4RSPA

X-ray structure of mers-cov nsp5 protease bound with a designed inhibitor
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
304
structure length
303
Chain Sequence
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-induced Dimerization of Middle East Respiratory Syndrome (MERS) Coronavirus nsp5 Protease (3CLpro): IMPLICATIONS FOR nsp5 REGULATION AND THE DEVELOPMENT OF ANTIVIRALS.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Orf1a protein
total genus 86
structure length 303
sequence length 304
ec nomenclature
pdb deposition date 2014-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4rspA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4rspA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4rspA02
2RDLA 3UWIA 1K1LA 5FX5A 3SQHE 4LZ1H 1GI1A 2BXUH 3A7YA 3S0NA 3M36A 1QBNA 2CHAC 3QO6A 3PROA 4WH6A 1PYTC 1PPCE 1WBGB 4HI3A 3SHCH 1D4PB 2M5TA 4ZXXH 3MU1A 1NROH 2O8LA 1GBJA 2F9UA 3ZZAA 4CR9A 2WUCA 1KLTA 4NIXA 2ZU5A 3LKWA 3TJUA 1JWTA 1DWDH 4A6LA 4BAKB 2OLGA 1F0UA 4B74A 3QUMP 2C8XB 2HVXA 5E8EH 1C1UH 2ODQA 2DUCA 1EPTB 5ETXA 5LH8A 1VCPA 2TGAA 1CT4E 2C4FH 2SNWA 2ZO3H 1O2UA 2UWPA 4JZDH 4K69A 3NKKA 3RXQA 3ZVFA 2FYRA 1UTKA 4LK4A 5FPSA 1LTOA 3RXVA 1P10A 4GLYA 1CHGA 4I8KA 8LPRA 1MZDA 2XTTB 3KL6A 1A0LA 1KXBA 2GCHG 1UK4A 3CP7A 3VXFH 1GVZA 1S6FA 2G5VA 1ID5H 4ZAEA 1PQAA 4O97A 5T6GA 1CGHA 1NRQH 6CHAC 4A1VA 1V2TT 3UTUH 1IOEA 1AVWA 1C5VA 5E2PA 4XDEA 1EX3A 2FOEA 2WYGA 1ZTKA 4X1SU 1A1RA 2O8TA 2Z9KA 2BDCA 1IQHA 2A2XH 3GYMA 3OYPA 2KAIA 3TGIE 3OY5U 4D76A 1AFQB 2BD3A 3SGAE 3FANA 1DWBH 2AH4X 1C9PA 5SGAE 3GISB 3GY7A 1QIXB 1QB9A 1XUFA 1B0EA 2F3CE 5GIBA 3T2NA 4O3TA 1F7ZA 1S0QA 3H5CB 4AYVB 1JBUH 1KDQB 1MH0A 5FCRA 2SGEE 2QC2A 1ELEE 4NA7A 1YP9A 1HDTH 5EQSA 1QQ4A 2G81E 1N6YA 1UTJA 2BVRH 2G51A 1O5AB 4BTUB 2ZC9H 2P8OB 5JBBS 1C2LA 1SPJA 1Z8IB 2BDGA 1TPPA 4K2YA 4I31A 4A1TA 1GBHA 3RXHA 3VPKA 4THNH 5J4QA 1Y5UT 1SGEE 4INHA 1PJPA 1ZYOA 3A84A 4B2BA 2WYJA 1V6DA 2ZEBA 2VWOA 3ATMA 5CHAB 3O8RA 1V2MT 3A89A 3UUZA 1O35A 2ZECA 1GBCA 4ABIA 5EGMA 2V35A 1C2HA 3RXDA 1NZQH 1EZXC 1BRAA 1TX6A 1W0ZU 3MO3A 4BAOB 4AFUA 2XBVA 2A7CA 2UWOA 2VWNA 1ACBE 1G3EA 1UTMA 5AF9H 5GPIB 1NFYA 9ESTA 2H5CA 3STJA 1GHAF 1TQ0B 1MAYA 2EC9H 1SGPE 3UQOA 1CA0C 4UEHH 1QY6A 1AZ8A 2FS8A 5C67A 3TGJE 1L4ZA 2BY9X 3MHWU 5EQRA 1KY9A 1FY8E 3NZIA 1GCTC 5HGGA 4OS1A 2VWLA 3DHKH 1MTWA 2FO9A 2FODA 1BIOA 2TGPZ 7ESTE 1MCTA 4NFEA 1P3EA 1TA2A 2XYAA 4DOQA 4PROA 1GI8B 3RU4E 4BNRA 4B76A 2C3SA 1GJ7B 3KQCA 1ABJH 1EZSC 3UR9A 4AFZA 1TNJA 2JETB 4XOJA 2ZCLP 3MH7A 1MQ5A 2W7SA 1DS2E 1GJAB 4Q7YA 3VGCB 1HAOH 2SGQE 1P57B 3SGQE 1BT7A 1BDAA 3GY6A 4NIYA 2Y80A 2JH5D 1O38A 3TH4H 1ANBA 1SHYA 4UFEH 2Y6TA 1ZPBA 3ZVEA 4BAHB 3BTWE 1TNLA 4GSOA 4X6PA 2OCVB 3BTEE 2HPQH 1TOMH 3OSYA 1G3CA 1H9HE 2XBYA 1L1NA 1BUIA 2GCTB 3N7OA 1D6RA 3GCOA 4INLA 1GHWH 4UE7H 2Y5GA 3LOXA 4ISHH 5CHAC 1FY5A 1S84A 1T8LA 1QRXA 4YOGA 1TMBH 1Y3YA 3NK8A 3V13A 2A1DB 4YOJA 2HNTE 2FPZA 4R0IA 1FMGA 4WJG2 2FOBA 2JETC 3P8GA 2G55A 3AAUA 1NO9H 3D62A 2J94A 1HNEE 5L2YH 2VJ1A 6LPRA 2PV9B 2ZFPH 3KQBA 1AY6H 3LONA 1UVSH 4OS4A 3SOSA 1IHSH 3SI3H 2BLVA 1BTXA 2XBXA 6CHAB 1MZAA 1F0RA 4DGJA 1JRTA 2H5DA 1NRSH 3DFJA 1S6HA 3MI4A 4A92A 1GBTA 5DGJA 3LGWA 3S7KB 1OKXA 1C1SA 3LGUA 1S82A 4MPWA 1QJ1B 3JZ2B 2VVUA 5AVDA 3RLWH 1C2JA 1QGFA 1O2LA 1GJ8B 3GY4A 5I46H 1G2LA 1W11U 1TNIA 1C2FA 1KIGH 4BOHA 1QBVH 4F49A 3BTHE 3RXCA 1FXYA 2QF3A 2PFEA 1Z8RA 1HXEH 4E7RG 1P02A 3A7VA 4FUHA 4Q7ZA 1FY1A 2P95A 4FUJA 2GMTC 4XE4A 3QZRA 4RN6A 4JZEH 2G8TA 1BMLA 2ZGBH 3W94A 3TK9A 1C5RA 1TBRH 1RIWB 3F6UH 3ODDA 4CRAA 3FZDA 3U69H 7KMEH 1K28D 1SSXA 3G01A 2CJIA 2P93A 4SGBE 1EAXA 2FOCA 1Z8GA 1C5LH 2BLOA 3TNSA 4HZHA 2OC1A 1NTPA 1TB6H 3SU2A 1GDUA 1RRKA 1UK3A 1NFWA 5F8XA 2WV4A 3MNCA 4UDWH 2XBWA 4NA8A 3F68H 1BHXB 2FMJA 4MG3A 1VCWA 1FDPA 3MU4A 4OGXA 3UOPA 1Y5AT 1HAPH 4BXWA 1P9SA 1K1PA 4ZKOU 1MKWH 1O2YA 2CGAA 2OXSA 4NGAH 4O9VA 5HYOA 1HAVA 2BHGA 1SBWA 2FTLE 1L2EA 3EBNA 5K7RA 2GZ8A 1HAHH 3EA9A 1TA6A 4FUBA 4ZH8A 5G4BA 1D3QB 1G9IE 1EZQA 1G3BA 2HNTC 3GDUA 1D6WA 3U1IB 1SLUB 1QHRB 1UK2A 2BZ6H 2FOGA 3RXTA 2Y5HA 1BMMH 1IQFA 3TU7H 3F9EA 2V0BA 5A0CA 1G36A 3D49H 3E16B 1IHTH 4YESB 5JBCS 2TRMA 4MNVA 5JYIA 3ZVDA 3SI4H 3T5FH 1O3EA 2R0LA 4F4OC 1LHGH 2I6SA 1V2RT 2IN2A 1Y3VA 1K1OA 1GL1A 1BBRH 4HGCA 4Y11E 1O3NA 1ZHRA 1HAZB 4JYTA 2BQ6B 2F83A 1GBIA 1EXFA 1NU9A 1CE5A 1GI9B 1GBMA 1IAUA 2GD4B 5I25A 4ABFA 2BQ7B 1THRH 1J16A 1GBLA 1P04A 4IS5A 1AGJA 1O2GH 1TAWA 4X2YA 6GCHG 1QA0A 1C5PA 3RXSA 1AKSA 4YZUA 3TJVA 5FBEA 2F9VA 1XKBC 1AE8H 1GGDB 5GDSH 2ULLA 5E2OA 1HJAB 2C90B 4CRDA 3M3TA 1C2MA 3A8AA 3MYWA 3UR6A 3F9HA 3M3VA 3MH5A 5JBAS 2SGPE 1CGIE 3DA9B 2GCTC 4X1NU 1UVPA 2FOAA 1PQ8A 2ZWLH 4U01A 1C5OH 3QZQA 1SQOA 3LJJA 4CH2B 1V2JT 2Q1JA 4I7YH 1A3EH 2XWBI 3E8LA 1F5KU 3SBKA 5JB9S 1HXFH 1GJ6A 3A83A 1DOJA 3HGNA 2PKSB 1GMDG 4Q2KA 2A7JA 3HGPA 5EW1H 3K6YA 1O2PA 2B0FA 1TFXA 3F1SB 3T29A 3BEIB 2ILNA 1WQSA 1SL3A 3RC5A 1YPLH 1F5LA 1SGTA 1CHOG 1C2GA 2FLRH 4GAWA 4AGJA 3ZYDA 1EP5A 3ITIA 2FI4E 1ARCA 3GICB 3PTNA 1FAKH 3SW2B 1F0SA 2NU1E 1O3IA 1KTTB 1Q31A 5FXLA 2H9TH 2HLCA 3BG4B 4YT7H 1O3PB 4NZQA 3FP7E 3VXEH 1B0FA 1HIAB 2Z9JA 1V2WT 4D9QA 1WAYB 3SU4A 5LGOA 2GV7A 3RU4T 3EYDA 4BAQB 1V3XA 1V2OT 2ZGHA 4FUDA 3GDSA 1K1MA 3M5MA 2YNAA 3A8CA 4ESTE 3KHVA 1W8BH 1PPGE 4BTIB 4FXGH 1ORFA 4AX9H 2QCYA 2HRVA 3ZZBA 3RMOH 2BX3A 2YNBA 1DVAH 5T3HA 4AFQA 3MMGA 1TALA 3ZZ5A 3W95A 2J2UA 2V3HH 4ISLA 3BV9B 3FAOA 2A5IA 1K1JA 2ZU2A 1GHYH 1TPAE 5EOKA 2EI7A 2TBSA 2A4OA 3ENSB 2SGFE 4IN2A 1C1TA 4X1PU 8KME2 2F9OA 4Y79A 1W7GH 1BBRK 2Z6BD 1TOCB 2O8WA 3SJ8A 2ZCKP 1BOQA 4JYVH 2FOHA 3PB1E 2PKSC 1FIZA 1EB1H 5H4IB 2LIZA 2FP7B 3P95A 1C5QA 4DT7B 2ZDKA 1BTPA 1O3FA 3RXRA 1O2VA 2IOTA 3M37A 1JIMA 3V7TA 3RXMA 2AERH 2Z94A 3SNDA 1P2OA 1GMHF 1SGDE 4NG9H 3PWBA 1DY9A 3WY8A 4BTTB 3T26A 1CT0E 1K1NA 1MKXK 2RG3A 3SV6A 1MCVA 1GDNA 1IQNA 1WYKA 2J9NA 2FOFA 3U8TH 3P8FA 1T7CA 5EQQA 1GMCF 1P2MA 4O3UA 2ZF0H 2ZKSA 4FUGA 1O3GA 2AMQA 2W5EA 4B73A 5L2ZH 1T32A 2FLBH 1TGBA 3ZZ8A 2FX6A 1KXFA 2YOLA 4FUFA 1YPKH 3BG8A 1O36A 1MBMA 4JZFH 5FPYA 2C8ZB 1ZGIA 1O2WA 1BJVA 1O5EH 3RXPA 2OUAA 3PWCA 2F9BH 1TRNA 3U9AH 1C1WH 1GBBA 4AG1A 4CRBA 2G4UA 1O0DH 1YF4A 3A85A 5ESTE 3IG6B 2BQWB 1FY4A 3A88A 4WWYA 3GY2A 1KLIH 4OS7A 1FPHH 1BTWA 2VGCB 1OOKB 1J8AA 3RXOA 3A86A 3UREA 3ZZ3A 5GJ4B 2CF8H 2KAIB 1WTGH 1EAUA 1SG8B 1G2MA 1P01A 2FS9A 1TRYA 2GCHF 4AG2A 4YO9A 1AD8H 3Q3XA 4Y71A 5FX6A 3O8BA 2PLXA 4I32A 3CS0A 2C8WB 2Y7ZA 2GT8A 1C2IA 3T62A 1AZZA 4D7GA 1OWHA 2TPIZ 3I29A 2V6NA 3ZV9A 4B1TA 2BY7X 1AB9B 1OYTH 1QJ6B 1QL9A 4ABDA 3V0XA 1DLKB 1GJ4H 2Z3CA 3CS7A 1O5FH 1O5GH 2DE8A 1TNGA 3S9CA 1C5ZB 1ZMJA 1NU7B 1LPGB 3EA8A 4X1RU 2AEIH 1W7XH 2BD5A 1N1LA 6ESTA 1AB9C 1O30A 1XVOA 1O33A 1CBWC 4I8LA 4KP0A 1BITA 1AFQC 3A82A 2A0QB 3ZZ6A 3SUGA 5A8XA 1GHBG 2AMPA 4ISIH 4ISNA 4JCNA 1MKXH 3DFLA 1QA7A 3TPIZ 1HAGE 3QN7A 4Y6DA 1V2LT 1NM6A 2XC5A 2AGGX 2UUKB 2Y5FA 4FUIA 3IWMA 5GCHG 3Q00A 1P09A 2ZG0H 2GTBA 1BA8B 1WTHD 5EXNA 1BHXF 5IYTA 1ELAA 1RXPA 1GCDA 3JZ1B 3UWJH 1V2QT 2VH6A 4TPYA 2STAE 1QB6A 3EE0B 3SQEE 1CSOE 3F9FA 2VIVA 2ZFSA 4DIIH 2GKVE 4A7IB 4H4FA 1MU8B 1O2SA 4NIVA 1GI3A 4WMDA 1V2UT 1GWAA 3C27B 3T25A 2W26A 3BF6H 5EXLA 2PUQH 4K1TA 1SGFA 1HAVB 2CF9H 1FJSA 4H42U 3QTVH 4XFQA 1AQ7A 3BTME 3HATH 3VB7A 4IN1A 2BZAA 3T28A 1GBAA 3BTDE 3RXEA 2PUXB 4ISOA 1W13U 1EPTA 1E0FD 5DK1A 4U30A 5EXMA 3MH4A 1FPCH 2XW9A 2FYQA 1QBOA 1LCYA 1FUJA 4X8TH 5DG6A 2FTMA 4RKOB 4FVDA 3QTOH 4QT8C 1E34B 3A7TA 2GZ9A 2PSYA 1ESTA 4GUXA 1AWFH 1YCPM 4LOYH 5DP9A 1VGCC 1SGFG 1T4VH 4IBLH 1VR1H 3ZZDA 2ZU1A 3MO6A 1GMCG 2C8YB 1GJ5H 4X6NA 5JPMH 3SU0A 1TE0A 2VIOA 1P2KA 2BY8X 4JK6A 1GGDC 3KNXA 1FAXA 2BTCE 5C5NA 1QFKH 3SJIA 1ZSLA 2PTCE 1ELCA 2R2MB 1ZPCA 2ZHWH 1P0SH 3PM3A 1DM4B 2ODYB 3VGCC 2NU0E 1PPBH 1C5WB 1RGQA 4D9RA 1O2MA 4D8NA 1GHBF 1EP6A 1C2KA 1JMOH 2EA3A 1QURH 1C1QA 3MNBA 1ELGA 1GPZA 1BTZA 4A5TS 1LVOA 1GJDB 5EPNA 1QB1A 3PO1C 3SHAH 1OP2A 1V2PT 1TX8A 2V3OH 1MTNC 1JXPA 2PR3A 2QYIA 1GCTB 1GI5A 1S85A 1CT2E 2Y81A 1S0RA 1GJBB 2VINA 1HYLA 1RD3B 1TONA 3LH3A 4DY7B 1SR5C 1WQVH 3H7TA 1W14U 2BDAA 1BTUA 2XXLA 1HPGA 1O2TA 1AE5A 3ZZ4A 4K3JA 1FZZA 2A4GA 2VIQA 3O8CA 3TJOA 4NCYA 2A4RA 2J34A 3SNAA 1C9TA 3GOVB 1P8VC 1ESBA 1TGNA 3SJKA 3FFGA 4Y8XA 1UTLM 1LHFH 3P6ZB 3RXLA 1MD8A 3PMHB 1DUAA 4FUEA 1C1RA 1UTOA 4B75A 2ZDAH 1TPOA 1D3TB 1SGNE 1O3JA 3TGKE 3TLOA 1MU6B 2OP9A 2ZFFH 2Z3EA 7GCHF 1PYTD 1SB1H 5DP8A 3ODFA 2A32A 3EA7A 1A61H 2WUBA 1SGYE 4D7FA 1A5IA 1EAWA 2R2WU 4E05H 2BDIA 4OGYA 1ZRBA 2VVCA 5DPAA 1DPOA 3SN8A 2P59A 3R3GB 5T6DA 1O3BA 2F91A 2IPHA 4MTBA 1EJMA 3U1JB 1ELDE 1HAIH 3M7QA 3SORA 2BD7A 2ZTXA 1Z6JH 4DW2U 1V2VT 4ZHMU 4SGAE 3KN2A 1GHXH 1P2JA 3LU9B 2LNCA 3SV2H 2AIPA 2WPKS 1DE7H 4MNYA 1XUHA 5EU8A 3MH6A 3P17H 4UFGH 1TGCA 2JH0D 2XRCA 1WUNH 4Y7BA 1OXGA 1O34A 2P94A 1GI2A 1QCPA 1B7XB 4B2CA 1SLWB 1AMHA 2Q6DA 1CHOF 3PLPA 1H1BA 1JIRA 5C1XA 1XUGA 4GCHG 1EUFA 3ATWA 2CN0H 2QY0B 3E3TA 4IC6A 3PLBA 4CREA 5GXPA 4IW4E 5GCHF 5E0JA 4Q7XA 1LVYA 1OWKA 1QJ7B 1C4U2 2OC7A 3KGPA 1ANEA 1GL0E 4R8TB 3SV8A 2ESTE 1BTHH 4INKA 3Q3YA 1WU1A 1SQAA 1O3OA 1CVWH 2XCFA 3PTBA 1OWDA 1PPZA 2SNVA 3EAJA 3R0FA 3SJ9A 1L0ZA 1NRNH 3QK1A 1C2DA 3A8BA 1ZTLA 2VH0A 1L1JA 1SQTA 1AU8A 1HJ9A 4X6MA 1P12E 1DITH 1EAIA 4TWYA 2Y82A 2A7HA 2F9NA 1O2ZA 2UUFB 3S69A 1VITF 1CBWB 2A4QA 2R3UA 1MQ6A 3ATIA 4AN7A 2BOHB 2ANWA 1FONA 2OBOA 5CE1A 2J92A 2IJOB 1X7AC 1YKTA 1NRPH 1UCYK 1A0HB 4WH8A 1D3DB 2ZQ2A 3LH1A 3PLKA 3O8DA 2ZTZA 2Q6FA 1SLXB 2BDHA 2ZHEH 4ZKSU 1LHEH 1PFXC 1P06A 3A7ZA 1BTYA 1DT2A 3E90B 1T31A 2D2DA 1DY8A 3I78A 1Q2WA 5C3NA 2HWLB 3E6PH 9LPRA 3UY9A 2H2ZA 2VIPA 1YPHE 2ALVA 1ZGVA 2D26C 1NFUA 1PPEE 3P92A 2NU2E 1AKSB 1QRWA 1DLEA 1F92A 4BXSA 2QF0A 3P8NA 4AB8A 1GMDF 2FI3E 1J9CH 1DFPA 3MU0A 1ANDA 4XBCA 3HK3B 3A87A 4MNWA 1YCPK 3UNQA 1INCA 3QLPH 2RCEA 4YLUA 2BVSH 3MTYA 3LIWA 1SC8U 3VB3A 2C93B 2VWMA 2BDBA 2DE9A 1K2I1 4AGKA 1NPMA 2PHBA 4KTCA 1L4DA 3LDXH 1Y8TA 3UNSA 4GCHF 2D8WA 5DP4A 1MKWK 2QN5T 3QDZB 3P70B 3TIUA 1O3AA 3KQDA 3LJOA 4AOQA 1UJ1A 1XMNB 1VITH 5C1YA 1OWJA 1GG6B 3M3SA 5EW2H 3RXAA 1QR3E 5DJ7A 1UVOA 1SGRE 1C1MA 1LPZB 1B5GH 2O8MA 1AO5A 4XBBA 5C1UA 1OYQA 4XSKU 2BD4A 4MLFB 5L6NH 1O37A 3RXUA 3D65E 1BMAA 1KXAA 4WMEA 2Z9IA 4TY7A 3ZV8A 5A09A 3KEEA 1WOFA 5A8ZA 1ELBA 2O8UA 3LGYA 3LC5A 2K7XA 4YLQH 2TIOA 3ESTA 2VIWA 3GY5A 2Z9LA 2ANMH 3PMAB 3BTQE 3QGNB 4FU9A 4A1XA 3S9BA 1CGJE 1H8IH 2GX4A 3TH3H 1EOJA 3GDVA 3FP6E 3RC6A 2QXIA 4I8GA 3A7WA 4I33A 3MNSA 1KYNA 1F0TA 3M5LA 2H6MA 5B6OA 2ZTYA 4CRGA 1VITG 1CA0B 1ARBA 2OBQA 3I77A 3MU8A 5AFYH 2Z9GA 3BTKE 3RP2A 2ZA5A 2EI8A 1TMUH 1DSUA 2ZFQH 4WXVA 1XVMA 1HIAA 1O3KA 5C5OA 1DWCH 1P03A 1MTSA 1EJNA 1SI5H 1O2IA 5JBTA 5DP5A 1UCYE 1O31A 5K0HA 1UO6A 1EB2A 1AIXH 4HFPB 2Z7FE 3OY6U 2J38A 2B9LA 3V3MA 1LHCH 1O5DH 2FXRA 1VCQA 4JZ1A 4YM9A 5F8TA 3SV9A 1C5MD 2HALA 2PW8H 4FVBA 1GVLA 4NFFA 2PKAB 3VB5A 1TGSZ 1WCZA 4GVUA 5EG4A 4UONA 4UD9H 2GP9B 1YCPH 1LPKB 1WSSH 5L30H 4CRCA 3TNTA 2I6QA 4GHQA 1NS3A 2H1UA 1E38B 4U2WA 4X6OA 3TK6A 2G00A 1EKBB 3KQEA 3FZZA 4DVAU 1UHBA 1HGTH 2P3TB 3SNEA 1TIOA 3T27A 4TWWA 1GJCB 1O32A 8ESTE 1GBKA 5FCKA 3FP8E 1O2NA 1RJXB 3ZZ7A 4MQAA 1ZSJA 2WINI 2WPJS 3SUDA 3NUMA 4DCDA 1P11E 2O9QA 1WV7H 1Q3XA 1C5NH 2ZCHP 4GPGA 4ASHA 4JZIA 1NN6A 1NC6A 1N8OB 3UPEA 2OTVA 3ZVBA 1TNHA 5ABWA 1XKAC 1DWEH 1SMFE 1DX5M 1OWIA 1SVPA 3ZZCA 1AVGH 1C5UA 4KTSA 1Z1IA 3E1XB 3TK5A 4WF8A 2B5TB 4UFDH 3UOUA 1K1IA 4M7GA 1VJ9U 1A2CH 4MPXA 1HV7A 5DP3A 1BRUP 3HPTB 1NFXA 1YC0A 1BBRE 1C1PA 1SGQE 2ZGXH 4LXBH 2XWAA 3BG4C 1O2XA 1QTFA 2H9HA 2Q6GA 5J4SA 2CV3A 1HUTH 3F9GA 3MO9A 4GHTA 1Y3XA 1SGCA 4FU7A 1DXWA 1SLVB 1EQ9A 1UHBB 3BEFB 1H8DH 1IQLA 5DKMA 1DXPA 1GI0A 2ZNKH 4AORA 1ANCA 1V2NT 3RDZA 1LO6A 2GT7A 4AYYB 1G30B 3ZVAA 1ZMLA 1BB0B 1AN1E 1FLEE 3GY8A 3OU0A 2AS9A 1GBEA 3ZVGA 2VVVA 1AWHB 1GJ9B 3VB6A 5GWZA 2ZHDA 1C2EA 1ESAA 1TQ7B 2OC0A 3L3TA 1TYNA 2ANYA 2F9PA 2LPRA 5BPEA 5TCAA 4X0WU 2HPPH 3RMMH 1UVUH 4YT6H 1ZPZA 1LMWB 2R0KA 3ATLA 1IQIA 1YPMH 1ELTA 3RXJA 1YLCA 3NCLA 3QWCH 2JKHA 1V2KT 2OQUA 2FI5E 2VU8E 3NPSA 3LC3A 1P05A 4ZROA 4H6SB 2OC8A 3D23A 1P2NA 4Y8YA 2WPLS 1A0JA 1O2QA 1HJAC 2A5KA 1P2QA 4NWLA 1TBZH 1TGTA 2CHAB 1MTUA 4J2YB 2EEKA 2BD2A 2VB0A 2WV5A 2WPIS 1BQYA 2FZZA 2J95A 4RKJB 5F03A 1C1OA 5PTPA 1TBQH 1HB0B 1IQJA 3GCHC 3BN9A 4KTUA 2GMTB 3BIUH 3K65B 3SO3A 1TWXB 3DD2H 3RC4A 4K8YA 4BAMB 1A5GH 1P2IA 3VB4A 1MAXA 3TJNA 4Y10E 2QA9E 1PPHE 3MU5A 2JH6D 2ZPRA 1S5SA 6GCHF 4X8VH 3MFJA 1FI8A 4H6TA 2RA3A 3RMNH 4Y0ZE 4IMQA 4ZKNU 1F2SE 3SU5A 3SUFA 3A80A 4Q80A 1OP8A 2AIQA 3S9AA 2QAAA 3KIDU 3BTFE 4AFSA 5JB8S 2A5AA 3RXBA 2ODPA 3ZZ9A 4ABJA 2XNIA 1AVXA 1CU1A 1HAYB 2W3IA 4ABEA 2W7UA 1A3BH 4NA9H 2SGAA 4ABBA 1LHDH 2FOMB 3OTJE 3M61U 1Z1JA 1EPTC 7GCHG 1DDJA 2D1JA 1RS0A 4ZXYH 1T8OA 3QGJA 2ZDMA 3SNBA 1KXCA 2TGTA 1AI8H 2GVFA 1Y3WA 1O2JA 2QXJA 3P8OA 3EQ0H 3GYLB 1YM0A 1PQ5A 1Z6EA 3PMJA 1ABIH 3STIA 2VGCC 2ALPA 3PV4A 3NWUA 1EJAA 2ZP0H 1RTKA 5A0BA 3URCA 1VZQH 1HCGA 2NU3E 2PSXA 2R9PA 3SNCA 1H9LB 1M9UA 2NU4E 1W3CA 4K1SA 1O3MA 2QXHA 2G5NA 1C1VH 1O3HA 4OS2A 1DUEA 2NWNA 4K8BA 1TRMA 4O03A 3S7HB 1KTSB 3FVFB 3ZVCA 1HBTH 3LPRA 2CMYA 2BYAX 3HKJB 3SU6A 3E91A 2ZDNA 3HKIB 1RIWC 1QRZA 1ZJDA 1ZHPA 1GHAG 4OS6A 1Y5BT 2HOBA 5C20A 3RLYH 1J15A 5CMXH 2ZFTA 2BY5X 3M35A 1SFQB 3SUEA 1LDTT 2ZGCA 1BZXE 2FM2A 2FDAA 3B23B 3M7UA 1Z71A 1BJUA 3GCNA 1AUJA 2BVXH 5T6FA 1THPB 3H7OA 1Y59T 3M7TA 3VEQB 2BM2A 2FWWA 1K9OE 3M5NA 2ANKH 3MNXA 1P3CA 1D3PB 2BY6X 1OWEA 2PTNA 5EODA 1QL7A 2ZI2H 5TCCA 2A31A 2BLQA 2GV6A 3NXPA 4CHAB 1GDQA 1XXDA 2BOKA 4XBDA 1FQ3A 2UUJB 3RXKA 4BANB 3B8JA 4WXIA 4YOIA 2AGIX 1O39A 1KDQA 2ZFRH 1JRSA 3L33A 1GHVH 5JDUB 2A2QH 1GMHG 5BRRE 3PMBB 3LGVA 1LVBA 5HXFA 1FNIA 1CQQA 1C5SA 3ELAH 1ZMNA 2G52A 2STBE 1IQMA 1CA8B 4IMZA 4CRFA 1FY3A 2ZPSA 3U8OH 1G37A 3HK6B 3SV7A 4J1YA 4Z6AH 2QXGA 3KCGH 4DIHH 5E0HA 1XX9A 1GBDA 5A8YA 5HM2A 4MPUA 1AFEH 2ZZUH 2ZGJA 2GDEH 1OPHB 2ZIQH 1ELVA 4MDSA 1ZHMA 1YPHC 1NRRH 2EI6A 2P3FH 5C2ZA 2UWLA 1PQ7A 4X8SH 1XUIA 3K9XB 4MVNA 4NSVA 1RFNA 1EZUC 4NIWA 3SU3A 1T8MA 8GCHF 5LPEA 2TGDA 4DG4A 1O5CB 4OS5A 1SHHB 1CO7E 4AB9A 2FEQH 3A81A 3TVJB 4Y7AA 2P16A 1A5HA 4FUCA 1VJAU 4CR5A 1VGCB 1TABE 2PGBB 1LKBA 4K1EA 1NESE 3DT0H 3BSQA 2XC4A 3SJOA 1MUEB 1SGIB 1FN8A 2ZQ1A 1BCUH 1UTNA 3AASA 3UQVA 1IQKA 3Q76A 4NSYA 2ZPQA 3KF2A 3URDA 1MD7A 1EATA 1XUKA 5FAHA 1OX1A 1N6XA 1TLDA 2ZHFH 4ABHA 3SZNA 1UTQA 1IQEA 1UVTH 1BMNH 1TPSA 3BTGE 1GI7B 4Y0YE 3TITA 4KGAA 4VGCC 2BXTH 1J14A 4JYUH 1A4WH 2RA0A 3LGIA 1GHZA 1SOZA 5HMAA 2QV1A 1JOUB 5DP7A 2Z3DA 1MMJN 3Q3KA 2OD3B 1H4WA 4MPVA 1XXFA 4TYDA 3RU4D 4WY3A 4Z0KA 4K60A 1A46H 1LQDB 1ZJKA 5LPRA 2GGVB 5A2MH 3AW1A 2BDYA 4B2AA 3PO1B 1ELFA 4AZ2B 2FESH 1MBQA 1GI6A 4X2VA 4ABAA 1C4V2 3MOCA 1Z7KA 1C5TA 4I8JA 4NZLA 3BTTE 1ZRKA 3UNRA 1O5BB 2WPHS 1NT1A 1O2KA 2PWXA 1NY22 1O3DA 4IGDA 3VFEA 1E36B 2AMDA 4IC5A 2PKAA 7LPRA 5HM9A 1KXDA 2QIQA 1E35B 1AHTH 1H9IE 1K22H 4UFFH 1S83A 4CBOA 1C4Y2 2AFQB 2CXVA 3AW0A 3B9FH 1C5XB 4E7NA 1W2KH 1G32B 3AAVA 1O2OA 2GZ7A 1SFIA 4KKDA 4NWKA 5LPFA 1YYY1 3RXGA 4ZHLU 8GCHG 1KLJH 3RXFA 1QNJA 4I8HA 1P9UA 4TY6A 1T8NA 1V2ST 4JMYA 2J4IA 1O3LA 1BRBE 2WPMS 1GBFA 5AHGH 1ZOMA 5A0AE 1SOTA 2HGTH 3SU1A 1ZR0A 2P3UB 1UMAH 1HJ8A 2VNTA 2ZU3A 4ABGA 2ZHQH 3CENA 1O2RA 5IDKA 2BB4A 1LQEA 1GVKB 1T4UH 1A7SA 3BEUA 1OS8A 3GCTF 1O2HA 4CH8B 2ASUB 1XM1A 3BIVH 3M5OA 3MWIU 1RTLA 3A7XA 4ZUHA 2AYWA 2ZDLA 1J17T 3RMLH 4X2WA 1RTFB 4X1QU 1ETSH 2FX4A 4LZ4B 1ETTH 1E37B 5TJXA 2XCNA 1YPJH 2BD8A 2Y7XA 1W10U 1FN6A 4U32A 3UIRA 4X2XA 1OP0A 2SFAA 1W12U 2BLWA 2BMGB 1UCYH 3PYHA 1EASA 3L6PA 1DANH 1YBWA 3AVZA 4YTAA 1L1GA 1HAXB 2W3KA 1PPFE 2GDDA 3RM0H 1Y3UA 3ATKA 3RUOA 4TPIZ 1MTNB 3U98H 4ZHAA 1LKAA 1FIWA 1S81A 1UTPA 4ZMAH 1C5YB 3SGBE 1IQGA 2G4TA 2VIDA 3Q77A 5F8ZA 3UFAA 1KXEA 1YPEH 1GI4A 1TMTH 1MTVA 1N8OC 2SGDE 2BX4A 3QX5H 5DP6A 3U8RH 2PGQB 1HLTH 3TH2H 1LVMA 1AUTC 4DJZB 2P8OC 4X8UH 2HNTF 3EDXB 2ZDVH 1D9IA 3OX7U 1DICA 3GY3A 4FU8A 4Y8ZA 1KSNA 4WMFA 3C1KA 4JK5A 3V12A 2A45B 1G3DA 3E0NB 5EPYA 1THSH 5FHTA 4E06H 5FPTA 2FIRH 2B7DH 1GG6C 5FBIA 3DUXH 4K5ZA 4KELA 1EOLA 4VGCB 1YPGH 4DURA 1BRCE 4MNXA 3A8DA 2OQ5A 4CHAC 4B71A 4Y76A 1U6QA 1O3CA 2OINA 3IITA 3K2UA 4HTCH 1TNKA 3E0PB 3LGTA 1ZZZA 1ZTJA 3LT3A 2ZU4A 1QQUA 3GCTG 4CBNA 1Z8JB 1YGCH 1ZSKA 1C1NA 2BD9A 1K21H 1W0YH 2K1QA 1ZLRA 3K6ZA 3RXIA 1YLDA 2THFB 4RSPA 1HFDA 1F5RA 1TX7A 1ETRH 5ESBA 1DSTA 2AGEX 2QGRA 5AFZH 3ZYEA 5E0GA 1OSSA 5F6MA 1FV9A 4ZKRU 2B8OH 2XC0A 2UUYA 2H9EH 1QL8A 2R3YA 3EGKH 3GCHB 5DO4H 1HRTH 4WVPE 1XUJA 3RM2H
chains in the Genus database with same CATH superfamily
2RDLA 3UWIA 1K1LA 5FX5A 3SQHE 4LZ1H 1GI1A 2BXUH 3A7YA 3S0NA 3M36A 1QBNA 2CHAC 3QO6A 3PROA 4WH6A 1PYTC 1PPCE 1WBGB 4HI3A 3SHCH 1D4PB 2M5TA 4ZXXH 3MU1A 1NROH 2O8LA 1GBJA 2F9UA 3ZZAA 4CR9A 2WUCA 1KLTA 4NIXA 2ZU5A 3OFND 3LKWA 3TJUA 1JWTA 1DWDH 4A6LA 4BAKB 2OLGA 1F0UA 4B74A 3QUMP 2C8XB 2HVXA 5E8EH 1C1UH 2ODQA 2DUCA 1EPTB 5ETXA 5LH8A 1VCPA 1QZ8A 2TGAA 1CT4E 2C4FH 3KYGA 2SNWA 2ZO3H 1O2UA 2UWPA 4JZDH 4K69A 3NKKA 3RXQA 3ZVFA 2FYRA 1UTKA 4LK4A 4TSFD 1LTOA 5FPSA 3RXVA 1P10A 4GLYA 1CHGA 4I8KA 8LPRA 1MZDA 2XTTB 3KL6A 2KX4A 1A0LA 1KXBA 2GCHG 1UK4A 3CP7A 3VXFH 1GVZA 1S6FA 2G5VA 1ID5H 4ZAEA 1PQAA 4O97A 5T6GA 1CGHA 1NRQH 6CHAC 4A1VA 1V2TT 3UTUH 1IOEA 2WPDD 1AVWA 1C5VA 5E2PA 4XDEA 1EX3A 2FOEA 2WYGA 1ZTKA 4X1SU 1A1RA 2O8TA 2Z9KA 2BDCA 1IQHA 2A2XH 3GYMA 2KR7A 3OYPA 2KAIA 3TGIE 3OY5U 4D76A 1AFQB 2BD3A 3SGAE 3FANA 1DWBH 2AH4X 1C9PA 5SGAE 3GISB 3GY7A 5GNDA 1QIXB 1QB9A 1XUFA 1B0EA 2F3CE 5GIBA 3N99A 3T2NA 4O3TA 1F7ZA 1S0QA 3H5CB 4AYVB 1JBUH 1KDQB 1MH0A 5FCRA 2SGEE 2QC2A 1ELEE 2IPQX 1YP9A 4NA7A 1HDTH 2GJGA 5EQSA 1QQ4A 2G81E 1N6YA 1UTJA 2BVRH 2G51A 1O5AB 4BTUB 3FO8D 2ZC9H 1FX0B 2P8OB 5JBBS 1C2LA 1SPJA 1Z8IB 2BDGA 1TPPA 4K2YA 4I31A 4A1TA 1GBHA 3RXHA 3VPKA 4THNH 5J4QA 1Y5UT 2L6OA 1SGEE 4INHA 1PJPA 1ZYOA 3A84A 4B2BA 2WYJA 1V6DA 2ZEBA 2VWOA 3ATMA 5CHAB 3O8RA 5C94A 2KCYA 1V2MT 3A89A 3UUZA 1O35A 2ZECA 1GBCA 4ABIA 5EGMA 2V35A 1C2HA 3RXDA 1NZQH 1EZXC 1BRAA 1TX6A 1W0ZU 3MO3A 3UB0A 2LELA 4AFUA 4BAOB 2XBVA 2A7CA 2UWOA 2VWNA 1ACBE 1G3EA 1UTMA 5AF9H 5GPIB 1NFYA 9ESTA 2H5CA 3STJA 4OM9A 1GHAF 1TQ0B 1MAYA 2EC9H 1SGPE 3UQOA 1CA0C 4UEHH 1QY6A 1AZ8A 2FS8A 5C67A 3TGJE 1L4ZA 2BY9X 3MHWU 5EQRA 1KY9A 2JIZD 1FY8E 3NZIA 1GCTC 5HGGA 4OS1A 2VWLA 3DHKH 1MTWA 2FO9A 2FODA 1BIOA 2TGPZ 7ESTE 1MCTA 4NFEA 1P3EA 1TA2A 2XYAA 3MQKC 4DOQA 4PROA 1GI8B 3RU4E 4BNRA 4B76A 2C3SA 1GJ7B 3KQCA 1ABJH 1EZSC 4P02A 3UR9A 1TNJA 4AFZA 2JETB 4XOJA 2ZCLP 3MH7A 1MQ5A 2W7SA 5KECA 1DS2E 1GJAB 4Q7YA 3VGCB 1HAOH 2SGQE 1P57B 3SGQE 1BT7A 1BDAA 3GY6A 4NIYA 2Y80A 2JH5D 1O38A 2WZQA 3TH4H 1ANBA 1SHYA 4UFEH 2Y6TA 1ZPBA 3ZVEA 4BAHB 5EJ1A 3BTWE 1TNLA 4GSOA 4X6PA 2OCVB 3BTEE 2HPQH 1TOMH 3OSYA 1G3CA 1H9HE 2XBYA 1L1NA 1BUIA 2GCTB 3N7OA 1D6RA 1BMFD 3GCOA 4INLA 4F48B 1GHWH 4UE7H 2Y5GA 1NBMD 3LOXA 4ISHH 5CHAC 1FY5A 1S84A 1T8LA 1QRXA 4YOGA 1TMBH 1Y3YA 3NK8A 3V13A 3DCLA 1WDIA 2A1DB 4YOJA 2HNTE 2FPZA 4R0IA 1FMGA 4WJG2 2FOBA 2JETC 3P8GA 2G55A 3KQ5A 2EQNA 3AAUA 1NO9H 3D62A 2J94A 1HNEE 5L2YH 2VJ1A 6LPRA 2PV9B 5C0TA 1COWD 2ZFPH 3KQBA 1AY6H 3LONA 1UVSH 4OS4A 3SOSA 1IHSH 3SI3H 2BLVA 1BTXA 2XBXA 6CHAB 1MZAA 1F0RA 4DGJA 1JRTA 2H5DA 1NRSH 3DFJA 1S6HA 3MI4A 4A92A 1GBTA 5DGJA 3OEHD 3LGWA 3S7KB 1OKXA 1C1SA 3LGUA 1S82A 4MPWA 1QJ1B 3JZ2B 2M2AA 2VVUA 2QF5A 3EE7A 5AVDA 3RLWH 1C2JA 1QGFA 1O2LA 5FL7D 1GJ8B 3GY4A 5I46H 1G2LA 1W11U 1TNIA 1C2FA 1KIGH 4BOHA 1QBVH 4F49A 3BTHE 3RXCA 1FXYA 2QF3A 2PFEA 1Z8RA 1HXEH 4E7RG 1P02A 3A7VA 4FUHA 4Q7ZA 1FY1A 2P95A 4FUJA 2GMTC 4XE4A 3GS9A 3QZRA 4RN6A 4JZEH 2G8TA 1BMLA 2ZGBH 3W94A 3TK9A 1C5RA 2XNDD 1TBRH 1RIWB 3F6UH 3ODDA 4CRAA 3FZDA 3U69H 7KMEH 1K28D 1SSXA 3G01A 2CJIA 2P93A 4SGBE 1EAXA 2FOCA 1Z8GA 1C5LH 2BLOA 3TNSA 4HZHA 2OC1A 1NTPA 1TB6H 3SU2A 1GDUA 1RRKA 4TT3D 1UK3A 1NFWA 5F8XA 2WV4A 3MNCA 4UDWH 2XBWA 4NA8A 5C0UA 3F68H 1BHXB 2FMJA 4MG3A 1VCWA 3OEED 1FDPA 3MU4A 4OGXA 3UOPA 1Y5AT 1HAPH 4BXWA 1P9SA 1K1PA 4ZKOU 3F2GA 1MKWH 1O2YA 2CGAA 2OXSA 4NGAH 4O9VA 5HYOA 1HAVA 2BHGA 1SBWA 2FTLE 1L2EA 3EBNA 5K7RA 2GZ8A 1OHHD 1HAHH 3EA9A 1TA6A 4FUBA 4ZH8A 5G4BA 1D3QB 1G9IE 1EZQA 1G3BA 2QF4A 2HNTC 3GDUA 1D6WA 3U1IB 1SLUB 4XD7D 1QHRB 1UK2A 2BZ6H 2FOGA 3RXTA 2Y5HA 1BMMH 1IQFA 3TU7H 3F9EA 2V0BA 5A0CA 1G36A 3D49H 3E16B 1IHTH 4YESB 5JBCS 5CDFE 2TRMA 4MNVA 5JYIA 3ZVDA 3SI4H 3T5FH 1O3EA 2R0LA 4F4OC 1LHGH 2I6SA 1V2RT 2IN2A 1Y3VA 1K1OA 1GL1A 1BBRH 4HGCA 4Y11E 1O3NA 1ZHRA 1HAZB 4JYTA 2BQ6B 2F83A 1GBIA 1EXFA 1NU9A 1CE5A 1GI9B 1GBMA 1IAUA 2GD4B 5I25A 4ABFA 2BQ7B 1THRH 1J16A 1GBLA 1P04A 4IS5A 3W1EA 1AGJA 1O2GH 1TAWA 4X2YA 6GCHG 1QA0A 1C5PA 3RXSA 1AKSA 4YZUA 3TJVA 5FBEA 2F9VA 1XKBC 1AE8H 1GGDB 5GDSH 2ULLA 5E2OA 1HJAB 2C90B 4CRDA 3M3TA 1C2MA 3A8AA 3MYWA 3UR6A 3F9HA 3M3VA 1YLNA 3MH5A 5JBAS 2SGPE 1CGIE 3DA9B 2GCTC 4X1NU 1UVPA 2FOAA 1PQ8A 2LP6A 2ZWLH 4U01A 1C5OH 3QZQA 1SQOA 3LJJA 4CH2B 3F2FA 1V2JT 2Q1JA 4I7YH 1A3EH 2J98B 2XWBI 3E8LA 1F5KU 3SBKA 5JB9S 1HXFH 1GJ6A 3A83A 1DOJA 3HGNA 2PKSB 3F0PA 1GMDG 4Q2KA 2A7JA 3HGPA 5EW1H 3K6YA 1O2PA 2B0FA 1TFXA 3F1SB 3T29A 3BEIB 2ILNA 1WQSA 1SL3A 3RC5A 1YPLH 1F5LA 1SGTA 1CHOG 1C2GA 2FLRH 4GAWA 4AGJA 3ZYDA 1EP5A 3ITIA 2FI4E 3PRDA 1ARCA 3GICB 3PTNA 1FAKH 3SW2B 1F0SA 2NU1E 1O3IA 1KTTB 1Q31A 5FXLA 2H9TH 2HLCA 3BG4B 4YT7H 1YWUA 1O3PB 4NZQA 3FP7E 3VXEH 1B0FA 1HIAB 2Z9JA 1V2WT 4D9QA 1WAYB 3SU4A 5LGOA 2GV7A 4Z1MD 3RU4T 3EYDA 2F4LA 1V3XA 4BAQB 1V2OT 2ZGHA 4FUDA 2K0QA 3GDSA 1K1MA 3M5MA 2YNAA 3A8CA 3DSOA 4ESTE 3KHVA 1W8BH 1PPGE 4BTIB 4FXGH 1ORFA 4AX9H 2QCYA 2HRVA 3ZZBA 3RMOH 2WV9A 2BX3A 2YNBA 1DVAH 5T3HA 4AFQA 3MMGA 1TALA 3ZZ5A 3W95A 2J2UA 2V3HH 4ISLA 3BV9B 3FAOA 2A5IA 1K1JA 2ZU2A 1GHYH 1TPAE 5EOKA 2EI7A 2TBSA 2A4OA 3ENSB 2SGFE 4IN2A 1C1TA 4X1PU 8KME2 2F9OA 4Y79A 1W7GH 1BBRK 2Z6BD 1TOCB 2O8WA 3SJ8A 2YMSD 2ZCKP 1BOQA 4JYVH 2FOHA 3PB1E 2PKSC 1FIZA 1EB1H 5H4IB 2LIZA 2FP7B 3P95A 1C5QA 4DT7B 2ZDKA 1BTPA 1O3FA 3RXRA 1O2VA 2IOTA 3M37A 1JIMA 3V7TA 3RXMA 2AERH 2Z94A 3SNDA 1P2OA 1GMHF 1SGDE 4NG9H 3PWBA 1DY9A 2HVYB 3WY8A 4BTTB 3T26A 1CT0E 1K1NA 1MKXK 2RG3A 3SV6A 1MCVA 1GDNA 1IQNA 1WYKA 2J9NA 3DSGA 2FOFA 3U8TH 5HKKD 3P8FA 1T7CA 5EQQA 1GMCF 1P2MA 4O3UA 2ZF0H 2ZKSA 4FUGA 1O3GA 5KEDA 2AMQA 2W5EA 5C17A 4B73A 5L2ZH 1T32A 2FLBH 1TGBA 2W6JD 3ZZ8A 2FX6A 1KXFA 2YOLA 4FUFA 1YPKH 3BG8A 4Q63A 1O36A 1MBMA 4JZFH 5CHBA 5FPYA 2C8ZB 1ZGIA 1O2WA 1BJVA 1O5EH 3RXPA 2OUAA 3PWCA 2F9BH 1TRNA 3U9AH 1C1WH 1GBBA 4AG1A 4CRBA 2G4UA 1O0DH 1YF4A 3A85A 5ESTE 3IG6B 2BQWB 1FY4A 3A88A 4WWYA 3GY2A 1KLIH 4OS7A 1FPHH 1BTWA 2VGCB 1OOKB 1J8AA 3RXOA 3A86A 3UREA 3ZZ3A 5GJ4B 2CF8H 2KAIB 1WTGH 1EAUA 1SG8B 1G2MA 1P01A 2FS9A 1TRYA 2GCHF 4AG2A 4ACAA 4YO9A 3F2HA 1AD8H 3Q3XA 4Y71A 5FX6A 3O8BA 2PLXA 4I32A 3CS0A 2C8WB 2Y7ZA 2GT8A 1C2IA 3T62A 1AZZA 4D7GA 1OWHA 2TPIZ 3I29A 2V6NA 3ZV9A 4B1TA 2BY7X 1AB9B 1OYTH 1QJ6B 1QL9A 4ABDA 3V0XA 1DLKB 1GJ4H 2Z3CA 3CS7A 1O5FH 1O5GH 2DE8A 1TNGA 3S9CA 1C5ZB 1ZMJA 1NU7B 1LPGB 3EA8A 4X1RU 2AEIH 1W7XH 2BD5A 1N1LA 6ESTA 1H8HD 1NBME 2JDID 1AB9C 2CK3D 1O30A 1E1RD 1XVOA 1O33A 1CBWC 4I8LA 4KP0A 1BITA 1AFQC 3A82A 2A0QB 3ZZ6A 3SUGA 5A8XA 1GHBG 2AMPA 4ISIH 4ISNA 4JCNA 1MABB 1MKXH 3DFLA 1QA7A 3TPIZ 1HAGE 3QN7A 4Y6DA 1V2LT 1NM6A 2XC5A 2AGGX 2UUKB 2Y5FA 4FUIA 3IWMA 5GCHG 3Q00A 1P09A 2ZG0H 2GTBA 1BA8B 1WTHD 5EXNA 1BHXF 5IYTA 1ELAA 1RXPA 1GCDA 3JZ1B 3UWJH 1V2QT 2VH6A 4TPYA 2STAE 1QB6A 3EE0B 3SQEE 1CSOE 3F9FA 2L74A 2VIVA 2ZFSA 4DIIH 2GKVE 4A7IB 4H4FA 1MU8B 1O2SA 4NIVA 2KZ4A 1GI3A 4WMDA 1V2UT 1GWAA 2KCOA 3C27B 3T25A 1EFRD 2W26A 3BF6H 5EXLA 2PUQH 4K1TA 1SGFA 1HAVB 2CF9H 1FJSA 4H42U 3QTVH 4XFQA 1AQ7A 3BTME 3HATH 3VB7A 4IN1A 2BZAA 3T28A 1GBAA 3BTDE 3RXEA 2PUXB 4ISOA 3NRLA 1W13U 1EPTA 1E0FD 5DK1A 4U30A 5EXMA 3MH4A 1FPCH 2XW9A 2FYQA 2V3MA 1QBOA 1LCYA 1FUJA 4X8TH 5DG6A 2FTMA 4RKOB 4FVDA 3QTOH 4QT8C 1E34B 3A7TA 2GZ9A 2PSYA 5DSFA 1ESTA 4GUXA 1AWFH 1YCPM 4LOYH 5DP9A 1VGCC 1SGFG 1T4VH 4IBLH 1VR1H 3ZZDA 2ZU1A 3MO6A 1GMCG 2C8YB 1GJ5H 4Q4LA 4X6NA 5JPMH 3SU0A 1TE0A 2VIOA 1P2KA 2BY8X 4JK6A 1GGDC 3KNXA 1FAXA 2BTCE 5C5NA 1QFKH 3SJIA 1ZSLA 2PTCE 1ELCA 2R2MB 1ZPCA 2ZHWH 1P0SH 3PM3A 1DM4B 2ODYB 3VGCC 4ZCNA 2NU0E 1PPBH 1C5WB 2AHME 1RGQA 4D9RA 1O2MA 4D8NA 2PP6A 1GHBF 1EP6A 1SQRA 1C2KA 1JMOH 2EA3A 1QURH 1C1QA 3MNBA 1ELGA 1GPZA 1BTZA 4A5TS 1LVOA 1GJDB 5EPNA 3WWFA 1QB1A 4AC9A 3PO1C 3SHAH 1OP2A 1V2PT 1TX8A 2V3OH 1MTNC 1JXPA 2PR3A 2QYIA 1GCTB 1GI5A 1S85A 1CT2E 2Y81A 1S0RA 1GJBB 2VINA 1HYLA 1RD3B 1TONA 3LH3A 4DY7B 1SR5C 1WQVH 1WXRA 3H7TA 1W14U 2F43B 2BDAA 1BTUA 2XXLA 1HPGA 1O2TA 1AE5A 3ZZ4A 4K3JA 1FZZA 2A4GA 2VIQA 3O8CA 3TJOA 4NCYA 2A4RA 2J34A 3SNAA 1C9TA 3GOVB 1P8VC 1ESBA 1TGNA 3SJKA 3FFGA 4Y8XA 1UTLM 1LHFH 3P6ZB 3KYFA 3RXLA 1MD8A 3PMHB 2JJ2D 1DUAA 4FUEA 1C1RA 1UTOA 4B75A 2ZDAH 1TPOA 1D3TB 1SGNE 1O3JA 3TGKE 3TLOA 1MU6B 2OP9A 2ZFFH 3N7DA 2Z3EA 7GCHF 3F0OA 1PYTD 1SB1H 5DP8A 3ODFA 2A32A 3EA7A 1A61H 2WUBA 1SGYE 4D7FA 1A5IA 1EAWA 2R2WU 4E05H 2BDIA 4OGYA 1ZRBA 2VVCA 5DPAA 3PV5A 1DPOA 3SN8A 2P59A 3R3GB 5T6DA 1O3BA 2F91A 2IPHA 4MTBA 5T1VA 1EJMA 3U1JB 1ELDE 1HAIH 3M7QA 3SORA 2BD7A 2ZTXA 1Z6JH 4DW2U 1V2VT 4ZHMU 4SGAE 3KN2A 1GHXH 1P2JA 3LU9B 2LNCA 3SV2H 2AIPA 4B6FA 2WPKS 1DE7H 4MNYA 1XUHA 5EU8A 3MH6A 3P17H 4UFGH 1TGCA 2JH0D 2XRCA 1WUNH 4Y7BA 1OXGA 1O34A 2P94A 1GI2A 1QCPA 4HG6A 1B7XB 4B2CA 1SLWB 1AMHA 2Q6DA 1CHOF 3PLPA 1H1BA 1JIRA 5C1XA 1XUGA 4GCHG 1EUFA 3ATWA 2CN0H 2QY0B 3E3TA 4IC6A 3PLBA 4CREA 5GXPA 4IW4E 5GCHF 5E0JA 4Q7XA 1LVYA 1OWKA 1QJ7B 1C4U2 2OC7A 3KGPA 1ANEA 1GL0E 4R8TB 3SV8A 2ESTE 1BTHH 4INKA 3Q3YA 1WU1A 1SQAA 2RFKC 1O3OA 1CVWH 2XCFA 3PTBA 1OWDA 1PPZA 2SNVA 3EAJA 3R0FA 3SJ9A 1L0ZA 1NRNH 3QK1A 1C2DA 3A8BA 1ZTLA 2VH0A 1L1JA 1SQTA 1AU8A 1HJ9A 4X6MA 1P12E 1DITH 1EAIA 4TWYA 2Y82A 2A7HA 2F9NA 1O2ZA 2IJD1 2UUFB 3PV2A 3S69A 1VITF 1CBWB 2A4QA 2R3UA 1MQ6A 3ATIA 4AN7A 2BOHB 2ANWA 1FONA 2OBOA 5CE1A 2J92A 2IJOB 1X7AC 1YKTA 1NRPH 1UCYK 4FOUC 1A0HB 4WH8A 1D3DB 5DN6D 2ZQ2A 3LH1A 3PLKA 3O8DA 2ZTZA 2Q6FA 1SLXB 2BDHA 2ZHEH 4ZKSU 1LHEH 1PFXC 1P06A 3A7ZA 1BTYA 1DT2A 3E90B 1T31A 2D2DA 1DY8A 3I78A 1Q2WA 5C3NA 2HWLB 3E6PH 9LPRA 3UY9A 2H2ZA 2VIPA 1YPHE 2KCAA 2ALVA 1ZGVA 2D26C 1NFUA 1PPEE 3P92A 2NU2E 1AKSB 1QRWA 1DLEA 1F92A 4BXSA 2QF0A 3P8NA 4AB8A 1GMDF 4F55A 2FI3E 1J9CH 1DFPA 1VKYA 3MU0A 1ANDA 4XBCA 3HK3B 3A87A 4MNWA 1YCPK 3UNQA 1INCA 3QLPH 2RCEA 4YLUA 2BVSH 3MTYA 3LIWA 1SC8U 3VB3A 2C93B 2VWMA 2BDBA 2DE9A 1K2I1 4AGKA 1NPMA 2PHBA 4KTCA 1L4DA 3SYJA 3LDXH 1Y8TA 3UNSA 4GCHF 2D8WA 5DP4A 1MKWK 2QN5T 3QDZB 3P70B 3TIUA 1O3AA 3KQDA 3LJOA 4AOQA 1UJ1A 4B6EA 1XMNB 1VITH 5C1YA 1OWJA 1GG6B 3M3SA 5EW2H 3RXAA 1QR3E 5DJ7A 1UVOA 1SGRE 1C1MA 1LPZB 2WSSD 1B5GH 2O8MA 1AO5A 4XBBA 5C1UA 1OYQA 4XSKU 2BD4A 3FKSD 4MLFB 5L6NH 1O37A 3RXUA 3D65E 1BMAA 1KXAA 4WMEA 2Z9IA 4TY7A 3ZV8A 5A09A 3KEEA 1WOFA 5A8ZA 1ELBA 2O8UA 3LGYA 3LC5A 2K7XA 4YLQH 3OE7D 2TIOA 3ESTA 2VIWA 3DSPA 3GY5A 2Z9LA 2ANMH 3PMAB 3BTQE 3QGNB 4FU9A 4A1XA 3S9BA 1CGJE 1H8IH 2GX4A 3TH3H 1EOJA 3GDVA 3FP6E 3RC6A 2QXIA 4I8GA 3A7WA 4I33A 3MNSA 1KYNA 1F0TA 3M5LA 2H6MA 5B6OA 2QE7D 2ZTYA 1VITG 4CRGA 1CA0B 1ARBA 2OBQA 3I77A 3MU8A 5AFYH 2Z9GA 3BTKE 3RP2A 2ZA5A 2EI8A 1TMUH 1DSUA 2ZFQH 4WXVA 1XVMA 1E79D 1HIAA 1O3KA 5C5OA 1DWCH 1P03A 1MTSA 1EJNA 1SI5H 1O2IA 5JBTA 5DP5A 1UCYE 1O31A 5K0HA 1UO6A 3OTPA 1EB2A 1AIXH 4HFPB 2Z7FE 3OY6U 2J38A 2B9LA 3V3MA 1LHCH 1O5DH 2FXRA 1VCQA 4JZ1A 3F3BA 4YM9A 5F8TA 2XOKD 1C5MD 3SV9A 2HALA 2PW8H 4FVBA 1GVLA 4NFFA 2PKAB 3PRBA 3VB5A 1TGSZ 1WCZA 4GVUA 5EG4A 4UONA 4UD9H 2GP9B 1YCPH 1LPKB 1WSSH 5L30H 4CRCA 3TNTA 5EIYA 2I6QA 4GHQA 1NS3A 2H1UA 1E38B 4U2WA 4X6OA 3TK6A 2G00A 1H8ED 1EKBB 3KQEA 3FZZA 4DVAU 1UHBA 1HGTH 2P3TB 3SNEA 1TIOA 3T27A 4TWWA 1GJCB 1O32A 8ESTE 1GBKA 5FCKA 3FP8E 1O2NA 1RJXB 3ZZ7A 4MQAA 2KM0A 1ZSJA 2WINI 2WPJS 3SUDA 3NUMA 4DCDA 1P11E 2O9QA 1WV7H 1Q3XA 1C5NH 2ZCHP 4GPGA 4ASHA 4JZIA 1NN6A 1NC6A 1N8OB 3UPEA 2OTVA 3ZVBA 1TNHA 5ABWA 1XKAC 1DWEH 1SMFE 1DX5M 1OWIA 5F53A 1SVPA 3ZZCA 1AVGH 1C5UA 4KTSA 2YMSB 1Z1IA 3E1XB 3TK5A 4WF8A 2B5TB 4UFDH 3UOUA 1K1IA 4M7GA 1VJ9U 1A2CH 4MPXA 1HV7A 5EJZA 5DP3A 1BRUP 3HPTB 1NFXA 1YC0A 1BBRE 1C1PA 5KGOA 1SGQE 2ZGXH 4LXBH 2XWAA 3BG4C 1O2XA 1QTFA 2H9HA 2Q6GA 5J4SA 2CV3A 1HUTH 3F9GA 3MO9A 4GHTA 1Y3XA 1SGCA 4FU7A 1DXWA 1SLVB 1EQ9A 1UHBB 1W0JD 1H8DH 3BEFB 4DT4A 1IQLA 5DKMA 1DXPA 1GI0A 2ZNKH 4FETA 4AORA 1ANCA 1V2NT 3RDZA 1LO6A 2GT7A 5HIYA 4AYYB 1G30B 3ZVAA 1ZMLA 1BB0B 1AN1E 1FLEE 3GY8A 3OU0A 2AS9A 1GBEA 3ZVGA 2VVVA 1AWHB 1GJ9B 3VB6A 5GWZA 2ZHDA 1C2EA 1ESAA 1TQ7B 2OC0A 3L3TA 1TYNA 2ANYA 2F9PA 2LPRA 3SZEA 5BPEA 5TCAA 4X0WU 2HPPH 3RMMH 1UVUH 4YT6H 1ZPZA 1LMWB 2R0KA 5HIZA 3ATLA 1IQIA 1YPMH 1ELTA 3RXJA 1YLCA 3NCLA 3QWCH 2JKHA 1V2KT 3FOAA 2OQUA 2FI5E 2VU8E 3NPSA 3LC3A 1P05A 4ZROA 4H6SB 2OC8A 3D23A 1P2NA 4Y8YA 2WPLS 1A0JA 1O2QA 1HJAC 2A5KA 1P2QA 4NWLA 1TBZH 1TGTA 2CHAB 1MTUA 4J2YB 2EEKA 2BD2A 2VB0A 2WV5A 2WPIS 1BQYA 2FZZA 2J95A 4RKJB 5F03A 1C1OA 5PTPA 1TBQH 1HB0B 1IQJA 3GCHC 3BN9A 4KTUA 2GMTB 3BIUH 3WW7A 3K65B 3SO3A 1TWXB 3WWBA 3DD2H 3RC4A 4K8YA 4BAMB 1A5GH 1P2IA 3VB4A 1MAXA 5B6LA 3TJNA 4Y10E 2QA9E 1PPHE 3MU5A 4XRNA 3OAAD 2JH6D 2ZPRA 1S5SA 6GCHF 4X8VH 3MFJA 1FI8A 4H6TA 2RA3A 3RMNH 4Y0ZE 4IMQA 4ZKNU 1F2SE 3SU5A 3SUFA 3A80A 4Q80A 1OP8A 2AIQA 3S9AA 2QAAA 2RDEA 3KIDU 3BTFE 4RT1A 4AFSA 5JB8S 2A5AA 3RXBA 2ODPA 3ZZ9A 4ABJA 2XNIA 1AVXA 1CU1A 1HAYB 2W3IA 3N7EA 4ABEA 2W7UA 1A3BH 4NA9H 2SGAA 4ABBA 1LHDH 2FOMB 3OTJE 3M61U 1Z1JA 1EPTC 7GCHG 1DDJA 2D1JA 1RS0A 4ZXYH 1T8OA 3QGJA 2ZDMA 2W6ID 3SNBA 1KXCA 2TGTA 1AI8H 2GVFA 1Y3WA 1O2JA 2QXJA 3P8OA 3EQ0H 3GYLB 1YM0A 1PQ5A 1Z6EA 3PMJA 1ABIH 3STIA 2VGCC 2ALPA 3PV4A 3NWUA 2KCPA 1EJAA 2ZP0H 4P00A 1RTKA 5A0BA 3URCA 1VZQH 1HCGA 2NU3E 2PSXA 2R9PA 3SNCA 1H9LB 1M9UA 2NU4E 1W3CA 4K1SA 1O3MA 2QXHA 2G5NA 1C1VH 2OK5A 1YY3A 4I86A 3VG8A 1O3HA 4OS2A 1DUEA 2NWNA 4K8BA 1TRMA 4O03A 3S7HB 1KTSB 3FVFB 3ZVCA 1HBTH 3LPRA 2CMYA 3CNRA 2BYAX 3HKJB 3SU6A 3E91A 2ZDNA 3HKIB 1RIWC 1QRZA 1ZJDA 1ZHPA 1GHAG 4OS6A 4RI0A 1Y5BT 2HOBA 5C20A 3RLYH 1J15A 5CMXH 2ZFTA 2BY5X 3M35A 1SFQB 3SUEA 1KMHB 1LDTT 2ZGCA 1BZXE 2FM2A 2FDAA 3B23B 3M7UA 1Z71A 1BJUA 3GCNA 1AUJA 2BVXH 5T6FA 1S6LA 1THPB 3H7OA 1Y59T 3M7TA 3VEQB 4M9FA 2BM2A 2FWWA 1K9OE 3M5NA 2ANKH 3MNXA 1P3CA 1D3PB 2BY6X 1OWEA 2PTNA 5EODA 1QL7A 2ZI2H 5TCCA 2A31A 2BLQA 2GV6A 3NXPA 3U28C 4CHAB 1GDQA 1XXDA 2BOKA 4XBDA 1FQ3A 2UUJB 3RXKA 4BANB 3B8JA 4WXIA 4YOIA 2AGIX 1O39A 1KDQA 2ZFRH 1JRSA 3L33A 1GHVH 2VBCA 5JDUB 2A2QH 1GMHG 5BRRE 2YMSC 3PMBB 3LGVA 1LVBA 5HXFA 1FNIA 1CQQA 1C5SA 3ELAH 1ZMNA 2G52A 2STBE 1IQMA 1CA8B 4IMZA 4CRFA 1FY3A 2ZPSA 3U8OH 1G37A 3HK6B 3SV7A 4J1YA 4Z6AH 2QXGA 3KCGH 4DIHH 2J5UA 5E0HA 1XX9A 1GBDA 5A8YA 5HM2A 4MPUA 1AFEH 2ZZUH 2ZGJA 2GDEH 1OPHB 2ZIQH 1ELVA 4MDSA 1ZHMA 1YPHC 1NRRH 2EI6A 1SKYE 2P3FH 5C2ZA 2UWLA 1PQ7A 4X8SH 1XUIA 3K9XB 4MVNA 4NSVA 1RFNA 1EZUC 4NIWA 3SU3A 1T8MA 8GCHF 5LPEA 2TGDA 4DG4A 1O5CB 4OS5A 1SHHB 3ZIAD 1CO7E 4AB9A 2FEQH 3A81A 3TVJB 4Y7AA 2P16A 5IK2D 1A5HA 4FUCA 1VJAU 4CR5A 1VGCB 1TABE 2PGBB 2J97A 1LKBA 4K1EA 1NESE 3DT0H 1W0KD 2XC4A 3BSQA 3SJOA 1MUEB 1SGIB 1FN8A 2ZQ1A 1BCUH 4ACBA 1UTNA 3AASA 3UQVA 1IQKA 3Q76A 4NSYA 2ZPQA 3KF2A 3URDA 1MD7A 1EATA 1XUKA 1K0HA 5FAHA 1OX1A 1N6XA 1TLDA 2ZHFH 4ABHA 3SZNA 1UTQA 1IQEA 2JJ1D 1UVTH 1BMNH 1TPSA 3BTGE 1GI7B 4Y0YE 3TITA 4KGAA 4VGCC 2BXTH 1J14A 4JYUH 1A4WH 3AK5A 2RA0A 3LGIA 1GHZA 1SOZA 5HMAA 2QV1A 1JOUB 5DP7A 2Z3DA 1MMJN 3Q3KA 2OD3B 1H4WA 4MPVA 1XXFA 4TYDA 3RU4D 2KFWA 4WY3A 4Z0KA 4K60A 1A46H 1LQDB 1UW7A 1ZJKA 2EY4C 2WHXA 5LPRA 2GGVB 5A2MH 3AW1A 2BDYA 4B2AA 3PO1B 1ELFA 4AZ2B 2FESH 1MBQA 1GI6A 2V7QD 4X2VA 4ABAA 1C4V2 3MOCA 1Z7KA 1C5TA 4I8JA 4NZLA 3BTTE 1ZRKA 3UNRA 1O5BB 2WPHS 1NT1A 4YXWD 1O2KA 2PWXA 1NY22 1O3DA 4IGDA 3VFEA 1E36B 2AMDA 4IC5A 2PKAA 7LPRA 5HM9A 1KXDA 2QIQA 1E35B 1AHTH 1H9IE 1K22H 4UFFH 1S83A 4CBOA 1C4Y2 2AFQB 2CXVA 3AW0A 3B9FH 1C5XB 4E7NA 1W2KH 1G32B 3AAVA 1O2OA 2GZ7A 1SFIA 4KKDA 4NWKA 5LPFA 1YYY1 3RXGA 4ZHLU 8GCHG 1KLJH 3RXFA 1QNJA 4I8HA 4RT0A 1P9UA 4TY6A 1T8NA 1V2ST 4JMYA 2J4IA 1O3LA 1BRBE 2WPMS 1GBFA 5AHGH 1ZOMA 5A0AE 1SOTA 2HGTH 3SU1A 1ZR0A 3H09A 2P3UB 1UMAH 1HJ8A 2VNTA 2ZU3A 4ABGA 2ZHQH 3CENA 1O2RA 5IDKA 2BB4A 1LQEA 1GVKB 1T4UH 1A7SA 3BEUA 1OS8A 3GCTF 1O2HA 4CH8B 2ASUB 1XM1A 3BIVH 3M5OA 3MWIU 1RTLA 3A7XA 4ZUHA 2AYWA 4ASUD 2ZDLA 1J17T 3RMLH 4X2WA 1RTFB 4X1QU 1ETSH 2FX4A 4LZ4B 1ETTH 1E37B 5TJXA 2XCNA 1YPJH 2BD8A 2Y7XA 1W10U 1FN6A 2J98A 4U32A 3UIRA 4X2XA 1OP0A 3UAIC 2SFAA 1W12U 2BLWA 2BMGB 5EJLA 1UCYH 3PYHA 1EASA 3L6PA 1DANH 1YBWA 3AVZA 2HLDD 4YTAA 1L1GA 1HAXB 2W3KA 1PPFE 2GDDA 3RM0H 1Y3UA 3ATKA 3RUOA 4TPIZ 1MTNB 3U98H 4ZHAA 1LKAA 1FIWA 1S81A 1UTPA 3FN8A 4ZMAH 1C5YB 3SGBE 1IQGA 2G4TA 2VIDA 3Q77A 5F8ZA 1E1QD 3UFAA 1KXEA 1YPEH 1GI4A 1TMTH 1MTVA 1N8OC 2SGDE 2BX4A 3QX5H 5DP6A 3U8RH 2PGQB 1HLTH 3TH2H 1LVMA 1AUTC 4DJZB 2P8OC 4X8UH 2HNTF 3EDXB 2ZDVH 1D9IA 3OX7U 1DICA 3GY3A 4FU8A 4Y8ZA 1KSNA 4WMFA 3C1KA 4JK5A 3V12A 2A45B 1G3DA 3E0NB 5EPYA 1THSH 5FHTA 4E06H 5FPTA 2FIRH 2B7DH 1GG6C 5FBIA 3DUXH 4K5ZA 4KELA 1EOLA 4VGCB 1YPGH 4DURA 1BRCE 4MNXA 3A8DA 2OQ5A 4CHAC 4B71A 2K8IA 4Y76A 1U6QA 1O3CA 2OINA 3IITA 3K2UA 4HTCH 1TNKA 3E0PB 3LGTA 1ZZZA 1ZTJA 3LT3A 2ZU4A 1QQUA 3GCTG 4CBNA 1Z8JB 1YGCH 1ZSKA 1C1NA 2BD9A 1K21H 1W0YH 2K1QA 1ZLRA 3K6ZA 3RXIA 1YLDA 2THFB 4RSPA 1HFDA 1F5RA 1TX7A 1ETRH 5ESBA 1DSTA 2AGEX 2QGRA 5AFZH 3ZYEA 5E0GA 1OSSA 5F6MA 1FV9A 4ZKRU 2B8OH 2XC0A 2UUYA 2H9EH 1QL8A 2R3YA 3EGKH 3GCHB 5DO4H 1HRTH 4WVPE 1XUJA 3RM2H
chains in the Genus database with same CATH topology
2RDLA 3UWIA 1K1LA 5FX5A 3SQHE 4LZ1H 1GI1A 2BXUH 3A7YA 3S0NA 3M36A 1QBNA 2CHAC 3QO6A 3PROA 4WH6A 1PYTC 1PPCE 1WBGB 4HI3A 3SHCH 1D4PB 2M5TA 4ZXXH 3MU1A 1NROH 2O8LA 1GBJA 2F9UA 3ZZAA 4CR9A 2WUCA 1KLTA 4NIXA 2ZU5A 3LKWA 3TJUA 1JWTA 1DWDH 4A6LA 4BAKB 2OLGA 1F0UA 4B74A 3QUMP 2C8XB 2HVXA 5E8EH 1C1UH 2ODQA 2DUCA 1EPTB 5ETXA 5LH8A 1VCPA 2TGAA 1CT4E 2C4FH 2SNWA 2ZO3H 1O2UA 2UWPA 4JZDH 4K69A 3NKKA 3RXQA 3ZVFA 2FYRA 1UTKA 4LK4A 5FPSA 1LTOA 3RXVA 1P10A 4GLYA 1CHGA 4I8KA 8LPRA 1MZDA 2XTTB 3KL6A 1A0LA 1KXBA 2GCHG 1UK4A 3CP7A 3VXFH 1GVZA 1S6FA 2G5VA 1ID5H 4ZAEA 1PQAA 4O97A 5T6GA 1CGHA 1NRQH 6CHAC 4A1VA 1V2TT 3UTUH 1IOEA 1AVWA 1C5VA 5E2PA 4XDEA 1EX3A 2FOEA 2WYGA 1ZTKA 4X1SU 1A1RA 2O8TA 2Z9KA 2BDCA 1IQHA 2A2XH 3GYMA 3OYPA 2KAIA 3TGIE 3OY5U 4D76A 1AFQB 2BD3A 3SGAE 3FANA 1DWBH 2AH4X 1C9PA 5SGAE 3GISB 3GY7A 1QIXB 1QB9A 1XUFA 1B0EA 2F3CE 5GIBA 3T2NA 4O3TA 1F7ZA 1S0QA 3H5CB 4AYVB 1JBUH 1KDQB 1MH0A 5FCRA 2SGEE 2QC2A 1ELEE 4NA7A 1YP9A 1HDTH 5EQSA 1QQ4A 2G81E 1N6YA 1UTJA 2BVRH 2G51A 1O5AB 4BTUB 2ZC9H 2P8OB 5JBBS 1C2LA 1SPJA 1Z8IB 2BDGA 1TPPA 4K2YA 4I31A 4A1TA 1GBHA 3RXHA 3VPKA 4THNH 5J4QA 1Y5UT 1SGEE 4INHA 1PJPA 1ZYOA 3A84A 4B2BA 2WYJA 1V6DA 2ZEBA 2VWOA 3ATMA 5CHAB 3O8RA 1V2MT 3A89A 3UUZA 1O35A 2ZECA 1GBCA 4ABIA 5EGMA 2V35A 1C2HA 3RXDA 1NZQH 1EZXC 1BRAA 1TX6A 1W0ZU 3MO3A 4BAOB 4AFUA 2XBVA 2A7CA 2UWOA 2VWNA 1ACBE 1G3EA 1UTMA 5AF9H 5GPIB 1NFYA 9ESTA 2H5CA 3STJA 1GHAF 1TQ0B 1MAYA 2EC9H 1SGPE 3UQOA 1CA0C 4UEHH 1QY6A 1AZ8A 2FS8A 5C67A 3TGJE 1L4ZA 2BY9X 3MHWU 5EQRA 1KY9A 1FY8E 3NZIA 1GCTC 5HGGA 4OS1A 2VWLA 3DHKH 1MTWA 2FO9A 2FODA 1BIOA 2TGPZ 7ESTE 1MCTA 4NFEA 1P3EA 1TA2A 2XYAA 4DOQA 4PROA 1GI8B 3RU4E 4BNRA 4B76A 2C3SA 1GJ7B 3KQCA 1ABJH 1EZSC 3UR9A 4AFZA 1TNJA 2JETB 4XOJA 2ZCLP 3MH7A 1MQ5A 2W7SA 1DS2E 1GJAB 4Q7YA 3VGCB 1HAOH 2SGQE 1P57B 3SGQE 1BT7A 1BDAA 3GY6A 4NIYA 2Y80A 2JH5D 1O38A 3TH4H 1ANBA 1SHYA 4UFEH 2Y6TA 1ZPBA 3ZVEA 4BAHB 3BTWE 1TNLA 4GSOA 4X6PA 2OCVB 3BTEE 2HPQH 1TOMH 3OSYA 1G3CA 1H9HE 2XBYA 1L1NA 1BUIA 2GCTB 3N7OA 1D6RA 3GCOA 4INLA 1GHWH 4UE7H 2Y5GA 3LOXA 4ISHH 5CHAC 1FY5A 1S84A 1T8LA 1QRXA 4YOGA 1TMBH 1Y3YA 3NK8A 3V13A 2A1DB 4YOJA 2HNTE 2FPZA 4R0IA 1FMGA 4WJG2 2FOBA 2JETC 3P8GA 2G55A 3AAUA 1NO9H 3D62A 2J94A 1HNEE 5L2YH 2VJ1A 6LPRA 2PV9B 2ZFPH 3KQBA 1AY6H 3LONA 1UVSH 4OS4A 3SOSA 1IHSH 3SI3H 2BLVA 1BTXA 2XBXA 6CHAB 1MZAA 1F0RA 4DGJA 1JRTA 2H5DA 1NRSH 3DFJA 1S6HA 3MI4A 4A92A 1GBTA 5DGJA 3LGWA 3S7KB 1OKXA 1C1SA 3LGUA 1S82A 4MPWA 1QJ1B 3JZ2B 2VVUA 5AVDA 3RLWH 1C2JA 1QGFA 1O2LA 1GJ8B 3GY4A 5I46H 1G2LA 1W11U 1TNIA 1C2FA 1KIGH 4BOHA 1QBVH 4F49A 3BTHE 3RXCA 1FXYA 2QF3A 2PFEA 1Z8RA 1HXEH 4E7RG 1P02A 3A7VA 4FUHA 4Q7ZA 1FY1A 2P95A 4FUJA 2GMTC 4XE4A 3QZRA 4RN6A 4JZEH 2G8TA 1BMLA 2ZGBH 3W94A 3TK9A 1C5RA 1TBRH 1RIWB 3F6UH 3ODDA 4CRAA 3FZDA 3U69H 7KMEH 1K28D 1SSXA 3G01A 2CJIA 2P93A 4SGBE 1EAXA 2FOCA 1Z8GA 1C5LH 2BLOA 3TNSA 4HZHA 2OC1A 1NTPA 1TB6H 3SU2A 1GDUA 1RRKA 1UK3A 1NFWA 5F8XA 2WV4A 3MNCA 4UDWH 2XBWA 4NA8A 3F68H 1BHXB 2FMJA 4MG3A 1VCWA 1FDPA 3MU4A 4OGXA 3UOPA 1Y5AT 1HAPH 4BXWA 1P9SA 1K1PA 4ZKOU 1MKWH 1O2YA 2CGAA 2OXSA 4NGAH 4O9VA 5HYOA 1HAVA 2BHGA 1SBWA 2FTLE 1L2EA 3EBNA 5K7RA 2GZ8A 1HAHH 3EA9A 1TA6A 4FUBA 4ZH8A 5G4BA 1D3QB 1G9IE 1EZQA 1G3BA 2HNTC 3GDUA 1D6WA 3U1IB 1SLUB 1QHRB 1UK2A 2BZ6H 2FOGA 3RXTA 2Y5HA 1BMMH 1IQFA 3TU7H 3F9EA 2V0BA 5A0CA 1G36A 3D49H 3E16B 1IHTH 4YESB 5JBCS 2TRMA 4MNVA 5JYIA 3ZVDA 3SI4H 3T5FH 1O3EA 2R0LA 4F4OC 1LHGH 2I6SA 1V2RT 2IN2A 1Y3VA 1K1OA 1GL1A 1BBRH 4HGCA 4Y11E 1O3NA 1ZHRA 1HAZB 4JYTA 2BQ6B 2F83A 1GBIA 1EXFA 1NU9A 1CE5A 1GI9B 1GBMA 1IAUA 2GD4B 5I25A 4ABFA 2BQ7B 1THRH 1J16A 1GBLA 1P04A 4IS5A 1AGJA 1O2GH 1TAWA 4X2YA 6GCHG 1QA0A 1C5PA 3RXSA 1AKSA 4YZUA 3TJVA 5FBEA 2F9VA 1XKBC 1AE8H 1GGDB 5GDSH 2ULLA 5E2OA 1HJAB 2C90B 4CRDA 3M3TA 1C2MA 3A8AA 3MYWA 3UR6A 3F9HA 3M3VA 3MH5A 5JBAS 2SGPE 1CGIE 3DA9B 2GCTC 4X1NU 1UVPA 2FOAA 1PQ8A 2ZWLH 4U01A 1C5OH 3QZQA 1SQOA 3LJJA 4CH2B 1V2JT 2Q1JA 4I7YH 1A3EH 2XWBI 3E8LA 1F5KU 3SBKA 5JB9S 1HXFH 1GJ6A 3A83A 1DOJA 3HGNA 2PKSB 1GMDG 4Q2KA 2A7JA 3HGPA 5EW1H 3K6YA 1O2PA 2B0FA 1TFXA 3F1SB 3T29A 3BEIB 2ILNA 1WQSA 1SL3A 3RC5A 1YPLH 1F5LA 1SGTA 1CHOG 1C2GA 2FLRH 4GAWA 4AGJA 3ZYDA 1EP5A 3ITIA 2FI4E 1ARCA 3GICB 3PTNA 1FAKH 3SW2B 1F0SA 2NU1E 1O3IA 1KTTB 1Q31A 5FXLA 2H9TH 2HLCA 3BG4B 4YT7H 1O3PB 4NZQA 3FP7E 3VXEH 1B0FA 1HIAB 2Z9JA 1V2WT 4D9QA 1WAYB 3SU4A 5LGOA 2GV7A 3RU4T 3EYDA 4BAQB 1V3XA 1V2OT 2ZGHA 4FUDA 3GDSA 1K1MA 3M5MA 2YNAA 3A8CA 4ESTE 3KHVA 1W8BH 1PPGE 4BTIB 4FXGH 1ORFA 4AX9H 2QCYA 2HRVA 3ZZBA 3RMOH 2BX3A 2YNBA 1DVAH 5T3HA 4AFQA 3MMGA 1TALA 3ZZ5A 3W95A 2J2UA 2V3HH 4ISLA 3BV9B 3FAOA 2A5IA 1K1JA 2ZU2A 1GHYH 1TPAE 5EOKA 2EI7A 2TBSA 2A4OA 3ENSB 2SGFE 4IN2A 1C1TA 4X1PU 8KME2 2F9OA 4Y79A 1W7GH 1BBRK 2Z6BD 1TOCB 2O8WA 3SJ8A 2ZCKP 1BOQA 4JYVH 2FOHA 3PB1E 2PKSC 1FIZA 1EB1H 5H4IB 2LIZA 2FP7B 3P95A 1C5QA 4DT7B 2ZDKA 1BTPA 1O3FA 3RXRA 1O2VA 2IOTA 3M37A 1JIMA 3V7TA 3RXMA 2AERH 2Z94A 3SNDA 1P2OA 1GMHF 1SGDE 4NG9H 3PWBA 1DY9A 3WY8A 4BTTB 3T26A 1CT0E 1K1NA 1MKXK 2RG3A 3SV6A 1MCVA 1GDNA 1IQNA 1WYKA 2J9NA 2FOFA 3U8TH 3P8FA 1T7CA 5EQQA 1GMCF 1P2MA 4O3UA 2ZF0H 2ZKSA 4FUGA 1O3GA 2AMQA 2W5EA 4B73A 5L2ZH 1T32A 2FLBH 1TGBA 3ZZ8A 2FX6A 1KXFA 2YOLA 4FUFA 1YPKH 3BG8A 1O36A 1MBMA 4JZFH 5FPYA 2C8ZB 1ZGIA 1O2WA 1BJVA 1O5EH 3RXPA 2OUAA 3PWCA 2F9BH 1TRNA 3U9AH 1C1WH 1GBBA 4AG1A 4CRBA 2G4UA 1O0DH 1YF4A 3A85A 5ESTE 3IG6B 2BQWB 1FY4A 3A88A 4WWYA 3GY2A 1KLIH 4OS7A 1FPHH 1BTWA 2VGCB 1OOKB 1J8AA 3RXOA 3A86A 3UREA 3ZZ3A 5GJ4B 2CF8H 2KAIB 1WTGH 1EAUA 1SG8B 1G2MA 1P01A 2FS9A 1TRYA 2GCHF 4AG2A 4YO9A 1AD8H 3Q3XA 4Y71A 5FX6A 3O8BA 2PLXA 4I32A 3CS0A 2C8WB 2Y7ZA 2GT8A 1C2IA 3T62A 1AZZA 4D7GA 1OWHA 2TPIZ 3I29A 2V6NA 3ZV9A 4B1TA 2BY7X 1AB9B 1OYTH 1QJ6B 1QL9A 4ABDA 3V0XA 1DLKB 1GJ4H 2Z3CA 3CS7A 1O5FH 1O5GH 2DE8A 1TNGA 3S9CA 1C5ZB 1ZMJA 1NU7B 1LPGB 3EA8A 4X1RU 2AEIH 1W7XH 2BD5A 1N1LA 6ESTA 1AB9C 1O30A 1XVOA 1O33A 1CBWC 4I8LA 4KP0A 1BITA 1AFQC 3A82A 2A0QB 3ZZ6A 3SUGA 5A8XA 1GHBG 2AMPA 4ISIH 4ISNA 4JCNA 1MKXH 3DFLA 1QA7A 3TPIZ 1HAGE 3QN7A 4Y6DA 1V2LT 1NM6A 2XC5A 2AGGX 2UUKB 2Y5FA 4FUIA 3IWMA 5GCHG 3Q00A 1P09A 2ZG0H 2GTBA 1BA8B 1WTHD 5EXNA 1BHXF 5IYTA 1ELAA 1RXPA 1GCDA 3JZ1B 3UWJH 1V2QT 2VH6A 4TPYA 2STAE 1QB6A 3EE0B 3SQEE 1CSOE 3F9FA 2VIVA 2ZFSA 4DIIH 2GKVE 4A7IB 4H4FA 1MU8B 1O2SA 4NIVA 1GI3A 4WMDA 1V2UT 1GWAA 3C27B 3T25A 2W26A 3BF6H 5EXLA 2PUQH 4K1TA 1SGFA 1HAVB 2CF9H 1FJSA 4H42U 3QTVH 4XFQA 1AQ7A 3BTME 3HATH 3VB7A 4IN1A 2BZAA 3T28A 1GBAA 3BTDE 3RXEA 2PUXB 4ISOA 1W13U 1EPTA 1E0FD 5DK1A 4U30A 5EXMA 3MH4A 1FPCH 2XW9A 2FYQA 1QBOA 1LCYA 1FUJA 4X8TH 5DG6A 2FTMA 4RKOB 4FVDA 3QTOH 4QT8C 1E34B 3A7TA 2GZ9A 2PSYA 1ESTA 4GUXA 1AWFH 1YCPM 4LOYH 5DP9A 1VGCC 1SGFG 1T4VH 4IBLH 1VR1H 3ZZDA 2ZU1A 3MO6A 1GMCG 2C8YB 1GJ5H 4X6NA 5JPMH 3SU0A 1TE0A 2VIOA 1P2KA 2BY8X 4JK6A 1GGDC 3KNXA 1FAXA 2BTCE 5C5NA 1QFKH 3SJIA 1ZSLA 2PTCE 1ELCA 2R2MB 1ZPCA 2ZHWH 1P0SH 3PM3A 1DM4B 2ODYB 3VGCC 2NU0E 1PPBH 1C5WB 1RGQA 4D9RA 1O2MA 4D8NA 1GHBF 1EP6A 1C2KA 1JMOH 2EA3A 1QURH 1C1QA 3MNBA 1ELGA 1GPZA 1BTZA 4A5TS 1LVOA 1GJDB 5EPNA 1QB1A 3PO1C 3SHAH 1OP2A 1V2PT 1TX8A 2V3OH 1MTNC 1JXPA 2PR3A 2QYIA 1GCTB 1GI5A 1S85A 1CT2E 2Y81A 1S0RA 1GJBB 2VINA 1HYLA 1RD3B 1TONA 3LH3A 4DY7B 1SR5C 1WQVH 3H7TA 1W14U 2BDAA 1BTUA 2XXLA 1HPGA 1O2TA 1AE5A 3ZZ4A 4K3JA 1FZZA 2A4GA 2VIQA 3O8CA 3TJOA 4NCYA 2A4RA 2J34A 3SNAA 1C9TA 3GOVB 1P8VC 1ESBA 1TGNA 3SJKA 3FFGA 4Y8XA 1UTLM 1LHFH 3P6ZB 3RXLA 1MD8A 3PMHB 1DUAA 4FUEA 1C1RA 1UTOA 4B75A 2ZDAH 1TPOA 1D3TB 1SGNE 1O3JA 3TGKE 3TLOA 1MU6B 2OP9A 2ZFFH 2Z3EA 7GCHF 1PYTD 1SB1H 5DP8A 3ODFA 2A32A 3EA7A 1A61H 2WUBA 1SGYE 4D7FA 1A5IA 1EAWA 2R2WU 4E05H 2BDIA 4OGYA 1ZRBA 2VVCA 5DPAA 1DPOA 3SN8A 2P59A 3R3GB 5T6DA 1O3BA 2F91A 2IPHA 4MTBA 1EJMA 3U1JB 1ELDE 1HAIH 3M7QA 3SORA 2BD7A 2ZTXA 1Z6JH 4DW2U 1V2VT 4ZHMU 4SGAE 3KN2A 1GHXH 1P2JA 3LU9B 2LNCA 3SV2H 2AIPA 2WPKS 1DE7H 4MNYA 1XUHA 5EU8A 3MH6A 3P17H