4RSPA

X-ray structure of mers-cov nsp5 protease bound with a designed inhibitor
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
304
structure length
303
Chain Sequence
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Orf1a protein
publication title Ligand-induced Dimerization of Middle East Respiratory Syndrome (MERS) Coronavirus nsp5 Protease (3CLpro): IMPLICATIONS FOR nsp5 REGULATION AND THE DEVELOPMENT OF ANTIVIRALS.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
total genus 86
structure length 303
sequence length 304
ec nomenclature
pdb deposition date 2014-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4rspA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4rspA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4rspA02
1MAXA 5A09A 1GBTA 1DLEA 4OS2A 1UTPA 3L33A 1G2LA 2A4RA 1T32A 2ASUB 4YESB 1DPOA 1GMHF 3BV9B 3HK3B 1CHOF 1K1MA 2CGAA 4FUJA 3SJIA 1O2ZA 4ISLA 2J38A 1KTTB 1W8BH 1FY1A 1QA0A 3SU2A 1OPHB 1C2FA 3R0FA 1ZOMA 3PWBA 4A7IB 5C1XA 5EW2H 3VB6A 1EP5A 2QXGA 1IQJA 1T8OA 1TQ0B 2BLOA 2C8WB 2BQ7B 3ZV8A 1EX3A 3OYPA 1YPHC 1DY8A 3MU5A 1F7ZA 4MPXA 1GL1A 5EPYA 1DWCH 4RKOB 3S7HB 4BAQB 1TGCA 3HK6B 4CREA 4I8HA 2V3HH 4X6NA 3A7TA 3ITIA 2WUCA 1HXFH 4ISHH 4MPVA 4X8TH 1FI8A 3A7ZA 2A2QH 3T29A 2BVSH 3E0NB 1D3TB 1TGTA 3GY6A 1GJAB 3C27B 2RCEA 1LHCH 5F8TA 1RD3B 1V2MT 3RDZA 4B73A 4U01A 5FPTA 3SZNA 4SGBE 1ZMJA 1OS8A 1SG8B 1IHSH 1S85A 2ZCLP 2GZ7A 1XUGA 2WPJS 2R0LA 3S7KB 2G52A 3T5FH 4BOHA 1EJMA 1Z8RA 2GGVB 5E0JA 4IMQA 4FU9A 1OKXA 1O3HA 3Q00A 4X2VA 1SGIB 1O3KA 1O5AB 1P3CA 1W2KH 3QTOH 1NT1A 1ABJH 3QO6A 1TNGA 1PPEE 3R3GB 3O8CA 5AHGH 1YPHE 1ANBA 1T7CA 4Q2KA 1O38A 2H6MA 1BMNH 1O5BB 1MH0A 1PQAA 3A84A 1O31A 3PO1B 1NM6A 2UUYA 1TRYA 2PKSB 4JK6A 5HM9A 5T3HA 1AZ8A 3T62A 3VB3A 2Z3DA 1RRKA 2QGRA 1XXDA 1S6HA 1O2HA 1XKBC 1QBVH 1XUIA 4Y8XA 1MZDA 5C1UA 4OGXA 4YOJA 1O5DH 3LGTA 2VU8E 3ZYDA 2O8MA 2HNTE 1MKWK 4E7NA 2VH0A 4BAKB 3OX7U 3ZVDA 3BEIB 5FX6A 3ZVEA 5AF9H 1HUTH 1G3CA 1LDTT 1YPJH 3F9HA 1VZQH 3UWJH 1TWXB 1G3BA 4RN6A 3RXVA 3BTWE 1MCTA 1HXEH 1NROH 1TNHA 2ILNA 2Z9IA 3SBKA 1YPMH 1QBNA 1CSOE 2G81E 2AYWA 1C2GA 1S83A 4U32A 4OS6A 3E91A 1ZJDA 4UFGH 1W3CA 1MAYA 1K22H 4CRFA 1P0SH 4TPYA 2OD3B 4ISOA 1ELDE 3FANA 4MVNA 3SU3A 3TU7H 4LXBH 1WCZA 2ZGHA 1HJAC 3U8TH 2BY9X 1C5QA 1N6XA 2ULLA 4X8UH 2YOLA 4Q7YA 1C5XB 1GG6C 5GCHG 1CVWH 3H7TA 1TBRH 1O2RA 2PSYA 1BA8B 1EUFA 1KXCA 5BRRE 8LPRA 1GDNA 1HAIH 4XBBA 1OYTH 1BDAA 1FJSA 1BJUA 3QK1A 8GCHF 2VIQA 4X6PA 1HAOH 1TABE 3RXEA 3URCA 3K9XB 1MKXK 2ZU2A 1ZPBA 7GCHG 3ZZDA 4B2AA 3BIVH 1AKSA 1P2JA 4HGCA 3PM3A 5HMAA 2SGFE 1UVSH 3KEEA 5EG4A 3AAUA 3G01A 1GHZA 2ZFTA 1O2MA 4FXGH 3A8BA 1C5OH 1ETTH 4UE7H 5E0HA 2YNAA 3GCHC 5HM2A 2FTMA 4NGAH 1BTHH 4IGDA 1AB9C 3UFAA 1K1LA 2V35A 4NG9H 1O2IA 2BZ6H 2Z9KA 5EGMA 1ELGA 2QA9E 4XE4A 1TLDA 1KLTA 4TYDA 2F9PA 3PLBA 5DPAA 2Y7ZA 4I8LA 4CRBA 2ZIQH 1O2SA 4B71A 3RMOH 1N6YA 1YF4A 3RXDA 3GCOA 1ABIH 1GMCF 4AOQA 3LC3A 3A8DA 5DP6A 2NU3E 1F92A 4X0WU 4YLQH 1NRNH 1C9TA 1NFUA 1GI1A 1ZHPA 3MHWU 4K5ZA 1ZPCA 1HV7A 4TY6A 3U8OH 5DP9A 2VVVA 3S69A 3SI3H 2FI5E 2Z94A 1TGNA 4X8SH 1ELTA 2TGTA 1GI2A 3I29A 5G4BA 1SR5C 2QF3A 3UR6A 5A8ZA 2A5IA 4SGAE 3ODDA 2ZP0H 3UNRA 4A6LA 1G36A 1J17T 1QCPA 4IBLH 5JBCS 5DP7A 1EOJA 1FNIA 1V2JT 5LH8A 2BX4A 1SGRE 4X1RU 2PKAB 5A8YA 1GHBG 2EEKA 1XVOA 1O3NA 2A1DB 4AFSA 4UONA 3UQVA 1A1RA 1YM0A 1SB1H 1T31A 2CV3A 5K7RA 2CMYA 4WJG2 2ZQ1A 5TJXA 1P9SA 1O33A 9ESTA 3F68H 2PR3A 2FS8A 1K2I1 4FUBA 2WPHS 2GKVE 3MU0A 3O8BA 3E8LA 2ZPSA 1L2EA 3HPTB 1K1NA 3F1SB 1NFXA 3A7YA 3RLYH 1ZZZA 1GMDF 2GDEH 1LPKB 1CT0E 1OYQA 1SLVB 1BTZA 3QGJA 1C2LA 1SLUB 2OQ5A 4UDWH 5PTPA 1O2KA 1C1SA 3LOXA 3KHVA 1C1WH 1T8NA 3IITA 3W94A 1Y3WA 1O2WA 1P10A 4DOQA 1ZPZA 4JYTA 5EODA 4ZH8A 3KCGH 1TNIA 1BHXF 1Z8JB 4FUCA 2BD4A 2WPLS 1GI7B 1V2RT 3RP2A 3A89A 2A4OA 3UIRA 2VINA 1UTJA 1GJ5H 1H1BA 1HAYB 2ODPA 1G32B 1JWTA 1F5RA 3FZZA 1A5HA 5E8EH 2K7XA 1THRH 3DFLA 1G3EA 1DT2A 3P17H 1SGDE 2GT7A 3RU4T 1ELFA 3TH2H 1SLWB 4ZKRU 2ZHEH 1U6QA 4D9QA 2DE8A 3VGCB 6LPRA 3ZVAA 4YM9A 1HIAA 1THPB 1VITF 2BDBA 2CF8H 3SO3A 3SQHE 1YPEH 3GDVA 3TK5A 3A7XA 3VB5A 1XVMA 1GGDB 5HGGA 1DVAH 1GVZA 3SJ9A 4IC6A 3VXEH 4FU8A 1TYNA 2XTTB 3V13A 1ELCA 4JZIA 3RXUA 4GPGA 1O3IA 1SGTA 1VR1H 3EYDA 3RXJA 3TVJB 1HFDA 2VIWA 3GICB 3HGPA 1MTVA 1UCYK 3M3TA 1A61H 2PHBA 2W26A 1EZSC 2TGAA 1YPKH 2DE9A 2JETB 3PTBA 4Y71A 3PMHB 2A45B 1O2VA 3UREA 2O8WA 2QF0A 2R2MB 1YC0A 3PMAB 2XC4A 1E38B 3A85A 1W7GH 1GJ9B 1TOMH 2BY6X 1BQYA 3RXCA 1EPTA 1ANCA 4YO9A 3SV2H 2AGEX 4WH6A 3ZVCA 6ESTA 2CHAC 4CHAC 2WUBA 2YNBA 3BN9A 8ESTE 5JB8S 1FONA 1XUFA 3MNBA 3MO9A 3U69H 4JYUH 2NU0E 1P8VC 3EA9A 4MLFB 1Z8GA 5FXLA 3IG6B 3D49H 2R3YA 2ZU3A 3VEQB 1ZRKA 4Z0KA 3UPEA 3ODFA 5EQSA 4BAOB 1SGYE 4ZXXH 2F9OA 1RJXB 1PPZA 1XX9A 2C3SA 4X1NU 5DKMA 3TLOA 3SV7A 3E0PB 2BQWB 1HAVA 4ABGA 5A0CA 3P8GA 3PO1C 1BZXE 3B8JA 2G00A 2FO9A 4KTCA 1J14A 4NFEA 1FY8E 2OCVB 3K6YA 1QL9A 5A0BA 1C1PA 3PTNA 4AGJA 3RXGA 5T6GA 3SU6A 1QURH 2DUCA 1C1VH 3RLWH 2SGQE 1UMAH 1F2SE 5C5NA 2JKHA 4VGCB 5C3NA 1ZR0A 3PB1E 1UK4A 5FPSA 5CMXH 1SGQE 2KAIA 2BDCA 1W12U 6GCHG 2ZC9H 4RSPA 2C90B 4OS5A 2FI3E 1VJAU 1CA0B 1DSUA 3TJOA 5F8XA 4I7YH 2STAE 4WY3A 3V12A 5EXNA 3CS0A 4B1TA 1J8AA 1CE5A 1AY6H 5DK1A 1EKBB 1VGCC 1XUHA 4Y10E 4MTBA 1HAXB 3MH6A 3SN8A 1TAWA 4HTCH 2THFB 1O2LA 1P09A 1AD8H 1SQAA 2A5AA 3MO6A 3P8OA 3RC6A 4U2WA 1YPLH 2ANWA 4Y0YE 2WPIS 4K2YA 1GVKB 2JH6D 5FX5A 2VB0A 1V2TT 1QBOA 3PV4A 1AO5A 4Y8ZA 2BZAA 1AFQC 2ZDAH 1FAXA 2P8OB 1O32A 3KN2A 1SOZA 1INCA 1IOEA 3LT3A 3V0XA 4LOYH 1O2YA 1BMLA 1BTXA 3BTQE 2CF9H 1FUJA 1WAYB 2QY0B 2F83A 5GCHF 4DIIH 2Q1JA 2XNIA 4CRDA 2FOCA 1S0RA 1S84A 2BD2A 1MTNC 4YOGA 1RS0A 1T4UH 1A0HB 3SGBE 2ZKSA 2ZO3H 1ZLRA 1GBMA 1QB1A 5H4IB 3RXIA 2AFQB 4K1TA 4BAHB 1DANH 1QB9A 2ZCHP 3OTJE 7GCHF 1S5SA 2HVXA 1CT4E 3CS7A 2XC5A 1SGFA 2PUQH 1ZJKA 3MFJA 3P8NA 3GY7A 4MNWA 3K65B 2Y81A 3A7VA 2B8OH 5HYOA 2A7HA 2W7UA 1AI8H 3QLPH 1UK3A 1A0LA 1GJ4H 1MBQA 5DP5A 4FUIA 4NIVA 2AS9A 2BD8A 2FI4E 1OWHA 2QN5T 2GMTB 1YYY1 2PTNA 1C5PA 3ZYEA 2PW8H 1QR3E 5AFYH 5J4SA 4GUXA 5FBEA 2IOTA 1GBAA 2GCTC 1HB0B 2AEIH 2M5TA 2STBE 1F0UA 2AH4X 2V6NA 2ZGBH 2BDGA 1TGBA 3HKJB 2ZHWH 2AIQA 4DVAU 4I32A 1QJ1B 1LHGH 1ACBE 4WH8A 3ZVBA 1ZSLA 2H9TH 1EAIA 1E34B 1LVMA 3FP7E 4BXSA 4CR5A 1EPTC 1Y3YA 5LPFA 1SC8U 1DXPA 1TMBH 2VIOA 2BTCE 1HAGE 4CRCA 3STJA 4INLA 2AMPA 1ESBA 2FS9A 1BMMH 1QB6A 2BDYA 3S9BA 1BRCE 1QHRB 1GHBF 4X6OA 1BHXB 4ZKOU 4TWYA 4I8JA 3SJ8A 1Y5BT 1B0FA 4GHQA 3EQ0H 5DGJA 2LIZA 2H2ZA 1O5EH 1NZQH 5FHTA 1JIRA 1RIWC 1SGNE 2ZGXH 3SNBA 4WMFA 4NWKA 3GCTG 3S9AA 4K69A 2FZZA 1J15A 2GV7A 1UTMA 3PROA 1Y5UT 1MTUA 1P57B 1V2LT 5I25A 1VCWA 2XBVA 1ZHMA 4D9RA 2ZPQA 1NRSH 3LJJA 2XBXA 4LZ1H 3ZZ8A 3Q3XA 2Z3EA 4I33A 1D4PB 1FPHH 2HNTC 4KKDA 1C5NH 2GZ8A 1JOUB 4AB8A 4A1XA 4A1TA 2ZFPH 1RTLA 1XXFA 1K1PA 3ENSB 4DCDA 3B23B 1BRAA 4JZ1A 1IQGA 1BBRE 2ZWLH 1N8OC 3RUOA 3VB7A 2VH6A 3SI4H 2OBQA 1AFEH 2BXUH 1BTWA 1LVBA 1C5MD 1GBJA 1T8MA 2F9UA 2FTLE 1GBCA 2WV4A 1P05A 1A3BH 4Y8YA 1G37A 4DJZB 3T25A 2SNWA 1GI5A 2GP9B 1OP2A 2VVCA 1F0TA 1KLJH 1VJ9U 5CHAB 3OY5U 2R0KA 1MUEB 2P59A 3NPSA 4YLUA 2WYJA 1A46H 1CBWB 2Z6BD 2VGCC 1L4DA 5E2OA 3BEFB 3UWIA 1HAHH 3MNSA 2Y7XA 2ZGCA 2A2XH 3ZZ6A 2G55A 3NKKA 1QL8A 1S81A 4JZFH 3SORA 3CP7A 3SNEA 3P6ZB 3TH3H 3SV9A 3MOCA 3F9EA 1O0DH 4AZ2B 5FCKA 1KDQA 1GBLA 1NRQH 1F5LA 2BM2A 3F9GA 1W7XH 1SSXA 4ZROA 1WTHD 1SMFE 2FOBA 5JBBS 1C4U2 1O3GA 1EJAA 2ZFSA 1PPCE 1O3PB 1OOKB 1GI4A 3A80A 2R3UA 3MH5A 4IC5A 4FUFA 3CENA 3GISB 3LGWA 4WWYA 1GHWH 1C9PA 1ELVA 3DA9B 5IYTA 1FPCH 1F5KU 1CT2E 4CRAA 3TNTA 3MU1A 2FOHA 1O2JA 1MQ5A 3QDZB 2BHGA 2R2WU 1SGPE 1JRSA 1JIMA 2NU4E 1N1LA 1BB0B 3PYHA 1K9OE 3P95A 1T4VH 3LGIA 1GWAA 1A0JA 2Q6DA 1AVGH 2OINA 2UUKB 3MH4A 1L1GA 2BLVA 4ZAEA 1IQHA 4Q7XA 5AVDA 1GHXH 2J9NA 3MU8A 3BTKE 4MG3A 3U1IB 4YT6H 2WPMS 3SUGA 1LQDB 1F0RA 5JBAS 3RMLH 2TRMA 1M9UA 1A3EH 1P3EA 1BRUP 1ETRH 3GY8A 1IQNA 1GI3A 4FUGA 3ZVFA 3TGJE 2G4UA 1P2QA 1MMJN 3EE0B 4AORA 2HGTH 4Y11E 2JH5D 1TNKA 4ABHA 1C2MA 3ZZ7A 1Q31A 1OSSA 1KXAA 4X2WA 1EOLA 1YBWA 5L2ZH 1UTOA 2ZA5A 5AFZH 4ESTE 1HLTH 6CHAB 4X1QU 2ZF0H 3W95A 1BRBE 4H42U 1FV9A 2D2DA 6GCHF 1W0ZU 2HRVA 1DX5M 3U1JB 3ESTA 1GCTB 3KQDA 5T6DA 3A82A 4NSVA 1YKTA 3ZVGA 3TJNA 3IWMA 1W13U 5EQQA 1L1NA 3HATH 3EBNA 1Y8TA 1GPZA 1AWFH 4THNH 2BD3A 4O03A 1CGHA 7KMEH 1H9IE 2FYQA 4A92A 3RXAA 4HZHA 5ETXA 1KYNA 3OY6U 2TPIZ 3E6PH 1O2GH 5EU8A 2BDHA 2Z9JA 3D62A 1RXPA 2FX6A 5CE1A 4I31A 4NA7A 5JB9S 4F49A 4Z6AH 2A31A 1AIXH 1YPGH 3AVZA 4YTAA 1GJDB 1TPOA 4INHA 4E06H 1S6FA 1ZSJA 1C5RA 1GJCB 1YP9A 1Z7KA 1SGCA 1SVPA 1TONA 1ZTLA 1D6RA 2IN2A 3F9FA 1QRWA 2ZDMA 1D6WA 1SFIA 1IQKA 2VIDA 4AB9A 3EDXB 1W14U 3VPKA 3GDUA 1B0EA 1GHVH 3RXPA 3RXBA 4D7FA 3BTME 5EXMA 2V3OH 2HOBA 3SNAA 2P94A 3BG8A 5ABWA 4CH8B 5FPYA 1QQUA 3I77A 1C5SA 1PQ7A 3RC4A 3GY2A 1ANDA 1P01A 1TX8A 1TOCB 1PJPA 5E2PA 3UNSA 4TWWA 2HPQH 2QC2A 1QFKH 1EAXA 4BAMB 4XDEA 1ANEA 5B6OA 2A7JA 2P16A 1ID5H 1LKAA 3BG4B 4FUDA 1Z8IB 2J4IA 1XUKA 5FAHA 4ZMAH 1BBRH 3KL6A 1NO9H 1C5YB 2P3UB 2FYRA 2UWPA 2P93A 1UHBB 1LMWB 3UNQA 1WU1A 1TIOA 4LZ4B 4JCNA 1GBIA 5L30H 3TITA 1QJ7B 4XBCA 5JYIA 4ZHLU 1ESAA 3M5MA 5EPNA 2C8YB 3ZZBA 2D1JA 1D9IA 2C8XB 3URDA 1SHHB 1B7XB 1Z1JA 3S0NA 3KF2A 3BTDE 2A4QA 3DUXH 3TJUA 1AVWA 5TCCA 3STIA 4D76A 3LU9B 3EA8A 1RTKA 5EW1H 2Y5FA 5ESTE 1V2WT 1EAWA 1QA7A 1L4ZA 2R9PA 3VFEA 3ZZ3A 3BTHE 4K8BA 1NPMA 2QV1A 3A81A 1O3CA 1SGFG 1GBDA 1GBKA 3SU1A 3MWIU 2P3TB 1DE7H 4JYVH 3JZ1B 1UVPA 1O5GH 1C2JA 2UUJB 2LPRA 1FXYA 1YCPM 3BEUA 2PTCE 3SU4A 4CR9A 3A87A 1O3DA 3SUFA 5C67A 1C5VA 4AYVB 2HLCA 3GCTF 2ZDLA 1KXBA 1FIZA 3GY3A 3OSYA 1E35B 4AG1A 3RU4E 1O3AA 2OC0A 3TK6A 3B9FH 3A88A 2PKAA 3HKIB 1XM1A 1EASA 1SL3A 1AHTH 3BIUH 3SQEE 4BTTB 4GCHG 1AMHA 1P12E 3RXOA 3UR9A 1DWDH 4DW2U 1NS3A 1NFWA 1HNEE 1C2KA 1HDTH 2JH0D 2ALVA 4AFQA 1NN6A 4Q80A 3KQCA 3LKWA 2XC0A 3RXRA 2FDAA 1W11U 1O2NA 1BTUA 4JZEH 2A4GA 5DP4A 2HWLB 3A86A 3ZZ4A 1DSTA 2BDIA 3P70B 2XCNA 4X8VH 2PV9B 1P9UA 2PKSC 4WMDA 1TA6A 3RXQA 4X1PU 3DT0H 4MNVA 1GBBA 2BXTH 2OBOA 2SGPE 4Y79A 1HJAB 3RXKA 2FP7B 1GG6B 3UTUH 5A0AE 3TK9A 2EA3A 1X7AC 3LJOA 4GLYA 9LPRA 1GL0E 3I78A 1A2CH 1NY22 4WF8A 1O2QA 3H5CB 4X2XA 5C1YA 1A4WH 2OC1A 3Q3KA 1LPZB 2ZCKP 1FDPA 2W7SA 5DP8A 2RG3A 3QGNB 2LNCA 3RXSA 3TJVA 5JBTA 5BPEA 1BMAA 1TPPA 2EI7A 2ZGJA 3GCHB 5ESBA 2GVFA 3MYWA 1AB9B 4OS7A 1TMTH 4ZHAA 1IQIA 1V3XA 4INKA 1C2EA 1UTNA 3LIWA 3M5LA 1KIGH 4TY7A 3RXFA 1DUEA 1P2NA 1WV7H 4ZXYH 3FP8E 1UTLM 3LDXH 1GVLA 1O2OA 4Y0ZE 2J95A 3SV6A 5K0HA 2GT8A 1ELBA 1NRPH 3P8FA 1HCGA 3U8RH 3S9CA 2NU1E 3M3SA 4DY7B 2ZDVH 3NUMA 2EI6A 1SLXB 2AERH 1V2OT 3ELAH 1FY5A 3UY9A 3TGIE 1ZMLA 2D26C 2P95A 2VJ1A 2H5DA 1HAZB 4IS5A 3EGKH 4R0IA 4AX9H 1TE0A 3GY4A 3NXPA 2NWNA 3NWUA 2F9BH 3PLPA 2VVUA 3LGYA 4NWLA 4WVPE 1DITH 3KNXA 2GX4A 2BQ6B 2XCFA 2ZTZA 1FN6A 4ISIH 2AMDA 2GTBA 1C5TA 3A8CA 5A8XA 1MCVA 2PGQB 3BTEE 1ESTA 1DOJA 5GPIB 1IAUA 1GI8B 3MMGA 2ZECA 1MTSA 1P06A 1SBWA 3A8AA 1SQOA 2H9HA 2EC9H 1LHEH 1Z6EA 1DWEH 1V2NT 1CGIE 1BJVA 3QZRA 2RA0A 4YZUA 3QN7A 1DXWA 1GCTC 1LHFH 1O2TA 1GCDA 4O3TA 4ZKNU 2FOFA 1XKAC 3DD2H 4XSKU 1ZMNA 4DT7B 2FOAA 2HALA 3SNCA 4ABJA 2FEQH 2XYAA 4TPIZ 4K8YA 2FOEA 1Q3XA 2QYIA 3AW1A 1BCUH 1NC6A 2Y5HA 3GOVB 1JRTA 1TX7A 1O3EA 1Q2WA 1TQ7B 3AAVA 1LHDH 2BB4A 1V2PT 1C4V2 2ZPRA 4X1SU 5LGOA 4IW4E 2OP9A 3VXFH 2GCHG 4FVDA 3SNDA 3M3VA 3LH3A 1GHAG 4ABIA 3O8DA 1SHYA 1EJNA 2B0FA 2WYGA 3FZDA 3NK8A 2OXSA 3LGUA 2ZG0H 2EI8A 3FAOA 3M7UA 3ATIA 3M61U 4MQAA 1HPGA 4AFUA 2PUXB 1TBZH 2O8LA 1P04A 4D7GA 2ZU5A 2HNTF 2BVXH 4BANB 5GWZA 2BVRH 1P2MA 2C8ZB 3OU0A 3L3TA 1ZTKA 4UEHH 1CGJE 3KQEA 2SGDE 2W3IA 2ZDNA 1E37B 1F0SA 3TPIZ 1O3LA 3AW0A 4UFEH 4X6MA 5T6FA 4AN7A 1SI5H 1IQMA 1C2HA 3BG4C 4ISNA 1Y59T 3RC5A 4D8NA 2ZZUH 3Q77A 2Z3CA 2O9QA 2ZFQH 3AASA 1K21H 4X2YA 4KTUA 1PFXC 1QQ4A 5LPRA 1BTYA 5GIBA 1H8IH 1S82A 2ZTXA 4K1SA 1AKSB 1Y3UA 1RGQA 2A5KA 2F9NA 4NCYA 2UWLA 1SGEE 1A5GH 1V2QT 3EAJA 1BITA 1H4WA 3SJOA 3GDSA 3VGCC 2I6SA 2SGAA 2CHAB 4CHAB 2VNTA 1MZAA 4RKJB 3ATLA 4DURA 3BF6H 1ZGIA 1AUJA 3P92A 5FCRA 1H9HE 1Z71A 3RM2H 1LKBA 1K1OA 3BSQA 2W5EA 1GGDC 2XWBI 1O34A 1VITH 4BXWA 1TGSZ 3GY5A 1WQVH 2BMGB 1IHTH 4NIXA 1HRTH 1MKWH 2XBWA 4NSYA 4B75A 1GBHA 1C5UA 1TMUH 1GI6A 4MPUA 4MPWA 4ABBA 1GJ8B 2FIRH 2BX3A 1O3FA 2JETC 1VCQA 1EXFA 1J9CH 2GZ9A 3RM0H 1UCYE 3K2UA 4I8GA 1MU8B 4B2BA 2VIVA 1GDUA 1GI9B 1ETSH 1C5ZB 4AGKA 1P2KA 3JZ2B 4AG2A 4CBOA 4MDSA 2OLGA 1V2ST 3L6PA 3RXMA 2PWXA 2QXHA 2ZU1A 1HJ9A 1JMOH 2ANYA 1LVOA 3VB4A 2RA3A 1XMNB 2HPPH 4AYYB 1P03A 1SOTA 1OP8A 2Q6GA 3TIUA 1TB6H 2FXRA 3ZZ9A 2QXJA 1OWDA 2O8UA 5F03A 3QUMP 4NFFA 3M36A 2H1UA 2ZTYA 2ZI2H 1EP6A 4GHTA 1NTPA 5GXPA 2W3KA 2QAAA 1DM4B 3QZQA 4GCHF 4A5TS 2ZQ2A 5EQRA 5I46H 3ZZCA 3SUDA 1OWJA 4ZUHA 4J1YA 1VGCB 4QT8C 1MKXH 1UVTH 1DY9A 2WV5A 2FPZA 1TPSA 1MQ6A 5GDSH 2QIQA 1DWBH 2AGGX 3QTVH 1V2VT 2ZEBA 1GDQA 3LGVA 3NCLA 4OGYA 4DGJA 1FN8A 1GJ7B 1ZSKA 3SUEA 5J4QA 1DICA 2AGIX 1D3PB 1AFQB 1QGFA 2UWOA 3GYLB 3RXTA 1SPJA 1P2OA 2ALPA 2UUFB 4VGCC 3M37A 3FP6E 1O37A 4F4OC 1ZTJA 4WXIA 1ARBA 3MU4A 1UTQA 2AIPA 1MTNB 2B5TB 2J92A 2GDDA 3DHKH 4IN1A 1AE8H 1DUAA 2TGPZ 1QY6A 1CA0C 3UOUA 1C1RA 1AUTC 3M7TA 1J16A 4NZLA 1BTPA 1SFQB 1HIAB 2O8TA 4O3UA 1O2UA 2J34A 4UFFH 3NZIA 2ZHDA 1WOFA 4ABDA 1L0ZA 1O39A 1QNJA 2VWMA 1FIWA 4Y7BA 1C1OA 4NA8A 4E05H 2K1QA 1MU6B 3ZZAA 1P2IA 2PFEA 1C2DA 2P3FH 2TBSA 1MTWA 1ZYOA 3KQBA 3U98H 1UJ1A 2GD4B 4B74A 1MBMA 2VWNA 1YCPH 3O8RA 3PLKA 2P8OC 1BT7A 2D8WA 4K60A 1KXDA 2GCTB 2ODQA 1S0QA 3BTFE 3QX5H 1PQ8A 5GJ4B 1NU7B 1KXFA 5HXFA 1C1UH 1O30A 1H8DH 5F6MA 1GMHG 3D65E 3LC5A 1CHOG 2FODA 5L6NH 1KXEA 3TH4H 1NU9A 5DO4H 2I6QA 3PMBB 3ATWA 2F3CE 1TNJA 2XW9A 1LVYA 5C2ZA 4BTIB 1LPGB 1YCPK 1EPTB 4R8TB 1BOQA 1B5GH 2PLXA 3MH7A 1MD8A 2ZU4A 4A1VA 4ABAA 3MNCA 1UTKA 3LH1A 4IN2A 1H9LB 1HJ8A 3ATMA 2G8TA 1ZGVA 1EATA 4J2YB 2G5VA 3N7OA 2BY8X 1E36B 1WUNH 1CA8B 2G51A 4NIWA 3UOPA 4OS1A 2XXLA 2FLRH 1OP0A 2GMTC 2CJIA 1V6DA 4FU7A 3SGAE 4YT7H 3KGPA 2CN0H 4KTSA 2ESTE 4B76A 2BD7A 1BIOA 1UO6A 5EXLA 1RIWB 2FWWA 3ZZ5A 3BTGE 1HGTH 4O9VA 1HAVB 1FLEE 4GVUA 2OTVA 3F6UH 2Q6FA 4MNXA 1OWEA 1QL7A 5LPEA 5IDKA 1AWHB 1EQ9A 2F91A 3Q76A 4I8KA 1P02A 8KME2 1NFYA 1OWKA 1C1MA 1TALA 5DP3A 2BY7X 1CQQA 1GBEA 4Y76A 4XFQA 1PYTC 4NA9H 1TNLA 2ANKH 1C1NA 3HGNA 3SU0A 1FY3A 5JDUB 3M7QA 1BBRK 3SOSA 5C20A 4ZKSU 2KAIB 1ARCA 2XWAA 4WXVA 1GJBB 1K28D 1N8OB 1GJ6A 1YLCA 1LCYA 3GYMA 3SHAH 3T27A 2VIPA 1EZQA 1FY4A 2GCHF 1C1TA 1QIXB 3H7OA 3MO3A 1PPFE 1O35A 3ATKA 1GHAF 1KSNA 4YOIA 3SV8A 1FQ3A 2VWLA 1YGCH 1UCYH 2SGEE 2C4FH 1TRNA 1SQTA 3V7TA 2XRCA 2BLQA 4H6TA 5DJ7A 1G30B 4ASHA 1WSSH 2Y6TA 1K1JA 2OC7A 4K1EA 4CRGA 4JZDH 1PPGE 2VGCB 4XBDA 1AGJA 3FVFB 1HBTH 3SU5A 3A83A 2C93B 1O3MA 2H9EH 1TFXA 3T28A 3E1XB 3M5NA 2ODYB 3LPRA 4Y7AA 2ANMH 1TA2A 2WINI 2BDAA 2QCYA 3TNSA 3Q3YA 1Y5AT 1PPHE 4XOJA 1EZUC 2ZFRH 1WBGB 1RTFB 2B9LA 5C5OA 4KP0A 1Z6JH 5F8ZA 1WTGH 1C2IA 4UD9H 1TRMA 4U30A 2WPKS 2Z9LA 1W0YH 2OC8A 4GAWA 4Y6DA 5EOKA 3E90B 2AMQA 2QXIA 5JPMH 1QRXA 2G4TA 5E0GA 3UQOA 2OUAA 2ZNKH 1ORFA 2H5CA 2BD5A 1CU1A 1Y3XA 1O5CB 5L2YH 5CHAC 4FVBA 1WQSA 1AU8A 1GHYH 2IJOB 3PMJA 1CBWC 1W10U 1O3OA 4WMEA 1JBUH 2J2UA 4BTUB 8GCHG 1QTFA 1EB2A 4H4FA 2BLWA 2RDLA 2BOHB 1DLKB 1QJ6B 2GV6A 4JK5A 1EAUA 4KGAA 1FZZA 2A32A 2NU2E 1HAPH 3ZV9A 4ABFA 1V2KT 1NESE 4NIYA 3BTTE 3M35A 1OXGA 4ABEA 5TCAA 1O36A 1LQEA 1UHBA 4FUHA 4Q7ZA 4DIHH 5FBIA 3EA7A 1P11E 3KIDU 3E16B 3PWCA 1EB1H 3SW2B 1MD7A 7LPRA 2BY5X 1L1JA 1HYLA 4GSOA 1KY9A 4E7RG 4PROA 1LO6A 3K6ZA 2Y80A 4ZHMU 3T26A 1AQ7A 3RXHA 2FM2A 1O3JA 1TBQH 2XBYA 1D3QB 3QWCH 4M7GA 5A2MH 4HI3A 1WYKA 1GMCG 3LONA 1EZXC 1TPAE 4CBNA 2ZDKA 2IPHA 2V0BA 1O2XA 3SJKA 1A7SA 1FMGA 2ZHFH 3RMMH 4CH2B 3A7WA 1D3DB 1G3DA 1ELAA 1XUJA 2FLBH 1C5WB 2TGDA 1E0FD 1OWIA 1DFPA 1AZZA 1GBFA 2A7CA 3RMNH 1LTOA 1GI0A 4DG4A 4H6SB 2FOGA 1IQFA 3C1KA 1AE5A 5DG6A 1PQ5A 7ESTE 1YLDA 5SGAE 1ELEE 1UVUH 1IQLA 1V2UT 1TX6A 1DDJA 2ZHQH 2Z9GA 3D23A 1Y3VA 1A5IA 1T8LA 2SNVA 4BNRA 1O3BA 4HFPB 3RU4D 4K3JA 1UK2A 3V3MA 1PYTD 2Y5GA 3M5OA 1C5LH 3SGQE 1CHGA 3SHCH 3WY8A 1ZHRA 4LK4A 4FUEA 1NRRH 1BUIA 2PGBB 2J94A 1K1IA 2FOMB 4JMYA 1GMDG 4AFZA 1C1QA 6CHAC 1KLIH 1ZRBA 4IMZA 1DS2E 2OQUA 3RXLA 3FFGA 1OX1A 2B7DH 2Z7FE 1JXPA 2FX4A 1PPBH 3T2NA 3MNXA 3GCNA 4OS4A 1O5FH 2BD9A 2TIOA 3DFJA 2CXVA 3MTYA 2BYAX 2FMJA 3UUZA 4B2CA 4UFDH 1IQEA 2A0QB 2SFAA 2FESH 1QRZA 2PSXA 4O97A 1VCPA 2F9VA 2Y82A 1KTSB 1G9IE 1FAKH 4NZQA 1C4Y2 1RFNA 2ZFFH 1AN1E 1KDQB 1G2MA 4KELA 1CO7E 1UVOA 2G5NA 4MNYA 2BOKA 3MI4A 3U9AH 1THSH 3E3TA 1Z1IA 2VWOA 1O2PA 1VITG 3TGKE 1AVXA
chains in the Genus database with same CATH superfamily
1MAXA 5A09A 1GBTA 1DLEA 4OS2A 1UTPA 3L33A 1G2LA 2A4RA 1T32A 2ASUB 4YESB 1DPOA 1GMHF 3BV9B 3HK3B 1CHOF 1K1MA 2CGAA 4FUJA 3SJIA 1O2ZA 4ISLA 2J38A 1KTTB 5CHBA 1W8BH 1FY1A 1QA0A 3SU2A 1OPHB 1C2FA 3R0FA 1ZOMA 3PWBA 4A7IB 5C1XA 5EW2H 3VB6A 2OK5A 1EP5A 2QXGA 1IQJA 1T8OA 1TQ0B 2BLOA 2C8WB 3N7EA 2BQ7B 3ZV8A 1EX3A 3OYPA 1YPHC 1DY8A 3MU5A 1F7ZA 4MPXA 1GL1A 5EPYA 1DWCH 4RKOB 3S7HB 4ASUD 4BAQB 1TGCA 3HK6B 4CREA 4I8HA 2V3HH 4X6NA 3A7TA 3ITIA 2WUCA 5DSFA 1HXFH 4ISHH 4MPVA 4M9FA 4X8TH 1FI8A 3A7ZA 2A2QH 3T29A 2BVSH 3E0NB 1D3TB 1TGTA 3GY6A 1GJAB 3C27B 2RCEA 1LHCH 5F8TA 1RD3B 1V2MT 3RDZA 4B73A 4U01A 5FPTA 3SZNA 4SGBE 1ZMJA 1OS8A 1SG8B 1IHSH 1S85A 2ZCLP 2GZ7A 1XUGA 2VBCA 2WPJS 2R0LA 3S7KB 2G52A 3T5FH 4BOHA 1EJMA 1Z8RA 2GGVB 5E0JA 4IMQA 4FU9A 1OKXA 1O3HA 3Q00A 4X2VA 1SGIB 1O3KA 1O5AB 1P3CA 1W2KH 3QTOH 1NT1A 1ABJH 3QO6A 1TNGA 1PPEE 3R3GB 3O8CA 5AHGH 1YPHE 1ANBA 1T7CA 4Q2KA 1O38A 2H6MA 1BMNH 1O5BB 1MH0A 1PQAA 3A84A 1O31A 3PO1B 1NM6A 2UUYA 1TRYA 2PKSB 4JK6A 5HM9A 5T3HA 1AZ8A 3T62A 3OTPA 3VB3A 2Z3DA 1RRKA 2QGRA 1XXDA 1S6HA 1O2HA 2LP6A 1XKBC 1QBVH 1XUIA 4Y8XA 1MZDA 5C1UA 4OGXA 4YOJA 1O5DH 3LGTA 2VU8E 5HIZA 3ZYDA 2O8MA 2HNTE 1MKWK 4E7NA 2VH0A 4BAKB 2JIZD 3OX7U 3ZVDA 3BEIB 5FX6A 3ZVEA 5AF9H 1HUTH 1G3CA 1LDTT 1YPJH 3F9HA 1VZQH 3UWJH 1TWXB 1G3BA 4RN6A 3RXVA 3BTWE 1MCTA 1HXEH 1NROH 1TNHA 2ILNA 2Z9IA 3SBKA 1YPMH 1QBNA 1CSOE 2G81E 2AYWA 1C2GA 1S83A 4U32A 4OS6A 3E91A 1ZJDA 4UFGH 1W3CA 1MAYA 1K22H 4TT3D 4CRFA 1P0SH 4TPYA 2OD3B 4ISOA 1ELDE 3FANA 4MVNA 3SU3A 3TU7H 4LXBH 2WZQA 1WCZA 2ZGHA 1HJAC 3U8TH 2BY9X 1C5QA 1N6XA 2ULLA 4X8UH 2YOLA 4Q7YA 1C5XB 2XNDD 1GG6C 3F3BA 5GCHG 1CVWH 3H7TA 1TBRH 1O2RA 2PSYA 1BA8B 1EUFA 1KXCA 5BRRE 8LPRA 1GDNA 1HAIH 4XBBA 3WWBA 1OYTH 1BDAA 1FJSA 1BJUA 3QK1A 8GCHF 2VIQA 4X6PA 1HAOH 1TABE 3RXEA 3URCA 3K9XB 1MKXK 2ZU2A 1ZPBA 3FO8D 7GCHG 3ZZDA 4B2AA 3BIVH 1AKSA 1P2JA 4HGCA 3PM3A 5HMAA 2SGFE 1UVSH 3KEEA 5EG4A 3AAUA 3G01A 1GHZA 2ZFTA 1O2MA 4FXGH 3A8BA 1C5OH 1ETTH 4UE7H 5E0HA 2YNAA 3GCHC 1YLNA 5HM2A 2FTMA 4NGAH 1BTHH 4IGDA 1AB9C 3UFAA 1K1LA 2V35A 4NG9H 1O2IA 2BZ6H 2Z9KA 5EGMA 1ELGA 2QA9E 4XE4A 1TLDA 1KLTA 4TYDA 2F9PA 3PLBA 5DPAA 2Y7ZA 4I8LA 4CRBA 2ZIQH 1O2SA 4B71A 1SQRA 1N6YA 3RMOH 1YF4A 3RXDA 3GCOA 1ABIH 1GMCF 4AOQA 3LC3A 3A8DA 5DP6A 2NU3E 1F92A 4X0WU 4YLQH 1NRNH 1C9TA 1NFUA 1GI1A 1ZHPA 3MHWU 4K5ZA 1ZPCA 1HV7A 4TY6A 3U8OH 5EJZA 5DP9A 2VVVA 3S69A 3SI3H 2FI5E 2Z94A 1TGNA 4X8SH 1ELTA 2TGTA 1GI2A 3I29A 5G4BA 1SR5C 2QF3A 3UR6A 5A8ZA 2A5IA 4SGAE 3ODDA 2ZP0H 3UNRA 4A6LA 1G36A 3W1EA 1J17T 1QCPA 4IBLH 5JBCS 1NBME 5DP7A 1EOJA 1FNIA 1V2JT 5LH8A 2BX4A 1SGRE 4X1RU 2PKAB 5A8YA 1GHBG 2EEKA 1XVOA 1O3NA 2A1DB 2RDEA 4AFSA 4UONA 3UQVA 1A1RA 1YM0A 1SB1H 1T31A 2CV3A 5K7RA 1FX0B 2CMYA 2ZQ1A 4WJG2 5TJXA 1P9SA 1O33A 9ESTA 3F68H 2PR3A 2FS8A 1K2I1 4FUBA 2WPHS 2GKVE 3MU0A 3O8BA 3E8LA 2ZPSA 1L2EA 3HPTB 1K1NA 3F1SB 1NFXA 3A7YA 3RLYH 1ZZZA 1GMDF 2GDEH 1LPKB 1CT0E 1OYQA 3ZIAD 1SLVB 1BTZA 3QGJA 1C2LA 1SLUB 5C0UA 2OQ5A 4UDWH 5PTPA 1O2KA 1C1SA 3LOXA 3KHVA 1C1WH 1T8NA 3IITA 3W94A 1Y3WA 1O2WA 1P10A 4DOQA 1ZPZA 4JYTA 5EODA 4ZH8A 3KCGH 1TNIA 1BHXF 4Z1MD 1Z8JB 4FUCA 1H8ED 2BD4A 2WPLS 1GI7B 1V2RT 3PV5A 3RP2A 3A89A 2A4OA 3UIRA 2VINA 1UTJA 1GJ5H 1H1BA 1HAYB 2ODPA 1G32B 1JWTA 1F5RA 3FZZA 1A5HA 5E8EH 2K7XA 1THRH 3DFLA 1G3EA 1DT2A 3P17H 1SGDE 2GT7A 3RU4T 1ELFA 3TH2H 1SLWB 4ZKRU 2ZHEH 1U6QA 4D9QA 2DE8A 2EY4C 3VGCB 6LPRA 3ZVAA 4YM9A 1WDIA 1HIAA 2QF4A 1THPB 1VITF 2BDBA 2CF8H 3SO3A 3SQHE 1YPEH 3GDVA 3TK5A 3A7XA 3VB5A 1XVMA 1GGDB 5HGGA 1DVAH 1GVZA 3SJ9A 4IC6A 3VXEH 4FU8A 3VG8A 1TYNA 2XTTB 3V13A 1ELCA 3MQKC 4JZIA 3RXUA 4GPGA 2V7QD 1O3IA 1SGTA 1VR1H 3EYDA 3RXJA 3TVJB 1HFDA 2VIWA 3GICB 3HGPA 2KZ4A 1MTVA 1UCYK 3M3TA 1A61H 2PHBA 2W26A 4ACAA 1EZSC 2TGAA 1YPKH 3F2FA 2KCAA 2DE9A 2JETB 3PTBA 4Y71A 3PMHB 2A45B 1EFRD 1O2VA 3UREA 2O8WA 2QF0A 2R2MB 1YC0A 3PMAB 4FOUC 2XC4A 1E38B 3A85A 1W7GH 1GJ9B 1TOMH 2BY6X 1BQYA 3RXCA 1EPTA 1ANCA 4YO9A 3SV2H 2AGEX 4WH6A 3ZVCA 6ESTA 2CHAC 4CHAC 2WUBA 2YNBA 3BN9A 8ESTE 5JB8S 1FONA 1XUFA 3MNBA 2KCOA 3F0OA 3MO9A 3U69H 4JYUH 2NU0E 1P8VC 3EA9A 4MLFB 1Z8GA 5FXLA 3IG6B 3D49H 2R3YA 2ZU3A 3VEQB 2RFKC 1ZRKA 4Z0KA 3UPEA 3ODFA 5EQSA 4BAOB 1SGYE 4ZXXH 2F9OA 1RJXB 5B6LA 1PPZA 1W0KD 1XX9A 2C3SA 4X1NU 5DKMA 3TLOA 3SV7A 3E0PB 2BQWB 1HAVA 4ABGA 5A0CA 3P8GA 3PO1C 1BZXE 3B8JA 2G00A 2FO9A 4KTCA 1J14A 4NFEA 1FY8E 2OCVB 3OFND 3K6YA 1QL9A 5A0BA 1C1PA 3PTNA 4AGJA 3RXGA 5T6GA 3SU6A 1QURH 2DUCA 1C1VH 3RLWH 2SGQE 1UMAH 1F2SE 5C5NA 2JKHA 4VGCB 5C3NA 1ZR0A 3PB1E 5GNDA 1UK4A 5FPSA 5CMXH 1SGQE 2KAIA 2BDCA 1W12U 6GCHG 2ZC9H 4RSPA 2C90B 4OS5A 2FI3E 1VJAU 1CA0B 1DSUA 3TJOA 5F8XA 4I7YH 2STAE 4WY3A 4Q63A 3V12A 5EXNA 3CS0A 4B1TA 1J8AA 1CE5A 1AY6H 5DK1A 1EKBB 5T1VA 1VGCC 1XUHA 4Y10E 4MTBA 1HAXB 2K0QA 3MH6A 3SN8A 1TAWA 4HTCH 2THFB 1O2LA 4B6FA 1P09A 1AD8H 1SQAA 2A5AA 3MO6A 3P8OA 3RC6A 4U2WA 1YPLH 2ANWA 4Y0YE 2W6ID 2WPIS 4K2YA 1GVKB 2JH6D 5FX5A 2VB0A 1V2TT 3SYJA 1QBOA 3PV4A 1AO5A 4Y8ZA 2BZAA 1AFQC 2ZDAH 1FAXA 2P8OB 1O32A 3KN2A 1SOZA 1INCA 1IOEA 3LT3A 3V0XA 4LOYH 1O2YA 1BMLA 2F4LA 1BTXA 3BTQE 2CF9H 1FUJA 1WAYB 2QY0B 2F83A 5GCHF 4DIIH 2Q1JA 2XNIA 4CRDA 2FOCA 1S0RA 1S84A 2BD2A 1MTNC 4YOGA 1RS0A 1T4UH 1A0HB 3SGBE 2ZKSA 2ZO3H 1ZLRA 1GBMA 1QB1A 5H4IB 3RXIA 2AFQB 4K1TA 4BAHB 1DANH 1QB9A 2ZCHP 3OTJE 7GCHF 1S5SA 2HVXA 1CT4E 3CS7A 2XC5A 1SGFA 2PUQH 1ZJKA 3DSPA 3MFJA 3P8NA 3GY7A 4MNWA 3K65B 2Y81A 3A7VA 2B8OH 5HYOA 2A7HA 2W7UA 1AI8H 3QLPH 3DSOA 1UK3A 1A0LA 1GJ4H 1MBQA 5DP5A 4FUIA 4NIVA 4HG6A 2AS9A 2BD8A 2FI4E 1OWHA 2QN5T 2GMTB 1OHHD 1YYY1 2PTNA 1C5PA 3ZYEA 2PW8H 1QR3E 5AFYH 5J4SA 4GUXA 5FBEA 2IOTA 1GBAA 2GCTC 1HB0B 2AEIH 2M5TA 1VKYA 2STBE 1F0UA 2AH4X 2V6NA 2ZGBH 2BDGA 1TGBA 3HKJB 2ZHWH 2AIQA 4DVAU 4I32A 1QJ1B 1LHGH 1ACBE 4WH8A 3ZVBA 1ZSLA 2H9TH 1EAIA 2WPDD 1E34B 1LVMA 3FP7E 4BXSA 4CR5A 1EPTC 1Y3YA 5LPFA 1SC8U 1DXPA 1TMBH 2VIOA 5HKKD 2BTCE 1HAGE 4CRCA 3STJA 4INLA 2AMPA 1ESBA 2FS9A 1BMMH 1QB6A 2BDYA 3S9BA 1BRCE 1QHRB 1GHBF 4X6OA 1BHXB 4ZKOU 1BMFD 4TWYA 4I8JA 3SJ8A 1Y5BT 1B0FA 4GHQA 3EQ0H 5DGJA 2LIZA 2H2ZA 1O5EH 1NZQH 5FHTA 1JIRA 1RIWC 1SGNE 2ZGXH 3SNBA 4WMFA 4NWKA 3GCTG 3S9AA 4K69A 2YMSD 5KEDA 2FZZA 1J15A 2GV7A 1UTMA 3PROA 2CK3D 1Y5UT 1MTUA 1P57B 1V2LT 2KCYA 5I25A 1VCWA 2XBVA 1ZHMA 4D9RA 2ZPQA 1NRSH 3LJJA 2XBXA 4LZ1H 3ZZ8A 3Q3XA 2Z3EA 4I33A 1D4PB 1FPHH 2HNTC 4KKDA 1C5NH 2GZ8A 1JOUB 4AB8A 1YWUA 4A1XA 4A1TA 2ZFPH 1RTLA 1XXFA 1K1PA 3ENSB 2KFWA 3B23B 4DCDA 1BRAA 4JZ1A 1IQGA 1BBRE 2ZWLH 1N8OC 3RUOA 3VB7A 2VH6A 3SI4H 2OBQA 1AFEH 2BXUH 1BTWA 1LVBA 2EQNA 1C5MD 1GBJA 1T8MA 1S6LA 2F9UA 2FTLE 1GBCA 2WV4A 1P05A 1A3BH 4Y8YA 1G37A 4DJZB 3T25A 2SNWA 1GI5A 2GP9B 1OP2A 2VVCA 1F0TA 1KLJH 1VJ9U 5HIYA 5CHAB 3OY5U 2R0KA 1MUEB 2P59A 5EJLA 3NPSA 4YLUA 2WYJA 1A46H 1CBWB 2Z6BD 2VGCC 1L4DA 5E2OA 3BEFB 3UWIA 1HAHH 3MNSA 2Y7XA 4YXWD 2ZGCA 2A2XH 3ZZ6A 2G55A 3NKKA 1QL8A 1S81A 4JZFH 3SORA 3CP7A 3SNEA 3P6ZB 3TH3H 3SV9A 3MOCA 3F9EA 1O0DH 4AZ2B 5FCKA 1KDQA 1GBLA 2YMSB 1NRQH 1F5LA 2BM2A 3F9GA 1W7XH 1SSXA 4ZROA 1WTHD 1SMFE 2FOBA 3OE7D 1C4U2 1O3GA 1EJAA 5JBBS 2ZFSA 5DN6D 1PPCE 1O3PB 1OOKB 1GI4A 4RT0A 3A80A 2R3UA 3MH5A 4IC5A 4FUFA 3CENA 3GISB 3LGWA 4WWYA 1GHWH 1C9PA 1ELVA 3DA9B 5IYTA 1FPCH 1F5KU 1CT2E 4CRAA 3TNTA 3MU1A 2FOHA 1O2JA 1MQ5A 3QDZB 2BHGA 2R2WU 1SGPE 1JRSA 1JIMA 2NU4E 1N1LA 1BB0B 3EE7A 3PYHA 1K9OE 3OAAD 3P95A 1T4VH 3LGIA 1GWAA 1A0JA 2Q6DA 1AVGH 2OINA 2UUKB 3MH4A 1L1GA 2BLVA 4ZAEA 1IQHA 4Q7XA 5AVDA 1GHXH 2J9NA 3MU8A 3BTKE 4MG3A 3U1IB 4YT6H 2WPMS 3SUGA 1LQDB 1F0RA 5JBAS 4XD7D 3RMLH 2TRMA 1M9UA 1A3EH 1P3EA 1BRUP 1ETRH 3GY8A 1IQNA 1GI3A 4FUGA 3ZVFA 3TGJE 2G4UA 1P2QA 1MMJN 3EE0B 4AORA 2HGTH 4Y11E 2JH5D 1TNKA 4ABHA 1C2MA 3ZZ7A 1Q31A 1OSSA 1KXAA 4X2WA 1EOLA 1YBWA 5L2ZH 2WHXA 1UTOA 2ZA5A 5AFZH 4ESTE 1HLTH 6CHAB 4X1QU 2ZF0H 3W95A 1BRBE 4H42U 5IK2D 1FV9A 2D2DA 6GCHF 1W0ZU 2HRVA 1DX5M 3AK5A 3U1JB 3ESTA 1GCTB 3KQDA 5T6DA 3A82A 4NSVA 1YKTA 3ZVGA 3TJNA 3IWMA 1W13U 5EQQA 1L1NA 3HATH 3EBNA 1Y8TA 1GPZA 1AWFH 4THNH 2BD3A 1E1QD 4O03A 1CGHA 7KMEH 1H9IE 2FYQA 4A92A 3RXAA 4HZHA 5ETXA 1KYNA 3N7DA 3OY6U 2TPIZ 3E6PH 1O2GH 5EU8A 2BDHA 2Z9JA 3D62A 1RXPA 2FX6A 5C0TA 5CE1A 4I31A 4NA7A 5JB9S 4F49A 4Z6AH 2A31A 1AIXH 1YPGH 3AVZA 4YTAA 1GJDB 1TPOA 4INHA 4E06H 1S6FA 1ZSJA 1C5RA 1GJCB 2XOKD 1YP9A 1Z7KA 1SGCA 1SVPA 1TONA 2JDID 1ZTLA 1D6RA 2IN2A 3F9FA 4ACBA 1QRWA 2ZDMA 1D6WA 1SFIA 1IQKA 2VIDA 4AB9A 3EDXB 1W14U 3VPKA 3WWFA 3GDUA 3WW7A 1B0EA 1GHVH 3RXPA 3RXBA 4D7FA 3BTME 5EXMA 2V3OH 2HOBA 3SNAA 2P94A 3BG8A 5ABWA 4CH8B 5FPYA 2IPQX 1QQUA 3I77A 1C5SA 1PQ7A 3RC4A 3GY2A 1ANDA 1P01A 1TX8A 1TOCB 1PJPA 5E2PA 3UNSA 4TWWA 2HPQH 3FKSD 2QC2A 1QFKH 2HLDD 1EAXA 4BAMB 4XDEA 1ANEA 5B6OA 2A7JA 2P16A 1ID5H 1LKAA 3BG4B 2KCPA 3PRDA 4FUDA 1Z8IB 2J4IA 1UW7A 1XUKA 5FL7D 5FAHA 4ZMAH 1BBRH 3KL6A 1NO9H 1C5YB 2P3UB 2FYRA 2UWPA 2P93A 1UHBB 1LMWB 2V3MA 3UNQA 1WU1A 1TIOA 4LZ4B 4JCNA 1GBIA 5L30H 3TITA 1QJ7B 4XBCA 5JYIA 4ZHLU 1ESAA 3M5MA 5EPNA 2C8YB 3ZZBA 2D1JA 1D9IA 2C8XB 3URDA 1SHHB 1B7XB 1Z1JA 3S0NA 3KF2A 3BTDE 4B6EA 2A4QA 3DUXH 3TJUA 2JJ1D 1AVWA 5TCCA 3STIA 4D76A 3LU9B 3EA8A 1RTKA 5EW1H 2Y5FA 5ESTE 5EJ1A 1V2WT 1EAWA 1QA7A 1L4ZA 2R9PA 3VFEA 3ZZ3A 3BTHE 4K8BA 1NPMA 2QV1A 3A81A 1O3CA 1SGFG 1GBDA 1GBKA 3SU1A 3MWIU 2P3TB 1DE7H 4JYVH 2KX4A 3JZ1B 1UVPA 1O5GH 1C2JA 2UUJB 2LPRA 1FXYA 3U28C 2JJ2D 1YCPM 3BEUA 2PTCE 3SU4A 4CR9A 3A87A 1O3DA 3SUFA 5C67A 1C5VA 4AYVB 2HLCA 3GCTF 2ZDLA 5EIYA 1KXBA 1FIZA 3GY3A 3OSYA 1E35B 4AG1A 3RU4E 1NBMD 1O3AA 2OC0A 3TK6A 3B9FH 3A88A 2PKAA 3HKIB 1XM1A 1EASA 1SL3A 1AHTH 3BIUH 3SQEE 4BTTB 4GCHG 1AMHA 1P12E 3RXOA 3UR9A 1DWDH 4DW2U 1NS3A 1NFWA 1HNEE 1C2KA 1HDTH 2JH0D 2ALVA 4AFQA 1NN6A 4Q80A 3KQCA 3LKWA 2XC0A 3RXRA 2AHME 2FDAA 2IJD1 1W11U 1O2NA 1BTUA 4JZEH 2A4GA 5DP4A 2HWLB 3A86A 3ZZ4A 1DSTA 2BDIA 3P70B 2XCNA 4X8VH 2PV9B 1P9UA 2PKSC 4WMDA 1TA6A 3RXQA 4X1PU 3DT0H 4MNVA 1GBBA 2BXTH 2OBOA 2L6OA 2SGPE 4OM9A 4Y79A 1HJAB 3RXKA 2FP7B 1GG6B 3UTUH 5A0AE 3TK9A 2EA3A 1X7AC 3LJOA 4GLYA 9LPRA 3F2HA 1GL0E 3I78A 1A2CH 1NY22 3KQ5A 4WF8A 1O2QA 3H5CB 4X2XA 5C1YA 1A4WH 2OC1A 3Q3KA 1LPZB 2ZCKP 1FDPA 2W7SA 5DP8A 2RG3A 3QGNB 2LNCA 3RXSA 3TJVA 5JBTA 5BPEA 1BMAA 1TPPA 2J97A 2PP6A 2EI7A 2ZGJA 3GCHB 5ESBA 2GVFA 3MYWA 1AB9B 4OS7A 1TMTH 4ZHAA 1IQIA 1V3XA 4INKA 1C2EA 1UTNA 3LIWA 3M5LA 1KIGH 2KR7A 4TY7A 3RXFA 1DUEA 1P2NA 1WV7H 4ZXYH 3FP8E 1UTLM 3LDXH 1GVLA 1O2OA 4Y0ZE 2J95A 3SV6A 5K0HA 1KMHB 2GT8A 1ELBA 1NRPH 1K0HA 3P8FA 1HCGA 3U8RH 3S9CA 2NU1E 3M3SA 4DY7B 2ZDVH 3NUMA 2EI6A 1SLXB 2AERH 1V2OT 3ELAH 1FY5A 3UY9A 3TGIE 1ZMLA 2D26C 2P95A 2VJ1A 3N99A 5KECA 2H5DA 1HAZB 4IS5A 3EGKH 4R0IA 4AX9H 1TE0A 3GY4A 3NRLA 3NXPA 2NWNA 3NWUA 2F9BH 3PLPA 2VVUA 3LGYA 4NWLA 4WVPE 1DITH 3KNXA 2GX4A 2BQ6B 2XCFA 2ZTZA 1FN6A 1W0JD 2AMDA 2GTBA 1C5TA 3A8CA 3CNRA 4ISIH 1MCVA 5A8XA 2PGQB 3BTEE 1ESTA 1DOJA 5GPIB 1IAUA 1GI8B 3MMGA 2ZECA 1MTSA 1P06A 1SBWA 3A8AA 1SQOA 2H9HA 2EC9H 1LHEH 1H8HD 1Z6EA 1DWEH 1V2NT 2J98A 1CGIE 1BJVA 3QZRA 2RA0A 4YZUA 2WSSD 3QN7A 1DXWA 1SKYE 1GCTC 1LHFH 1O2TA 1GCDA 4O3TA 4ZKNU 2FOFA 1XKAC 3DD2H 4XSKU 1ZMNA 4DT7B 2FOAA 2HALA 3SNCA 4ABJA 2FEQH 2XYAA 4TPIZ 2QE7D 4K8YA 2FOEA 1Q3XA 2QYIA 3AW1A 1COWD 1BCUH 1NC6A 2Y5HA 3GOVB 1JRTA 1TX7A 1O3EA 1Q2WA 1TQ7B 3AAVA 1LHDH 2BB4A 1V2PT 1C4V2 4RT1A 2ZPRA 3OEHD 4X1SU 5LGOA 4IW4E 2OP9A 3VXFH 2GCHG 4FVDA 3SNDA 3M3VA 3LH3A 1GHAG 3SZEA 4ABIA 3O8DA 1SHYA 1EJNA 2B0FA 2WYGA 3FZDA 3NK8A 2OXSA 3LGUA 2ZG0H 2EI8A 3FAOA 3M7UA 3ATIA 3GS9A 3M61U 4MQAA 1HPGA 4AFUA 2PUXB 1TBZH 2O8LA 1P04A 4D7GA 2ZU5A 2HNTF 2BVXH 4BANB 5GWZA 2BVRH 1P2MA 2C8ZB 3OU0A 3L3TA 1ZTKA 4UEHH 1CGJE 3KQEA 2QF5A 2SGDE 2W3IA 2ZDNA 2W6JD 1E37B 1F0SA 3TPIZ 1O3LA 3AW0A 4UFEH 4F55A 4X6MA 5T6FA 4AN7A 1SI5H 1IQMA 1C2HA 3BG4C 4ISNA 1Y59T 3RC5A 4D8NA 2ZZUH 3Q77A 2Z3CA 2O9QA 2ZFQH 3AASA 1K21H 2GJGA 4X2YA 4KTUA 1PFXC 1QQ4A 5LPRA 1BTYA 5GIBA 1H8IH 1S82A 2ZTXA 4K1SA 1AKSB 1Y3UA 1RGQA 2A5KA 2F9NA 4NCYA 2UWLA 1SGEE 1A5GH 1V2QT 3EAJA 1BITA 1H4WA 3SJOA 3GDSA 3VGCC 2I6SA 2SGAA 2CHAB 4CHAB 2VNTA 1MZAA 4RKJB 3ATLA 4DURA 3BF6H 1ZGIA 1AUJA 3P92A 5FCRA 1H9HE 1Z71A 3RM2H 1LKBA 1K1OA 3BSQA 2W5EA 1GGDC 2XWBI 1O34A 1VITH 4BXWA 1TGSZ 3GY5A 1WQVH 2BMGB 1IHTH 4NIXA 1HRTH 1MKWH 2XBWA 4NSYA 4B75A 1GBHA 1C5UA 1TMUH 1GI6A 4MPUA 4MPWA 4ABBA 1GJ8B 2FIRH 2BX3A 1O3FA 2JETC 1VCQA 1EXFA 1J9CH 2GZ9A 3RM0H 1UCYE 3K2UA 4I8GA 1MU8B 5CDFE 4B2BA 2VIVA 1GDUA 1GI9B 1ETSH 1C5ZB 4AGKA 1P2KA 3JZ2B 4AG2A 4CBOA 4MDSA 2OLGA 1V2ST 3L6PA 3RXMA 2PWXA 2QXHA 2ZU1A 1HJ9A 1JMOH 2ANYA 1LVOA 3VB4A 1YY3A 2RA3A 1XMNB 2HPPH 4AYYB 1P03A 4FETA 2L74A 1SOTA 1OP8A 2Q6GA 3TIUA 1TB6H 2FXRA 3ZZ9A 2QXJA 1OWDA 2O8UA 5F03A 3QUMP 4NFFA 3M36A 2H1UA 2ZTYA 2ZI2H 1EP6A 4GHTA 4I86A 1NTPA 5GXPA 2W3KA 2QAAA 1DM4B 3QZQA 4GCHF 4A5TS 2ZQ2A 5EQRA 5I46H 3ZZCA 3SUDA 1OWJA 4ZUHA 4J1YA 1VGCB 4QT8C 1MKXH 1UVTH 1DY9A 2WV5A 2FPZA 1TPSA 1MQ6A 5GDSH 2QIQA 1DWBH 2AGGX 3QTVH 1V2VT 2ZEBA 1GDQA 3LGVA 3NCLA 4OGYA 4DGJA 1FN8A 1GJ7B 1ZSKA 3SUEA 5J4QA 3FN8A 1DICA 2AGIX 1D3PB 1AFQB 1QGFA 2UWOA 3GYLB 3RXTA 1SPJA 1P2OA 2ALPA 2UUFB 4VGCC 3M37A 3FP6E 1O37A 4F4OC 1ZTJA 1E1RD 4WXIA 1ARBA 3MU4A 1UTQA 2AIPA 1MTNB 2B5TB 2J92A 2GDDA 3DHKH 4IN1A 1AE8H 1DUAA 2TGPZ 1QY6A 1CA0C 4AC9A 3PRBA 3UOUA 1C1RA 2WV9A 2M2AA 1AUTC 3DSGA 3M7TA 3FOAA 1J16A 4NZLA 1BTPA 1SFQB 1HIAB 2O8TA 4O3UA 1O2UA 2J34A 4UFFH 3NZIA 2ZHDA 1WOFA 4ABDA 1L0ZA 1O39A 4DT4A 1QNJA 2VWMA 1FIWA 4Y7BA 1C1OA 4NA8A 4E05H 2K1QA 1MU6B 3ZZAA 1P2IA 2PFEA 1C2DA 2P3FH 2TBSA 1MTWA 1ZYOA 3KQBA 3U98H 1UJ1A 2GD4B 4B74A 1MBMA 2VWNA 1YCPH 3O8RA 3PLKA 2P8OC 1BT7A 2D8WA 4K60A 3PV2A 1KXDA 2GCTB 2ODQA 1S0QA 3BTFE 3QX5H 1PQ8A 5GJ4B 1NU7B 1KXFA 5HXFA 1C1UH 1O30A 1H8DH 5F6MA 1GMHG 3D65E 3LC5A 1CHOG 2FODA 5L6NH 1KXEA 3TH4H 1NU9A 5DO4H 2I6QA 3KYGA 3PMBB 3ATWA 2F3CE 1TNJA 2XW9A 1LVYA 5C2ZA 4BTIB 1LPGB 1YCPK 1EPTB 3KYFA 4R8TB 1BOQA 1B5GH 1E79D 2PLXA 1MD8A 3MH7A 2ZU4A 4A1VA 4ABAA 3MNCA 1UTKA 3LH1A 4IN2A 1H9LB 1HJ8A 3ATMA 2G8TA 1ZGVA 1EATA 4J2YB 2G5VA 3N7OA 2BY8X 1E36B 1WUNH 1CA8B 2G51A 4NIWA 3UOPA 4OS1A 2XXLA 2FLRH 1OP0A 2GMTC 2CJIA 1V6DA 4FU7A 3SGAE 4YT7H 3KGPA 2CN0H 4KTSA 2ESTE 4B76A 2BD7A 1BIOA 1UO6A 5EXLA 1RIWB 2FWWA 3ZZ5A 3BTGE 1HGTH 4O9VA 1HAVB 1FLEE 4GVUA 2OTVA 3F6UH 2Q6FA 4MNXA 1OWEA 1QL7A 5LPEA 2LELA 1QZ8A 5IDKA 1AWHB 1EQ9A 2F91A 4Q4LA 3Q76A 4I8KA 1P02A 8KME2 1NFYA 1OWKA 1C1MA 1TALA 5DP3A 3DCLA 2BY7X 1CQQA 1GBEA 4Y76A 4XFQA 1PYTC 4TSFD 4NA9H 1TNLA 2ANKH 1C1NA 3HGNA 3OEED 3SU0A 1FY3A 5JDUB 3M7QA 1BBRK 4ZCNA 3SOSA 5C20A 4ZKSU 2KAIB 1ARCA 2XWAA 4WXVA 1GJBB 1K28D 1N8OB 1GJ6A 1YLCA 1LCYA 2HVYB 3GYMA 3SHAH 3T27A 2VIPA 1EZQA 1FY4A 2GCHF 1C1TA 1QIXB 3H7OA 3MO3A 1PPFE 1O35A 3ATKA 1GHAF 4P00A 1KSNA 4YOIA 3SV8A 1FQ3A 2VWLA 1YGCH 1UCYH 2SGEE 2C4FH 1TRNA 1SQTA 3V7TA 2XRCA 2BLQA 4H6TA 5DJ7A 1G30B 4ASHA 1WSSH 2Y6TA 1K1JA 2OC7A 4K1EA 4CRGA 4JZDH 1PPGE 2VGCB 4XBDA 1AGJA 3FVFB 5C94A 1HBTH 3SU5A 3A83A 2C93B 1O3MA 2H9EH 1TFXA 3T28A 3E1XB 3M5NA 2ODYB 3LPRA 4Y7AA 2ANMH 1TA2A 2WINI 2BDAA 2QCYA 3TNSA 3Q3YA 1Y5AT 1PPHE 4XOJA 5C17A 1EZUC 2ZFRH 1WBGB 1RTFB 2B9LA 5C5OA 4KP0A 1Z6JH 5F8ZA 1WTGH 1C2IA 4UD9H 1TRMA 4U30A 2WPKS 2Z9LA 1W0YH 2OC8A 4GAWA 4Y6DA 5EOKA 3E90B 2AMQA 2QXIA 3UB0A 5JPMH 1QRXA 2G4TA 5E0GA 3UQOA 2OUAA 2ZNKH 1ORFA 2H5CA 2BD5A 1CU1A 1Y3XA 1O5CB 5L2YH 5CHAC 4FVBA 1WQSA 1AU8A 1GHYH 2IJOB 4RI0A 3PMJA 1CBWC 1W10U 2J98B 1O3OA 4WMEA 1JBUH 2J2UA 4BTUB 8GCHG 1QTFA 1EB2A 4H4FA 2BLWA 2RDLA 5F53A 2BOHB 1DLKB 1QJ6B 2GV6A 4JK5A 1EAUA 4KGAA 1FZZA 2A32A 2NU2E 1HAPH 3ZV9A 4ABFA 2F43B 1V2KT 1NESE 4NIYA 3BTTE 3M35A 2YMSC 1OXGA 4ABEA 5TCAA 1O36A 1LQEA 1UHBA 4FUHA 4Q7ZA 4DIHH 5FBIA 3EA7A 1P11E 3KIDU 3E16B 3PWCA 1EB1H 3SW2B 1MD7A 7LPRA 2BY5X 1L1JA 1HYLA 4GSOA 1KY9A 4E7RG 4PROA 1LO6A 3K6ZA 2Y80A 4ZHMU 3T26A 1AQ7A 3RXHA 2FM2A 1O3JA 1TBQH 4F48B 2XBYA 1D3QB 3QWCH 4M7GA 5A2MH 3F2GA 4HI3A 1WYKA 1GMCG 3LONA 1EZXC 1TPAE 4CBNA 2ZDKA 2IPHA 2V0BA 1O2XA 3SJKA 1A7SA 1FMGA 2ZHFH 3RMMH 4CH2B 2J5UA 3A7WA 3F0PA 1D3DB 1G3DA 1ELAA 1XUJA 2K8IA 2FLBH 1C5WB 2TGDA 1E0FD 1OWIA 1DFPA 1AZZA 1GBFA 2A7CA 3RMNH 1LTOA 1GI0A 4DG4A 4H6SB 2FOGA 1IQFA 3C1KA 1AE5A 5DG6A 1PQ5A 7ESTE 1YLDA 5SGAE 1ELEE 1UVUH 1IQLA 1V2UT 1TX6A 1DDJA 2ZHQH 2Z9GA 4XRNA 3D23A 1Y3VA 1A5IA 1T8LA 2SNVA 4BNRA 1O3BA 4HFPB 3RU4D 4K3JA 1UK2A 3V3MA 1PYTD 2Y5GA 3M5OA 1C5LH 3UAIC 3SGQE 1CHGA 3SHCH 3WY8A 1ZHRA 4LK4A 4FUEA 1NRRH 1BUIA 2PGBB 2J94A 1K1IA 2FOMB 4JMYA 1GMDG 4AFZA 1C1QA 6CHAC 1KLIH 1ZRBA 4IMZA 1DS2E 2OQUA 3RXLA 3FFGA 1OX1A 2B7DH 2Z7FE 1JXPA 2FX4A 1PPBH 3T2NA 3MNXA 3GCNA 4OS4A 1O5FH 3H09A 5KGOA 2BD9A 2TIOA 3DFJA 1WXRA 2CXVA 3MTYA 2BYAX 2FMJA 2KM0A 3UUZA 4B2CA 4UFDH 1IQEA 2A0QB 2SFAA 2FESH 1QRZA 2PSXA 4O97A 1VCPA 2F9VA 2Y82A 1KTSB 1G9IE 1FAKH 4NZQA 1C4Y2 1RFNA 2ZFFH 1AN1E 1KDQB 1G2MA 4KELA 1CO7E 1UVOA 2G5NA 4MNYA 2BOKA 3MI4A 1MABB 3U9AH 1THSH 3E3TA 3TGKE 1Z1IA 2VWOA 1O2PA 1VITG 4P02A 1AVXA
chains in the Genus database with same CATH topology
1MAXA 5A09A 1GBTA 1DLEA 4OS2A 1UTPA 3L33A 1G2LA 2A4RA 1T32A 2ASUB 4YESB 1DPOA 1GMHF 3BV9B 3HK3B 1CHOF 1K1MA 2CGAA 4FUJA 3SJIA 1O2ZA 4ISLA 2J38A 1KTTB 1W8BH 1FY1A 1QA0A 3SU2A 1OPHB 1C2FA 3R0FA 1ZOMA 3PWBA 4A7IB 5C1XA 5EW2H 3VB6A 1EP5A 2QXGA 1IQJA 1T8OA 1TQ0B 2BLOA 2C8WB 2BQ7B 3ZV8A 1EX3A 3OYPA 1YPHC 1DY8A 3MU5A 1F7ZA 4MPXA 1GL1A 5EPYA 1DWCH 4RKOB 3S7HB 4BAQB 1TGCA 3HK6B 4CREA 4I8HA 2V3HH 4X6NA 3A7TA 3ITIA 2WUCA 1HXFH 4ISHH 4MPVA 4X8TH 1FI8A 3A7ZA 2A2QH 3T29A 2BVSH 3E0NB 1D3TB 1TGTA 3GY6A 1GJAB 3C27B 2RCEA 1LHCH 5F8TA 1RD3B 1V2MT 3RDZA 4B73A 4U01A 5FPTA 3SZNA 4SGBE 1ZMJA 1OS8A 1SG8B 1IHSH 1S85A 2ZCLP 2GZ7A 1XUGA 2WPJS 2R0LA 3S7KB 2G52A 3T5FH 4BOHA 1EJMA 1Z8RA 2GGVB 5E0JA 4IMQA 4FU9A 1OKXA 1O3HA 3Q00A 4X2VA 1SGIB 1O3KA 1O5AB 1P3CA 1W2KH 3QTOH 1NT1A 1ABJH 3QO6A 1TNGA 1PPEE 3R3GB 3O8CA 5AHGH 1YPHE 1ANBA 1T7CA 4Q2KA 1O38A 2H6MA 1BMNH 1O5BB 1MH0A 1PQAA 3A84A 1O31A 3PO1B 1NM6A 2UUYA 1TRYA 2PKSB 4JK6A 5HM9A 5T3HA 1AZ8A 3T62A 3VB3A 2Z3DA 1RRKA 2QGRA 1XXDA 1S6HA 1O2HA 1XKBC 1QBVH 1XUIA 4Y8XA 1MZDA 5C1UA 4OGXA 4YOJA 1O5DH 3LGTA 2VU8E 3ZYDA 2O8MA 2HNTE 1MKWK 4E7NA 2VH0A 4BAKB 3OX7U 3ZVDA 3BEIB 5FX6A 3ZVEA 5AF9H 1HUTH 1G3CA 1LDTT 1YPJH 3F9HA 1VZQH 3UWJH 1TWXB 1G3BA 4RN6A 3RXVA 3BTWE 1MCTA 1HXEH 1NROH 1TNHA 2ILNA 2Z9IA 3SBKA 1YPMH 1QBNA 1CSOE 2G81E 2AYWA 1C2GA 1S83A 4U32A 4OS6A 3E91A 1ZJDA 4UFGH 1W3CA 1MAYA 1K22H 4CRFA 1P0SH 4TPYA 2OD3B 4ISOA 1ELDE 3FANA 4MVNA 3SU3A 3TU7H 4LXBH 1WCZA 2ZGHA 1HJAC 3U8TH 2BY9X 1C5QA 1N6XA 2ULLA 4X8UH 2YOLA 4Q7YA 1C5XB 1GG6C 5GCHG 1CVWH 3H7TA 1TBRH 1O2RA 2PSYA 1BA8B 1EUFA 1KXCA 5BRRE 8LPRA 1GDNA 1HAIH 4XBBA 1OYTH 1BDAA 1FJSA 1BJUA 3QK1A 8GCHF 2VIQA 4X6PA 1HAOH 1TABE 3RXEA 3URCA 3K9XB 1MKXK 2ZU2A 1ZPBA 7GCHG 3ZZDA 4B2AA 3BIVH 1AKSA 1P2JA 4HGCA 3PM3A 5HMAA 2SGFE 1UVSH 3KEEA 5EG4A 3AAUA 3G01A 1GHZA 2ZFTA 1O2MA 4FXGH 3A8BA 1C5OH 1ETTH 4UE7H 5E0HA 2YNAA 3GCHC 5HM2A 2FTMA 4NGAH 1BTHH 4IGDA 1AB9C 3UFAA 1K1LA 2V35A 4NG9H 1O2IA 2BZ6H 2Z9KA 5EGMA 1ELGA 2QA9E 4XE4A 1TLDA 1KLTA 4TYDA 2F9PA 3PLBA 5DPAA 2Y7ZA 4I8LA 4CRBA 2ZIQH 1O2SA 4B71A 3RMOH 1N6YA 1YF4A 3RXDA 3GCOA 1ABIH 1GMCF 4AOQA 3LC3A 3A8DA 5DP6A 2NU3E 1F92A 4X0WU 4YLQH 1NRNH 1C9TA 1NFUA 1GI1A 1ZHPA 3MHWU 4K5ZA 1ZPCA 1HV7A 4TY6A 3U8OH 5DP9A 2VVVA 3S69A 3SI3H 2FI5E 2Z94A 1TGNA 4X8SH 1ELTA 2TGTA 1GI2A 3I29A 5G4BA 1SR5C 2QF3A 3UR6A 5A8ZA 2A5IA 4SGAE 3ODDA 2ZP0H 3UNRA 4A6LA 1G36A 1J17T 1QCPA 4IBLH 5JBCS 5DP7A 1EOJA 1FNIA 1V2JT 5LH8A 2BX4A 1SGRE 4X1RU 2PKAB 5A8YA 1GHBG 2EEKA 1XVOA 1O3NA 2A1DB 4AFSA 4UONA 3UQVA 1A1RA 1YM0A 1SB1H 1T31A 2CV3A 5K7RA 2CMYA 4WJG2 2ZQ1A 5TJXA 1P9SA 1O33A 9ESTA 3F68H 2PR3A 2FS8A 1K2I1 4FUBA 2WPHS 2GKVE 3MU0A 3O8BA 3E8LA 2ZPSA 1L2EA 3HPTB 1K1NA 3F1SB 1NFXA 3A7YA 3RLYH 1ZZZA 1GMDF 2GDEH 1LPKB 1CT0E 1OYQA 1SLVB 1BTZA 3QGJA 1C2LA 1SLUB 2OQ5A 4UDWH 5PTPA 1O2KA 1C1SA 3LOXA 3KHVA 1C1WH 1T8NA 3IITA 3W94A 1Y3WA 1O2WA 1P10A 4DOQA 1ZPZA 4JYTA 5EODA 4ZH8A 3KCGH 1TNIA 1BHXF 1Z8JB 4FUCA 2BD4A 2WPLS 1GI7B 1V2RT 3RP2A 3A89A 2A4OA 3UIRA 2VINA 1UTJA 1GJ5H 1H1BA 1HAYB 2ODPA 1G32B 1JWTA 1F5RA 3FZZA 1A5HA 5E8EH 2K7XA 1THRH 3DFLA 1G3EA 1DT2A 3P17H 1SGDE 2GT7A 3RU4T 1ELFA 3TH2H 1SLWB 4ZKRU 2ZHEH 1U6QA 4D9QA 2DE8A 3VGCB 6LPRA 3ZVAA 4YM9A 1HIAA 1THPB 1VITF 2BDBA 2CF8H 3SO3A 3SQHE 1YPEH 3GDVA 3TK5A 3A7XA 3VB5A 1XVMA 1GGDB 5HGGA 1DVAH 1GVZA 3SJ9A 4IC6A 3VXEH 4FU8A 1TYNA 2XTTB 3V13A 1ELCA 4JZIA 3RXUA 4GPGA 1O3IA 1SGTA 1VR1H 3EYDA 3RXJA 3TVJB 1HFDA 2VIWA 3GICB 3HGPA 1MTVA 1UCYK 3M3TA 1A61H 2PHBA 2W26A 1EZSC 2TGAA 1YPKH 2DE9A 2JETB 3PTBA 4Y71A 3PMHB 2A45B 1O2VA 3UREA 2O8WA 2QF0A 2R2MB 1YC0A 3PMAB 2XC4A 1E38B 3A85A 1W7GH 1GJ9B 1TOMH 2BY6X 1BQYA 3RXCA 1EPTA 1ANCA 4YO9A 3SV2H 2AGEX 4WH6A 3ZVCA 6ESTA 2CHAC 4CHAC 2WUBA 2YNBA 3BN9A 8ESTE 5JB8S 1FONA 1XUFA 3MNBA 3MO9A 3U69H 4JYUH 2NU0E 1P8VC 3EA9A 4MLFB 1Z8GA 5FXLA 3IG6B 3D49H 2R3YA 2ZU3A 3VEQB 1ZRKA 4Z0KA 3UPEA 3ODFA 5EQSA 4BAOB 1SGYE 4ZXXH 2F9OA 1RJXB 1PPZA 1XX9A 2C3SA 4X1NU 5DKMA 3TLOA 3SV7A 3E0PB 2BQWB 1HAVA 4ABGA 5A0CA 3P8GA 3PO1C 1BZXE 3B8JA 2G00A 2FO9A 4KTCA 1J14A 4NFEA 1FY8E 2OCVB 3K6YA 1QL9A 5A0BA 1C1PA 3PTNA 4AGJA 3RXGA 5T6GA 3SU6A 1QURH 2DUCA 1C1VH 3RLWH 2SGQE 1UMAH 1F2SE 5C5NA 2JKHA 4VGCB 5C3NA 1ZR0A 3PB1E 1UK4A 5FPSA 5CMXH 1SGQE 2KAIA 2BDCA 1W12U 6GCHG 2ZC9H 4RSPA 2C90B 4OS5A 2FI3E 1VJAU 1CA0B 1DSUA 3TJOA 5F8XA 4I7YH 2STAE 4WY3A 3V12A 5EXNA 3CS0A 4B1TA 1J8AA 1CE5A 1AY6H 5DK1A 1EKBB 1VGCC 1XUHA 4Y10E 4MTBA 1HAXB 3MH6A 3SN8A 1TAWA 4HTCH 2THFB 1O2LA 1P09A 1AD8H 1SQAA 2A5AA 3MO6A 3P8OA 3RC6A 4U2WA 1YPLH 2ANWA 4Y0YE 2WPIS 4K2YA 1GVKB 2JH6D 5FX5A 2VB0A 1V2TT 1QBOA 3PV4A 1AO5A 4Y8ZA 2BZAA 1AFQC 2ZDAH 1FAXA 2P8OB 1O32A 3KN2A 1SOZA 1INCA 1IOEA 3LT3A 3V0XA 4LOYH 1O2YA 1BMLA 1BTXA 3BTQE 2CF9H 1FUJA 1WAYB 2QY0B 2F83A 5GCHF 4DIIH 2Q1JA 2XNIA 4CRDA 2FOCA 1S0RA 1S84A 2BD2A 1MTNC 4YOGA 1RS0A 1T4UH 1A0HB 3SGBE 2ZKSA 2ZO3H 1ZLRA 1GBMA 1QB1A 5H4IB 3RXIA 2AFQB 4K1TA 4BAHB 1DANH 1QB9A 2ZCHP 3OTJE 7GCHF 1S5SA 2HVXA 1CT4E 3CS7A 2XC5A 1SGFA 2PUQH 1ZJKA 3MFJA 3P8NA 3GY7A 4MNWA 3K65B 2Y81A 3A7VA 2B8OH 5HYOA 2A7HA 2W7UA 1AI8H 3QLPH 1UK3A 1A0LA 1GJ4H 1MBQA 5DP5A 4FUIA 4NIVA 2AS9A 2BD8A 2FI4E 1OWHA 2QN5T 2GMTB 1YYY1 2PTNA 1C5PA 3ZYEA 2PW8H 1QR3E 5AFYH 5J4SA 4GUXA 5FBEA 2IOTA 1GBAA 2GCTC 1HB0B 2AEIH 2M5TA 2STBE 1F0UA 2AH4X 2V6NA 2ZGBH 2BDGA 1TGBA 3HKJB 2ZHWH 2AIQA 4DVAU 4I32A 1QJ1B 1LHGH 1ACBE 4WH8A 3ZVBA 1ZSLA 2H9TH 1EAIA 1E34B 1LVMA 3FP7E 4BXSA 4CR5A 1EPTC 1Y3YA 5LPFA 1SC8U 1DXPA 1TMBH 2VIOA 2BTCE 1HAGE 4CRCA 3STJA 4INLA 2AMPA 1ESBA 2FS9A 1BMMH 1QB6A 2BDYA 3S9BA 1BRCE 1QHRB 1GHBF 4X6OA 1BHXB 4ZKOU 4TWYA 4I8JA 3SJ8A 1Y5BT 1B0FA 4GHQA 3EQ0H 5DGJA 2LIZA 2H2ZA 1O5EH 1NZQH 5FHTA 1JIRA 1RIWC 1SGNE 2ZGXH 3SNBA 4WMFA 4NWKA 3GCTG 3S9AA 4K69A 2FZZA 1J15A 2GV7A 1UTMA 3PROA 1Y5UT 1MTUA 1P57B 1V2LT 5I25A 1VCWA 2XBVA 1ZHMA 4D9RA 2ZPQA 1NRSH 3LJJA 2XBXA 4LZ1H 3ZZ8A 3Q3XA 2Z3EA 4I33A 1D4PB 1FPHH 2HNTC 4KKDA 1C5NH 2GZ8A 1JOUB 4AB8A 4A1XA 4A1TA 2ZFPH 1RTLA 1XXFA 1K1PA 3ENSB 4DCDA 3B23B 1BRAA 4JZ1A 1IQGA 1BBRE 2ZWLH 1N8OC 3RUOA 3VB7A 2VH6A 3SI4H 2OBQA 1AFEH 2BXUH 1BTWA 1LVBA 1C5MD 1GBJA 1T8MA 2F9UA 2FTLE 1GBCA 2WV4A 1P05A 1A3BH 4Y8YA 1G37A 4DJZB 3T25A 2SNWA 1GI5A 2GP9B 1OP2A 2VVCA 1F0TA 1KLJH 1VJ9U 5CHAB 3OY5U 2R0KA 1MUEB 2P59A 3NPSA 4YLUA 2WYJA 1A46H 1CBWB 2Z6BD 2VGCC 1L4DA 5E2OA 3BEFB 3UWIA 1HAHH 3MNSA 2Y7XA 2ZGCA 2A2XH 3ZZ6A 2G55A 3NKKA 1QL8A 1S81A 4JZFH 3SORA 3CP7A 3SNEA 3P6ZB 3TH3H 3SV9A 3MOCA 3F9EA 1O0DH 4AZ2B 5FCKA 1KDQA 1GBLA 1NRQH 1F5LA 2BM2A 3F9GA 1W7XH 1SSXA 4ZROA 1WTHD 1SMFE 2FOBA 5JBBS 1C4U2 1O3GA 1EJAA 2ZFSA 1PPCE 1O3PB 1OOKB 1GI4A 3A80A 2R3UA 3MH5A 4IC5A 4FUFA 3CENA 3GISB 3LGWA 4WWYA 1GHWH 1C9PA 1ELVA 3DA9B 5IYTA 1FPCH 1F5KU 1CT2E 4CRAA 3TNTA 3MU1A 2FOHA 1O2JA 1MQ5A 3QDZB 2BHGA 2R2WU 1SGPE 1JRSA 1JIMA 2NU4E 1N1LA 1BB0B 3PYHA 1K9OE 3P95A 1T4VH 3LGIA 1GWAA 1A0JA 2Q6DA 1AVGH 2OINA 2UUKB 3MH4A 1L1GA 2BLVA 4ZAEA 1IQHA 4Q7XA 5AVDA 1GHXH 2J9NA 3MU8A 3BTKE 4MG3A 3U1IB 4YT6H 2WPMS 3SUGA 1LQDB 1F0RA 5JBAS 3RMLH 2TRMA 1M9UA 1A3EH 1P3EA 1BRUP 1ETRH 3GY8A 1IQNA 1GI3A 4FUGA 3ZVFA 3TGJE 2G4UA 1P2QA 1MMJN 3EE0B 4AORA 2HGTH 4Y11E 2JH5D 1TNKA 4ABHA 1C2MA 3ZZ7A 1Q31A 1OSSA 1KXAA 4X2WA 1EOLA 1YBWA 5L2ZH 1UTOA 2ZA5A 5AFZH 4ESTE 1HLTH 6CHAB 4X1QU 2ZF0H 3W95A 1BRBE 4H42U 1FV9A 2D2DA 6GCHF 1W0ZU 2HRVA 1DX5M 3U1JB 3ESTA 1GCTB 3KQDA 5T6DA 3A82A 4NSVA 1YKTA 3ZVGA 3TJNA 3IWMA 1W13U 5EQQA 1L1NA 3HATH 3EBNA 1Y8TA 1GPZA 1AWFH 4THNH 2BD3A 4O03A 1CGHA 7KMEH 1H9IE 2FYQA 4A92A 3RXAA 4HZHA 5ETXA 1KYNA 3OY6U 2TPIZ 3E6PH 1O2GH 5EU8A 2BDHA 2Z9JA 3D62A 1RXPA 2FX6A 5CE1A 4I31A 4NA7A 5JB9S 4F49A 4Z6AH 2A31A 1AIXH 1YPGH 3AVZA 4YTAA 1GJDB 1TPOA 4INHA 4E06H 1S6FA 1ZSJA 1C5RA 1GJCB 1YP9A 1Z7KA 1SGCA 1SVPA 1TONA 1ZTLA 1D6RA 2IN2A 3F9FA 1QRWA 2ZDMA 1D6WA 1SFIA 1IQKA 2VIDA 4AB9A 3EDXB 1W14U 3VPKA 3GDUA 1B0EA 1GHVH 3RXPA 3RXBA 4D7FA 3BTME 5EXMA 2V3OH 2HOBA 3SNAA 2P94A 3BG8A 5ABWA 4CH8B 5FPYA 1QQUA