4RSPA

X-ray structure of mers-cov nsp5 protease bound with a designed inhibitor
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
304
structure length
303
Chain Sequence
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orf1a protein
publication title Ligand-induced Dimerization of Middle East Respiratory Syndrome (MERS) Coronavirus nsp5 Protease (3CLpro): IMPLICATIONS FOR nsp5 REGULATION AND THE DEVELOPMENT OF ANTIVIRALS.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 86
structure length 303
sequence length 304
ec nomenclature
pdb deposition date 2014-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4rspA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4rspA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4rspA02
4I33A 5FHTA 1JWTA 1GJBB 2XCNA 1O3OA 1TGCA 5EPNA 1UVPA 1LPKB 4NIVA 5AVDA 4CRFA 5HM9A 3SN8A 1WBGB 1A46H 1FY1A 1CA0C 1GBHA 1ELBA 3TNSA 1BTWA 3M7UA 3MNCA 3BTQE 1O3EA 1VITH 4K1TA 1ZJKA 3Q00A 2SNWA 3ATMA 2ZO3H 1IQFA 1UO6A 3VB6A 2PFEA 1T8NA 5T6FA 1LKAA 3TGJE 1FJSA 1AU8A 1AQ7A 2HLCA 2ZPSA 3A80A 3FP7E 3SO3A 3EA9A 4BAHB 4BXSA 5AF9H 1K1JA 2F9UA 1MD8A 3MNXA 1A3EH 4GHTA 3ZVGA 2ZHQH 4ZHLU 5JPMH 1EKBB 2O8LA 3UIRA 3TIUA 1RGQA 3S9AA 1EXFA 3ZZDA 1BB0B 4Q7YA 1P01A 2BD3A 3NCLA 2Q6DA 4U30A 4B75A 3BG4B 1YM0A 1BUIA 2RDLA 4K3JA 3RC5A 3ZZ9A 1RFNA 2J92A 3ZYDA 3QLPH 1ETTH 4GAWA 1NPMA 3FANA 1O3MA 2VGCC 3BEIB 3UFAA 2HVXA 1UK4A 1JBUH 3HK3B 1QGFA 5BRRE 1BRAA 1ELVA 3GISB 1AIXH 4X1NU 8GCHG 5EXNA 2ILNA 1L4DA 2ZU4A 2JH6D 1B7XB 1SFIA 1ZZZA 3E91A 1C5ZB 2VIPA 4INHA 3KQCA 3RUOA 4F49A 1J17T 1SR5C 3FVFB 1AUJA 1GMHG 3SBKA 2NU2E 2BHGA 2FODA 1VCQA 3NPSA 1UHBB 1AZ8A 1N8OC 2ZP0H 3PB1E 4FVBA 3LH3A 4Y8ZA 1ZMJA 1N6YA 2H1UA 4NFFA 2D8WA 9LPRA 3SJIA 3RXRA 1FPHH 3WY8A 5JDUB 1EAIA 3A81A 7LPRA 5E2OA 4MPUA 3GCOA 4K2YA 4IMZA 1PYTC 5I46H 5FX6A 3TGIE 1LPZB 3SUEA 5LPEA 1KDQB 1UHBA 2VB0A 3TLOA 1LHEH 2Z9JA 4TY6A 1BRBE 3S7KB 2FYQA 1FLEE 5F6MA 4AB8A 3BN9A 1C5RA 1ELDE 2BD7A 4NZLA 2QF3A 1C4U2 4MVNA 3TJOA 3BTME 1OXGA 2PGQB 4QT8C 8GCHF 3GOVB 4JMYA 4AG1A 1EZQA 1Z8IB 2ODYB 1KIGH 1D6WA 3SU1A 1ZYOA 1MD7A 1HAPH 1P2IA 2R3UA 3HKIB 2TIOA 4I31A 1KDQA 1GMHF 2TGPZ 3QDZB 2ZCLP 4MG3A 1HAHH 3BIUH 1PPCE 3MH7A 4ABGA 1T31A 1TALA 1O3LA 5G4BA 3V7TA 2F9PA 2BY5X 1O5DH 1SGRE 3SI4H 1INCA 3T26A 3ELAH 4DOQA 1BJVA 2HGTH 2FXRA 3BTKE 6CHAB 5C20A 3U1IB 3KIDU 3F9GA 1GI2A 1ESBA 2F9OA 3URCA 2P95A 3SUDA 1BTPA 1C1PA 1XM1A 1GJAB 3EGKH 1DWDH 4X8SH 1ZRKA 2NU0E 3W94A 3DT0H 1TONA 4BAKB 1W2KH 1EPTA 2V3OH 3KQEA 1DDJA 1D6RA 3PWCA 1GI1A 1Z8RA 3ZVCA 1C1OA 4X2XA 2F9NA 1PPBH 3AASA 3P8NA 1V2TT 2WPJS 5DP8A 1W11U 2JKHA 4X6PA 2A32A 4MPXA 1XXFA 1MAYA 1AKSA 1K9OE 1EOLA 1AD8H 3B8JA 1DOJA 2XWAA 3A7XA 4H4FA 4JZFH 2RA3A 3M35A 4ZMAH 1GBFA 1AUTC 4BTTB 4FU9A 2XRCA 2GDDA 3A87A 2D2DA 3CENA 3F68H 3TJUA 1OX1A 2LPRA 1C1VH 1Y59T 3BTFE 3LGWA 1AFQC 3GCHB 3ITIA 2ZFSA 3TGKE 1C1SA 1ZR0A 3UWIA 3E0PB 3UNRA 2PSYA 3LGUA 4VGCC 1C9PA 1DXPA 1BHXF 3QZQA 1QJ1B 2GV7A 2OCVB 1Y3WA 1BJUA 4CRGA 1XVOA 2XTTB 1O2JA 1P2JA 1Z6JH 4K60A 2GT7A 2FLBH 3ZZ5A 5GCHG 2G5NA 3PMHB 1B0EA 1SGEE 2DE8A 3UR6A 1C1WH 1H1BA 1SGDE 3LU9B 1TOMH 2QA9E 2ZTXA 1G2MA 3RMMH 3RXAA 2C8WB 7KMEH 4NIYA 1ESAA 5TCAA 1TBRH 2UUKB 1T8MA 1OP2A 1CU1A 1UVTH 1TMBH 2FI3E 3Q77A 1C5TA 1KY9A 2O8WA 1WQSA 4GPGA 1GI9B 1P9SA 1F0UA 1HV7A 3SORA 4HFPB 1VGCB 3M3VA 1MTNB 4IC5A 2QCYA 3MO3A 3MNBA 3TNTA 3MHWU 2BDBA 4X8UH 1AVWA 3DFLA 2FESH 2VIVA 5E0JA 2WYJA 8KME2 4WMEA 1XUFA 4NIXA 4CRBA 3VXFH 3SHAH 1DY9A 4WF8A 3RU4E 2W3IA 3GY3A 1YGCH 1P03A 1UVUH 3E90B 1TX8A 3HGNA 1TNLA 1C5WB 1QJ6B 4ZKRU 5DO4H 1W0ZU 2OUAA 2P8OC 1GI5A 3P8GA 5I25A 2Y6TA 4ABJA 2A2XH 4B74A 1ZMLA 2P3UB 2HRVA 4ABFA 1C2MA 1YPEH 2TGDA 4DURA 1F0SA 1O2SA 1A0LA 1T7CA 1VCPA 1T4UH 1TBZH 2W5EA 4CBOA 2NU3E 3I77A 1W3CA 2H5DA 1TFXA 2CHAB 4AGKA 2W7SA 3MI4A 1GPZA 1TRYA 1AZZA 3R0FA 1IHSH 1FZZA 4HZHA 1DT2A 2A4QA 3ZV9A 1AE5A 3K6YA 4E05H 3SZNA 3SJKA 2V3HH 1V2KT 4X1SU 3E8LA 1IQJA 4OS4A 1QBOA 3A7VA 2GMTC 1QNJA 1QL7A 1DLEA 2FMJA 3SJ9A 1TQ7B 1O3HA 1Z6EA 3L6PA 1GI8B 3MWIU 2PGBB 1SG8B 1EJNA 4PROA 3RMNH 3T62A 2CXVA 1ZHPA 1PYTD 1MAXA 2IOTA 4NG9H 1ZTJA 4X8VH 3RU4D 3QTOH 1BTXA 1O5EH 2PUXB 1TX7A 2R9PA 1EAUA 5EODA 3TK6A 1TOCB 2AS9A 1HLTH 4WMDA 4HI3A 1PPFE 4NWLA 3S69A 4Z6AH 1SC8U 3QUMP 2YNAA 4YT7H 4TWWA 2WPMS 2AIPA 1LPGB 1IQIA 1K1LA 1IQMA 2BY9X 4NSVA 1EZSC 3CP7A 4ZKSU 1EJAA 1ELGA 2PLXA 5DP5A 1BMMH 1JIRA 5L6NH 2BZAA 1TPOA 2Q1JA 4XBCA 3O8DA 2ZEBA 2FYRA 3QO6A 1F5LA 3A84A 1WQVH 1Q2WA 4D76A 2VIWA 4Z0KA 1NRNH 3BF6H 1NTPA 3RXEA 3M7QA 1QFKH 5A0BA 3V12A 1NFYA 3E0NB 1O3PB 3PLKA 1GVZA 1TMUH 4X0WU 1QRXA 2BLWA 2ZDMA 1BHXB 1JIMA 3HK6B 3EBNA 2Y5GA 5AHGH 2F83A 1ORFA 4FU7A 1C5SA 3QGJA 1D3QB 1FIWA 1CT0E 3MU1A 3SV7A 1SPJA 4Y8XA 1P9UA 1CO7E 2HWLB 3TK9A 2FM2A 5C5OA 1EX3A 4ZKOU 4GUXA 2ZIQH 2GTBA 2HALA 3NXPA 2K1QA 4LOYH 1NFXA 4Y7BA 3GY8A 2EI6A 1GMCG 1FY3A 1F2SE 4FUEA 1SQAA 3UPEA 1O38A 3LGIA 1EUFA 1Y3VA 2GT8A 2I6SA 1C1NA 6LPRA 3UNQA 1UK2A 1EQ9A 1Q31A 2ZQ2A 2F91A 1G3EA 1LTOA 1SGPE 3RXGA 1BQYA 2A7JA 2THFB 4RSPA 1BIOA 1O2UA 1OWDA 2B8OH 2F3CE 5J4QA 2UUYA 1ZGIA 4Q7ZA 4WWYA 1GMDG 3MOCA 4O3TA 2R2WU 3M3TA 1QIXB 1GBJA 1EATA 1LVYA 2RCEA 3RC6A 5A0AE 3JZ1B 1SGFG 1UVSH 1J9CH 1UCYE 3PYHA 1HAIH 1P3CA 3LOXA 4K8YA 1JRTA 3VEQB 1S5SA 2SFAA 1OS8A 1QB9A 4B71A 4UFEH 1VCWA 3LJOA 3OY6U 3VB7A 1GMCF 1SLUB 1IQKA 1VJAU 1SLVB 4JCNA 1RTFB 1EJMA 4I8JA 2ODPA 3Q3XA 1C5QA 1GJ4H 1GVKB 4Q2KA 3F1SB 2DUCA 1Z8JB 2BOHB 5F8ZA 2GP9B 1THPB 1WYKA 2ZNKH 4Y8YA 1K1OA 1CA0B 2BD8A 1DVAH 3VB3A 2TGTA 4THNH 1TAWA 1DE7H 4K1EA 1SGQE 2ZDVH 1OYQA 1TABE 1CQQA 4FUFA 3F9HA 2Z3CA 4UE7H 2A2QH 1DM4B 1GMDF 1B0FA 1TPAE 4XBBA 1SL3A 3S9BA 3QZRA 4O3UA 5B6OA 1GHVH 1FIZA 4MTBA 1TE0A 5FCKA 2VJ1A 3BTEE 3PO1B 1HIAA 2BOKA 2W7UA 4J1YA 2ZDKA 4OGXA 1MU8B 2B9LA 2BDCA 3OY5U 4JYTA 1MH0A 4WY3A 4NA8A 1L4ZA 1SOTA 4IMQA 3M3SA 1TWXB 3SV2H 3ZZ3A 1P12E 1C4V2 5A2MH 2C93B 3U69H 2TGAA 1GDNA 4KTSA 4Y7AA 1O2ZA 3S9CA 2VGCB 1F7ZA 3MFJA 2V6NA 1S82A 4GLYA 1YC0A 2BVRH 3A7TA 4WH6A 3E6PH 1K1NA 1GJ7B 4Y71A 4D8NA 7GCHG 1C2HA 1CBWB 1W10U 1LHFH 4AYYB 5FPYA 1F0TA 5EQQA 3ZVAA 1SBWA 2FOBA 4MNVA 5H4IB 4ABHA 1TA6A 4AN7A 1WTHD 1MCVA 1GBKA 1V2MT 2RG3A 1NRPH 1O3DA 1S0RA 3TH4H 4OS5A 1GVLA 2GCHG 1V2VT 1ABJH 3SV6A 3ZVEA 1TNJA 2O8MA 3V0XA 2TRMA 1V6DA 4KGAA 1GBBA 1N8OB 2Y81A 4FUBA 1ELFA 2W26A 1AO5A 3A83A 3BEFB 5E0GA 2A31A 5A8XA 1ELEE 4AZ2B 1DWEH 1ZSKA 3P70B 1C2JA 1LCYA 3G01A 2J4IA 2KAIB 5FCRA 4TPIZ 1A0JA 5FX5A 5CE1A 3SGQE 5BPEA 4YESB 2SGAA 2ZDLA 5GPIB 2XCFA 5EOKA 3GY2A 1GHYH 3UUZA 1AB9C 4A5TS 2VIDA 5A8ZA 1MTWA 1Z1JA 3EE0B 3NUMA 3ZVDA 1GWAA 1NRQH 1NESE 1IHTH 1TB6H 4AFUA 4D7FA 2A1DB 4CH2B 7GCHF 4FXGH 1T4VH 2KAIA 2UWPA 1HAXB 1OWEA 2PHBA 1H9LB 1S84A 2H2ZA 4JZ1A 1T32A 3FZDA 1GL1A 2XC0A 3MU8A 1HJ8A 2BQWB 3SNEA 1NS3A 4TYDA 2BDYA 3OYPA 2J94A 1YPKH 2OXSA 1CA8B 1CSOE 1SLXB 4FUGA 3SQEE 9ESTA 1AE8H 3DD2H 2FOMB 4GCHG 2BQ6B 4Y79A 1CGJE 5EXMA 5LH8A 4I7YH 1UTOA 1S0QA 3TH3H 2ULLA 3MO9A 2AYWA 5PTPA 1ESTA 1O2IA 1T8LA 2CN0H 1NC6A 1P11E 3RXCA 3RLYH 5EU8A 1GBTA 2QV1A 3A7WA 1TNHA 1N1LA 3QWCH 1MU6B 3PTNA 1O2MA 1QBVH 1XX9A 1MUEB 7ESTE 1C5VA 3RXOA 2BYAX 3PMBB 5JB9S 1ETSH 3GY4A 1HJAC 1FONA 1LKBA 4K69A 1ANEA 4Y6DA 3MMGA 2ZHDA 4AFZA 1O2KA 1C4Y2 2ZU3A 3SOSA 2WPLS 1MQ5A 2QYIA 1KLTA 1KXEA 2AGIX 3NWUA 1PQAA 2YOLA 1ABIH 4GCHF 1FAKH 2BY8X 1JRSA 1UCYH 5DP3A 1IQHA 1RD3B 1TIOA 1AFQB 1EZXC 2BB4A 1O2TA 4TY7A 3P95A 4F4OC 1FDPA 3MTYA 4VGCB 1KXBA 1GHBG 1P02A 1BCUH 2UUFB 1EP5A 2ZDAH 1TX6A 1YPLH 3UNSA 2OC7A 4OS2A 3UREA 1H8IH 5DG6A 2ZECA 4ABAA 1YPJH 1GCTC 1O2WA 2FS9A 1MTUA 4IS5A 2QXHA 1P0SH 2QAAA 1CT2E 1XKBC 5FPTA 3IWMA 1KXAA 1TQ0B 2XBYA 2WV4A 5C3NA 3STIA 1V2ST 2NU1E 2EI7A 1GJ5H 1LVMA 3SW2B 1KXCA 1E34B 2NWNA 4IW4E 2Z3DA 4AX9H 5LGOA 2G52A 3JZ2B 1YP9A 1QHRB 5AFZH 4KP0A 1Y3YA 1P2QA 5L2YH 3E1XB 2Q6GA 4HTCH 1P05A 3ENSB 2FTMA 5EPYA 6GCHG 4LK4A 1SQTA 3SJ8A 4ZKNU 2H6MA 1SI5H 5C1YA 3QGNB 4K5ZA 1BTUA 1C2GA 1GHBF 1QBNA 1NRRH 1VJ9U 1X7AC 4BAQB 1NU9A 3A8BA 5GWZA 1OOKB 3TITA 1MCTA 2OBOA 4AOQA 3PLPA 3UOPA 5AFYH 1UCYK 2SNVA 2CF9H 2XNIA 1TGBA 2BY6X 3LDXH 4I8KA 3M37A 1V2RT 1A5IA 1Z7KA 3GICB 2Z6BD 1O5GH 2HNTC 1O2VA 1ZTKA 2XW9A 3LIWA 4X8TH 1QQUA 1J15A 2K7XA 5A8YA 1A2CH 2P8OB 4Q80A 1EPTC 2P3FH 2G51A 2WINI 3DUXH 1DS2E 1GBEA 1BITA 3AAVA 3C27B 1A7SA 1K22H 1PPGE 2A0QB 1UTMA 4B2CA 1MKWK 3SU4A 3GDSA 6CHAC 1ZGVA 1LMWB 1KYNA 1KTTB 3MU0A 2VIQA 1AI8H 5DGJA 1QL8A 1O3GA 6GCHF 3O8RA 3ODDA 2AMPA 1XUIA 1MBQA 3P17H 2BDHA 3I29A 2ZF0H 1XUGA 3RXQA 1GHAG 1TPSA 3VB4A 1FV9A 1OWIA 1P10A 2ZGBH 2YNBA 1SGTA 1MZDA 3M5MA 4AB9A 2TBSA 2PTNA 4XOJA 1DSUA 1ZMNA 4D7GA 2Z9LA 1EASA 1O3KA 2GMTB 3GYMA 4X2VA 1O36A 3ZZAA 5ABWA 3I78A 1G32B 1BBRE 1W7XH 1GJDB 1HDTH 3VPKA 3KHVA 4KELA 4YLQH 1TNIA 1LQEA 2BVSH 1QTFA 3B23B 3GCNA 3SV9A 2OTVA 1GL0E 2ANYA 1HXFH 2ZPQA 2H5CA 5GCHF 4NIWA 1QA7A 2ANMH 4A7IB 1AVXA 1HPGA 1YCPH 2VWMA 3AAUA 3SJOA 1SGCA 2XWBI 1F0RA 2AGEX 4R0IA 2RA0A 2GGVB 2Z9KA 1P2NA 3BG8A 1LDTT 1P2OA 1XUJA 2C3SA 2Y80A 3PM3A 5FBIA 1GJ8B 4A6LA 2ZU1A 1ZJDA 1RRKA 2OLGA 1C5PA 1THSH 1FI8A 3MH4A 1AFEH 1GHWH 1O3FA 2ZGCA 4BANB 2SGFE 2G4TA 3TJVA 3RC4A 3F9FA 2UWOA 3HPTB 1C5OH 1GHAF 5F8XA 3STJA 1EB1H 1Z8GA 3RLWH 3VGCC 1P04A 1VZQH 2IPHA 1C1MA 3QTVH 3SGBE 1LVOA 1DXWA 5TCCA 1OWHA 1PQ8A 2BLQA 4NGAH 4WH8A 4IN1A 4UFGH 4BOHA 1PJPA 1GBCA 1SMFE 2Q6FA 4AFQA 1FQ3A 3SGAE 2ZC9H 3V13A 2BQ7B 3A7ZA 5HGGA 2DE9A 3EA8A 3SUFA 5CHAB 1ZSLA 3T25A 1F5RA 1ANBA 2J38A 1G3DA 1YKTA 8ESTE 2FX4A 3LGYA 4MDSA 1KLJH 1PPEE 3ODFA 4DIHH 1YPHC 2CF8H 1GI3A 1MTNC 3BTDE 1Y8TA 1SHYA 2BDAA 2ZHWH 5EXLA 3SUGA 1T8OA 1HNEE 1THRH 4MPWA 1TGTA 1CGIE 2B5TB 2BD2A 2OP9A 1D3TB 3MH5A 1YCPK 2QN5T 1O2OA 2J2UA 1KTSB 5J4SA 4IBLH 3PTBA 1K2I1 4KTUA 3SU6A 1BTHH 1DUEA 1TMTH 5DKMA 1ZPCA 1QCPA 2XC4A 4H6SB 4ASHA 3RXPA 4ESTE 1U6QA 1TRMA 2SGDE 4INLA 2HNTE 1SB1H 1B5GH 4JZDH 3UWJH 3LT3A 3MNSA 1HAYB 1EP6A 1IQLA 4IN2A 1W14U 1ZPZA 3RXKA 1D3PB 1D4PB 4B2AA 3U8OH 1K1MA 2IN2A 2A4RA 5EGMA 1QL9A 1BMNH 4ISIH 2CHAC 2ZG0H 1A61H 2BDIA 2Z9IA 5ESBA 1O3JA 1GI6A 1GDQA 4MNYA 5JB8S 1TPPA 2HOBA 2UUJB 4A1TA 1E38B 1SQOA 2WUBA 2ZFRH 1L0ZA 1QB1A 1QJ7B 1AWFH 4X1PU 1K21H 1V2PT 2Z3EA 2BZ6H 1WAYB 3EQ0H 2R2MB 2BTCE 5ESTE 3P6ZB 1NFUA 1KSNA 3LPRA 3QX5H 2QXGA 4CREA 2QGRA 4Y10E 1EOJA 1ELTA 1H8DH 3Q3KA 1NRSH 1E35B 4ABDA 4ZROA 4Y0ZE 1O39A 2BXTH 1XXDA 4GHQA 1DY8A 1IQGA 2PKSC 1RIWC 5FBEA 2SGQE 2A7CA 3LC5A 1O3IA 3U9AH 3UQOA 1FNIA 5DJ7A 2XXLA 4O03A 4CBNA 1S81A 4ABIA 3KQBA 3V3MA 1HCGA 3M61U 1RTLA 4A1XA 2FEQH 3ATKA 4MLFB 5C1XA 4Q7XA 4B76A 2Y7XA 4DY7B 2ZFPH 1MBMA 3UOUA 1HAGE 5C2ZA 2OC0A 3K2UA 1CE5A 4I8GA 2PR3A 2R0LA 1TA2A 4ABBA 1UJ1A 1NROH 4XE4A 3SU3A 4LZ4B 3RXVA 4H6TA 3H5CB 2VWOA 1TBQH 1GBDA 4NSYA 1HAZB 2JETC 4GSOA 1CT4E 1P06A 2PUQH 1KXDA 5JBAS 2V0BA 1AVGH 1HAVB 2ANWA 5CMXH 2Z9GA 1AWHB 3ZVFA 4E06H 3FAOA 3O8CA 2C8XB 1V2UT 4ISHH 2ZFQH 4AORA 1HB0B 2VINA 5SGAE 1C5LH 2Y5FA 1W0YH 2GD4B 4DGJA 8LPRA 4ZHAA 4JZIA 3MU5A 4CRCA 1W7GH 1GJCB 2C8YB 1ZTLA 1JXPA 1AB9B 4Y11E 1YPHE 2R3YA 2BLVA 1FXYA 3L3TA 2O9QA 4WVPE 1C5NH 4I8HA 3U8RH 2ZZUH 3U98H 5JBTA 2GCTC 3SU2A 1BRUP 4ZXXH 1EB2A 2OINA 3DA9B 4YT6H 1GDUA 2PV9B 1GI7B 1GJ9B 1UTLM 4RN6A 1CGHA 4CHAC 4U01A 1ARCA 2ALPA 3T29A 5HM2A 1CVWH 1O2QA 2P94A 1G3CA 3LONA 3T2NA 1GBAA 2XBXA 4FU8A 3BTHE 4DIIH 2FP7B 1NFWA 1GHZA 3GY6A 3ZZ4A 4CR5A 3NKKA 3Q76A 1DICA 2PSXA 1AMHA 1A0HB 1LVBA 1DITH 1KLIH 1YCPM 4NFEA 3BTGE 1ZOMA 4FUDA 3S7HB 3U8TH 3C1KA 2C90B 4XSKU 3CS0A 4FUCA 1O5FH 4X6MA 1WCZA 2AERH 2FWWA 4J2YB 3RP2A 3LGVA 1FY4A 3IG6B 1O2GH 2AEIH 1TRNA 3KGPA 3TPIZ 4X1QU 1TLDA 2VWNA 3KF2A 1GG6C 1BBRK 1D3DB 1SGIB 1GI0A 3NZIA 2VU8E 2VIOA 4OS6A 4YOGA 3E3TA 1A4WH 2F9BH 1FY8E 1MMJN 1OYTH 3EAJA 5GXPA 1OP0A 1N6XA 3PMJA 3BSQA 1HJAB 2ALVA 4KTCA 4UEHH 3SNDA 2H9HA 1Y5BT 1O5BB 1TNGA 1O3CA 2ZDNA 1UK3A 1QURH 3RXIA 5K7RA 4Y76A 2CGAA 1W8BH 2I6QA 4NCYA 2A45B 3PO1C 1SVPA 2ZCHP 3ZVBA 2GCHF 3A85A 5HMAA 4AYVB 2AMQA 1GBLA 1YPGH 2BY7X 1QRZA 2FOFA 1Y3XA 3TVJB 1G2LA 1G37A 1OSSA 2C8ZB 5L2ZH 2OC8A 3N7OA 5DP6A 2JH5D 3RDZA 2C4FH 3RXJA 1GGDC 4E7RG 3GDVA 1C2KA 2AMDA 2FI5E 5HYOA 3VXEH 2ZFFH 1CBWC 3AW0A 3RXFA 2ANKH 1GCTB 1FN8A 2Y5HA 3A86A 2SGPE 1OP8A 2BVXH 2V35A 3ATLA 1HRTH 2ZA5A 1YF4A 1ZHRA 4ISNA 4NZQA 1OWKA 4UONA 1UTJA 1L1GA 2VH6A 1RJXB 3ZYEA 2AH4X 1ELCA 1HGTH 2QXIA 4K8BA 4OS7A 1G36A 3IITA 3NK8A 2ZI2H 1C2LA 3BTTE 3W95A 1XVMA 5EW2H 3VFEA 2GKVE 2BXUH 4WMFA 2OQ5A 4GVUA 1O5AB 1HXEH 1O30A 4U32A 1NZQH 3U1JB 1C2IA 2ZHEH 3RXHA 1V3XA 2CV3A 4UDWH 1YLDA 3A88A 4LZ1H 1WUNH 3FZZA 4CH8B 1CHGA 2BX4A 1O35A 2ZGXH 2D26C 2ASUB 1S6FA 3BG4C 5ETXA 1ZLRA 2FDAA 2XBWA 1DWBH 3SQHE 3T28A 2PW8H 1H9HE 4AG2A 4H42U 1GBMA 3FP6E 1ETRH 4MQAA 1P2KA 4O9VA 5DK1A 2GZ8A 2QXJA 4ZAEA 1WU1A 3M36A 3SHCH 1XUKA 4RKOB 2VNTA 1EPTB 3RXMA 3F9EA 1GBIA 1MKWH 1O3AA 2FOAA 3B9FH 4BAOB 1TNKA 2ZWLH 3PMAB 3A89A 3UY9A 2WPHS 2PWXA 2GDEH 3H7TA 4NA7A 3Q3YA 2ZPRA 3L33A 3DHKH 4WXIA 5IDKA 1C9TA 1BA8B 2G5VA 1G30B 2OC1A 2BMGB 1P09A 2FO9A 3FP8E 1V2QT 2BD5A 2WPIS 1SGFA 4NA9H 1S83A 1HAOH 1AKSB 4XFQA 1OKXA 1F92A 1P3EA 3ZZCA 2EEKA 1Z71A 3FFGA 2PKAB 5T3HA 2WYGA 2XBVA 3RXDA 1AN1E 1O2RA 1L1JA 3RXBA 1F5KU 4ZXYH 3RXUA 3ATWA 1K1IA 4ABEA 1AGJA 1HUTH 3PV4A 2HPPH 1O2YA 1OPHB 2P16A 2A5KA 5EG4A 1E36B 3LGTA 4HGCA 1EAWA 4AFSA 2J34A 4X1RU 1FY5A 2BD4A 4R8TB 4OGYA 2PKAA 5FXLA 1UMAH 2VVUA 3VB5A 1LHGH 1V2NT 3SV8A 4DT7B 3GYLB 1C5YB 2G81E 3AW1A 1K28D 1YYY1 4OS1A 2G00A 2Y82A 4YZUA 1UTNA 1O5CB 2VVCA 2FLRH 1O3NA 1BDAA 3HATH 3MH6A 3T5FH 1G9IE 1SFQB 1ZSJA 3GDUA 2ZHFH 3OSYA 1H4WA 3EDXB 2ZGHA 5GDSH 1ARBA 3VGCB 1V2OT 3ESTA 1L2EA 1XMNB 1RTKA 5L30H 4I8LA 2P3TB 2WUCA 3LH1A 1BTYA 4IC6A 3OU0A 1C2DA 1DSTA 3O8BA 1A5GH 3URDA 3D49H 4AGJA 1SGYE 1V2WT 2NU4E 3KEEA 5T6DA 1NY22 1WOFA 1UVOA 4YOIA 3ZZBA 4BAMB 2ZTZA 4I32A 2VVVA 5DP9A 1O3BA 3P92A 3UTUH 1XUHA 1C1UH 3HGPA 4MNXA 1KXFA 2SGEE 3UR9A 1PPZA 1CHOG 3TH2H 1LO6A 3SU0A 2UWLA 5DP4A 6ESTA 1ELAA 1YPMH 4FUIA 1BMLA 3KCGH 2TPIZ 1BRCE 1TGSZ 4XBDA 3MO6A 3SNCA 1W13U 2ZQ1A 1GJ6A 3RMLH 4U2WA 1ANCA 1O2PA 2GZ7A 1NO9H 1JMOH 4MNWA 1HJ9A 1PQ7A 1C2EA 1JOUB 1EAXA 3GCHC 4LXBH 4YM9A 2WV5A 5LPFA 3P8OA 1J8AA 4K1SA 1PFXC 1O2XA 2GX4A 4M7GA 3DFJA 4DVAU 2BD9A 3GY7A 4X2WA 3R3GB 3H7OA 3QN7A 4JYVH 1BZXE 1HFDA 3RXLA 3MU4A 2FZZA 4FVDA 4IGDA 2A4OA 3A8AA 3RXTA 4KKDA 4XDEA 2FS8A 2GV6A 2CMYA 4DG4A 3EA7A 3TJNA 1DWCH 3ATIA 3SU5A 1XKAC 1O32A 1ZHMA 2A5AA 1MTSA 4INKA 1CHOF 1SHHB 1IAUA 5EW1H 1K1PA 3BEUA 2BM2A 4BNRA 3SI3H 3KQDA 3ZZ6A 4D9QA 4D9RA 3RM2H 1PPHE 4YO9A 3LC3A 4JYUH 1MTVA 5TJXA 2ZCKP 3RXSA 1V2LT 2QY0B 2JH0D 1VGCC 1QY6A 1AY6H 1MQ6A 1A5HA 4E7NA 3GY5A 2AGGX 3PROA 2M5TA 1ZPBA 4FUHA 3TU7H 1QB6A 2FOEA 4BTUB 1MKXH 2F9VA 5HXFA 3M7TA 2B0FA 1A3BH 3KNXA 1BT7A 5JYIA 5EQRA 3RMOH 3F6UH 1L1NA 2BLOA 5GJ4B 2Z7FE 1P8VC 1DX5M 2ZTYA 1OWJA 5K0HA 2G4UA 2FTLE 2FOCA 4RKJB 4TWYA 2FIRH 4BTIB 2PKSB 1Z1IA 1RIWB 3SNBA 1FPCH 1QR3E 2XC5A 4X2YA 1P2MA 1RS0A 5F8TA 2W3KA 4B1TA 1J14A 1DPOA 4TPYA 1EZUC 2ZU5A 2ESTE 3ZZ7A 1DANH 1UTKA 3A82A 3D62A 1SLWB 2BX3A 3EYDA 1C2FA 1C5MD 1ID5H 3K65B 5DPAA 5E2PA 1ACBE 5F03A 1WSSH 3A8CA 3BTWE 3KL6A 2AFQB 1P57B 2A4GA 1QA0A 2J95A 4YTAA 1DFPA 1VR1H 4CRDA 3RU4T 1H9IE 2IJOB 5E0HA 1FN6A 2D1JA 2JETB 2AIQA 1DUAA 2OQUA 3A8DA 1V2JT 3P8FA 3RM0H 2LIZA 2Z94A 1C1TA 1HYLA 1O37A 2FPZA 1ZRBA 2FOGA 3UQVA 5CHAC 4SGAE 3ZZ8A 3PLBA 3LJJA 1HBTH 1UTQA 1YBWA 2BDGA 4O97A 3KN2A 1MKXK 1VITG 4ISOA 4ZUHA 1GHXH 1MZAA 1FAXA 3CS7A 1E37B 1FUJA 2G55A 5C5NA 4JZEH 1A1RA 1WV7H 2O8UA 2FX6A 3A7YA 1GCDA 1S85A 4JK6A 2O8TA 3S0NA 2GCTB 1G3BA 4NWKA 2B7DH 5JBBS 4Y0YE 3MYWA 2FOHA 5JBCS 1ANDA 5A09A 4CHAB 5C67A 1Y5UT 1AHTH 3M5OA 2Y7ZA 3K6ZA 2OD3B 3BV9B 1QQ4A 4JK5A 2WPKS 5FPSA 1J16A 1SOZA 2PTCE 3LKWA 1Q3XA 4ZH8A 4DJZB 1C1RA 5A0CA 3GCTG 1NU7B 5IYTA 2QC2A 1SGNE 2EA3A 2GZ9A 5T6GA 3PWBA 1VITF 2EI8A 1Y5AT 1C5XB 1BBRH 4CR9A 1W12U 1NN6A 1TGNA 3ZV8A 1S6HA 4WXVA 3TK5A 2STBE 1LQDB 1GG6B 2GVFA 4UFDH 4YOJA 2H9EH 1C1QA 4ISLA 3M5NA 4A1VA 2J9NA 4CRAA 1BOQA 1QRWA 1Y3UA 4X6OA 2P93A 1O0DH 5E8EH 2R0KA 5LPRA 2HNTF 1BTZA 2EC9H 1HIAB 1LHDH 5GIBA 2A7HA 3SNAA 2STAE 1LHCH 4B73A 2LNCA 4B2BA 4SGBE 1O31A 1HAVA 3E16B 1O33A 1UTPA 5EQSA 1M9UA 4FUJA 1NT1A 1GI4A 4BXWA 4DCDA 1IOEA 1DLKB 1RXPA 5C1UA 2ZGJA 2VWLA 3BIVH 1O34A 1E0FD 1PQ5A 3T27A 4DW2U 3OX7U 1C5UA 1SSXA 1O2NA 1WTGH 2QIQA 2XYAA 3AVZA 1TYNA 2QF0A 5FAHA 3GCTF 3M5LA 1BMAA 2FI4E 2ZU2A 2ODQA 2ZFTA 2HPQH 2G8TA 1FMGA 4UFFH 1O2HA 4A92A 2H9TH 1YLCA 4YLUA 1GGDB 2OBQA 1IQNA 4X6NA 4UD9H 2ZKSA 2P59A 1D9IA 3QK1A 2CJIA 2VH0A 1O2LA 3D65E 1NM6A 3OTJE 4MPVA 3D23A 3HKJB 3K9XB 5DP7A 1IQEA 4WJG2 2A5IA 4ZHMU
chains in the Genus database with same CATH superfamily
4I33A 5FHTA 1JWTA 1GJBB 2XCNA 1O3OA 1TGCA 5EPNA 1UVPA 1LPKB 4NIVA 5AVDA 4CRFA 5HM9A 3SN8A 4B6FA 1WBGB 1A46H 1FY1A 1CA0C 1GBHA 1ELBA 3TNSA 1BTWA 3M7UA 3MNCA 4FOUC 3BTQE 1O3EA 1VITH 4K1TA 1ZJKA 3Q00A 2SNWA 5F53A 3U28C 3ATMA 2ZO3H 1IQFA 1UO6A 3VB6A 2PFEA 1T8NA 5T6FA 1YWUA 1LKAA 3TGJE 1FJSA 1AU8A 1AQ7A 2HLCA 2ZPSA 3A80A 3FP7E 3SO3A 3EA9A 4BAHB 4BXSA 5AF9H 1K1JA 2F9UA 1MD8A 3MNXA 1A3EH 4GHTA 3ZVGA 2ZHQH 4ZHLU 5JPMH 1EKBB 2O8LA 3UIRA 3TIUA 1RGQA 2WZQA 3S9AA 1EXFA 3ZZDA 1BB0B 4Q7YA 1P01A 2BD3A 3NCLA 2Q6DA 4U30A 4B75A 3BG4B 1YM0A 1BUIA 2RDLA 4K3JA 3RC5A 3ZZ9A 1RFNA 2J92A 3ZYDA 3QLPH 2LP6A 1ETTH 4GAWA 1NPMA 3FANA 1O3MA 2VGCC 3BEIB 3UFAA 2HVXA 1UK4A 1JBUH 3HK3B 1QGFA 5BRRE 1BRAA 1ELVA 3GISB 1AIXH 4X1NU 8GCHG 5EXNA 2ILNA 1L4DA 2ZU4A 2JH6D 1B7XB 1SFIA 1ZZZA 3E91A 1C5ZB 2VIPA 4INHA 3KQCA 4OM9A 3RUOA 4F49A 1J17T 1SR5C 3FVFB 1AUJA 1GMHG 3SBKA 2NU2E 2BHGA 2KCOA 2FODA 1VCQA 2KFWA 2V3MA 1UHBB 3NPSA 1AZ8A 1N8OC 2ZP0H 3PB1E 3OAAD 4FVBA 3LH3A 4Y8ZA 1ZMJA 1N6YA 2H1UA 4NFFA 2D8WA 9LPRA 3SJIA 3RXRA 1FPHH 5C94A 3WY8A 5JDUB 1EAIA 3A81A 7LPRA 2VBCA 5E2OA 4MPUA 3GCOA 4K2YA 4IMZA 1W0JD 2JJ2D 1PYTC 5I46H 5FX6A 3TGIE 1LPZB 3SUEA 5LPEA 1KDQB 1UHBA 4DT4A 2VB0A 3TLOA 1LHEH 1UW7A 2Z9JA 4TY6A 1BRBE 3S7KB 2FYQA 1FLEE 5F6MA 4AB8A 3BN9A 1C5RA 1ELDE 2BD7A 4NZLA 2QF3A 1C4U2 1BMFD 4MVNA 3TJOA 3BTME 1OXGA 2PGQB 4QT8C 8GCHF 3GOVB 4JMYA 4AG1A 1EZQA 1Z8IB 2ODYB 1KIGH 1D6WA 3SU1A 1ZYOA 1MD7A 1HAPH 1P2IA 2R3UA 3HKIB 2WSSD 2TIOA 4I31A 1KDQA 1GMHF 2TGPZ 3QDZB 5GNDA 2ZCLP 4MG3A 1HAHH 1S6LA 3BIUH 1PPCE 1SKYE 3MH7A 4ABGA 1T31A 1TALA 1O3LA 5G4BA 3V7TA 2F9PA 2BY5X 1O5DH 1SGRE 3SI4H 1INCA 3T26A 3ELAH 4DOQA 1BJVA 2HGTH 2FXRA 3BTKE 6CHAB 5C20A 3U1IB 3KIDU 3F9GA 1GI2A 1ESBA 2F9OA 3URCA 2P95A 3SUDA 1BTPA 1C1PA 1XM1A 1GJAB 2KCYA 3EGKH 5B6LA 1DWDH 4X8SH 1ZRKA 2NU0E 3W94A 2YMSC 3DT0H 1TONA 3DSPA 4BAKB 1W2KH 1EPTA 2V3OH 3KQEA 1DDJA 3KYFA 1D6RA 2LELA 3PWCA 1GI1A 1Z8RA 3ZVCA 1C1OA 4X2XA 2F9NA 1PPBH 3AASA 3P8NA 1V2TT 2WPJS 5DP8A 1W11U 2JKHA 4X6PA 1FX0B 3WWFA 2A32A 4MPXA 1XXFA 1MAYA 1AKSA 1K9OE 1EOLA 1AD8H 2WHXA 1DOJA 2XWAA 3A7XA 3B8JA 4H4FA 4JZFH 2RA3A 3M35A 4ZMAH 1E79D 1GBFA 1AUTC 4BTTB 4FU9A 2XRCA 2GDDA 3A87A 2D2DA 3CENA 3F68H 3TJUA 1OX1A 2LPRA 1C1VH 1Y59T 3BTFE 3LGWA 1AFQC 3GCHB 3ITIA 2ZFSA 3TGKE 1C1SA 1ZR0A 3UWIA 3E0PB 3UNRA 2PSYA 3LGUA 4VGCC 1C9PA 1DXPA 1BHXF 3QZQA 1QJ1B 2GV7A 2OCVB 1Y3WA 1BJUA 4CRGA 1XVOA 2XTTB 1O2JA 1P2JA 1Z6JH 4K60A 2GT7A 2FLBH 3ZZ5A 5GCHG 2G5NA 3PMHB 1B0EA 1SGEE 2DE8A 3UR6A 1C1WH 1H1BA 1SGDE 3LU9B 1TOMH 2QA9E 2ZTXA 1G2MA 3RMMH 3RXAA 2C8WB 7KMEH 4NIYA 1ESAA 5TCAA 1TBRH 2UUKB 1T8MA 1OP2A 1CU1A 1UVTH 1TMBH 2FI3E 4ACBA 3Q77A 1C5TA 1KY9A 2O8WA 1WQSA 4GPGA 1GI9B 1P9SA 1F0UA 1HV7A 3SORA 4HFPB 1VGCB 3M3VA 1MTNB 4IC5A 2QCYA 3MO3A 3MNBA 3TNTA 3MHWU 2BDBA 4X8UH 1AVWA 3DFLA 2FESH 2VIVA 5E0JA 2WYJA 8KME2 4WMEA 1XUFA 4NIXA 5HIYA 4CRBA 3VXFH 3SHAH 1DY9A 4WF8A 3RU4E 2W3IA 3GY3A 1YGCH 1P03A 1UVUH 3E90B 2XNDD 1TX8A 3HGNA 1TNLA 1C5WB 1QJ6B 4ZKRU 5DO4H 1W0ZU 2OUAA 2P8OC 1GI5A 3P8GA 5I25A 2Y6TA 4ABJA 2A2XH 4B74A 1ZMLA 2P3UB 2HRVA 4ABFA 2J98B 1C2MA 1YPEH 2QF5A 2TGDA 4DURA 3F2FA 1F0SA 1O2SA 1A0LA 1T7CA 1VCPA 1T4UH 1TBZH 2W5EA 4CBOA 3PRBA 2NU3E 4ACAA 3I77A 2WV9A 1W3CA 2H5DA 1TFXA 2CHAB 4AGKA 2W7SA 3MI4A 1GPZA 1TRYA 1AZZA 3R0FA 1IHSH 1FZZA 4HZHA 1DT2A 1COWD 2A4QA 3ZV9A 1AE5A 3K6YA 4E05H 3SZNA 3SJKA 2V3HH 1V2KT 4X1SU 3E8LA 1IQJA 3UB0A 4OS4A 1QBOA 3A7VA 2GMTC 1QNJA 1QL7A 1DLEA 2FMJA 3SJ9A 1TQ7B 1O3HA 1Z6EA 3L6PA 1GI8B 3MWIU 3N7EA 2PGBB 1QZ8A 1SG8B 1EJNA 1K0HA 4PROA 3RMNH 3T62A 2CXVA 1ZHPA 1PYTD 1MAXA 2IOTA 4NG9H 1ZTJA 4X8VH 3RU4D 3QTOH 1BTXA 1O5EH 2PUXB 1TX7A 2R9PA 1EAUA 5EODA 3TK6A 1TOCB 2AS9A 1HLTH 4WMDA 4HI3A 1PPFE 4NWLA 3S69A 4Z6AH 1SC8U 3QUMP 2YNAA 4YT7H 4TWWA 2WPMS 2AIPA 1LPGB 1IQIA 1K1LA 1IQMA 5FL7D 2BY9X 2HLDD 4NSVA 1EZSC 3CP7A 4ZKSU 1EJAA 1ELGA 2PLXA 5DP5A 1BMMH 1JIRA 5L6NH 2BZAA 1TPOA 2Q1JA 4XBCA 2KM0A 3O8DA 2ZEBA 2FYRA 3QO6A 1F5LA 3A84A 3OFND 1WQVH 1Q2WA 4D76A 2VIWA 4Z0KA 1NRNH 3BF6H 1NTPA 3RXEA 3WWBA 3M7QA 1QFKH 5A0BA 3V12A 1NFYA 3E0NB 1O3PB 3PLKA 1GVZA 1TMUH 4X0WU 1QRXA 2BLWA 2ZDMA 1BHXB 1JIMA 3HK6B 3EBNA 2Y5GA 5AHGH 2F83A 1ORFA 4FU7A 1C5SA 3QGJA 1D3QB 1FIWA 1CT0E 3MU1A 3SV7A 1SPJA 4Y8XA 1P9UA 1CO7E 2HWLB 3TK9A 2FM2A 5C5OA 1EX3A 4ZKOU 4GUXA 2ZIQH 2GTBA 2HALA 3NXPA 2K1QA 4LOYH 1NFXA 2JDID 4Y7BA 3GY8A 2EI6A 1GMCG 1FY3A 1F2SE 1E1RD 4FUEA 1SQAA 3UPEA 1O38A 3LGIA 1EUFA 1Y3VA 2GT8A 2I6SA 1C1NA 6LPRA 3UNQA 1UK2A 1EQ9A 1Q31A 2ZQ2A 2F91A 1G3EA 1LTOA 1SGPE 3RXGA 1BQYA 2A7JA 2THFB 4RSPA 1BIOA 1O2UA 1OWDA 2B8OH 2F3CE 5J4QA 2UUYA 1ZGIA 3F2HA 4Q7ZA 4WWYA 1GMDG 3MOCA 4O3TA 2R2WU 1MABB 3M3TA 1QIXB 1GBJA 1EATA 1LVYA 3KQ5A 2RCEA 1KMHB 5EJ1A 3RC6A 5A0AE 3H09A 3JZ1B 4B6EA 1SGFG 1UVSH 1J9CH 1UCYE 3PYHA 1HAIH 1P3CA 3LOXA 4K8YA 1JRTA 3VEQB 1S5SA 2SFAA 1OS8A 1QB9A 4B71A 4UFEH 1VCWA 3LJOA 3OY6U 3VB7A 1E1QD 1GMCF 1SLUB 1SQRA 1IQKA 1VJAU 1SLVB 4JCNA 1RTFB 1EJMA 2W6JD 4I8JA 2ODPA 3Q3XA 1C5QA 1GJ4H 1GVKB 4Q2KA 3F1SB 2DUCA 1Z8JB 2BOHB 5F8ZA 2GP9B 1THPB 1WYKA 2ZNKH 4Y8YA 1K1OA 1CA0B 2BD8A 1DVAH 3VB3A 2TGTA 4THNH 1TAWA 1DE7H 4K1EA 1SGQE 2ZDVH 1OYQA 1TABE 1CQQA 4FUFA 3F9HA 2Z3CA 4UE7H 2A2QH 1DM4B 1GMDF 5EJLA 1B0FA 1TPAE 4XBBA 1SL3A 3S9BA 3QZRA 4O3UA 4RT1A 5B6OA 1GHVH 1FIZA 5DSFA 4MTBA 1TE0A 5FCKA 2VJ1A 3BTEE 3PO1B 1HIAA 2BOKA 2W7UA 4J1YA 2ZDKA 4OGXA 1MU8B 2B9LA 2BDCA 3OY5U 4JYTA 1MH0A 4WY3A 4NA8A 1L4ZA 1SOTA 4IMQA 3M3SA 1TWXB 3SV2H 3ZZ3A 1P12E 1C4V2 5A2MH 2C93B 3U69H 2TGAA 1GDNA 4KTSA 4Y7AA 1O2ZA 3S9CA 2VGCB 1F7ZA 3MFJA 2V6NA 1S82A 4GLYA 1YC0A 2BVRH 3A7TA 4RT0A 4WH6A 3E6PH 1K1NA 1GJ7B 4Y71A 4D8NA 7GCHG 1C2HA 1CBWB 1W10U 1LHFH 4AYYB 5FPYA 1F0TA 5EQQA 3ZVAA 1SBWA 2FOBA 4MNVA 5H4IB 4ABHA 1TA6A 4AN7A 1WTHD 1MCVA 1GBKA 1V2MT 2RG3A 1NRPH 1O3DA 4Z1MD 1S0RA 3TH4H 4F48B 4OS5A 1GVLA 2GCHG 1V2VT 1ABJH 3SV6A 3ZVEA 1TNJA 2O8MA 3V0XA 2TRMA 1V6DA 4KGAA 1GBBA 1N8OB 2Y81A 4FUBA 1ELFA 2W26A 1AO5A 3A83A 3BEFB 5E0GA 2A31A 5A8XA 1ELEE 4AZ2B 2OK5A 1DWEH 1ZSKA 3P70B 1C2JA 1YY3A 1LCYA 3G01A 2J4IA 2KAIB 5EJZA 5FCRA 4TPIZ 1A0JA 5FX5A 5CE1A 3SGQE 3DCLA 5BPEA 4YESB 2SGAA 2L74A 2ZDLA 5GPIB 2XCFA 5EOKA 3GY2A 1GHYH 3UUZA 1AB9C 4A5TS 2VIDA 2RFKC 5A8ZA 1MTWA 1Z1JA 3EE0B 3NUMA 3ZVDA 1GWAA 1NRQH 1NESE 1IHTH 1TB6H 4AFUA 4D7FA 2A1DB 4CH2B 7GCHF 4FXGH 1T4VH 2KAIA 2UWPA 1HAXB 1OWEA 2PHBA 1H9LB 1S84A 2H2ZA 4JZ1A 1T32A 3FZDA 1GL1A 2XC0A 3MU8A 1HJ8A 2BQWB 3SNEA 1NS3A 4TYDA 2BDYA 3OYPA 3EE7A 2J94A 1YPKH 2OXSA 1CA8B 1CSOE 1SLXB 4FUGA 3SQEE 9ESTA 1AE8H 3DD2H 2FOMB 4GCHG 2BQ6B 4Y79A 1CGJE 5EXMA 5LH8A 4I7YH 4TT3D 1UTOA 1S0QA 3TH3H 2ULLA 3MO9A 2AYWA 5PTPA 1ESTA 1O2IA 1T8LA 2CN0H 1NC6A 1P11E 3RXCA 3RLYH 3FOAA 5EU8A 1GBTA 2QV1A 3A7WA 1TNHA 4P00A 1N1LA 3QWCH 1MU6B 3PTNA 1O2MA 1QBVH 1XX9A 4AC9A 1MUEB 7ESTE 1C5VA 3RXOA 2BYAX 3PMBB 5JB9S 1ETSH 3GY4A 1HJAC 1FONA 1LKBA 4K69A 1ANEA 4Y6DA 3MMGA 2ZHDA 4AFZA 1O2KA 1C4Y2 2ZU3A 3SOSA 2WPLS 5CDFE 1MQ5A 2QYIA 1KLTA 1KXEA 2AGIX 3NWUA 1PQAA 2YOLA 1ABIH 2K8IA 4GCHF 1FAKH 2BY8X 1JRSA 3KYGA 1UCYH 5DP3A 1IQHA 1RD3B 1TIOA 1AFQB 1EZXC 2BB4A 1O2TA 4TY7A 3P95A 4F4OC 2KCPA 1FDPA 3MTYA 4VGCB 1KXBA 1GHBG 1P02A 1BCUH 2UUFB 1EP5A 2ZDAH 1TX6A 1YPLH 3UNSA 5CHBA 2OC7A 4OS2A 3UREA 1H8IH 5DG6A 2ZECA 4ABAA 1YPJH 1GCTC 1O2WA 2FS9A 1MTUA 4IS5A 2QXHA 1P0SH 2QAAA 3N99A 1CT2E 1XKBC 5FPTA 3IWMA 1KXAA 1TQ0B 2XBYA 2WV4A 5C3NA 3STIA 1V2ST 2NU1E 2EI7A 1GJ5H 1LVMA 3SW2B 1KXCA 1E34B 2NWNA 4IW4E 2Z3DA 4AX9H 5LGOA 2G52A 3JZ2B 1YP9A 1QHRB 5AFZH 4KP0A 1Y3YA 1P2QA 5L2YH 3E1XB 2Q6GA 4HTCH 5DN6D 1P05A 3ENSB 2FTMA 5EPYA 6GCHG 4LK4A 1SQTA 3F2GA 1H8ED 3SJ8A 4ZKNU 3F0PA 2H6MA 1SI5H 5C1YA 1VKYA 3QGNB 4K5ZA 1BTUA 1C2GA 1GHBF 1QBNA 1NRRH 1VJ9U 1X7AC 4BAQB 1NU9A 3A8BA 5GWZA 1OOKB 3TITA 1MCTA 2M2AA 2OBOA 4AOQA 3PLPA 3UOPA 5AFYH 1UCYK 2SNVA 2CF9H 2XNIA 1TGBA 2BY6X 3LDXH 4I8KA 3M37A 1V2RT 1A5IA 1Z7KA 3GICB 2Z6BD 2KCAA 1O5GH 2HNTC 1O2VA 1ZTKA 2XW9A 3LIWA 4X8TH 1QQUA 1J15A 2K7XA 5A8YA 1A2CH 2P8OB 4Q80A 1EPTC 2P3FH 2G51A 2WINI 3DUXH 1DS2E 1GBEA 1BITA 3AAVA 3C27B 1A7SA 1K22H 1PPGE 4M9FA 2A0QB 1UTMA 3GS9A 4B2CA 4XD7D 1MKWK 3SU4A 3GDSA 6CHAC 1ZGVA 1LMWB 1KYNA 1KTTB 3MU0A 2VIQA 1AI8H 5DGJA 1QL8A 1O3GA 6GCHF 3O8RA 3ODDA 2AMPA 1XUIA 1MBQA 3P17H 2BDHA 3I29A 2ZF0H 1XUGA 1W0KD 3RXQA 1GHAG 1TPSA 3VB4A 1FV9A 1OWIA 1P10A 2ZGBH 2YNBA 1SGTA 1MZDA 3M5MA 4AB9A 2TBSA 2PTNA 4XOJA 1DSUA 1ZMNA 4D7GA 2Z9LA 1EASA 1O3KA 2GMTB 3GYMA 4X2VA 1O36A 3ZZAA 5ABWA 2JJ1D 3I78A 1G32B 1BBRE 1W7XH 1GJDB 1HDTH 3VPKA 3KHVA 4KELA 4YLQH 1TNIA 1LQEA 2BVSH 1QTFA 3B23B 3GCNA 3SV9A 2OTVA 1GL0E 2ANYA 1HXFH 2ZPQA 2H5CA 5GCHF 4NIWA 1QA7A 2ANMH 4A7IB 1AVXA 1HPGA 1YCPH 2VWMA 3AAUA 3SJOA 1SGCA 2XWBI 1F0RA 2AGEX 4R0IA 2RA0A 2GGVB 2Z9KA 1P2NA 3BG8A 1LDTT 1P2OA 1XUJA 2C3SA 2Y80A 3PM3A 5FBIA 1GJ8B 4A6LA 2ZU1A 1ZJDA 1RRKA 2OLGA 3DSOA 1C5PA 1THSH 1FI8A 3MH4A 1AFEH 1GHWH 1O3FA 2ZGCA 4BANB 2SGFE 2G4TA 3TJVA 3RC4A 3F9FA 2UWOA 3HPTB 1C5OH 1GHAF 5F8XA 3STJA 1EB1H 1Z8GA 3RLWH 3VGCC 1P04A 1VZQH 2IPHA 1C1MA 2K0QA 3QTVH 3SGBE 1LVOA 1DXWA 5TCCA 1OWHA 1PQ8A 2BLQA 4NGAH 4WH8A 4IN1A 4UFGH 4BOHA 2J98A 1PJPA 1GBCA 1SMFE 2Q6FA 4AFQA 2EQNA 1FQ3A 3SGAE 2ZC9H 3V13A 2BQ7B 3A7ZA 5HGGA 2DE9A 3EA8A 3SUFA 5CHAB 1ZSLA 3T25A 1F5RA 1ANBA 2J38A 1G3DA 1YKTA 8ESTE 2CK3D 2J97A 2FX4A 3LGYA 4MDSA 1KLJH 1PPEE 3ODFA 4DIHH 1YPHC 2CF8H 2AHME 1GI3A 1MTNC 3BTDE 1Y8TA 1SHYA 2BDAA 2ZHWH 5EXLA 3SUGA 1T8OA 1HNEE 1THRH 4MPWA 1TGTA 1CGIE 2B5TB 2BD2A 2OP9A 1D3TB 3MH5A 1YCPK 2QN5T 1O2OA 2J2UA 1KTSB 5J4SA 4IBLH 3PTBA 1K2I1 4KTUA 3SU6A 1BTHH 1DUEA 1TMTH 5DKMA 1ZPCA 5IK2D 1QCPA 2XC4A 4H6SB 4ASHA 3RXPA 4ESTE 1U6QA 1TRMA 2SGDE 4INLA 2HNTE 1SB1H 1B5GH 4JZDH 3UWJH 3VG8A 3LT3A 3MNSA 1HAYB 1EP6A 1IQLA 4IN2A 1W14U 1ZPZA 3RXKA 1D3PB 1D4PB 4B2AA 3U8OH 1K1MA 2IN2A 2A4RA 2YMSD 5EGMA 1QL9A 1BMNH 4ISIH 3CNRA 2CHAC 2ZG0H 1A61H 2BDIA 2Z9IA 5ESBA 1O3JA 1GI6A 1GDQA 4MNYA 5JB8S 1TPPA 4XRNA 2HOBA 2UUJB 4A1TA 1E38B 1SQOA 2WUBA 2ZFRH 1L0ZA 1QB1A 1QJ7B 1AWFH 4X1PU 1K21H 1V2PT 2Z3EA 2BZ6H 1WAYB 3EQ0H 2R2MB 2BTCE 5ESTE 3P6ZB 1NFUA 1KSNA 3LPRA 4YXWD 3QX5H 2QXGA 4CREA 2QGRA 4Y10E 1EOJA 1ELTA 1H8DH 3Q3KA 1NRSH 1E35B 4ABDA 4ZROA 4Y0ZE 1O39A 2BXTH 1XXDA 4GHQA 1DY8A 1IQGA 2PKSC 1RIWC 5FBEA 2SGQE 2A7CA 3LC5A 1O3IA 3U9AH 3UQOA 1FNIA 5DJ7A 2XXLA 4O03A 2GJGA 4CBNA 1S81A 4ABIA 3KQBA 3V3MA 1HCGA 3M61U 1RTLA 4A1XA 2FEQH 3ATKA 4MLFB 5C1XA 4Q7XA 4B76A 2Y7XA 4DY7B 2ZFPH 1MBMA 3UOUA 5C0TA 1HAGE 5C2ZA 2OC0A 3K2UA 2XOKD 1CE5A 4I8GA 2PR3A 2R0LA 1TA2A 4ABBA 1UJ1A 1NROH 4XE4A 3SU3A 4LZ4B 3RXVA 4H6TA 3H5CB 2VWOA 1TBQH 1GBDA 4NSYA 1HAZB 2JETC 4GSOA 1CT4E 1P06A 2PUQH 1KXDA 5JBAS 2V0BA 1AVGH 1HAVB 2ANWA 5CMXH 2Z9GA 1AWHB 3PV2A 3ZVFA 4E06H 3F3BA 3FAOA 4RI0A 3O8CA 2C8XB 1V2UT 4ISHH 2ZFQH 4AORA 1HB0B 2VINA 5SGAE 1C5LH 2Y5FA 1W0YH 2GD4B 4DGJA 8LPRA 4ZHAA 4JZIA 3MU5A 4CRCA 1W7GH 5KGOA 1GJCB 2C8YB 1ZTLA 1JXPA 1AB9B 4Y11E 2JIZD 1YPHE 2R3YA 2BLVA 1FXYA 3L3TA 2O9QA 4WVPE 1C5NH 4I8HA 3U8RH 2ZZUH 3U98H 5JBTA 2GCTC 3SU2A 1BRUP 4ZXXH 1EB2A 2OINA 3DA9B 4YT6H 1GDUA 2PV9B 1GI7B 1GJ9B 1UTLM 4RN6A 1CGHA 4CHAC 4U01A 1ARCA 2ALPA 3T29A 5HM2A 1CVWH 1O2QA 2P94A 1G3CA 3LONA 3T2NA 1GBAA 2XBXA 4FU8A 3BTHE 4DIIH 2FP7B 1NFWA 1GHZA 3GY6A 3ZZ4A 4CR5A 3NKKA 3Q76A 1DICA 2PSXA 1AMHA 1A0HB 1LVBA 1DITH 1KLIH 1YCPM 4NFEA 3BTGE 1ZOMA 4FUDA 3S7HB 2F4LA 3U8TH 3C1KA 2C90B 4XSKU 3CS0A 4FUCA 1O5FH 4X6MA 3FN8A 1WCZA 2AERH 2FWWA 4J2YB 3SYJA 3RP2A 3LGVA 1FY4A 3IG6B 1O2GH 2AEIH 1TRNA 3KGPA 3TPIZ 4X1QU 1TLDA 2VWNA 3KF2A 1GG6C 1BBRK 1D3DB 1SGIB 1GI0A 3NZIA 2VU8E 2VIOA 4OS6A 4YOGA 3E3TA 1A4WH 2F9BH 1FY8E 1MMJN 1OYTH 3EAJA 5GXPA 1OP0A 1N6XA 3PMJA 3BSQA 1HJAB 2ALVA 4KTCA 4UEHH 3SNDA 2H9HA 1Y5BT 1O5BB 4I86A 1TNGA 1O3CA 2ZDNA 1UK3A 1QURH 5KEDA 3RXIA 5K7RA 4Y76A 2CGAA 1W8BH 2I6QA 4NCYA 2A45B 3PO1C 4FETA 1SVPA 2ZCHP 3ZVBA 2GCHF 3A85A 4TSFD 5HMAA 4AYVB 2AMQA 1GBLA 1YPGH 4ZCNA 2BY7X 1QRZA 2FOFA 1Y3XA 5EIYA 3TVJB 1G2LA 1G37A 1OSSA 1OHHD 2C8ZB 2OC8A 3N7OA 5DP6A 2JH5D 3RDZA 2C4FH 5L2ZH 3RXJA 1GGDC 4E7RG 3GDVA 1C2KA 2AMDA 2FI5E 5HYOA 1NBME 3VXEH 2ZFFH 1CBWC 3AW0A 3RXFA 2ANKH 1GCTB 1FN8A 2Y5HA 3A86A 2SGPE 1OP8A 2BVXH 2YMSB 2V35A 3ATLA 1HRTH 2ZA5A 1YF4A 1ZHRA 4ISNA 4NZQA 1OWKA 4UONA 1UTJA 1L1GA 2VH6A 1RJXB 4Q4LA 3ZYEA 2AH4X 1ELCA 1HGTH 2QXIA 4K8BA 4OS7A 1G36A 3IITA 3NK8A 2ZI2H 1C2LA 3BTTE 3W95A 1XVMA 5EW2H 3VFEA 2L6OA 2GKVE 2BXUH 4WMFA 2OQ5A 4GVUA 1O5AB 1HXEH 1O30A 4U32A 1NZQH 3U1JB 1C2IA 2ZHEH 3FKSD 3RXHA 1V3XA 2CV3A 4UDWH 1YLDA 3A88A 4LZ1H 1WUNH 3FZZA 4CH8B 1CHGA 2BX4A 1O35A 2ZGXH 2D26C 2ASUB 1S6FA 3BG4C 5ETXA 1ZLRA 2FDAA 3AK5A 2XBWA 1DWBH 3WW7A 3SQHE 3T28A 5C17A 2PW8H 1H9HE 4AG2A 4H42U 1GBMA 3FP6E 1ETRH 4MQAA 1P2KA 4O9VA 5DK1A 2GZ8A 1WXRA 2QXJA 4ZAEA 1WU1A 3M36A 3SHCH 1XUKA 4RKOB 2VNTA 1EPTB 3RXMA 1NBMD 2KZ4A 3F9EA 1GBIA 1MKWH 1O3AA 2FOAA 3B9FH 4BAOB 1TNKA 2ZWLH 3PMAB 3A89A 3UY9A 2WPHS 2PWXA 2GDEH 3H7TA 4NA7A 3Q3YA 2ZPRA 3L33A 3DHKH 4WXIA 2EY4C 5IDKA 1C9TA 1BA8B 2G5VA 1G30B 2OC1A 2BMGB 1P09A 2FO9A 3FP8E 1V2QT 2BD5A 2WPIS 1SGFA 4NA9H 1S83A 1HAOH 1AKSB 4XFQA 1OKXA 1F92A 2WPDD 1P3EA 3ZZCA 1WDIA 2EEKA 1Z71A 3FFGA 3DSGA 2PKAB 5T3HA 2WYGA 2XBVA 3RXDA 1AN1E 1O2RA 1L1JA 3RXBA 1F5KU 4ZXYH 3RXUA 3ATWA 1K1IA 4ABEA 1AGJA 1HUTH 3PV4A 2HPPH 1O2YA 1OPHB 2P16A 2A5KA 5EG4A 1E36B 3LGTA 4HGCA 1EAWA 4AFSA 2J34A 4X1RU 3OEED 1FY5A 2BD4A 2HVYB 4R8TB 4OGYA 2PKAA 5FXLA 1UMAH 2VVUA 3VB5A 1LHGH 1V2NT 3OEHD 3SV8A 4DT7B 3GYLB 2W6ID 1C5YB 2G81E 3AW1A 1K28D 1YYY1 4OS1A 2G00A 2Y82A 4YZUA 1UTNA 1O5CB 2VVCA 2FLRH 3ZIAD 1O3NA 1BDAA 3HATH 3MH6A 3T5FH 1G9IE 1SFQB 1ZSJA 3GDUA 2ZHFH 3OSYA 1H4WA 3EDXB 2ZGHA 5GDSH 1ARBA 1EFRD 3VGCB 1V2OT 3ESTA 1L2EA 1XMNB 1RTKA 5L30H 4I8LA 2P3TB 2WUCA 3LH1A 1BTYA 4IC6A 3OU0A 1C2DA 1DSTA 3O8BA 1A5GH 3URDA 3D49H 4AGJA 1SGYE 1V2WT 2NU4E 3KEEA 5T6DA 1NY22 1WOFA 1UVOA 4YOIA 3ZZBA 4BAMB 2ZTZA 3FO8D 2VVVA 4I32A 5DP9A 1O3BA 3P92A 3UTUH 1XUHA 1C1UH 3HGPA 4MNXA 1KXFA 2SGEE 3UR9A 1PPZA 1CHOG 3TH2H 1LO6A 3SU0A 2UWLA 5DP4A 6ESTA 1ELAA 1YPMH 4FUIA 1BMLA 3KCGH 2TPIZ 1BRCE 1TGSZ 4XBDA 3MO6A 3SNCA 1W13U 2ZQ1A 1GJ6A 3RMLH 4U2WA 1ANCA 1O2PA 2GZ7A 1NO9H 1JMOH 4MNWA 1HJ9A 1PQ7A 1C2EA 1JOUB 1EAXA 3GCHC 4LXBH 4YM9A 2WV5A 5LPFA 3P8OA 1J8AA 4K1SA 1PFXC 1O2XA 2GX4A 4M7GA 3DFJA 4DVAU 2BD9A 3GY7A 4X2WA 3R3GB 3H7OA 3QN7A 4JYVH 1BZXE 1HFDA 3RXLA 3MU4A 2FZZA 4FVDA 4IGDA 2A4OA 3A8AA 5T1VA 3RXTA 4ASUD 4KKDA 4XDEA 2FS8A 2GV6A 2CMYA 4DG4A 3EA7A 3TJNA 1DWCH 3ATIA 3SU5A 1XKAC 1O32A 1ZHMA 2A5AA 1MTSA 4INKA 1CHOF 1SHHB 1IAUA 5EW1H 1K1PA 3BEUA 2BM2A 4BNRA 3SI3H 3KQDA 3ZZ6A 4D9QA 4D9RA 3RM2H 1PPHE 4YO9A 3LC3A 4JYUH 1MTVA 5TJXA 2ZCKP 3RXSA 3UAIC 1V2LT 2QY0B 2JH0D 1VGCC 1QY6A 1AY6H 1MQ6A 1A5HA 4E7NA 3GY5A 2AGGX 3PROA 2M5TA 1ZPBA 4FUHA 3TU7H 1QB6A 2FOEA 4BTUB 1MKXH 1YLNA 2F9VA 5HXFA 3M7TA 2B0FA 1A3BH 3KNXA 1BT7A 5JYIA 5EQRA 3RMOH 3F6UH 1L1NA 2BLOA 2V7QD 5GJ4B 2Z7FE 1P8VC 1DX5M 2ZTYA 1OWJA 5K0HA 2G4UA 2FTLE 5KECA 2PP6A 3NRLA 2FOCA 4RKJB 4TWYA 2FIRH 5HIZA 4BTIB 2PKSB 1Z1IA 1RIWB 3SNBA 1FPCH 1QR3E 2XC5A 4X2YA 1P2MA 1RS0A 5F8TA 2W3KA 4B1TA 1J14A 1DPOA 4TPYA 1EZUC 2ZU5A 2ESTE 3ZZ7A 1DANH 1UTKA 3A82A 3D62A 1SLWB 2BX3A 3EYDA 1C2FA 1C5MD 1ID5H 3K65B 5DPAA 5E2PA 1ACBE 5F03A 1WSSH 2QE7D 3A8CA 3BTWE 3KL6A 2AFQB 1P57B 2A4GA 1QA0A 2J95A 4YTAA 1DFPA 1VR1H 4CRDA 2F43B 3RU4T 1H9IE 2IJOB 5E0HA 1FN6A 2D1JA 2J5UA 2JETB 2AIQA 1DUAA 2OQUA 3A8DA 1V2JT 3P8FA 3RM0H 2LIZA 2Z94A 1C1TA 1HYLA 1O37A 2FPZA 1H8HD 1ZRBA 3PRDA 2FOGA 3UQVA 5CHAC 4SGAE 3ZZ8A 3PLBA 3LJJA 1HBTH 1UTQA 1YBWA 2BDGA 4O97A 3KN2A 4HG6A 1MKXK 1VITG 4ISOA 4ZUHA 1GHXH 1MZAA 1FAXA 3CS7A 1E37B 1FUJA 3MQKC 2G55A 4F55A 5C5NA 4JZEH 1A1RA 1WV7H 2O8UA 2FX6A 3A7YA 1GCDA 1S85A 4JK6A 3OTPA 2O8TA 3S0NA 2GCTB 1G3BA 4NWKA 3W1EA 2B7DH 5JBBS 4Y0YE 5C0UA 4P02A 2RDEA 2FOHA 3MYWA 5JBCS 1ANDA 5A09A 4CHAB 5C67A 1Y5UT 1AHTH 3M5OA 2Y7ZA 3K6ZA 2OD3B 3BV9B 1QQ4A 4JK5A 3F0OA 2WPKS 5FPSA 1J16A 1SOZA 2PTCE 3LKWA 1Q3XA 4ZH8A 4DJZB 1C1RA 5A0CA 3GCTG 1NU7B 5IYTA 2QC2A 1SGNE 2EA3A 2GZ9A 5T6GA 3PWBA 1VITF 2EI8A 4Q63A 1Y5AT 1C5XB 1BBRH 4CR9A 1W12U 1NN6A 1TGNA 3ZV8A 1S6HA 4WXVA 3TK5A 2STBE 2KR7A 1LQDB 1GG6B 2GVFA 4UFDH 4YOJA 2H9EH 1C1QA 4ISLA 3M5NA 4A1VA 2J9NA 4CRAA 1BOQA 1QRWA 1Y3UA 4X6OA 2P93A 1O0DH 5E8EH 2R0KA 5LPRA 3N7DA 2HNTF 1BTZA 2EC9H 1HIAB 1LHDH 5GIBA 2A7HA 3SNAA 2STAE 1LHCH 4B73A 2IPQX 2LNCA 4B2BA 4SGBE 1O31A 1HAVA 3E16B 1O33A 1UTPA 5EQSA 1M9UA 4FUJA 1NT1A 1GI4A 4BXWA 4DCDA 1IOEA 1DLKB 1RXPA 2IJD1 5C1UA 2ZGJA 2VWLA 3BIVH 1O34A 1E0FD 1PQ5A 3T27A 4DW2U 3OX7U 2QF4A 1C5UA 1SSXA 1O2NA 1WTGH 2QIQA 2XYAA 3AVZA 1TYNA 2QF0A 5FAHA 3GCTF 3M5LA 1BMAA 2FI4E 2ZU2A 2ODQA 2ZFTA 2HPQH 2G8TA 2KX4A 1FMGA 3PV5A 4UFFH 1O2HA 3OE7D 4A92A 2H9TH 1YLCA 4YLUA 1GGDB 2OBQA 1IQNA 4X6NA 4UD9H 2ZKSA 2P59A 1D9IA 3QK1A 2CJIA 2VH0A 1O2LA 3D65E 1NM6A 5HKKD 3OTJE 4MPVA 3SZEA 3D23A 3HKJB 3K9XB 5DP7A 1IQEA 4WJG2 2A5IA 4ZHMU
chains in the Genus database with same CATH topology
4I33A 5FHTA 1JWTA 1GJBB 2XCNA 1O3OA 1TGCA 5EPNA 1UVPA 1LPKB 4NIVA 5AVDA 4CRFA 5HM9A 3SN8A 1WBGB 1A46H 1FY1A 1CA0C 1GBHA 1ELBA 3TNSA 1BTWA 3M7UA 3MNCA 3BTQE 1O3EA 1VITH 4K1TA 1ZJKA 3Q00A 2SNWA 3ATMA 2ZO3H 1IQFA 1UO6A 3VB6A 2PFEA 1T8NA 5T6FA 1LKAA 3TGJE 1FJSA 1AU8A 1AQ7A 2HLCA 2ZPSA 3A80A 3FP7E 3SO3A 3EA9A 4BAHB 4BXSA 5AF9H 1K1JA 2F9UA 1MD8A 3MNXA 1A3EH 4GHTA 3ZVGA 2ZHQH 4ZHLU 5JPMH 1EKBB 2O8LA 3UIRA 3TIUA 1RGQA 3S9AA 1EXFA 3ZZDA 1BB0B 4Q7YA 1P01A 2BD3A 3NCLA 2Q6DA 4U30A 4B75A 3BG4B 1YM0A 1BUIA 2RDLA 4K3JA 3RC5A 3ZZ9A 1RFNA 2J92A 3ZYDA 3QLPH 1ETTH 4GAWA 1NPMA 3FANA 1O3MA 2VGCC 3BEIB 3UFAA 2HVXA 1UK4A 1JBUH 3HK3B 1QGFA 5BRRE 1BRAA 1ELVA 3GISB 1AIXH 4X1NU 8GCHG 5EXNA 2ILNA 1L4DA 2ZU4A 2JH6D 1B7XB 1SFIA 1ZZZA 3E91A 1C5ZB 2VIPA 4INHA 3KQCA 3RUOA 4F49A 1J17T 1SR5C 3FVFB 1AUJA 1GMHG 3SBKA 2NU2E 2BHGA 2FODA 1VCQA 3NPSA 1UHBB 1AZ8A 1N8OC 2ZP0H 3PB1E 4FVBA 3LH3A 4Y8ZA 1ZMJA 1N6YA 2H1UA 4NFFA 2D8WA 9LPRA 3SJIA 3RXRA 1FPHH 3WY8A 5JDUB 1EAIA 3A81A 7LPRA 5E2OA 4MPUA 3GCOA 4K2YA 4IMZA 1PYTC 5I46H 5FX6A 3TGIE 1LPZB 3SUEA 5LPEA 1KDQB 1UHBA 2VB0A 3TLOA 1LHEH 2Z9JA 4TY6A 1BRBE 3S7KB 2FYQA 1FLEE 5F6MA 4AB8A 3BN9A 1C5RA 1ELDE 2BD7A 4NZLA 2QF3A 1C4U2 4MVNA 3TJOA 3BTME 1OXGA 2PGQB 4QT8C 8GCHF 3GOVB 4JMYA 4AG1A 1EZQA 1Z8IB 2ODYB 1KIGH 1D6WA 3SU1A 1ZYOA 1MD7A 1HAPH 1P2IA 2R3UA 3HKIB 2TIOA 4I31A 1KDQA 1GMHF 2TGPZ 3QDZB 2ZCLP 4MG3A 1HAHH 3BIUH 1PPCE 3MH7A 4ABGA 1T31A 1TALA 1O3LA 5G4BA 3V7TA 2F9PA 2BY5X 1O5DH 1SGRE 3SI4H 1INCA 3T26A 3ELAH 4DOQA 1BJVA 2HGTH 2FXRA 3BTKE 6CHAB 5C20A 3U1IB 3KIDU 3F9GA 1GI2A 1ESBA 2F9OA 3URCA 2P95A 3SUDA 1BTPA 1C1PA 1XM1A 1GJAB 3EGKH 1DWDH 4X8SH 1ZRKA 2NU0E 3W94A 3DT0H 1TONA 4BAKB 1W2KH 1EPTA 2V3OH 3KQEA 1DDJA 1D6RA 3PWCA 1GI1A 1Z8RA 3ZVCA 1C1OA 4X2XA 2F9NA 1PPBH 3AASA 3P8NA 1V2TT 2WPJS 5DP8A 1W11U 2JKHA 4X6PA 2A32A 4MPXA 1XXFA 1MAYA 1AKSA 1K9OE 1EOLA 1AD8H 3B8JA 1DOJA 2XWAA 3A7XA 4H4FA 4JZFH 2RA3A 3M35A 4ZMAH 1GBFA 1AUTC 4BTTB 4FU9A 2XRCA 2GDDA 3A87A 2D2DA 3CENA 3F68H 3TJUA 1OX1A 2LPRA 1C1VH 1Y59T 3BTFE 3LGWA 1AFQC 3GCHB 3ITIA 2ZFSA 3TGKE 1C1SA 1ZR0A 3UWIA 3E0PB 3UNRA 2PSYA 3LGUA 4VGCC 1C9PA 1DXPA 1BHXF 3QZQA 1QJ1B 2GV7A 2OCVB 1Y3WA 1BJUA 4CRGA 1XVOA 2XTTB 1O2JA 1P2JA 1Z6JH 4K60A 2GT7A 2FLBH 3ZZ5A 5GCHG 2G5NA 3PMHB 1B0EA 1SGEE 2DE8A 3UR6A 1C1WH 1H1BA 1SGDE 3LU9B 1TOMH 2QA9E 2ZTXA 1G2MA 3RMMH 3RXAA 2C8WB 7KMEH 4NIYA 1ESAA 5TCAA 1TBRH 2UUKB 1T8MA 1OP2A 1CU1A 1UVTH 1TMBH 2FI3E 3Q77A 1C5TA 1KY9A 2O8WA 1WQSA 4GPGA 1GI9B 1P9SA 1F0UA 1HV7A 3SORA 4HFPB 1VGCB 3M3VA 1MTNB 4IC5A 2QCYA 3MO3A 3MNBA 3TNTA 3MHWU 2BDBA 4X8UH 1AVWA 3DFLA 2FESH 2VIVA 5E0JA 2WYJA 8KME2 4WMEA 1XUFA 4NIXA 4CRBA 3VXFH 3SHAH 1DY9A 4WF8A 3RU4E 2W3IA 3GY3A 1YGCH 1P03A 1UVUH 3E90B 1TX8A 3HGNA 1TNLA 1C5WB 1QJ6B 4ZKRU 5DO4H 1W0ZU 2OUAA 2P8OC 1GI5A 3P8GA 5I25A 2Y6TA 4ABJA 2A2XH 4B74A 1ZMLA 2P3UB 2HRVA 4ABFA 1C2MA 1YPEH 2TGDA 4DURA 1F0SA 1O2SA 1A0LA 1T7CA 1VCPA 1T4UH 1TBZH 2W5EA 4CBOA 2NU3E 3I77A 1W3CA 2H5DA 1TFXA 2CHAB 4AGKA 2W7SA 3MI4A 1GPZA 1TRYA 1AZZA 3R0FA 1IHSH 1FZZA 4HZHA 1DT2A 2A4QA 3ZV9A 1AE5A 3K6YA 4E05H 3SZNA 3SJKA 2V3HH 1V2KT 4X1SU 3E8LA 1IQJA 4OS4A 1QBOA 3A7VA 2GMTC 1QNJA 1QL7A 1DLEA 2FMJA 3SJ9A 1TQ7B 1O3HA 1Z6EA 3L6PA 1GI8B 3MWIU 2PGBB 1SG8B 1EJNA 4PROA 3RMNH 3T62A 2CXVA 1ZHPA 1PYTD 1MAXA 2IOTA 4NG9H 1ZTJA 4X8VH 3RU4D 3QTOH 1BTXA 1O5EH 2PUXB 1TX7A 2R9PA 1EAUA 5EODA 3TK6A 1TOCB 2AS9A 1HLTH 4WMDA 4HI3A 1PPFE 4NWLA 3S69A 4Z6AH 1SC8U 3QUMP 2YNAA 4YT7H 4TWWA 2WPMS 2AIPA 1LPGB 1IQIA 1K1LA 1IQMA 2BY9X 4NSVA 1EZSC 3CP7A 4ZKSU 1EJAA 1ELGA 2PLXA 5DP5A 1BMMH 1JIRA 5L6NH 2BZAA 1TPOA 2Q1JA 4XBCA 3O8DA 2ZEBA 2FYRA 3QO6A 1F5LA 3A84A 1WQVH 1Q2WA 4D76A 2VIWA 4Z0KA 1NRNH 3BF6H 1NTPA 3RXEA 3M7QA 1QFKH 5A0BA 3V12A 1NFYA 3E0NB 1O3PB 3PLKA 1GVZA 1TMUH 4X0WU 1QRXA 2BLWA 2ZDMA 1BHXB 1JIMA 3HK6B 3EBNA 2Y5GA 5AHGH 2F83A 1ORFA 4FU7A 1C5SA 3QGJA 1D3QB 1FIWA 1CT0E 3MU1A 3SV7A 1SPJA 4Y8XA 1P9UA 1CO7E 2HWLB 3TK9A 2FM2A 5C5OA 1EX3A 4ZKOU 4GUXA 2ZIQH 2GTBA 2HALA 3NXPA 2K1QA 4LOYH 1NFXA 4Y7BA 3GY8A 2EI6A 1GMCG 1FY3A 1F2SE 4FUEA 1SQAA 3UPEA 1O38A 3LGIA 1EUFA 1Y3VA 2GT8A 2I6SA 1C1NA 6LPRA 3UNQA 1UK2A 1EQ9A 1Q31A 2ZQ2A 2F91A 1G3EA 1LTOA 1SGPE 3RXGA 1BQYA 2A7JA 2THFB 4RSPA 1BIOA 1O2UA 1OWDA 2B8OH 2F3CE 5J4QA 2UUYA 1ZGIA 4Q7ZA 4WWYA 1GMDG 3MOCA 4O3TA 2R2WU 3M3TA 1QIXB 1GBJA 1EATA 1LVYA 2RCEA 3RC6A 5A0AE 3JZ1B 1SGFG 1UVSH 1J9CH 1UCYE 3PYHA 1HAIH 1P3CA 3LOXA 4K8YA 1JRTA 3VEQB 1S5SA 2SFAA 1OS8A 1QB9A 4B71A 4UFEH 1VCWA 3LJOA 3OY6U 3VB7A 1GMCF 1SLUB 1IQKA 1VJAU 1SLVB 4JCNA 1RTFB 1EJMA 4I8JA 2ODPA 3Q3XA 1C5QA 1GJ4H 1GVKB 4Q2KA 3F1SB 2DUCA 1Z8JB 2BOHB 5F8ZA 2GP9B 1THPB 1WYKA 2ZNKH 4Y8YA 1K1OA 1CA0B 2BD8A 1DVAH 3VB3A 2TGTA 4THNH 1TAWA 1DE7H 4K1EA 1SGQE 2ZDVH 1OYQA 1TABE 1CQQA 4FUFA 3F9HA 2Z3CA 4UE7H 2A2QH 1DM4B 1GMDF 1B0FA 1TPAE 4XBBA 1SL3A 3S9BA 3QZRA 4O3UA 5B6OA 1GHVH 1FIZA 4MTBA 1TE0A 5FCKA 2VJ1A 3BTEE 3PO1B 1HIAA 2BOKA 2W7UA 4J1YA 2ZDKA 4OGXA 1MU8B 2B9LA 2BDCA 3OY5U 4JYTA 1MH0A 4WY3A 4NA8A 1L4ZA 1SOTA 4IMQA 3M3SA 1TWXB 3SV2H 3ZZ3A 1P12E 1C4V2 5A2MH 2C93B 3U69H 2TGAA 1GDNA 4KTSA 4Y7AA 1O2ZA 3S9CA 2VGCB 1F7ZA 3MFJA 2V6NA 1S82A 4GLYA 1YC0A 2BVRH 3A7TA 4WH6A 3E6PH 1K1NA 1GJ7B 4Y71A 4D8NA 7GCHG 1C2HA 1CBWB 1W10U 1LHFH 4AYYB 5FPYA 1F0TA 5EQQA 3ZVAA 1SBWA 2FOBA 4MNVA 5H4IB 4ABHA 1TA6A 4AN7A 1WTHD 1MCVA 1GBKA 1V2MT 2RG3A 1NRPH 1O3DA 1S0RA 3TH4H 4OS5A 1GVLA 2GCHG 1V2VT 1ABJH 3SV6A 3ZVEA 1TNJA 2O8MA 3V0XA 2TRMA 1V6DA 4KGAA 1GBBA 1N8OB 2Y81A 4FUBA 1ELFA 2W26A 1AO5A 3A83A 3BEFB 5E0GA 2A31A 5A8XA 1ELEE 4AZ2B 1DWEH 1ZSKA 3P70B 1C2JA 1LCYA 3G01A 2J4IA 2KAIB 5FCRA 4TPIZ 1A0JA 5FX5A 5CE1A 3SGQE 5BPEA 4YESB 2SGAA 2ZDLA 5GPIB 2XCFA 5EOKA 3GY2A 1GHYH 3UUZA 1AB9C 4A5TS 2VIDA 5A8ZA 1MTWA 1Z1JA 3EE0B 3NUMA 3ZVDA 1GWAA 1NRQH 1NESE 1IHTH 1TB6H 4AFUA 4D7FA 2A1DB 4CH2B 7GCHF 4FXGH 1T4VH 2KAIA 2UWPA 1HAXB 1OWEA 2PHBA 1H9LB 1S84A 2H2ZA 4JZ1A 1T32A 3FZDA 1GL1A 2XC0A 3MU8A 1HJ8A 2BQWB 3SNEA 1NS3A 4TYDA 2BDYA 3OYPA 2J94A 1YPKH 2OXSA 1CA8B 1CSOE 1SLXB 4FUGA 3SQEE 9ESTA 1AE8H 3DD2H 2FOMB 4GCHG 2BQ6B 4Y79A 1CGJE 5EXMA 5LH8A 4I7YH 1UTOA 1S0QA 3TH3H 2ULLA 3MO9A 2AYWA 5PTPA 1ESTA 1O2IA 1T8LA 2CN0H 1NC6A 1P11E 3RXCA 3RLYH 5EU8A 1GBTA 2QV1A 3A7WA 1TNHA 1N1LA 3QWCH 1MU6B 3PTNA 1O2MA 1QBVH 1XX9A 1MUEB 7ESTE 1C5VA 3RXOA 2BYAX 3PMBB 5JB9S 1ETSH 3GY4A 1HJAC 1FONA 1LKBA 4K69A 1ANEA 4Y6DA 3MMGA 2ZHDA 4AFZA 1O2KA 1C4Y2 2ZU3A 3SOSA 2WPLS 1MQ5A 2QYIA 1KLTA 1KXEA 2AGIX 3NWUA 1PQAA 2YOLA 1ABIH 4GCHF 1FAKH 2BY8X 1JRSA 1UCYH 5DP3A 1IQHA 1RD3B 1TIOA 1AFQB 1EZXC 2BB4A 1O2TA 4TY7A 3P95A 4F4OC 1FDPA 3MTYA 4VGCB 1KXBA 1GHBG 1P02A 1BCUH 2UUFB 1EP5A 2ZDAH 1TX6A 1YPLH 3UNSA 2OC7A 4OS2A 3UREA 1H8IH 5DG6A 2ZECA 4ABAA 1YPJH 1GCTC 1O2WA 2FS9A 1MTUA 4IS5A 2QXHA 1P0SH 2QAAA 1CT2E 1XKBC 5FPTA 3IWMA 1KXAA 1TQ0B 2XBYA 2WV4A 5C3NA 3STIA 1V2ST 2NU1E 2EI7A 1GJ5H 1LVMA 3SW2B 1KXCA 1E34B 2NWNA 4IW4E 2Z3DA 4AX9H 5LGOA 2G52A 3JZ2B 1YP9A 1QHRB 5AFZH 4KP0A 1Y3YA 1P2QA 5L2YH 3E1XB 2Q6GA 4HTCH 1P05A 3ENSB 2FTMA 5EPYA 6GCHG 4LK4A 1SQTA 3SJ8A 4ZKNU 2H6MA 1SI5H 5C1YA 3QGNB 4K5ZA 1BTUA 1C2GA 1GHBF 1QBNA 1NRRH 1VJ9U 1X7AC 4BAQB 1NU9A 3A8BA 5GWZA 1OOKB 3TITA 1MCTA 2OBOA 4AOQA 3PLPA 3UOPA 5AFYH 1UCYK 2SNVA 2CF9H 2XNIA 1TGBA 2BY6X 3LDXH 4I8KA 3M37A 1V2RT 1A5IA 1Z7KA 3GICB 2Z6BD 1O5GH 2HNTC 1O2VA 1ZTKA 2XW9A 3LIWA 4X8TH 1QQUA 1J15A 2K7XA 5A8YA 1A2CH 2P8OB 4Q80A 1EPTC 2P3FH 2G51A 2WINI 3DUXH 1DS2E 1GBEA 1BITA 3AAVA 3C27B 1A7SA 1K22H 1PPGE 2A0QB 1UTMA 4B2CA 1MKWK 3SU4A 3GDSA 6CHAC 1ZGVA 1LMWB 1KYNA 1KTTB 3MU0A 2VIQA 1AI8H 5DGJA 1QL8A 1O3GA 6GCHF 3O8RA 3ODDA 2AMPA 1XUIA 1MBQA 3P17H 2BDHA 3I29A 2ZF0H 1XUGA 3RXQA 1GHAG 1TPSA 3VB4A 1FV9A 1OWIA 1P10A 2ZGBH 2YNBA 1SGTA 1MZDA 3M5MA 4AB9A 2TBSA 2PTNA 4XOJA 1DSUA 1ZMNA 4D7GA 2Z9LA 1EASA 1O3KA 2GMTB 3GYMA 4X2VA 1O36A 3ZZAA 5ABWA 3I78A 1G32B 1BBRE 1W7XH 1GJDB 1HDTH 3VPKA 3KHVA 4KELA 4YLQH 1TNIA 1LQEA 2BVSH 1QTFA 3B23B 3GCNA 3SV9A 2OTVA 1GL0E 2ANYA