2EY4C

Crystal structure of a cbf5-nop10-gar1 complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
73
Chain Sequence
b'MKRLGKVLHYAKQGFLIVRTNWVPSLNDRVVDKRLQFVGIVKDVFGPVKMPYVAIKPKVSNPEIYVGEVLYVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable tRNA pseudouridine synthase B
publication title Crystal structure of a Cbf5-Nop10-Gar1 complex and implications in RNA-guided pseudouridylation and dyskeratosis congenita.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/biosynthetic protein
total genus 7
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.230 Mainly Beta Beta Barrel Thrombin, subunit H Probable tRNA pseudouridine synthase domain 2ey4C00
3U28C 3UAIC 2EY4C 2HVYB 2EQNA 3MQKC 2V3MA 2RFKC
chains in the Genus database with same CATH superfamily
5DK1A 1GHYH 3EAJA 1A3EH 2SGAA 3A8BA 2DE8A 1HAOH 1SGIB 5KGOA 4DJZB 5EW1H 4YLUA 1C5QA 1CGIE 3SZEA 3NPSA 4FU9A 4H6TA 2UUYA 1XKBC 1TOCB 4XD7D 4CREA 4BXWA 1DS2E 1YM0A 3SI4H 2TPIZ 1ETSH 2O8MA 3SW2B 1V2UT 1HJAC 2ZFTA 1NY22 1NBMD 2RDLA 2XNDD 4AB9A 2ZDLA 4JZFH 4ESTE 1O38A 1FMGA 2OC8A 3TJVA 4X2VA 3P6ZB 3SJ9A 2CGAA 1O2PA 3M7TA 1FAXA 1UTOA 4ZUHA 2GMTC 4AG1A 3V12A 1SQTA 3Q3KA 4KTCA 1DPOA 4M7GA 1WAYB 4OM9A 1DITH 4IW4E 4UFEH 3Q3XA 3KQEA 4BAQB 2OK5A 3ESTA 1KLJH 1MBMA 3GISB 2ANWA 3ZVBA 1P9UA 1Q2WA 4MPUA 2W3KA 3U8TH 4ZHAA 4DG4A 2ODQA 1J15A 2LPRA 1T8OA 1ZSJA 2YOLA 3PWBA 1HJ9A 3WWFA 2J38A 3M61U 1O2SA 4FUIA 3SHAH 3ZVDA 3ATKA 1Z6JH 2A4RA 1HAGE 2WV4A 4X1SU 4INHA 1ZSLA 5CHAC 1GJBB 2C3SA 1CQQA 2R9PA 1MTWA 3QWCH 2BD5A 4DCDA 1O5CB 1Z8RA 3A86A 1K1NA 2KAIA 1O2KA 1RTFB 1NPMA 1P10A 5FPYA 1JRSA 1TBRH 3DUXH 4MNYA 3U8RH 1TNIA 2JH0D 2VNTA 2GP9B 1IQMA 5CDFE 6LPRA 1MD8A 2ZFRH 1HAZB 4F4OC 2FOMB 2FWWA 4FVDA 3GICB 1V2ST 4K5ZA 1GG6B 1V2WT 2P16A 3ATIA 2Z7FE 3BG8A 1DVAH 1E34B 2WPKS 4J1YA 3BTKE 2OD3B 4NFEA 3S9AA 2WUCA 3PO1C 1J17T 1SGYE 3TITA 2HVXA 3T2NA 1AU8A 3P8FA 1GVKB 4BAHB 2ZHEH 1VCWA 3BIUH 2BZAA 1V2KT 2YNAA 2XWBI 1N8OB 4NA7A 1EX3A 2FI5E 4TPYA 3MH5A 3ZZ6A 3DT0H 3E16B 1CHGA 1N6XA 3BTFE 3UTUH 3ZVAA 3M35A 5EQRA 2XTTB 4FU8A 3RXGA 5HM9A 2ANKH 4K2YA 2AMPA 1QQ4A 3U98H 4Y71A 5DN6D 3SNBA 1IQGA 6CHAB 3CP7A 1IQEA 1PPZA 2VIDA 2EC9H 1SPJA 3UOPA 2QE7D 1OOKB 4WH8A 4ZCNA 2FTLE 1CT4E 2F9NA 3AAVA 1IQFA 1T31A 2JKHA 1O3KA 5EPYA 3UAIC 2BY8X 1MH0A 3K65B 3KYGA 3MFJA 2ZU4A 1C2GA 3BIVH 3QZRA 1SOZA 2GT7A 4Y8YA 4YO9A 1HIAA 4IN2A 4UD9H 3PB1E 1S6FA 5DP7A 4LZ1H 3PMAB 5LPFA 1RS0A 4Q7ZA 1DM4B 4HTCH 1XUJA 2LP6A 3VXFH 4ZHMU 3EDXB 4AZ2B 2VIQA 3SJ8A 2FOCA 1HXEH 2FOFA 2VINA 4WMEA 5GNDA 3SNCA 2ZWLH 1BUIA 1GHVH 3TU7H 2IOTA 1O2VA 1SBWA 3ZV8A 3OEED 2BX3A 1GBBA 2G55A 2RFKC 1O32A 5FBIA 3T25A 2A5KA 4WH6A 3EE0B 2BHGA 1AKSA 2B8OH 1FY8E 2FZZA 1D6RA 1A5GH 1SLVB 4UDWH 2AMDA 1O33A 5T3HA 4ISNA 1B7XB 1MU6B 4D7GA 2QIQA 3ZV9A 4F49A 2JJ1D 4LXBH 5TJXA 4ZKRU 1BRAA 1C4U2 1YPEH 4FUGA 2W7SA 3RXBA 2G4UA 3H7TA 4TT3D 3SU0A 2VGCB 3UPEA 5KECA 2J34A 2XC0A 1C2JA 1MABB 4XE4A 3O8BA 2XRCA 1O3MA 4Y7BA 2BD4A 4ISHH 4AN7A 1BT7A 2VIVA 1HAPH 4OS2A 1O2UA 1AFQC 2JETC 2PTCE 4X2XA 1A46H 1PPGE 2NU3E 1EZXC 2J2UA 3RXQA 5AF9H 1O2WA 2FS9A 2TRMA 5H4IB 1YF4A 4U01A 2F43B 2Z9LA 1V3XA 2ZGBH 1YC0A 2ULLA 1FUJA 1RTKA 5EQQA 4KELA 4ABFA 4XDEA 1WSSH 5FPSA 2QF0A 5DP5A 4UONA 2QCYA 1O5BB 3ATMA 1Z1JA 4WF8A 1BTUA 3G01A 1ZTKA 3KIDU 1OYTH 2FLRH 1A61H 3H5CB 4FVBA 4ZKOU 2NU4E 3E0NB 2QYIA 4IMQA 3DA9B 4DY7B 1H8DH 3SNAA 1Z7KA 1J16A 3RXAA 3R3GB 2BD3A 1O2ZA 2PSYA 1FPHH 3CS0A 3LH3A 2J4IA 3SU5A 2V3OH 2P3FH 1HAVA 2FESH 1RXPA 3N99A 2ZHFH 2FOEA 1O39A 1IAUA 5JBTA 1UVOA 2J98A 1GBLA 2WV9A 3UNQA 1Z6EA 3LPRA 4AX9H 4DIIH 1AE5A 1RJXB 4BAMB 5E0HA 1GBKA 1TNJA 1LPKB 1GBTA 1HGTH 3A8AA 1GMHF 3LGYA 1C5ZB 3MNCA 2ZHQH 3B9FH 1AI8H 2LELA 1JRTA 1Q31A 2QXIA 3A7TA 2WPHS 2QXGA 1MD7A 2HRVA 5HIZA 1TOMH 2A45B 1QIXB 3GCHB 3LOXA 2FOHA 3F9FA 1AO5A 4TY6A 4CRGA 2ZA5A 1ACBE 1OX1A 1SQAA 2FDAA 3NK8A 1OWEA 1HDTH 1C9PA 1BMAA 2JDID 2XYAA 3WY8A 3ELAH 3C27B 2C4FH 2JH6D 2ALVA 2CHAB 4CHAB 1NRNH 3RMOH 1A7SA 3FZZA 3GY3A 1OKXA 5LH8A 1W11U 3KCGH 2HNTF 3M7UA 4FUBA 1LDTT 1Y5AT 1ZPCA 1FV9A 4Y10E 1O5DH 2BLWA 1TRMA 1YCPK 2PKAB 4X1RU 2RA0A 4BTUB 4OS7A 2BY6X 2IPHA 1V2LT 2PTNA 1C1RA 4AYVB 1C5VA 1FAKH 2ZHWH 1CA8B 4CRCA 3GY4A 3SQHE 3ODFA 1BRBE 3RXPA 1FN8A 2Z9JA 4M9FA 1C5XB 1C1QA 3I29A 1GI4A 1EUFA 4Q80A 1O3CA 3BEUA 3MH6A 4NA9H 1ARBA 4D8NA 1C1WH 4Q7XA 3AK5A 1J8AA 1ABIH 3A83A 4JZIA 4ZXXH 4A7IB 4AGKA 1GBDA 3K6YA 1FY3A 1YCPH 1Y3VA 1C2FA 1NN6A 1WCZA 2YMSB 1SOTA 5PTPA 5ETXA 3O8CA 2ZKSA 1COWD 2FS8A 2ZTXA 4AB8A 2WYJA 2KM0A 2XXLA 4H42U 4Y11E 4TWWA 3TJNA 2ZU5A 5AVDA 2UWOA 1LO6A 2AIPA 3UNSA 1MAXA 1ZR0A 4A1VA 2VWNA 4FUJA 4B1TA 2NU0E 3UIRA 1X7AC 3ENSB 4AOQA 4AG2A 3LKWA 3SNEA 1WBGB 3STIA 1QTFA 3MYWA 4TPIZ 3KHVA 1C5WB 4Y0ZE 3LU9B 2ZGHA 2AGIX 2PP6A 3D49H 2TBSA 4ZAEA 4D7FA 2H9HA 4ABDA 1S0QA 1SKYE 1KMHB 2AGGX 3U1IB 1GJDB 1GJ6A 1WQVH 3UQVA 1SG8B 2VVCA 1H8ED 1G3CA 2UWLA 1GBAA 3UREA 4Q4LA 1GHAF 1TLDA 4NFFA 3RU4T 5IDKA 1CA0B 3SU4A 1Y3WA 1L4ZA 1BMNH 1QNJA 2GCHF 4R8TB 1GHXH 1JBUH 5ESBA 1S6LA 2C90B 3HKIB 2ZDKA 2ANMH 1QL8A 5C5NA 5FHTA 2BOKA 2EA3A 3LC5A 3V3MA 4D76A 1BHXB 1UHBA 2RG3A 1SFQB 1MMJN 2QXJA 3IG6B 1E0FD 1AMHA 1DUAA 2AGEX 4B2CA 2WPDD 2ZI2H 4CR5A 1AIXH 2ZGXH 1XVMA 4Y76A 1MKWH 2WYGA 4Z1MD 2OQUA 1Z1IA 1FJSA 1TRYA 4YOIA 5I46H 3MO3A 1PQ8A 3F9EA 2ZF0H 1ZTLA 3HK6B 4X8SH 3MU8A 4MPXA 2WUBA 1O2XA 1O2YA 1P12E 2AHME 2A2QH 3D23A 4ABEA 4HZHA 1TABE 3QGJA 3SV7A 4DOQA 4HGCA 3RC5A 1H9HE 1EAWA 2EI6A 1GI8B 4GSOA 3Q00A 2Z6BD 1NC6A 1ELVA 1QBOA 3NCLA 2J94A 1YBWA 3V13A 1GG6C 2AFQB 4JZDH 2A31A 3TIUA 1FN6A 1H8HD 2GZ9A 2ZCHP 1AGJA 1TGSZ 1O5GH 2XBWA 1ZJDA 3JZ1B 1WQSA 2F91A 1O3HA 1XUHA 2R3YA 2PV9B 3AVZA 3WWBA 1P2QA 3QTOH 1N8OC 3FFGA 3M3VA 4FU7A 4CBOA 5F8TA 2CV3A 1T4VH 1S0RA 2HALA 2Z94A 1SHHB 1NRSH 4MPWA 1BIOA 3PLBA 1SGNE 1EP6A 1AHTH 2W6ID 3BTHE 3Q77A 1O2MA 6CHAC 2ESTE 4MPVA 4X1NU 2ALPA 1GJCB 1KTTB 2H9TH 1OXGA 3RC6A 1SMFE 3SV6A 1XUFA 1BTPA 2XBVA 4K60A 1LQDB 1D6WA 1P09A 4O3UA 3A7VA 1MBQA 1ETTH 1TX6A 2VWMA 4SGAE 3ATLA 4CRAA 1UVPA 4XFQA 1TBQH 3A80A 3SJOA 1C2IA 1NTPA 2BVRH 1DSTA 1UTNA 1WTHD 1ZJKA 1MTSA 4AORA 1FPCH 2FTMA 5FAHA 1TMBH 5A09A 1K1OA 1XM1A 3A7ZA 5DSFA 2HPPH 1TNLA 1HAXB 2Q6FA 4NZQA 3ZZ9A 2K1QA 1F5KU 6ESTA 4FUEA 1ZZZA 1ELBA 3DFJA 4WMDA 5FCRA 2ZTZA 2A4QA 3T62A 4OGYA 3I77A 3MQKC 1U6QA 4B2AA 2G5VA 5EXLA 5DKMA 4ABGA 1O2JA 3F6UH 4U30A 3NUMA 1O2OA 1P8VC 1QL9A 2F3CE 2A7JA 3M37A 4D9QA 2A5IA 1QJ6B 1GHWH 2XC5A 1QCPA 2VGCC 2G52A 2AH4X 3GS9A 3C1KA 4CRDA 2BXUH 2ZU1A 1K9OE 1F0SA 3E1XB 1OPHB 5I25A 1RFNA 1O3OA 1VGCB 1QY6A 3MH4A 5HMAA 4ABIA 3DFLA 3NXPA 3JZ2B 1KXBA 3PROA 2F83A 1O3NA 3UWIA 1GDNA 3WW7A 1KXEA 1O37A 1HYLA 1ELGA 1QZ8A 3OTPA 2CMYA 3BF6H 4WXVA 3H09A 5EG4A 1P2KA 3TJUA 3ZYEA 6GCHF 1O3EA 2J5UA 4YOJA 3V0XA 2XNIA 2WZQA 5GJ4B 1UTQA 2ZIQH 2SGQE 3S0NA 5B6OA 5FX6A 1O3GA 2BQ7B 2GV7A 5L2YH 2VVVA 3DSPA 1ZGVA 5HXFA 1IHTH 4Y7AA 1O34A 2HWLB 4GHTA 1C5SA 5DO4H 1CT2E 2OBOA 2GX4A 1YGCH 3VXEH 1RRKA 2R3UA 1E79D 3I78A 2PKAA 3U28C 1KXDA 2W7UA 1FI8A 2Z9IA 1EZSC 1BRUP 1GI0A 1EB2A 5A0AE 2JIZD 1YPLH 1GMHG 1H4WA 1OWJA 1C5YB 2FI4E 2A4OA 2ZHDA 2Z9KA 3F2FA 1BB0B 1P02A 3E0PB 1A1RA 1Z8IB 2A7CA 3AASA 4I31A 3L3TA 4DW2U 1BTZA 4X6PA 1BCUH 1L0ZA 1LVYA 4XBDA 4WVPE 3K6ZA 1C2MA 3GY2A 3PTBA 2WV5A 2C8YB 1TNGA 2FOGA 2G4TA 2R2MB 3SUEA 3QLPH 1K1JA 2Q1JA 3LGWA 1GPZA 1G3DA 2EQNA 4MVNA 3F0OA 5FL7D 3BTQE 1TB6H 1XMNB 1DY8A 1GJ9B 1V2JT 1HCGA 4GUXA 2ZGCA 5C2ZA 3SQEE 8KME2 2AIQA 3SUFA 2UWPA 1VCPA 2ZDNA 4MLFB 5HYOA 1BTXA 3GCHC 2KCAA 2VWOA 4Y8ZA 1S83A 4R0IA 1YLCA 4GVUA 2CF8H 3RP2A 2BB4A 1C5OH 5DPAA 1O30A 3RXLA 1A4WH 3TNTA 1TPPA 3PV4A 1MTUA 4MNVA 1NU7B 3BEIB 1NU9A 1LHEH 1F7ZA 1MQ5A 1C5UA 1YY3A 5G4BA 3TH2H 3B8JA 5EIYA 3FANA 1DE7H 3A85A 2ZFQH 4CHAC 3UB0A 1SL3A 3BN9A 1L4DA 3TPIZ 1O31A 1TFXA 2VH6A 5AHGH 1S6HA 1KXCA 1EPTB 1CO7E 3RU4E 1PQ5A 4RI0A 2C8ZB 3T27A 1LVMA 2QV1A 5ABWA 3TNSA 1V2RT 4FUHA 1G3EA 2AERH 4Q7YA 3P17H 3NRLA 1LVOA 4BNRA 2VB0A 1HXFH 2CXVA 1CGJE 1W10U 1LPZB 4AC9A 1NFWA 4MDSA 2BLQA 1W12U 1JIMA 1GJAB 3S9CA 2D26C 1ZGIA 2FLBH 1ESAA 3EA9A 1ZYOA 3BG4B 4Q2KA 1GJ8B 1UCYE 1OHHD 2Y7XA 3TGIE 1AUTC 1SI5H 4U2WA 1GJ4H 4BANB 3M7QA 3P8NA 1AZ8A 1BQYA 1KTSB 1SGCA 3SGBE 5A2MH 4DIHH 1TWXB 4A6LA 5KEDA 2BQ6B 2WPIS 3KN2A 3A88A 1ZOMA 2YMSD 1TX8A 4MNWA 4MQAA 4DURA 3E8LA 1P3EA 2ZTYA 4K8BA 4XRNA 4ABBA 1GVZA 1P2JA 1TE0A 1DANH 3GDVA 2YMSC 5SGAE 1P04A 3ZZ5A 3VPKA 1EQ9A 5DG6A 5EW2H 1O3PB 1SGQE 3L33A 4RKJB 1V2PT 1T4UH 1C2DA 3LC3A 1UJ1A 2BD7A 4DT7B 1YP9A 1EAIA 1K28D 1GHAG 2FODA 3ZVCA 1XXDA 3MNBA 1C2KA 1D3TB 1FY4A 3KF2A 1YPMH 4K3JA 1OP8A 1TPAE 1ELTA 1L1NA 4E7RG 1YPKH 2HPQH 1EFRD 1SQRA 2QC2A 1YPHE 1QJ1B 2Z9GA 2BDAA 5C94A 3MNXA 1ZSKA 1ZTJA 2ZZUH 3V7TA 4NSVA 3E3TA 4IS5A 2TIOA 2GMTB 4WJG2 4GAWA 4F48B 2VIOA 1C1VH 2A0QB 1HAYB 3RXJA 3LIWA 2SGEE 1CA0C 3RU4D 3K9XB 2P94A 5E8EH 7LPRA 1D4PB 1GCDA 1BTHH 1THSH 1BZXE 2V0BA 3VFEA 2M5TA 1AUJA 4K1EA 1GJ5H 1C1SA 3PV2A 1W7GH 1UMAH 2GDDA 2ZP0H 2ZU2A 3K2UA 2BDHA 2OC7A 1WU1A 2V3MA 2Z3CA 2XW9A 5T6GA 3ZZBA 3VGCB 2G5NA 5DGJA 1YKTA 3H7OA 1ZHPA 1MCTA 5JB9S 4AFZA 1K22H 2BD8A 2AS9A 4UE7H 1HJ8A 3SV9A 3UWJH 2ZU3A 4B71A 3MOCA 5BPEA 1BJVA 4RKOB 4B74A 1GWAA 3KGPA 4X0WU 2FMJA 3KNXA 4CR9A 3O8RA 1CGHA 1CBWB 1HPGA 3KYFA 2ZO3H 1INCA 1F2SE 3EGKH 1V2QT 4B6FA 5DP6A 4BXSA 1F0TA 3SJIA 3W95A 3PO1B 1OWDA 2KCYA 1DXWA 2OQ5A 1K1IA 2XBXA 3FP6E 4E06H 1XKAC 3LGTA 1DDJA 1TIOA 1PPFE 5FXLA 5EOKA 1OSSA 1UO6A 3M3SA 4X8UH 1FZZA 4ABAA 1DFPA 3ZVGA 4ZHLU 2ZGJA 4JYUH 1TA6A 1WV7H 3S7HB 2OP9A 2GKVE 1PPCE 2BQWB 1PPBH 2SNWA 1ANCA 5C17A 2K8IA 2LNCA 5GIBA 3U9AH 1ZHRA 1Y8TA 1OP0A 2A5AA 1C5TA 1O35A 2P95A 3KEEA 1VITF 3FO8D 4RT0A 3UQOA 1HAIH 1F0RA 1D3DB 1T32A 4BTTB 1KSNA 1DLKB 1GHZA 3FZDA 2NWNA 2BDGA 3P70B 2Q6GA 1B0FA 4B2BA 1C5LH 3HKJB 7GCHF 2DUCA 1O2GH 1SC8U 2G8TA 4X6MA 2BD9A 3BEFB 5E2OA 4ZKNU 5J4SA 1JIRA 1EAXA 4YT7H 1AQ7A 2OUAA 1V2NT 1SR5C 1YPHC 4ABJA 3D65E 3A7YA 1MCVA 1UW7A 2G81E 2IPQX 1K1PA 1LTOA 2P8OB 1D9IA 1V2MT 1L2EA 3DHKH 2GZ7A 1C1UH 2F9VA 5C1XA 1FIZA 2GZ8A 4YT6H 1VZQH 4FXGH 5EU8A 3F68H 2GTBA 4CH2B 5HKKD 2EI7A 1JMOH 5E0GA 1SSXA 2CF9H 4H6SB 2QGRA 3RXUA 3A82A 5AFZH 4HI3A 3SOSA 5FBEA 2UUKB 2F9OA 1O0DH 4YOGA 2A1DB 2EI8A 1IQIA 2EY4C 1GBCA 1O2TA 2D8WA 1S5SA 1W3CA 3E6PH 1QBNA 2KZ4A 4K1SA 1MKXK 1UTLM 3MO9A 1QL7A 1P9SA 4AFQA 1MU8B 3QGNB 1CT0E 5LGOA 2RDEA 6GCHG 1LHDH 4Z6AH 1QFKH 3A8CA 1KDQB 3PV5A 3E91A 1MAYA 3URCA 1IQKA 3UUZA 1FIWA 4YTAA 1QB9A 2A32A 4UFGH 3SU3A 3RLYH 1T7CA 3A89A 1MUEB 3BSQA 3M5LA 1Q3XA 1VGCC 1L1GA 1OP2A 2ANYA 4CH8B 5EJZA 1FDPA 2BDCA 4UFDH 1KIGH 1MKXH 2VVUA 2ZDVH 2VH0A 1B0EA 1FLEE 1AFEH 1G3BA 1YPGH 1TQ0B 1ELDE 2BDYA 1EJAA 4ACAA 1IHSH 2D1JA 2HNTE 1QB1A 3NWUA 3TGJE 2Y82A 5FX5A 1L1JA 1EOJA 1GVLA 1EPTA 3PM3A 4NA8A 2STAE 1E35B 2BM2A 3IITA 2H1UA 4JK6A 5F6MA 5AFYH 1MZAA 1ARCA 3F2HA 4A1XA 1YLNA 9LPRA 3BV9B 2PUQH 1QRXA 1ZMJA 2Z3EA 1EKBB 2TGTA 1ZMLA 4XBCA 3CNRA 1SVPA 1BBRE 2F4LA 1NRRH 2F9UA 2ZC9H 4I32A 3MU4A 3RC4A 1GI6A 3SHCH 3O8DA 4X1PU 1EP5A 1K1LA 1C1PA 4E7NA 3GCTF 3OX7U 2SFAA 1VITH 3VB5A 1A0LA 3GYLB 3FP7E 1S81A 2NU2E 2ZG0H 1SLUB 1XUIA 3SORA 1Z8JB 2KX4A 3QDZB 1DWEH 1M9UA 1OYQA 4A92A 3AW1A 4JYVH 1GBHA 2Y5HA 1T8MA 1XUKA 2P93A 3TK9A 3SI3H 3QN7A 1BITA 1AZZA 1RD3B 4FUDA 4O3TA 1BDAA 3RXIA 1TNKA 1AWHB 1UVSH 3TJOA 2Y5GA 2ZCLP 1LHFH 3MO6A 1SQOA 3N7OA 2Y6TA 5C3NA 1HAHH 2FIRH 3P92A 2O8UA 2PUXB 3B23B 1BA8B 3HATH 4WXIA 2R0LA 3SBKA 2TGAA 4NSYA 2Y80A 1HFDA 2VJ1A 4CRFA 5IK2D 1O3IA 2OBQA 4IN1A 8LPRA 3RMNH 3BTEE 1SGDE 1ZRKA 1HV7A 1BMMH 2AYWA 4X6NA 1NZQH 2DE9A 3U1JB 1W7XH 4KGAA 2PSXA 2QY0B 2PGBB 2VIWA 1W0ZU 1QBVH 2BDBA 3RXKA 1ID5H 5DP8A 1GI7B 4NIVA 3SNDA 1GHBF 4B73A 1ZHMA 2W6JD 5TCAA 3RXDA 4QT8C 2FX4A 2J92A 4U32A 2Y81A 5EXMA 1O2RA 4ABHA 2H5CA 2BY7X 2PKSB 1EPTC 1SGFG 1EATA 3PTNA 4DVAU 1FONA 1F5RA 1A0JA 4WWYA 4AFSA 3A7XA 4TWYA 1A0HB 5A8YA 5E2PA 3TGKE 3LJOA 2GJGA 4O03A 1GI2A 2HNTC 4B6EA 1D3PB 5JBBS 1WXRA 1GI5A 1GMCF 3SGAE 1IQNA 3GY6A 2CN0H 3T5FH 1TBZH 2QXHA 2A4GA 1EAUA 1GI1A 4K8YA 4I8HA 3OYPA 5C20A 3MNSA 1O3LA 1EJNA 3GDUA 1TGTA 2PR3A 5JPMH 3S9BA 1EXFA 1P2IA 3VB6A 3SV8A 3LONA 2Z3DA 3OSYA 4Y6DA 3A81A 3MMGA 3UY9A 1P0SH 2BDIA 2W3IA 2FO9A 2M2AA 4VGCB 3BTTE 1QURH 1QRWA 1VJAU 1W0JD 3F0PA 3RDZA 4OS4A 2Q6DA 2BVXH 1SHYA 1XX9A 3GCOA 2H6MA 1ANEA 1HRTH 4I8KA 4ASHA 4RSPA 1G9IE 1RIWB 3RXTA 4FETA 1ELFA 1CHOF 1WUNH 1AVWA 4IC5A 3OFND 1TMUH 2FOBA 2BTCE 3VB4A 4INKA 2PW8H 3EQ0H 1UK2A 2C8WB 1MTNB 1Z71A 2HLCA 2I6SA 3UNRA 1TA2A 1G37A 3S69A 1FNIA 3U69H 1K0HA 1IQLA 3A87A 2STBE 3MU0A 4MTBA 4ISIH 5GPIB 1N1LA 4I8JA 1PQ7A 1HBTH 1O2LA 2GVFA 4UEHH 2BVSH 1C4V2 4I33A 1UVTH 2ZCKP 4GCHF 3GY5A 1LCYA 2BXTH 3TH4H 1CE5A 1C1NA 2GDEH 4P00A 3RXHA 1HB0B 3EA8A 2ZPSA 2ZFPH 3IWMA 4IC6A 1O3JA 3FP8E 4ZMAH 2OCVB 3MH7A 1T8LA 4I7YH 1JXPA 1UK4A 1ZPBA 1FQ3A 3MTYA 1FX0B 1P57B 5JDUB 4I86A 2O8TA 3KQBA 1GCTB 3AAUA 4B76A 1DOJA 1BHXF 1KY9A 3KL6A 1SFIA 1TQ7B 3VB7A 1TYNA 5A8XA 1S82A 4JCNA 2THFB 2HGTH 4WMFA 1Z8GA 5GWZA 1Y3YA 3MU1A 3F2GA 2ILNA 3SN8A 2GCTB 1H9IE 2FP7B 1EJMA 1J9CH 1HUTH 1WOFA 1N6YA 2KCPA 5DP3A 1GBFA 1CSOE 2BOHB 2WPLS 3ZIAD 4NGAH 1PPHE 3HGPA 1J14A 3VGCC 1P06A 3PRBA 3M5NA 1V2TT 1TONA 3VG8A 5JBCS 1EASA 4E05H 1G2MA 5JBAS 2G51A 2OTVA 5C67A 1AD8H 4RN6A 4AGJA 1BMFD 4LOYH 1H1BA 4INLA 3T26A 4DT4A 2AEIH 1VITG 1UTJA 1CBWC 2QN5T 1QRZA 1NFYA 2OXSA 5EXNA 1RGQA 2RCEA 2IN2A 3DD2H 2B5TB 4A5TS 7GCHG 5A8ZA 4Y8XA 4TYDA 2WPMS 1KDQA 3UR6A 3SUGA 2C93B 1P05A 1EZUC 3UR9A 8GCHF 1NS3A 2BMGB 2PFEA 2CHAC 2J95A 1QHRB 2V7QD 3T29A 3QO6A 1C1OA 1UTKA 1E36B 1LKAA 4XBBA 1XVOA 3SJKA 3W94A 1DUEA 1DICA 2I6QA 4KTUA 3LT3A 1BTYA 1TPOA 3URDA 4A1TA 5L30H 2ZQ2A 2XWAA 1P2MA 2GT8A 3DSOA 3S7KB 3R0FA 2BLVA 2KCOA 1NT1A 1K2I1 1TMTH 3A84A 1C5NH 2SNVA 1P3CA 3SGQE 4K69A 3CENA 1PPEE 1GBJA 1E38B 3UFAA 3GY7A 3ODDA 2O9QA 2G00A 1ZLRA 5EQSA 1YLDA 1Y59T 1NM6A 1FY5A 1UHBB 1SLWB 1W0KD 1AB9B 5BRRE 1MQ6A 3MWIU 2P8OC 2XCNA 2VIPA 1FXYA 1YPJH 2OC0A 5ESTE 2RA3A 3FKSD 1ELAA 5JB8S 4YLQH 3PRDA 4JZEH 3PMHB 3GDSA 5LPEA 2JH5D 3LGUA 3SO3A 1GGDB 1UVUH 1ETRH 1P03A 4NIWA 5DP9A 1O3FA 1DXPA 1SGPE 1UCYK 1ZRBA 4XOJA 3ZZ4A 4IMZA 5EJ1A 4KP0A 5GDSH 3RLWH 2WINI 4YM9A 4NWLA 4YESB 4I8GA 1PFXC 3BTDE 5EGMA 5IYTA 1Y3UA 4ISOA 2FM2A 5GCHF 5HIYA 3SU2A 5C0UA 1BTWA 1VCQA 2NU1E 3A8DA 8ESTE 1P11E 1QA0A 3ZZDA 1KXFA 2V35A 3RXEA 2XC4A 5K0HA 4OS5A 2C8XB 4LZ4B 4THNH 2GCHG 1TNHA 4Y0YE 1NROH 3NKKA 4FUFA 5A0CA 1F92A 1GMDF 1C2HA 2ZDAH 1HJAB 2L6OA 2FX6A 2PHBA 4HG6A 3LDXH 3OE7D 1UCYH 1H9LB 3PYHA 3PMBB 4TSFD 2FOAA 1SGRE 3F3BA 2UUJB 1O3DA 5C1YA 3F1SB 3TK5A 2XBYA 4LK4A 1DY9A 3N7DA 4UFFH 1KXAA 4O9VA 2V3HH 1A3BH 4MG3A 5EPNA 1THRH 3TK6A 3OEHD 1EOLA 1G32B 3BTGE 2BY5X 3GCTG 4X2YA 3Q3YA 4X8TH 1TGBA 2FYQA 1YYY1 4JK5A 2EEKA 1K1MA 5C5OA 1ELEE 1LHCH 3ZZ3A 2ODPA 1WYKA 4O97A 1PJPA 3MI4A 3E90B 4ZKSU 2PLXA 2TGDA 1OWKA 1O5AB 5CHAB 5EODA 1O3AA 1P2NA 5F53A 2J9NA 5C0TA 3DCLA 3UOUA 2IJOB 4NG9H 5HM2A 5HGGA 3RXVA 1PQAA 3GCNA 3ZZ7A 3RM0H 1ZMNA 5FCKA 2ASUB 2ZNKH 3HGNA 1WDIA 1HLTH 4X6OA 9ESTA 4KTSA 1TAWA 1TX7A 1B5GH 4X2WA 2HVYB 2ZDMA 3W1EA 1CU1A 1SGEE 3GYMA 4BTIB 1OS8A 1SGFA 1KLTA 3SV2H 2O8LA 3LGIA 2QF4A 4HFPB 1E37B 1E1QD 3A7WA 1P01A 4YZUA 1GHBG 2ZECA 1KLIH 1W14U 4NCYA 3KQCA 2FEQH 2QF3A 2CJIA 4I8LA 3T28A 4J2YB 4IBLH 4JZ1A 2J97A 2XOKD 1QR3E 1NO9H 2ODYB 5T6DA 4B75A 3FN8A 1SB1H 1C5PA 2Y5FA 1GL0E 1O5EH 2L74A 3FOAA 4MNXA 1JOUB 2B7DH 5EJLA 3OAAD 1V2OT 1BRCE 3FVFB 1GMCG 1W8BH 3RXRA 3SUDA 3M5MA 1V6DA 4ZH8A 3ZZAA 3PLPA 3EA7A 4Y79A 1QJ7B 1A5IA 1LHGH 1H8IH 2PKSC 1C4Y2 5B6LA 4JMYA 4NWKA 3RXOA 2HOBA 5L2ZH 3EE7A 2ZEBA 2BY9X 4GLYA 2ZQ1A 3SYJA 2B0FA 4ZXYH 4TY7A 3RXCA 3RUOA 1G2LA 3OY6U 2XCFA 3F9GA 1GI3A 2WPJS 3BTME 3ITIA 1OWHA 4Q63A 3RXSA 1HNEE 2VBCA 2KAIB 5GXPA 1XUGA 2BZ6H 3ZVEA 2TGPZ 2WSSD 2R2WU 1A5HA 1CHOG 5LPRA 3GOVB 4BOHA 3TVJB 1EB1H 1LKBA 4WY3A 1ZPZA 4Z0KA 1O36A 1QQUA 7ESTE 1GJ7B 1NESE 1DWDH 1AVGH 2CK3D 1ORFA 1Y5UT 2BX4A 5K7RA 1ELCA 4VGCC 5CE1A 1VKYA 1DX5M 1S85A 4GCHG 3M36A 3ZZ8A 4NIXA 3RMMH 2A2XH 2H9EH 1QGFA 3ZYDA 5JYIA 2VWLA 1K21H 7KMEH 2AMQA 2YNBA 2ZPQA 5DJ7A 1EZQA 2SGDE 1Y3XA 1RIWC 3SU1A 1SLXB 3SU6A 1O5FH 1F5LA 1O2QA 3LGVA 2H2ZA 5TCCA 3QUMP 3ZZCA 4ACBA 3SZNA 3MHWU 4JYTA 2JETB 1AFQB 3PMJA 1O2HA 2FPZA 1MTNC 3L6PA 1O2IA 3P8OA 4OS6A 3ZVFA 2ZPRA 1DLEA 1GDUA 1LMWB 1SGTA 5L6NH 4P02A 2H5DA 4FOUC 1DWBH 3STJA 2ZFSA 4ISLA 2W5EA 4H4FA 1IQHA 2BYAX 1BJUA 5E0JA 1GL1A 4PROA 5T6FA 4IGDA 2BD2A 1F0UA 1C5MD 3N7EA 2O8WA 3TH3H 3VB3A 4YXWD 1O3BA 1P2OA 4AYYB 4K1TA 1RTLA 1MKWK 1UK3A 4SGBE 1UTPA 3M5OA 4X8VH 2KFWA 1E1RD 5F8XA 3ATWA 4ASUD 1HIAB 5DP4A 4AFUA 2BLOA 1S84A 1DWCH 3CS7A 1KYNA 1GCTC 2HLDD 1BMLA 4GHQA 3GY8A 1GBEA 2R0KA 4CRBA 4DGJA 2UUFB 1DSUA 2PWXA 3TLOA 3KQDA 3RMLH 3BTWE 1YWUA 1IOEA 2OLGA 1GBIA 1GI9B 1NFUA 2GCTC 1PYTD 1T8NA 2OC1A 4RT1A 2IJD1 1V2VT 3P95A 1AKSB 1IQJA 2PGQB 1BBRK 1PYTC 2F9BH 1W2KH 3FAOA 4OGXA 3OY5U 3QTVH 1TALA 1VJ9U 5CHBA 2JJ2D 3LJJA 3D62A 1MZDA 1Y5BT 3MU5A 4F55A 8GCHG 1C2LA 2QF5A 2P3UB 1MTVA 1NFXA 2GD4B 1ESTA 1ANDA 1C1TA 4NZLA 5F03A 1AN1E 2P3TB 3RM2H 2QAAA 1UTMA 1THPB 4D9RA 5FPTA 1VR1H 5J4QA 3U8OH 1NBME 1BBRH 3PWCA 3OTJE 2D2DA 3F9HA 1W13U 4CBNA 2W26A 2P59A 3LH1A 3DSGA 3RXFA 1QA7A 1W0YH 1AVXA 1LQEA 2F9PA 3QK1A 2A7HA 5T1VA 2B9LA 5A0BA 2OINA 1C5RA 3QX5H 2GGVB 1BOQA 2K0QA 1D3QB 1TGCA 1TPSA 1TGNA 2SGPE 2VU8E 1CVWH 1ESBA 2SGFE 4FUCA 4GPGA 3Q76A 1AE8H 2FI3E 1ABJH 2FXRA 1GBMA 4BAOB 1C1MA 4X1QU 3NZIA 5C1UA 1QB6A 1WTGH 1NRQH 3HPTB 1FY1A 4KKDA 1LVBA 1JWTA 4ZROA 5F8ZA 4BAKB 2FYRA 1TRNA 4OS1A 3BG4C 1XXFA 1NRPH 2KR7A 1DT2A 3HK3B 5GCHG 1AB9C 1HAVB 3OU0A 3KQ5A 4NIYA 5CMXH 3QZQA 3VEQB 1LPGB 2J98B 1YCPM 2V6NA 1G36A 2WHXA 1C2EA 1O2NA 3AW0A 4XSKU 1C9TA 1ANBA 1G30B 3M3TA 1GMDG 1GGDC 1AY6H 2GV6A 2Y7ZA 2ZFFH 3EYDA 1GDQA 3RXMA 1AWFH 2QA9E 1OWIA 3PLKA 1A2CH 3P8GA
chains in the Genus database with same CATH topology
3U28C 3UAIC 2EY4C 2HVYB 2EQNA 3MQKC 2V3MA 2RFKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U28 C;  3UAI C;  2EY4 C;  2HVY B;  2EQN A;  3MQK C;  2V3M A;  2RFK C; 
#chains in the Genus database with same CATH topology
 5DK1 A;  1GHY H;  3EAJ A;  1A3E H;  2SGA A;  3A8B A;  2DE8 A;  1HAO H;  1SGI B;  5KGO A;  4DJZ B;  5EW1 H;  4YLU A;  1C5Q A;  1CGI E;  3SZE A;  3NPS A;  4FU9 A;  4H6T A;  2UUY A;  1XKB C;  1TOC B;  4XD7 D;  4CRE A;  4BXW A;  1DS2 E;  1YM0 A;  3SI4 H;  2TPI Z;  1ETS H;  2O8M A;  3SW2 B;  1V2U T;  1HJA C;  2ZFT A;  1NY2 2;  1NBM D;  2RDL A;  2XND D;  4AB9 A;  2ZDL A;  4JZF H;  4EST E;  1O38 A;  1FMG A;  2OC8 A;  3TJV A;  4X2V A;  3P6Z B;  3SJ9 A;  2CGA A;  1O2P A;  3M7T A;  1FAX A;  1UTO A;  4ZUH A;  2GMT C;  4AG1 A;  3V12 A;  1SQT A;  3Q3K A;  4KTC A;  1DPO A;  4M7G A;  1WAY B;  4OM9 A;  1DIT H;  4IW4 E;  4UFE H;  3Q3X A;  3KQE A;  4BAQ B;  2OK5 A;  3EST A;  1KLJ H;  1MBM A;  3GIS B;  2ANW A;  3ZVB A;  1P9U A;  1Q2W A;  4MPU A;  2W3K A;  3U8T H;  4ZHA A;  4DG4 A;  2ODQ A;  1J15 A;  2LPR A;  1T8O A;  1ZSJ A;  2YOL A;  3PWB A;  1HJ9 A;  3WWF A;  2J38 A;  3M61 U;  1O2S A;  4FUI A;  3SHA H;  3ZVD A;  3ATK A;  1Z6J H;  2A4R A;  1HAG E;  2WV4 A;  4X1S U;  4INH A;  1ZSL A;  5CHA C;  1GJB B;  2C3S A;  1CQQ A;  2R9P A;  1MTW A;  3QWC H;  2BD5 A;  4DCD A;  1O5C B;  1Z8R A;  3A86 A;  1K1N A;  2KAI A;  1O2K A;  1RTF B;  1NPM A;  1P10 A;  5FPY A;  1JRS A;  1TBR H;  3DUX H;  4MNY A;  3U8R H;  1TNI A;  2JH0 D;  2VNT A;  2GP9 B;  1IQM A;  5CDF E;  6LPR A;  1MD8 A;  2ZFR H;  1HAZ B;  4F4O C;  2FOM B;  2FWW A;  4FVD A;  3GIC B;  1V2S T;  4K5Z A;  1GG6 B;  1V2W T;  2P16 A;  3ATI A;  2Z7F E;  3BG8 A;  1DVA H;  1E34 B;  2WPK S;  4J1Y A;  3BTK E;  2OD3 B;  4NFE A;  3S9A A;  2WUC A;  3PO1 C;  1J17 T;  1SGY E;  3TIT A;  2HVX A;  3T2N A;  1AU8 A;  3P8F A;  1GVK B;  4BAH B;  2ZHE H;  1VCW A;  3BIU H;  2BZA A;  1V2K T;  2YNA A;  2XWB I;  1N8O B;  4NA7 A;  1EX3 A;  2FI5 E;  4TPY A;  3MH5 A;  3ZZ6 A;  3DT0 H;  3E16 B;  1CHG A;  1N6X A;  3BTF E;  3UTU H;  3ZVA A;  3M35 A;  5EQR A;  2XTT B;  4FU8 A;  3RXG A;  5HM9 A;  2ANK H;  4K2Y A;  2AMP A;  1QQ4 A;  3U98 H;  4Y71 A;  5DN6 D;  3SNB A;  1IQG A;  6CHA B;  3CP7 A;  1IQE A;  1PPZ A;  2VID A;  2EC9 H;  1SPJ A;  3UOP A;  2QE7 D;  1OOK B;  4WH8 A;  4ZCN A;  2FTL E;  1CT4 E;  2F9N A;  3AAV A;  1IQF A;  1T31 A;  2JKH A;  1O3K A;  5EPY A;  3UAI C;  2BY8 X;  1MH0 A;  3K65 B;  3KYG A;  3MFJ A;  2ZU4 A;  1C2G A;  3BIV H;  3QZR A;  1SOZ A;  2GT7 A;  4Y8Y A;  4YO9 A;  1HIA A;  4IN2 A;  4UD9 H;  3PB1 E;  1S6F A;  5DP7 A;  4LZ1 H;  3PMA B;  5LPF A;  1RS0 A;  4Q7Z A;  1DM4 B;  4HTC H;  1XUJ A;  2LP6 A;  3VXF H;  4ZHM U;  3EDX B;  4AZ2 B;  2VIQ A;  3SJ8 A;  2FOC A;  1HXE H;  2FOF A;  2VIN A;  4WME A;  5GND A;  3SNC A;  2ZWL H;  1BUI A;  1GHV H;  3TU7 H;  2IOT A;  1O2V A;  1SBW A;  3ZV8 A;  3OEE D;  2BX3 A;  1GBB A;  2G55 A;  2RFK C;  1O32 A;  5FBI A;  3T25 A;  2A5K A;  4WH6 A;  3EE0 B;  2BHG A;  1AKS A;  2B8O H;  1FY8 E;  2FZZ A;  1D6R A;  1A5G H;  1SLV B;  4UDW H;  2AMD A;  1O33 A;  5T3H A;  4ISN A;  1B7X B;  1MU6 B;  4D7G A;  2QIQ A;  3ZV9 A;  4F49 A;  2JJ1 D;  4LXB H;  5TJX A;  4ZKR U;  1BRA A;  1C4U 2;  1YPE H;  4FUG A;  2W7S A;  3RXB A;  2G4U A;  3H7T A;  4TT3 D;  3SU0 A;  2VGC B;  3UPE A;  5KEC A;  2J34 A;  2XC0 A;  1C2J A;  1MAB B;  4XE4 A;  3O8B A;  2XRC A;  1O3M A;  4Y7B A;  2BD4 A;  4ISH H;  4AN7 A;  1BT7 A;  2VIV A;  1HAP H;  4OS2 A;  1O2U A;  1AFQ C;  2JET C;  2PTC E;  4X2X A;  1A46 H;  1PPG E;  2NU3 E;  1EZX C;  2J2U A;  3RXQ A;  5AF9 H;  1O2W A;  2FS9 A;  2TRM A;  5H4I B;  1YF4 A;  4U01 A;  2F43 B;  2Z9L A;  1V3X A;  2ZGB H;  1YC0 A;  2ULL A;  1FUJ A;  1RTK A;  5EQQ A;  4KEL A;  4ABF A;  4XDE A;  1WSS H;  5FPS A;  2QF0 A;  5DP5 A;  4UON A;  2QCY A;  1O5B B;  3ATM A;  1Z1J A;  4WF8 A;  1BTU A;  3G01 A;  1ZTK A;  3KID U;  1OYT H;  2FLR H;  1A61 H;  3H5C B;  4FVB A;  4ZKO U;  2NU4 E;  3E0N B;  2QYI A;  4IMQ A;  3DA9 B;  4DY7 B;  1H8D H;  3SNA A;  1Z7K A;  1J16 A;  3RXA A;  3R3G B;  2BD3 A;  1O2Z A;  2PSY A;  1FPH H;  3CS0 A;  3LH3 A;  2J4I A;  3SU5 A;  2V3O H;  2P3F H;  1HAV A;  2FES H;  1RXP A;  3N99 A;  2ZHF H;  2FOE A;  1O39 A;  1IAU A;  5JBT A;  1UVO A;  2J98 A;  1GBL A;  2WV9 A;  3UNQ A;  1Z6E A;  3LPR A;  4AX9 H;  4DII H;  1AE5 A;  1RJX B;  4BAM B;  5E0H A;  1GBK A;  1TNJ A;  1LPK B;  1GBT A;  1HGT H;  3A8A A;  1GMH F;  3LGY A;  1C5Z B;  3MNC A;  2ZHQ H;  3B9F H;  1AI8 H;  2LEL A;  1JRT A;  1Q31 A;  2QXI A;  3A7T A;  2WPH S;  2QXG A;  1MD7 A;  2HRV A;  5HIZ A;  1TOM H;  2A45 B;  1QIX B;  3GCH B;  3LOX A;  2FOH A;  3F9F A;  1AO5 A;  4TY6 A;  4CRG A;  2ZA5 A;  1ACB E;  1OX1 A;  1SQA A;  2FDA A;  3NK8 A;  1OWE A;  1HDT H;  1C9P A;  1BMA A;  2JDI D;  2XYA A;  3WY8 A;  3ELA H;  3C27 B;  2C4F H;  2JH6 D;  2ALV A;  2CHA B;  4CHA B;  1NRN H;  3RMO H;  1A7S A;  3FZZ A;  3GY3 A;  1OKX A;  5LH8 A;  1W11 U;  3KCG H;  2HNT F;  3M7U A;  4FUB A;  1LDT T;  1Y5A T;  1ZPC A;  1FV9 A;  4Y10 E;  1O5D H;  2BLW A;  1TRM A;  1YCP K;  2PKA B;  4X1R U;  2RA0 A;  4BTU B;  4OS7 A;  2BY6 X;  2IPH A;  1V2L T;  2PTN A;  1C1R A;  4AYV B;  1C5V A;  1FAK H;  2ZHW H;  1CA8 B;  4CRC A;  3GY4 A;  3SQH E;  3ODF A;  1BRB E;  3RXP A;  1FN8 A;  2Z9J A;  4M9F A;  1C5X B;  1C1Q A;  3I29 A;  1GI4 A;  1EUF A;  4Q80 A;  1O3C A;  3BEU A;  3MH6 A;  4NA9 H;  1ARB A;  4D8N A;  1C1W H;  4Q7X A;  3AK5 A;  1J8A A;  1ABI H;  3A83 A;  4JZI A;  4ZXX H;  4A7I B;  4AGK A;  1GBD A;  3K6Y A;  1FY3 A;  1YCP H;  1Y3V A;  1C2F A;  1NN6 A;  1WCZ A;  2YMS B;  1SOT A;  5PTP A;  5ETX A;  3O8C A;  2ZKS A;  1COW D;  2FS8 A;  2ZTX A;  4AB8 A;  2WYJ A;  2KM0 A;  2XXL A;  4H42 U;  4Y11 E;  4TWW A;  3TJN A;  2ZU5 A;  5AVD A;  2UWO A;  1LO6 A;  2AIP A;  3UNS A;  1MAX A;  1ZR0 A;  4A1V A;  2VWN A;  4FUJ A;  4B1T A;  2NU0 E;  3UIR A;  1X7A C;  3ENS B;  4AOQ A;  4AG2 A;  3LKW A;  3SNE A;  1WBG B;  3STI A;  1QTF A;  3MYW A;  4TPI Z;  3KHV A;  1C5W B;  4Y0Z E;  3LU9 B;  2ZGH A;  2AGI X;  2PP6 A;  3D49 H;  2TBS A;  4ZAE A;  4D7F A;  2H9H A;  4ABD A;  1S0Q A;  1SKY E;  1KMH B;  2AGG X;  3U1I B;  1GJD B;  1GJ6 A;  1WQV H;  3UQV A;  1SG8 B;  2VVC A;  1H8E D;  1G3C A;  2UWL A;  1GBA A;  3URE A;  4Q4L A;  1GHA F;  1TLD A;  4NFF A;  3RU4 T;  5IDK A;  1CA0 B;  3SU4 A;  1Y3W A;  1L4Z A;  1BMN H;  1QNJ A;  2GCH F;  4R8T B;  1GHX H;  1JBU H;  5ESB A;  1S6L A;  2C90 B;  3HKI B;  2ZDK A;  2ANM H;  1QL8 A;  5C5N A;  5FHT A;  2BOK A;  2EA3 A;  3LC5 A;  3V3M A;  4D76 A;  1BHX B;  1UHB A;  2RG3 A;  1SFQ B;  1MMJ N;  2QXJ A;  3IG6 B;  1E0F D;  1AMH A;  1DUA A;  2AGE X;  4B2C A;  2WPD D;  2ZI2 H;  4CR5 A;  1AIX H;  2ZGX H;  1XVM A;  4Y76 A;  1MKW H;  2WYG A;  4Z1M D;  2OQU A;  1Z1I A;  1FJS A;  1TRY A;  4YOI A;  5I46 H;  3MO3 A;  1PQ8 A;  3F9E A;  2ZF0 H;  1ZTL A;  3HK6 B;  4X8S H;  3MU8 A;  4MPX A;  2WUB A;  1O2X A;  1O2Y A;  1P12 E;  2AHM E;  2A2Q H;  3D23 A;  4ABE A;  4HZH A;  1TAB E;  3QGJ A;  3SV7 A;  4DOQ A;  4HGC A;  3RC5 A;  1H9H E;  1EAW A;  2EI6 A;  1GI8 B;  4GSO A;  3Q00 A;  2Z6B D;  1NC6 A;  1ELV A;  1QBO A;  3NCL A;  2J94 A;  1YBW A;  3V13 A;  1GG6 C;  2AFQ B;  4JZD H;  2A31 A;  3TIU A;  1FN6 A;  1H8H D;  2GZ9 A;  2ZCH P;  1AGJ A;  1TGS Z;  1O5G H;  2XBW A;  1ZJD A;  3JZ1 B;  1WQS A;  2F91 A;  1O3H A;  1XUH A;  2R3Y A;  2PV9 B;  3AVZ A;  3WWB A;  1P2Q A;  3QTO H;  1N8O C;  3FFG A;  3M3V A;  4FU7 A;  4CBO A;  5F8T A;  2CV3 A;  1T4V H;  1S0R A;  2HAL A;  2Z94 A;  1SHH B;  1NRS H;  4MPW A;  1BIO A;  3PLB A;  1SGN E;  1EP6 A;  1AHT H;  2W6I D;  3BTH E;  3Q77 A;  1O2M A;  6CHA C;  2EST E;  4MPV A;  4X1N U;  2ALP A;  1GJC B;  1KTT B;  2H9T H;  1OXG A;  3RC6 A;  1SMF E;  3SV6 A;  1XUF A;  1BTP A;  2XBV A;  4K60 A;  1LQD B;  1D6W A;  1P09 A;  4O3U A;  3A7V A;  1MBQ A;  1ETT H;  1TX6 A;  2VWM A;  4SGA E;  3ATL A;  4CRA A;  1UVP A;  4XFQ A;  1TBQ H;  3A80 A;  3SJO A;  1C2I A;  1NTP A;  2BVR H;  1DST A;  1UTN A;  1WTH D;  1ZJK A;  1MTS A;  4AOR A;  1FPC H;  2FTM A;  5FAH A;  1TMB H;  5A09 A;  1K1O A;  1XM1 A;  3A7Z A;  5DSF A;  2HPP H;  1TNL A;  1HAX B;  2Q6F A;  4NZQ A;  3ZZ9 A;  2K1Q A;  1F5K U;  6EST A;  4FUE A;  1ZZZ A;  1ELB A;  3DFJ A;  4WMD A;  5FCR A;  2ZTZ A;  2A4Q A;  3T62 A;  4OGY A;  3I77 A;  3MQK C;  1U6Q A;  4B2A A;  2G5V A;  5EXL A;  5DKM A;  4ABG A;  1O2J A;  3F6U H;  4U30 A;  3NUM A;  1O2O A;  1P8V C;  1QL9 A;  2F3C E;  2A7J A;  3M37 A;  4D9Q A;  2A5I A;  1QJ6 B;  1GHW H;  2XC5 A;  1QCP A;  2VGC C;  2G52 A;  2AH4 X;  3GS9 A;  3C1K A;  4CRD A;  2BXU H;  2ZU1 A;  1K9O E;  1F0S A;  3E1X B;  1OPH B;  5I25 A;  1RFN A;  1O3O A;  1VGC B;  1QY6 A;  3MH4 A;  5HMA A;  4ABI A;  3DFL A;  3NXP A;  3JZ2 B;  1KXB A;  3PRO A;  2F83 A;  1O3N A;  3UWI A;  1GDN A;  3WW7 A;  1KXE A;  1O37 A;  1HYL A;  1ELG A;  1QZ8 A;  3OTP A;  2CMY A;  3BF6 H;  4WXV A;  3H09 A;  5EG4 A;  1P2K A;  3TJU A;  3ZYE A;  6GCH F;  1O3E A;  2J5U A;  4YOJ A;  3V0X A;  2XNI A;  2WZQ A;  5GJ4 B;  1UTQ A;  2ZIQ H;  2SGQ E;  3S0N A;  5B6O A;  5FX6 A;  1O3G A;  2BQ7 B;  2GV7 A;  5L2Y H;  2VVV A;  3DSP A;  1ZGV A;  5HXF A;  1IHT H;  4Y7A A;  1O34 A;  2HWL B;  4GHT A;  1C5S A;  5DO4 H;  1CT2 E;  2OBO A;  2GX4 A;  1YGC H;  3VXE H;  1RRK A;  2R3U A;  1E79 D;  3I78 A;  2PKA A;  3U28 C;  1KXD A;  2W7U A;  1FI8 A;  2Z9I A;  1EZS C;  1BRU P;  1GI0 A;  1EB2 A;  5A0A E;  2JIZ D;  1YPL H;  1GMH G;  1H4W A;  1OWJ A;  1C5Y B;  2FI4 E;  2A4O A;  2ZHD A;  2Z9K A;  3F2F A;  1BB0 B;  1P02 A;  3E0P B;  1A1R A;  1Z8I B;  2A7C A;  3AAS A;  4I31 A;  3L3T A;  4DW2 U;  1BTZ A;  4X6P A;  1BCU H;  1L0Z A;  1LVY A;  4XBD A;  4WVP E;  3K6Z A;  1C2M A;  3GY2 A;  3PTB A;  2WV5 A;  2C8Y B;  1TNG A;  2FOG A;  2G4T A;  2R2M B;  3SUE A;  3QLP H;  1K1J A;  2Q1J A;  3LGW A;  1GPZ A;  1G3D A;  2EQN A;  4MVN A;  3F0O A;  5FL7 D;  3BTQ E;  1TB6 H;  1XMN B;  1DY8 A;  1GJ9 B;  1V2J T;  1HCG A;  4GUX A;  2ZGC A;  5C2Z A;  3SQE E;  8KME 2;  2AIQ A;  3SUF A;  2UWP A;  1VCP A;  2ZDN A;  4MLF B;  5HYO A;  1BTX A;  3GCH C;  2KCA A;  2VWO A;  4Y8Z A;  1S83 A;  4R0I A;  1YLC A;  4GVU A;  2CF8 H;  3RP2 A;  2BB4 A;  1C5O H;  5DPA A;  1O30 A;  3RXL A;  1A4W H;  3TNT A;  1TPP A;  3PV4 A;  1MTU A;  4MNV A;  1NU7 B;  3BEI B;  1NU9 A;  1LHE H;  1F7Z A;  1MQ5 A;  1C5U A;  1YY3 A;  5G4B A;  3TH2 H;  3B8J A;  5EIY A;  3FAN A;  1DE7 H;  3A85 A;  2ZFQ H;  4CHA C;  3UB0 A;  1SL3 A;  3BN9 A;  1L4D A;  3TPI Z;  1O31 A;  1TFX A;  2VH6 A;  5AHG H;  1S6H A;  1KXC A;  1EPT B;  1CO7 E;  3RU4 E;  1PQ5 A;  4RI0 A;  2C8Z B;  3T27 A;  1LVM A;  2QV1 A;  5ABW A;  3TNS A;  1V2R T;  4FUH A;  1G3E A;  2AER H;  4Q7Y A;  3P17 H;  3NRL A;  1LVO A;  4BNR A;  2VB0 A;  1HXF H;  2CXV A;  1CGJ E;  1W10 U;  1LPZ B;  4AC9 A;  1NFW A;  4MDS A;  2BLQ A;  1W12 U;  1JIM A;  1GJA B;  3S9C A;  2D26 C;  1ZGI A;  2FLB H;  1ESA A;  3EA9 A;  1ZYO A;  3BG4 B;  4Q2K A;  1GJ8 B;  1UCY E;  1OHH D;  2Y7X A;  3TGI E;  1AUT C;  1SI5 H;  4U2W A;  1GJ4 H;  4BAN B;  3M7Q A;  3P8N A;  1AZ8 A;  1BQY A;  1KTS B;  1SGC A;  3SGB E;  5A2M H;  4DIH H;  1TWX B;  4A6L A;  5KED A;  2BQ6 B;  2WPI S;  3KN2 A;  3A88 A;  1ZOM A;  2YMS D;  1TX8 A;  4MNW A;  4MQA A;  4DUR A;  3E8L A;  1P3E A;  2ZTY A;  4K8B A;  4XRN A;  4ABB A;  1GVZ A;  1P2J A;  1TE0 A;  1DAN H;  3GDV A;  2YMS C;  5SGA E;  1P04 A;  3ZZ5 A;  3VPK A;  1EQ9 A;  5DG6 A;  5EW2 H;  1O3P B;  1SGQ E;  3L33 A;  4RKJ B;  1V2P T;  1T4U H;  1C2D A;  3LC3 A;  1UJ1 A;  2BD7 A;  4DT7 B;  1YP9 A;  1EAI A;  1K28 D;  1GHA G;  2FOD A;  3ZVC A;  1XXD A;  3MNB A;  1C2K A;  1D3T B;  1FY4 A;  3KF2 A;  1YPM H;  4K3J A;  1OP8 A;  1TPA E;  1ELT A;  1L1N A;  4E7R G;  1YPK H;  2HPQ H;  1EFR D;  1SQR A;  2QC2 A;  1YPH E;  1QJ1 B;  2Z9G A;  2BDA A;  5C94 A;  3MNX A;  1ZSK A;  1ZTJ A;  2ZZU H;  3V7T A;  4NSV A;  3E3T A;  4IS5 A;  2TIO A;  2GMT B;  4WJG 2;  4GAW A;  4F48 B;  2VIO A;  1C1V H;  2A0Q B;  1HAY B;  3RXJ A;  3LIW A;  2SGE E;  1CA0 C;  3RU4 D;  3K9X B;  2P94 A;  5E8E H;  7LPR A;  1D4P B;  1GCD A;  1BTH H;  1THS H;  1BZX E;  2V0B A;  3VFE A;  2M5T A;  1AUJ A;  4K1E A;  1GJ5 H;  1C1S A;  3PV2 A;  1W7G H;  1UMA H;  2GDD A;  2ZP0 H;  2ZU2 A;  3K2U A;  2BDH A;  2OC7 A;  1WU1 A;  2V3M A;  2Z3C A;  2XW9 A;  5T6G A;  3ZZB A;  3VGC B;  2G5N A;  5DGJ A;  1YKT A;  3H7O A;  1ZHP A;  1MCT A;  5JB9 S;  4AFZ A;  1K22 H;  2BD8 A;  2AS9 A;  4UE7 H;  1HJ8 A;  3SV9 A;  3UWJ H;  2ZU3 A;  4B71 A;  3MOC A;  5BPE A;  1BJV A;  4RKO B;  4B74 A;  1GWA A;  3KGP A;  4X0W U;  2FMJ A;  3KNX A;  4CR9 A;  3O8R A;  1CGH A;  1CBW B;  1HPG A;  3KYF A;  2ZO3 H;  1INC A;  1F2S E;  3EGK H;  1V2Q T;  4B6F A;  5DP6 A;  4BXS A;  1F0T A;  3SJI A;  3W95 A;  3PO1 B;  1OWD A;  2KCY A;  1DXW A;  2OQ5 A;  1K1I A;  2XBX A;  3FP6 E;  4E06 H;  1XKA C;  3LGT A;  1DDJ A;  1TIO A;  1PPF E;  5FXL A;  5EOK A;  1OSS A;  1UO6 A;  3M3S A;  4X8U H;  1FZZ A;  4ABA A;  1DFP A;  3ZVG A;  4ZHL U;  2ZGJ A;  4JYU H;  1TA6 A;  1WV7 H;  3S7H B;  2OP9 A;  2GKV E;  1PPC E;  2BQW B;  1PPB H;  2SNW A;  1ANC A;  5C17 A;  2K8I A;  2LNC A;  5GIB A;  3U9A H;  1ZHR A;  1Y8T A;  1OP0 A;  2A5A A;  1C5T A;  1O35 A;  2P95 A;  3KEE A;  1VIT F;  3FO8 D;  4RT0 A;  3UQO A;  1HAI H;  1F0R A;  1D3D B;  1T32 A;  4BTT B;  1KSN A;  1DLK B;  1GHZ A;  3FZD A;  2NWN A;  2BDG A;  3P70 B;  2Q6G A;  1B0F A;  4B2B A;  1C5L H;  3HKJ B;  7GCH F;  2DUC A;  1O2G H;  1SC8 U;  2G8T A;  4X6M A;  2BD9 A;  3BEF B;  5E2O A;  4ZKN U;  5J4S A;  1JIR A;  1EAX A;  4YT7 H;  1AQ7 A;  2OUA A;  1V2N T;  1SR5 C;  1YPH C;  4ABJ A;  3D65 E;  3A7Y A;  1MCV A;  1UW7 A;  2G81 E;  2IPQ X;  1K1P A;  1LTO A;  2P8O B;  1D9I A;  1V2M T;  1L2E A;  3DHK H;  2GZ7 A;  1C1U H;  2F9V A;  5C1X A;  1FIZ A;  2GZ8 A;  4YT6 H;  1VZQ H;  4FXG H;  5EU8 A;  3F68 H;  2GTB A;  4CH2 B;  5HKK D;  2EI7 A;  1JMO H;  5E0G A;  1SSX A;  2CF9 H;  4H6S B;  2QGR A;  3RXU A;  3A82 A;  5AFZ H;  4HI3 A;  3SOS A;  5FBE A;  2UUK B;  2F9O A;  1O0D H;  4YOG A;  2A1D B;  2EI8 A;  1IQI A;  2EY4 C;  1GBC A;  1O2T A;  2D8W A;  1S5S A;  1W3C A;  3E6P H;  1QBN A;  2KZ4 A;  4K1S A;  1MKX K;  1UTL M;  3MO9 A;  1QL7 A;  1P9S A;  4AFQ A;  1MU8 B;  3QGN B;  1CT0 E;  5LGO A;  2RDE A;  6GCH G;  1LHD H;  4Z6A H;  1QFK H;  3A8C A;  1KDQ B;  3PV5 A;  3E91 A;  1MAY A;  3URC A;  1IQK A;  3UUZ A;  1FIW A;  4YTA A;  1QB9 A;  2A32 A;  4UFG H;  3SU3 A;  3RLY H;  1T7C A;  3A89 A;  1MUE B;  3BSQ A;  3M5L A;  1Q3X A;  1VGC C;  1L1G A;  1OP2 A;  2ANY A;  4CH8 B;  5EJZ A;  1FDP A;  2BDC A;  4UFD H;  1KIG H;  1MKX H;  2VVU A;  2ZDV H;  2VH0 A;  1B0E A;  1FLE E;  1AFE H;  1G3B A;  1YPG H;  1TQ0 B;  1ELD E;  2BDY A;  1EJA A;  4ACA A;  1IHS H;  2D1J A;  2HNT E;  1QB1 A;  3NWU A;  3TGJ E;  2Y82 A;  5FX5 A;  1L1J A;  1EOJ A;  1GVL A;  1EPT A;  3PM3 A;  4NA8 A;  2STA E;  1E35 B;  2BM2 A;  3IIT A;  2H1U A;  4JK6 A;  5F6M A;  5AFY H;  1MZA A;  1ARC A;  3F2H A;  4A1X A;  1YLN A;  9LPR A;  3BV9 B;  2PUQ H;  1QRX A;  1ZMJ A;  2Z3E A;  1EKB B;  2TGT A;  1ZML A;  4XBC A;  3CNR A;  1SVP A;  1BBR E;  2F4L A;  1NRR H;  2F9U A;  2ZC9 H;  4I32 A;  3MU4 A;  3RC4 A;  1GI6 A;  3SHC H;  3O8D A;  4X1P U;  1EP5 A;  1K1L A;  1C1P A;  4E7N A;  3GCT F;  3OX7 U;  2SFA A;  1VIT H;  3VB5 A;  1A0L A;  3GYL B;  3FP7 E;  1S81 A;  2NU2 E;  2ZG0 H;  1SLU B;  1XUI A;  3SOR A;  1Z8J B;  2KX4 A;  3QDZ B;  1DWE H;  1M9U A;  1OYQ A;  4A92 A;  3AW1 A;  4JYV H;  1GBH A;  2Y5H A;  1T8M A;  1XUK A;  2P93 A;  3TK9 A;  3SI3 H;  3QN7 A;  1BIT A;  1AZZ A;  1RD3 B;  4FUD A;  4O3T A;  1BDA A;  3RXI A;  1TNK A;  1AWH B;  1UVS H;  3TJO A;  2Y5G A;  2ZCL P;  1LHF H;  3MO6 A;  1SQO A;  3N7O A;  2Y6T A;  5C3N A;  1HAH H;  2FIR H;  3P92 A;  2O8U A;  2PUX B;  3B23 B;  1BA8 B;  3HAT H;  4WXI A;  2R0L A;  3SBK A;  2TGA A;  4NSY A;  2Y80 A;  1HFD A;  2VJ1 A;  4CRF A;  5IK2 D;  1O3I A;  2OBQ A;  4IN1 A;  8LPR A;  3RMN H;  3BTE E;  1SGD E;  1ZRK A;  1HV7 A;  1BMM H;  2AYW A;  4X6N A;  1NZQ H;  2DE9 A;  3U1J B;  1W7X H;  4KGA A;  2PSX A;  2QY0 B;  2PGB B;  2VIW A;  1W0Z U;  1QBV H;  2BDB A;  3RXK A;  1ID5 H;  5DP8 A;  1GI7 B;  4NIV A;  3SND A;  1GHB F;  4B73 A;  1ZHM A;  2W6J D;  5TCA A;  3RXD A;  4QT8 C;  2FX4 A;  2J92 A;  4U32 A;  2Y81 A;  5EXM A;  1O2R A;  4ABH A;  2H5C A;  2BY7 X;  2PKS B;  1EPT C;  1SGF G;  1EAT A;  3PTN A;  4DVA U;  1FON A;  1F5R A;  1A0J A;  4WWY A;  4AFS A;  3A7X A;  4TWY A;  1A0H B;  5A8Y A;  5E2P A;  3TGK E;  3LJO A;  2GJG A;  4O03 A;  1GI2 A;  2HNT C;  4B6E A;  1D3P B;  5JBB S;  1WXR A;  1GI5 A;  1GMC F;  3SGA E;  1IQN A;  3GY6 A;  2CN0 H;  3T5F H;  1TBZ H;  2QXH A;  2A4G A;  1EAU A;  1GI1 A;  4K8Y A;  4I8H A;  3OYP A;  5C20 A;  3MNS A;  1O3L A;  1EJN A;  3GDU A;  1TGT A;  2PR3 A;  5JPM H;  3S9B A;  1EXF A;  1P2I A;  3VB6 A;  3SV8 A;  3LON A;  2Z3D A;  3OSY A;  4Y6D A;  3A81 A;  3MMG A;  3UY9 A;  1P0S H;  2BDI A;  2W3I A;  2FO9 A;  2M2A A;  4VGC B;  3BTT E;  1QUR H;  1QRW A;  1VJA U;  1W0J D;  3F0P A;  3RDZ A;  4OS4 A;  2Q6D A;  2BVX H;  1SHY A;  1XX9 A;  3GCO A;  2H6M A;  1ANE A;  1HRT H;  4I8K A;  4ASH A;  4RSP A;  1G9I E;  1RIW B;  3RXT A;  4FET A;  1ELF A;  1CHO F;  1WUN H;  1AVW A;  4IC5 A;  3OFN D;  1TMU H;  2FOB A;  2BTC E;  3VB4 A;  4INK A;  2PW8 H;  3EQ0 H;  1UK2 A;  2C8W B;  1MTN B;  1Z71 A;  2HLC A;  2I6S A;  3UNR A;  1TA2 A;  1G37 A;  3S69 A;  1FNI A;  3U69 H;  1K0H A;  1IQL A;  3A87 A;  2STB E;  3MU0 A;  4MTB A;  4ISI H;  5GPI B;  1N1L A;  4I8J A;  1PQ7 A;  1HBT H;  1O2L A;  2GVF A;  4UEH H;  2BVS H;  1C4V 2;  4I33 A;  1UVT H;  2ZCK P;  4GCH F;  3GY5 A;  1LCY A;  2BXT H;  3TH4 H;  1CE5 A;  1C1N A;  2GDE H;  4P00 A;  3RXH A;  1HB0 B;  3EA8 A;  2ZPS A;  2ZFP H;  3IWM A;  4IC6 A;  1O3J A;  3FP8 E;  4ZMA H;  2OCV B;  3MH7 A;  1T8L A;  4I7Y H;  1JXP A;  1UK4 A;  1ZPB A;  1FQ3 A;  3MTY A;  1FX0 B;  1P57 B;  5JDU B;  4I86 A;  2O8T A;  3KQB A;  1GCT B;  3AAU A;  4B76 A;  1DOJ A;  1BHX F;  1KY9 A;  3KL6 A;  1SFI A;  1TQ7 B;  3VB7 A;  1TYN A;  5A8X A;  1S82 A;  4JCN A;  2THF B;  2HGT H;  4WMF A;  1Z8G A;  5GWZ A;  1Y3Y A;  3MU1 A;  3F2G A;  2ILN A;  3SN8 A;  2GCT B;  1H9I E;  2FP7 B;  1EJM A;  1J9C H;  1HUT H;  1WOF A;  1N6Y A;  2KCP A;  5DP3 A;  1GBF A;  1CSO E;  2BOH B;  2WPL S;  3ZIA D;  4NGA H;  1PPH E;  3HGP A;  1J14 A;  3VGC C;  1P06 A;  3PRB A;  3M5N A;  1V2T T;  1TON A;  3VG8 A;  5JBC S;  1EAS A;  4E05 H;  1G2M A;  5JBA S;  2G51 A;  2OTV A;  5C67 A;  1AD8 H;  4RN6 A;  4AGJ A;  1BMF D;  4LOY H;  1H1B A;  4INL A;  3T26 A;  4DT4 A;  2AEI H;  1VIT G;  1UTJ A;  1CBW C;  2QN5 T;  1QRZ A;  1NFY A;  2OXS A;  5EXN A;  1RGQ A;  2RCE A;  2IN2 A;  3DD2 H;  2B5T B;  4A5T S;  7GCH G;  5A8Z A;  4Y8X A;  4TYD A;  2WPM S;  1KDQ A;  3UR6 A;  3SUG A;  2C93 B;  1P05 A;  1EZU C;  3UR9 A;  8GCH F;  1NS3 A;  2BMG B;  2PFE A;  2CHA C;  2J95 A;  1QHR B;  2V7Q D;  3T29 A;  3QO6 A;  1C1O A;  1UTK A;  1E36 B;  1LKA A;  4XBB A;  1XVO A;  3SJK A;  3W94 A;  1DUE A;  1DIC A;  2I6Q A;  4KTU A;  3LT3 A;  1BTY A;  1TPO A;  3URD A;  4A1T A;  5L30 H;  2ZQ2 A;  2XWA A;  1P2M A;  2GT8 A;  3DSO A;  3S7K B;  3R0F A;  2BLV A;  2KCO A;  1NT1 A;  1K2I 1;  1TMT H;  3A84 A;  1C5N H;  2SNV A;  1P3C A;  3SGQ E;  4K69 A;  3CEN A;  1PPE E;  1GBJ A;  1E38 B;  3UFA A;  3GY7 A;  3ODD A;  2O9Q A;  2G00 A;  1ZLR A;  5EQS A;  1YLD A;  1Y59 T;  1NM6 A;  1FY5 A;  1UHB B;  1SLW B;  1W0K D;  1AB9 B;  5BRR E;  1MQ6 A;  3MWI U;  2P8O C;  2XCN A;  2VIP A;  1FXY A;  1YPJ H;  2OC0 A;  5EST E;  2RA3 A;  3FKS D;  1ELA A;  5JB8 S;  4YLQ H;  3PRD A;  4JZE H;  3PMH B;  3GDS A;  5LPE A;  2JH5 D;  3LGU A;  3SO3 A;  1GGD B;  1UVU H;  1ETR H;  1P03 A;  4NIW A;  5DP9 A;  1O3F A;  1DXP A;  1SGP E;  1UCY K;  1ZRB A;  4XOJ A;  3ZZ4 A;  4IMZ A;  5EJ1 A;  4KP0 A;  5GDS H;  3RLW H;  2WIN I;  4YM9 A;  4NWL A;  4YES B;  4I8G A;  1PFX C;  3BTD E;  5EGM A;  5IYT A;  1Y3U A;  4ISO A;  2FM2 A;  5GCH F;  5HIY A;  3SU2 A;  5C0U A;  1BTW A;  1VCQ A;  2NU1 E;  3A8D A;  8EST E;  1P11 E;  1QA0 A;  3ZZD A;  1KXF A;  2V35 A;  3RXE A;  2XC4 A;  5K0H A;  4OS5 A;  2C8X B;  4LZ4 B;  4THN H;  2GCH G;  1TNH A;  4Y0Y E;  1NRO H;  3NKK A;  4FUF A;  5A0C A;  1F92 A;  1GMD F;  1C2H A;  2ZDA H;  1HJA B;  2L6O A;  2FX6 A;  2PHB A;  4HG6 A;  3LDX H;  3OE7 D;  1UCY H;  1H9L B;  3PYH A;  3PMB B;  4TSF D;  2FOA A;  1SGR E;  3F3B A;  2UUJ B;  1O3D A;  5C1Y A;  3F1S B;  3TK5 A;  2XBY A;  4LK4 A;  1DY9 A;  3N7D A;  4UFF H;  1KXA A;  4O9V A;  2V3H H;  1A3B H;  4MG3 A;  5EPN A;  1THR H;  3TK6 A;  3OEH D;  1EOL A;  1G32 B;  3BTG E;  2BY5 X;  3GCT G;  4X2Y A;  3Q3Y A;  4X8T H;  1TGB A;  2FYQ A;  1YYY 1;  4JK5 A;  2EEK A;  1K1M A;  5C5O A;  1ELE E;  1LHC H;  3ZZ3 A;  2ODP A;  1WYK A;  4O97 A;  1PJP A;  3MI4 A;  3E90 B;  4ZKS U;  2PLX A;  2TGD A;  1OWK A;  1O5A B;  5CHA B;  5EOD A;  1O3A A;  1P2N A;  5F53 A;  2J9N A;  5C0T A;  3DCL A;  3UOU A;  2IJO B;  4NG9 H;  5HM2 A;  5HGG A;  3RXV A;  1PQA A;  3GCN A;  3ZZ7 A;  3RM0 H;  1ZMN A;  5FCK A;  2ASU B;  2ZNK H;  3HGN A;  1WDI A;  1HLT H;  4X6O A;  9EST A;  4KTS A;  1TAW A;  1TX7 A;  1B5G H;  4X2W A;  2HVY B;  2ZDM A;  3W1E A;  1CU1 A;  1SGE E;  3GYM A;  4BTI B;  1OS8 A;  1SGF A;  1KLT A;  3SV2 H;  2O8L A;  3LGI A;  2QF4 A;  4HFP B;  1E37 B;  1E1Q D;  3A7W A;  1P01 A;  4YZU A;  1GHB G;  2ZEC A;  1KLI H;  1W14 U;  4NCY A;  3KQC A;  2FEQ H;  2QF3 A;  2CJI A;  4I8L A;  3T28 A;  4J2Y B;  4IBL H;  4JZ1 A;  2J97 A;  2XOK D;  1QR3 E;  1NO9 H;  2ODY B;  5T6D A;  4B75 A;  3FN8 A;  1SB1 H;  1C5P A;  2Y5F A;  1GL0 E;  1O5E H;  2L74 A;  3FOA A;  4MNX A;  1JOU B;  2B7D H;  5EJL A;  3OAA D;  1V2O T;  1BRC E;  3FVF B;  1GMC G;  1W8B H;  3RXR A;  3SUD A;  3M5M A;  1V6D A;  4ZH8 A;  3ZZA A;  3PLP A;  3EA7 A;  4Y79 A;  1QJ7 B;  1A5I A;  1LHG H;  1H8I H;  2PKS C;  1C4Y 2;  5B6L A;  4JMY A;  4NWK A;  3RXO A;  2HOB A;  5L2Z H;  3EE7 A;  2ZEB A;  2BY9 X;  4GLY A;  2ZQ1 A;  3SYJ A;  2B0F A;  4ZXY H;  4TY7 A;  3RXC A;  3RUO A;  1G2L A;  3OY6 U;  2XCF A;  3F9G A;  1GI3 A;  2WPJ S;  3BTM E;  3ITI A;  1OWH A;  4Q63 A;  3RXS A;  1HNE E;  2VBC A;  2KAI B;  5GXP A;  1XUG A;  2BZ6 H;  3ZVE A;  2TGP Z;  2WSS D;  2R2W U;  1A5H A;  1CHO G;  5LPR A;  3GOV B;  4BOH A;  3TVJ B;  1EB1 H;  1LKB A;  4WY3 A;  1ZPZ A;  4Z0K A;  1O36 A;  1QQU A;  7EST E;  1GJ7 B;  1NES E;  1DWD H;  1AVG H;  2CK3 D;  1ORF A;  1Y5U T;  2BX4 A;  5K7R A;  1ELC A;  4VGC C;  5CE1 A;  1VKY A;  1DX5 M;  1S85 A;  4GCH G;  3M36 A;  3ZZ8 A;  4NIX A;  3RMM H;  2A2X H;  2H9E H;  1QGF A;  3ZYD A;  5JYI A;  2VWL A;  1K21 H;  7KME H;  2AMQ A;  2YNB A;  2ZPQ A;  5DJ7 A;  1EZQ A;  2SGD E;  1Y3X A;  1RIW C;  3SU1 A;  1SLX B;  3SU6 A;  1O5F H;  1F5L A;  1O2Q A;  3LGV A;  2H2Z A;  5TCC A;  3QUM P;  3ZZC A;  4ACB A;  3SZN A;  3MHW U;  4JYT A;  2JET B;  1AFQ B;  3PMJ A;  1O2H A;  2FPZ A;  1MTN C;  3L6P A;  1O2I A;  3P8O A;  4OS6 A;  3ZVF A;  2ZPR A;  1DLE A;  1GDU A;  1LMW B;  1SGT A;  5L6N H;  4P02 A;  2H5D A;  4FOU C;  1DWB H;  3STJ A;  2ZFS A;  4ISL A;  2W5E A;  4H4F A;  1IQH A;  2BYA X;  1BJU A;  5E0J A;  1GL1 A;  4PRO A;  5T6F A;  4IGD A;  2BD2 A;  1F0U A;  1C5M D;  3N7E A;  2O8W A;  3TH3 H;  3VB3 A;  4YXW D;  1O3B A;  1P2O A;  4AYY B;  4K1T A;  1RTL A;  1MKW K;  1UK3 A;  4SGB E;  1UTP A;  3M5O A;  4X8V H;  2KFW A;  1E1R D;  5F8X A;  3ATW A;  4ASU D;  1HIA B;  5DP4 A;  4AFU A;  2BLO A;  1S84 A;  1DWC H;  3CS7 A;  1KYN A;  1GCT C;  2HLD D;  1BML A;  4GHQ A;  3GY8 A;  1GBE A;  2R0K A;  4CRB A;  4DGJ A;  2UUF B;  1DSU A;  2PWX A;  3TLO A;  3KQD A;  3RML H;  3BTW E;  1YWU A;  1IOE A;  2OLG A;  1GBI A;  1GI9 B;  1NFU A;  2GCT C;  1PYT D;  1T8N A;  2OC1 A;  4RT1 A;  2IJD 1;  1V2V T;  3P95 A;  1AKS B;  1IQJ A;  2PGQ B;  1BBR K;  1PYT C;  2F9B H;  1W2K H;  3FAO A;  4OGX A;  3OY5 U;  3QTV H;  1TAL A;  1VJ9 U;  5CHB A;  2JJ2 D;  3LJJ A;  3D62 A;  1MZD A;  1Y5B T;  3MU5 A;  4F55 A;  8GCH G;  1C2L A;  2QF5 A;  2P3U B;  1MTV A;  1NFX A;  2GD4 B;  1EST A;  1AND A;  1C1T A;  4NZL A;  5F03 A;  1AN1 E;  2P3T B;  3RM2 H;  2QAA A;  1UTM A;  1THP B;  4D9R A;  5FPT A;  1VR1 H;  5J4Q A;  3U8O H;  1NBM E;  1BBR H;  3PWC A;  3OTJ E;  2D2D A;  3F9H A;  1W13 U;  4CBN A;  2W26 A;  2P59 A;  3LH1 A;  3DSG A;  3RXF A;  1QA7 A;  1W0Y H;  1AVX A;  1LQE A;  2F9P A;  3QK1 A;  2A7H A;  5T1V A;  2B9L A;  5A0B A;  2OIN A;  1C5R A;  3QX5 H;  2GGV B;  1BOQ A;  2K0Q A;  1D3Q B;  1TGC A;  1TPS A;  1TGN A;  2SGP E;  2VU8 E;  1CVW H;  1ESB A;  2SGF E;  4FUC A;  4GPG A;  3Q76 A;  1AE8 H;  2FI3 E;  1ABJ H;  2FXR A;  1GBM A;  4BAO B;  1C1M A;  4X1Q U;  3NZI A;  5C1U A;  1QB6 A;  1WTG H;  1NRQ H;  3HPT B;  1FY1 A;  4KKD A;  1LVB A;  1JWT A;  4ZRO A;  5F8Z A;  4BAK B;  2FYR A;  1TRN A;  4OS1 A;  3BG4 C;  1XXF A;  1NRP H;  2KR7 A;  1DT2 A;  3HK3 B;  5GCH G;  1AB9 C;  1HAV B;  3OU0 A;  3KQ5 A;  4NIY A;  5CMX H;  3QZQ A;  3VEQ B;  1LPG B;  2J98 B;  1YCP M;  2V6N A;  1G36 A;  2WHX A;  1C2E A;  1O2N A;  3AW0 A;  4XSK U;  1C9T A;  1ANB A;  1G30 B;  3M3T A;  1GMD G;  1GGD C;  1AY6 H;  2GV6 A;  2Y7Z A;  2ZFF H;  3EYD A;  1GDQ A;  3RXM A;  1AWF H;  2QA9 E;  1OWI A;  3PLK A;  1A2C H;  3P8G A; 
#chains in the Genus database with same CATH homology
 3U28 C;  3UAI C;  2EY4 C;  2HVY B;  2EQN A;  3MQK C;  2V3M A;  2RFK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...