4RSPA

X-ray structure of mers-cov nsp5 protease bound with a designed inhibitor
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
304
structure length
303
Chain Sequence
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-induced Dimerization of Middle East Respiratory Syndrome (MERS) Coronavirus nsp5 Protease (3CLpro): IMPLICATIONS FOR nsp5 REGULATION AND THE DEVELOPMENT OF ANTIVIRALS.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Orf1a protein
total genus 86
structure length 303
sequence length 304
ec nomenclature
pdb deposition date 2014-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4rspA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4rspA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4rspA02
1CT4E 1ZHMA 3O8CA 2QC2A 3K6YA 3MH7A 2F9NA 2GCHG 3FP8E 4GSOA 1OYQA 2VGCB 4X2XA 4XBCA 1C1VH 5C2ZA 1O2LA 2BZAA 1C5UA 4NWKA 3NZIA 1TONA 4HI3A 1Q2WA 1GHZA 1NFXA 1UTPA 4A5TS 1GI1A 1EQ9A 2OINA 2ANMH 1T8MA 3MYWA 2P16A 2F83A 2SNVA 1FZZA 2PGBB 1OPHB 1UCYE 1RIWC 3SBKA 2QA9E 4AB9A 4U01A 5GPIB 1ZTJA 2GV6A 1VITF 2GDDA 3DUXH 1ARBA 2AH4X 4Q80A 4DW2U 1C1SA 2ZHWH 2NU4E 3SGQE 2TGPZ 4YLQH 1G2MA 1V2MT 5JBBS 3TGKE 1J8AA 1YPGH 1TABE 2WPJS 1DM4B 4QT8C 1ZR0A 5DO4H 1TNHA 4IN2A 3MI4A 3SNEA 1GMHG 3TITA 3RXFA 3A87A 4Q7XA 2G4UA 3CP7A 4X8UH 4YESB 5AVDA 1XVMA 1W14U 2HPPH 4AB8A 3RXKA 4CRFA 1GBKA 1ZPBA 2BDYA 5DJ7A 3STJA 2W5EA 2VINA 1MTWA 3PTNA 1HAPH 4Z6AH 1ELAA 1V2QT 3E3TA 1O2IA 5DP8A 1B0EA 1P57B 2BX3A 1KXDA 1SLWB 2ZGXH 1DITH 1O3LA 1C5QA 3GDVA 1GMDF 3KQDA 1A0LA 3ODDA 4SGAE 4ZXXH 2GP9B 4MPXA 2QXHA 5FAHA 2Z7FE 2VIOA 4KKDA 1MZDA 4R8TB 4RN6A 3ODFA 3SZNA 1KDQA 4AFUA 2BYAX 4Y71A 2ZGBH 3BTGE 4ZHLU 1TOCB 1ZMNA 3PMBB 4D9RA 3F9FA 2VIVA 4FU8A 1GHVH 1LHCH 4I8HA 1C2MA 3QK1A 3SU1A 3TJNA 7GCHF 4IN1A 5A2MH 1C5LH 1SR5C 2XBYA 6GCHG 4A92A 1ETTH 1P0SH 3A7VA 3RXBA 3MHWU 2AFQB 4OS1A 2RA3A 2BB4A 2VVVA 3ZZDA 3SU2A 2BMGB 3P70B 1GHWH 3KCGH 1P8VC 1FLEE 1ESBA 1TIOA 4Q7YA 1YPLH 2FX4A 1UTKA 1O2JA 8LPRA 1GL1A 1P2QA 4ZKSU 3ELAH 3ZZ7A 2FEQH 2AMPA 4ISIH 1JRSA 2R2MB 1PYTC 2OQUA 3UNSA 1TNKA 4R0IA 2C8ZB 3M7UA 3BIVH 4RKJB 4K8BA 2F9VA 1SGIB 4GCHF 1E0FD 3TLOA 5F03A 3RDZA 2ZFQH 1GCTC 1Z6EA 2ZFFH 4X2VA 3RXGA 1EP6A 2XWAA 4X6MA 1CE5A 5F8ZA 2XXLA 1OXGA 2GZ7A 3DA9B 4ABBA 4XFQA 3CENA 4B2BA 2FLBH 3D65E 2FODA 1SBWA 1FXYA 1KYNA 1S83A 1D4PB 1ESTA 1ZGIA 2A7HA 2H9EH 1GVZA 1UCYH 1FV9A 4CH2B 1C2GA 3L3TA 1E34B 2ZIQH 1V2KT 5EQRA 1O37A 4A1VA 1O2OA 3IWMA 2BLVA 1EX3A 1YF4A 1O3CA 1P3CA 1TWXB 4CHAC 5FCRA 1NRSH 1SGYE 2Y80A 1DVAH 1MCTA 1WSSH 5DG6A 2WYJA 3V0XA 5L30H 2PKSC 1PQ7A 2LPRA 1QJ7B 3P8NA 3ENSB 1C4V2 1CU1A 4IS5A 1C4U2 3SGAE 3UFAA 5ABWA 2ZDAH 2O8UA 1SVPA 2C90B 2BD4A 1A0HB 1C1RA 4I31A 1QGFA 2ZGHA 3KEEA 4Y7AA 1MTVA 3U8OH 5E2OA 1QURH 1INCA 1QRZA 2Z6BD 4RKOB 3UWIA 1FPCH 3SI3H 1EKBB 1EB2A 1QL9A 3QGJA 1GGDB 5ETXA 1BDAA 1NS3A 4I8LA 3SHCH 1ZSJA 1EP5A 1W7XH 1AFQC 1WV7H 1GJDB 1P2IA 1VGCB 1SG8B 1QBOA 4K3JA 3ZYEA 4BXSA 4NSVA 3BTQE 1O2ZA 1PPBH 4KELA 1P2MA 1C1MA 1T31A 1XKBC 2UUKB 2ZG0H 3A8CA 1QCPA 4Y7BA 3TGJE 2ANWA 4JMYA 2WUBA 4B71A 1EZXC 2A1DB 2ZHFH 2J92A 4MG3A 5CHAB 2VB0A 2IPHA 2UUFB 5C67A 3D23A 3U8TH 1V2RT 1AQ7A 1V2UT 4AZ2B 3GY3A 3UREA 1ZSLA 1UTOA 1DS2E 1QFKH 1W11U 1LQEA 1O39A 2BD9A 2W7UA 1QHRB 1FUJA 1C5WB 5EXLA 2PV9B 1O33A 3S9CA 1P2NA 1BTHH 1P01A 2A4RA 1T32A 4IMQA 3WY8A 5EW1H 5FHTA 5IDKA 4ABDA 1V2LT 2ZCLP 1C1QA 1ZHPA 1JMOH 2DE9A 1AZZA 2QY0B 3GY2A 3PMAB 1EOLA 1FMGA 4ZAEA 1GVLA 1JRTA 4Y79A 1SGRE 1V2WT 3PM3A 1Q3XA 5DPAA 2BD5A 3B23B 4ASHA 1XUJA 1SGNE 2Z3CA 2W7SA 1ELEE 4INLA 1XUKA 1HAOH 2AIQA 1WUNH 4X8VH 3BG8A 2FIRH 3ZVBA 2D8WA 3RC4A 1GHAG 2ALVA 1KTSB 1SQTA 4FUEA 4IGDA 1GBEA 2Y5FA 4JCNA 2FOAA 1HGTH 4Y6DA 3ZZ5A 1XXFA 3Q3XA 2HOBA 3T28A 1J16A 1C9TA 1WTHD 4ZKNU 1BJUA 1XKAC 1KXAA 2M5TA 1O5AB 1BBRK 4NZQA 1P04A 2A45B 4FUIA 1NROH 1UCYK 2FZZA 1GJBB 2FTMA 5GCHG 2CHAB 3I77A 1GCTB 5AHGH 1LTOA 2VIWA 3Q3KA 3GCHC 1ABJH 2WYGA 3LGTA 3ZZCA 1JIRA 1TGCA 1K1MA 2JKHA 3KQEA 1NRPH 3LGVA 1A1RA 1ANBA 1O35A 2UUYA 3RXMA 4U2WA 3P95A 1U6QA 2PHBA 1FN6A 2ZFSA 2QV1A 3GDSA 3STIA 1ZPCA 1DLEA 3TH3H 3SV7A 1C5RA 3NXPA 3D62A 2ZEBA 3RXJA 3PLBA 1HXEH 2JH0D 1TGBA 2J95A 1K28D 4Y10E 5ESBA 3RXQA 3O8RA 2PUXB 1O2MA 1FONA 1HDTH 4M7GA 1M9UA 1NT1A 3T25A 5GCHF 2FWWA 1BTWA 1GBAA 1GI8B 1HFDA 1QA7A 3DFJA 3M5OA 2XW9A 2ZTYA 1Q31A 2O8LA 1A5IA 2H2ZA 3HGPA 3QZQA 5T6GA 3FP7E 3Q77A 3PWBA 1FY5A 3LGUA 1PFXC 3VXEH 2JH5D 3UOUA 1MTSA 1S0RA 3ZZ8A 1KIGH 2BQ6B 2C4FH 1AUTC 2GCTB 3MMGA 2F9OA 2PGQB 2J4IA 2WV4A 3NCLA 5C1XA 2TBSA 3FANA 2XC4A 2QGRA 4H6SB 2G5NA 2ZO3H 5EQSA 1P12E 1QBVH 3A7ZA 1AGJA 1D3QB 3A82A 3GISB 4TYDA 3U8RH 2FESH 2BDIA 3E91A 3DFLA 4UDWH 1NO9H 4X2YA 1E38B 3TNSA 1C5SA 2ZC9H 2OC0A 3K9XB 4ISLA 1GJ9B 3VPKA 1SQOA 1FJSA 2AMQA 1LO6A 5A0CA 1GI3A 4WXIA 1DDJA 3ZZAA 2W3KA 3P8OA 1EAIA 1S0QA 2ZDLA 4INKA 2F9PA 4NIWA 1ZMLA 2H1UA 1TLDA 4BAOB 4I8KA 1ESAA 2RG3A 6GCHF 1MMJN 1TA6A 4ZMAH 4NIVA 5B6OA 1LVBA 2ZHEH 5E2PA 3PLPA 1UJ1A 1DWBH 1C5NH 4GHTA 4BOHA 1KXCA 4GLYA 1XUFA 3VB5A 1O3EA 2B0FA 1DOJA 2YOLA 1GJAB 2FLRH 3FFGA 1THPB 2UWPA 1GHBG 1CHGA 4Y0ZE 5E0HA 3W94A 1J17T 1ACBE 2SNWA 4ZHMU 1NRQH 2PUQH 1XUIA 3GOVB 2A2QH 2XBWA 4O97A 3F68H 3MU5A 3LH3A 1DSTA 3TPIZ 5E0JA 1J9CH 3SU3A 1TE0A 1GBBA 1C5ZB 2QF3A 1RFNA 4K2YA 4X1SU 3K6ZA 4LOYH 1QRWA 3ZV9A 1NPMA 1VCQA 1XUGA 2XYAA 2XRCA 4NA7A 1P03A 1O5FH 1O3AA 3FZZA 1CVWH 1ETSH 3LPRA 3VGCB 1HAVA 5DP4A 1SPJA 2BVXH 2SGPE 3EYDA 3H7TA 3V13A 6CHAC 1HV7A 2BY7X 2BY5X 3PB1E 5L2ZH 1GJ6A 3TK5A 3ZZ6A 3ZZBA 1N8OC 4CRBA 2P95A 1EJAA 1TNLA 1SLVB 1BJVA 1C2JA 3BTME 3O8DA 1HAIH 3E8LA 3M3VA 1PPHE 1HAVB 2ANYA 3BTTE 1GI4A 1C1WH 1HAYB 5CHAC 1G30B 1BRBE 3QO6A 4NFEA 5PTPA 3GCNA 1OX1A 3ATMA 3GICB 2ZPQA 2XTTB 3TJUA 9ESTA 2G4TA 1MAYA 3A84A 1TQ7B 5DKMA 1Y8TA 4ESTE 1EZQA 3Q76A 5GDSH 1Y3XA 2R0LA 1JOUB 5DP5A 2FI4E 2V3HH 1GGDC 4MQAA 2HGTH 3EGKH 1TX8A 1C2FA 2FYRA 1FNIA 1BMAA 2ILNA 2ZGJA 4FXGH 1C5TA 3D49H 5EXMA 3O8BA 3EA8A 2Z3DA 1RD3B 5I46H 1QL8A 1AKSA 1C5VA 3PYHA 1XXDA 1H9HE 1LVMA 1WQVH 4VGCB 1GJ4H 3HK3B 3KGPA 4J1YA 1QNJA 1OSSA 3V7TA 1DXWA 3TJOA 2ZPSA 1RTKA 3RXAA 1CGHA 1TRMA 1ZTKA 2WV5A 5DGJA 4DVAU 1ZJKA 1HBTH 3RXVA 1MD7A 4AYVB 1LHEH 2Y5HA 1AIXH 3PLKA 1K21H 1P10A 3S7HB 2YNAA 1UVOA 3UNRA 2BY6X 5BRRE 1BMMH 1DICA 1TGTA 3F1SB 4XOJA 3HK6B 4Y8ZA 4X0WU 4WXVA 3FVFB 1O5BB 2CV3A 4JYUH 1GBHA 4JYVH 1QRXA 3HGNA 1T8LA 1IOEA 4NIYA 1GHXH 3R0FA 2FOFA 3H7OA 2NWNA 3RXEA 1AZ8A 1FY3A 2K7XA 2Z3EA 3SI4H 3TVJB 4WJG2 3ZVGA 2BOKA 2G8TA 2SGAA 3B9FH 3UNQA 3RXSA 1LHGH 4I7YH 4TPIZ 3GCTG 1AB9C 2A4GA 1TA2A 3ZZ4A 1GBMA 5EU8A 3QX5H 4IC5A 1GMCF 3I29A 3SO3A 1HAXB 2BM2A 2P8OC 4F4OC 2A2XH 4MPVA 2K1QA 1AVWA 2WPMS 2OBOA 2OC8A 2OXSA 3LU9B 3M7TA 1CGIE 3AASA 1E35B 1TALA 2BVSH 2QIQA 1Z8RA 3OX7U 4TY6A 1ZJDA 1DUEA 1LQDB 4WY3A 2GX4A 1ELDE 1DWDH 1DUAA 1LKAA 2ZF0H 4X6OA 3F6UH 1UVPA 1V2ST 1MD8A 3UR6A 4TY7A 2W3IA 3GY6A 1OWIA 3M7QA 1CHOF 3EA7A 2CXVA 1QL7A 1BTYA 1K2I1 1XMNB 5G4BA 1MU8B 3VXFH 3U1IB 1GMCG 1LVYA 4I8JA 2D2DA 1KLIH 1V2VT 1QTFA 2BOHB 2QXJA 1SGFA 3MNSA 4K1TA 3UQVA 2BDGA 4FUCA 2F9UA 1C1UH 1QB6A 1O31A 3A7TA 1UO6A 1KLJH 1SGDE 1YP9A 1MCVA 1GI9B 2XCFA 3BTKE 2BDCA 1JBUH 4BAQB 1RIWB 1O3BA 3SOSA 4B1TA 2Q6GA 2OQ5A 3S69A 2FXRA 1P2KA 1YGCH 2HVXA 2OD3B 5K7RA 3BTHE 4GCHG 2NU1E 1W2KH 5DP9A 4FUJA 2AMDA 3GCTF 4DIHH 3QGNB 4WVPE 1GI7B 1SLXB 1XX9A 3MTYA 1IQNA 1YLDA 1AE5A 3OYPA 3BSQA 1GI2A 5EPNA 5HYOA 4MPWA 5L2YH 4K1SA 3JZ1B 3MNBA 3ZVDA 1Z71A 1A3BH 5JBCS 5DP6A 1TBQH 5FBIA 5HXFA 1F0UA 3MO6A 1Y3UA 1SLUB 2XC0A 2PW8H 2GKVE 3A7YA 4H42U 2R3UA 1UTLM 2FOEA 4NFFA 2NU2E 1TNGA 1PYTD 1LVOA 4GPGA 3RM0H 2ZECA 1AUJA 1D3PB 1RRKA 2ZTZA 1QA0A 4NWLA 2OP9A 3DD2H 4FUFA 5J4QA 4WMDA 3VB6A 1DX5M 3SNDA 3JZ2B 1S5SA 4X8SH 2G81E 2GT8A 2B8OH 1P09A 1DLKB 1MKWH 1YPHC 1V6DA 3B8JA 4A7IB 1H9IE 1PQ5A 1TGNA 1O5GH 2STAE 2GTBA 1O38A 1O2NA 2FOBA 1GJ5H 2SGEE 3T62A 1WQSA 3RUOA 3W95A 3LT3A 2P3TB 4YO9A 3BTWE 1CBWB 2R3YA 2ZWLH 4BAKB 1GDNA 4LZ4B 1OWEA 1V2OT 3RU4D 1S6FA 2GCHF 1PJPA 4TPYA 1Z8IB 1UK2A 3GYLB 3UUZA 1LKBA 1QQUA 8KME2 3RMLH 1GHYH 2ODPA 2F3CE 2BXTH 3F9HA 1DPOA 1HLTH 1O3FA 3G01A 3M5NA 4X6NA 2PKSB 1MBMA 1MTUA 1QJ1B 3TK6A 5JYIA 1SFQB 3BF6H 1OWDA 3HPTB 2ULLA 4CREA 3SU0A 3TIUA 1OOKB 1CT0E 3A88A 1F7ZA 1EAWA 4NA9H 1MQ6A 1ANCA 2J2UA 1DY8A 1RGQA 2F91A 3KF2A 3R3GB 2VJ1A 1O3HA 3SV8A 1OS8A 1EPTC 1HJAC 1P9SA 5L6NH 1TX6A 4D7GA 1X7AC 5DK1A 1W13U 1AKSB 3U9AH 1WBGB 1AWFH 2VNTA 4ZHAA 1K22H 4JZDH 2GD4B 4MVNA 2UUJB 3ATKA 1GHBF 4DT7B 3ZYDA 2XCNA 2ZDMA 3ATLA 3QDZB 5A8ZA 2C8WB 3RXDA 1LPZB 1CA0C 1P02A 1NRRH 2VWLA 1K9OE 1RTLA 2F9BH 2OUAA 1H8DH 4DGJA 5HGGA 5H4IB 1A5HA 2PR3A 5E8EH 1MKXK 5LPRA 2H9TH 1SGTA 3AW0A 5I25A 2HNTC 2UWLA 1O2XA 1Z8GA 2Y81A 1GBCA 1LPGB 5FPYA 4AFQA 3TJVA 5LPFA 4NA8A 3PTBA 4AG2A 1IHSH 5FCKA 5F8XA 4JK5A 1SGQE 3M35A 1NFUA 1HRTH 2EI7A 1K1NA 4HGCA 1ARCA 2AIPA 4DY7B 1AE8H 2LIZA 1HJ9A 1BBRH 1HPGA 2QXGA 4H6TA 2BHGA 1YPJH 3P8GA 4FU9A 1GBDA 3VB4A 1CQQA 5EQQA 3RP2A 3A8AA 3UOPA 2C3SA 1C4Y2 1EZSC 5T6FA 3M61U 2GZ9A 2HPQH 2ODYB 2ZFPH 4CRCA 2C8XB 1W0ZU 4XE4A 1A3EH 7GCHG 1P3EA 1LHDH 5EODA 1FAXA 1TRYA 2J94A 4NCYA 3HATH 1AMHA 1TOMH 4IBLH 1XVOA 1PPZA 1T4UH 4UONA 1ZRKA 4MNWA 3BTDE 4GUXA 1ZGVA 2BTCE 3LH1A 1BRUP 1TGSZ 1B0FA 1HAZB 3FP6E 1OP0A 1FQ3A 1DWEH 1VCWA 3GY5A 2VU8E 3PWCA 2Z9LA 2H9HA 1EXFA 1TB6H 4SGBE 1GI0A 1WU1A 1SGPE 1OWKA 3A8DA 2JETC 2H5DA 3KQBA 2ZU2A 1GDUA 1WYKA 2I6QA 1EOJA 3MFJA 1SQAA 4JZ1A 1EZUC 2Y7XA 1G3EA 4BTUB 3LDXH 2NU3E 1Y5UT 1RS0A 5IYTA 1L1NA 1S81A 2A7JA 1UTNA 1IQEA 4MDSA 1KXEA 3EDXB 3TU7H 2OLGA 5A8YA 1H8IH 2STBE 3PV4A 2WINI 3SU5A 1P05A 4KP0A 5EG4A 3SHAH 3LJJA 1QJ6B 2BLQA 4CRDA 1JIMA 1EATA 2P93A 3A86A 3MWIU 1O34A 1WOFA 5SGAE 2VWOA 8GCHG 2OCVB 2XNIA 3S9AA 4I33A 2J38A 3MH4A 1XUHA 3VB7A 1LMWB 3GYMA 4XSKU 5DP3A 1EAUA 1ZSKA 2CJIA 3LGYA 3VEQB 3KIDU 3T29A 7LPRA 1P2OA 1TFXA 1MTNB 3MH5A 1FN8A 1V2TT 2GMTC 3A85A 4JZFH 2Y82A 4OGYA 1SGEE 2OC7A 1QR3E 2FS8A 1PPCE 4I8GA 3ZZ3A 1QQ4A 3QN7A 2BQ7B 3URDA 1OWJA 2ZGCA 1UHBA 4UFEH 4CHAB 1QB9A 3EE0B 1VJ9U 1FY4A 1NY22 3S7KB 1S6HA 1KLTA 2VVUA 1L4ZA 4OS6A 1YCPM 2QCYA 1FAKH 1GHAF 2WUCA 5GXPA 1KXBA 2ZU3A 3L33A 2KAIB 1NN6A 1W12U 3SJIA 2P8OB 3KNXA 2FO9A 3SW2B 1S85A 1GG6C 4MLFB 2B5TB 1ELGA 2D1JA 2GT7A 1BIOA 2V3OH 3MOCA 3ZVFA 1NESE 5EOKA 4XDEA 3TK9A 4K1EA 5AFZH 5AF9H 4JZEH 4FU7A 3LIWA 5AFYH 1CA0B 1CT2E 2ZDVH 1C9PA 4B2AA 1YCPK 3A83A 4OS7A 2CHAC 3RMMH 4UFFH 1RXPA 4MTBA 1BBRE 1MZAA 1SGCA 5FXLA 2PKAA 2Y5GA 3V3MA 3RU4T 1NZQH 3NK8A 3DHKH 2FOMB 1SC8U 1YYY1 4O03A 1TX7A 4YT7H 3CS0A 1ZTLA 3U69H 5A0AE 5C5NA 1ZYOA 3A8BA 1C5YB 3E90B 4AYYB 4O3TA 5A09A 1O2HA 1DSUA 2H6MA 1BZXE 3AW1A 2B9LA 2ALPA 4DOQA 2EI8A 3RLWH 1FDPA 2QAAA 1FIZA 3TNTA 2TRMA 3PO1C 1O36A 1CSOE 1LHFH 5LH8A 2RA0A 3AAUA 2A4OA 4ZXYH 4ZKRU 2C93B 1CHOG 1NRNH 4K60A 1DANH 3S0NA 1ELFA 4ZUHA 1EB1H 1GPZA 1W3CA 1FPHH 1TBRH 4YLUA 2ZDKA 5TCCA 3UPEA 2FP7B 4WH6A 1NM6A 1SMFE 1GJ7B 1IQKA 1V2NT 1L1JA 3IG6B 1ELBA 5FX6A 4Q2KA 2GVFA 2PWXA 5JPMH 4H4FA 2Q6FA 1YBWA 1BCUH 2SGQE 3SORA 1AWHB 3SV2H 3VGCC 4DJZB 2VH6A 2HLCA 2QYIA 1G37A 4CR9A 1F0TA 3SQHE 4JZIA 2FMJA 4A6LA 1AVXA 1WCZA 4CRGA 1GBFA 2O8TA 1ID5H 1HYLA 3HKJB 5J4SA 3OSYA 1NC6A 1SOZA 4ISHH 4BNRA 5EW2H 2AS9A 3MU1A 1C1OA 2CGAA 2P3UB 1B7XB 1XM1A 2FOCA 1TPOA 4FUGA 1YCPH 3RLYH 2DE8A 1NU9A 2A5IA 2ZQ2A 1PPEE 3S9BA 1UTMA 2ZU1A 4LZ1H 1A46H 4YOGA 5LGOA 1TMUH 4ABGA 3EAJA 1A4WH 1TPAE 1DFPA 1Y5AT 1ZZZA 1GMHF 2ZFRH 1O2SA 2H5CA 4ABIA 1KXFA 2ZFTA 4E06H 3FZDA 1IQFA 1F5RA 2WPIS 4Y0YE 4YTAA 2BDBA 2FS9A 2ZI2H 2BZ6H 3LC5A 3TH2H 2QF0A 1BRCE 4PROA 2R0KA 4FVDA 3ZZ9A 3RXTA 3SGBE 1BOQA 1JWTA 5TJXA 1PPFE 4DCDA 1Z8JB 3C27B 1BITA 4XBDA 3VB3A 3NWUA 1SFIA 4K8YA 3U98H 4KGAA 2J34A 4X2WA 1V3XA 3SU6A 4CBOA 2VGCC 3KN2A 3A80A 4TWYA 1ABIH 5A8XA 2HALA 1C5PA 1F0RA 4IW4E 3F9GA 3QZRA 4AG1A 1YC0A 3MO9A 4OS4A 1D6RA 2IJOB 1BTPA 3ESTA 1D9IA 2I6SA 1W8BH 1C2LA 5C3NA 1WAYB 1SB1H 4YT6H 3BEIB 3SV6A 1HB0B 1N6XA 1O2QA 3MU4A 2ZU4A 4O3UA 1THRH 2A0QB 2HWLB 1GG6B 1G32B 1L4DA 3NKKA 2A31A 4E7RG 4ABAA 3A81A 1ZHRA 4D76A 3RXPA 1W7GH 5JBAS 1NU7B 2WPHS 1SOTA 1T8NA 1MH0A 1O5DH 1C1TA 1GI5A 2BLWA 1H9LB 4AFZA 1IQHA 8ESTE 3OY6U 2W26A 3RMNH 3H5CB 2FTLE 4B73A 1QB1A 4WWYA 2VIPA 2ZDNA 4LXBH 1OP8A 1OWHA 4UFDH 1KDQB 2PLXA 3GCHB 3UIRA 3NPSA 3BIUH 1FIWA 1ETRH 2G51A 1UK4A 4B2CA 1MTNC 3ITIA 1TMBH 4XBBA 4KTCA 1W10U 1QIXB 4AGJA 1WTGH 1Y59T 1BQYA 1GWAA 3BV9B 4I32A 4UE7H 1HJAB 1EAXA 4WH8A 4WF8A 3KQCA 1ZMJA 4X1PU 2BD7A 3OU0A 3I78A 4X8TH 1C5OH 2P59A 1GVKB 3BG4B 3SQEE 3QWCH 1G9IE 1S84A 2J9NA 1ELTA 9LPRA 5JBTA 3C1KA 1K1OA 2VIQA 4D8NA 3RMOH 1O2TA 2PTNA 3K65B 1TAWA 2O8WA 1A0JA 1DWCH 1HCGA 2FM2A 1D3DB 3QTOH 4D9QA 2AERH 1UTJA 3IITA 3SUFA 2O8MA 4NZLA 4YOIA 1YLCA 1G3CA 3PROA 3RXHA 1G3DA 3ATWA 3UQOA 2IN2A 3L6PA 2BLOA 1O2YA 5BPEA 2BY9X 1GL0E 1BB0B 2CMYA 3RXIA 6CHAB 4RSPA 3M37A 4WMFA 1Y3VA 1F5LA 2AGEX 2G00A 4AGKA 1TQ0B 1VJAU 1VZQH 5JB9S 4MNYA 5GJ4B 2FX6A 1AO5A 2Q1JA 2BDAA 2SFAA 3MH6A 4HTCH 1PPGE 1JXPA 4INHA 1LDTT 2AYWA 6ESTA 1UVTH 4ISOA 4GAWA 3TH4H 1FY8E 1EASA 4MNVA 3EBNA 2GV7A 1HJ8A 2VWMA 4E05H 4DIIH 1O0DH 5CE1A 3P8FA 1J14A 5C20A 1DE7H 3ATIA 2SGDE 1AU8A 2EEKA 5A0BA 1O3OA 3HKIB 4ABFA 1YPKH 4YZUA 4YM9A 2Y6TA 2ANKH 1E36B 1O3GA 1UVSH 1HAHH 1GBIA 1YKTA 2EI6A 3LKWA 1TBZH 2PSYA 4HFPB 4K69A 2ZTXA 3DT0H 3LGIA 1V2PT 1DXPA 1ZLRA 4D7FA 1TYNA 2FDAA 4IC6A 2VH0A 2JETB 1O5CB 1Z7KA 2A7CA 2P94A 5F8TA 3KL6A 2FI3E 1TRNA 1ELCA 3M3TA 1PQAA 1P2JA 3SNAA 1T7CA 1FY1A 4WMEA 3N7OA 2XC5A 2P3FH 4OGXA 2ZNKH 3SJOA 3ZV8A 2Q6DA 1BHXF 4Y76A 3E1XB 1AN1E 1N6YA 2XBVA 1Y5BT 3RXCA 1O3JA 2CF9H 1F92A 1O2KA 1VR1H 5HM2A 2BY8X 3EA9A 1GCDA 4NG9H 4JYTA 3MU0A 3SUGA 2TGAA 2Z94A 1SHYA 5HM9A 5HMAA 1AB9B 2BD2A 3BEUA 5EGMA 1W0YH 4AORA 1D6WA 1TNJA 1BRAA 6LPRA 3AVZA 1GBJA 2SGFE 3VFEA 2CN0H 3MNXA 2LNCA 1TMTH 2ASUB 2XBXA 1IQMA 2A4QA 4O9VA 4AFSA 3QLPH 3GY4A 2O9QA 5FX5A 1HUTH 1HIAA 3RM2H 5TCAA 4Y11E 4KTSA 2BDHA 1AHTH 3PO1B 1ANEA 2ZKSA 3SJ8A 1TPPA 1C5XB 1O30A 2QN5T 3SJKA 1UTQA 4MPUA 1OP2A 4FUDA 3BG4C 1EPTA 1Z6JH 1C2HA 1T4VH 4ZKOU 1IHTH 1KY9A 1K1JA 3E6PH 2IOTA 4GVUA 1SSXA 1OKXA 5FPTA 1LCYA 4J2YB 2D26C 3SJ9A 2FPZA 4FUHA 4BAMB 4E7NA 2Z9KA 3GCOA 4VGCC 4IMZA 2FI5E 2FYQA 4BXWA 1P06A 3FAOA 4A1TA 1AY6H 1IQGA 4NGAH 2ZCKP 2ZQ1A 2RDLA 5LPEA 2TIOA 4AOQA 3RXRA 1VITH 4B76A 3MNCA 3BTEE 1MQ5A 2AGIX 3UTUH 3UR9A 2V6NA 1YPHE 2OC1A 1LPKB 3RXLA 5ESTE 3RU4E 1GBLA 4AX9H 4THNH 4YOJA 1ZRBA 4OS5A 1O2VA 1C1NA 1O3NA 4ABJA 1C5MD 4UD9H 4AN7A 2FOGA 1MU6B 3MU8A 1C2IA 2EA3A 2VVCA 5FBEA 4X1RU 1UMAH 1L0ZA 1TPSA 1SL3A 1MBQA 4BTIB 1MKWK 3A7WA 1UK3A 1GDQA 4LK4A 3K2UA 2BVRH 1C1PA 1THSH 3ZVCA 2WPKS 4DURA 2GMTB 2Z9GA 1F5KU 4U32A 3URCA 1VITG 3P92A 1L1GA 2HNTE 1N8OB 1RTFB 4A1XA 1J15A 2GZ8A 1HXFH 5EXNA 2XWBI 3BN9A 1KTTB 1IQIA 3LOXA 7ESTE 1BTXA 5C1YA 1CGJE 1O5EH 1ORFA 2B7DH 1YPEH 2ODQA 3Q00A 1ANDA 4CR5A 3OY5U 1B5GH 4FVBA 2ESTE 3BEFB 2AGGX 2FOHA 2KAIA 1IQLA 4B75A 1P9UA 1GJ8B 2V0BA 1A7SA 4ISNA 3T27A 1AVGH 4X6PA 3SV9A 4NSYA 3E0PB 4ABEA 1H4WA 1O3KA 2HRVA 1UHBB 4U30A 2Z9JA 3GDUA 1A61H 1F0SA 5T6DA 1IAUA 2JH6D 3QTVH 3SUEA 1VCPA 4F49A 4Y8YA 3SUDA 2V35A 4BAHB 4JK6A 2OTVA 2VIDA 3ZVAA 4ZROA 2ZZUH 2BXUH 4X1QU 5T3HA 2R9PA 2GDEH 2EC9H 4BANB 2PSXA 5EPYA 3RXOA 1YPMH 2CF8H 3RXUA 3UWJH 3TGIE 4FUBA 3RC5A 4Q7ZA 2QXIA 5C1UA 1UVUH 4UEHH 2TGTA 4OS2A 1ZOMA 4K5ZA 1O3IA 1Z1JA 2ZA5A 3A89A 4KTUA 2PFEA 1T8OA 1C2KA 1FI8A 3SNBA 1AFQB 1O2PA 1VGCC 3M5MA 2NU0E 5F6MA 3MO3A 1NFWA 2VWNA 2A5KA 1H1BA 1SGFG 1AD8H 3M36A 3PMHB 2BD3A 3T5FH 2ZP0H 2HNTF 2TGDA 3P6ZB 3LONA 2DUCA 2PTCE 2GCTC 3GY7A 4ZH8A 1ZPZA 4CH8B 3E16B 5FPSA 1G3BA 1A5GH 1G2LA 5DP7A 1L2EA 1SI5H 1YM0A 1S82A 1Z1IA 2YNBA 3SU4A 2A5AA 1K1LA 1SHHB 3SN8A 3PMJA 3BTFE 3LJOA 2R2WU 1AFEH 1BUIA 1AI8H 1GJCB 3T26A 5C5OA 1F2SE 1EPTB 3M5LA 1BMNH 1O32A 1E37B 1CO7E 1N1LA 2ZHQH 2AEIH 1V2JT 3CS7A 1QY6A 4UFGH 1O3DA 4DG4A 3P17H 1K1PA 4MNXA 1NFYA 2THFB 1HIAB 5K0HA 7KMEH 1PQ8A 5E0GA 1C2EA 4TWWA 8GCHF 1RJXB 1O2GH 2BX4A 4GHQA 3KHVA 2GGVB 3GY8A 3T2NA 1GI6A 2OBQA 4Z0KA 1GMDG 2PKAB 1G36A 3SNCA 1GBTA 2G5VA 1Y3YA 1EJMA 1KSNA 1NTPA 3LC3A 1BA8B 1BTZA 2C8YB 3E0NB 4HZHA 4Y8XA 3Q3YA 1A2CH 3EQ0H 5GIBA 1OYTH 3AAVA 4CBNA 2G55A 3ZVEA 1C2DA 4ABHA 4X1NU 3QUMP 1D3TB 1EJNA 1O2UA 2A32A 5CMXH 2Y7ZA 1O2RA 3V12A 1CA8B 1Y3WA 2RCEA 1BT7A 3LGWA 5JDUB 1QBNA 1K1IA 1BHXB 1O3MA 1MUEB 3RC6A 2TPIZ 1HAGE 2UWOA 4BTTB 1MAXA 1HNEE 3U1JB 2BQWB 2ZPRA 1O2WA 1EUFA 1P11E 1TNIA 2WPLS 2Z9IA 3OTJE 3F9EA 4B74A 5JB8S 1O3PB 4NIXA 5GWZA 1DY9A 1IQJA 3A7XA 2ZCHP 1ELVA 2ZHDA 2G52A 3UY9A 1MKXH 1BMLA 1BTUA 2ZU5A 4CRAA 1CBWC 3M3SA 2BD8A 1DT2A 3NUMA
chains in the Genus database with same CATH superfamily
1CT4E 1ZHMA 3O8CA 2QC2A 3K6YA 3MH7A 2F9NA 2GCHG 3FP8E 4GSOA 2KCOA 1OYQA 2VGCB 4X2XA 4XBCA 4M9FA 1C1VH 5C2ZA 1O2LA 2BZAA 1C5UA 4NWKA 3NZIA 1TONA 4HI3A 1Q2WA 1GHZA 1NFXA 1UTPA 4A5TS 1GI1A 1EQ9A 2OINA 2ANMH 1T8MA 3MYWA 2P16A 2F83A 2SNVA 1FZZA 2PGBB 1OPHB 1UCYE 1RIWC 3SBKA 2QA9E 4AB9A 4U01A 5GPIB 1ZTJA 2GV6A 1VITF 2GDDA 3DUXH 1ARBA 2AH4X 4Q80A 4DW2U 1C1SA 2ZHWH 2NU4E 2WPDD 3SGQE 2TGPZ 4YLQH 1G2MA 1V2MT 5JBBS 3TGKE 1J8AA 1UW7A 1YPGH 1TABE 2WPJS 1DM4B 4QT8C 1ZR0A 5DO4H 1TNHA 4IN2A 3KYFA 3MI4A 3SNEA 1GMHG 3TITA 3RXFA 3A87A 4Q7XA 2G4UA 3CP7A 4X8UH 4YESB 5AVDA 1XVMA 5KEDA 1W14U 2HPPH 4AB8A 3RXKA 4CRFA 1GBKA 1ZPBA 2BDYA 5DJ7A 3STJA 2W5EA 2VINA 1MTWA 3PTNA 1HAPH 4Z6AH 1ELAA 1V2QT 3E3TA 1O2IA 5DP8A 1B0EA 1P57B 2BX3A 1KXDA 1SLWB 2ZGXH 1DITH 1O3LA 1C5QA 3GDVA 1GMDF 3KQDA 1A0LA 3ODDA 4SGAE 4ZXXH 2GP9B 4MPXA 2QXHA 5FAHA 2Z7FE 2VIOA 4KKDA 1MZDA 4R8TB 4RN6A 3ODFA 3SZNA 1KDQA 4AFUA 2BYAX 4Y71A 2ZGBH 3BTGE 4ZHLU 1TOCB 1ZMNA 3PMBB 4D9RA 3F9FA 2VIVA 4FU8A 1GHVH 1LHCH 4I8HA 1C2MA 2IJD1 3QK1A 3SU1A 3TJNA 7GCHF 4IN1A 5A2MH 1C5LH 1SR5C 2XBYA 6GCHG 4A92A 1ETTH 1P0SH 3A7VA 3RXBA 3MHWU 2AFQB 4OS1A 2RA3A 2BB4A 2VVVA 3ZZDA 3SU2A 2BMGB 2JDID 3P70B 1GHWH 3KCGH 1P8VC 1W0KD 1FLEE 1ESBA 5KECA 1TIOA 4Q7YA 1YPLH 2FX4A 1UTKA 2F4LA 1O2JA 8LPRA 1GL1A 1P2QA 4ZKSU 3ELAH 3ZZ7A 2FEQH 1E1QD 2AMPA 4ISIH 1JRSA 2R2MB 2WHXA 1PYTC 2OQUA 3UNSA 1TNKA 4R0IA 2C8ZB 3M7UA 3BIVH 4RKJB 5HIZA 4K8BA 2F9VA 1SGIB 4GCHF 1E0FD 3TLOA 5F03A 3RDZA 2ZFQH 1GCTC 1Z6EA 2M2AA 2ZFFH 4X2VA 3RXGA 1EP6A 2XWAA 4X6MA 1CE5A 5F8ZA 2XXLA 1OXGA 2GZ7A 3DA9B 4ABBA 4XFQA 3CENA 4B2BA 3PV5A 2FLBH 3D65E 2FODA 1SBWA 1FXYA 1KYNA 1S83A 1D4PB 1ESTA 1ZGIA 2A7HA 2H9EH 1GVZA 1UCYH 1FV9A 4CH2B 1C2GA 3L3TA 1E34B 2ZIQH 1V2KT 5EQRA 1O37A 4A1VA 1O2OA 3IWMA 2BLVA 1EX3A 1YF4A 1O3CA 1P3CA 1TWXB 4CHAC 5FCRA 1NRSH 1SGYE 2Y80A 1DVAH 1MCTA 1WSSH 5DG6A 2WYJA 3V0XA 5L30H 2PKSC 1PQ7A 2LPRA 1QJ7B 3P8NA 3ENSB 1C4V2 1CU1A 5IK2D 4IS5A 1C4U2 3SGAE 3UFAA 5ABWA 2ZDAH 2O8UA 1SVPA 2C90B 2BD4A 1A0HB 1C1RA 4I31A 1QGFA 2ZGHA 3KEEA 4Y7AA 1MTVA 3U8OH 5E2OA 1QURH 1INCA 1QRZA 2Z6BD 4RKOB 3UWIA 1FPCH 4TT3D 3SI3H 1EKBB 1EB2A 2OK5A 1QL9A 3QGJA 1GGDB 5ETXA 1BDAA 1NS3A 4I8LA 3SHCH 1ZSJA 1EP5A 1W7XH 1AFQC 1WV7H 1GJDB 1P2IA 1VGCB 1SG8B 1QBOA 4K3JA 3ZYEA 4BXSA 4NSVA 3BTQE 1O2ZA 1PPBH 4KELA 1P2MA 1C1MA 1T31A 1XKBC 2UUKB 2ZG0H 3A8CA 1QCPA 4Y7BA 3TGJE 2ANWA 4JMYA 2WUBA 4B71A 1EZXC 2A1DB 2ZHFH 2J92A 4MG3A 5CHAB 2VB0A 4P00A 2IPHA 2UUFB 5C67A 3D23A 3U8TH 1V2RT 1AQ7A 1V2UT 4AZ2B 3GY3A 3UREA 1ZSLA 1UTOA 1DS2E 1QFKH 1W11U 1LQEA 1O39A 2BD9A 2W7UA 1QHRB 1FUJA 1C5WB 5EXLA 2PV9B 1O33A 3S9CA 1P2NA 1BTHH 1P01A 2A4RA 1T32A 2IPQX 4IMQA 3WY8A 5EW1H 5FHTA 5IDKA 4ABDA 1V2LT 2ZCLP 1C1QA 1YLNA 1ZHPA 1JMOH 2DE9A 1AZZA 2QY0B 3GY2A 3PMAB 1EOLA 1FMGA 4ZAEA 1GVLA 1JRTA 4Y79A 1SGRE 1V2WT 3PM3A 1Q3XA 5DPAA 2BD5A 3B23B 4ASHA 1XUJA 1SGNE 2Z3CA 2W7SA 1ELEE 4INLA 1XUKA 1HAOH 2AIQA 1WUNH 4X8VH 3BG8A 2FIRH 3ZVBA 2D8WA 3RC4A 1GHAG 2ALVA 1KTSB 1SQTA 4FUEA 4IGDA 1GBEA 2Y5FA 4JCNA 2FOAA 1HGTH 4Y6DA 3ZZ5A 1XXFA 3Q3XA 2HOBA 3F3BA 1J16A 3T28A 1C9TA 1WTHD 4ZKNU 1BJUA 1XKAC 1KXAA 2M5TA 1O5AB 1BBRK 4NZQA 1P04A 2A45B 1SKYE 4FUIA 1NROH 1UCYK 2FZZA 1GJBB 2FTMA 5GCHG 2CHAB 2LP6A 3I77A 1GCTB 5AHGH 1LTOA 2K8IA 3DSGA 2VIWA 3Q3KA 3GCHC 1ABJH 2WYGA 3LGTA 3UAIC 3ZZCA 1JIRA 1TGCA 1K1MA 4HG6A 2JKHA 3KQEA 1NRPH 3LGVA 1A1RA 1ANBA 1O35A 2UUYA 3RXMA 4U2WA 3P95A 1U6QA 2PHBA 1FN6A 2ZFSA 2QV1A 3GDSA 3STIA 1ZPCA 1DLEA 3TH3H 3SV7A 1C5RA 3NXPA 3D62A 2ZEBA 3RXJA 3PLBA 1HXEH 2JH0D 1TGBA 2J95A 1K28D 4Y10E 5ESBA 3RXQA 3O8RA 2PUXB 4RT1A 1O2MA 1FONA 1HDTH 4M7GA 1M9UA 1NT1A 3T25A 4ASUD 5GCHF 2FWWA 1BTWA 1GBAA 1GI8B 1HFDA 1QA7A 3DFJA 3M5OA 2XW9A 2ZTYA 1Q31A 2O8LA 1A5IA 2H2ZA 3HGPA 3QZQA 5T6GA 3UB0A 3FP7E 3Q77A 3PWBA 1FY5A 3LGUA 1PFXC 3VXEH 2JH5D 3UOUA 1MTSA 1S0RA 3ZZ8A 1KIGH 2BQ6B 3NRLA 2C4FH 1AUTC 2GCTB 3MMGA 2F9OA 2PGQB 2J4IA 2WV4A 3NCLA 5C1XA 2TBSA 3FANA 2QE7D 2XC4A 2QGRA 4H6SB 2G5NA 2ZO3H 1WXRA 5EQSA 1P12E 1QBVH 3A7ZA 1AGJA 1D3QB 3A82A 3GISB 4TYDA 3U8RH 2FESH 2BDIA 3E91A 3DFLA 4UDWH 1NO9H 4X2YA 5T1VA 1E38B 3TNSA 1C5SA 2ZC9H 2OC0A 3K9XB 1EFRD 4ISLA 1GJ9B 3VPKA 1SQOA 1FJSA 2AMQA 1LO6A 5A0CA 1GI3A 4WXIA 1DDJA 3ZZAA 2W3KA 3P8OA 1EAIA 1S0QA 2ZDLA 4INKA 2F9PA 4NIWA 1ZMLA 3N7EA 2H1UA 1TLDA 4BAOB 4I8KA 1ESAA 2RG3A 6GCHF 1MMJN 1TA6A 4ZMAH 4NIVA 2AHME 5B6OA 1LVBA 2ZHEH 5E2PA 3PLPA 1UJ1A 1DWBH 1C5NH 4GHTA 4BOHA 1KXCA 4GLYA 1XUFA 3VB5A 1O3EA 2B0FA 1DOJA 2YOLA 1GJAB 2FLRH 3FFGA 1THPB 2UWPA 1GHBG 1CHGA 4Y0ZE 5E0HA 3W94A 1J17T 1ACBE 2SNWA 4ZHMU 1NRQH 2PUQH 1XUIA 3GOVB 2A2QH 2XBWA 4O97A 3F68H 3MU5A 3LH3A 1DSTA 3TPIZ 5E0JA 1J9CH 3SU3A 1TE0A 1GBBA 1C5ZB 2QF3A 1RFNA 4K2YA 4X1SU 3K6ZA 4LOYH 1QRWA 3ZV9A 3ZIAD 1NPMA 1VCQA 1XUGA 2XYAA 2XRCA 4NA7A 1P03A 1O5FH 1O3AA 3FZZA 1CVWH 1YWUA 1ETSH 3LPRA 3VGCB 1HAVA 5DP4A 1SPJA 2BVXH 2SGPE 3EYDA 3H7TA 3V13A 6CHAC 1HV7A 2BY7X 1NBMD 2BY5X 3PB1E 5L2ZH 1GJ6A 3TK5A 3ZZ6A 3ZZBA 1N8OC 4CRBA 2P95A 1EJAA 1TNLA 1SLVB 1BJVA 1C2JA 3BTME 3O8DA 1HAIH 3E8LA 3M3VA 1PPHE 1HAVB 2ANYA 3BTTE 1GI4A 4F55A 1C1WH 1HAYB 5CHAC 1G30B 1BRBE 3QO6A 4NFEA 5PTPA 3GCNA 1OX1A 1SQRA 3ATMA 3GICB 2ZPQA 2XTTB 3TJUA 9ESTA 2G4TA 1MAYA 3A84A 1TQ7B 5DKMA 1Y8TA 4ESTE 1EZQA 3Q76A 5GDSH 1Y3XA 2R0LA 1JOUB 5DP5A 2FI4E 2V3HH 1GGDC 2GJGA 2HGTH 4MQAA 3DSOA 3EGKH 4XD7D 1TX8A 4P02A 1C2FA 2FYRA 1FNIA 1BMAA 2ILNA 2ZGJA 2PP6A 4RT0A 4FXGH 1C5TA 3D49H 5EXMA 3O8BA 3EA8A 2Z3DA 1RD3B 5I46H 1QL8A 1AKSA 1C5VA 3PYHA 1XXDA 1H9HE 1LVMA 1WQVH 4VGCB 1GJ4H 3HK3B 3KGPA 4J1YA 1QNJA 1OSSA 3V7TA 1DXWA 3TJOA 2ZPSA 1RTKA 3RXAA 1CGHA 1TRMA 1ZTKA 2WV5A 5DGJA 4DVAU 1ZJKA 1HBTH 3RXVA 1MD7A 4AYVB 1LHEH 2Y5HA 1AIXH 3PLKA 1K21H 1P10A 3S7HB 2YNAA 1UVOA 3UNRA 2BY6X 5BRRE 1BMMH 1DICA 1TGTA 3F1SB 4XOJA 3HK6B 4Y8ZA 4X0WU 4WXVA 3FVFB 1O5BB 2CV3A 4JYUH 1GBHA 4JYVH 1QRXA 3HGNA 1T8LA 1IOEA 4NIYA 1GHXH 3R0FA 2J98A 2FOFA 3H7OA 1OHHD 2NWNA 3RXEA 1AZ8A 1FY3A 2K7XA 2Z3EA 3SI4H 3TVJB 4WJG2 3ZVGA 2BOKA 2G8TA 2SGAA 3B9FH 3UNQA 3PRDA 3RXSA 1LHGH 4I7YH 1YY3A 4TPIZ 3GCTG 1AB9C 2A4GA 1TA2A 3ZZ4A 1GBMA 5EU8A 3QX5H 4IC5A 1GMCF 3I29A 3SO3A 1HAXB 2BM2A 2P8OC 4F4OC 2A2XH 4MPVA 2K1QA 1AVWA 2WPMS 2OBOA 2OC8A 2OXSA 3LU9B 3M7TA 1CGIE 3AASA 1E35B 1TALA 2BVSH 2QIQA 1Z8RA 3OX7U 4TY6A 1ZJDA 1DUEA 1LQDB 4WY3A 2GX4A 1ELDE 1DWDH 1DUAA 1LKAA 2ZF0H 4X6OA 3F6UH 1UVPA 1E79D 1V2ST 1MD8A 3UR6A 4TY7A 2W3IA 3GY6A 1OWIA 3M7QA 1CHOF 3EA7A 2CXVA 1QL7A 1BTYA 1K2I1 1XMNB 5G4BA 1MU8B 3VXFH 3U1IB 1GMCG 1LVYA 4I8JA 2D2DA 1KLIH 1V2VT 1QTFA 2BOHB 2QXJA 1SGFA 3MNSA 4K1TA 3UQVA 2BDGA 4FUCA 5C17A 2F9UA 1C1UH 1QB6A 1O31A 3A7TA 1UO6A 1KLJH 4RI0A 1SGDE 1YP9A 1MCVA 1GI9B 2XCFA 3BTKE 2BDCA 1JBUH 2V3MA 4BAQB 1RIWB 2RFKC 1O3BA 3SOSA 4B1TA 2Q6GA 2OQ5A 3S69A 2FXRA 1P2KA 1YGCH 2HVXA 2OD3B 5K7RA 3BTHE 4GCHG 2NU1E 1W2KH 5DP9A 4FUJA 2AMDA 3GCTF 4DIHH 3QGNB 4WVPE 1GI7B 1SLXB 1XX9A 3MTYA 1IQNA 1YLDA 1AE5A 3OYPA 3BSQA 1GI2A 5EPNA 5HYOA 4MPWA 5L2YH 4K1SA 3JZ1B 3MNBA 3ZVDA 1Z71A 1A3BH 5JBCS 5DP6A 1TBQH 5FBIA 5HXFA 1F0UA 3MO6A 1Y3UA 1SLUB 2XC0A 2PW8H 2GKVE 3A7YA 4H42U 2R3UA 1UTLM 2FOEA 4NFFA 2NU2E 1TNGA 1PYTD 1LVOA 1H8ED 4GPGA 3RM0H 2ZECA 1AUJA 1D3PB 1RRKA 2ZTZA 1QA0A 2QF4A 4NWLA 2OP9A 3DD2H 4FUFA 5J4QA 4WMDA 3VB6A 1DX5M 3SNDA 3JZ2B 1S5SA 5EJ1A 4X8SH 2G81E 2GT8A 2B8OH 1P09A 1DLKB 1MKWH 1YPHC 1V6DA 3B8JA 4A7IB 1H9IE 1PQ5A 1TGNA 1O5GH 2STAE 2GTBA 1O38A 1O2NA 2FOBA 1GJ5H 2SGEE 3T62A 1WQSA 3RUOA 3W95A 3LT3A 5HIYA 2P3TB 4YO9A 3BTWE 1CBWB 2R3YA 2ZWLH 4BAKB 2J98B 1GDNA 2WV9A 4LZ4B 1OWEA 1V2OT 3RU4D 1S6FA 2GCHF 1PJPA 4TPYA 1Z8IB 1UK2A 3GYLB 3UUZA 1LKBA 1QQUA 8KME2 3RMLH 3N99A 1GHYH 2ODPA 2F3CE 2BXTH 3F9HA 1DPOA 1HLTH 1O3FA 3G01A 3M5NA 4X6NA 2PKSB 1MBMA 1MTUA 1QJ1B 2QF5A 3TK6A 4YXWD 5JYIA 1SFQB 3BF6H 1OWDA 3HPTB 2KR7A 2ULLA 4CREA 3SU0A 3TIUA 1OOKB 1CT0E 3A88A 1F7ZA 1EAWA 4NA9H 1MQ6A 1ANCA 2J2UA 1DY8A 1RGQA 2F91A 3DSPA 3KF2A 3R3GB 2VJ1A 1O3HA 3SV8A 1OS8A 1EPTC 1HJAC 1P9SA 5KGOA 5L6NH 1TX6A 4D7GA 1X7AC 5DK1A 1W13U 1AKSB 3U9AH 1WBGB 1AWFH 2VNTA 4ZHAA 1K22H 4JZDH 2GD4B 4MVNA 2UUJB 3ATKA 1GHBF 4DT7B 3ZYDA 2XCNA 2ZDMA 3ATLA 3QDZB 5A8ZA 2C8WB 3F2FA 5GNDA 5C0TA 1W0JD 3RXDA 1LPZB 1CA0C 1P02A 1NRRH 2VWLA 1K9OE 1RTLA 2F9BH 2OUAA 2JJ2D 3FO8D 1H8DH 4DGJA 5HGGA 2YMSD 5H4IB 1A5HA 2PR3A 5E8EH 1MKXK 5LPRA 2H9TH 1SGTA 3AW0A 5I25A 2HNTC 2UWLA 1O2XA 1Z8GA 2Y81A 1GBCA 1LPGB 5FPYA 4AFQA 3TJVA 5LPFA 4NA8A 3PTBA 4AG2A 1IHSH 5FCKA 5F8XA 4JK5A 1SGQE 3M35A 1NFUA 1HRTH 2EI7A 4DT4A 1K1NA 4HGCA 1ARCA 2AIPA 4I86A 4DY7B 1AE8H 2LIZA 1HJ9A 1BBRH 1HPGA 2QXGA 4H6TA 2BHGA 1YPJH 3P8GA 4FU9A 1GBDA 3VB4A 5C0UA 1CQQA 5EQQA 3RP2A 3A8AA 3UOPA 2C3SA 1C4Y2 1EZSC 5T6FA 3M61U 2GZ9A 2HPQH 2ODYB 2ZFPH 4CRCA 2C8XB 1W0ZU 4XE4A 1A3EH 7GCHG 1P3EA 1LHDH 5EODA 1FAXA 1TRYA 2J94A 4NCYA 3OE7D 1K0HA 3HATH 1AMHA 1TOMH 4IBLH 1XVOA 1PPZA 1T4UH 4UONA 1ZRKA 4MNWA 3BTDE 4GUXA 1ZGVA 2XOKD 2BTCE 3CNRA 3LH1A 1BRUP 1TGSZ 1B0FA 1HAZB 3FP6E 1OP0A 1FQ3A 1DWEH 1VCWA 3GY5A 2VU8E 3PWCA 2Z9LA 2H9HA 1EXFA 1TB6H 4SGBE 1GI0A 1WU1A 1SGPE 1OWKA 3A8DA 2JETC 2H5DA 3KQBA 2ZU2A 1GDUA 1WYKA 2I6QA 1EOJA 3MFJA 1SQAA 3U28C 4JZ1A 1EZUC 2Y7XA 1G3EA 4BTUB 3LDXH 2NU3E 1Y5UT 1RS0A 5IYTA 1L1NA 1S81A 2A7JA 1UTNA 1IQEA 4MDSA 1KXEA 3EDXB 3TU7H 2OLGA 1BMFD 5A8YA 1H8IH 2STBE 4AC9A 3PV4A 2WINI 3SU5A 1P05A 4KP0A 4B6FA 5EG4A 3SHAH 3LJJA 1QJ6B 2BLQA 4CRDA 1JIMA 1EATA 2P93A 3A86A 3MWIU 3KYGA 1O34A 1WOFA 5SGAE 2VWOA 8GCHG 2OCVB 2XNIA 3S9AA 4I33A 2J38A 3MH4A 1XUHA 3VB7A 1LMWB 3GYMA 4XSKU 5DP3A 1EAUA 1ZSKA 2CJIA 3LGYA 3VEQB 3KIDU 3T29A 7LPRA 1P2OA 1TFXA 1MTNB 3MH5A 1FN8A 1V2TT 2GMTC 3A85A 4JZFH 3OEED 2Y82A 4OGYA 1SGEE 2OC7A 1QR3E 2FS8A 1PPCE 4I8GA 3ZZ3A 1QQ4A 3QN7A 2BQ7B 3URDA 1OWJA 2ZGCA 1UHBA 4UFEH 4CHAB 1QB9A 3EE0B 1VJ9U 1VKYA 1FY4A 1NY22 3S7KB 1S6HA 1KLTA 2VVUA 1L4ZA 5EIYA 4OS6A 1YCPM 2QCYA 1FAKH 1GHAF 2V7QD 2WUCA 5GXPA 1KXBA 2ZU3A 3L33A 2KAIB 1NN6A 1W12U 3SJIA 2P8OB 3KNXA 3OAAD 2FO9A 3SW2B 1S85A 1GG6C 4MLFB 2B5TB 1ELGA 2D1JA 3FOAA 2GT7A 1BIOA 2V3OH 3MOCA 3ZVFA 1NESE 5EOKA 4XDEA 3TK9A 4K1EA 5AFZH 5AF9H 4JZEH 2KCPA 4FU7A 3LIWA 5AFYH 1CA0B 1CT2E 2ZDVH 1C9PA 4B2AA 1YCPK 3A83A 4OS7A 3SYJA 3SZEA 2CHAC 2CK3D 2W6ID 3RMMH 4UFFH 1RXPA 4MTBA 1BBRE 1MZAA 1SGCA 4ACBA 5FXLA 2PKAA 2Y5GA 3V3MA 3RU4T 1NZQH 3NK8A 3DHKH 2FOMB 1SC8U 1YYY1 4O03A 1TX7A 4YT7H 3CS0A 1FX0B 1ZTLA 3U69H 5A0AE 5C5NA 1ZYOA 3A8BA 1C5YB 3E90B 4AYYB 4O3TA 5A09A 1O2HA 1DSUA 2H6MA 1BZXE 3AW1A 2B9LA 2ALPA 4DOQA 2EI8A 3RLWH 1FDPA 2QAAA 1FIZA 3TNTA 2TRMA 3PO1C 1O36A 1CSOE 1LHFH 5LH8A 2RA0A 3AAUA 2A4OA 4ZXYH 4ZKRU 2F43B 2C93B 1CHOG 1NRNH 4K60A 1DANH 3S0NA 1ELFA 1WDIA 4ZUHA 1EB1H 1GPZA 1W3CA 1FPHH 1TBRH 4YLUA 2ZDKA 5TCCA 3UPEA 2FP7B 4WH6A 1NM6A 1SMFE 1GJ7B 1IQKA 1V2NT 1L1JA 3IG6B 1ELBA 5FX6A 1KMHB 4Q2KA 2GVFA 5CHBA 2PWXA 5JPMH 4H4FA 2Q6FA 1YBWA 4ZCNA 1BCUH 2SGQE 2J97A 3SORA 1AWHB 3SV2H 3VGCC 4DJZB 2VH6A 2HLCA 2KCYA 2QYIA 1G37A 4CR9A 1F0TA 3SQHE 4JZIA 2FMJA 4A6LA 1AVXA 1WCZA 4CRGA 1GBFA 2O8TA 1ID5H 1HYLA 3HKJB 5J4SA 2W6JD 3OSYA 1NC6A 1SOZA 4ISHH 3VG8A 4BNRA 5EW2H 2AS9A 3MU1A 1C1OA 2CGAA 2P3UB 1B7XB 1XM1A 2FOCA 1TPOA 4Q4LA 2JIZD 4FUGA 1YCPH 3RLYH 2DE8A 1NU9A 2A5IA 2ZQ2A 1PPEE 3S9BA 1UTMA 2ZU1A 4LZ1H 1A46H 4YOGA 2JJ1D 5LGOA 1TMUH 4ABGA 3EAJA 1A4WH 1TPAE 1DFPA 1Y5AT 1ZZZA 1GMHF 2ZFRH 1O2SA 2H5CA 4ABIA 1KXFA 2ZFTA 4E06H 3FZDA 1IQFA 1F5RA 2WPIS 4Y0YE 4YTAA 2BDBA 2FS9A 5B6LA 2ZI2H 2BZ6H 3LC5A 3TH2H 2QF0A 1BRCE 4PROA 2R0KA 4FVDA 3ZZ9A 3RXTA 3SGBE 1BOQA 1JWTA 5TJXA 1PPFE 4DCDA 1Z8JB 3C27B 5F53A 1BITA 4FETA 4XBDA 3VB3A 2YMSB 3NWUA 1SFIA 3EE7A 4K8YA 3U98H 4KGAA 4F48B 2J34A 4X2WA 1V3XA 3SU6A 4CBOA 3OFND 2VGCC 3KN2A 3A80A 4TWYA 1ABIH 5A8XA 2HALA 1C5PA 1F0RA 4IW4E 3F9GA 3QZRA 4AG1A 1YC0A 3MO9A 3WW7A 4OS4A 1D6RA 2IJOB 1BTPA 3ESTA 1D9IA 2I6SA 1W8BH 1C2LA 5C3NA 1WAYB 1SB1H 4YT6H 3BEIB 3SV6A 1HB0B 1N6XA 1O2QA 3MU4A 2ZU4A 4O3UA 1THRH 2A0QB 2HWLB 1GG6B 1G32B 1L4DA 3NKKA 2A31A 4E7RG 5EJZA 4ABAA 3W1EA 3A81A 2HVYB 1ZHRA 4D76A 3RXPA 1W7GH 5JBAS 1NU7B 2WPHS 1SOTA 1T8NA 1MH0A 1O5DH 1C1TA 1GI5A 2BLWA 1H9LB 4AFZA 1IQHA 3N7DA 8ESTE 3OY6U 2W26A 3RMNH 3H5CB 2FTLE 4B73A 1QB1A 4WWYA 2VIPA 2ZDNA 4LXBH 1OP8A 1OWHA 4UFDH 1KDQB 2PLXA 3GCHB 3UIRA 3NPSA 3BIUH 1FIWA 1ETRH 2G51A 1UK4A 4B2CA 1MTNC 3ITIA 1TMBH 2XNDD 4XBBA 4KTCA 1W10U 2RDEA 1QIXB 4AGJA 1WTGH 5FL7D 1COWD 1Y59T 1BQYA 1GWAA 3BV9B 4I32A 4UE7H 1HJAB 1EAXA 4WH8A 4WF8A 3KQCA 1ZMJA 4X1PU 2BD7A 3OU0A 3I78A 4X8TH 1C5OH 2P59A 1GVKB 3BG4B 3SQEE 3QWCH 1G9IE 1S84A 2J9NA 1ELTA 9LPRA 5JBTA 3C1KA 1K1OA 2VIQA 4D8NA 2L6OA 3RMOH 1O2TA 2PTNA 3K65B 1TAWA 2O8WA 4Q63A 3OEHD 1A0JA 1DWCH 1HCGA 2FM2A 1D3DB 3QTOH 4D9QA 2AERH 1UTJA 3IITA 3SUFA 2O8MA 4NZLA 4YOIA 1YLCA 1G3CA 3PROA 3RXHA 1G3DA 3ATWA 3UQOA 5CDFE 5DSFA 2IN2A 3L6PA 2BLOA 3PRBA 1E1RD 1O2YA 4Z1MD 5BPEA 2BY9X 1GL0E 1BB0B 2CMYA 3RXIA 6CHAB 4RSPA 3M37A 4WMFA 1Y3VA 5HKKD 1F5LA 2AGEX 2G00A 4AGKA 1TQ0B 1VJAU 1VZQH 5JB9S 4MNYA 5GJ4B 2FX6A 1AO5A 2Q1JA 2BDAA 2SFAA 3MH6A 4HTCH 1PPGE 1JXPA 4INHA 1LDTT 2AYWA 6ESTA 1UVTH 4ISOA 4GAWA 3TH4H 1FY8E 1EASA 4MNVA 3EBNA 2GV7A 1HJ8A 2VWMA 4E05H 4DIIH 1O0DH 5CE1A 3P8FA 1J14A 5C20A 1DE7H 3ATIA 2SGDE 1AU8A 2EEKA 5A0BA 1O3OA 3HKIB 4ABFA 1YPKH 4YZUA 4YM9A 2Y6TA 2ANKH 1E36B 1O3GA 1UVSH 1HAHH 1GBIA 1YKTA 2EI6A 4TSFD 3LKWA 1TBZH 2PSYA 1S6LA 4HFPB 4K69A 2ZTXA 3DT0H 3LGIA 1V2PT 1DXPA 1ZLRA 4D7FA 1TYNA 2FDAA 4IC6A 2VH0A 2JETB 3F2GA 1O5CB 1Z7KA 5C94A 2A7CA 2P94A 5F8TA 3KL6A 2FI3E 1TRNA 1ELCA 3M3TA 1PQAA 1P2JA 3SNAA 1T7CA 1FY1A 4WMEA 3N7OA 2XC5A 2P3FH 4OGXA 2ZNKH 3SJOA 3ZV8A 2Q6DA 1BHXF 4Y76A 3E1XB 1AN1E 1N6YA 2XBVA 1Y5BT 3RXCA 1O3JA 2CF9H 1F92A 1O2KA 1VR1H 2K0QA 2VBCA 5HM2A 2BY8X 3EA9A 1GCDA 4NG9H 4JYTA 3MU0A 3SUGA 2TGAA 2Z94A 3F0PA 1SHYA 5HM9A 5HMAA 1AB9B 2BD2A 3BEUA 5EGMA 1W0YH 4AORA 1D6WA 1TNJA 1BRAA 6LPRA 3AVZA 1GBJA 2SGFE 3VFEA 2CN0H 3MNXA 2LNCA 1TMTH 2ASUB 2XBXA 1IQMA 2A4QA 4O9VA 4AFSA 3QLPH 3GY4A 2O9QA 5FX5A 1HUTH 1HIAA 3RM2H 5TCAA 4Y11E 4KTSA 2BDHA 1AHTH 3PO1B 1ANEA 2ZKSA 3SJ8A 1TPPA 1C5XB 1O30A 2QN5T 3SJKA 1UTQA 4MPUA 1OP2A 4FUDA 3BG4C 1EPTA 1Z6JH 1C2HA 1T4VH 4ZKOU 1IHTH 1KY9A 1K1JA 3E6PH 2IOTA 4GVUA 1SSXA 1OKXA 5FPTA 1LCYA 4J2YB 2D26C 2LELA 2KM0A 3SJ9A 2FPZA 4FUHA 4BAMB 4E7NA 2Z9KA 3GCOA 4VGCC 4IMZA 2FI5E 2FYQA 2EY4C 4BXWA 1P06A 3FAOA 4A1TA 1AY6H 1IQGA 4NGAH 2ZCKP 2KX4A 2ZQ1A 2RDLA 5LPEA 2TIOA 4AOQA 3RXRA 1VITH 4B76A 3MNCA 3BTEE 1MQ5A 2AGIX 3UTUH 3UR9A 2V6NA 1YPHE 2OC1A 1LPKB 3RXLA 5ESTE 3RU4E 3MQKC 1GBLA 4AX9H 4THNH 4YOJA 1ZRBA 4OS5A 1O2VA 1C1NA 1O3NA 4ABJA 1C5MD 4UD9H 5DN6D 4AN7A 2FOGA 1MU6B 3MU8A 4XRNA 1C2IA 2EA3A 2VVCA 5FBEA 4X1RU 1UMAH 1L0ZA 1TPSA 1SL3A 1MBQA 4BTIB 1MKWK 3A7WA 1UK3A 1GDQA 4LK4A 3K2UA 2BVRH 1C1PA 1THSH 3ZVCA 2WPKS 4DURA 2GMTB 2Z9GA 1F5KU 4U32A 3URCA 1VITG 3P92A 1L1GA 1MABB 2HNTE 1N8OB 1RTFB 4A1XA 1J15A 3WWBA 2GZ8A 1HXFH 5EXNA 2XWBI 3BN9A 1KTTB 1IQIA 3LOXA 7ESTE 1BTXA 5C1YA 1CGJE 1O5EH 1ORFA 2B7DH 1YPEH 2ODQA 3Q00A 1ANDA 4CR5A 3OY5U 1B5GH 4FVBA 2ESTE 3BEFB 2AGGX 2FOHA 2KAIA 1IQLA 4B75A 1P9UA 1GJ8B 2V0BA 1A7SA 4ISNA 3T27A 1AVGH 4X6PA 3FN8A 3SV9A 4NSYA 3E0PB 4ABEA 1H4WA 1O3KA 2HRVA 1UHBB 4U30A 2Z9JA 3GDUA 1A61H 4OM9A 1F0SA 5T6DA 1IAUA 2JH6D 3QTVH 3SUEA 1VCPA 4F49A 4Y8YA 3SUDA 2V35A 4BAHB 4JK6A 2OTVA 2VIDA 4B6EA 3ZVAA 4ZROA 2ZZUH 1QZ8A 2BXUH 4X1QU 5T3HA 2R9PA 2GDEH 2EC9H 4BANB 2PSXA 5EPYA 3RXOA 1YPMH 2CF8H 3RXUA 3UWJH 3TGIE 4FUBA 3RC5A 4Q7ZA 1H8HD 2QXIA 5C1UA 1UVUH 2WZQA 4UEHH 2TGTA 2L74A 4OS2A 1ZOMA 3GS9A 4K5ZA 1O3IA 1Z1JA 2ZA5A 3A89A 3WWFA 4KTUA 2PFEA 1T8OA 3OTPA 2KCAA 1C2KA 1FI8A 3SNBA 1AFQB 1O2PA 1VGCC 3FKSD 3M5MA 2NU0E 5F6MA 3MO3A 1NFWA 2VWNA 2A5KA 1H1BA 1SGFG 1AD8H 3M36A 3PMHB 2BD3A 3T5FH 2ZP0H 3KQ5A 2HNTF 2TGDA 3P6ZB 3LONA 2DUCA 3F0OA 2PTCE 2GCTC 3GY7A 4ZH8A 1ZPZA 4ACAA 4CH8B 3E16B 5FPSA 1G3BA 1A5GH 1G2LA 5DP7A 1L2EA 1SI5H 2HLDD 1YM0A 1S82A 1Z1IA 2YNBA 3SU4A 2A5AA 1K1LA 1SHHB 3SN8A 3PMJA 3BTFE 3LJOA 1AFEH 1BUIA 2R2WU 1AI8H 5EJLA 1GJCB 3T26A 5C5OA 1F2SE 1EPTB 3H09A 3M5LA 1BMNH 1O32A 1E37B 1CO7E 1N1LA 2ZHQH 3DCLA 2AEIH 1V2JT 3CS7A 1QY6A 4UFGH 1O3DA 4DG4A 3P17H 1K1PA 4MNXA 1NFYA 2THFB 4FOUC 1HIAB 5K0HA 7KMEH 1PQ8A 2KZ4A 5E0GA 1C2EA 4TWWA 8GCHF 1RJXB 1O2GH 2BX4A 2J5UA 4GHQA 1NBME 3KHVA 2GGVB 3GY8A 3T2NA 1GI6A 2OBQA 4Z0KA 1GMDG 2PKAB 1G36A 3SNCA 1GBTA 2KFWA 2G5VA 1Y3YA 1EJMA 1KSNA 1NTPA 3LC3A 1BA8B 1BTZA 2C8YB 3AK5A 3E0NB 3PV2A 4HZHA 4Y8XA 3Q3YA 1A2CH 3EQ0H 5GIBA 1OYTH 3AAVA 4CBNA 2G55A 3ZVEA 1C2DA 4ABHA 4X1NU 3QUMP 1D3TB 1EJNA 1O2UA 2A32A 5CMXH 2Y7ZA 1O2RA 3V12A 1CA8B 1Y3WA 2RCEA 1BT7A 3LGWA 5JDUB 1QBNA 1K1IA 1BHXB 1O3MA 2YMSC 1MUEB 3RC6A 2TPIZ 1HAGE 2UWOA 4BTTB 1MAXA 1HNEE 3U1JB 2BQWB 2ZPRA 1O2WA 2WSSD 1EUFA 1P11E 1TNIA 2WPLS 2Z9IA 3OTJE 3F9EA 4B74A 5JB8S 1O3PB 4NIXA 5GWZA 1DY9A 1IQJA 3A7XA 2ZCHP 1ELVA 2ZHDA 2G52A 3UY9A 2EQNA 1MKXH 1BMLA 1BTUA 3F2HA 2ZU5A 4CRAA 1CBWC 3M3SA 2BD8A 1DT2A 3NUMA
chains in the Genus database with same CATH topology
1CT4E 1ZHMA 3O8CA 2QC2A 3K6YA 3MH7A 2F9NA 2GCHG 3FP8E 4GSOA 1OYQA 2VGCB 4X2XA 4XBCA 1C1VH 5C2ZA 1O2LA 2BZAA 1C5UA 4NWKA 3NZIA 1TONA 4HI3A 1Q2WA 1GHZA 1NFXA 1UTPA 4A5TS 1GI1A 1EQ9A 2OINA 2ANMH 1T8MA 3MYWA 2P16A 2F83A 2SNVA 1FZZA 2PGBB 1OPHB 1UCYE 1RIWC 3SBKA 2QA9E 4AB9A 4U01A 5GPIB 1ZTJA 2GV6A 1VITF 2GDDA 3DUXH 1ARBA 2AH4X 4Q80A 4DW2U 1C1SA 2ZHWH 2NU4E 3SGQE 2TGPZ 4YLQH 1G2MA 1V2MT 5JBBS 3TGKE 1J8AA 1YPGH 1TABE 2WPJS 1DM4B 4QT8C 1ZR0A 5DO4H 1TNHA 4IN2A 3MI4A 3SNEA 1GMHG 3TITA 3RXFA 3A87A 4Q7XA 2G4UA 3CP7A 4X8UH 4YESB 5AVDA 1XVMA 1W14U 2HPPH 4AB8A 3RXKA 4CRFA 1GBKA 1ZPBA 2BDYA 5DJ7A 3STJA 2W5EA 2VINA 1MTWA 3PTNA 1HAPH 4Z6AH 1ELAA 1V2QT 3E3TA 1O2IA 5DP8A 1B0EA 1P57B 2BX3A 1KXDA 1SLWB 2ZGXH 1DITH 1O3LA 1C5QA 3GDVA 1GMDF 3KQDA 1A0LA 3ODDA 4SGAE 4ZXXH 2GP9B 4MPXA 2QXHA 5FAHA 2Z7FE 2VIOA 4KKDA 1MZDA 4R8TB 4RN6A 3ODFA 3SZNA 1KDQA 4AFUA 2BYAX 4Y71A 2ZGBH 3BTGE 4ZHLU 1TOCB 1ZMNA 3PMBB 4D9RA 3F9FA 2VIVA 4FU8A 1GHVH 1LHCH 4I8HA 1C2MA 3QK1A 3SU1A 3TJNA 7GCHF 4IN1A 5A2MH 1C5LH 1SR5C 2XBYA 6GCHG 4A92A 1ETTH 1P0SH 3A7VA 3RXBA 3MHWU 2AFQB 4OS1A 2RA3A 2BB4A 2VVVA 3ZZDA 3SU2A 2BMGB 3P70B 1GHWH 3KCGH 1P8VC 1FLEE 1ESBA 1TIOA 4Q7YA 1YPLH 2FX4A 1UTKA 1O2JA 8LPRA 1GL1A 1P2QA 4ZKSU 3ELAH 3ZZ7A 2FEQH 2AMPA 4ISIH 1JRSA 2R2MB 1PYTC 2OQUA 3UNSA 1TNKA 4R0IA 2C8ZB 3M7UA 3BIVH 4RKJB 4K8BA 2F9VA 1SGIB 4GCHF 1E0FD 3TLOA 5F03A 3RDZA 2ZFQH 1GCTC 1Z6EA 2ZFFH 4X2VA 3RXGA 1EP6A 2XWAA 4X6MA 1CE5A 5F8ZA 2XXLA 1OXGA 2GZ7A 3DA9B 4ABBA 4XFQA 3CENA 4B2BA 2FLBH 3D65E 2FODA 1SBWA 1FXYA 1KYNA 1S83A 1D4PB 1ESTA 1ZGIA 2A7HA 2H9EH 1GVZA 1UCYH 1FV9A 4CH2B 1C2GA 3L3TA 1E34B 2ZIQH 1V2KT 5EQRA 1O37A 4A1VA 1O2OA 3IWMA 2BLVA 1EX3A 1YF4A 1O3CA 1P3CA 1TWXB 4CHAC 5FCRA 1NRSH 1SGYE 2Y80A 1DVAH 1MCTA 1WSSH 5DG6A 2WYJA 3V0XA 5L30H 2PKSC 1PQ7A 2LPRA 1QJ7B 3P8NA 3ENSB 1C4V2 1CU1A 4IS5A 1C4U2 3SGAE 3UFAA 5ABWA 2ZDAH 2O8UA 1SVPA 2C90B 2BD4A 1A0HB 1C1RA 4I31A 1QGFA 2ZGHA 3KEEA 4Y7AA 1MTVA 3U8OH 5E2OA 1QURH 1INCA 1QRZA 2Z6BD 4RKOB 3UWIA 1FPCH 3SI3H 1EKBB 1EB2A 1QL9A 3QGJA 1GGDB 5ETXA 1BDAA 1NS3A 4I8LA 3SHCH 1ZSJA 1EP5A 1W7XH 1AFQC 1WV7H 1GJDB 1P2IA 1VGCB 1SG8B 1QBOA 4K3JA 3ZYEA 4BXSA 4NSVA 3BTQE 1O2ZA 1PPBH 4KELA 1P2MA 1C1MA 1T31A 1XKBC 2UUKB 2ZG0H 3A8CA 1QCPA 4Y7BA 3TGJE 2ANWA 4JMYA 2WUBA 4B71A 1EZXC 2A1DB 2ZHFH 2J92A 4MG3A 5CHAB 2VB0A 2IPHA 2UUFB 5C67A 3D23A 3U8TH 1V2RT 1AQ7A 1V2UT 4AZ2B 3GY3A 3UREA 1ZSLA 1UTOA 1DS2E 1QFKH 1W11U 1LQEA 1O39A 2BD9A 2W7UA 1QHRB 1FUJA 1C5WB 5EXLA 2PV9B 1O33A 3S9CA 1P2NA 1BTHH 1P01A 2A4RA 1T32A 4IMQA 3WY8A 5EW1H 5FHTA 5IDKA 4ABDA 1V2LT 2ZCLP 1C1QA 1ZHPA 1JMOH 2DE9A 1AZZA 2QY0B 3GY2A 3PMAB 1EOLA 1FMGA 4ZAEA 1GVLA 1JRTA 4Y79A 1SGRE 1V2WT 3PM3A 1Q3XA 5DPAA 2BD5A 3B23B 4ASHA 1XUJA 1SGNE 2Z3CA 2W7SA 1ELEE 4INLA 1XUKA 1HAOH 2AIQA 1WUNH 4X8VH 3BG8A 2FIRH 3ZVBA 2D8WA 3RC4A 1GHAG 2ALVA 1KTSB 1SQTA 4FUEA 4IGDA 1GBEA 2Y5FA 4JCNA 2FOAA 1HGTH 4Y6DA 3ZZ5A 1XXFA 3Q3XA 2HOBA 3T28A 1J16A 1C9TA 1WTHD 4ZKNU 1BJUA 1XKAC 1KXAA 2M5TA 1O5AB 1BBRK 4NZQA 1P04A 2A45B 4FUIA 1NROH 1UCYK 2FZZA 1GJBB 2FTMA 5GCHG 2CHAB 3I77A 1GCTB 5AHGH 1LTOA 2VIWA 3Q3KA 3GCHC 1ABJH 2WYGA 3LGTA 3ZZCA 1JIRA 1TGCA 1K1MA 2JKHA 3KQEA 1NRPH 3LGVA 1A1RA 1ANBA 1O35A 2UUYA 3RXMA 4U2WA 3P95A 1U6QA 2PHBA 1FN6A 2ZFSA 2QV1A 3GDSA 3STIA 1ZPCA 1DLEA 3TH3H 3SV7A 1C5RA 3NXPA 3D62A 2ZEBA 3RXJA 3PLBA 1HXEH 2JH0D 1TGBA 2J95A 1K28D 4Y10E 5ESBA 3RXQA 3O8RA 2PUXB 1O2MA 1FONA 1HDTH 4M7GA 1M9UA 1NT1A 3T25A 5GCHF 2FWWA 1BTWA 1GBAA 1GI8B 1HFDA 1QA7A 3DFJA 3M5OA 2XW9A 2ZTYA 1Q31A 2O8LA 1A5IA 2H2ZA 3HGPA 3QZQA 5T6GA 3FP7E 3Q77A 3PWBA 1FY5A 3LGUA 1PFXC 3VXEH 2JH5D 3UOUA 1MTSA 1S0RA 3ZZ8A 1KIGH 2BQ6B 2C4FH 1AUTC 2GCTB 3MMGA 2F9OA 2PGQB 2J4IA 2WV4A 3NCLA 5C1XA 2TBSA 3FANA 2XC4A 2QGRA 4H6SB 2G5NA 2ZO3H 5EQSA 1P12E 1QBVH 3A7ZA 1AGJA 1D3QB 3A82A 3GISB 4TYDA 3U8RH 2FESH 2BDIA 3E91A 3DFLA 4UDWH 1NO9H 4X2YA 1E38B 3TNSA 1C5SA 2ZC9H 2OC0A 3K9XB 4ISLA 1GJ9B 3VPKA 1SQOA 1FJSA 2AMQA 1LO6A 5A0CA 1GI3A 4WXIA 1DDJA 3ZZAA 2W3KA 3P8OA 1EAIA 1S0QA 2ZDLA 4INKA 2F9PA 4NIWA 1ZMLA 2H1UA 1TLDA 4BAOB 4I8KA 1ESAA 2RG3A 6GCHF 1MMJN 1TA6A 4ZMAH 4NIVA 5B6OA 1LVBA 2ZHEH 5E2PA 3PLPA 1UJ1A 1DWBH 1C5NH 4GHTA 4BOHA 1KXCA 4GLYA 1XUFA 3VB5A 1O3EA 2B0FA 1DOJA 2YOLA 1GJAB 2FLRH 3FFGA 1THPB 2UWPA 1GHBG 1CHGA 4Y0ZE 5E0HA 3W94A 1J17T 1ACBE 2SNWA 4ZHMU 1NRQH 2PUQH 1XUIA 3GOVB 2A2QH 2XBWA 4O97A 3F68H 3MU5A 3LH3A 1DSTA 3TPIZ 5E0JA 1J9CH 3SU3A 1TE0A 1GBBA 1C5ZB 2QF3A 1RFNA 4K2YA 4X1SU 3K6ZA 4LOYH 1QRWA 3ZV9A 1NPMA 1VCQA 1XUGA 2XYAA 2XRCA 4NA7A 1P03A 1O5FH 1O3AA 3FZZA 1CVWH 1ETSH 3LPRA 3VGCB 1HAVA 5DP4A 1SPJA 2BVXH 2SGPE 3EYDA 3H7TA 3V13A 6CHAC 1HV7A 2BY7X 2BY5X 3PB1E 5L2ZH 1GJ6A 3TK5A 3ZZ6A 3ZZBA 1N8OC 4CRBA 2P95A 1EJAA 1TNLA 1SLVB 1BJVA 1C2JA 3BTME 3O8DA 1HAIH 3E8LA 3M3VA 1PPHE 1HAVB 2ANYA 3BTTE 1GI4A 1C1WH 1HAYB 5CHAC 1G30B 1BRBE 3QO6A 4NFEA 5PTPA 3GCNA 1OX1A 3ATMA 3GICB 2ZPQA 2XTTB 3TJUA 9ESTA 2G4TA 1MAYA 3A84A 1TQ7B 5DKMA 1Y8TA 4ESTE 1EZQA 3Q76A 5GDSH 1Y3XA 2R0LA 1JOUB 5DP5A 2FI4E 2V3HH 1GGDC 4MQAA 2HGTH 3EGKH 1TX8A 1C2FA 2FYRA 1FNIA 1BMAA 2ILNA 2ZGJA 4FXGH 1C5TA 3D49H 5EXMA 3O8BA 3EA8A 2Z3DA 1RD3B 5I46H 1QL8A 1AKSA 1C5VA 3PYHA 1XXDA 1H9HE 1LVMA 1WQVH 4VGCB 1GJ4H 3HK3B 3KGPA 4J1YA 1QNJA 1OSSA 3V7TA 1DXWA 3TJOA 2ZPSA 1RTKA 3RXAA 1CGHA 1TRMA 1ZTKA 2WV5A 5DGJA 4DVAU 1ZJKA 1HBTH 3RXVA 1MD7A 4AYVB 1LHEH 2Y5HA 1AIXH 3PLKA 1K21H 1P10A 3S7HB 2YNAA 1UVOA 3UNRA 2BY6X 5BRRE 1BMMH 1DICA 1TGTA 3F1SB 4XOJA 3HK6B 4Y8ZA 4X0WU 4WXVA 3FVFB 1O5BB 2CV3A 4JYUH 1GBHA 4JYVH 1QRXA 3HGNA 1T8LA 1IOEA 4NIYA 1GHXH 3R0FA 2FOFA 3H7OA 2NWNA 3RXEA 1AZ8A 1FY3A 2K7XA 2Z3EA 3SI4H 3TVJB 4WJG2 3ZVGA 2BOKA 2G8TA 2SGAA 3B9FH 3UNQA 3RXSA 1LHGH 4I7YH 4TPIZ 3GCTG 1AB9C 2A4GA 1TA2A 3ZZ4A 1GBMA 5EU8A 3QX5H 4IC5A 1GMCF 3I29A 3SO3A 1HAXB 2BM2A 2P8OC 4F4OC 2A2XH 4MPVA 2K1QA 1AVWA 2WPMS 2OBOA 2OC8A 2OXSA 3LU9B 3M7TA 1CGIE 3AASA 1E35B 1TALA 2BVSH 2QIQA 1Z8RA 3OX7U 4TY6A 1ZJDA 1DUEA 1LQDB 4WY3A 2GX4A 1ELDE 1DWDH 1DUAA 1LKAA 2ZF0H 4X6OA 3F6UH 1UVPA 1V2ST 1MD8A 3UR6A 4TY7A 2W3IA 3GY6A 1OWIA 3M7QA 1CHOF 3EA7A 2CXVA 1QL7A 1BTYA 1K2I1 1XMNB 5G4BA 1MU8B 3VXFH 3U1IB 1GMCG 1LVYA 4I8JA 2D2DA 1KLIH 1V2VT 1QTFA 2BOHB 2QXJA 1SGFA 3MNSA 4K1TA 3UQVA 2BDGA 4FUCA 2F9UA 1C1UH 1QB6A 1O31A 3A7TA 1UO6A 1KLJH 1SGDE 1YP9A 1MCVA 1GI9B 2XCFA 3BTKE 2BDCA 1JBUH 4BAQB 1RIWB 1O3BA 3SOSA 4B1TA 2Q6GA 2OQ5A 3S69A 2FXRA 1P2KA 1YGCH 2HVXA 2OD3B 5K7RA 3BTHE 4GCHG 2NU1E 1W2KH 5DP9A 4FUJA 2AMDA 3GCTF 4DIHH 3QGNB 4WVPE 1GI7B 1SLXB 1XX9A 3MTYA 1IQNA 1YLDA 1AE5A 3OYPA 3BSQA 1GI2A 5EPNA 5HYOA 4MPWA 5L2YH 4K1SA 3JZ1B 3MNBA 3ZVDA 1Z71A 1A3BH 5JBCS 5DP6A 1TBQH 5FBIA 5HXFA 1F0UA 3MO6A 1Y3UA 1SLUB 2XC0A 2PW8H 2GKVE 3A7YA 4H42U 2R3UA 1UTLM 2FOEA 4NFFA 2NU2E 1TNGA 1PYTD 1LVOA 4GPGA 3RM0H 2ZECA 1AUJA 1D3PB 1RRKA 2ZTZA 1QA0A 4NWLA 2OP9A 3DD2H 4FUFA 5J4QA 4WMDA 3VB6A 1DX5M 3SNDA 3JZ2B 1S5SA 4X8SH 2G81E 2GT8A 2B8OH 1P09A 1DLKB 1MKWH 1YPHC 1V6DA 3B8JA 4A7IB 1H9IE 1PQ5A 1TGNA 1O5GH 2STAE 2GTBA 1O38A 1O2NA 2FOBA 1GJ5H 2SGEE 3T62A 1WQSA 3RUOA 3W95A 3LT3A 2P3TB 4YO9A 3BTWE 1CBWB 2R3YA 2ZWLH 4BAKB 1GDNA 4LZ4B 1OWEA 1V2OT 3RU4D 1S6FA 2GCHF 1PJPA 4TPYA 1Z8IB 1UK2A 3GYLB 3UUZA 1LKBA 1QQUA 8KME2 3RMLH 1GHYH 2ODPA 2F3CE 2BXTH 3F9HA 1DPOA 1HLTH 1O3FA 3G01A 3M5NA 4X6NA 2PKSB 1MBMA 1MTUA 1QJ1B 3TK6A 5JYIA 1SFQB 3BF6H 1OWDA 3HPTB 2ULLA 4CREA 3SU0A 3TIUA 1OOKB 1CT0E 3A88A 1F7ZA 1EAWA 4NA9H 1MQ6A 1ANCA 2J2UA 1DY8A 1RGQA 2F91A 3KF2A 3R3GB 2VJ1A 1O3HA 3SV8A 1OS8A 1EPTC 1HJAC 1P9SA 5L6NH 1TX6A 4D7GA 1X7AC 5DK1A 1W13U 1AKSB 3U9AH 1WBGB 1AWFH 2VNTA 4ZHAA 1K22H 4JZDH 2GD4B 4MVNA 2UUJB 3ATKA 1GHBF 4DT7B 3ZYDA 2XCNA 2ZDMA 3ATLA 3QDZB 5A8ZA 2C8WB 3RXDA 1LPZB 1CA0C 1P02A 1NRRH 2VWLA 1K9OE 1RTLA 2F9BH 2OUAA 1H8DH 4DGJA 5HGGA 5H4IB 1A5HA 2PR3A 5E8EH 1MKXK 5LPRA 2H9TH 1SGTA 3AW0A 5I25A 2HNTC 2UWLA 1O2XA 1Z8GA 2Y81A 1GBCA 1LPGB 5FPYA 4AFQA 3TJVA 5LPFA 4NA8A 3PTBA 4AG2A 1IHSH 5FCKA 5F8XA 4JK5A 1SGQE 3M35A