLA 3L33A 3FANA 3ITIA 9ESTA 2FO9A 1KXEA 3AW1A 1C2FA 3MYWA 1MU8B 1BBRH 2EA3A 2Y5FA 1FLEE 2JETC 3MNCA 3W1EA 2WV4A 1P05A 2ZGCA 1EQ9A 3PLKA 4DGJA 3MQKC 2BQ6B 2EI8A 1AN1E 1A0JA 3W95A 1SGEE 1SQRA 1V2RT 3E0PB 2VJ1A 2AERH 3EA7A 2OBQA 2ZFQH 1OSSA 4UEHH 2NWNA 3ESTA 4WMDA 1T31A 5GXPA 2FMJA 1LHDH 2Q6DA 1P10A 1HDTH 3U98H 4HFPB 5TCCA 1RTFB 2B8OH 1MBQA 1MKWK 3F9EA 1GG6B 2QXHA 1C5NH 4Q2KA 1VZQH 1FXYA 1AE8H 1T8MA 2J4IA 1RJXB 2VIQA 1HCGA 2Y80A 3RLYH 4MPVA 5AHGH 4AN7A 1H8HD 1UCYH 1AU8A 4DG4A 1UTMA 1C1QA 1A1RA 3ENSB 1K1JA 2YMSD 3RM0H 1QR3E 2JDID 4NZQA 5F8ZA 1J8AA 3Q3YA 4YT6H 2A1DB 3TNSA 1O32A 3GY5A 2BOHB 2G51A 2XYAA 1NT1A 1CHOF 2ZHWH 1O2TA 1SC8U 2UWPA 1MTWA 3KGPA 2QF3A 5EXNA 3DSOA 2Z9GA 2H1UA 3SYJA 1O2QA 3TGKE 3K2UA 3SUDA 2ZA5A 4B71A 1A5HA 3A7YA 2PKSC 3E1XB 3EE7A 1FV9A 3A8CA 3DUXH 3E6PH 4NIVA 1TOMH 1U6QA 1BTHH 4QT8C 4NA8A 2XWAA 2K0QA 4OS5A 5CHBA 2J38A 2FOEA 2ZCLP 1XMNB 4AYYB 4FUGA 3GICB 2PR3A 4F55A 3P6ZB 5K0HA 1GHAG 4K1TA 1FY3A 4UE7H 2XCNA 3M5NA 1W13U 4WH8A 1HXEH 1WQSA 2ZGJA 2B0FA 2OUAA 2ZU3A 5B6LA 3ZYEA 1WTHD 3U1JB 4IC5A 3LPRA 4B73A 2HLCA 2XNDD 1YKTA 2G52A 1C1TA 1T32A 4MLFB 1C1RA 2BLWA 4OS2A 5JBCS 1H8IH 4NIYA 1LO6A 1UVTH 4CRFA 2OQUA 1LHGH 3PV5A 2XNIA 2ZP0H 1GJAB 3EYDA 3I29A 2J98B 2AS9A 2Z3CA 3A83A 2VIVA 3MU4A 3ZZ9A 3B8JA 1QBNA 1GDNA 2AMQA 2AGIX 1L4ZA 1HIAB 3PLBA 1K28D 1YC0A 4Q7XA 1L1NA 1O2NA 1TBZH 1IQHA 1F0TA 1V2KT 1QQUA 3BIUH 3QO6A 3UNQA 3UQVA 1A61H 1O5AB 1A2CH 1SLWB 1VCPA 4GUXA 2FX4A 4DVAU 1OOKB 4WXVA 1SR5C 1UK3A 3C27B 2ZCHP 2BMGB 1O2UA 1SGIB 5T6FA 3GDUA 2GGVB 2XC0A 1BJVA 1CA0C 2GTBA 1PJPA 3U28C 2TGDA 3SQHE 4YT7H 1GI8B 2J34A 2LELA 1OX1A 3MOCA 1SLVB 3AASA 2R2WU 3KF2A 1KLIH 1O2GH 1TX7A 2ZFSA 3M61U 4TSFD 4D76A 2G81E 3PTNA 1ZMJA 1YP9A 3FKSD 1G30B 4LOYH 3S9CA 1MUEB 1KLJH 1MTNC 1O2RA 1Y3UA 1JRTA 1O3GA 2XBWA 2AYWA 1MQ5A 3GYMA 3A82A 1D9IA 1QB9A 1DVAH 3PRDA 2VB0A 1NM6A 4GSOA 4P00A 2HPQH 4TY6A 2K8IA 5JBTA 3ZVCA 3ZZ8A 5FL7D 4VGCC 1C5YB 3UTUH 3FP8E 2H6MA 5JPMH 2OQ5A 2F9VA 2O8LA 4I32A 1GHBG 2GZ9A 1EP5A 1BTPA 2TRMA 1UTPA 1AY6H 1OWHA 3RU4D 1LKAA 2WPDD 1ACBE 4FVDA 2QA9E 2R9PA 1W11U 4NIWA 2ZU4A 1B0FA 1GJDB 3A7WA 4AYVB 4H6SB 2PV9B 4M9FA 2ZU5A 3ZZ7A 1HRTH 2PTNA 1ZYOA 1TNIA 3ZYDA 1VJAU 1A0LA 2QF5A 1BUIA 2FIRH 3RXSA 2P59A 2BLQA 2ODYB 3VGCC 3BTWE 1ETTH 2VGCC 1BZXE 1TRYA 3AAVA 4NA9H 2FOHA 4A92A 1AB9C 1OWKA 2KFWA 1WCZA 2JJ2D 5ESBA 2I6SA 1YY3A 5ESTE 3EQ0H 2J97A 3F2GA 5EJ1A 2R0KA 4ZKOU 1ZPBA 3T5FH 5FPYA 5LPRA 1O3EA 2IJD1 3KYGA 4Y71A 5C3NA 2W7SA 3S7HB 4K69A 1Y59T 2Z9JA 3SGQE 3ATIA 2ZDMA 1LTOA 3WW7A 1GJ8B 1ZHMA 1C5LH 4MQAA 1DUEA 2HWLB 4AORA 1GDQA 1OKXA 2P3UB 1EFRD 4PROA 1Y3WA 3OYPA 4O9VA 4D8NA 4YO9A 1C1WH 2BVRH 2WUCA 4MNYA 1TA2A 4AG1A 2VINA 4B6FA 3A81A 3SU1A 1CO7E 2LPRA 1KTTB 4ZHMU 1O3IA 1V2UT 4MDSA 2QAAA 4FUBA 4OGXA 1SGTA 3RXBA 2V3MA 3RXAA 1EPTC 3PV4A 2I6QA 4DT7B 2F91A 3A7XA 2GT7A 3SI3H 2BDCA 1OHHD 1JBUH 3SJ9A 1ELGA 5L6NH 2GMTB 1TLDA 8GCHG 4YXWD 2R0LA 4U2WA 4FUJA 1C1MA 3FFGA 3N99A 4ABHA 3OX7U 3FO8D 5EXLA 1EOJA 1LDTT 1ZOMA 3A87A 1TWXB 5FXLA 1MTVA 4YOJA 2J5UA 2YMSC 1H8DH 3SV7A 5JB9S 1O5BB 2QXIA 2VIDA 1RGQA 3FN8A 4CHAC 4B76A 2ULLA 3MI4A 1TGSZ 2ZKSA 1GI0A 2UUYA 2QXGA 3OEED 4WVPE 6CHAC 1W8BH 1W7GH 5LGOA 4IBLH 2VVUA 1SI5H 5FCRA 1BRUP 1NFXA 3MH4A 2FS8A 1KTSB 4RI0A 1DICA 3RXTA 3BTFE 4JZIA 1CGHA 3SJOA 2GD4B 5C5NA 2KM0A 1C4Y2 1DY9A 2CK3D 3BTHE 1IQLA 1O36A 2EI6A 1BMFD 3ZVFA 3TGJE 3V7TA 4BAQB 1WQVH 2W26A 5E2OA 1F92A 4LZ4B 1AB9B 3T62A 1GJCB 1Q2WA 3ATLA 1GGDC 3LH1A 3RP2A 2OC1A 3TH4H 5F8XA 1MTSA 4CH8B 3D62A 2BDBA 2PGQB 2BD8A 5HXFA 1C2KA 1P12E 2PTCE 2ZDAH 4RKOB 2ZQ1A 2ZGXH 4D9QA 2PSXA 2WINI 1VKYA 1XVMA 1C1NA 5DP9A 3SUGA 2GCHF 3M7UA 1NRNH 1LQDB 1XKBC 1SGFG 3PTBA 1EZUC 1E1RD 1INCA 3ZZ5A 4A6LA 1ZJDA 3E0NB 2ZEBA 3MHWU 1N6YA 1JWTA 1SHYA 3NCLA 5A09A 2A7JA 1O2XA 5DG6A 4IMQA 4Y79A 5JB8S 3UY9A 2GCHG 4U01A 1G3DA 1THPB 2P8OB 2WYJA 3KQDA 1P02A 1W3CA 5DKMA 2QN5T 5C0TA 1V2LT 3RXGA 1GI3A 1BHXF 1IQMA 2O9QA 5E8EH 3UUZA 4FETA 1WXRA 5DJ7A 1KMHB 2O8TA 4SGBE 1GCDA 3F0PA 2F4LA 4FUFA 1C5TA 1MCVA 4Z1MD 4FUHA 2CHAC 2HLDD 3BTTE 1PQAA 2KX4A 3O8RA 3A89A 3LGVA 2ANYA 3M5OA 1GHYH 4K1SA 1DWDH 1E36B 1TRNA 1K1LA 3U8RH 1KDQA 1A3BH 5GDSH 3SI4H 2HNTE 2RA3A 5BPEA 4ZUHA 1YPHE 3SU6A 3KQBA 1XKAC 1C2LA 1CT4E 1KY9A 2ZFFH 2SNWA 5C1YA 2FYQA 1E35B 1W0KD 3BG4B 4Z0KA 5FAHA 1UCYK 2C93B 2OK5A 1O2MA 2R3YA 2KCPA 3KHVA 3T25A 1ZSKA 2FOCA 5DGJA 1BTZA 2HNTF 1SLXB 1NESE 4O03A 3S9BA 1G37A 1ORFA 3GCTG 3ZVDA 2Z94A 3BEFB 3RXCA 3VB6A 1O2OA 1QB1A 2NU3E 3UREA 2V3OH 3ZVAA 1LVBA 1DOJA 2W6ID 2IN2A 1Y3YA 4NIXA 1ZSLA 1G3CA 1TGNA 2ZDNA 1OS8A 3E8LA 1O3LA 1ZTJA 3SBKA 5C5OA 2BDHA 1HAYB 2XRCA 1RFNA 1AFQB 4O97A 1TFXA 3GY2A 3IITA 4X1SU 2RDEA 3F2FA 2RCEA 2NU0E 2UWOA 2WPKS 1C1VH 1XUIA 2VWLA 1BDAA 4MNWA 1VCWA 2FOBA 3LGYA 3VB5A 1O2KA 1QRZA 4BXSA 1SGNE 4CBOA 4DY7B 3P8GA 2BY7X 2Z9LA 1GVKB 2ZECA 2C8YB 5JDUB 1Z6EA 3E16B 1N8OB 4U32A 3PYHA 1BA8B 4IGDA 4XOJA 3KYFA 1CSOE 1V2TT 4HZHA 1DWCH 1EAXA 3OTJE 3A86A 4R8TB 1MQ6A 4WF8A 4Y7BA 5E0GA 1IQJA 1ZPCA 3S0NA 4BTIB 1SQOA 1QGFA 3PWBA 3QZRA 2TGAA 1HJAC 1H4WA 1YPLH 3LONA 4J2YB 4CR9A 1QIXB 2O8UA 1MKWH 1SBWA 1SLUB 4KTUA 2XWBI 5FX5A 4ABEA 3QWCH 2WPHS 4LZ1H 3GY6A 3VXFH 4J1YA 3MO9A 2ZHDA 4JYTA 4O3UA 2WPJS 1UVOA 3SZNA 1CBWB 2THFB 1TGTA 2GDEH 4B1TA 5ETXA 2L6OA 1J14A 4I31A 4K8BA 1SL3A 3RLWH 3IG6B 4A1TA 5GWZA 2KCYA 3S9AA 1NFWA 2D1JA 3UOPA 3ELAH 4CBNA 5IDKA 1MH0A 2JH6D 3RU4T 1EAUA 3PO1B 1YGCH 3SJKA 3HK3B 1BCUH 3FVFB 3QGNB 3N7EA 3PROA 2EI7A 1P2NA 5I25A 1O33A 4H4FA 3LGIA 5AFYH 4IN1A 2AIPA 1TMUH 2J95A 4BAHB 3G01A 1GHBF 1XUKA 1S85A 1QQ4A 1TABE 1P3CA 3GY3A 4IS5A 1HAVB 3ODDA 4H6TA 4ABBA 2IPHA 1RIWB 2FOGA 3SNAA 3VGCB 9LPRA 1RTKA 1PPFE 3P8NA 3SNBA 3TJOA 1XX9A 2B7DH 4HGCA 3DFJA 2HNTC 2PUQH 4Y8XA 1Q31A 3A8DA 1FIZA 3TITA 1O5EH 1AVXA 2GV7A 1MKXH 2HALA 2OBOA 3FOAA 1O3FA 3RXLA 2UWLA 2FTMA 2OD3B 4OS4A 5LPFA 3BF6H 1IQKA 1BRCE 3OSYA 3NZIA 3N7DA 1HBTH 1ESBA 4HG6A 4Q63A 3MU0A 3H09A 1Y3VA 3M3TA 4JYVH 1DSTA 2BX4A 4X6PA 1P8VC 2XOKD 1E0FD 5A0BA 3STJA 3A8AA 1OYQA 2ZF0H 3C1KA 2FZZA 5BRRE 4TPYA 3SV8A 3TJVA 1GBFA 1HAHH 1DXPA 5J4SA 1P2OA 1DWEH 3QTOH 1UTLM 3Q76A 1UMAH 1ZJKA 2ZPRA 3RXDA 3NPSA 1FPCH 1DE7H 1IOEA 4GLYA 3SNDA 2GCTB 1EUFA 1ELVA 5DPAA 4D9RA 1IQEA 1BTXA 4NCYA 5FCKA 2W6JD 1D3QB 6GCHF 2FPZA 3MO6A 1W2KH 2EC9H 3HKIB 1TPAE 1QA7A 4B2AA 5C67A 3T27A 5J4QA 1HJAB 1BB0B 1BTYA 1FY8E 2SFAA 1LHCH 4BOHA 3VXEH 3GYLB 1QURH 2JJ1D 3PM3A 1AFQC 1P9UA 1AKSB 3MH5A 1Z71A 4ZKSU 4DOQA 1O34A 1DS2E 2BHGA 2D8WA 5F8TA 2BZ6H 2VIWA 1ESAA 3K6YA 3P70B 4XDEA 2ZPQA 4P02A 2V35A 3F1SB 2GVFA 1TNJA 1GVLA 3VG8A 5KGOA 1RD3B 2C8XB 3O8BA 1UCYE 1C2JA 1GHAF 1SMFE 1SFIA 3AW0A 2Q1JA 3TU7H 1TRMA 3EE0B 4ESTE 2R3UA 1DLKB 2Y7ZA 3Q3XA 1ELFA 1PPCE 3LKWA 3TK5A 1S0RA 4I33A 3SU5A 2AMDA 1HPGA 1AUJA 3WY8A 1CU1A 4YTAA 4Q7YA 2OC8A 1C2IA 1F5LA 1A5GH 1D4PB 1DXWA 4UONA 1MZAA 2A7CA 4ISNA 5EJLA 3KL6A 1L2EA 1MAYA 2A2QH 2W3IA 2Z3DA 2KCAA 2VWNA 2AFQB 5DP6A 3ZZ3A 4BAKB 2H2ZA 2STBE 1SGCA 2G00A 3ZZ4A 4Y10E 1SVPA 4E7RG 3TK9A 1VCQA 2QGRA 2FLBH 2ODPA 4IMZA 2WYGA 3UAIC 2SGAA 1XVOA 8KME2 1G3BA 1K0HA 1YWUA 2GZ7A 1T4UH 2Z9KA 4CRBA 1ELEE 1GBKA 3OTPA 2WPIS 2WHXA 3V13A 3F9HA 4K1EA 1GHZA 2FX6A 5HYOA 1TNHA 2F43B 3QDZB 1WOFA 3A8BA 1F5KU 2Y7XA 4WMEA 3K65B 4DT4A 1AHTH 1F2SE 1VR1H 2PKAB 1NFUA 1Z8IB 2M2AA 2DUCA 5DK1A 3DSGA 1SGYE 3ZZDA 3QZQA 2KCOA 4AOQA 2ZTYA 2Y5GA 2PFEA 2A4OA 1TMTH 3RMLH 4ASUD 4ABFA 1P57B 1FAXA 1YPHC 3URCA 2A7HA 4ZXYH 1NRSH 2TGPZ 2WPMS 3V3MA 2CF8H 1MTNB 1S84A 1BBRK 3EA8A 1DUAA 4ACAA 4NFFA 3BSQA 3KN2A 1XUHA 2ASUB 2P3TB 3OEHD 4X1RU 3D65E 5HKKD 1HNEE 2A4GA 3ZZBA 3NXPA 1O3JA 1HB0B 1SHHB 5KEDA 4DIHH 3FAOA 4CRDA 5EW1H 3SGAE 1YBWA 1NY22 3FZDA 4B2BA 1N8OC 3VB3A 1W0YH 4K8YA 3RXPA 1NBMD 4ZH8A 4KTCA 1WSSH 1C1SA 3B9FH 3OFND 4INKA 4X1QU 3B23B 1OWEA 1WBGB 1EAIA 2W3KA 1YPJH 1C5OH 3RXFA 4INLA 4I7YH 4KKDA 5IYTA 1GI4A 3SOSA 3WWBA 2G5NA 4CRAA 1GGDB 4BAOB 4FU8A 1QRWA 4ISLA 2CN0H 3DD2H 3O8CA 1HGTH 2ALVA 3F68H 4NSVA 2DE8A 2G4UA 2CV3A 3M36A 4SGAE 5B6OA 2JETB 1O3CA 1EB2A 3E3TA 1LVOA 3UB0A 3NK8A 1OWJA 1TNKA 5C94A 1NZQH 4NWLA 4BXWA 2C8ZB 3TVJB 1QJ1B 1S81A 1DX5M 1N6XA 2VVVA 1V2QT 3KQ5A 3UR6A 3SV6A 1W7XH 5CDFE 1Y5BT 1ELBA 3P92A 3DCLA 4YOIA 1EJAA 4Y8YA 1KDQB 1D6WA 1BIOA 2FM2A 1SSXA 4Y0YE 3Q00A 4YLQH 1ZMLA 2F83A 3EAJA 3Q3KA 1DITH 1MMJN 1CHGA 1VITG 1NBME 5I46H 1NRQH 1AZZA 4I8JA 3M3VA 1V6DA 4F49A 1FX0B 1OP0A 1QY6A 3BTGE 1C5ZB 1ARCA 2BY8X 1C5RA 1W10U 3PRBA 2WV5A 3GDVA 1MZDA 3VFEA 3SU3A 1YCPM 2GMTC 2ZG0H 2VH0A 2V3HH 4GCHF 3RM2H 4YOGA 1E37B 1ELCA 2BXUH 1ZRBA 1Y5AT 4B2CA 5GCHF 1NN6A 3RMOH 3TIUA 4E05H 2KAIB 1P06A 1K1PA 2GJGA 2VWMA 1FONA 2W5EA 3HATH 3CNRA 4BANB 1KXCA 1J9CH 3SHAH 1ZZZA 2BDAA 1BQYA 1C2DA 2OTVA 1EAWA 2JIZD 1TNGA 3CP7A 2HPPH 4ZKRU 3GCOA 3SU2A 3TJUA 1BTUA 3KQEA 4IC6A 4XD7D 3LC3A 4XE4A 5A8XA 2VIPA 6CHAB 5HM9A 1S83A 5FPSA 1D6RA 1EZSC 1O3HA 2F9UA 1P2QA 2ZU2A 2KZ4A 1G2MA 7KMEH 2XBVA 1L1GA 1A4WH 1UJ1A 3SU4A 3OE7D 3GISB 2BX3A 4CRGA 4UFFH 1GHWH 3PMHB 4YM9A 1LHEH 1F7ZA 2OC7A 1NS3A 1OXGA 2OC0A 1T8OA 4AZ2B 3UNRA 1G2LA 3TLOA 1T8LA 1DT2A
chains in the Genus database with same CATH topology
4K2YA 3RMMH 3M7TA 1F5RA 2YNBA 1HFDA 3P8FA 1KXBA 5GIBA 1AZ8A 1P0SH 3EDXB 4GVUA 1O2HA 1D3PB 1O5GH 2SGQE 1HLTH 5EPYA 2OCVB 2CF9H 1AFEH 3RC4A 2QC2A 3UIRA 1QBVH 1C5MD 1WV7H 1UTOA 3H7OA 1QL8A 3NUMA 5H4IB 4ZHAA 1W14U 1MAXA 4XBDA 3UR9A 1TE0A 1KXAA 1S6FA 1CA0B 1RXPA 4A1VA 2Z6BD 3U69H 5EXMA 2A5IA 2CJIA 1PPEE 3RU4E 3RXEA 3MO3A 1TNLA 1QNJA 2NU2E 1V2NT 5AVDA 2BD7A 4JZEH 2STAE 2LNCA 2H9TH 3RXIA 3OY5U 1ZMNA 2BB4A 1NU7B 1GBCA 1JRSA 3MU1A 2FESH 5HGGA 1PFXC 1UTQA 2C8WB 2Y81A 4ABIA 3CENA 1MU6B 3HGPA 4GHTA 3MU5A 2PKSB 3MNSA 3SO3A 1EJNA 1GMHG 4BAMB 2VGCB 1BRBE 4ABDA 1MD7A 3RXRA 2BD4A 2OP9A 3T28A 4NGAH 4OS6A 1S6HA 1FY4A 1YM0A 3UWJH 1C5XB 3K9XB 1ELDE 3TPIZ 1O2YA 2FWWA 2ZI2H 1AKSA 2FOMB 1TAWA 3KQCA 3RXOA 4E7NA 3TH3H 3NWUA 2J94A 1V2OT 1FIWA 1ZRKA 1P2KA 1GI1A 1YCPH 7GCHF 2BLVA 3FP6E 4X2XA 1GBTA 1LCYA 1AMHA 3SV2H 4MNVA 4X2WA 1SFQB 3CS7A 4FU9A 4TPIZ 3S7KB 2VVCA 2HRVA 4DURA 1J17T 1MKXK 4LXBH 2Z9IA 3MNBA 3VB4A 1C2MA 1DY8A 2UUKB 1YPKH 4JZDH 2ZGHA 1NRRH 2YNAA 4M7GA 1NO9H 1MD8A 2GV6A 5AFZH 5FX6A 4XFQA 1EATA 5C1XA 1AI8H 3V12A 1OPHB 1V3XA 5EODA 1AE5A 5PTPA 1V2MT 4F4OC 1SQAA 3TGIE 3N7OA 4I8HA 1C4U2 2TGTA 2FI3E 1ETRH 1P2MA 2GDDA 3BG8A 1AWFH 1Z8JB 3BTQE 2C3SA 1GBIA 2FLRH 6LPRA 1MCTA 3R3GB 2V0BA 3SJ8A 1T4VH 4FU7A 3D49H 1TA6A 4TWWA 5SGAE 2ZWLH 2AMPA 4RN6A 1O38A 1QL9A 2JH5D 3EGKH 1GI6A 1HYLA 2GKVE 3GY8A 2ZFRH 4KGAA 1MTUA 2Q6FA 4ISIH 2G4TA 1SPJA 3BIVH 1GL1A 4D7FA 2AIQA 1F0SA 1S5SA 1TPPA 4WMFA 2SGFE 3OU0A 3O8DA 2J2UA 1BRAA 3UNSA 2TPIZ 4IN2A 1HAGE 1QTFA 2ZGBH 3H5CB 4FVBA 5DP8A 6GCHG 4YZUA 4X8UH 3QN7A 3TJNA 3LOXA 1EKBB 2ODQA 1TX8A 3ZVGA 2ZFTA 1DWBH 1TPOA 3S69A 5DP4A 4ZXXH 1W12U 4LK4A 1O5CB 4X8VH 1GMCG 1UHBA 2PLXA 4THNH 5C2ZA 3BG4C 1AWHB 4K3JA 2J92A 1HJ9A 1NPMA 3P17H 7ESTE 1O2ZA 2FTLE 2ZHFH 4BTTB 1WUNH 4Y7AA 2BD3A 1EZXC 2SNVA 1NFYA 1O3OA 2BVSH 1EPTA 1XXFA 2PUXB 4X6MA 1V2JT 2M5TA 3HPTB 3ATWA 5A0CA 1L4DA 2PGBB 2PWXA 1GBBA 3FZZA 2A5KA 3A7ZA 3RXJA 1TQ7B 5EPNA 1TMBH 5K7RA 3URDA 1V2PT 1IQGA 1GBMA 1P2JA 1B0EA 4Y11E 1C5QA 3RXVA 2P94A 5FPTA 5L2YH 2F9NA 4AB9A 2P3FH 2QYIA 1QL7A 4A7IB 1B7XB 1FN6A 2IOTA 1TQ0B 4ASHA 2CGAA 5A0AE 1EXFA 1UVSH 2BTCE 1OYTH 1C2EA 2FDAA 2XXLA 5CHAC 4X1PU 4MNXA 2XBXA 1O2PA 4JK6A 1GJ5H 3SU0A 1TPSA 3ZZ6A 1C2HA 1HJ8A 3LGUA 3UOUA 4XBCA 3D23A 2ZFPH 1PPGE 4CRCA 2HGTH 4D7GA 8ESTE 1YF4A 3GCHB 1YLCA 1O5DH 1PQ8A 2PHBA 1GMDF 1BTWA 1A7SA 2BDGA 3GDSA 4TWYA 4A1XA 3LJJA 3GCHC 1ANBA 2BLOA 1WAYB 1KYNA 1V2VT 1RIWC 5EQSA 3LGTA 4OS7A 4H42U 2GP9B 3HGNA 2O8WA 1KSNA 1PQ5A 1G9IE 1O30A 2EEKA 3K6ZA 1O3KA 3A84A 1DPOA 2PKAA 3GY4A 1FZZA 1BJUA 4Z6AH 3JZ1B 1EOLA 1UO6A 1XM1A 1SB1H 3PO1C 3KEEA 1AIXH 2Y82A 2GZ8A 3NKKA 3RXKA 5LH8A 1BMNH 4DIIH 1Y5UT 1ZR0A 1XUFA 1KXDA 1O3NA 1RRKA 2FODA 1C1UH 4ZAEA 2BDIA 1BT7A 1HXFH 1O3PB 1V2ST 1C5PA 1ZHRA 3LH3A 2PSYA 5L30H 1C1OA 2A32A 5F03A 1GBLA 3TH2H 2A31A 2CXVA 4E06H 1NTPA 1G32B 1HIAA 3E90B 1FNIA 2P95A 4IW4E 2ZU1A 4X6NA 2VNTA 2F9BH 1UHBB 1IAUA 4R0IA 3H7TA 2G8TA 1OWIA 4X0WU 3ZV8A 1W0ZU 3MFJA 1GVZA 1O39A 5C20A 5C1UA 3LGWA 2TBSA 1C9PA 4BNRA 1SGPE 5CE1A 3DHKH 4DCDA 1QJ7B 3SQEE 1XXDA 2VU8E 3SHCH 2D26C 3GCTF 4WH6A 3RUOA 1O2VA 3M5LA 4AGJA 1SOZA 2BD9A 3U1IB 1GWAA 1YYY1 1F0RA 5T6GA 2XCFA 1EX3A 3UPEA 3UQOA 3BTME 4UFDH 1LPKB 2DE9A 1FUJA 4Y6DA 2OLGA 4X2YA 4AG2A 1Z8GA 4B75A 2FI4E 3BEUA 1TYNA 4HTCH 1GPZA 1QCPA 1O2JA 3A88A 5LPEA 3T2NA 2HVXA 4TY7A 1PPHE 1C9TA 2TIOA 2ZHQH 4K60A 1VITH 1TBQH 3BTEE 1O2SA 2ZCKP 3QTVH 1JOUB 2ZDVH 1GBEA 2BZAA 2OXSA 2O8MA 4RSPA 3BTKE 1RS0A 1NC6A 2BY5X 1DDJA 4RKJB 1A5IA 2GX4A 5A2MH 1GI9B 3AAUA 4I8GA 1PPZA 1VGCB 1PYTD 1SGDE 2A4QA 1YPMH 1GMDG 1K9OE 1TGCA 4AFSA 3I78A 4B74A 1LVYA 4DJZB 3PB1E 1CVWH 1D3DB 1EASA 4FUIA 5FBIA 4CREA 1GBHA 2R2MB 3GOVB 1IQNA 1JIRA 1FMGA 1UVUH 3ATKA 1AQ7A 3M37A 1OWDA 1QB6A 4Q7ZA 3HKJB 1ELAA 1THSH 2ZO3H 4ISHH 4AFZA 4MTBA 5TCAA 2AH4X 3HK6B 1Z1JA 1FY1A 3M5MA 2RDLA 1SOTA 5JYIA 1HUTH 3F9FA 4Y8ZA 1EZQA 4FUEA 3BEIB 3I77A 3F9GA 1TX6A 1SGQE 3MMGA 1ABJH 1VJ9U 2FXRA 2J9NA 1TB6H 5DP3A 1XUGA 1G36A 4NSYA 2ZTXA 2B5TB 1ESTA 3PMBB 1GDUA 1NRPH 5TJXA 1AD8H 1O2IA 4JZFH 2YOLA 2CHAB 5EW2H 4GAWA 1HAOH 3KCGH 1GCTB 3DA9B 1WTGH 3BN9A 1TONA 1V2WT 2F3CE 4FUDA 1O3MA 1O2LA 1YCPK 1GMCF 2XC5A 3VB7A 2H9HA 4NG9H 3LDXH 1DM4B 4UD9H 1ARBA 3M7QA 3DFLA 2BY6X 3A7TA 1PPBH 3SJIA 1AVWA 1A46H 2AGGX 2ZNKH 3RXHA 1LQEA 2F9OA 2WPLS 5E2PA 2FP7B 2H5DA 8GCHF 5GJ4B 2ZQ2A 4X8TH 4CH2B 2OINA 2XW9A 1SGFA 3SORA 1J15A 1T7CA 2BD2A 4O3TA 5E0HA 1GG6C 2F9PA 4K5ZA 1ZLRA 4X2VA 4YLUA 3SUEA 3V0XA 3RXMA 1BITA 1ANDA 4AX9H 1CGIE 4OS1A 2ANWA 1ANEA 4A5TS 1JMOH 1Z8RA 1O0DH 2ZC9H 1K22H 4ABAA 1P11E 2ILNA 1GBAA 2NU4E 1C5SA 3PWCA 4Q80A 5G4BA 1NROH 4KELA 2SGDE 2Y5HA 5E0JA 1OP8A 3VEQB 4XBBA 2PW8H 2VIOA 4TYDA 4WY3A 3T26A 1CT0E 3SGBE 4INHA 1UTKA 4KP0A 5HM2A 3P95A 1P3EA 4AGKA 2W7UA 3F6UH 2ZZUH 1AVGH 3LIWA 1O35A 5T3HA 1IHSH 1TOCB 1SG8B 1H9IE 1Z6JH 1QA0A 2A45B 4NZLA 1JXPA 5DP5A 1L0ZA 1GBJA 3SNEA 4FXGH 1O5FH 1FY5A 3U8TH 4KTSA 2C4FH 2QY0B 3QX5H 1GI7B 2QCYA 2KAIA 1K1IA 4UFEH 1A0HB 1ZPZA 3TNTA 2IJOB 1PYTC 5FHTA 2SGPE 1NU9A 2HOBA 1KLTA 2Y6TA 2BOKA 4X8SH 4VGCB 1LPZB 5GPIB 1LVMA 3PLPA 1ANCA 4MVNA 1DANH 1CBWC 1J16A 5A8YA 3BTDE 4JK5A 1P2IA 3L6PA 2VH6A 3MWIU 3ATMA 5EQQA 1S0QA 7GCHG 4MPXA 4JZ1A 3JZ2B 2XC4A 1K1OA 1UVPA 3RC5A 2BDYA 3QLPH 1GCTC 1LKBA 2ALPA 1GI2A 2RA0A 4UFGH 3PMJA 3QGJA 2K1QA 4I8KA 3BV9B 2ZDKA 1WYKA 2RG3A 1IQIA 1T8NA 1GJBB 1TGBA 5A8ZA 3ZVBA 1C5UA 3ZVEA 1HAIH 1GI5A 1HAZB 1TIOA 2CMYA 1Y3XA 4ZHLU 1GMHF 1FDPA 1Y8TA 5EU8A 1QBOA 4XSKU 1CE5A 2ZTZA 1VGCC 7LPRA 1ID5H 2A4RA 2BQ7B 2H9EH 4Y0ZE 1C4V2 3KIDU 2QXJA 1O3DA 2BD5A 1LPGB 1AUTC 1QHRB 3W94A 1RTLA 1ABIH 1FQ3A 4U30A 1D3TB 5L2ZH 3IWMA 1MBMA 1GHXH 3L3TA 1C2GA 1PQ7A 4WXIA 3MH7A 3SV9A 1CQQA 2B9LA 4FUCA 3UFAA 3QUMP 4BTUB 1M9UA 2C90B 4ISOA 3ZZCA 1G3EA 1FI8A 5F6MA 2XBYA 1GJ6A 1L1JA 1QJ6B 1C1PA 2ANKH 2G5VA 3RXQA 2P16A 1C5VA 1HAVA 1HV7A 3FP7E 3Q77A 3MU8A 1QRXA 1BHXB 1ZGVA 1K1NA 1ZTLA 2UUFB 2ZPSA 1BBRE 1FJSA 3ZV9A 4X1NU 1X7AC 3MNXA 1FAKH 1SGRE 2VWOA 5FBEA 1OP2A 3KNXA 3A85A 1ZHPA 1H1BA 3P8OA 4ZKNU 2JH0D 4I8LA 3LJOA 2ESTE 2FOFA 2BY9X 1TBRH 3LC5A 1O31A 2FOAA 1WU1A 1CT2E 3GY7A 3GCNA 2Q6GA 3T29A 1K21H 4OGYA 3E91A 3STIA 2A5AA 1UTNA 1K2I1 4CHAB 1P9SA 2NU1E 4AFQA 1GL0E 1SQTA 1E38B 5EOKA 1DFPA 2GT8A 2BM2A 3LT3A 1ZTKA 1HAPH 5DO4H 1EB1H 3ZZAA 2P93A 1DLEA 2ZDLA 1GHVH 1UTJA 3AVZA 1GJ4H 5JBBS 1IQFA 2P8OC 3ODFA 1ZGIA 4AFUA 1YPEH 1YLDA 5ABWA 2BQWB 5T6DA 4MPWA 4Y76A 2BYAX 2Z3EA 1EPTB 1FPHH 2QV1A 3M35A 3MH6A 1Z1IA 1P01A 2GCTC 1TALA 8LPRA 4HI3A 4NWKA 3RDZA 1P04A 3A7VA 5GCHG 2AEIH 1KIGH 4WWYA 1CA8B 1IHTH 3CS0A 1CHOG 4JCNA 3SW2B 1P09A 4AB8A 1UK4A 2BVXH 4GCHG 4X6OA 4YESB 1LMWB 1EJMA 1AGJA 4CR5A 6ESTA 4ZROA 1N1LA 1EP6A 4NA7A 2FEQH 2ZHEH 4ABJA 2SGEE 2FS9A 4MG3A 1VITF 5DP7A 3A80A 2H5CA 1KXFA 2UUJB 1O2WA 1O3AA 5CHAB 1B5GH 5AF9H 1P03A 1HAXB 3EA9A 2JKHA 1H9LB 3TK6A 4ABGA 1ELTA 4ZMAH 3U8OH 1E34B 3R0FA 4GPGA 2QF0A 1GBDA 1O37A 5EG4A 3SNCA 3RC6A 4DW2U 3OY6U 1C5WB 2WUBA 1Z7KA 3DT0H 1JIMA 2AGEX 5EQRA 1UK2A 4NFEA 3LU9B 2ANMH 2FI5E 4MPUA 4GHQA 3VPKA 3QK1A 1A3EH 1XUJA 2G55A 1BOQA 2V6NA 1BMMH 3M3SA 1H9HE 1FN8A 1F0UA 2D2DA 2Z7FE 3MTYA 1GJ9B 2ZIQH 5JBAS 2BXTH 1Q3XA 4JYUH 3RMNH 5CMXH 1CGJE 3PMAB 2A2XH 4WJG2 4JMYA 1THRH 1YPGH 5EGMA 1O3BA 4UDWH 3RXUA 2FYRA 3UWIA 1ZSJA 1LHFH 1S82A 1BMAA 2A0QB 2XTTB 1QFKH 1DSUA 3U9AH 3SUFA 5HMAA 3SN8A 2QIQA 1K1MA 1ETSH 1GJ7B 1AO5A 1BMLA 3L33A 3FANA 3ITIA 9ESTA 2FO9A 1KXEA 3AW1A 1C2FA 3MYWA 1MU8B 2Y5FA 1BBRH 2EA3A 1FLEE 2JETC 3MNCA 2WV4A 1P05A 2ZGCA 1EQ9A 3PLKA 4DGJA 2BQ6B 2EI8A 1AN1E 1A0JA 3W95A 1SGEE 1V2RT 3E0PB 2VJ1A 2AERH 3EA7A 2OBQA 2ZFQH 1OSSA 4UEHH 2NWNA 3ESTA 4WMDA 1T31A 5GXPA 2FMJA 1LHDH 2Q6DA 1P10A 1HDTH 3U98H 4HFPB 5TCCA 1RTFB 2B8OH 1MBQA 1MKWK 3F9EA 1GG6B 2QXHA 1C5NH 4Q2KA 1VZQH 1FXYA 1AE8H 1T8MA 2J4IA 1RJXB 2VIQA 1HCGA 2Y80A 3RLYH 4MPVA 5AHGH 4AN7A 1UCYH 1AU8A 4DG4A 1UTMA 1C1QA 1A1RA 3ENSB 1K1JA 3RM0H 1QR3E 4NZQA 5F8ZA 1J8AA 3Q3YA 4YT6H 2A1DB 3TNSA 1O32A 3GY5A 2BOHB 2G51A 2XYAA 1NT1A 1CHOF 2ZHWH 1O2TA