4RSPA

X-ray structure of mers-cov nsp5 protease bound with a designed inhibitor
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
304
structure length
303
Chain Sequence
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-induced Dimerization of Middle East Respiratory Syndrome (MERS) Coronavirus nsp5 Protease (3CLpro): IMPLICATIONS FOR nsp5 REGULATION AND THE DEVELOPMENT OF ANTIVIRALS.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Orf1a protein
total genus 86
structure length 303
sequence length 304
ec nomenclature
pdb deposition date 2014-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4rspA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4rspA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4rspA02
5EODA 1ANCA 1V2QT 3U8OH 4D76A 2V3HH 3SNCA 1A0JA 2ZCLP 4NIXA 3MU1A 3P8NA 1O2QA 1ZHRA 2ODQA 2EI6A 2XCNA 4U30A 3MNCA 1UTQA 1EATA 1O3KA 2PTNA 1BBRK 1O2UA 1S85A 5FHTA 3PO1B 4LXBH 1P2JA 4B74A 2QIQA 4FUDA 1GCTC 3ATLA 5E8EH 2JKHA 1TOCB 5ETXA 4ESTE 2QYIA 3MYWA 3GY6A 2TGDA 4MNYA 1C1NA 2VVCA 2ZTXA 3BEIB 1P3CA 1KTSB 1CA8B 1OSSA 3A88A 2FZZA 1NS3A 6GCHG 1PPHE 1LVMA 2ZDLA 1EP6A 1SGDE 2BHGA 4Y6DA 1YCPM 3A7XA 3T62A 1O2PA 2PKAA 2PGBB 2ZTYA 4OS2A 3S7KB 1SGCA 2QXIA 1NFUA 2XCFA 1W8BH 3TNTA 5EG4A 3UR6A 3MU5A 5HXFA 3U9AH 2BMGB 1TOMH 3UNQA 2GT7A 4Q7ZA 4AFZA 1AI8H 1HCGA 2HPPH 3SV8A 1Y3UA 1FY4A 1BRAA 2J4IA 2UUFB 3VFEA 2VH6A 3SOSA 1PPBH 2FTMA 2ZU1A 3K65B 2SNVA 3N7OA 1P2OA 1QTFA 5DK1A 4BTTB 5A8YA 1TMUH 3RC4A 1DICA 3ZZBA 3S0NA 1HUTH 2ZU5A 3PYHA 5JB8S 2GZ8A 1XM1A 1UTLM 4CRAA 4KTSA 3T28A 1GJDB 1TQ7B 1TBRH 2BX4A 4X8TH 2Z3DA 4A1VA 4JZ1A 1CGJE 2SGPE 2UWPA 1HAHH 4H4FA 1P10A 3BTHE 9LPRA 2WV4A 2C90B 3BTFE 5LPFA 1O3FA 3RMOH 1Y5UT 1AUTC 1O3AA 3SU6A 1C1MA 5EW1H 1C5NH 1SLXB 4BNRA 5T3HA 7KMEH 3RC5A 3ZYEA 1UTMA 3K2UA 2W3IA 3QDZB 4H42U 4XDEA 5EW2H 2OC8A 1NRPH 2B5TB 3HATH 3OX7U 2BTCE 1ELGA 4UFDH 4ISHH 3RXPA 1ZJDA 1KTTB 2IPHA 2A4GA 1SI5H 2WINI 2R3YA 2JH5D 5DP7A 1ESBA 4FUJA 4FUBA 1ZJKA 1ZTLA 7ESTE 2Z7FE 3ZZ5A 2B9LA 2PR3A 1GHXH 2WPIS 2ZHQH 1W14U 3A8AA 1ETSH 3PLKA 3GYLB 4A7IB 3DHKH 2FOBA 3SGQE 4AZ2B 1K9OE 3UR9A 2M5TA 4MVNA 1NC6A 2ANWA 4NSYA 1V2RT 1O2HA 2PV9B 1GL0E 1GDQA 4B75A 3RLWH 1GMCF 5C1YA 2D1JA 1LPZB 1W7GH 1WV7H 2Y6TA 1S5SA 4BXWA 2OC7A 3TK6A 1C9PA 1C5PA 5EPYA 4TWWA 2GCHF 2GMTB 4WMFA 1IHSH 1XKBC 1O2GH 3QGNB 4INHA 4ZHAA 1P02A 1BBRE 2ZTZA 3UUZA 8GCHG 1NRRH 1KYNA 1OWEA 2WPLS 1C2JA 1W2KH 1OWIA 1FAXA 1SLWB 2J38A 3H7OA 2K7XA 4GUXA 1WCZA 2PFEA 1O2XA 4Y8YA 3D23A 1FPCH 1Y3WA 1DWCH 1QBVH 1L0ZA 3ZZAA 1YPHC 4NIWA 2F9BH 1C2MA 3FZDA 1ANEA 1EOJA 1GL1A 1BJVA 1OKXA 2LPRA 2FOEA 5AVDA 1RD3B 5JBCS 3Q76A 1TAWA 3MI4A 3TH4H 2BVSH 2ZP0H 3WY8A 3CENA 4GHTA 1UTJA 1DDJA 1CU1A 2BD3A 1AVWA 4WVPE 1UVPA 2FXRA 2ZU4A 2O8TA 2LIZA 1FN6A 1ZYOA 3TJOA 3EE0B 4INKA 1HAVA 5I46H 5ESBA 2B7DH 1CSOE 1SGEE 3BTDE 1XMNB 1J15A 1FPHH 1LCYA 1S84A 3HK3B 4UE7H 3K9XB 1J8AA 3TJNA 3TH3H 1GI0A 2J34A 3GY4A 1FLEE 3A7VA 4NCYA 4KGAA 4X8UH 2Z9KA 1C2HA 1GBEA 2P3TB 2AMDA 1GHWH 4IC5A 1Z71A 1CQQA 1O2JA 4SGAE 1EB1H 2H5CA 3OYPA 1GBKA 3UOUA 1HAZB 3PTBA 1OPHB 3SNAA 1T4UH 2ZFPH 4TYDA 1EAXA 3V12A 1GPZA 2FTLE 2A0QB 5C1UA 2RA3A 1L4DA 3MH4A 2A45B 1VJAU 3KHVA 2Q6GA 1FJSA 3M35A 1GHYH 3P70B 4O97A 3FP6E 3GISB 3SO3A 2ZG0H 3KL6A 3LGUA 2FO9A 1DSUA 4FUCA 3RXKA 1UTNA 3A8DA 1FNIA 4INLA 7GCHF 1HAIH 2WPHS 2BB4A 2BYAX 2Y81A 1AE5A 2VJ1A 1AFQB 3DT0H 3SBKA 2HRVA 3ATIA 5TJXA 1ELAA 5FX6A 3RXGA 1Q2WA 1GI5A 4XSKU 1TA2A 3RMMH 2BD4A 1E0FD 4WJG2 4WMDA 5BPEA 1S0RA 1UHBB 1G37A 1BTPA 1GJ7B 3SU1A 1JWTA 3A8CA 4FUFA 3VGCB 3O8BA 5JYIA 3E91A 3Q3KA 3R0FA 3R3GB 3KF2A 3S9CA 4H6TA 1B0FA 1F7ZA 3RMNH 6CHAC 2J92A 3H5CB 1ANDA 1ELTA 1O39A 1KDQB 3TK5A 1V6DA 4CBOA 2ZF0H 4I8JA 4K2YA 2QA9E 4UD9H 3RXDA 1GJ5H 4KTUA 3LKWA 3U98H 1KLTA 2ZDAH 3F6UH 1BHXF 5DP4A 4AX9H 1C2EA 2ZGBH 1C1QA 2GX4A 1GDUA 1P8VC 3EA7A 1KLIH 1KSNA 3AAUA 1KY9A 4MNXA 1GBAA 3ZVAA 1IQNA 4CRBA 1O5CB 1XVMA 3ZVCA 1NU7B 1AN1E 1EAIA 1EZQA 1O5DH 2RCEA 4FUHA 1OP0A 1A4WH 3RXHA 2BD2A 3BTKE 2J95A 1BIOA 4D8NA 3S7HB 1F0RA 2WYGA 1AU8A 3EGKH 4FU8A 1VCQA 3RM2H 3ZVDA 1HJAC 1D3TB 4DIIH 3BIVH 1OOKB 1VGCC 2ALPA 2EEKA 1IQJA 4HTCH 2ZHEH 1P2MA 4O03A 1DVAH 1WTGH 2BD7A 2NU0E 3HKIB 4ISOA 1G3EA 8ESTE 1Z6JH 3KEEA 2C8YB 3DFLA 4GCHF 3M5OA 1UVUH 1YPHE 4A92A 1KXFA 3UREA 1IQLA 2ANKH 2H9HA 4NFFA 4VGCC 5PTPA 3KGPA 5JDUB 1OXGA 2G55A 1W10U 3PV4A 4CH8B 1YYY1 5L2ZH 1T8NA 4LZ1H 2FMJA 3KQBA 4YM9A 1TGBA 4MNVA 2O8LA 2BXUH 4ZKNU 2GV6A 1G3DA 3DA9B 1DUEA 1P57B 6LPRA 3S9BA 5HGGA 2BY7X 2W7SA 4WXIA 3BTQE 4MTBA 1SL3A 2QXJA 1Y3YA 2BZAA 4NIVA 1Y5AT 2ODYB 3RXAA 1RIWC 1MQ6A 5I25A 2JETC 2UWLA 1NY22 3E8LA 1NM6A 3VXEH 1BTYA 4X6NA 4YT7H 1G3CA 2BDAA 1FIWA 5ESTE 3LONA 1H8IH 1SFQB 1AVGH 3MNBA 1BTXA 2GDDA 1F5LA 2W5EA 3KQDA 3FZZA 4IN2A 1TNJA 3U8RH 1EJAA 1O37A 9ESTA 1GHVH 1GI2A 3PTNA 4I32A 4YLUA 1O5BB 3B9FH 1MZAA 1LO6A 4FVBA 1TMTH 1YPMH 2ZWLH 1O33A 1ZRKA 1ZMJA 5F8XA 2BLWA 3T26A 3LPRA 2Y5GA 3UNRA 1IAUA 1DWDH 3KN2A 3IWMA 3QWCH 2A31A 1F0UA 1GHZA 2O8UA 1SSXA 1O5AB 2ZCHP 1WSSH 2Z9JA 1C1TA 1MU8B 5F8TA 1DS2E 1TIOA 2TGTA 1N6YA 1OP8A 3M61U 3LGIA 1HLTH 3OSYA 5A2MH 1HRTH 1QIXB 1VJ9U 2Z9LA 3EAJA 1ZSKA 1MCTA 2BOHB 2BDCA 2BQWB 3AAVA 2EC9H 2O9QA 3ZV9A 1Z7KA 2FI3E 2BD8A 3U69H 1ELCA 1FIZA 3JZ2B 4IC6A 1BRCE 1A5GH 1JIMA 1LVBA 3Q3XA 1CT0E 2DE8A 3GCTF 3EA9A 3RDZA 1H4WA 5FXLA 2AEIH 1P06A 3MWIU 1PPGE 1NFXA 1WYKA 4LOYH 3QTVH 4MPWA 5GDSH 3M3SA 2F9UA 1ELFA 4X0WU 5CHAB 2A5IA 3M36A 1CT4E 1SHYA 3UIRA 3EQ0H 2CV3A 3T25A 1HAYB 3VXFH 1HJ9A 3FVFB 1P2QA 2QN5T 2W3KA 4ABHA 1UK3A 1HGTH 3TNSA 1LVYA 3W95A 3V0XA 1GI1A 2B0FA 4MLFB 2SGQE 1Z8IB 2GKVE 4YOIA 5C5NA 5K0HA 4E05H 1DY8A 2OINA 1IQIA 1NU9A 3E3TA 3HGNA 4FUEA 1D3PB 1EJNA 2ZFRH 5A0AE 2I6SA 1C5SA 4JCNA 1O3CA 2ZNKH 1QL9A 4LK4A 4QT8C 1O2TA 1IQHA 2ZECA 4J2YB 3SHCH 4MDSA 1NO9H 2G81E 2Z9IA 1YPKH 3UTUH 1TFXA 1W0ZU 2F9PA 1X7AC 1V2LT 2XYAA 3U1IB 1VITF 2HPQH 2A5KA 1UCYE 3F9HA 4FUGA 3TLOA 2GCTB 1Y3VA 1GHAG 1O2NA 1FAKH 1BTZA 3SUDA 4NA7A 1PPCE 1HXFH 2WV5A 3PMHB 2FOGA 1GCDA 3M7TA 1H9LB 1SLUB 1P11E 1F0SA 3LH1A 2AGEX 3ENSB 1O2LA 2D26C 2ZU3A 2G00A 4CR9A 1ID5H 1THRH 5E0GA 1Z1IA 1WOFA 3LT3A 3F9EA 3TGIE 3HKJB 1IQFA 3F9FA 1MH0A 1YKTA 2J2UA 4MQAA 5C20A 1AD8H 3A82A 4Q2KA 8KME2 1IQMA 2EI8A 1W3CA 3UNSA 3LH3A 3ODFA 3DFJA 4MNWA 5EGMA 1SVPA 5FBIA 2A32A 3M7QA 1UO6A 1VCWA 1MTVA 5DKMA 4JYUH 1LKBA 3M5NA 3LC5A 5FBEA 3ESTA 3M3TA 1GMCG 4OS5A 2GDEH 3GOVB 3SU2A 2FDAA 4UONA 4JZDH 4I8KA 3STIA 2NU2E 1KXCA 5C5OA 1V2PT 2FM2A 4WF8A 1MCVA 1GI8B 2V6NA 2ZGHA 5JB9S 3VEQB 1LHCH 3MTYA 1DITH 1EUFA 1GMDG 1SMFE 3ZZCA 3BF6H 5L6NH 4JZIA 4K1TA 3M5LA 4J1YA 4I7YH 4D7FA 1GHBF 1INCA 3G01A 3P95A 2XBXA 1V2UT 1TRMA 3NCLA 1XX9A 1DLEA 1DE7H 3RXMA 1SHHB 2F83A 3SUEA 4ZROA 1MKWH 1Z8RA 3ZZ6A 2XW9A 2PKSB 2OCVB 2CJIA 5A8XA 1E38B 1K1OA 4AFSA 4ISIH 4ZXXH 3ZVBA 2PLXA 1GBIA 3FP8E 2HWLB 4E7NA 3B23B 1TPPA 3KQEA 1O5FH 2XNIA 4DIHH 2A4OA 1TNHA 1ZSJA 2A2QH 3SJIA 1O2OA 2VVUA 2H9TH 1O30A 4I8LA 2ANMH 1IHTH 1GBCA 4HFPB 5EQRA 3SHAH 1DSTA 2QCYA 5DO4H 2ZGCA 2BDBA 5LGOA 3DD2H 4SGBE 3STJA 1ELVA 1RTFB 1YPLH 1Z8JB 1H9HE 1QURH 2PUQH 1GHAF 3PLBA 1G2LA 4UDWH 4X6MA 1O3MA 1O3NA 1F92A 1OYTH 1OS8A 1HB0B 3P17H 1GGDC 1NRQH 1F5RA 4AYYB 1P03A 2ANYA 2WPKS 5DG6A 3SJ9A 2STBE 3PMBB 2OC0A 1EXFA 3RXCA 2UUJB 3KCGH 3W94A 1LHGH 4M7GA 1GBDA 1MTUA 1BBRH 3QO6A 4ZMAH 3BEUA 2HNTE 4I8GA 3D49H 4ABJA 4Y0YE 3SN8A 2PWXA 2VGCB 4TPIZ 1QRZA 3NK8A 2AERH 1OWJA 5LH8A 2AMPA 1BA8B 2QC2A 3QTOH 2H2ZA 4X2YA 4YO9A 2V35A 1GJ6A 1BRBE 3TJVA 1O3JA 4OS7A 2VVVA 4X1NU 1LQEA 2HLCA 4O3TA 3ZZDA 1S83A 4MPXA 1SGTA 1SGYE 1D4PB 2Q6FA 1AUJA 1LPKB 5C3NA 1C5UA 1A5IA 2A1DB 3ELAH 2FX6A 1LHDH 4AG1A 2ZFFH 3A80A 3T29A 2SFAA 3S9AA 3PWCA 3C1KA 1GBBA 2C93B 1YPGH 1O35A 3BTWE 1OP2A 5FCKA 1AKSA 1TONA 2XBYA 3SJKA 3OY5U 3PMJA 1CA0B 4YLQH 3QZQA 4XOJA 2ZDVH 3QGJA 1GDNA 1N8OB 3ZZ8A 2XBWA 1C9TA 1WQSA 2RG3A 1ELEE 2ZFSA 2FI4E 3RU4D 4DOQA 1UTKA 1C2IA 2KAIB 1ESTA 4BTUB 3SV9A 3SV6A 3NKKA 1GI9B 5C67A 1YCPK 2CF8H 1MTNC 3AASA 1O34A 3LGVA 4B2CA 2PSYA 1DXPA 1SC8U 4X2WA 1C5VA 4A6LA 1T32A 1EAWA 5JPMH 4D7GA 3B8JA 4OS1A 5E2PA 2Y82A 1GGDB 1B0EA 4RN6A 2AH4X 1BTWA 2VIDA 1XXFA 5T6FA 2PUXB 2I6QA 3SGBE 4ABFA 1FY3A 1SGRE 2B8OH 2PTCE 2AGGX 3I77A 4XBCA 2DUCA 2IJOB 1SPJA 1HBTH 2A7CA 4AOQA 4JYVH 3L3TA 1P05A 1ELBA 1ZGVA 4XBBA 2PHBA 1A1RA 3EYDA 1AIXH 4ASHA 1Y5BT 5DP9A 4XFQA 3LOXA 1QJ7B 1P2NA 2OXSA 4KELA 2HNTF 2P16A 3PROA 2C8XB 2FWWA 5C1XA 4Y8XA 5L2YH 1LHFH 2ZCKP 1C2FA 3BG4B 3FFGA 5E2OA 1JXPA 1PQ7A 2ODPA 2FP7B 1BMMH 3RXFA 5T6DA 2R2WU 2WUBA 1FUJA 1L2EA 1W13U 1SGFA 2QXHA 1UK2A 4CRDA 1EPTA 4D9RA 1TNLA 3MO9A 1DUAA 2P3FH 3LIWA 3BV9B 4GSOA 3UOPA 1IQKA 1V2WT 3URCA 3V7TA 3U1JB 3PWBA 2P8OB 3ZZ9A 1TPAE 2PGQB 3EBNA 1V2OT 2HALA 4BANB 1AFQC 1TX7A 4Y11E 2VIVA 4K5ZA 1C5OH 2BDIA 2ZKSA 4TY7A 4B1TA 1C5YB 1Y8TA 2AIPA 3MFJA 1HXEH 4UFFH 2XTTB 1EZSC 1PYTD 1GJCB 4F49A 2H6MA 3QUMP 4IBLH 2R9PA 2YNAA 2ZA5A 1PJPA 1SQAA 3GYMA 2GT8A 1GCTB 1ABJH 1N1LA 1KLJH 1BTHH 4ZUHA 3VPKA 3NWUA 4DVAU 2CN0H 4E7RG 2XXLA 5EOKA 5BRRE 1AGJA 1TPSA 5AFZH 1S82A 4K60A 3UWJH 1O3IA 4WWYA 2VWNA 4X6PA 1C1UH 2CGAA 3TITA 1C4U2 1TB6H 1ACBE 4B76A 5DP3A 1HJ8A 1ZZZA 1BMAA 3O8CA 1EZUC 4KTCA 1VR1H 1ZMNA 2JH0D 3QX5H 2UUKB 3SV2H 4DT7B 1TGSZ 1TWXB 1SBWA 3JZ1B 4ZAEA 1YPJH 3VB6A 2Y7ZA 3SUFA 3HGPA 4RSPA 1G32B 1A3BH 2YOLA 3GY5A 1TA6A 3VB5A 1S0QA 1TNKA 1JBUH 1A46H 1QJ6B 4U2WA 2FODA 1GJ4H 2PKSC 1ZMLA 1H1BA 1S6FA 4Y79A 4AGJA 4JMYA 1ZR0A 1PQ5A 1DM4B 2XWBI 2WUCA 3BTEE 4BTIB 3A84A 2BX3A 1EPTC 1T31A 7LPRA 1GMDF 1C5ZB 3GCNA 1G30B 1DLKB 5CMXH 1YBWA 1NRNH 2ZQ2A 3RXQA 2J94A 5B6OA 3Q3YA 2ZDMA 4OS4A 2G4TA 4I31A 2AGIX 4HGCA 3RXEA 1FXYA 1MMJN 1W12U 3TIUA 3UQVA 3LGWA 3MU4A 2AFQB 4F4OC 2F9NA 4IMQA 2UWOA 4U32A 2TIOA 4IGDA 2GCHG 5DP6A 3QK1A 2H1UA 1P9SA 3SQHE 1GHBG 4YT6H 5AHGH 2BY8X 2OBQA 3A86A 5FPSA 1GJAB 1BCUH 3VGCC 2CHAC 1PPZA 2FOCA 4I8HA 3A81A 3ATMA 4O3UA 2BLOA 1SGFG 4LZ4B 5F6MA 4CHAC 1O5EH 1T4VH 3LGYA 3ZZ4A 5EPNA 1IOEA 1QB9A 1MTWA 3E90B 1MU6B 2GZ7A 4IW4E 3SJ8A 4JYTA 4XBDA 1C2KA 6GCHF 1NFYA 1BMNH 4HZHA 4X6OA 2D8WA 3GDSA 1L4ZA 3MH5A 1WTHD 1UHBA 1QHRB 3A87A 1QR3E 1UVSH 1E36B 2Y80A 3ZYDA 1YC0A 1O2WA 4NSVA 3E0NB 3Q77A 1K2I1 2EA3A 4FXGH 3M3VA 2ULLA 2FEQH 1RJXB 1G2MA 1YF4A 3RXBA 3GCHB 3ZZ7A 1QCPA 1MD7A 1T8LA 4ABIA 4CHAB 1TE0A 1LDTT 2HNTC 3O8DA 2BVRH 4KKDA 2GZ9A 5LPEA 2ZHWH 3SORA 2XC0A 1CGHA 3OY6U 1WUNH 1XUKA 2PSXA 3E6PH 3PB1E 1EASA 1G3BA 1YP9A 1O3LA 1CO7E 2FIRH 1C4V2 3TJUA 1FMGA 3SU0A 5DP5A 3SU5A 4Y8ZA 3NZIA 5EQQA 2ZHDA 4Z6AH 1TABE 2BLVA 2R2MB 3P8OA 3RXJA 2FYQA 1ORFA 1O3PB 1UJ1A 3TH2H 1KXDA 3PMAB 2Y5HA 1AMHA 3EDXB 4VGCB 2FS8A 1O3GA 1MBQA 2R3UA 2R0KA 4Y71A 1AVXA 5DPAA 3SGAE 4NGAH 5FX5A 1DWBH 2ZEBA 3L33A 2VGCC 3GDVA 3GY3A 1D6RA 1NFWA 1G9IE 2ZPSA 1HPGA 1OWKA 2IOTA 2DE9A 4Y76A 5ABWA 4A1TA 2JH6D 1QQ4A 4XE4A 3RXSA 4DCDA 1EAUA 3SUGA 5K7RA 1FONA 1C2GA 2BY5X 1KXEA 1AB9C 4BAKB 4X1QU 1YM0A 1K1JA 4WH6A 4OGYA 3BIUH 1SB1H 2AYWA 1HAVB 2ZZUH 1BJUA 3MNSA 4YTAA 1MD8A 1W0YH 2VWLA 2FESH 2F9VA 1XXDA 4NG9H 4MPVA 5H4IB 1VZQH 3H7TA 2QXGA 3KIDU 3TPIZ 2ALVA 3KQCA 2EI7A 4ABDA 3T2NA 4AFUA 1QL8A 1TYNA 2BZ6H 1P04A 2VIPA 1JMOH 1V2NT 1M9UA 2FLBH 1L1GA 2PW8H 1VITG 2HVXA 2G8TA 2SGDE 5JBTA 2J9NA 4UFEH 4JZFH 5GPIB 4X8SH 1H8DH 1TGTA 2ZI2H 2BXTH 2FX4A 2O8MA 3F1SB 5F03A 4DW2U 2QAAA 2HGTH 1MUEB 4CRCA 1Y3XA 4A5TS 5T6GA 2VINA 1IQGA 1MAYA 2VH0A 4YZUA 2BOKA 1QGFA 3E0PB 4E06H 3RLYH 4D9QA 3RXUA 4Q7XA 1QRXA 4FU7A 5AFYH 1BUIA 2GTBA 1O2KA 1BITA 1GWAA 1GMHF 2C8WB 1EX3A 4ZH8A 3GCOA 1SGNE 1N6XA 3RXOA 4B71A 2BLQA 1TLDA 4TWYA 1GVLA 1K1IA 4RKJB 1UK4A 1EZXC 2OC1A 1MKWK 2OQUA 1ABIH 1FI8A 1CT2E 3PM3A 2A7HA 2ZO3H 5J4SA 1O38A 3CP7A 4X1SU 3VB3A 1CHGA 3UY9A 4AN7A 1C5MD 2CF9H 1ZPZA 4ZKOU 1HDTH 4UFGH 3NUMA 3SU3A 2GP9B 1C1VH 1K1MA 3BSQA 1Z8GA 2VB0A 1PYTC 5FAHA 3UPEA 1YCPH 1W7XH 1QY6A 1KDQA 1V2JT 2P3UB 3BTTE 3ITIA 4GPGA 1V3XA 2NU4E 1GJ8B 2LNCA 4BOHA 3QLPH 4ABGA 4BAQB 4NA9H 4X2XA 1Y59T 1HIAB 4BXSA 3GY8A 2V3OH 5G4BA 5HMAA 2G51A 3AW1A 2F3CE 1J14A 5CHAC 2R0LA 2VU8E 2XBVA 4R8TB 3ZV8A 3QN7A 1S81A 5F8ZA 2ZFQH 1F0TA 4X1RU 2QF3A 2SNWA 2W7UA 3UWIA 4THNH 2HOBA 2Q1JA 1JRSA 1TPOA 4Y10E 1HFDA 2FOHA 1AZ8A 3RM0H 3TGJE 1BTUA 4YOJA 2QF0A 4IN1A 3F68H 4Q80A 1HJAB 1SLVB 1XKAC 2FOAA 1CE5A 1C4Y2 1GBMA 1T7CA 1ZHMA 1VGCB 2OD3B 2P8OC 1HAXB 5JBAS 1NPMA 3GDUA 1SGIB 2F91A 2Y5FA 4FU9A 2WYJA 2CMYA 4DURA 3TVJB 2AMQA 1F5KU 2F9OA 4HI3A 4AYVB 3I29A 3SI3H 2OBOA 3ATKA 5A0BA 1GBHA 4FUIA 4CR5A 1SR5C 1GJ9B 1UTOA 3RXIA 3EA8A 5JBBS 2NU3E 1C1PA 3D65E 1MKXK 4K8YA 2GD4B 3SJOA 3Q00A 3S69A 3RU4E 2ZDKA 2Z6BD 4K69A 4NA8A 2ZHFH 4CRFA 4Q7YA 1BDAA 5TCCA 1ZSLA 1P9UA 2OLGA 1TNGA 1EP5A 2CXVA 1C5WB 1PPFE 1RFNA 5A09A 1AO5A 1DXWA 5EU8A 5E0HA 4ABBA 1K1PA 2BQ7B 4X8VH 1ZOMA 1ZRBA 3A7WA 1YPEH 2THFB 1K28D 1XUIA 5HYOA 2FOMB 2XWAA 4NWLA 4R0IA 3SNDA 1AWHB 4WY3A 3P8FA 2ASUB 1RXPA 2IN2A 4ZXYH 1AWFH 4MPUA 3VB4A 2G4UA 5GXPA 7GCHG 1J16A 3ATWA 1L1NA 1T8MA 1WQVH 5EXMA 2TBSA 3CS0A 1HYLA 4AFQA 4JZEH 5J4QA 5DGJA 1A5HA 2BDYA 1GMHG 1LPGB 2UUYA 1ESAA 3P8GA 1DPOA 3A7YA 3M37A 3TGKE 3LU9B 2BQ6B 1GVKB 1J17T 2P94A 1V2KT 3ZVEA 1TMBH 3IG6B 3L6PA 1TQ0B 2WPMS 4ZHMU 1UCYK 5TCAA 3MH6A 1JIRA 2QV1A 3E16B 2Z3EA 4DG4A 3T5FH 1P12E 1THPB 1O2YA 1O3OA 1D9IA 1K21H 2BY9X 3MOCA 2BY6X 1RS0A 4K1EA 3A83A 1QB6A 1CA0C 1AZZA 2C4FH 1O3DA 1O3EA 2ZDNA 3D62A 1AY6H 3RUOA 4K3JA 1GG6C 1TX8A 4DY7B 2AIQA 3ZVGA 5FPYA 3ZZ3A 5FCRA 1GBFA 1RRKA 4B2AA 2SGEE 3SQEE 1P0SH 2AS9A 3K6ZA 3URDA 2RDLA 4YESB 1BB0B 1C5TA 5GCHG 5DJ7A 1SGPE 3SU4A 4ISLA 1LMWB 3A7ZA 3A7TA 1C2DA 1CBWC 2VIQA 1J9CH 2PKAB 4NZLA 3FP7E 1N8OC 3QZRA 1PPEE 3F9GA 2A4RA 4CRGA 1BOQA 1TGCA 4TPYA 1FZZA 1GI6A 4OGXA 1SQOA 3ODDA 4IMZA 2Q6DA 3MH7A 6ESTA 2A7JA 1DWEH 3E1XB 3LJJA 2JETB 4FVDA 3RXTA 2FS9A 2OTVA 1Z1JA 1GG6B 1NESE 3MHWU 2OQ5A 2FOFA 3RXLA 3DUXH 3GICB 3PO1C 1V2MT 2C8ZB 3BG4C 3IITA 3SNBA 1C1RA 1UCYH 1ELDE 5IDKA 1NN6A 1BZXE 2VNTA 1DFPA 1NROH 1O2SA 2FYRA 1OX1A 2XRCA 1MQ5A 1UVOA 1WAYB 1O31A 1W11U 4BAHB 1LVOA 2GMTC 4ABEA 3P6ZB 1P2KA 2ZU2A 2H9EH 2K1QA 3LC3A 1O2VA 3MU0A 1O5GH 3KNXA 4B73A 1HAPH 6CHAB 1CHOF 1LKAA 1QQUA 1ANBA 1CVWH 1MTSA 1OWDA 5GCHF 1OYQA 1KXBA 5FPTA 5HM9A 2Y7XA 1ZTKA 3OTJE 1C5XB 3OU0A 1V2VT 4ZKRU 2P93A 1A0LA 1Q3XA 1C1WH 2BVXH 3NXPA 3RXVA 3MNXA 1MTNB 3K6YA 1UVTH 1LQDB 3UFAA 8GCHF 1ETRH 4NFEA 4NWKA 2A5AA 1LHEH 5EXNA 4CBNA 4PROA 4X2VA 3ZVFA 1V2TT 1GBJA 1O36A 1ARCA 1Q31A 2BM2A 1MKXH 1YGCH 2VWMA 2G5VA 4GLYA 1F2SE 1TX6A 1DOJA 1SGQE 2STAE 4ZHLU 4H6SB 1G36A 1QRWA 2FPZA 4YOGA 3RP2A 1WBGB 2SGFE 1E34B 2P95A 3I78A 1KXAA 2CHAB 1KIGH 1ZGIA 3LJOA 3A85A 1K1LA 3BG8A 1SG8B 1QNJA 1QL7A 2VIWA 1ZHPA 3MO6A 3LGTA 1H9IE 1QA7A 2C3SA 1AFEH 2ILNA 5EQSA 2BD9A 1GBTA 4K8BA 5EXLA 5A8ZA 4AG2A 1QA0A 1U6QA 1ZTJA 1ZLRA 3UQOA 2ZIQH 1FY1A 4Y0ZE 1ARBA 3BEFB 1CGIE 3TK9A 1XUHA 1AE8H 3LDXH 1VITH 1PQ8A 4GCHG 1LTOA 2P59A 1D6WA 4UEHH 4WXVA 1K1NA 4WMEA 1BMLA 3VB7A 1AB9B 1UTPA 1MBMA 3SW2B 1L1JA 1SOZA 4X1PU 4GHQA 1E35B 1O2MA 1FDPA 1GI4A 5CE1A 1XUGA 1DY9A 3AW0A 2D2DA 2RA0A 1P3EA 1AHTH 1TBZH 4Z0KA 2ZQ1A 1SFIA 4Y7BA 4IS5A 1C2LA 1NTPA 4GVUA 1A2CH 1TNIA 1CHOG 2WPJS 1ZPCA 1CBWB 1D3DB 1DT2A 4CH2B 1QB1A 1THSH 2BD5A 1NT1A 2G52A 3RMLH 3FAOA 3AVZA 1P01A 1GVZA 1A61H 2ZPRA 2NWNA 1QFKH 1FN8A 5HM2A 1DX5M 1FV9A 4OS6A 1PFXC 1NRSH 1O3HA 1FY8E 3SV7A 4AGKA 1A3EH 1HIAA 1ETTH 4U01A 2FI5E 1HAOH 1EB2A 1EJMA 1GBLA 1BT7A 3RXRA 2QY0B 2GGVB 4B2BA 2YNBA 1O32A 4AORA 3GY2A 4Y7AA 4A1XA 1O0DH 1AQ7A 2VIOA 2QGRA 1B5GH 1BRUP 2OUAA 3NPSA 2FLRH 3HK6B 4ABAA 3MMGA 4GAWA 2O8WA 1V2ST 3GY7A 3CS7A 1NZQH 2BDGA 4K1SA 1SQTA 3C27B 3M7UA 3TU7H 1P09A 4O9VA 2GVFA 3V3MA 1C1SA 3A8BA 3T27A 1JOUB 3RC6A 1SOTA 4TY6A 2TGPZ 1RGQA 2GV7A 3V13A 5L30H 4ISNA 4WH8A 1HNEE 1AKSB 1EPTB 3PLPA 1Z6EA 1A7SA 1C5QA 3FANA 2XC5A 1T8OA 1C5LH 3A89A 4ZKSU 1HAGE 1JRTA 2W26A 2ZPQA 4I33A 2TGAA 4NIYA 5LPRA 1ZPBA 1GI3A 2KAIA 1FY5A 4KP0A 1K22H 5A0CA 4RKOB 3GCHC 1QBNA 1S6HA 4MG3A 8LPRA 1RIWB 1E37B 5GWZA 1D3QB 2SGAA 2Z9GA 1FQ3A 2OP9A 3GCTG 1BHXB 1QJ1B 1A0HB 2XC4A 1TBQH 5C2ZA 3U8TH 3P92A 3HPTB 1TRYA 3O8RA 1HV7A 1TRNA 3SI4H 4AB8A 2A4QA 1BQYA 1PQAA 5AF9H 2VWOA 2ZGJA 1RTLA 1EOLA 2V0BA 5E0JA 3M5MA 1GI7B 5IYTA 3MO3A 1O2ZA 3BTGE 1VCPA 2H5DA 3BN9A 2A2XH 2GCTC 1DANH 5DP8A 3MU8A 1UMAH 3SZNA 4DJZB 2Z94A 1EKBB 1TALA 1B7XB 4AB9A 1GJBB 1O2RA 2BDHA 4JK6A 1P2IA 3SNEA 4BAMB 4DGJA 3BTME 2TPIZ 2TRMA 2G5NA 1TGNA 1XUJA 1WU1A 2ZGXH 1QBOA 1OWHA 1YLCA 1C1OA 1EQ9A 5SGAE 2ZFTA 2NU1E 2Z3CA 1IQEA 5GIBA 5GJ4B 4CREA 1XUFA 4NZQA 4BAOB 1RTKA 2ESTE 1C5RA 1YLDA 1O2IA 2ZC9H 1MAXA 4JK5A 1XVOA 3RU4T 1O3BA 1MZDA
chains in the Genus database with same CATH superfamily
5EODA 1ANCA 1V2QT 3U8OH 4D76A 2V3HH 3SNCA 1A0JA 2ZCLP 4NIXA 3MU1A 3P8NA 1O2QA 1ZHRA 2ODQA 2EI6A 2XCNA 4U30A 3MNCA 1UTQA 1EATA 1O3KA 2PTNA 1BBRK 2IPQX 1O2UA 1S85A 5FHTA 3PO1B 4LXBH 2KCOA 1P2JA 4B74A 2QIQA 4FUDA 1GCTC 3ATLA 5E8EH 2JKHA 1TOCB 5ETXA 4ESTE 2QYIA 3MYWA 3GY6A 2TGDA 4MNYA 1C1NA 2VVCA 2ZTXA 3BEIB 1P3CA 1KTSB 1CA8B 1OSSA 3A88A 2FZZA 1NS3A 6GCHG 1PPHE 1LVMA 2ZDLA 1EP6A 1SGDE 2BHGA 4Y6DA 1YCPM 3A7XA 3T62A 1O2PA 2PKAA 2QE7D 2PGBB 2V3MA 3U28C 2ZTYA 4OS2A 3S7KB 1SGCA 2QXIA 1NFUA 2XCFA 1W8BH 3TNTA 5EG4A 3UR6A 1NBMD 3MU5A 5HXFA 3U9AH 2BMGB 1TOMH 3UNQA 2GT7A 4Q7ZA 4AFZA 1AI8H 1HCGA 2HPPH 3SV8A 1Y3UA 1FY4A 3KYFA 1BRAA 2J4IA 2UUFB 3VFEA 2VH6A 3SOSA 1PPBH 2FTMA 2ZU1A 3K65B 2SNVA 3N7OA 1P2OA 1QTFA 5DK1A 4BTTB 5A8YA 1TMUH 3RC4A 1DICA 3ZZBA 3S0NA 1HUTH 2ZU5A 3PYHA 1E1RD 5JB8S 2GZ8A 1XM1A 1UTLM 4CRAA 4KTSA 3T28A 1GJDB 1TQ7B 1TBRH 2BX4A 4X8TH 3UAIC 2Z3DA 4A1VA 4JZ1A 1CGJE 2SGPE 2UWPA 1HAHH 4H4FA 1P10A 3BTHE 9LPRA 2WV4A 2C90B 3BTFE 5LPFA 1O3FA 3RMOH 1Y5UT 1AUTC 1O3AA 3SU6A 1C1MA 5EW1H 1C5NH 1SLXB 4BNRA 5T3HA 7KMEH 3RC5A 3ZYEA 1UTMA 3K2UA 2W3IA 3QDZB 4H42U 4XDEA 5EW2H 3PV5A 2OC8A 1NRPH 2B5TB 4RI0A 3HATH 3OX7U 2BTCE 1ELGA 4UFDH 2J98B 4ISHH 3RXPA 1ZJDA 1KTTB 2IPHA 2A4GA 1SI5H 2WINI 2R3YA 2JH5D 5DP7A 1ESBA 4FUJA 4FUBA 1ZJKA 1ZTLA 7ESTE 2Z7FE 3ZZ5A 2B9LA 2PR3A 1GHXH 2WPIS 2ZHQH 1W14U 3A8AA 1ETSH 3PLKA 3GYLB 4A7IB 3DHKH 2FOBA 3N7EA 3SGQE 4AZ2B 1K9OE 3UR9A 2M5TA 4MVNA 1NC6A 2ANWA 4NSYA 1V2RT 1O2HA 2PV9B 1GL0E 1GDQA 4B75A 3RLWH 1GMCF 5C1YA 2D1JA 1LPZB 1W7GH 1WV7H 2Y6TA 1S5SA 2QF4A 4BXWA 2OC7A 3TK6A 1C9PA 1C5PA 5EPYA 4TWWA 2GCHF 2GMTB 4WMFA 1IHSH 1XKBC 1O2GH 3QGNB 4INHA 4ZHAA 1P02A 1BBRE 2ZTZA 3UUZA 8GCHG 1NRRH 1KYNA 1OWEA 2WPLS 1C2JA 1W2KH 1OWIA 1FAXA 1SLWB 2J38A 3H7OA 2KR7A 2K7XA 4GUXA 1WCZA 2PFEA 1O2XA 4Y8YA 3D23A 1FPCH 1Y3WA 1DWCH 2IJD1 1QBVH 1L0ZA 1K0HA 3ZZAA 1YPHC 4NIWA 2F9BH 1C2MA 3FZDA 1ANEA 1EOJA 1GL1A 1BJVA 1OKXA 4TSFD 2LPRA 3OEED 2FOEA 5AVDA 1RD3B 5JBCS 3Q76A 1TAWA 3MI4A 3TH4H 2BVSH 2ZP0H 3WY8A 3CENA 4GHTA 1UTJA 1DDJA 1CU1A 2BD3A 1AVWA 4WVPE 1UVPA 2FXRA 2ZU4A 2O8TA 2LIZA 1FN6A 1ZYOA 3TJOA 3EE0B 4INKA 1HAVA 5I46H 5ESBA 2B7DH 1CSOE 1SGEE 3BTDE 1XMNB 1J15A 1FPHH 1LCYA 1S84A 3HK3B 4UE7H 3K9XB 1J8AA 3TJNA 3TH3H 1GI0A 2J34A 3GY4A 1FLEE 3A7VA 4M9FA 4NCYA 4KGAA 4X8UH 2Z9KA 1C2HA 1GBEA 2P3TB 2AMDA 1GHWH 4IC5A 1Z71A 1CQQA 1O2JA 4SGAE 1EB1H 2H5CA 3OYPA 1GBKA 3UOUA 1HAZB 2K8IA 3PTBA 1OPHB 3SNAA 1T4UH 2ZFPH 3OAAD 4TYDA 1EAXA 3V12A 1GPZA 2FTLE 2A0QB 5C1UA 2RA3A 1L4DA 3MH4A 2A45B 1VJAU 3KHVA 2Q6GA 1EFRD 1FJSA 3M35A 1GHYH 3P70B 4O97A 3FP6E 3GISB 3SO3A 2ZG0H 3KL6A 3LGUA 2FO9A 1DSUA 4FUCA 3RXKA 1UTNA 3A8DA 1FNIA 4INLA 5C0TA 7GCHF 1HAIH 2WPHS 2BB4A 2BYAX 2Y81A 1AE5A 2VJ1A 1AFQB 3DT0H 3SBKA 2HRVA 3ATIA 5TJXA 1ELAA 5FX6A 3RXGA 1Q2WA 1GI5A 4XSKU 1TA2A 5DSFA 3RMMH 2BD4A 1E0FD 4WJG2 4WMDA 5BPEA 2HVYB 1S0RA 1UHBB 1G37A 1BTPA 1GJ7B 3SU1A 1JWTA 3A8CA 4FUFA 4ACBA 3VGCB 3O8BA 5JYIA 3E91A 3Q3KA 3R0FA 3R3GB 3KF2A 3S9CA 4H6TA 1B0FA 1F7ZA 3RMNH 6CHAC 2J92A 3H5CB 1ANDA 1ELTA 1O39A 1KDQB 3TK5A 1V6DA 4CBOA 2ZF0H 4F48B 4I8JA 4K2YA 2QA9E 4UD9H 3RXDA 3SZEA 1GJ5H 4KTUA 3LKWA 3U98H 5IK2D 1KLTA 2ZDAH 3F6UH 1BHXF 5DP4A 4AX9H 1C2EA 2ZGBH 1C1QA 2GX4A 1GDUA 1P8VC 3EA7A 1KLIH 1KSNA 3AAUA 1KY9A 4MNXA 1GBAA 3ZVAA 1IQNA 4CRBA 1O5CB 1XVMA 3ZVCA 1NU7B 1AN1E 1EAIA 1EZQA 1O5DH 2RCEA 4FUHA 1OP0A 1A4WH 3RXHA 2BD2A 3BTKE 3FN8A 2J95A 1BIOA 4D8NA 3S7HB 1F0RA 2WYGA 1AU8A 3EGKH 4FU8A 1VCQA 3RM2H 3ZVDA 1HJAC 1D3TB 4DIIH 3BIVH 1OOKB 1VGCC 2ALPA 2EEKA 5EIYA 1IQJA 4HTCH 2ZHEH 1P2MA 4O03A 1DVAH 1WTGH 2BD7A 2NU0E 3HKIB 4ISOA 1G3EA 8ESTE 1Z6JH 3KEEA 2JJ1D 2C8YB 3DFLA 4GCHF 3M5OA 1UVUH 1YPHE 4A92A 1KXFA 3UREA 1IQLA 2ANKH 2H9HA 4NFFA 4VGCC 5PTPA 3KGPA 5C17A 5JDUB 1OXGA 2G55A 1W10U 3PV4A 4CH8B 1YYY1 5L2ZH 1T8NA 4LZ1H 2FMJA 3KQBA 4YM9A 1TGBA 4MNVA 2O8LA 2BXUH 4ZKNU 2GV6A 1G3DA 3DA9B 1DUEA 1P57B 6LPRA 1SKYE 3S9BA 5HGGA 2BY7X 2W7SA 1W0KD 4WXIA 3BTQE 4MTBA 1SL3A 2QXJA 1Y3YA 2BZAA 4NIVA 1Y5AT 2ODYB 3RXAA 1RIWC 1MQ6A 5I25A 2JETC 2UWLA 1NY22 3E8LA 1NM6A 3VXEH 1BTYA 4X6NA 4YT7H 1G3CA 2BDAA 1FIWA 5ESTE 3LONA 5FL7D 1H8IH 1SFQB 1AVGH 3KQ5A 3MNBA 1BTXA 2GDDA 1F5LA 2W5EA 3KQDA 3FZZA 4IN2A 1TNJA 3U8RH 1EJAA 1O37A 9ESTA 1GHVH 1GI2A 3PTNA 4I32A 4YLUA 1O5BB 3B9FH 1MZAA 1LO6A 5F53A 4FVBA 3UB0A 1TMTH 1YPMH 2ZWLH 1O33A 1ZRKA 1ZMJA 5F8XA 2BLWA 3T26A 3LPRA 2Y5GA 3UNRA 1IAUA 1DWDH 3KN2A 3IWMA 3QWCH 2A31A 1F0UA 1GHZA 2O8UA 1SSXA 1O5AB 2ZCHP 1WSSH 2Z9JA 1C1TA 1MU8B 5F8TA 1DS2E 1TIOA 2TGTA 1N6YA 1OP8A 3M61U 3LGIA 1HLTH 3OSYA 2XNDD 5A2MH 1HRTH 1QIXB 1VJ9U 2Z9LA 3EAJA 1ZSKA 1MCTA 3AK5A 2BOHB 2BDCA 2BQWB 3AAVA 2EC9H 2O9QA 3ZV9A 1Z7KA 2FI3E 2BD8A 3U69H 1ELCA 1E79D 1FIZA 3JZ2B 4IC6A 3KYGA 1BRCE 1A5GH 1JIMA 1LVBA 3Q3XA 1CT0E 2DE8A 3GCTF 3EA9A 3RDZA 1H4WA 5FXLA 5KECA 2AEIH 1P06A 3MWIU 1PPGE 1NFXA 1WYKA 4LOYH 3QTVH 4MPWA 5GDSH 3M3SA 2F9UA 1ELFA 4X0WU 5CHAB 2A5IA 3M36A 1CT4E 1SHYA 3UIRA 1SQRA 3EQ0H 2CV3A 3T25A 1HAYB 3VXFH 1HJ9A 3FVFB 1P2QA 2QN5T 2W3KA 4ABHA 1UK3A 1HGTH 3TNSA 1LVYA 3W95A 2J98A 1GI1A 2B0FA 4MLFB 3V0XA 2SGQE 1Z8IB 2GKVE 4YOIA 5C5NA 5K0HA 4E05H 1DY8A 2OINA 1IQIA 1NU9A 3E3TA 3HGNA 2K0QA 4FUEA 1D3PB 1EJNA 2ZFRH 5A0AE 2I6SA 1C5SA 2W6ID 4JCNA 1O3CA 2ZNKH 1QL9A 4LK4A 4QT8C 1O2TA 1IQHA 2ZECA 3CNRA 4J2YB 3SHCH 4MDSA 1NO9H 2G81E 2Z9IA 1YPKH 3UTUH 1TFXA 1W0ZU 2F9PA 1X7AC 1V2LT 2XYAA 3U1IB 1VITF 5CDFE 2HPQH 2A5KA 1UCYE 3F9HA 4FUGA 3TLOA 2GCTB 1Y3VA 1GHAG 1O2NA 1FAKH 1BTZA 3SUDA 4NA7A 1PPCE 1HXFH 2WV5A 3PMHB 2FOGA 1GCDA 3M7TA 1H9LB 4B6EA 1SLUB 1P11E 1F0SA 3LH1A 2AGEX 3ENSB 1O2LA 2D26C 2ZU3A 2G00A 4CR9A 1ID5H 1THRH 5E0GA 1Z1IA 1WOFA 3PRBA 3LT3A 3F9EA 3TGIE 3HKJB 1IQFA 3F9FA 1MH0A 1YKTA 2J2UA 4MQAA 5C20A 1AD8H 3A82A 4Q2KA 8KME2 5HKKD 1IQMA 2EI8A 1W3CA 3UNSA 3LH3A 3ODFA 3DFJA 4MNWA 5EGMA 1SVPA 5FBIA 2A32A 3M7QA 1UO6A 1VCWA 1MTVA 1H8ED 5DKMA 4JYUH 1LKBA 3M5NA 3LC5A 5FBEA 3ESTA 3M3TA 1GMCG 4OS5A 2GDEH 3GOVB 3SU2A 2FDAA 4UONA 4JZDH 4I8KA 3STIA 2NU2E 1KXCA 5C5OA 1V2PT 2FM2A 4WF8A 1MCVA 1GI8B 2V6NA 2ZGHA 5JB9S 3VEQB 1LHCH 3MTYA 1DITH 1EUFA 1GMDG 1SMFE 3ZZCA 3BF6H 5L6NH 4JZIA 4K1TA 3M5LA 4J1YA 2KZ4A 4I7YH 4D7FA 1GHBF 1INCA 5KGOA 3G01A 3P95A 2XBXA 1V2UT 3NRLA 1TRMA 3NCLA 1XX9A 5KEDA 1DLEA 5EJ1A 1DE7H 3RXMA 1SHHB 2F83A 3SUEA 4ZROA 1MKWH 1Z8RA 2CK3D 1MABB 3ZZ6A 2XW9A 2PKSB 2OCVB 2CJIA 5A8XA 1E38B 1K1OA 2KCPA 4ISIH 4ZXXH 4AFSA 3ZVBA 2PLXA 1GBIA 3FP8E 2HWLB 4E7NA 3B23B 1TPPA 3KQEA 3EE7A 1O5FH 2XNIA 4DIHH 2A4OA 1TNHA 1ZSJA 2A2QH 4TT3D 3SJIA 1QZ8A 1O2OA 2VVUA 2H9TH 1O30A 4I8LA 2ANMH 1IHTH 1GBCA 4HFPB 5EQRA 3SHAH 1DSTA 2QCYA 5DO4H 2ZGCA 2BDBA 5LGOA 3DD2H 4SGBE 3STJA 1ELVA 1RTFB 1YPLH 1Z8JB 1H9HE 1QURH 2PUQH 1GHAF 3PLBA 1G2LA 4UDWH 4X6MA 1O3MA 1O3NA 1F92A 1OYTH 1YY3A 1OS8A 1HB0B 3P17H 1GGDC 1NRQH 3GS9A 1F5RA 4AYYB 1P03A 2ANYA 2WPKS 5DG6A 3SJ9A 2STBE 3PMBB 2OC0A 1EXFA 3RXCA 2UUJB 3KCGH 3W94A 1LHGH 4M7GA 1GBDA 1MTUA 3N99A 2KCAA 1BBRH 3QO6A 4ZMAH 3BEUA 2HNTE 4I8GA 3D49H 4ABJA 4Y0YE 3SN8A 2PWXA 2VGCB 4TPIZ 2L74A 1QRZA 3NK8A 2AERH 1OWJA 5LH8A 2AMPA 1BA8B 2QC2A 3QTOH 2H2ZA 4X2YA 4YO9A 2V35A 1GJ6A 1BRBE 3TJVA 1O3JA 4OS7A 2VVVA 4X1NU 1LQEA 2HLCA 4O3TA 3ZZDA 1S83A 4MPXA 1SGTA 1SGYE 1D4PB 2Q6FA 1AUJA 1LPKB 5C3NA 1C5UA 1A5IA 2A1DB 3ELAH 2W6JD 2FX6A 1LHDH 4AG1A 2ZFFH 3A80A 3T29A 2SFAA 3S9AA 3PWCA 3C1KA 1GBBA 2C93B 1YPGH 3SYJA 1O35A 3BTWE 1OP2A 5FCKA 1AKSA 1TONA 2XBYA 3SJKA 3OY5U 3PRDA 2WZQA 3PMJA 1CA0B 4YLQH 3QZQA 4XOJA 2ZDVH 3QGJA 1GDNA 1N8OB 3ZZ8A 2XBWA 1C9TA 1WQSA 2RG3A 1ELEE 2ZFSA 2FI4E 3RU4D 4DOQA 1UTKA 3DSPA 1C2IA 2KAIB 1ESTA 4BTUB 3SV9A 3SV6A 3NKKA 1GI9B 5C67A 1YCPK 2CF8H 1MTNC 3AASA 3FKSD 1O34A 3LGVA 4B2CA 2PSYA 1DXPA 1SC8U 4X2WA 1C5VA 4A6LA 1T32A 1EAWA 5JPMH 4D7GA 2KX4A 3B8JA 4OS1A 5E2PA 2Y82A 1GGDB 1B0EA 4RN6A 2AH4X 1BTWA 2VIDA 1XXFA 5T6FA 2PUXB 2I6QA 3SGBE 4ABFA 1FY3A 1SGRE 2B8OH 2PTCE 2AGGX 3I77A 4XBCA 2DUCA 2IJOB 1SPJA 1HBTH 2A7CA 4AOQA 2WPDD 4JYVH 3L3TA 1P05A 1ELBA 1ZGVA 4XBBA 2PHBA 1A1RA 3EYDA 1AIXH 4ASHA 1Y5BT 5DP9A 4XFQA 3LOXA 1QJ7B 1P2NA 2OXSA 4KELA 2HNTF 2P16A 3PROA 2C8XB 2FWWA 5C1XA 4Y8XA 5L2YH 1LHFH 5T1VA 2ZCKP 1C2FA 2HLDD 3BG4B 3FFGA 5E2OA 1JXPA 1PQ7A 2ODPA 2FP7B 1BMMH 3RXFA 5T6DA 2R2WU 2WUBA 1FUJA 1L2EA 1W13U 1SGFA 2QXHA 1UK2A 4CRDA 1EPTA 4D9RA 1TNLA 3MO9A 1DUAA 2P3FH 3LIWA 3BV9B 2LP6A 4GSOA 3UOPA 1IQKA 1V2WT 3URCA 3V7TA 3U1JB 3PWBA 2P8OB 3ZZ9A 1TPAE 2PGQB 3EBNA 1V2OT 2HALA 4BANB 1AFQC 1TX7A 4Y11E 2VIVA 4K5ZA 2KFWA 1C5OH 2BDIA 2ZKSA 3DSGA 4TY7A 1C5YB 1Y8TA 4B1TA 2AIPA 3MFJA 1HXEH 4UFFH 2XTTB 1EZSC 1PYTD 1GJCB 4F49A 2H6MA 3QUMP 4IBLH 2R9PA 2YNAA 2ZA5A 1PJPA 3VG8A 1SQAA 3GYMA 2GT8A 1GCTB 1ABJH 1N1LA 1KLJH 1BTHH 4ZUHA 3VPKA 3NWUA 4DVAU 2CN0H 4E7RG 2XXLA 5EOKA 5BRRE 1AGJA 1TPSA 5AFZH 1S82A 4K60A 3UWJH 1O3IA 4FETA 4WWYA 2VWNA 4X6PA 1C1UH 2CGAA 3TITA 1C4U2 1TB6H 1ACBE 1H8HD 4B76A 5DP3A 1HJ8A 2EY4C 1ZZZA 1BMAA 3O8CA 1EZUC 4KTCA 1VR1H 1ZMNA 2JH0D 3QX5H 2UUKB 3SV2H 4DT7B 1TGSZ 1TWXB 1SBWA 3JZ1B 4ZAEA 1YPJH 3VB6A 2Y7ZA 3SUFA 3HGPA 4RSPA 1G32B 1A3BH 2YOLA 3GY5A 1TA6A 3VB5A 1S0QA 1TNKA 1JBUH 1A46H 1QJ6B 4U2WA 2FODA 1GJ4H 2PKSC 1ZMLA 1H1BA 1S6FA 4Y79A 4AGJA 4JMYA 1ZR0A 3OTPA 1PQ5A 1DM4B 2XWBI 2WUCA 3BTEE 4BTIB 3A84A 2BX3A 1EPTC 1T31A 7LPRA 1GMDF 1C5ZB 3GCNA 1G30B 1DLKB 5CMXH 1YBWA 1NRNH 2ZQ2A 3RXQA 2J94A 5B6OA 3Q3YA 2ZDMA 4OS4A 2G4TA 4I31A 2AGIX 2YMSC 4HGCA 3RXEA 1FXYA 1MMJN 1W12U 3TIUA 3UQVA 3LGWA 3MU4A 2AFQB 4F4OC 2F9NA 4IMQA 2UWOA 4U32A 5B6LA 2TIOA 4IGDA 2GCHG 5DP6A 3QK1A 2H1UA 1P9SA 3SQHE 1GHBG 4YT6H 4I86A 5AHGH 2BY8X 2OBQA 3A86A 5FPSA 1GJAB 1BCUH 2F43B 3VGCC 2CHAC 1PPZA 2FOCA 4I8HA 3A81A 3ATMA 4O3UA 2BLOA 1SGFG 4LZ4B 5F6MA 4CHAC 1O5EH 1T4VH 3LGYA 3ZZ4A 3F2FA 5EPNA 1IOEA 1QB9A 1MTWA 3E90B 1MU6B 2QF5A 2GZ7A 4IW4E 3SJ8A 4JYTA 4XBDA 1C2KA 6GCHF 1NFYA 1BMNH 4HZHA 4X6OA 2D8WA 3GDSA 1L4ZA 3MH5A 1WTHD 1UHBA 1QHRB 3A87A 1QR3E 1UVSH 1E36B 2Y80A 3ZYDA 1YC0A 1O2WA 4NSVA 3E0NB 3Q77A 1K2I1 2EA3A 1YLNA 4FXGH 3M3VA 2ULLA 2FEQH 2RFKC 1RJXB 1G2MA 1YF4A 3RXBA 3GCHB 3ZZ7A 1QCPA 1MD7A 1T8LA 4ABIA 4CHAB 1TE0A 1LDTT 2HNTC 3O8DA 2BVRH 1S6LA 4KKDA 2GZ9A 2XOKD 5LPEA 2ZHWH 3SORA 2XC0A 1CGHA 3OY6U 1WUNH 1XUKA 2PSXA 2WV9A 3E6PH 3PB1E 1EASA 1G3BA 2J97A 1YP9A 2YMSB 1O3LA 1CO7E 2FIRH 1C4V2 3TJUA 1FMGA 3SU0A 5DP5A 3SU5A 4Y8ZA 3NZIA 5EQQA 2ZHDA 4Z6AH 1TABE 2BLVA 2R2MB 3P8OA 3N7DA 3RXJA 2FYQA 1ORFA 1O3PB 1UJ1A 3TH2H 1KXDA 3PMAB 2Y5HA 1AMHA 3EDXB 4VGCB 2FS8A 1O3GA 1MBQA 2R3UA 2R0KA 4Y71A 1AVXA 2RDEA 5DPAA 3SGAE 4NGAH 2WHXA 5FX5A 1DWBH 2ZEBA 3L33A 2VGCC 3GDVA 3GY3A 1D6RA 1NFWA 1G9IE 2ZPSA 1HPGA 1OWKA 2IOTA 2DE9A 4Y76A 5ABWA 4A1TA 2JH6D 1QQ4A 4XE4A 3RXSA 4DCDA 4RT1A 4Q63A 1EAUA 3SUGA 2PP6A 5K7RA 1FONA 1C2GA 2BY5X 1KXEA 1AB9C 4BAKB 4X1QU 1YM0A 1K1JA 4WH6A 4ZCNA 4OGYA 2YMSD 3BIUH 1SB1H 2AYWA 1HAVB 2ZZUH 1BJUA 3MNSA 4YTAA 1MD8A 1W0YH 2VWLA 2FESH 2F9VA 1XXDA 4NG9H 4MPVA 2LELA 5H4IB 1VZQH 3H7TA 2QXGA 2KCYA 3KIDU 3TPIZ 2ALVA 3KQCA 2EI7A 4ABDA 3T2NA 4AFUA 1QL8A 1TYNA 2BZ6H 1P04A 2VIPA 1JMOH 1V2NT 1M9UA 2FLBH 1L1GA 2PW8H 1VITG 4Q4LA 2HVXA 2G8TA 2SGDE 5JBTA 2J9NA 4UFEH 4JZFH 5GPIB 4X8SH 1H8DH 1TGTA 2ZI2H 2BXTH 2FX4A 2O8MA 3F1SB 5F03A 4DW2U 2QAAA 2HGTH 1MUEB 4CRCA 1Y3XA 4A5TS 5T6GA 2VINA 1IQGA 1MAYA 2VH0A 4YZUA 2BOKA 1QGFA 3E0PB 4E06H 3RLYH 4D9QA 3RXUA 4Q7XA 1QRXA 4FU7A 5AFYH 1BUIA 2GTBA 1O2KA 1BITA 1GWAA 1GMHF 2C8WB 1EX3A 4ZH8A 3GCOA 1SGNE 1N6XA 3RXOA 4B71A 2BLQA 1TLDA 4TWYA 1GVLA 1K1IA 4RKJB 1UK4A 1EZXC 5C0UA 2OC1A 1MKWK 2OQUA 1ABIH 1FI8A 1CT2E 3PM3A 2A7HA 2ZO3H 5J4SA 1O38A 4AC9A 3CP7A 4X1SU 3VB3A 1CHGA 3UY9A 4AN7A 1C5MD 2CF9H 1ZPZA 4ZKOU 1HDTH 4UFGH 3NUMA 3SU3A 2GP9B 1C1VH 1K1MA 3BSQA 1Z8GA 2VB0A 1PYTC 5FAHA 3UPEA 1YCPH 1W7XH 1QY6A 1KDQA 1V2JT 2P3UB 3BTTE 3ITIA 4GPGA 1V3XA 2NU4E 1GJ8B 2LNCA 4BOHA 3QLPH 3WW7A 1YWUA 4ABGA 4BAQB 4NA9H 4X2XA 1Y59T 3F0PA 1HIAB 4BXSA 3GY8A 2V3OH 5G4BA 5HMAA 4ASUD 2G51A 3AW1A 2F3CE 1J14A 5CHAC 2R0LA 2VU8E 2XBVA 4R8TB 3ZV8A 3QN7A 1S81A 5F8ZA 2ZFQH 1F0TA 4X1RU 2QF3A 2SNWA 2W7UA 3UWIA 4THNH 2HOBA 2Q1JA 1JRSA 1TPOA 5EJLA 4Y10E 1HFDA 2FOHA 1AZ8A 3RM0H 3TGJE 1BTUA 3OEHD 4YOJA 2QF0A 4IN1A 3F68H 4Q80A 1HJAB 1SLVB 1XKAC 2FOAA 1CE5A 1C4Y2 1GBMA 1T7CA 1ZHMA 1VGCB 2OD3B 2P8OC 1HAXB 5JBAS 1NPMA 3GDUA 1SGIB 2F91A 2Y5FA 4FU9A 2WYJA 2CMYA 4DURA 3TVJB 2AMQA 1F5KU 2F9OA 4HI3A 4AYVB 3I29A 3SI3H 2OBOA 3ATKA 5A0BA 1GBHA 2WSSD 4FUIA 4CR5A 1SR5C 2KM0A 3ZIAD 1GJ9B 1UTOA 3RXIA 3EA8A 3DSOA 5JBBS 2NU3E 1C1PA 3D65E 1MKXK 2JIZD 4K8YA 1VKYA 2GD4B 3SJOA 3Q00A 3S69A 4FOUC 3RU4E 2ZDKA 2Z6BD 4K69A 4NA8A 2ZHFH 4CRFA 4Q7YA 4OM9A 1BDAA 5TCCA 1ZSLA 1P9UA 2OLGA 1TNGA 1EP5A 2CXVA 1C5WB 1PPFE 1RFNA 3H09A 5A09A 1AO5A 1DXWA 5EU8A 5E0HA 4ABBA 1K1PA 2BQ7B 4X8VH 1ZOMA 1ZRBA 3A7WA 1YPEH 2THFB 2M2AA 1K28D 1XUIA 5HYOA 2FOMB 2XWAA 4NWLA 4R0IA 3SNDA 1AWHB 4WY3A 3P8FA 2ASUB 1RXPA 3OFND 4RT0A 2IN2A 4ZXYH 1AWFH 4MPUA 5EJZA 3VB4A 2G4UA 5GXPA 5C94A 7GCHG 1J16A 3ATWA 1L1NA 1T8MA 1WQVH 5EXMA 2TBSA 3CS0A 1HYLA 4AFQA 4JZEH 5J4QA 5DGJA 1A5HA 2BDYA 1GMHG 1LPGB 2UUYA 1ESAA 3P8GA 1DPOA 3A7YA 3M37A 3OE7D 3TGKE 3LU9B 2BQ6B 1GVKB 1J17T 2P94A 1V2KT 3ZVEA 1TMBH 3IG6B 3L6PA 1TQ0B 2WPMS 4ZHMU 5CHBA 1W0JD 1UCYK 5TCAA 3F2HA 3MH6A 1JIRA 2QV1A 3E16B 2Z3EA 4DG4A 4P02A 3T5FH 1P12E 1THPB 1O2YA 1O3OA 1D9IA 1K21H 2BY9X 3MOCA 2BY6X 1RS0A 4K1EA 3A83A 1QB6A 1CA0C 1AZZA 2C4FH 1O3DA 1O3EA 2ZDNA 3D62A 1AY6H 3RUOA 4K3JA 1GG6C 1TX8A 4DY7B 1NBME 2AIQA 3ZVGA 5FPYA 3ZZ3A 5FCRA 1GBFA 1RRKA 4B2AA 2SGEE 3SQEE 1P0SH 2AS9A 3K6ZA 3URDA 2RDLA 4YESB 1BB0B 1C5TA 5GCHG 5DJ7A 1SGPE 3F3BA 3SU4A 4ISLA 2L6OA 1LMWB 3A7ZA 3A7TA 1C2DA 1CBWC 2VIQA 1J9CH 4DT4A 4YXWD 2PKAB 4NZLA 3FP7E 1N8OC 3QZRA 1PPEE 3F9GA 1BMFD 2A4RA 4CRGA 1BOQA 1TGCA 4TPYA 1FZZA 1GI6A 2EQNA 4OGXA 1SQOA 3ODDA 4IMZA 2Q6DA 3MH7A 6ESTA 2A7JA 1DWEH 3E1XB 3LJJA 2JETB 4FVDA 3RXTA 2FS9A 2OTVA 1Z1JA 1GG6B 1NESE 3MHWU 2OQ5A 2FOFA 3RXLA 3DUXH 3GICB 3PO1C 1V2MT 2C8ZB 3BG4C 3IITA 3SNBA 1C1RA 1UCYH 1KMHB 1ELDE 5IDKA 1NN6A 1BZXE 2VNTA 1DFPA 1NROH 5HIZA 1O2SA 2FYRA 1OX1A 2XRCA 5GNDA 1MQ5A 1UVOA 1WAYB 4XD7D 1O31A 2AHME 1W11U 4BAHB 1LVOA 2GMTC 4ABEA 3P6ZB 1P2KA 2ZU2A 2H9EH 2JJ2D 2GJGA 2K1QA 3LC3A 1O2VA 3MU0A 1O5GH 3KNXA 4B73A 1WXRA 1HAPH 6CHAB 4HG6A 1CHOF 1LKAA 1QQUA 1ANBA 1CVWH 1MTSA 1OWDA 5GCHF 1OYQA 2J5UA 1KXBA 5FPTA 5HM9A 2Y7XA 1ZTKA 3OTJE 1C5XB 3OU0A 1V2VT 4ZKRU 3PV2A 1COWD 2P93A 1A0LA 1Q3XA 1C1WH 2BVXH 3NXPA 3RXVA 3MNXA 1MTNB 3K6YA 1UVTH 1LQDB 3F2GA 4B6FA 3UFAA 8GCHF 1ETRH 4NFEA 4NWKA 2A5AA 1LHEH 5EXNA 4CBNA 4PROA 4X2VA 3ZVFA 1V2TT 1GBJA 1O36A 1ARCA 1Q31A 2BM2A 1MKXH 1YGCH 2VWMA 2G5VA 4GLYA 1F2SE 1TX6A 1DOJA 1SGQE 2STAE 4ZHLU 4H6SB 1G36A 1QRWA 2FPZA 4YOGA 3RP2A 3MQKC 1WBGB 2SGFE 1E34B 2P95A 3I78A 1KXAA 2CHAB 1KIGH 1ZGIA 3LJOA 3A85A 1K1LA 3BG8A 1SG8B 1QNJA 1QL7A 2VIWA 1ZHPA 3MO6A 3LGTA 1H9IE 1QA7A 2C3SA 1AFEH 2ILNA 5EQSA 2BD9A 1GBTA 4K8BA 5EXLA 5A8ZA 4AG2A 1QA0A 1U6QA 1ZTJA 1ZLRA 3UQOA 2ZIQH 2VBCA 1FY1A 4Y0ZE 1ARBA 3BEFB 1CGIE 3TK9A 1XUHA 1AE8H 3LDXH 1VITH 1PQ8A 4GCHG 1LTOA 2P59A 1D6WA 4UEHH 4WXVA 1K1NA 4WMEA 1BMLA 3VB7A 1AB9B 1UTPA 1WDIA 1MBMA 3SW2B 1L1JA 1SOZA 4X1PU 4GHQA 1E35B 1O2MA 1FDPA 1GI4A 5CE1A 1XUGA 1DY9A 3AW0A 2D2DA 2RA0A 1P3EA 1AHTH 1TBZH 4Z0KA 2ZQ1A 1SFIA 4Y7BA 4IS5A 1C2LA 1NTPA 4GVUA 1A2CH 1TNIA 1CHOG 2WPJS 1ZPCA 1CBWB 1D3DB 1DT2A 4CH2B 1QB1A 4P00A 1THSH 2BD5A 1NT1A 2G52A 3RMLH 3W1EA 3FAOA 3AVZA 1P01A 1GVZA 1A61H 2ZPRA 2NWNA 1QFKH 1FN8A 5HM2A 1DX5M 1FV9A 4OS6A 1PFXC 1NRSH 1O3HA 1FY8E 3SV7A 4AGKA 1A3EH 1HIAA 1ETTH 4U01A 2FI5E 1HAOH 1EB2A 1EJMA 1GBLA 1BT7A 3RXRA 2QY0B 2GGVB 4B2BA 2YNBA 4Z1MD 1O32A 4AORA 3GY2A 1UW7A 4Y7AA 4A1XA 1O0DH 1AQ7A 2VIOA 2QGRA 1B5GH 1BRUP 2OUAA 2JDID 3NPSA 2FLRH 3HK6B 4ABAA 3MMGA 4GAWA 2O8WA 1E1QD 1V2ST 3GY7A 4XRNA 3CS7A 1NZQH 2BDGA 4K1SA 1SQTA 3C27B 1FX0B 2V7QD 3M7UA 3TU7H 1P09A 4O9VA 3DCLA 2GVFA 3F0OA 3V3MA 1C1SA 3A8BA 3T27A 1JOUB 3RC6A 4ACAA 1SOTA 4TY6A 2TGPZ 1RGQA 2GV7A 3V13A 5L30H 4ISNA 4WH8A 1HNEE 1AKSB 1EPTB 3PLPA 1Z6EA 1A7SA 1C5QA 3FANA 2XC5A 1T8OA 1C5LH 3A89A 4ZKSU 1HAGE 1JRTA 2W26A 2ZPQA 4I33A 2TGAA 4NIYA 5LPRA 1ZPBA 1GI3A 2KAIA 3WWBA 1FY5A 4KP0A 1K22H 5A0CA 4RKOB 3GCHC 1QBNA 1S6HA 4MG3A 8LPRA 3FOAA 1RIWB 1E37B 5GWZA 1D3QB 5DN6D 2Z9GA 1FQ3A 2SGAA 2OP9A 3GCTG 1BHXB 1QJ1B 1A0HB 2XC4A 1TBQH 5C2ZA 3U8TH 3P92A 2OK5A 3HPTB 1TRYA 3O8RA 1HV7A 1TRNA 3SI4H 4AB8A 2A4QA 1BQYA 1PQAA 3FO8D 5AF9H 2VWOA 2ZGJA 1RTLA 3WWFA 1EOLA 2V0BA 5E0JA 3M5MA 1GI7B 5IYTA 3MO3A 1O2ZA 3BTGE 1VCPA 2H5DA 3BN9A 2A2XH 2GCTC 1DANH 5DP8A 3MU8A 4F55A 1UMAH 3SZNA 4DJZB 2Z94A 1EKBB 1TALA 1B7XB 4AB9A 1GJBB 5HIYA 1O2RA 2BDHA 4JK6A 1P2IA 3SNEA 4BAMB 4DGJA 3BTME 2TPIZ 2TRMA 2G5NA 1TGNA 1XUJA 1WU1A 2ZGXH 1QBOA 1OWHA 1YLCA 1C1OA 1EQ9A 5SGAE 2ZFTA 2NU1E 1OHHD 2Z3CA 1IQEA 2F4LA 5GIBA 5GJ4B 4CREA 1XUFA 4NZQA 4BAOB 1RTKA 2ESTE 1C5RA 1YLDA 1O2IA 2ZC9H 1MAXA 4JK5A 1XVOA 3RU4T 1O3BA 1MZDA
chains in the Genus database with same CATH topology
5EODA 1ANCA 1V2QT 3U8OH 4D76A 2V3HH 3SNCA 1A0JA 2ZCLP 4NIXA 3MU1A 3P8NA 1O2QA 1ZHRA 2ODQA 2EI6A 2XCNA 4U30A 3MNCA 1UTQA 1EATA 1O3KA 2PTNA 1BBRK 1O2UA 1S85A 5FHTA 3PO1B 4LXBH 1P2JA 4B74A 2QIQA 4FUDA 1GCTC 3ATLA 5E8EH 2JKHA 1TOCB 5ETXA 4ESTE 2QYIA 3MYWA 3GY6A 2TGDA 4MNYA 1C1NA 2VVCA 2ZTXA 3BEIB 1P3CA 1KTSB 1CA8B 1OSSA 3A88A 2FZZA 1NS3A 6GCHG 1PPHE 1LVMA 2ZDLA 1EP6A 1SGDE 2BHGA 4Y6DA 1YCPM 3A7XA 3T62A 1O2PA 2PKAA 2PGBB 2ZTYA 4OS2A 3S7KB 1SGCA 2QXIA 1NFUA 2XCFA 1W8BH 3TNTA 5EG4A 3UR6A 3MU5A 5HXFA 3U9AH 2BMGB 1TOMH 3UNQA 2GT7A 4Q7ZA 4AFZA 1AI8H 1HCGA 2HPPH 3SV8A 1Y3UA 1FY4A 1BRAA 2J4IA 2UUFB 3VFEA 2VH6A 3SOSA 1PPBH 2FTMA 2ZU1A 3K65B 2SNVA 3N7OA 1P2OA 1QTFA 5DK1A 4BTTB 5A8YA 1TMUH 3RC4A 1DICA 3ZZBA 3S0NA 1HUTH 2ZU5A 3PYHA 5JB8S 2GZ8A 1XM1A 1UTLM 4CRAA 4KTSA 3T28A 1GJDB 1TQ7B 1TBRH 2BX4A 4X8TH 2Z3DA 4A1VA 4JZ1A 1CGJE 2SGPE 2UWPA 1HAHH 4H4FA 1P10A 3BTHE 9LPRA 2WV4A 2C90B 3BTFE 5LPFA 1O3FA 3RMOH 1Y5UT 1AUTC 1O3AA 3SU6A 1C1MA 5EW1H 1C5NH 1SLXB 4BNRA 5T3HA 7KMEH 3RC5A 3ZYEA 1UTMA 3K2UA 2W3IA 3QDZB 4H42U 4XDEA 5EW2H 2OC8A 1NRPH 2B5TB 3HATH 3OX7U 2BTCE 1ELGA 4UFDH 4ISHH 3RXPA 1ZJDA 1KTTB 2IPHA 2A4GA 1SI5H 2WINI 2R3YA 2JH5D 5DP7A 1ESBA 4FUJA 4FUBA 1ZJKA 1ZTLA 7ESTE 2Z7FE 3ZZ5A 2B9LA 2PR3A 1GHXH 2WPIS 2ZHQH 1W14U 3A8AA 1ETSH 3PLKA 3GYLB 4A7IB 3DHKH 2FOBA 3SGQE 4AZ2B 1K9OE 3UR9A 2M5TA 4MVNA 1NC6A 2ANWA 4NSYA 1V2RT 1O2HA 2PV9B 1GL0E 1GDQA 4B75A 3RLWH 1GMCF 5C1YA 2D1JA 1LPZB 1W7GH 1WV7H 2Y6TA 1S5SA 4BXWA 2OC7A 3TK6A 1C9PA 1C5PA 5EPYA 4TWWA 2GCHF 2GMTB 4WMFA 1IHSH 1XKBC 1O2GH 3QGNB 4INHA 4ZHAA 1P02A 1BBRE 2ZTZA 3UUZA 8GCHG 1NRRH 1KYNA 1OWEA 2WPLS 1C2JA 1W2KH 1OWIA 1FAXA 1SLWB 2J38A 3H7OA 2K7XA 4GUXA 1WCZA 2PFEA 1O2XA 4Y8YA 3D23A 1FPCH 1Y3WA 1DWCH 1QBVH 1L0ZA 3ZZAA 1YPHC 4NIWA 2F9BH 1C2MA 3FZDA 1ANEA 1EOJA 1GL1A 1BJVA 1OKXA 2LPRA 2FOEA 5AVDA 1RD3B 5JBCS 3Q76A 1TAWA 3MI4A 3TH4H 2BVSH 2ZP0H 3WY8A 3CENA 4GHTA 1UTJA 1DDJA 1CU1A 2BD3A 1AVWA 4WVPE 1UVPA 2FXRA 2ZU4A 2O8TA 2LIZA 1FN6A 1ZYOA 3TJOA 3EE0B 4INKA 1HAVA 5I46H 5ESBA 2B7DH 1CSOE 1SGEE 3BTDE 1XMNB 1J15A 1FPHH 1LCYA 1S84A 3HK3B 4UE7H 3K9XB 1J8AA 3TJNA 3TH3H 1GI0A 2J34A 3GY4A 1FLEE 3A7VA 4NCYA 4KGAA 4X8UH 2Z9KA 1C2HA 1GBEA 2P3TB 2AMDA 1GHWH 4IC5A 1Z71A 1CQQA 1O2JA 4SGAE 1EB1H 2H5CA 3OYPA 1GBKA 3UOUA 1HAZB 3PTBA 1OPHB 3SNAA 1T4UH 2ZFPH 4TYDA 1EAXA 3V12A 1GPZA 2FTLE 2A0QB 5C1UA 2RA3A 1L4DA 3MH4A 2A45B 1VJAU 3KHVA 2Q6GA 1FJSA 3M35A 1GHYH 3P70B 4O97A 3FP6E 3GISB 3SO3A 2ZG0H 3KL6A 3LGUA 2FO9A 1DSUA 4FUCA 3RXKA 1UTNA 3A8DA 1FNIA 4INLA 7GCHF 1HAIH 2WPHS 2BB4A 2BYAX 2Y81A 1AE5A 2VJ1A 1AFQB 3DT0H 3SBKA 2HRVA 3ATIA 5TJXA 1ELAA 5FX6A 3RXGA 1Q2WA 1GI5A 4XSKU 1TA2A 3RMMH 2BD4A 1E0FD 4WJG2 4WMDA 5BPEA 1S0RA 1UHBB 1G37A 1BTPA 1GJ7B 3SU1A 1JWTA 3A8CA 4FUFA 3VGCB 3O8BA 5JYIA 3E91A 3Q3KA 3R0FA 3R3GB 3KF2A 3S9CA 4H6TA 1B0FA 1F7ZA 3RMNH 6CHAC 2J92A 3H5CB 1ANDA 1ELTA 1O39A 1KDQB 3TK5A 1V6DA 4CBOA 2ZF0H 4I8JA 4K2YA 2QA9E 4UD9H 3RXDA 1GJ5H 4KTUA 3LKWA 3U98H 1KLTA 2ZDAH 3F6UH 1BHXF 5DP4A 4AX9H 1C2EA 2ZGBH 1C1QA 2GX4A 1GDUA 1P8VC 3EA7A 1KLIH 1KSNA 3AAUA 1KY9A 4MNXA 1GBAA 3ZVAA 1IQNA 4CRBA 1O5CB 1XVMA 3ZVCA 1NU7B 1AN1E 1EAIA 1EZQA 1O5DH 2RCEA 4FUHA 1OP0A 1A4WH 3RXHA 2BD2A 3BTKE 2J95A 1BIOA 4D8NA 3S7HB 1F0RA 2WYGA 1AU8A 3EGKH 4FU8A 1VCQA 3RM2H 3ZVDA 1HJAC 1D3TB 4DIIH 3BIVH 1OOKB 1VGCC 2ALPA 2EEKA 1IQJA 4HTCH 2ZHEH 1P2MA 4O03A 1DVAH 1WTGH 2BD7A 2NU0E 3HKIB 4ISOA 1G3EA 8ESTE 1Z6JH 3KEEA 2C8YB 3DFLA 4GCHF 3M5OA 1UVUH 1YPHE 4A92A 1KXFA 3UREA 1IQLA 2ANKH 2H9HA 4NFFA 4VGCC 5PTPA 3KGPA 5JDUB 1OXGA 2G55A 1W10U 3PV4A 4CH8B 1YYY1 5L2ZH 1T8NA 4LZ1H 2FMJA 3KQBA 4YM9A 1TGBA 4MNVA 2O8LA 2BXUH 4ZKNU 2GV6A 1G3DA 3DA9B 1DUEA 1P57B 6LPRA 3S9BA 5HGGA 2BY7X 2W7SA 4WXIA 3BTQE 4MTBA 1SL3A 2QXJA 1Y3YA 2BZAA 4NIVA 1Y5AT 2ODYB 3RXAA 1RIWC 1MQ6A 5I25A 2JETC 2UWLA 1NY22 3E8LA 1NM6A 3VXEH 1BTYA 4X6NA 4YT7H 1G3CA 2BDAA 1FIWA 5ESTE 3LONA 1H8IH 1SFQB 1AVGH 3MNBA 1BTXA 2GDDA 1F5LA 2W5EA 3KQDA 3FZZA 4IN2A 1TNJA 3U8RH 1EJAA 1O37A 9ESTA 1GHVH 1GI2A 3PTNA 4I32A 4YLUA 1O5BB 3B9FH 1MZAA 1LO6A 4FVBA 1TMTH 1YPMH 2ZWLH 1O33A 1ZRKA 1ZMJA 5F8XA 2BLWA 3T26A 3LPRA 2Y5GA 3UNRA 1IAUA 1DWDH 3KN2A 3IWMA 3QWCH 2A31A 1F0UA 1GHZA 2O8UA 1SSXA 1O5AB 2ZCHP 1WSSH 2Z9JA 1C1TA 1MU8B 5F8TA 1DS2E 1TIOA 2TGTA 1N6YA 1OP8A 3M61U 3LGIA 1HLTH 3OSYA 5A2MH 1HRTH 1QIXB 1VJ9U 2Z9LA 3EAJA 1ZSKA 1MCTA 2BOHB 2BDCA 2BQWB 3AAVA 2EC9H 2O9QA 3ZV9A 1Z7KA 2FI3E 2BD8A 3U69H 1ELCA 1FIZA 3JZ2B 4IC6A 1BRCE 1A5GH 1JIMA 1LVBA 3Q3XA 1CT0E 2DE8A 3GCTF 3EA9A 3RDZA 1H4WA 5FXLA 2AEIH 1P06A 3MWIU 1PPGE 1NFXA 1WYKA 4LOYH 3QTVH 4MPWA 5GDSH 3M3SA 2F9UA 1ELFA 4X0WU 5CHAB 2A5IA 3M36A 1CT4E 1SHYA 3UIRA 3EQ0H 2CV3A 3T25A 1HAYB 3VXFH 1HJ9A 3FVFB 1P2QA 2QN5T 2W3KA 4ABHA 1UK3A 1HGTH 3TNSA 1LVYA 3W95A 3V0XA 1GI1A 2B0FA 4MLFB 2SGQE 1Z8IB 2GKVE 4YOIA 5C5NA 5K0HA 4E05H 1DY8A 2OINA 1IQIA 1NU9A 3E3TA 3HGNA 4FUEA 1D3PB 1EJNA 2ZFRH 5A0AE 2I6SA 1C5SA 4JCNA 1O3CA 2ZNKH 1QL9A 4LK4A 4QT8C 1O2TA 1IQHA 2ZECA 4J2YB 3SHCH 4MDSA 1NO9H 2G81E 2Z9IA 1YPKH 3UTUH 1TFXA 1W0ZU 2F9PA 1X7AC 1V2LT 2XYAA 3U1IB 1VITF 2HPQH 2A5KA 1UCYE 3F9HA 4FUGA 3TLOA 2GCTB 1Y3VA 1GHAG 1O2NA 1FAKH 1BTZA 3SUDA 4NA7A 1PPCE 1HXFH 2WV5A 3PMHB 2FOGA 1GCDA 3M7TA 1H9LB 1SLUB 1P11E 1F0SA 3LH1A 2AGEX 3ENSB 1O2LA 2D26C 2ZU3A 2G00A 4CR9A 1ID5H 1THRH 5E0GA 1Z1IA 1WOFA 3LT3A 3F9EA 3TGIE 3HKJB 1IQFA 3F9FA 1MH0A 1YKTA 2J2UA 4MQAA 5C20A 1AD8H 3A82A 4Q2KA 8KME2 1IQMA 2EI8A 1W3CA 3UNSA 3LH3A 3ODFA 3DFJA 4MNWA 5EGMA 1SVPA 5FBIA 2A32A 3M7QA 1UO6A 1VCWA 1MTVA 5DKMA 4JYUH 1LKBA 3M5NA 3LC5A 5FBEA 3ESTA 3M3TA 1GMCG 4OS5A 2GDEH 3GOVB 3SU2A 2FDAA 4UONA 4JZDH 4I8KA 3STIA 2NU2E 1KXCA 5C5OA 1V2PT 2FM2A 4WF8A 1MCVA 1GI8B 2V6NA 2ZGHA 5JB9S 3VEQB 1LHCH 3MTYA 1DITH 1EUFA 1GMDG 1SMFE 3ZZCA 3BF6H 5L6NH 4JZIA 4K1TA 3M5LA 4J1YA 4I7YH 4D7FA 1GHBF 1INCA 3G01A 3P95A 2XBXA 1V2UT 1TRMA 3NCLA 1XX9A 1DLEA 1DE7H 3RXMA 1SHHB 2F83A 3SUEA 4ZROA 1MKWH 1Z8RA 3ZZ6A 2XW9A 2PKSB 2OCVB 2CJIA 5A8XA 1E38B 1K1OA 4AFSA 4ISIH 4ZXXH 3ZVBA 2PLXA 1GBIA 3FP8E 2HWLB 4E7NA 3B23B 1TPPA 3KQEA 1O5FH 2XNIA 4DIHH 2A4OA 1TNHA 1ZSJA 2A2QH 3SJIA 1O2OA 2VVUA 2H9TH 1O30A 4I8LA 2ANMH 1IHTH 1GBCA 4HFPB 5EQRA 3SHAH 1DSTA 2QCYA 5DO4H 2ZGCA 2BDBA 5LGOA 3DD2H 4SGBE 3STJA 1ELVA 1RTFB 1YPLH 1Z8JB 1H9HE 1QURH 2PUQH 1GHAF 3PLBA 1G2LA 4UDWH 4X6MA 1O3MA 1O3NA 1F92A 1OYTH 1OS8A 1HB0B 3P17H 1GGDC 1NRQH 1F5RA 4AYYB 1P03A 2ANYA 2WPKS 5DG6A 3SJ9A 2STBE 3PMBB 2OC0A 1EXFA 3RXCA 2UUJB 3KCGH 3W94A 1LHGH 4M7GA 1GBDA 1MTUA 1BBRH 3QO6A 4ZMAH 3BEUA 2HNTE 4I8GA 3D49H 4ABJA 4Y0YE 3SN8A 2PWXA 2VGCB 4TPIZ 1QRZA 3NK8A 2AERH 1OWJA 5LH8A 2AMPA 1BA8B 2QC2A 3QTOH 2H2ZA 4X2YA 4YO9A 2V35A 1GJ6A 1BRBE 3TJVA 1O3JA 4OS7A 2VVVA 4X1NU 1LQEA 2HLCA 4O3TA 3ZZDA 1S83A 4MPXA 1SGTA 1SGYE 1D4PB 2Q6FA 1AUJA 1LPKB 5C3NA 1C5UA 1A5IA 2A1DB 3ELAH 2FX6A 1LHDH 4AG1A 2ZFFH 3A80A 3T29A 2SFAA 3S9AA 3PWCA 3C1KA 1GBBA 2C93B 1YPGH 1O35A 3BTWE 1OP2A 5FCKA 1AKSA 1TONA 2XBYA 3SJKA 3OY5U 3PMJA 1CA0B 4YLQH 3QZQA 4XOJA 2ZDVH 3QGJA 1GDNA 1N8OB 3ZZ8A 2XBWA 1C9TA 1WQSA 2RG3A 1ELEE 2ZFSA 2FI4E 3RU4D 4DOQA 1UTKA 1C2IA 2KAIB 1ESTA 4BTUB 3SV9A 3SV6A 3NKKA 1GI9B 5C67A 1YCPK 2CF8H 1MTNC 3AASA 1O34A 3LGVA 4B2CA 2PSYA 1DXPA 1SC8U 4X2WA 1C5VA 4A6LA 1T32A 1EAWA 5JPMH 4D7GA 3B8JA 4OS1A 5E2PA 2Y82A 1GGDB 1B0EA 4RN6A 2AH4X 1BTWA 2VIDA 1XXFA 5T6FA 2PUXB 2I6QA 3SGBE 4ABFA 1FY3A 1SGRE 2B8OH 2PTCE 2AGGX 3I77A 4XBCA 2DUCA 2IJOB 1SPJA 1HBTH 2A7CA 4AOQA 4JYVH 3L3TA 1P05A 1ELBA 1ZGVA 4XBBA 2PHBA 1A1RA 3EYDA 1AIXH 4ASHA 1Y5BT 5DP9A 4XFQA 3LOXA 1QJ7B 1P2NA 2OXSA 4KELA 2HNTF 2P16A 3PROA 2C8XB 2FWWA 5C1XA 4Y8XA 5L2YH 1LHFH 2ZCKP 1C2FA 3BG4B 3FFGA 5E2OA 1JXPA 1PQ7A 2ODPA 2FP7B 1BMMH 3RXFA 5T6DA 2R2WU 2WUBA 1FUJA 1L2EA 1W13U 1SGFA 2QXHA 1UK2A 4CRDA 1EPTA 4D9RA 1TNLA 3MO9A 1DUAA 2P3FH 3LIWA 3BV9B 4GSOA 3UOPA 1IQKA 1V2WT 3URCA 3V7TA 3U1JB 3PWBA 2P8OB 3ZZ9A 1TPAE 2PGQB 3EBNA 1V2OT 2HALA 4BANB 1AFQC 1TX7A 4Y11E 2VIVA 4K5ZA 1C5OH 2BDIA