4RSPA

X-ray structure of mers-cov nsp5 protease bound with a designed inhibitor
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
304
structure length
303
Chain Sequence
b'SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orf1a protein
publication title Ligand-induced Dimerization of Middle East Respiratory Syndrome (MERS) Coronavirus nsp5 Protease (3CLpro): IMPLICATIONS FOR nsp5 REGULATION AND THE DEVELOPMENT OF ANTIVIRALS.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 86
structure length 303
sequence length 304
ec nomenclature
pdb deposition date 2014-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4rspA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4rspA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4rspA02
5A0BA 1A5GH 3Q00A 1DSUA 2ZFTA 4UFFH 4ZKNU 1IAUA 2Y5GA 4WXVA 3W94A 3A84A 1TB6H 1UTMA 3F6UH 1YPMH 3RMMH 1L2EA 2FIRH 1P57B 3RXKA 3LGIA 1DOJA 1KDQA 4ISOA 2VJ1A 1KYNA 3NXPA 3FP8E 1EX3A 2ZI2H 5DP7A 3LONA 4IGDA 2ZECA 2FI4E 1Y3WA 4JMYA 3SUEA 1J14A 2ZU3A 1EP6A 3SO3A 2Z9GA 4D7GA 1GHBG 1ARBA 2C8XB 5F8TA 4ZHAA 4XBBA 2Z94A 4ABEA 5L30H 1HAPH 1GBEA 3U8OH 3U8TH 1C1UH 2OINA 2F83A 3T27A 7GCHF 4SGAE 1CHOF 1QQUA 1O30A 5E0JA 3ZVBA 4DT7B 3HGNA 4KP0A 4A6LA 2H9EH 1TA2A 3P8OA 1ABJH 1ELCA 1HXFH 1QRWA 2G55A 2RG3A 1TPPA 3TVJB 2QV1A 3DFLA 2G4UA 5EPNA 6CHAB 1Y59T 1BZXE 5A8YA 1OPHB 1GI9B 5J4SA 2SGQE 3PMHB 2GX4A 1SB1H 4MLFB 5C1XA 3MNXA 1W12U 4I8KA 1PPBH 4D7FA 4OS1A 1O2TA 1HJ9A 1W7GH 1C2KA 3JZ2B 3LGTA 1FUJA 1QTFA 3SGBE 4LXBH 2PR3A 2W5EA 2AGIX 2P59A 1SGDE 2Z9JA 1PQ8A 1QGFA 1CE5A 1TGSZ 1TNGA 4FVDA 2PUXB 1DICA 2VU8E 3SN8A 3KIDU 4Q80A 1TAWA 2CHAB 1ZTJA 1HFDA 4NIYA 4WJG2 5EQSA 1YPHE 1T8NA 4AB8A 1HAZB 1FY3A 3VGCB 1CVWH 1E38B 4ESTE 2HVXA 1DVAH 1MU8B 5GCHG 1DSTA 3WY8A 4MNYA 4HZHA 5EQQA 4AORA 1NS3A 3M35A 3L6PA 2QIQA 1GBAA 1Q3XA 1GPZA 1TRYA 1V2NT 2BTCE 2Q6DA 3G01A 3SHCH 1Q2WA 2EI7A 2A7HA 1EPTA 3LC5A 1WCZA 4JZDH 3MYWA 1H8DH 1ZHPA 3O8BA 1MMJN 1E35B 1QFKH 3SW2B 3UR9A 3AVZA 1EUFA 5C67A 2AEIH 2V35A 1AD8H 3TJUA 2Y7XA 3M3VA 4ABHA 1O3IA 3SORA 5F03A 1YP9A 4GSOA 1NO9H 2FOMB 1GMCF 3SJKA 1OSSA 1Y5AT 4XE4A 1UK4A 1EJMA 1ETTH 2B7DH 3RMOH 1A7SA 4X1RU 1KTTB 1Z8IB 1O31A 5FPTA 3SU2A 2BD7A 2SGAA 3D62A 2XBWA 3CS7A 1IHSH 4NWKA 3UWJH 2XXLA 1O3FA 1ZMNA 4CH2B 2YNBA 1LHCH 1PQAA 1H8IH 2F9VA 2QA9E 2ZU2A 1OP8A 5CMXH 3Q77A 1B0EA 2JH5D 3UREA 3BTGE 3RXDA 1C9PA 2AYWA 1GVLA 2OCVB 2VH0A 1E0FD 1NRPH 1C2EA 1O35A 2BDAA 1O2XA 1DS2E 3LGVA 1RXPA 2HWLB 3E8LA 3SU4A 5GIBA 1XXFA 2P8OC 1O2GH 1H1BA 2G51A 2QC2A 3KF2A 1T8MA 1RTFB 2J38A 1PYTC 4CRBA 1SGQE 5F8ZA 1C5RA 3P17H 1V2WT 1AQ7A 5GPIB 1AI8H 1C2DA 3SI4H 4UFDH 2WV4A 2FOHA 4OS5A 1HDTH 2XNIA 2FS8A 4B2AA 1IQIA 1OOKB 1ZHMA 5FAHA 1RFNA 1CU1A 4KKDA 2ALVA 1GI4A 5A0CA 1AB9B 1OS8A 4NIWA 1MZAA 1YLCA 4BTIB 4INKA 4DG4A 1TNIA 5HXFA 2ZHQH 3CP7A 2ODPA 4O3TA 1GVKB 5LPEA 2BY8X 3RU4T 4B2BA 4MDSA 2WPLS 4AZ2B 1QB9A 1H9LB 1GJ7B 2Y81A 3LGYA 3BTKE 2ZDKA 4A1TA 2VB0A 2ZWLH 3M7UA 1CQQA 4NIXA 1QBVH 2QAAA 1DT2A 1PQ7A 3F9HA 4JK5A 1QL7A 1GI1A 3MU4A 1HIAB 3P95A 4GCHF 4X6PA 3SV6A 2J92A 3PM3A 1CA0C 3LC3A 4MTBA 2WPJS 5K7RA 3SV7A 2AIPA 3LKWA 1O3KA 4DW2U 2ZDAH 3EYDA 1KIGH 2Q1JA 1ZMLA 1UVUH 3HK6B 2SGPE 4MPWA 2KAIA 5PTPA 3QTVH 5FPSA 1BMAA 1ZRBA 3UTUH 5LGOA 1XUIA 2QCYA 1Z6JH 4FUIA 1OWDA 1LQDB 1HYLA 1C5YB 1O2ZA 4X8UH 1GHWH 1GI0A 3SGAE 3PLPA 1O3JA 3EGKH 1IQEA 1UTKA 1ESBA 1A3BH 3H7TA 1C1PA 1JIMA 1OX1A 1RS0A 4ABGA 3TK5A 3SJIA 1KDQB 3ITIA 3DA9B 1FJSA 4DIIH 1V2TT 1ZTKA 4E7RG 2F3CE 5CHAB 3A86A 4Q7YA 1HUTH 3KQCA 1IQMA 4D9QA 1QL8A 1G36A 2GZ7A 4BTTB 3ZZ3A 1ORFA 3ZV9A 2J9NA 3QGJA 2EC9H 4FU8A 4BNRA 3MMGA 1BIOA 5GDSH 4KTCA 3LT3A 1BTPA 1SLXB 3OX7U 4NSYA 2JKHA 3A8DA 1ANEA 1O36A 1ELDE 6LPRA 1EKBB 3PMJA 1F5LA 3GISB 3SOSA 4A92A 1GHBF 2C8ZB 2BY9X 1GJ5H 4CR5A 1XM1A 3ZYEA 2HNTE 1VITF 1GHAG 1KXAA 1LVYA 4ZXYH 4MVNA 4B73A 4AFQA 1TA6A 1MKWH 1TNKA 3SU1A 4AX9H 1O5EH 3PROA 2BQ7B 3ATMA 1CGJE 2HLCA 2NU1E 1MKWK 2VIQA 2ZU1A 1P3EA 1EB2A 1O5CB 1K9OE 1SGIB 1K1LA 3ZZBA 1EOLA 1P3CA 1TQ7B 1ZGIA 3R0FA 3SUGA 4DCDA 1HAOH 1DY9A 3ELAH 4MPUA 1EZXC 2GCHF 5ESTE 7LPRA 1P8VC 5T6FA 1SMFE 2GP9B 1ANDA 3BTME 3BTHE 1HJ8A 2CN0H 4WMDA 1DE7H 2P8OB 5HGGA 4CRDA 1SQTA 3A81A 1S83A 1EQ9A 4CRCA 3SBKA 2CF9H 1F0TA 2B9LA 3HGPA 1YC0A 1J15A 4XBCA 4ZAEA 1QJ7B 3Q76A 4Y8YA 3MI4A 1GDUA 5C20A 2OP9A 4MQAA 1P0SH 1A5HA 5DK1A 1FIZA 1BTWA 5DO4H 4CH8B 1WSSH 4VGCB 4K69A 3AASA 3DFJA 2VIOA 2VNTA 1XXDA 3QZRA 1K1PA 1MAYA 4BXSA 3BTQE 2PKSB 1SPJA 3PYHA 3SU5A 1HAVB 2VGCB 2ZU4A 1F2SE 1O2HA 4BAMB 1EAXA 3BIVH 1XX9A 2ESTE 1U6QA 3ZZAA 1BTYA 3GCHB 3A83A 1K28D 4RN6A 3A8BA 1YCPM 2WV5A 3QX5H 3EA7A 1MTUA 1O2NA 4PROA 3S0NA 1RD3B 1AVGH 4IMQA 2ILNA 4UEHH 1OKXA 1W7XH 1O0DH 1SI5H 4KTUA 1ACBE 2J95A 4FUBA 1AVWA 3QTOH 1CA0B 1FPCH 2SNWA 2Z9KA 3B8JA 4GUXA 1NFXA 5DP6A 1S6FA 3H5CB 1Y8TA 2ZA5A 5EQRA 3S9BA 2PTNA 2GD4B 2XCFA 1P03A 2A4RA 4WH6A 4UE7H 1BTUA 1VJAU 1P01A 4YLUA 4SGBE 1G9IE 1C2GA 3E6PH 1X7AC 1GHVH 1YBWA 1UK3A 4X2YA 3SZNA 2V3HH 1UVSH 1V2RT 3SNAA 1XUHA 6GCHG 1AUTC 2BLWA 4UFEH 2FTLE 2DE8A 4IMZA 5A8XA 3TJNA 5AFYH 4X1SU 1KLIH 1QNJA 4AB9A 3ZVCA 4CREA 3KHVA 4X1PU 1JRTA 2F9UA 4NZQA 1C9TA 1PPZA 1K22H 4X2VA 2ZHEH 3VXFH 1N8OC 4O03A 1CSOE 3FP6E 1VGCC 3TGKE 5EODA 1UK2A 1J16A 1J17T 2BDGA 2IJOB 2J2UA 1GJ4H 2ZCLP 2HOBA 1L0ZA 1NRRH 1C1MA 1O3OA 4Y79A 4Q7ZA 2GVFA 4JYTA 4ZKRU 4HTCH 1SFQB 4H6TA 4ABIA 4ABAA 3BTWE 4FUHA 5ETXA 2FLBH 4IN1A 4K1TA 1C2HA 1C4V2 2O8WA 1P2JA 3MH7A 2Z6BD 5CE1A 1TX6A 5T6DA 1A61H 2G81E 2OC8A 2F9PA 3ZZ8A 1UVTH 4ZROA 1BTHH 2NU4E 2R0KA 1HLTH 2BQWB 5DJ7A 1XVMA 2BXTH 1SGFA 4ABJA 4ZHLU 3KN2A 1FZZA 2BMGB 2ZIQH 3BTDE 3F1SB 2FI3E 2GGVB 3LGWA 1GBFA 1BA8B 1DWEH 2QGRA 3K65B 3V7TA 4NG9H 2ZFFH 1HIAA 1ZOMA 1P2MA 2OUAA 3UQVA 2STBE 1E36B 1VITH 1C2FA 2GZ9A 2ZGXH 3ZVDA 4X2XA 2GDEH 1G32B 3SJ9A 4Y76A 2OC1A 5EPYA 1GL1A 5C1YA 1GMHG 1GJ9B 1QBOA 2GTBA 4UONA 1BRBE 4OS7A 2BD4A 1C2LA 1TX8A 2HPQH 2VIDA 3GDSA 3TU7H 4GHQA 1P9UA 1O3MA 1IQNA 1G30B 3SI3H 2TGDA 3O8RA 2P95A 3EDXB 5ABWA 1JOUB 2QN5T 1P09A 2G8TA 3I77A 1INCA 1G2LA 1MUEB 1EZUC 4IC6A 1QA0A 4AGKA 3C1KA 2Y82A 3A7WA 2UWLA 3RXVA 4BAHB 1O2MA 3L3TA 1K21H 3URDA 5LH8A 1FLEE 1V6DA 1XUGA 3EBNA 1TOMH 2UUFB 2PWXA 3PV4A 1E37B 1YF4A 2H5CA 2LIZA 1CT4E 2AMPA 4IBLH 5L6NH 5AF9H 3A8AA 4BAQB 1TGNA 3ATKA 1AGJA 4ISLA 1GBMA 1EZSC 1AUJA 1MD8A 1BBRE 2UWOA 1TIOA 4JYVH 3ZV8A 2F91A 1Y3UA 3RXIA 5C2ZA 2ZFSA 1GHAF 1D3PB 2D26C 4WXIA 1DFPA 1SSXA 3HATH 5FBIA 1FY4A 5FX5A 2Y6TA 1V3XA 1HRTH 5EXLA 1KXFA 1UVOA 1AWHB 1FNIA 1LDTT 4KTSA 2PV9B 1W0YH 4Y8ZA 2GCTB 2J4IA 4UD9H 1PFXC 3MU0A 1YCPH 3RXHA 1NN6A 2W3IA 4JZ1A 1Q31A 1QIXB 2TIOA 3MU8A 4AFZA 2FOBA 4CHAB 1HAXB 5HYOA 3DT0H 1YCPK 4U32A 2JETC 1SBWA 2ZKSA 2FI5E 3ZZ5A 2CMYA 1SGRE 1KLJH 5H4IB 3A7VA 1RIWB 3RC5A 3KL6A 3Q3XA 3M3TA 1HB0B 3FFGA 3W95A 1GBDA 4IC5A 2B5TB 1N8OB 1SOZA 3ZZ4A 1C2MA 3RXEA 1GI7B 3N7OA 4ISHH 3UWIA 1D4PB 1Y5BT 1KSNA 3P92A 5EG4A 1BRAA 3S7KB 4E05H 1GBIA 2WUBA 3GDUA 4LZ4B 1S5SA 1F7ZA 2XC5A 2C8WB 1P2NA 5G4BA 1FI8A 3ZYDA 4B71A 5E2PA 1ANBA 5DP5A 5FCKA 1VCPA 2FYQA 1ETSH 3PLBA 1HAVA 2ZDNA 3FVFB 2G5VA 4RKJB 1O5FH 2ZDMA 4TY7A 2DE9A 4NFFA 2AIQA 1KLTA 3TJVA 2AGEX 2FS9A 1T31A 1QJ6B 3SNDA 1WBGB 3ESTA 1SR5C 3MO3A 1MBMA 2P3FH 3ZZ7A 2R3UA 1DANH 2O8MA 3IITA 3HPTB 1GG6C 4FXGH 1P2OA 1SGTA 4B2CA 2C90B 3U98H 1ELFA 1HJAB 2R3YA 1ZSJA 1EJAA 1DX5M 3F9FA 3M5OA 1SGYE 4XFQA 1TOCB 2WPKS 3SU6A 4X8SH 4BANB 2UWPA 1GCTB 1YM0A 4DOQA 2A0QB 2G52A 4ZH8A 1JIRA 5FPYA 2UUKB 2P93A 3M7QA 3Q3YA 1V2OT 4BXWA 3ATWA 2AS9A 2OBOA 2ZNKH 1C5ZB 1QQ4A 5JPMH 1DLEA 4WF8A 3NWUA 4TYDA 4BAKB 3M5NA 1A1RA 2ANKH 2P3UB 1C5PA 4BAOB 2ZU5A 2BOKA 1S0QA 5T6GA 2ASUB 2VH6A 1HAIH 1P9SA 1VJ9U 4OS4A 1YKTA 4Y0ZE 3RXLA 4K1SA 1SHHB 3PO1C 2GZ8A 4XDEA 2ZQ2A 2QXJA 3R3GB 1WU1A 4NFEA 2ANMH 3M7TA 1O34A 3K9XB 1BTZA 1K1OA 1MKXH 1BUIA 4YLQH 3SU0A 3RXOA 4KELA 3IWMA 3SGQE 1CO7E 2ZP0H 1MQ6A 1ZJKA 1BQYA 2VWMA 1MAXA 4GAWA 1Y3YA 1MKXK 2Z7FE 3VB4A 2ZPQA 3FANA 3RM2H 1YPLH 2XC0A 1WAYB 3V3MA 2C3SA 1NRSH 1QJ1B 1SHYA 4YT7H 1N6XA 2OXSA 3GY7A 4CBOA 2ZG0H 1CHGA 4B76A 2BD2A 1QR3E 4K3JA 1OWHA 1C1RA 1C1WH 3RC6A 3A87A 2O8TA 2C4FH 5JB9S 1O32A 3LU9B 2XBYA 1EPTC 1DY8A 2JH0D 4X6OA 1IQHA 3SUFA 1P06A 2HPPH 1O3PB 2VINA 1HPGA 1H4WA 1O2LA 3VB3A 2BVSH 1GBJA 1TALA 1G37A 2Y5HA 2R2MB 2BLOA 1P2KA 3O8DA 5IYTA 5GXPA 1Z1JA 1IQJA 2AERH 1V2MT 4Y7AA 1G3EA 1NY22 3E1XB 1TNJA 4I32A 1HBTH 1GL0E 4ZXXH 5C1UA 4K1EA 1SG8B 1UVPA 1O3GA 1K1MA 4BTUB 3M3SA 1GMDF 1LMWB 1GMHF 2STAE 1PPEE 2ZGCA 2Z3CA 3OSYA 2Q6FA 2ZFQH 4XBDA 4LZ1H 1LPZB 3AAVA 4JK6A 5FCRA 1F0RA 3MNCA 3OU0A 1O37A 1CGIE 1TX7A 3UPEA 1WQSA 5F8XA 5ESBA 2WPHS 2R2WU 2TGTA 3U1JB 1ESTA 1C2JA 4J2YB 3A8CA 3RXMA 1GGDC 3M36A 1FAXA 8LPRA 3MNSA 2ULLA 3BG8A 1LVOA 1HAHH 3RXTA 3ZVGA 2VVVA 3GICB 2ZTYA 4WVPE 1Z7KA 3ENSB 1IQFA 3MH4A 1NFWA 3NUMA 4NSVA 2P3TB 1NU9A 1EXFA 3SNBA 3E16B 3E91A 4O3UA 4XOJA 1GG6B 4MNVA 4UFGH 5HM9A 2UUJB 1GJCB 3ZVEA 2VWNA 3RDZA 1BBRH 3VEQB 1TPSA 4INHA 2A2QH 2WYJA 3OY6U 1SC8U 1QRZA 3ODFA 1BBRK 1D3QB 4U2WA 1BMLA 1LVMA 1G3DA 4ZMAH 1VZQH 2ANWA 3TH3H 1LHFH 1NRQH 4FUEA 4CRAA 3BG4C 1C4Y2 2W3KA 2OQ5A 1PYTD 3T2NA 4NA9H 3LOXA 1CBWC 3GYLB 1EZQA 4O97A 4QT8C 2BVXH 1LTOA 3H7OA 4E06H 2H9TH 1ZSKA 1EATA 4X8TH 1THRH 3CENA 1FQ3A 1WTHD 4ISNA 4DJZB 4CRGA 3T29A 2D8WA 2M5TA 1N1LA 1ZTLA 1O2QA 5EOKA 2GMTC 2FOGA 1NPMA 3P8NA 2XRCA 1FN6A 2HALA 1GHZA 3F9GA 1GBKA 2F9OA 2TPIZ 1YPKH 1BJVA 2R9PA 3FP7E 1TFXA 2A4OA 3K6ZA 1SGNE 1GWAA 1XUFA 3UY9A 3DHKH 4MPXA 5DG6A 2QXHA 2OTVA 1ZHRA 5GCHF 1RTLA 1SLWB 2Z9LA 4JZEH 8KME2 2XCNA 1FY1A 1F0SA 3GCOA 3BEUA 8GCHG 5FBEA 1V2QT 4FUGA 4NA8A 1ZZZA 3ODDA 4YESB 1BRUP 5L2ZH 1AN1E 3BF6H 3LH3A 2PUQH 1EJNA 2BD8A 2O8UA 3HKIB 5C5NA 4AOQA 2ODQA 2BDYA 1ID5H 1ETRH 2BD3A 2PW8H 3A89A 3KQEA 1YPHC 1BJUA 5TCAA 1GI8B 3A7ZA 3F9EA 3PWCA 3P8GA 1UO6A 4THNH 3P6ZB 2PLXA 3C27B 1A0HB 3SJOA 3RUOA 2FTMA 4TPYA 2SGFE 2WINI 1TABE 1GHYH 2ZO3H 4ABFA 2D1JA 3MU1A 4NA7A 1FPHH 2XWAA 1AHTH 1HAGE 2RDLA 2K7XA 2FP7B 1KTSB 3K2UA 5EGMA 1IHTH 1RTKA 4E7NA 1AE5A 5SGAE 1H9HE 2FOCA 1Y5UT 3ATIA 1TBRH 2CV3A 3K6YA 1JXPA 3B23B 4X0WU 1QBNA 1WTGH 3URCA 4DURA 4I33A 4K8YA 5C3NA 4NCYA 1KXDA 3FZZA 1CT2E 1TMUH 1LQEA 5IDKA 1BRCE 2CGAA 4MNXA 2H6MA 6CHAC 4HGCA 4HFPB 3RXAA 2JH6D 2A31A 1DM4B 2QF0A 1TGCA 5JBAS 1YPEH 1UTNA 4NWLA 3M61U 3ZVAA 3SJ8A 2F9NA 4B74A 2PKAB 2QXIA 1AFEH 4O9VA 3KNXA 1XUKA 2BD9A 3QO6A 3RM0H 4XSKU 5GWZA 2D2DA 3TK9A 1LKAA 1HAYB 3DD2H 2OC7A 2HRVA 4D8NA 5A0AE 1TONA 1W3CA 2BDBA 2FM2A 4JYUH 1GBBA 5E2OA 5E8EH 1QB6A 1BMNH 3AAUA 4FU9A 2CHAC 1ZMJA 1YPJH 5GJ4B 3RMLH 4OGYA 1C2IA 1HNEE 2FX6A 1AKSA 4JCNA 1T8OA 1HXEH 1TBQH 2HGTH 3LH1A 1FV9A 1GJBB 1C5NH 2FXRA 3VGCC 5C5OA 1WUNH 3UOUA 1TRNA 4CRFA 2OD3B 2A5KA 4Y11E 2FOEA 1WV7H 3PB1E 1MCTA 2XTTB 4RKOB 2I6SA 1ELBA 9LPRA 3MWIU 2YNAA 4U30A 1LCYA 1G3CA 5FX6A 1CBWB 4AGJA 2FDAA 4R0IA 3A82A 4I8HA 1DXWA 1O33A 1UJ1A 1A4WH 5EXNA 1AZ8A 3EE0B 3JZ1B 3O8CA 3GCTG 1P2QA 3RXGA 1TPOA 1TMBH 3UUZA 2GT8A 4K60A 4X1QU 3D49H 2CXVA 5TCCA 3MTYA 1AE8H 2BY5X 3SV9A 2GMTB 3S7HB 1TNHA 3PTNA 2FYRA 1S85A 2SFAA 1C5XB 1TRMA 4FUFA 5LPFA 3NK8A 2CF8H 4YOIA 1GJ8B 1GJDB 1EAWA 3VPKA 5FHTA 1S81A 3BIUH 2BDCA 2RA3A 4FUJA 4ISIH 1OXGA 2V0BA 1QRXA 3RXFA 3NKKA 1MTNC 1L1JA 2AGGX 3LPRA 1GJAB 1EASA 5JYIA 1JRSA 2B8OH 4D76A 2NU3E 4JZIA 1D3DB 3ATLA 2DUCA 3RP2A 4DGJA 1W10U 1D3TB 3VB6A 2ZHDA 1FAKH 1AWFH 1DITH 2VVCA 4KGAA 5EU8A 3F68H 2LNCA 1P02A 3VXEH 1THPB 3BEIB 1JBUH 2B0FA 2XBXA 3HK3B 1TWXB 1O2RA 3AW1A 1C5MD 2WUCA 4X1NU 1C5UA 1J8AA 1TGBA 2V3OH 3EQ0H 5A09A 1JWTA 2WPMS 2FODA 1WYKA 1BTXA 4YZUA 1PPFE 1LPKB 4MNWA 1SLVB 1LHGH 1HV7A 2FMJA 1DWDH 3OTJE 3SHAH 2BQ6B 2WYGA 5DP3A 1AFQC 2AH4X 1PPCE 2RA0A 1VITG 2WPIS 2I6QA 4Z0KA 3MFJA 1LHDH 2VIVA 1AB9C 1P12E 3S69A 1NFUA 1ZJDA 1MCVA 3MH5A 2W7SA 3S9CA 3KQBA 4INLA 3HKJB 3TH4H 2BB4A 3I78A 1P2IA 3OYPA 3BTTE 4I31A 1J9CH 4IW4E 2EI6A 1M9UA 1SGPE 1ELAA 2HNTC 5DP9A 1ZR0A 2SGDE 3SU3A 1AY6H 3ZZCA 1EP5A 2GCHG 5AHGH 3D23A 1RGQA 1C1TA 3T5FH 2ZTZA 2F9BH 5F6MA 1VGCB 2VWOA 2J34A 2ZFPH 2Q6GA 1ELVA 3LGUA 5I46H 1GDNA 5J4QA 1UTJA 4K2YA 1OWJA 1NU7B 3GOVB 1S6HA 1DPOA 3SUDA 4UDWH 1TPAE 3EA8A 1SGFG 3UOPA 3QUMP 3LJOA 1MH0A 4Y10E 1O5BB 4LK4A 1ELGA 2EEKA 3PLKA 5AFZH 3UFAA 1UTOA 1Z8JB 1AU8A 1NROH 4X8VH 1IOEA 1D9IA 3PWBA 1C5SA 1LPGB 2QXGA 1G3BA 3MHWU 3AW0A 1UHBB 1Z8RA 2Z9IA 3BSQA 1QL9A 1Z71A 1KXEA 4Y6DA 1V2JT 2G5NA 4GVUA 8GCHF 2A2XH 4R8TB 1A2CH 2VWLA 1V2PT 1ESAA 5CHAC 1S82A 2QY0B 1H9IE 1XVOA 2UUYA 1SLUB 1NFYA 2AMDA 1A3EH 3RLYH 4D9RA 4TY6A 1GHXH 1MU6B 4LOYH 1SGCA 3TK6A 2EI8A 3Q3KA 5DGJA 2A5AA 1PJPA 2NU0E 4TWYA 1FDPA 4Q7XA 2ZHWH 4TPIZ 5LPRA 2EA3A 1O2YA 4AG1A 1Z8GA 5DPAA 2ZGBH 1L4ZA 2ZDLA 2C93B 3QGNB 3SV2H 2ZPSA 1ZPBA 5DP4A 1GI2A 3GY5A 1O3BA 1V2VT 2FOAA 1EAIA 1O2JA 4AFSA 4J1YA 1O3CA 1MTNB 3PMAB 1UTQA 2BLVA 4FUDA 1VCWA 1Z6EA 4ZHMU 3LDXH 3V13A 1BITA 3KCGH 5FXLA 4K5ZA 1O2IA 4OS2A 1L4DA 1O5DH 6GCHF 3UIRA 1L1NA 3UNSA 3E0PB 1EOJA 1GBTA 1DWBH 1A0LA 2A7JA 4YOJA 1HGTH 2IN2A 4ABBA 3TGJE 3VB5A 1V2KT 2OC0A 1K1JA 2ZFRH 2VIWA 1MTSA 5BRRE 1G2MA 2AFQB 1QB1A 2PKAA 3S9AA 1GI6A 2W26A 1DUEA 1AKSB 3STIA 2K1QA 1OP2A 1ZPZA 1WOFA 1SQAA 3E90B 3BTEE 1RJXB 2FLRH 1PPHE 1NM6A 1KXCA 4B75A 3A80A 2Y80A 1O5AB 1QY6A 3UNRA 1AFQB 2BD5A 1THSH 1NRNH 1UCYE 3NZIA 4VGCC 1MZDA 1IQGA 3PMBB 1C5LH 1FIWA 2Z3EA 3RXRA 2PKSC 1MD7A 9ESTA 2SNVA 2O8LA 2VGCC 1QA7A 1VCQA 2PGQB 3M37A 4I8GA 2TGPZ 4Y0YE 1O38A 2ZF0H 4X6MA 4I7YH 5DKMA 3GCHC 1HCGA 3SNCA 2NU2E 4A1VA 2JETB 3TH2H 4WH8A 1WQVH 3RXSA 3TLOA 4H6SB 3EA9A 1AO5A 2BZAA 1PPGE 3A88A 1CA8B 4I8LA 3GCTF 5T3HA 3BEFB 1EAUA 1F92A 2PHBA 4DVAU 2W7UA 5E0HA 1O3EA 3SQHE 1YPGH 5A2MH 2BX3A 4F4OC 2FESH 1BDAA 1O3LA 1LHEH 4DIHH 1NC6A 2BOHB 1C5TA 1NESE 3D65E 3KQDA 4ZKOU 4MG3A 1FXYA 3KEEA 1NT1A 1UTPA 4WMFA 1T7CA 1ELTA 3V0XA 3QK1A 1QCPA 1F5RA 1K2I1 1TMTH 5HMAA 2FWWA 3GCNA 1FMGA 2GKVE 3TNSA 1BHXB 1O2PA 1OWIA 3E3TA 3NCLA 4ZUHA 2SGEE 1P11E 1F5KU 2ZGJA 1GJ6A 4GHTA 1UMAH 1BCUH 1XKAC 1FY5A 2GT7A 1VR1H 2ZDVH 2BX4A 1GI3A 1W2KH 3RMNH 1NZQH 1QURH 1C5OH 2ALPA 1ARCA 2BY6X 1DWCH 2P94A 3RXJA 2ZQ1A 3RC4A 4HI3A 4Q2KA 1A5IA 2ODYB 1C5WB 1YLDA 1E34B 1IQKA 4K8BA 3T28A 5L2YH 2ZCKP 5JDUB 1O2OA 1SOTA 1O39A 2V6NA 1O2KA 1OYQA 2PFEA 3T62A 1ZRKA 4RSPA 3LJJA 2ZEBA 3OY5U 1W11U 2OLGA 1T32A 1XMNB 2ZHFH 4Y71A 3U9AH 2OQUA 2A4QA 3ZVFA 3QLPH 4NIVA 7GCHG 3SNEA 1CHOG 3SQEE 2A45B 1V2ST 2BYAX 1DXPA 3EAJA 6ESTA 2FPZA 4Y7BA 5EXMA 3A7TA 2PGBB 1TYNA 2O9QA 1C1OA 1C5QA 3A85A 2TRMA 1NTPA 1O3DA 3RU4D 1EB1H 2GV7A 5BPEA 4CR9A 7ESTE 2XC4A 4JZFH 3TJOA 1ZSLA 3ZZ9A 4GPGA 2QYIA 3IG6B 4I8JA 1QHRB 2P16A 3RXBA 1W14U 2BDHA 3GY4A 4X6NA 1SFIA 1GBCA 2GV6A 3PO1B 1XUJA 3QN7A 3LIWA 1O2VA 4WWYA 5JB8S 4M7GA 2VIPA 3STJA 2A1DB 1FONA 3A7XA 3B9FH 1DDJA 4GLYA 3TITA 2OBQA 1AIXH 1O3HA 3ZZDA 2H9HA 2IOTA 3P70B 2A4GA 2XBVA 3VFEA 4H4FA 2G4TA 3M5LA 2Z3DA 1AZZA 1GBLA 4TWWA 2VVUA 1IQLA 1TGTA 3GDVA 2LPRA 1D6RA 4F49A 1P05A 5E0GA 2PTCE 2XYAA 1MTWA 3UNQA 1C1SA 3RLWH 2CJIA 2ANYA 3BN9A 1UHBA 4NGAH 3V12A 2NWNA 4IS5A 1TNLA 2HNTF 4AFUA 3RXQA 2G00A 2ZPRA 3UQOA 3A7YA 1EPTB 2R0LA 3RXPA 1TBZH 5B6OA 1ZPCA 4H42U 1OWEA 4NZLA 4A1XA 1ELEE 2ZCHP 1GBHA 3GY8A 2ZZUH 3TIUA 1KXBA 1C1QA 2RCEA 1DUAA 3I29A 1LKBA 1GMCG 4AYVB 1XKBC 1B5GH 2J94A 3GY2A 2H5DA 1GDQA 3PTBA 1TQ0B 3FZDA 1YGCH 3DUXH 1A0JA 1TLDA 4FVBA 3TNTA 4YTAA 1BHXF 3MOCA 4ABDA 2PSXA 4WMEA 1OWKA 3QZQA 1KY9A 4FU7A 1GCDA 4BOHA 2H2ZA 3RXUA 4YOGA 1C4U2 1W13U 3UR6A 4X2WA 3RU4E 5TJXA 4OS6A 1MQ5A 3MO6A 2FEQH 1OP0A 1K1IA 5JBBS 1BOQA 1PQ5A 4A7IB 3GY6A 3NPSA 3QWCH 4AN7A 5JBCS 1SQOA 3SV8A 3U69H 3T26A 1ABIH 1ZLRA 3BV9B 1MBQA 2GCTC 3MU5A 3RXCA 3FAOA 5DP8A 2C8YB 1AMHA 1GGDB 1C1VH 3CS0A 1SGEE 1DLKB 2FO9A 3MNBA 1OYTH 4OGXA 5I25A 4CHAC 1LO6A 5JBTA 1YYY1 3U1IB 1ZGVA 2Y5FA 2YOLA 1SVPA 4MPVA 1V2UT 2TBSA 4ZKSU 1LVBA 1W8BH 5A8ZA 1MTVA 3GY3A 2BLQA 2A32A 1BMMH 1RIWC 2Y7ZA 4AG2A 2BZ6H 3ZZ6A 1T4VH 4ASHA 1CT0E 4YO9A 1JMOH 5EW2H 1L1GA 1D6WA 2PSYA 1T4UH 2THFB 3MH6A 1F0UA 1AVXA 4U01A 2AMQA 1Y3XA 1RRKA 1FY8E 2ZTXA 4FUCA 2H1UA 1O3NA 1O3AA 1UCYH 1S0RA 2BXUH 4YM9A 3QDZB 3P8FA 5EW1H 2XWBI 1BB0B 1SL3A 3E0NB 2BDIA 3BG4B 2A5IA 4DY7B 1UCYK 4AYYB 4WY3A 1P10A 1UTLM 4CBNA 2A7CA 2FX4A 1O2WA 4IN2A 2FOFA 1ANCA 1O5GH 3TGIE 1K1NA 1Y3VA 1V2LT 4B1TA 2BHGA 2BM2A 2BVRH 4GCHG 4Z6AH 1P04A 3T25A 4Y8XA 3TPIZ 2ZC9H 1N6YA 1B0FA 1BT7A 1ZYOA 2FZZA 1A46H 1CGHA 2BY7X 3BTFE 4A5TS 2TGAA 1GVZA 1TE0A 2KAIB 2ZGHA 1W0ZU 3KGPA 3L33A 1FN8A 3VB7A 1C5VA 2QF3A 3U8RH 3GYMA 2XW9A 1O2SA 7KMEH 8ESTE 1T8LA 1HJAC 3M5MA 2GDDA 1GMDG 4YT6H 5HM2A 1GI5A 1B7XB 3MO9A 1S84A 1C1NA 1O2UA 2IPHA 1GCTC 1Z1IA 5K0HA 5AVDA
chains in the Genus database with same CATH superfamily
5A0BA 1A5GH 3Q00A 2KCAA 1DSUA 2ZFTA 4UFFH 4ZKNU 1IAUA 2Y5GA 4WXVA 3W94A 3A84A 1TB6H 1UTMA 3DSPA 3F6UH 1YPMH 3RMMH 1L2EA 2FIRH 1P57B 3RXKA 3LGIA 1DOJA 1KDQA 4ISOA 2VJ1A 1KYNA 3NXPA 3FP8E 1EX3A 2ZI2H 5DP7A 3LONA 4IGDA 2ZECA 1FX0B 2FI4E 1Y3WA 4JMYA 3SUEA 1J14A 2ZU3A 1EP6A 3SO3A 2Z9GA 4D7GA 1GHBG 1ARBA 2C8XB 5F8TA 4ZHAA 4XBBA 2IJD1 2Z94A 4ABEA 5L30H 1HAPH 1GBEA 3U8OH 3U8TH 2V7QD 1C1UH 2OINA 3OTPA 2F83A 3T27A 7GCHF 4SGAE 1CHOF 1QQUA 1O30A 5E0JA 3ZVBA 4DT7B 3HGNA 4KP0A 4A6LA 2H9EH 1TA2A 3P8OA 1ABJH 3OAAD 1ELCA 1HXFH 1QRWA 2G55A 2RG3A 1TPPA 3TVJB 2QV1A 3DFLA 2G4UA 5EPNA 6CHAB 1Y59T 1BZXE 5A8YA 1OPHB 1GI9B 5J4SA 2SGQE 3PMHB 2GX4A 1SB1H 3NRLA 4MLFB 5C1XA 3MNXA 1W12U 4I8KA 5KECA 1PPBH 4D7FA 4OS1A 1O2TA 1HJ9A 1W7GH 1C2KA 3JZ2B 3LGTA 1FUJA 1QTFA 3SGBE 4LXBH 2PR3A 2W5EA 2AGIX 2P59A 1SGDE 2Z9JA 1PQ8A 1QGFA 1CE5A 1TGSZ 1TNGA 4FVDA 2PUXB 1DICA 2VU8E 3SN8A 3KIDU 4Q80A 1TAWA 2CHAB 1ZTJA 1HFDA 4NIYA 4WJG2 5EQSA 1YPHE 4M9FA 1T8NA 4AB8A 1HAZB 1FY3A 3VGCB 1CVWH 1E38B 4ESTE 2HVXA 1DVAH 1MU8B 5GCHG 1DSTA 3WY8A 4MNYA 4HZHA 5EQQA 3PV5A 4AORA 1NS3A 2M2AA 3M35A 3L6PA 2QIQA 5F53A 1GBAA 1Q3XA 1GPZA 1TRYA 1V2NT 2BTCE 2Q6DA 3G01A 3SHCH 3F0PA 1Q2WA 2EI7A 2A7HA 1EPTA 3LC5A 1WCZA 4JZDH 3MYWA 1H8DH 1ZHPA 3O8BA 1MMJN 1E35B 1QFKH 3SW2B 3UR9A 3AVZA 1EUFA 5C67A 2AEIH 2V35A 1AD8H 3TJUA 2Y7XA 3M3VA 4ABHA 1O3IA 3SORA 5F03A 1YP9A 4GSOA 5DSFA 1NO9H 2FOMB 1GMCF 3SJKA 1OSSA 1Y5AT 2IPQX 4XE4A 1UK4A 1EJMA 1ETTH 2B7DH 3RMOH 4B6FA 1A7SA 4X1RU 4P02A 1KTTB 1Z8IB 1O31A 5FPTA 3SU2A 2BD7A 2SGAA 3D62A 2XBWA 3CS7A 2K8IA 2HVYB 1IHSH 4NWKA 3UWJH 2XXLA 1O3FA 1ZMNA 4CH2B 2YNBA 1LHCH 1PQAA 1H8IH 2F9VA 2QA9E 2ZU2A 1OP8A 5CMXH 3Q77A 1B0EA 2JH5D 3UREA 3BTGE 3RXDA 1C9PA 2AYWA 1GVLA 2OCVB 2VH0A 1E0FD 1NRPH 4ACAA 1C2EA 1O35A 2BDAA 1O2XA 1DS2E 3LGVA 1RXPA 2HWLB 3E8LA 1NBME 3SU4A 5GIBA 1XXFA 2P8OC 1O2GH 1H1BA 2G51A 2QC2A 3W1EA 3KF2A 1T8MA 1RTFB 2J38A 1PYTC 4CRBA 2KCOA 2J5UA 1SGQE 5F8ZA 1C5RA 3P17H 1V2WT 1AQ7A 5GPIB 1AI8H 1C2DA 3FN8A 3SI4H 4UFDH 2WV4A 2FOHA 4OS5A 1HDTH 2XNIA 2FS8A 4B2AA 4Z1MD 1IQIA 1OOKB 1ZHMA 5FAHA 1RFNA 1CU1A 4KKDA 2ALVA 1GI4A 5A0CA 1AB9B 1OS8A 3PV2A 4NIWA 1MZAA 1YLCA 4BTIB 4INKA 4DG4A 1TNIA 5HXFA 2ZHQH 3CP7A 2ODPA 4O3TA 1GVKB 5LPEA 2BY8X 3RU4T 4B2BA 4MDSA 2WPLS 4AZ2B 1QB9A 1H9LB 1GJ7B 2Y81A 3LGYA 3BTKE 2ZDKA 4A1TA 2VB0A 4HG6A 2L74A 2ZWLH 3M7UA 1CQQA 4NIXA 1QBVH 2QAAA 1DT2A 1PQ7A 3F9HA 4JK5A 1QL7A 1GI1A 3MU4A 1HIAB 3P95A 4GCHF 4X6PA 3SV6A 2J92A 3PM3A 1CA0C 3LC3A 4MTBA 2WPJS 5K7RA 3SV7A 2AIPA 3LKWA 1O3KA 4DW2U 2ZDAH 3EYDA 1KIGH 2Q1JA 1ZMLA 1UVUH 3HK6B 2SGPE 2QE7D 4MPWA 2KAIA 5PTPA 3QTVH 5FPSA 1BMAA 1ZRBA 4Q4LA 3UTUH 2GJGA 5LGOA 1XUIA 2QCYA 1Z6JH 4FUIA 1OWDA 1LQDB 1HYLA 1C5YB 1O2ZA 4X8UH 1GHWH 1GI0A 3SGAE 3PLPA 1O3JA 3EGKH 1IQEA 1UTKA 1ESBA 1A3BH 3H7TA 1C1PA 1JIMA 1OX1A 5HIZA 1RS0A 4ABGA 3TK5A 3SJIA 1KDQB 3SYJA 3ITIA 3DA9B 1FJSA 4DIIH 1V2TT 1ZTKA 4E7RG 2F3CE 5CHAB 3A86A 4Q7YA 1HUTH 3KQCA 2QF4A 1IQMA 1COWD 4D9QA 1QL8A 1G36A 2GZ7A 4BTTB 3ZZ3A 1ORFA 3ZV9A 2J9NA 3QGJA 2EC9H 2V3MA 4FU8A 4BNRA 5CDFE 3MMGA 1BIOA 5GDSH 4KTCA 3LT3A 1BTPA 1SLXB 3OX7U 4NSYA 2JKHA 3A8DA 1ANEA 1O36A 2F4LA 1ELDE 6LPRA 1EKBB 3PMJA 1F5LA 3GISB 3SOSA 4A92A 1GHBF 1YLNA 2C8ZB 2BY9X 1GJ5H 4CR5A 1XM1A 3ZYEA 2HNTE 1VITF 1GHAG 1KXAA 1LVYA 4ZXYH 4MVNA 4B73A 4AFQA 1TA6A 1MKWH 1TNKA 3SU1A 4AX9H 1O5EH 3PROA 2BQ7B 3ATMA 1CGJE 2HLCA 2NU1E 3ZIAD 1MKWK 2VIQA 2ZU1A 1P3EA 1EB2A 4B6EA 1O5CB 1K9OE 1SGIB 1K1LA 3ZZBA 1EOLA 1P3CA 1TQ7B 1ZGIA 3R0FA 3SUGA 4DCDA 1HAOH 1DY9A 3ELAH 4MPUA 1EZXC 2GCHF 5ESTE 7LPRA 1P8VC 5T6FA 1SMFE 2GP9B 1ANDA 3BTME 3BTHE 1HJ8A 2CN0H 4WMDA 1DE7H 2P8OB 5HGGA 4CRDA 1SQTA 3A81A 1S83A 1K0HA 3KYGA 1EQ9A 4CRCA 3SBKA 2CF9H 1F0TA 2B9LA 3HGPA 1YC0A 1J15A 4XBCA 4ZAEA 1QJ7B 3Q76A 4Y8YA 3MI4A 1GDUA 5C20A 2OP9A 4MQAA 1P0SH 1A5HA 5DK1A 1FIZA 1BTWA 5DO4H 4CH8B 1WSSH 4VGCB 4K69A 3AASA 3DFJA 2VIOA 2VNTA 1XXDA 3QZRA 1K1PA 1MAYA 4BXSA 3F3BA 3BTQE 2PKSB 1SPJA 3PYHA 3SU5A 1HAVB 2VGCB 2ZU4A 1F2SE 1O2HA 4BAMB 1EAXA 3BIVH 1XX9A 2ESTE 1U6QA 3ZZAA 1BTYA 3GCHB 3A83A 1K28D 4RN6A 3A8BA 1YCPM 2WV5A 3QX5H 3EA7A 1MTUA 1O2NA 4PROA 2RDEA 1RD3B 3S0NA 1AVGH 4IMQA 2ILNA 4UEHH 1OKXA 1W7XH 1O0DH 1SI5H 4KTUA 1ACBE 2W6ID 2J95A 4FUBA 1AVWA 3QTOH 1CA0B 1FPCH 2SNWA 2Z9KA 3B8JA 4GUXA 1NFXA 5DP6A 1S6FA 3H5CB 1Y8TA 2ZA5A 5EQRA 3S9BA 1SQRA 2PTNA 2GD4B 2XCFA 1P03A 2A4RA 1E79D 4WH6A 4UE7H 1BTUA 1VJAU 1P01A 4YLUA 4SGBE 1G9IE 1C2GA 3E6PH 1X7AC 1GHVH 1YBWA 1UK3A 4X2YA 3SZNA 2V3HH 1UVSH 1V2RT 3SNAA 1XUHA 6GCHG 1AUTC 3WWBA 2BLWA 4UFEH 2FTLE 2DE8A 4IMZA 5A8XA 3UAIC 3TJNA 5AFYH 4X1SU 1KLIH 1QNJA 1VKYA 4AB9A 3ZVCA 4CREA 3KHVA 3U28C 4X1PU 4F55A 2KCPA 1JRTA 2F9UA 4NZQA 1C9TA 1PPZA 1K22H 4X2VA 2ZHEH 3VXFH 1N8OC 4O03A 1CSOE 3FP6E 1VGCC 3TGKE 5EODA 2KFWA 1UK2A 1J16A 1J17T 2BDGA 2IJOB 2J2UA 1GJ4H 2ZCLP 2HOBA 1L0ZA 1NRRH 1C1MA 1O3OA 4Y79A 4Q7ZA 3DCLA 2GVFA 1H8HD 4JYTA 4ZKRU 4HTCH 1SFQB 4H6TA 4ABIA 5C17A 4ABAA 3BTWE 4FUHA 5ETXA 2FLBH 4IN1A 4K1TA 1C2HA 1C4V2 2O8WA 1P2JA 3MH7A 2Z6BD 4TT3D 5CE1A 1TX6A 5T6DA 1A61H 2G81E 2OC8A 2F9PA 3ZZ8A 1UVTH 4ZROA 1BTHH 2NU4E 2R0KA 1HLTH 2BQWB 5DJ7A 1XVMA 2BXTH 1SGFA 3N7DA 2W6JD 4ABJA 4ZHLU 3KN2A 1FZZA 2BMGB 2ZIQH 3BTDE 3F1SB 2KM0A 2FI3E 2GGVB 3LGWA 1GBFA 1BA8B 3OEED 5C94A 1DWEH 2QGRA 3K65B 3V7TA 4NG9H 4FOUC 2ZFFH 1HIAA 1ZOMA 1P2MA 2OUAA 3FKSD 3UQVA 2STBE 1E36B 1VITH 1C2FA 2GZ9A 2ZGXH 3ZVDA 4X2XA 2GDEH 1G32B 3SJ9A 4Y76A 2OC1A 5EPYA 1GL1A 5C1YA 1GMHG 1GJ9B 1QBOA 2GTBA 4UONA 1BRBE 4OS7A 2BD4A 1C2LA 1TX8A 2HPQH 2VIDA 3GDSA 3TU7H 4GHQA 1P9UA 1H8ED 1IQNA 1O3MA 1G30B 3SI3H 2TGDA 3O8RA 2P95A 3EDXB 5ABWA 1JOUB 2QN5T 1P09A 2G8TA 3I77A 1INCA 1G2LA 1MUEB 2JDID 1EZUC 4IC6A 1QA0A 4AGKA 3C1KA 2Y82A 3A7WA 2UWLA 3RXVA 4BAHB 1O2MA 3L3TA 1K21H 3URDA 5LH8A 1SKYE 3SZEA 1FLEE 1V6DA 1XUGA 3EBNA 3EE7A 3N99A 1TOMH 2UUFB 2PWXA 4XRNA 3PV4A 1E37B 1YF4A 3WWFA 2H5CA 2LIZA 1CT4E 2AMPA 4IBLH 5L6NH 5AF9H 3A8AA 4BAQB 1S6LA 1TGNA 3ATKA 1AGJA 4ISLA 1GBMA 1EZSC 4ZCNA 1AUJA 1MD8A 5FL7D 1BBRE 2UWOA 1TIOA 4JYVH 3ZV8A 2F91A 1Y3UA 3RXIA 5C2ZA 2ZFSA 1GHAF 1D3PB 2D26C 4WXIA 1DFPA 1SSXA 3HATH 5FBIA 1FY4A 5FX5A 2Y6TA 1V3XA 1HRTH 5EXLA 1KXFA 1UVOA 1AWHB 1FNIA 1LDTT 4KTSA 2PV9B 1W0YH 4Y8ZA 2GCTB 2J4IA 4UD9H 1PFXC 3MU0A 4TSFD 1YCPH 3RXHA 1NN6A 2W3IA 4JZ1A 1Q31A 1QIXB 2TIOA 3MU8A 4AFZA 2FOBA 4CHAB 1HAXB 5HYOA 3DT0H 1YCPK 4U32A 2JETC 1SBWA 2F43B 2ZKSA 2FI5E 3ZZ5A 2CMYA 1SGRE 1KLJH 5H4IB 3A7VA 1RIWB 3RC5A 3KL6A 3Q3XA 3M3TA 1HB0B 2WSSD 3FFGA 3W95A 4RI0A 1GBDA 4IC5A 2B5TB 1N8OB 1SOZA 3ZZ4A 1C2MA 3RXEA 1GI7B 3N7OA 4ISHH 3UWIA 1D4PB 5GNDA 1Y5BT 1KSNA 3P92A 5EG4A 2YMSC 1BRAA 3S7KB 4E05H 1GBIA 2WUBA 3GDUA 4LZ4B 1S5SA 3H09A 1F7ZA 2XC5A 2C8WB 1P2NA 5G4BA 1FI8A 3ZYDA 4B71A 1WDIA 5E2PA 3KQ5A 1ANBA 5DP5A 5FCKA 1VCPA 2FYQA 1ETSH 3PLBA 1HAVA 2ZDNA 3FVFB 2G5VA 4RKJB 1O5FH 2ZDMA 4TY7A 2DE9A 4NFFA 2AIQA 1KLTA 3TJVA 2AGEX 2JJ1D 2FS9A 1T31A 1QJ6B 3SNDA 1WBGB 3ESTA 1SR5C 3MO3A 1MBMA 2P3FH 3ZZ7A 2R3UA 1DANH 2O8MA 3IITA 3HPTB 1GG6C 4FXGH 1P2OA 1SGTA 2K0QA 2C90B 4B2CA 3U98H 5CHBA 1ELFA 1HJAB 2R3YA 1ZSJA 1EJAA 1DX5M 3F9FA 3M5OA 1SGYE 4XFQA 1TOCB 2WPKS 3SU6A 4X8SH 4BANB 2UWPA 1GCTB 1YM0A 4DOQA 2A0QB 2G52A 4ZH8A 1JIRA 5FPYA 2UUKB 2P93A 3M7QA 3Q3YA 1V2OT 4BXWA 3ATWA 2AS9A 2OBOA 4ASUD 2ZNKH 1C5ZB 1QQ4A 5JPMH 1DLEA 4WF8A 3NWUA 4TYDA 4BAKB 3M5NA 1A1RA 2ANKH 2P3UB 1C5PA 4BAOB 2ZU5A 2BOKA 1S0QA 5T6GA 2ASUB 2VH6A 1HAIH 1P9SA 1VJ9U 4OS4A 1YKTA 4Y0ZE 3RXLA 4K1SA 1SHHB 3PO1C 2GZ8A 4XDEA 2ZQ2A 2QXJA 3R3GB 3PRBA 1WU1A 4NFEA 2ANMH 3M7TA 1O34A 2CK3D 3K9XB 1BTZA 1K1OA 1MKXH 1BUIA 4YLQH 3SU0A 3RXOA 4KELA 3IWMA 3SGQE 1CO7E 2ZP0H 2RFKC 1MQ6A 1ZJKA 1BQYA 2VWMA 1MAXA 4GAWA 1Y3YA 1MKXK 2Z7FE 3VB4A 2ZPQA 3FANA 3RM2H 1YPLH 2XC0A 1WAYB 3V3MA 2C3SA 1NRSH 1QJ1B 1SHYA 3F2HA 4YT7H 1N6XA 5EJZA 2OXSA 1MABB 3GY7A 4CBOA 2ZG0H 1CHGA 4YXWD 3F2FA 4B76A 2BD2A 1QR3E 4K3JA 1OWHA 1C1RA 1C1WH 3RC6A 3OEHD 3A87A 2O8TA 2C4FH 5JB9S 1O32A 3LU9B 2XBYA 1EPTC 2J98B 1DY8A 2JH0D 4X6OA 1IQHA 3SUFA 1P06A 2PP6A 2HPPH 1O3PB 2VINA 1HPGA 1H4WA 1O2LA 2VBCA 3VB3A 2BVSH 1GBJA 1TALA 1G37A 2Y5HA 2R2MB 2BLOA 1P2KA 3O8DA 5IYTA 5GXPA 1Z1JA 2YMSD 1IQJA 2AERH 1V2MT 4Y7AA 1G3EA 1NY22 3E1XB 1TNJA 4I32A 1HBTH 1GL0E 4ZXXH 5C1UA 5DN6D 1WXRA 4K1EA 2KR7A 1SG8B 1UVPA 1O3GA 1K1MA 2KCYA 4BTUB 3M3SA 1GMDF 1LMWB 1GMHF 2LP6A 2STAE 1PPEE 2ZGCA 2Z3CA 3PRDA 3OSYA 2YMSB 2Q6FA 2ZFQH 4XBDA 4LZ1H 1LPZB 3AAVA 4JK6A 5FCRA 1F0RA 3MNCA 3OU0A 1O37A 1CGIE 1TX7A 3UPEA 1WQSA 5F8XA 5ESBA 2WPHS 2R2WU 2TGTA 3U1JB 1ESTA 1C2JA 4J2YB 3A8CA 3RXMA 5C0TA 1GGDC 3M36A 1FAXA 8LPRA 3MNSA 2ULLA 3BG8A 1LVOA 1HAHH 3RXTA 3VG8A 3ZVGA 2VVVA 3GICB 2ZTYA 4WVPE 1Z7KA 3ENSB 1IQFA 3MH4A 1NFWA 3NUMA 4NSVA 2P3TB 1NU9A 1EXFA 3SNBA 3E16B 3E91A 4O3UA 4XOJA 1GG6B 4MNVA 4UFGH 5HM9A 2UUJB 1GJCB 2WHXA 3ZVEA 2VWNA 3RDZA 1BBRH 3VEQB 1TPSA 4INHA 2A2QH 2WYJA 3OY6U 1SC8U 2J97A 1QRZA 3F0OA 3ODFA 1BBRK 1D3QB 4U2WA 1BMLA 1LVMA 1G3DA 4ZMAH 1VZQH 2ANWA 3TH3H 1LHFH 1NRQH 4FUEA 4CRAA 3BG4C 1C4Y2 2W3KA 2OQ5A 1PYTD 3T2NA 4NA9H 3LOXA 1CBWC 3GYLB 1EZQA 4O97A 4QT8C 2BVXH 1LTOA 3H7OA 4E06H 2H9TH 1ZSKA 1EATA 4X8TH 1THRH 3CENA 1FQ3A 1WTHD 4ISNA 4DJZB 4CRGA 3T29A 2D8WA 2M5TA 2EY4C 1N1LA 1ZTLA 1O2QA 3F2GA 5EOKA 2GMTC 5IK2D 2FOGA 1NPMA 3P8NA 2XRCA 1FN6A 2HALA 1GHZA 3F9GA 1GBKA 2F9OA 2TPIZ 1YPKH 1BJVA 2R9PA 3FP7E 1TFXA 2A4OA 3K6ZA 1SGNE 1GWAA 1XUFA 3UY9A 3DHKH 4MPXA 5DG6A 2QXHA 2OTVA 5KEDA 1ZHRA 5GCHF 1RTLA 1SLWB 2Z9LA 4JZEH 8KME2 2XCNA 1FY1A 1F0SA 3GCOA 3BEUA 8GCHG 5FBEA 1V2QT 4FUGA 4NA8A 1ZZZA 3ODDA 4YESB 1BRUP 5L2ZH 1AN1E 3BF6H 3LH3A 2PUQH 1EJNA 2BD8A 2O8UA 3HKIB 5C5NA 4AOQA 2ODQA 2BDYA 1ID5H 1ETRH 2BD3A 2PW8H 3A89A 3KQEA 1YPHC 1BJUA 5TCAA 1GI8B 3A7ZA 3F9EA 3PWCA 3P8GA 1UO6A 4THNH 3P6ZB 2PLXA 3C27B 1A0HB 3SJOA 3RUOA 2FTMA 4TPYA 2SGFE 2WINI 1TABE 1GHYH 2ZO3H 4ABFA 3OE7D 2D1JA 3MU1A 4NA7A 1FPHH 2XWAA 1AHTH 1HAGE 2RDLA 2K7XA 2LELA 2FP7B 1KTSB 3K2UA 5EGMA 1IHTH 1RTKA 4E7NA 1AE5A 5SGAE 1H9HE 2FOCA 1Y5UT 3ATIA 1TBRH 2CV3A 3K6YA 1JXPA 3B23B 2EQNA 4X0WU 1QBNA 1WTGH 3URCA 4DURA 4I33A 4K8YA 5C3NA 2XOKD 4NCYA 1KXDA 3FZZA 1CT2E 1TMUH 1LQEA 4RT0A 5IDKA 1BRCE 2CGAA 4MNXA 2H6MA 6CHAC 4HGCA 4HFPB 3RXAA 2JH6D 2A31A 1DM4B 2QF0A 1TGCA 5JBAS 3WW7A 1YPEH 1UTNA 4NWLA 1UW7A 3M61U 3ZVAA 3SJ8A 2F9NA 4B74A 2PKAB 2QXIA 1AFEH 4O9VA 3KNXA 1XUKA 2BD9A 3QO6A 3RM0H 4XSKU 5GWZA 2D2DA 3TK9A 1LKAA 1HAYB 5HIYA 3DD2H 2OC7A 2HRVA 4D8NA 5A0AE 1TONA 1W3CA 2BDBA 2FM2A 4JYUH 3FO8D 1GBBA 5E2OA 5E8EH 1QB6A 1BMNH 3AAUA 4FU9A 2CHAC 1ZMJA 1YPJH 5GJ4B 3RMLH 4OGYA 1C2IA 1HNEE 4OM9A 2FX6A 1AKSA 4JCNA 1T8OA 1HXEH 1TBQH 2HGTH 3LH1A 1FV9A 1GJBB 1C5NH 2FXRA 3VGCC 5C5OA 1WUNH 3UOUA 1TRNA 4CRFA 2OD3B 2A5KA 4Y11E 2FOEA 1WV7H 3PB1E 2WV9A 1MCTA 2XTTB 4RKOB 2I6SA 1ELBA 1W0KD 9LPRA 3MWIU 2YNAA 4U30A 1LCYA 1G3CA 5FX6A 1CBWB 4AGJA 2FDAA 4R0IA 3A82A 4I8HA 1DXWA 1O33A 1UJ1A 1A4WH 5EXNA 2J98A 1AZ8A 3EE0B 3JZ1B 3O8CA 3GCTG 1P2QA 3RXGA 1TPOA 1TMBH 3UUZA 2GT8A 4K60A 4X1QU 3D49H 2CXVA 5TCCA 3MTYA 1AE8H 2BY5X 3SV9A 2GMTB 5C0UA 3S7HB 1TNHA 3PTNA 2FYRA 1S85A 2SFAA 1C5XB 1TRMA 4FUFA 5LPFA 3NK8A 2CF8H 4YOIA 1GJ8B 1GJDB 1EAWA 3VPKA 5FHTA 1S81A 3BIUH 2BDCA 2RA3A 4FUJA 4ISIH 1OXGA 2V0BA 3GS9A 1QRXA 3RXFA 3NKKA 1MTNC 1L1JA 2AGGX 3LPRA 1GJAB 1EASA 5JYIA 1JRSA 2B8OH 4D76A 2NU3E 4JZIA 1D3DB 3ATLA 2DUCA 3RP2A 4DGJA 1W10U 1D3TB 3VB6A 2ZHDA 1FAKH 1AWFH 1DITH 2VVCA 4KGAA 5EU8A 1E1RD 3F68H 2LNCA 1P02A 3VXEH 1THPB 3BEIB 3DSOA 1JBUH 2B0FA 2XBXA 3HK3B 1TWXB 1O2RA 3AW1A 1C5MD 2WUCA 4X1NU 1C5UA 1J8AA 1TGBA 2V3OH 3EQ0H 5A09A 1JWTA 2WPMS 2FODA 1WYKA 1BTXA 4YZUA 1PPFE 1LPKB 4MNWA 1SLVB 4AC9A 1LHGH 1HV7A 1YWUA 2FMJA 1DWDH 3OTJE 3SHAH 2BQ6B 2WYGA 5DP3A 1AFQC 2AH4X 1PPCE 2RA0A 1VITG 4DT4A 1KMHB 2WPIS 2I6QA 4Z0KA 3MFJA 1LHDH 2VIVA 1AB9C 1P12E 3S69A 1NFUA 1ZJDA 1MCVA 3MH5A 2W7SA 3S9CA 3KQBA 4INLA 3HKJB 3TH4H 2BB4A 3I78A 1P2IA 3OYPA 3BTTE 4I31A 1J9CH 4IW4E 2EI6A 1M9UA 1SGPE 1ELAA 2HNTC 5DP9A 1ZR0A 2SGDE 3SU3A 1AY6H 3ZZCA 1EP5A 2WZQA 2GCHG 5AHGH 3D23A 1RGQA 1C1TA 3T5FH 5EJ1A 2ZTZA 2F9BH 5F6MA 1VGCB 2VWOA 2J34A 2ZFPH 2Q6GA 1ELVA 3LGUA 5I46H 1GDNA 5J4QA 1UTJA 4K2YA 1OWJA 1NU7B 1NBMD 3GOVB 1S6HA 1DPOA 3SUDA 4UDWH 1TPAE 3EA8A 1SGFG 3UOPA 3QUMP 3LJOA 1MH0A 4Y10E 1O5BB 4LK4A 1ELGA 2EEKA 3PLKA 5AFZH 3UFAA 1UTOA 1Z8JB 1AU8A 1NROH 2WPDD 1IOEA 4X8VH 1D9IA 3PWBA 1C5SA 1LPGB 2QXGA 1G3BA 3MHWU 3AW0A 1UHBB 1Z8RA 2Z9IA 3BSQA 1QL9A 1Z71A 1KXEA 4Y6DA 1V2JT 2G5NA 4GVUA 8GCHF 2A2XH 4R8TB 1A2CH 2VWLA 1V2PT 1ESAA 5CHAC 1S82A 2QY0B 1H9IE 1XVOA 2OK5A 2UUYA 1SLUB 1NFYA 2AMDA 1A3EH 3RLYH 4D9RA 4TY6A 1GHXH 1MU6B 4LOYH 2JJ2D 1SGCA 3TK6A 2EI8A 3Q3KA 5DGJA 2A5AA 1PJPA 2NU0E 1BMFD 4TWYA 1FDPA 4Q7XA 2ZHWH 4TPIZ 5LPRA 2EA3A 1O2YA 4AG1A 1Z8GA 5DPAA 2ZGBH 1L4ZA 2ZDLA 3OFND 2C93B 3QGNB 3SV2H 2ZPSA 1QZ8A 1ZPBA 5DP4A 1GI2A 3GY5A 1O3BA 1V2VT 2FOAA 1EAIA 1O2JA 4AFSA 4J1YA 1O3CA 1MTNB 3PMAB 1UTQA 2BLVA 4FUDA 3FOAA 1VCWA 1Z6EA 4ZHMU 3LDXH 3V13A 1BITA 3KCGH 2AHME 5FXLA 4K5ZA 1O2IA 4OS2A 4P00A 1L4DA 1O5DH 6GCHF 3UIRA 1L1NA 3UNSA 3E0PB 1EOJA 1GBTA 1DWBH 1A0LA 2A7JA 4YOJA 1HGTH 2IN2A 4ABBA 3TGJE 3VB5A 1V2KT 2OC0A 1K1JA 2ZFRH 2VIWA 1MTSA 5BRRE 1G2MA 2AFQB 1QB1A 2PKAA 3S9AA 1OHHD 1GI6A 2W26A 2XNDD 1DUEA 1AKSB 3STIA 2K1QA 1OP2A 1ZPZA 1WOFA 1SQAA 3E90B 3BTEE 1RJXB 2FLRH 1PPHE 1NM6A 1KXCA 4B75A 3A80A 2Y80A 1O5AB 1QY6A 3UNRA 1AFQB 3CNRA 4F48B 2BD5A 1THSH 1NRNH 1UCYE 3NZIA 4VGCC 1MZDA 2HLDD 1IQGA 3PMBB 1C5LH 1FIWA 2Z3EA 3RXRA 2PKSC 1MD7A 9ESTA 2SNVA 2O8LA 2VGCC 1QA7A 1VCQA 2PGQB 3M37A 4I8GA 2TGPZ 4Y0YE 1O38A 2ZF0H 4X6MA 4I7YH 5DKMA 3GCHC 1HCGA 3SNCA 2NU2E 4A1VA 2JETB 3TH2H 4WH8A 1WQVH 3RXSA 3TLOA 4H6SB 3EA9A 1AO5A 2BZAA 1PPGE 3A88A 1CA8B 4I8LA 3GCTF 5T1VA 5T3HA 3BEFB 1EAUA 1F92A 2PHBA 4DVAU 2W7UA 5E0HA 1O3EA 3SQHE 1YPGH 5A2MH 2BX3A 4F4OC 2FESH 1BDAA 1O3LA 1LHEH 4DIHH 1NC6A 2BOHB 1C5TA 1NESE 3D65E 3KQDA 4ZKOU 4MG3A 1FXYA 3KEEA 3KYFA 1NT1A 1UTPA 4WMFA 1T7CA 1ELTA 3V0XA 3QK1A 1QCPA 1F5RA 1K2I1 1TMTH 5HMAA 2FWWA 3GCNA 1FMGA 2GKVE 3TNSA 1BHXB 1O2PA 1OWIA 3E3TA 3NCLA 4ZUHA 2SGEE 1P11E 1F5KU 2ZGJA 1GJ6A 4GHTA 1UMAH 1BCUH 1XKAC 1FY5A 2GT7A 1VR1H 2ZDVH 2BX4A 1GI3A 1W2KH 3RMNH 1NZQH 1QURH 1C5OH 4FETA 2ALPA 1ARCA 2BY6X 1DWCH 2P94A 3RXJA 2ZQ1A 3RC4A 4HI3A 4Q2KA 1A5IA 2ODYB 1C5WB 1YLDA 1E34B 1IQKA 4K8BA 3T28A 5L2YH 2ZCKP 5JDUB 1O2OA 1SOTA 1O39A 2V6NA 1O2KA 1OYQA 2PFEA 3T62A 5EJLA 1ZRKA 4RSPA 3LJJA 2ZEBA 3OY5U 1W11U 2OLGA 1T32A 1XMNB 2ZHFH 4Y71A 3U9AH 2OQUA 2A4QA 3ZVFA 3QLPH 4NIVA 7GCHG 3SNEA 1CHOG 3SQEE 2A45B 1V2ST 2BYAX 1DXPA 3EAJA 6ESTA 2FPZA 4Y7BA 5EXMA 3A7TA 2PGBB 1TYNA 2O9QA 1C1OA 1C5QA 3A85A 2TRMA 1NTPA 1O3DA 3RU4D 1EB1H 2GV7A 5BPEA 4CR9A 7ESTE 2XC4A 4JZFH 3TJOA 1ZSLA 3ZZ9A 4GPGA 2QYIA 3IG6B 4I8JA 1QHRB 2P16A 3RXBA 1W14U 1YY3A 2BDHA 3GY4A 4X6NA 1SFIA 1GBCA 2GV6A 3PO1B 1XUJA 3QN7A 3LIWA 1O2VA 4WWYA 4ACBA 5JB8S 4M7GA 2VIPA 3STJA 2A1DB 1FONA 3A7XA 3B9FH 2QF5A 1DDJA 4GLYA 3TITA 2OBQA 1AIXH 1O3HA 3ZZDA 2H9HA 2IOTA 3P70B 5HKKD 2A4GA 2XBVA 2KX4A 3VFEA 4H4FA 2G4TA 3M5LA 2Z3DA 1AZZA 1GBLA 4TWWA 2VVUA 1IQLA 1TGTA 3GDVA 2LPRA 1D6RA 4F49A 1P05A 5E0GA 2PTCE 2XYAA 1MTWA 3UNQA 1C1SA 4XD7D 3AK5A 3RLWH 2CJIA 2ANYA 3BN9A 1UHBA 4NGAH 3UB0A 3V12A 2NWNA 4IS5A 1TNLA 2HNTF 4AFUA 3RXQA 2G00A 5B6LA 2ZPRA 3UQOA 3A7YA 3DSGA 1EPTB 2R0LA 3RXPA 1TBZH 5B6OA 1ZPCA 4H42U 1OWEA 4NZLA 4A1XA 1ELEE 2ZCHP 1GBHA 3GY8A 2ZZUH 3TIUA 1KXBA 1C1QA 2RCEA 1DUAA 3I29A 1LKBA 1GMCG 4AYVB 1XKBC 1B5GH 2J94A 3GY2A 2H5DA 1GDQA 3PTBA 1TQ0B 3N7EA 4Q63A 3FZDA 1YGCH 3DUXH 2L6OA 1A0JA 3MQKC 1TLDA 4FVBA 3TNTA 4YTAA 1BHXF 3MOCA 4ABDA 2PSXA 4WMEA 1OWKA 3QZQA 1KY9A 4FU7A 1GCDA 4BOHA 2H2ZA 3RXUA 4YOGA 1C4U2 1W13U 3UR6A 4X2WA 3RU4E 5TJXA 4OS6A 1MQ5A 3MO6A 2FEQH 1OP0A 1K1IA 5JBBS 1BOQA 1PQ5A 4A7IB 3GY6A 3NPSA 3QWCH 4AN7A 5JBCS 1SQOA 3SV8A 3U69H 3T26A 1ABIH 1ZLRA 3BV9B 1MBQA 2GCTC 3MU5A 3RXCA 3FAOA 5DP8A 2C8YB 1AMHA 1GGDB 1C1VH 3CS0A 2JIZD 1SGEE 5KGOA 1DLKB 2FO9A 3MNBA 1OYTH 4OGXA 5I25A 4CHAC 1LO6A 5JBTA 1YYY1 3U1IB 1ZGVA 2Y5FA 2YOLA 1SVPA 4MPVA 1V2UT 2TBSA 4ZKSU 1LVBA 1W8BH 5A8ZA 1MTVA 3GY3A 2BLQA 2A32A 1BMMH 1RIWC 2Y7ZA 4AG2A 2BZ6H 1EFRD 3ZZ6A 1T4VH 4ASHA 1CT0E 4YO9A 1JMOH 1W0JD 5EW2H 1L1GA 1D6WA 2PSYA 1T4UH 2THFB 3MH6A 1F0UA 1AVXA 4U01A 2AMQA 1Y3XA 1RRKA 1FY8E 2ZTXA 4FUCA 2H1UA 1O3NA 1E1QD 1O3AA 1UCYH 1S0RA 2BXUH 4YM9A 3QDZB 3P8FA 5EW1H 2XWBI 1BB0B 1SL3A 3E0NB 2BDIA 3BG4B 2KZ4A 2A5IA 4DY7B 1UCYK 4AYYB 4WY3A 1P10A 1UTLM 4CBNA 2A7CA 2FX4A 1O2WA 4IN2A 2FOFA 1ANCA 1O5GH 3TGIE 1K1NA 1Y3VA 1V2LT 4B1TA 2BHGA 2BM2A 2BVRH 4GCHG 4RT1A 4Z6AH 1P04A 3T25A 4Y8XA 3TPIZ 2ZC9H 1N6YA 1B0FA 1BT7A 1ZYOA 2FZZA 1A46H 1CGHA 2BY7X 3BTFE 4I86A 4A5TS 2TGAA 1GVZA 1TE0A 2KAIB 2ZGHA 1W0ZU 3KGPA 3L33A 5EIYA 1FN8A 3VB7A 1C5VA 2QF3A 3U8RH 3GYMA 2XW9A 1O2SA 7KMEH 8ESTE 1T8LA 1HJAC 3M5MA 2GDDA 1GMDG 4YT6H 5HM2A 1GI5A 1B7XB 3MO9A 1S84A 1C1NA 1O2UA 2IPHA 1GCTC 1Z1IA 5K0HA 5AVDA
chains in the Genus database with same CATH topology
5A0BA 1A5GH 3Q00A 1DSUA 2ZFTA 4UFFH 4ZKNU 1IAUA 2Y5GA 4WXVA 3W94A 3A84A 1TB6H 1UTMA 3F6UH 1YPMH 3RMMH 1L2EA 2FIRH 1P57B 3RXKA 3LGIA 1DOJA 1KDQA 4ISOA 2VJ1A 1KYNA 3NXPA 3FP8E 1EX3A 2ZI2H 5DP7A 3LONA 4IGDA 2ZECA 2FI4E 1Y3WA 4JMYA 3SUEA 1J14A 2ZU3A 1EP6A 3SO3A 2Z9GA 4D7GA 1GHBG 1ARBA 2C8XB 5F8TA 4ZHAA 4XBBA 2Z94A 4ABEA 5L30H 1HAPH 1GBEA 3U8OH 3U8TH 1C1UH 2OINA 2F83A 3T27A 7GCHF 4SGAE 1CHOF 1QQUA 1O30A 5E0JA 3ZVBA 4DT7B 3HGNA 4KP0A 4A6LA 2H9EH 1TA2A 3P8OA 1ABJH 1ELCA 1HXFH 1QRWA 2G55A 2RG3A 1TPPA 3TVJB 2QV1A 3DFLA 2G4UA 5EPNA 6CHAB 1Y59T 1BZXE 5A8YA 1OPHB 1GI9B 5J4SA 2SGQE 3PMHB 2GX4A 1SB1H 4MLFB 5C1XA 3MNXA 1W12U 4I8KA 1PPBH 4D7FA 4OS1A 1O2TA 1HJ9A 1W7GH 1C2KA 3JZ2B 3LGTA 1FUJA 1QTFA 3SGBE 4LXBH 2PR3A 2W5EA 2AGIX 2P59A 1SGDE 2Z9JA 1PQ8A 1QGFA 1CE5A 1TGSZ 1TNGA 4FVDA 2PUXB 1DICA 2VU8E 3SN8A 3KIDU 4Q80A 1TAWA 2CHAB 1ZTJA 1HFDA 4NIYA 4WJG2 5EQSA 1YPHE 1T8NA 4AB8A 1HAZB 1FY3A 3VGCB 1CVWH 1E38B 4ESTE 2HVXA 1DVAH 1MU8B 5GCHG 1DSTA 3WY8A 4MNYA 4HZHA 5EQQA 4AORA 1NS3A 3M35A 3L6PA 2QIQA 1GBAA 1Q3XA 1GPZA 1TRYA 1V2NT 2BTCE 2Q6DA 3G01A 3SHCH 1Q2WA 2EI7A 2A7HA 1EPTA 3LC5A 1WCZA 4JZDH 3MYWA 1H8DH 1ZHPA 3O8BA 1MMJN 1E35B 1QFKH 3SW2B 3UR9A 3AVZA 1EUFA 5C67A 2AEIH 2V35A 1AD8H 3TJUA 2Y7XA 3M3VA 4ABHA 1O3IA 3SORA 5F03A 1YP9A 4GSOA 1NO9H 2FOMB 1GMCF 3SJKA 1OSSA 1Y5AT 4XE4A 1UK4A 1EJMA 1ETTH 2B7DH 3RMOH 1A7SA 4X1RU 1KTTB 1Z8IB 1O31A 5FPTA 3SU2A 2BD7A 2SGAA 3D62A 2XBWA 3CS7A 1IHSH 4NWKA 3UWJH 2XXLA 1O3FA 1ZMNA 4CH2B 2YNBA 1LHCH 1PQAA 1H8IH 2F9VA 2QA9E 2ZU2A 1OP8A 5CMXH 3Q77A 1B0EA 2JH5D 3UREA 3BTGE 3RXDA 1C9PA 2AYWA 1GVLA 2OCVB 2VH0A 1E0FD 1NRPH 1C2EA 1O35A 2BDAA 1O2XA 1DS2E 3LGVA 1RXPA 2HWLB 3E8LA 3SU4A 5GIBA 1XXFA 2P8OC 1O2GH 1H1BA 2G51A 2QC2A 3KF2A 1T8MA 1RTFB 2J38A 1PYTC 4CRBA 1SGQE 5F8ZA 1C5RA 3P17H 1V2WT 1AQ7A 5GPIB 1AI8H 1C2DA 3SI4H 4UFDH 2WV4A 2FOHA 4OS5A 1HDTH 2XNIA 2FS8A 4B2AA 1IQIA 1OOKB 1ZHMA 5FAHA 1RFNA 1CU1A 4KKDA 2ALVA 1GI4A 5A0CA 1AB9B 1OS8A 4NIWA 1MZAA 1YLCA 4BTIB 4INKA 4DG4A 1TNIA 5HXFA 2ZHQH 3CP7A 2ODPA 4O3TA 1GVKB 5LPEA 2BY8X 3RU4T 4B2BA 4MDSA 2WPLS 4AZ2B 1QB9A 1H9LB 1GJ7B 2Y81A 3LGYA 3BTKE 2ZDKA 4A1TA 2VB0A 2ZWLH 3M7UA 1CQQA 4NIXA 1QBVH 2QAAA 1DT2A 1PQ7A 3F9HA 4JK5A 1QL7A 1GI1A 3MU4A 1HIAB 3P95A 4GCHF 4X6PA 3SV6A 2J92A 3PM3A 1CA0C 3LC3A 4MTBA 2WPJS 5K7RA 3SV7A 2AIPA 3LKWA 1O3KA 4DW2U 2ZDAH 3EYDA 1KIGH 2Q1JA 1ZMLA 1UVUH 3HK6B 2SGPE 4MPWA 2KAIA 5PTPA 3QTVH 5FPSA 1BMAA 1ZRBA 3UTUH 5LGOA 1XUIA 2QCYA 1Z6JH 4FUIA 1OWDA 1LQDB 1HYLA 1C5YB 1O2ZA 4X8UH 1GHWH 1GI0A 3SGAE 3PLPA 1O3JA 3EGKH 1IQEA 1UTKA 1ESBA 1A3BH 3H7TA 1C1PA 1JIMA 1OX1A 1RS0A 4ABGA 3TK5A 3SJIA 1KDQB 3ITIA 3DA9B 1FJSA 4DIIH 1V2TT 1ZTKA 4E7RG 2F3CE 5CHAB 3A86A 4Q7YA 1HUTH 3KQCA 1IQMA 4D9QA 1QL8A 1G36A 2GZ7A 4BTTB 3ZZ3A 1ORFA 3ZV9A 2J9NA 3QGJA 2EC9H 4FU8A 4BNRA 3MMGA 1BIOA 5GDSH 4KTCA 3LT3A 1BTPA 1SLXB 3OX7U 4NSYA 2JKHA 3A8DA 1ANEA 1O36A 1ELDE 6LPRA 1EKBB 3PMJA 1F5LA 3GISB 3SOSA 4A92A 1GHBF 2C8ZB 2BY9X 1GJ5H 4CR5A 1XM1A 3ZYEA 2HNTE 1VITF 1GHAG 1KXAA 1LVYA 4ZXYH 4MVNA 4B73A 4AFQA 1TA6A 1MKWH 1TNKA 3SU1A 4AX9H 1O5EH 3PROA 2BQ7B 3ATMA 1CGJE 2HLCA 2NU1E 1MKWK 2VIQA 2ZU1A 1P3EA 1EB2A 1O5CB 1K9OE 1SGIB 1K1LA 3ZZBA 1EOLA 1P3CA 1TQ7B 1ZGIA 3R0FA 3SUGA 4DCDA 1HAOH 1DY9A 3ELAH 4MPUA 1EZXC 2GCHF 5ESTE 7LPRA 1P8VC 5T6FA 1SMFE 2GP9B 1ANDA 3BTME 3BTHE 1HJ8A 2CN0H 4WMDA 1DE7H 2P8OB 5HGGA 4CRDA 1SQTA 3A81A 1S83A 1EQ9A 4CRCA 3SBKA 2CF9H 1F0TA 2B9LA 3HGPA 1YC0A 1J15A 4XBCA 4ZAEA 1QJ7B 3Q76A 4Y8YA 3MI4A 1GDUA 5C20A 2OP9A 4MQAA 1P0SH 1A5HA 5DK1A 1FIZA 1BTWA 5DO4H 4CH8B 1WSSH 4VGCB 4K69A 3AASA 3DFJA 2VIOA 2VNTA 1XXDA 3QZRA 1K1PA 1MAYA 4BXSA 3BTQE 2PKSB 1SPJA 3PYHA 3SU5A 1HAVB 2VGCB 2ZU4A 1F2SE 1O2HA 4BAMB 1EAXA 3BIVH 1XX9A 2ESTE 1U6QA 3ZZAA 1BTYA 3GCHB 3A83A 1K28D 4RN6A 3A8BA 1YCPM 2WV5A 3QX5H 3EA7A 1MTUA 1O2NA 4PROA 3S0NA 1RD3B 1AVGH 4IMQA 2ILNA 4UEHH 1OKXA 1W7XH 1O0DH 1SI5H 4KTUA 1ACBE 2J95A 4FUBA 1AVWA 3QTOH 1CA0B 1FPCH 2SNWA 2Z9KA 3B8JA 4GUXA 1NFXA 5DP6A 1S6FA 3H5CB 1Y8TA 2ZA5A 5EQRA 3S9BA 2PTNA 2GD4B 2XCFA 1P03A 2A4RA 4WH6A 4UE7H 1BTUA 1VJAU 1P01A 4YLUA 4SGBE 1G9IE 1C2GA 3E6PH 1X7AC 1GHVH 1YBWA 1UK3A 4X2YA 3SZNA 2V3HH 1UVSH 1V2RT 3SNAA 1XUHA 6GCHG 1AUTC 2BLWA 4UFEH 2FTLE 2DE8A 4IMZA 5A8XA 3TJNA 5AFYH 4X1SU 1KLIH 1QNJA 4AB9A 3ZVCA 4CREA 3KHVA 4X1PU 1JRTA 2F9UA 4NZQA 1C9TA 1PPZA 1K22H 4X2VA 2ZHEH 3VXFH 1N8OC 4O03A 1CSOE 3FP6E 1VGCC 3TGKE 5EODA 1UK2A 1J16A 1J17T 2BDGA 2IJOB 2J2UA 1GJ4H 2ZCLP 2HOBA 1L0ZA 1NRRH 1C1MA 1O3OA 4Y79A 4Q7ZA 2GVFA 4JYTA 4ZKRU 4HTCH 1SFQB 4H6TA 4ABIA 4ABAA 3BTWE 4FUHA 5ETXA 2FLBH 4IN1A 4K1TA 1C2HA 1C4V2 2O8WA 1P2JA 3MH7A 2Z6BD 5CE1A 1TX6A 5T6DA 1A61H 2G81E 2OC8A 2F9PA 3ZZ8A 1UVTH 4ZROA 1BTHH 2NU4E 2R0KA 1HLTH 2BQWB 5DJ7A 1XVMA 2BXTH 1SGFA 4ABJA 4ZHLU 3KN2A 1FZZA 2BMGB 2ZIQH 3BTDE 3F1SB 2FI3E 2GGVB 3LGWA 1GBFA 1BA8B 1DWEH 2QGRA 3K65B 3V7TA 4NG9H 2ZFFH 1HIAA 1ZOMA 1P2MA 2OUAA 3UQVA 2STBE 1E36B 1VITH 1C2FA 2GZ9A 2ZGXH 3ZVDA 4X2XA 2GDEH 1G32B 3SJ9A 4Y76A 2OC1A 5EPYA 1GL1A 5C1YA 1GMHG 1GJ9B 1QBOA 2GTBA 4UONA 1BRBE 4OS7A 2BD4A 1C2LA 1TX8A 2HPQH 2VIDA 3GDSA 3TU7H 4GHQA 1P9UA 1O3MA 1IQNA 1G30B 3SI3H 2TGDA 3O8RA 2P95A 3EDXB 5ABWA 1JOUB 2QN5T 1P09A 2G8TA 3I77A 1INCA 1G2LA 1MUEB 1EZUC 4IC6A 1QA0A 4AGKA 3C1KA 2Y82A 3A7WA 2UWLA 3RXVA 4BAHB 1O2MA 3L3TA 1K21H 3URDA 5LH8A 1FLEE 1V6DA 1XUGA 3EBNA 1TOMH 2UUFB 2PWXA 3PV4A 1E37B 1YF4A 2H5CA 2LIZA 1CT4E 2AMPA 4IBLH 5L6NH 5AF9H 3A8AA 4BAQB 1TGNA 3ATKA 1AGJA 4ISLA 1GBMA 1EZSC 1AUJA 1MD8A 1BBRE 2UWOA 1TIOA 4JYVH 3ZV8A 2F91A 1Y3UA 3RXIA 5C2ZA 2ZFSA 1GHAF 1D3PB 2D26C 4WXIA 1DFPA 1SSXA 3HATH 5FBIA 1FY4A 5FX5A 2Y6TA 1V3XA 1HRTH 5EXLA 1KXFA 1UVOA 1AWHB 1FNIA 1LDTT 4KTSA 2PV9B 1W0YH 4Y8ZA 2GCTB 2J4IA 4UD9H 1PFXC 3MU0A 1YCPH 3RXHA 1NN6A 2W3IA 4JZ1A 1Q31A 1QIXB 2TIOA 3MU8A 4AFZA 2FOBA 4CHAB 1HAXB 5HYOA 3DT0H 1YCPK 4U32A 2JETC 1SBWA 2ZKSA 2FI5E 3ZZ5A 2CMYA 1SGRE 1KLJH 5H4IB 3A7VA 1RIWB 3RC5A 3KL6A 3Q3XA 3M3TA 1HB0B 3FFGA 3W95A 1GBDA 4IC5A 2B5TB 1N8OB 1SOZA 3ZZ4A 1C2MA 3RXEA 1GI7B 3N7OA 4ISHH 3UWIA 1D4PB 1Y5BT 1KSNA 3P92A 5EG4A 1BRAA 3S7KB 4E05H 1GBIA 2WUBA 3GDUA 4LZ4B 1S5SA 1F7ZA 2XC5A 2C8WB 1P2NA 5G4BA 1FI8A 3ZYDA 4B71A 5E2PA 1ANBA 5DP5A 5FCKA 1VCPA 2FYQA 1ETSH 3PLBA 1HAVA 2ZDNA 3FVFB 2G5VA 4RKJB 1O5FH 2ZDMA 4TY7A 2DE9A 4NFFA 2AIQA 1KLTA 3TJVA 2AGEX 2FS9A 1T31A 1QJ6B 3SNDA 1WBGB 3ESTA 1SR5C 3MO3A 1MBMA 2P3FH 3ZZ7A 2R3UA 1DANH 2O8MA 3IITA 3HPTB 1GG6C 4FXGH 1P2OA 1SGTA 4B2CA 2C90B 3U98H 1ELFA 1HJAB 2R3YA 1ZSJA 1EJAA 1DX5M 3F9FA 3M5OA 1SGYE 4XFQA 1TOCB 2WPKS 3SU6A 4X8SH 4BANB 2UWPA 1GCTB 1YM0A 4DOQA 2A0QB 2G52A 4ZH8A 1JIRA 5FPYA 2UUKB 2P93A 3M7QA 3Q3YA 1V2OT 4BXWA 3ATWA 2AS9A 2OBOA 2ZNKH 1C5ZB 1QQ4A 5JPMH 1DLEA 4WF8A 3NWUA 4TYDA 4BAKB 3M5NA 1A1RA 2ANKH 2P3UB 1C5PA 4BAOB 2ZU5A 2BOKA 1S0QA 5T6GA 2ASUB 2VH6A 1HAIH 1P9SA 1VJ9U 4OS4A 1YKTA 4Y0ZE 3RXLA 4K1SA 1SHHB 3PO1C 2GZ8A 4XDEA 2ZQ2A 2QXJA 3R3GB 1WU1A 4NFEA 2ANMH 3M7TA 1O34A 3K9XB 1BTZA 1K1OA 1MKXH 1BUIA 4YLQH 3SU0A 3RXOA 4KELA 3IWMA 3SGQE 1CO7E 2ZP0H 1MQ6A 1ZJKA 1BQYA 2VWMA 1MAXA 4GAWA 1Y3YA 1MKXK 2Z7FE 3VB4A 2ZPQA 3FANA 3RM2H 1YPLH 2XC0A 1WAYB 3V3MA 2C3SA 1NRSH 1QJ1B 1SHYA 4YT7H 1N6XA 2OXSA 3GY7A 4CBOA 2ZG0H 1CHGA 4B76A 2BD2A 1QR3E 4K3JA 1OWHA 1C1RA 1C1WH 3RC6A 3A87A 2O8TA 2C4FH 5JB9S 1O32A 3LU9B 2XBYA 1EPTC 1DY8A 2JH0D 4X6OA 1IQHA 3SUFA 1P06A 2HPPH 1O3PB 2VINA 1HPGA 1H4WA 1O2LA 3VB3A 2BVSH 1GBJA 1TALA 1G37A 2Y5HA 2R2MB 2BLOA 1P2KA 3O8DA 5IYTA 5GXPA 1Z1JA 1IQJA 2AERH 1V2MT 4Y7AA 1G3EA 1NY22 3E1XB 1TNJA 4I32A 1HBTH 1GL0E 4ZXXH 5C1UA 4K1EA 1SG8B 1UVPA 1O3GA 1K1MA 4BTUB 3M3SA 1GMDF 1LMWB 1GMHF 2STAE 1PPEE 2ZGCA 2Z3CA 3OSYA 2Q6FA 2ZFQH 4XBDA 4LZ1H 1LPZB 3AAVA 4JK6A 5FCRA 1F0RA 3MNCA 3OU0A 1O37A 1CGIE 1TX7A 3UPEA 1WQSA 5F8XA 5ESBA 2WPHS 2R2WU 2TGTA 3U1JB 1ESTA 1C2JA 4J2YB 3A8CA 3RXMA 1GGDC 3M36A 1FAXA 8LPRA 3MNSA 2ULLA 3BG8A 1LVOA 1HAHH 3RXTA 3ZVGA 2VVVA 3GICB 2ZTYA 4WVPE 1Z7KA 3ENSB 1IQFA 3MH4A 1NFWA 3NUMA