1UTJA

Trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
222
structure length
222
Chain Sequence
IVGGYECKPYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMASY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN I
publication title Trypsin Specificity as Elucidated by Lie Calculations, X-Ray Structures, and Association Constant Measurements
pubmed doi rcsb
molecule tags Hydrolase
total genus 48
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utjA02
2HVXA 2ZCKP 4A6LA 1HUTH 1GBMA 2VGCC 3O8CA 1EOLA 3FANA 2FI3E 4X2XA 3RC4A 2WPLS 4CREA 4LZ4B 3MH7A 3QO6A 1GWAA 1ANBA 1A0JA 2HNTF 4RKOB 1OWJA 2XBXA 2TPIZ 1HLTH 1MKWK 1O3BA 3MU8A 2BY8X 3G01A 3GCHC 4A1VA 3LH3A 3FAOA 1SGFG 4KP0A 2CN0H 1TOMH 2ZTZA 2WPKS 3B9FH 4B2AA 1XUIA 2ZDNA 4NFEA 2PUQH 5ESTE 3RC5A 1D6RA 4OS2A 3BIVH 1P9SA 1QBVH 3BTDE 4WY3A 3E8LA 3MNBA 1K2I1 1XUHA 2PTCE 1BBRK 2PGBB 1BOQA 3SNEA 4IMZA 4CR9A 2QXHA 5FX6A 1GJ4H 1OWDA 2GVFA 3UPEA 6CHAC 1Y5AT 4K60A 1AIXH 1P06A 3TGJE 2ZFRH 1ELAA 2Z94A 4NIVA 2BXTH 3FP7E 2GZ8A 3R3GB 1F0RA 4H42U 1KLIH 1KYNA 1YPGH 3UWIA 1ZTKA 1L2EA 3BTGE 2LPRA 2GCHG 4OGYA 5EQSA 4ABBA 4GHTA 2GCHF 4GUXA 5DKMA 3GY7A 1GI1A 1C5MD 3VB5A 3SU4A 5F8TA 1LHDH 1ZTLA 3SOSA 1C2EA 1Q31A 1C5LH 1ID5H 4NSVA 2BVRH 1EPTB 2WPMS 1H9IE 1PYTC 1N8OC 2XNIA 3PO1B 3D23A 1AE8H 4YT6H 3A7VA 1E37B 1GBHA 1P10A 3LC5A 1Y3WA 2A7CA 5EGMA 2SGDE 1S0QA 2G51A 4PROA 5E2PA 1ZGVA 1TAWA 1G36A 2G55A 1YPEH 2ANMH 2HOBA 4XOJA 1ZYOA 1XVOA 1GBTA 4XBCA 2A4QA 3F68H 3BEUA 4ESTE 3DFJA 3UNRA 2FOEA 5H4IB 2EEKA 3SUEA 4AG2A 2Z9KA 4MPUA 1IQJA 1T8NA 1MMJN 3ELAH 1PQ8A 3GOVB 3ZVCA 3GY3A 1PFXC 3SHCH 2VWOA 3BTHE 3UR9A 1WCZA 4U2WA 1MCTA 2A2QH 4GHQA 1DT2A 1DY8A 1O5GH 3SU5A 1ELCA 1IQHA 2BDBA 1O39A 2BOHB 2XW9A 2ILNA 1NU7B 1VR1H 1CQQA 1S6HA 1GI5A 3F9GA 1AO5A 2BX4A 1QJ7B 4X8SH 1SLVB 2Z9LA 3LGIA 1BRCE 1FN6A 3UQOA 1ZJKA 1GMCG 3PMHB 1MTNC 1QQUA 2GZ9A 1WU1A 1O34A 1GBIA 2AMDA 3E3TA 1EKBB 4FUIA 4MVNA 3M5NA 1IQEA 1O2IA 3JZ2B 2VWMA 4OS6A 3SQEE 4BTUB 1NFYA 3CENA 2FOHA 1EAXA 1ELVA 1RTKA 1MH0A 3PMAB 3IG6B 3RLWH 2GMTC 3RXLA 5A0BA 4UDWH 1LPZB 4FU9A 1V2LT 2QGRA 5A0CA 2Y7ZA 4O3TA 1C1QA 1HAYB 2ZPSA 2A32A 1W7XH 1QL9A 2D2DA 3TLOA 3P8GA 3ZZ3A 4I8KA 4INLA 4AZ2B 4X8VH 2ZCLP 1J14A 5L30H 5HM2A 1L1NA 1FY1A 2BVSH 2H5CA 2RG3A 3OSYA 1GMHG 4FUFA 5EXLA 1LCYA 1EZXC 1GMHF 2R2WU 1EB1H 5F8XA 1DDJA 1G3BA 3V7TA 1GCTC 5AFZH 4TWYA 4D7GA 1O33A 1AY6H 4DCDA 2C8XB 3KN2A 1P01A 2GZ7A 3KL6A 5FCKA 1GDUA 5C67A 4NIYA 3FP8E 1B0FA 3MU0A 2CHAB 2FWWA 1QBOA 3U8TH 2F9UA 4WXVA 4CBOA 1ESBA 4ABDA 1HAVA 2SGEE 3QUMP 1EATA 1OOKB 1W0ZU 3WY8A 5L2YH 2ANKH 1A0HB 1SGCA 4ISLA 1DPOA 3RC6A 1TFXA 4AORA 4AN7A 1FY8E 1ANCA 1GG6C 3CS0A 4AGJA 1SR5C 4E05H 1OP2A 4FUDA 1QRWA 3FVFB 1WUNH 1DWEH 1AD8H 4X1RU 4CHAB 1PJPA 2PHBA 2HPPH 3D65E 3GCTG 1HAOH 1SLWB 1ZOMA 3GCTF 3P95A 2V3HH 3EA8A 1QB6A 2WPIS 3URDA 1AUJA 2ZGJA 4Y76A 1EUFA 3MI4A 1GJ8B 1O36A 4M7GA 1O5EH 3VEQB 3SORA 1SGPE 1ESAA 2VH6A 4R8TB 1C4Y2 1L1GA 3ZZ4A 2SNVA 1QNJA 2ZKSA 1TA6A 2O9QA 1WQSA 1XKAC 2ZI2H 3RXIA 1BJUA 4OS1A 1Y5BT 3DA9B 1EP5A 4NZQA 4BAKB 4Y7AA 4UFFH 1VJ9U 3TJOA 4ZKSU 1OS8A 1UCYE 3A80A 2VIQA 3RXHA 2CXVA 2H5DA 1GVKB 2R2MB 4ISNA 4AYYB 1O2XA 3M3VA 1GBFA 1ZTJA 2PR3A 3PWCA 2CF9H 5T6DA 1HAXB 1NS3A 1QCPA 5JPMH 1O0DH 2FOMB 3UR6A 2Z6BD 1YPJH 3K6ZA 1QRZA 2HALA 1PQ7A 5C20A 2P59A 3U98H 1C1MA 2FTMA 1TA2A 2J34A 1YCPM 1C4V2 1Q3XA 3B23B 2XYAA 2FP7B 1P04A 5GXPA 1C2KA 3M37A 4ABHA 1G3DA 1O3AA 3BEFB 5F6MA 1L4DA 4A1XA 5EQRA 3PV4A 5JBTA 1BHXB 1C5PA 1JRTA 3SUDA 5C5NA 1EZQA 1PPCE 2ZGBH 3TVJB 2BY6X 4INKA 3SJKA 3LGVA 1QFKH 1C5WB 1EAWA 1QB9A 1JRSA 4D9RA 3TJNA 1C5XB 2PGQB 2VVVA 4X2WA 1O3IA 5EXNA 1O2SA 4IW4E 3L6PA 2JETC 3RUOA 1DANH 1SFQB 2JH0D 1J16A 2CF8H 4JCNA 1QHRB 5FPYA 1O2PA 1L1JA 3E6PH 1ESTA 3D62A 4LXBH 1FUJA 3PM3A 2XBVA 2PUXB 3MU5A 1GBLA 3CS7A 5EPYA 1C2JA 1JIRA 4NZLA 1BTYA 3EQ0H 1P03A 1C2HA 1BQYA 2HNTC 3OYPA 1QQ4A 3BTME 2PKSB 3GY8A 4Q2KA 1DSTA 2H6MA 1IQFA 1HXFH 2Q1JA 1AZZA 2Y5FA 1OYQA 3UOUA 1GI6A 2TGAA 1P3EA 3LKWA 1EJAA 2Z3EA 1U6QA 1ELEE 5E0JA 4AFQA 6ESTA 1K21H 1TNGA 1YCPK 1HPGA 3A81A 1BTUA 1V2WT 2F3CE 4CH8B 3MTYA 1ZPBA 1QTFA 1F5RA 1K9OE 2AFQB 1NU9A 4WWYA 4IS5A 1XXDA 2D8WA 3QK1A 3S69A 1C5NH 5JDUB 1F5KU 3SU2A 1YPMH 1BA8B 1AB9B 2STAE 4IC5A 3MHWU 3A7WA 1M9UA 2XBWA 3EA9A 3A8CA 2EI6A 1C2FA 2ZU5A 1L4ZA 5HXFA 3HK6B 1O3LA 1BBRE 2FMJA 3TIUA 3ODDA 2BD5A 3E1XB 1C5OH 1GDQA 4IGDA 3MH5A 2RA0A 1XM1A 5LGOA 1NRQH 1C1NA 1C5YB 1CU1A 3SBKA 5DK1A 4YOGA 3RDZA 1V2TT 1HJAC 3SJ8A 1SSXA 3RU4T 3SV9A 1VITH 2W26A 1P0SH 4TPYA 1MZAA 1HRTH 4NIXA 5C5OA 4CH2B 1O5AB 1GBJA 1N1LA 1DXWA 2OC0A 5EW1H 1OPHB 2AIPA 2P8OC 3M3TA 6LPRA 2VIOA 1JWTA 1F7ZA 3PTNA 1FNIA 1O5DH 3A7ZA 3KQCA 3QZQA 1S0RA 4R0IA 2BDIA 2ZFPH 3F9FA 2WYJA 1UCYH 3S7KB 1XUFA 1A0LA 1UVUH 4JMYA 2BY9X 2XCNA 4Y8ZA 1O2RA 1O3PB 3LONA 4MNYA 1V2RT 2BD3A 1J15A 2HPQH 5EQQA 1O3CA 4GSOA 2TRMA 3LJJA 4Y71A 4KTUA 1THSH 2ZIQH 3M36A 3SNBA 1LKAA 2CJIA 1K1NA 1LDTT 4AFUA 4UFGH 3SU0A 4DG4A 3SGBE 5LH8A 4I8LA 1SFIA 1CT0E 4UFDH 1SGYE 3ZZ6A 1UVPA 1SGFA 3EGKH 1E36B 1QB1A 1SQOA 2VU8E 5EW2H 5DP3A 4AFZA 2BY5X 3TNTA 2JH6D 4H6TA 2BM2A 3ZZAA 1TABE 3DT0H 7KMEH 4WH8A 5DP9A 4DGJA 4MG3A 5I46H 2ZTYA 5EODA 1GHXH 2F9PA 1ZMNA 4FUBA 2P93A 1RRKA 2BB4A 2SGQE 5DP8A 1BHXF 3BG4C 4TPIZ 4Y11E 3E16B 1CA0B 2PKAB 4A5TS 1WSSH 1HAPH 1GVZA 1MKXH 1GL1A 1O3JA 1O2VA 3KGPA 1GJ5H 2ZO3H 1BDAA 1D4PB 1EX3A 5PTPA 1AFEH 4CRDA 4D76A 1L0ZA 3T26A 3H7TA 1SGEE 1UTPA 4CRGA 2RCEA 4IN2A 3NPSA 1A2CH 1EJMA 1TGNA 2A31A 1DX5M 4MLFB 5CHAB 1Z71A 4MPXA 2XC0A 4CBNA 4IN1A 1DWCH 3ESTA 1WV7H 2EC9H 1Q2WA 1HDTH 4K1EA 3EA7A 2P16A 4FUHA 4ZAEA 3I78A 2HRVA 3FZDA 1G32B 4IBLH 4U30A 2G52A 1A3BH 2CV3A 2ZU4A 1OWHA 1KXEA 1ZHMA 2FEQH 2AGEX 3T28A 4DVAU 1HIAB 2EI8A 1NN6A 5K7RA 1NFUA 1TBQH 1FI8A 1O5CB 1QY6A 1SI5H 3F9HA 1E34B 3LH1A 3LPRA 3T27A 2ZPRA 1TRYA 2OC1A 1C4U2 1QA0A 2OC8A 1YPHC 2RA3A 2PFEA 4CRFA 1Y3YA 1RTFB 3PLKA 4GCHG 1MKWH 4NWKA 3SNCA 7GCHG 1TQ0B 2SFAA 1P8VC 3SU1A 4GCHF 7GCHF 1V2NT 8KME2 4ZMAH 1B7XB 1BMNH 1NRPH 1S5SA 3S0NA 2P3FH 3GYMA 1CA8B 4YTAA 2QF3A 3SW2B 3MYWA 5C3NA 5AF9H 2JH5D 1YYY1 3RMMH 2VWLA 1DLKB 2BQ6B 1SLUB 1K22H 1P05A 3KF2A 2ODPA 2Y7XA 1BBRH 1GI2A 1TNJA 8GCHG 1YGCH 3S9CA 8GCHF 1ZHRA 1D6WA 4XE4A 2GT8A 1LHFH 1NESE 2ZP0H 1P2JA 1DE7H 1BMAA 2DE8A 2VWNA 2XC5A 4KTCA 3ZYEA 1HFDA 1VGCB 2SGFE 1AWFH 2THFB 5F03A 2O8UA 3EAJA 1EPTC 1YBWA 1P2OA 3TITA 2A7HA 1GMDG 1P09A 2PKAA 1AKSB 2FOGA 5T6GA 3BF6H 1BRAA 1THPB 1QGFA 1GMDF 2A1DB 3PO1C 1GJAB 4DT7B 2ZU1A 3SO3A 1DUEA 1JOUB 1CVWH 2GV6A 1IQGA 4MDSA 4ABJA 3RXDA 1C5TA 3DUXH 1EQ9A 2GDDA 1OX1A 1P2KA 1ETTH 3ZVFA 1AHTH 2BXUH 4MPVA 1MBQA 3C27B 3KQBA 4Q80A 2P3TB 3BSQA 1UTJA 1SGIB 2HNTE 3NCLA 2V6NA 2ZQ2A 1TE0A 1O3FA 1GJCB 3SUFA 2XCFA 3RXOA 4NA8A 3VGCB 3O8RA 1G37A 1AGJA 1MU6B 1G2LA 3ENSB 3O8DA 1NY22 3GISB 1O31A 1Z8IB 1ZSLA 1KXAA 1W12U 2STBE 1S81A 1C2GA 1DITH 3V3MA 4JYVH 4E7NA 1SOTA 2BD8A 1MQ5A 1AVWA 2WYGA 1AMHA 3Q77A 4YLQH 1AU8A 4X8UH 2A0QB 1LTOA 1HAZB 1HIAA 2NU2E 1P12E 4Q7YA 3ATIA 3A83A 5CMXH 2B7DH 1QJ1B 4X2YA 1O32A 3CP7A 1C1SA 1GMCF 3LC3A 4OS7A 1IQIA 4I8HA 1TALA 3RXRA 1C5SA 1JXPA 4ZKOU 1BT7A 3PMJA 3TGKE 1IHSH 3STJA 1F0UA 3EYDA 5G4BA 2QF0A 3UNQA 3O8BA 2Y5GA 5LPEA 1P9UA 1PPBH 3M35A 1FY3A 3TH3H 2AERH 1TPOA 1MTNB 3PTBA 3ITIA 1YLDA 5J4SA 2WV4A 1FY4A 2OQUA 5DGJA 1OYTH 2FOBA 4X6OA 2C8YB 2B0FA 5JBCS 4NIWA 1MQ6A 1W14U 1GBCA 2VIWA 2ANWA 1PPFE 3SJOA 3UY9A 5JBBS 1LVYA 2Y6TA 1TB6H 1G30B 1GJ9B 4XSKU 4DIHH 2VVUA 4BXSA 1O5FH 2CHAC 1ZSKA 1C1UH 1MZDA 1EPTA 5IYTA 3ZVAA 3Q3YA 4U01A 2QXIA 1NPMA 1LVBA 1EP6A 2UUKB 1NT1A 4X1PU 2J92A 1RIWB 4ZKRU 3UOPA 2AH4X 3LGTA 1LMWB 3RXUA 2ZWLH 3QZRA 3TK9A 2BLQA 2ZECA 5LPRA 1Y5UT 2ZFQH 5DPAA 4X0WU 3LOXA 3P6ZB 4K1TA 2NU0E 4B1TA 3KHVA 2W5EA 2QY0B 2Q6FA 1FPHH 2BZ6H 2GCTB 1V2JT 1W0YH 3F1SB 1A4WH 4I32A 3RXKA 2BD2A 5GWZA 2Z9GA 1LQDB 3IWMA 3TJUA 5F8ZA 4X6MA 2QAAA 3BIUH 2ZPQA 1O2KA 3SNDA 1IQLA 3I29A 5E0GA 2ZCHP 2EI7A 3D49H 1Z8RA 2G4UA 1NTPA 1HV7A 5SGAE 3BTTE 1SHYA 3ZZCA 1Y8TA 3QLPH 4IMQA 1FONA 4LOYH 3P17H 1SGRE 1RGQA 1NRSH 2PTNA 1O3GA 2O8TA 4NSYA 4NCYA 3QN7A 2PW8H 3LIWA 2V35A 3RU4D 1F2SE 1ZLRA 3SI3H 1G2MA 4WMEA 3S9AA 1TGTA 2G81E 3A8AA 1HYLA 5E0HA 2ZG0H 1A61H 2ZU3A 3KIDU 4AFSA 2ZU2A 4A7IB 2A4RA 1FIWA 2GKVE 2IPHA 4VGCC 1AFQB 2AYWA 3UWJH 1SQAA 4CRAA 1BB0B 2FI4E 2Y81A 3FFGA 3GY6A 2DUCA 4K2YA 2FX4A 4JZFH 3U69H 1UTNA 1ANDA 3SUGA 4ZHLU 4ABIA 1D3QB 5EG4A 3MO6A 4F4OC 5FPTA 2QC2A 1D3PB 2H2ZA 4BOHA 2WPHS 4NFFA 2FS9A 4D7FA 9LPRA 4BAQB 4O3UA 1O2LA 3OX7U 4SGAE 4XBDA 5DP4A 5J4QA 5HM9A 1XX9A 2QV1A 3HGPA 1A3EH 4O9VA 1FIZA 3ZVDA 2TBSA 4K69A 3A7TA 4INHA 3E0NB 1HJ8A 3BV9B 3KEEA 3SJIA 3AAUA 3SGAE 1DXPA 1YPHE 1LHCH 1WQVH 5A8XA 1GGDB 3RXAA 3Q76A 2HWLB 1VCQA 2PLXA 1DOJA 3SV6A 4FUEA 4HGCA 2OXSA 4U32A 2F9OA 7LPRA 2ZTXA 4XBBA 2A2XH 1C5VA 5AHGH 4ZROA 3T2NA 1FPCH 4B75A 1G9IE 2FO9A 1FV9A 4FVDA 1TLDA 1YP9A 4MNVA 2D26C 3A88A 4ISHH 1YPKH 2PKSC 2A4GA 2JKHA 1NM6A 1MTUA 1KXDA 1T8OA 3LU9B 3RXSA 4DY7B 2QXJA 2A5AA 5AFYH 1MTSA 5ESBA 1Z7KA 2OBOA 1ACBE 1MU8B 2ULLA 1DS2E 1THRH 2VH0A 1SGDE 3GY2A 2G00A 1UTQA 5JYIA 1ELBA 1UO6A 3GCOA 4KGAA 4O03A 4E06H 4ZHMU 3MOCA 3TNSA 2A45B 1X7AC 7ESTE 5FBEA 1KLJH 2Y80A 4RN6A 3PB1E 1BTPA 2FXRA 4Y10E 3OTJE 3UREA 4HZHA 1YCPH 3SI4H 1AB9C 3ZVGA 1UJ1A 1FAKH 3UNSA 1GHWH 3UIRA 1WTGH 4GAWA 5E8EH 2P95A 1RJXB 3E90B 2YNBA 1TNLA 4BAOB 2ZGHA 1BITA 1K28D 3VFEA 2BQWB 3S7HB 1O3DA 1DY9A 1WBGB 3ZVBA 4JZ1A 1T8LA 3RM2H 2I6SA 1S83A 1E35B 1FN8A 1Z8JB 2SGPE 1V2UT 1PPHE 4BAHB 1RS0A 2PSXA 1CBWC 3SQHE 1BMMH 4NA7A 2RDLA 1W2KH 1F0TA 1TGBA 4X6NA 2A5IA 1HAIH 1V2ST 2BLWA 4Y6DA 1P2QA 3SZNA 1AVXA 2WV5A 3GICB 4NA9H 4Y8YA 5L2ZH 3STIA 2OQ5A 3NZIA 4I8JA 1BIOA 2OLGA 2ZHQH 3E0PB 3GYLB 3HATH 4NGAH 1SL3A 3LGUA 2EA3A 1AN1E 1BCUH 5EOKA 1W13U 4UE7H 2A4OA 1QIXB 2VIDA 8LPRA 1GBBA 1KXCA 1Y59T 1MBMA 2QYIA 2FLBH 5DP7A 3RXQA 4NWLA 2BTCE 2XWAA 1PQAA 5GIBA 1GI4A 1SB1H 4MNXA 2VJ1A 2ZDVH 1V2MT 1JMOH 1C2IA 1CGHA 4FU8A 2J38A 2BDCA 2R9PA 3MFJA 1H8IH 3ZZBA 3ZV9A 2Z3DA 1EB2A 3B8JA 3ZYDA 4F49A 3PYHA 3RXPA 1C2LA 4WXIA 1EASA 1VCWA 1PQ5A 4K8BA 5HGGA 1FXYA 1A5HA 4JYUH 1T8MA 2FOFA 5FPSA 3RM0H 1TMUH 1BZXE 4Z6AH 5HMAA 4BANB 3TJVA 3A85A 2BD7A 4BNRA 2H9TH 4HFPB 2D1JA 3H7OA 4MTBA 1K1LA 4WVPE 1GBAA 4ZXXH 5TCAA 2VIPA 1BTZA 3IITA 3P70B 4AGKA 1O3KA 3URCA 1ANEA 1KIGH 3T25A 1C2DA 3PROA 3ATMA 2AEIH 1ZRBA 1LPKB 1LQEA 1HJ9A 2GGVB 3M7QA 5B6OA 5L6NH 3BTEE 1FDPA 1K1OA 2F9BH 1CA0C 1TOCB 1UMAH 1O37A 1UTMA 1EXFA 4H6SB 1TPSA 1V2KT 1TPPA 1GL0E 4ABFA 5TJXA 3QTOH 1CGJE 1MKXK 1G3CA 2F83A 3UUZA 1P2NA 4DURA 4OS4A 3BG4B 3BEIB 3EDXB 1C5ZB 1TPAE 1KXFA 4O97A 2ODQA 1UK4A 2B8OH 1TNKA 3MO3A 1ELTA 3GCNA 3MWIU 5CHAC 1OXGA 4I7YH 2BY7X 2AIQA 3TH2H 1C1RA 1J9CH 4MQAA 1KDQB 4DW2U 1UK2A 4X1QU 5JB8S 1H4WA 2ZFTA 1Z1JA 1KY9A 3ZZ5A 1LVMA 1UTOA 2XWBI 1TQ7B 1TRMA 1YLCA 3SHAH 2UWLA 1UVSH 3QWCH 1GCDA 1V2PT 2NU1E 2J94A 1PPEE 4Y0ZE 3T62A 1GJDB 1GBDA 4X1SU 4GPGA 3VPKA 1UVOA 3E91A 1N6YA 1MUEB 4OS5A 1TGCA 2OC7A 2ZHDA 4FUCA 5C1XA 2VGCB 2ZHWH 1GPZA 1O2ZA 5EU8A 1DM4B 1ABIH 1GJ7B 2J9NA 2Z7FE 3NKKA 4ZKNU 1H9LB 1LKBA 3AVZA 3M5MA 4ZHAA 1UVTH 2C8WB 3RXTA 2F9VA 3NXPA 1DLEA 4JZIA 3RXMA 3A87A 3EE0B 2C3SA 2P94A 1AQ7A 3GCHB 1FAXA 3LDXH 2Q6DA 2R0KA 3RXJA 2FDAA 1KLTA 1EZUC 2BQ7B 2ZF0H 3RXGA 1PPGE 1YM0A 1AVGH 2ODYB 2UWPA 1W11U 1H9HE 1TRNA 1BTXA 2BMGB 3TU7H 1CSOE 4ZH8A 1BTWA 1F92A 1W3CA 1SGTA 2ALPA 1P57B 5DP5A 1ZMLA 1UTKA 1ZPZA 2NU3E 1AE5A 2W7SA 1MTWA 1LHGH 4ABGA 3V0XA 6CHAB 8ESTE 2B5TB 1NO9H 4WJG2 1VGCC 3BTWE 4QT8C 1MCVA 1GI8B 1EAIA 1C5UA 2BDYA 3AW0A 3I77A 1ZSJA 3C1KA 2XC4A 2QA9E 1KXBA 1A5IA 2H9HA 1QRXA 1GI7B 1T31A 1NC6A 2WUCA 2ZEBA 4CRCA 1PPZA 3A7YA 3LT3A 1GHAG 1HNEE 1O2JA 4X8TH 3M7TA 2HLCA 3Q3XA 1F0SA 1GHAF 4Y0YE 5FXLA 3HKJB 4WF8A 2V0BA 4AG1A 3Q00A 1NROH 1QJ6B 3RLYH 3RXCA 3AASA 1HAVB 1O2HA 1N8OB 2FZZA 2XXLA 1O30A 1K1PA 1OWKA 2KAIB 3NUMA 5I25A 1NZQH 1O3NA 4WMFA 3ATKA 1T32A 1TGSZ 2BDGA 4K8YA 1O2WA 2FODA 3VGCC 2O8LA 5GCHG 1SPJA 3RMNH 5GCHF 2WPJS 1KDQA 1ELDE 2QIQA 3TGIE 2ZFFH 3FP6E 3K2UA 5TCCA 1HCGA 1XUGA 3QX5H 4B2CA 1GI9B 5JBAS 1N6XA 5JB9S 1W10U 3P8OA 4I8GA 1O2MA 4DJZB 2C8ZB 3VB6A 4KTSA 3V13A 2NU4E 3K6YA 3RP2A 2SGAA 4ISIH 3U1JB 2VNTA 1TMBH 4IC6A 4JYTA 4CR5A 1XXFA 2Z9IA 1RD3B 3P92A 3ZZ8A 1SBWA 1CHOG 1BJVA 4FUGA 1CHOF 1ELFA 2Z3CA 3L3TA 2FYRA 1TONA 2YNAA 1TX8A 1HAGE 1EAUA 2VIVA 1P02A 4BTTB 4B74A 4UEHH 1VITG 4YOIA 3BN9A 4B76A 1VITF 3U8RH 3M5LA 1LVOA 4X2VA 5A2MH 3LGYA 1VCPA 3Q3KA 1KTTB 4YOJA 4BAMB 4GLYA 3H5CB 2ZDLA 1B0EA 2FX6A 1TX6A 3GY5A 4TYDA 2FOCA 1O3MA 2GV7A 3GDVA 4Q7ZA 1O2YA 3VXEH 1IQKA 5HYOA 1DICA 4K1SA 1BUIA 3MMGA 4LK4A 3ZZ9A 5GDSH 2UWOA 4I31A 2GMTB 3OY5U 4XDEA 4Y7BA 1CHGA 1XUKA 1NFWA 4TY7A 5ETXA 4ZXYH 2UUFB 3AW1A 4JZDH 4K5ZA 1P2MA 5DO4H 3KCGH 3S9BA 4ABAA 1DWBH 5A0AE 1FY5A 1Y3XA 3KNXA 3MU1A 4LZ1H 1ZZZA 4TWWA 2F91A 5FCRA 4B2BA 2P3UB 4B71A 1IOEA 6GCHG 1BRUP 1V2OT 3HKIB 6GCHF 3ZVEA 1GCTB 1Y3UA 1AKSA 2FLRH 3VB3A 1RIWC 3PLBA 1C5QA 2HGTH 1GVLA 3A84A 1MTVA 3MU4A 1BTHH 4AOQA 1DUAA 4HI3A 1IQNA 1QR3E 3A8DA 4OGXA 1OP8A 2XBYA 1TX7A 1TNHA 4UD9H 3UTUH 4CHAC 5BPEA 1O3HA 2KAIA 3ATLA 2OINA 2GCTC 4KELA 4Y8XA 5FAHA 3F6UH 3T5FH 1HBTH 2BX3A 2ESTE 2CMYA 1GG6B 4BTIB 3DFLA 2TIOA 5DJ7A 5LPFA 2CGAA 2O8MA 1HAHH 3JZ1B 3LJOA 2YOLA 1O2OA 1SLXB 5C1UA 5EXMA 1GBEA 2ZDKA 1TIOA 4ASHA 5DP6A 2LNCA 1TNIA 4YT7H 1K1IA 4JK6A 1RXPA 1K1MA 4FUJA 3SGQE 3GDUA 2J4IA 1Z1IA 3NWUA 2TGDA 2OCVB 4J1YA 3HPTB 2BDAA 5FX5A 4D9QA 1AUTC 1ARCA 3SV7A 3SV8A 1EZSC 1GHVH 1WAYB 2W3IA 2ZNKH 4J2YB 3U1IB 2PV9B 5A8YA 2K1QA 1CGIE 3QGJA 2WINI 5A8ZA 3ZZDA 3SJ9A 3A89A 3BG8A 2F9NA 1ABJH 5EPNA 1T4VH 1OP0A 1ZMJA 4YLUA 2BD4A 1ZHPA 4JZEH 2ASUB 2QXGA 1CE5A 1FQ3A 3MNXA 2M5TA 1SMFE 1DWDH 2SNWA 1P11E 3DD2H 1RFNA 1ORFA 3RMLH 4RSPA 1AFQC 1W7GH 2AGGX 4AX9H 2R3YA 3FZZA 3RXBA 1ELGA 3MNCA 1J8AA 2ZGXH 1W8BH 1BMLA 3SU3A 1O2TA 1A46H 1LHEH 1DVAH 4X6PA 1C1OA 2Y5HA 4NG9H 4H4FA 3TH4H 4VGCB 2GDEH 1IHTH 3LGWA 1ARBA 3MO9A 1XVMA 1H1BA 1INCA 1C5RA 2J2UA 3UQVA 1ZJDA 3VB4A 1IAUA 2ZQ1A 4JK5A 1PYTD 5C1YA 2BD9A 3K9XB 5DG6A 5A09A 2OP9A 2V3OH 1LO6A 3P8NA 1BRBE 1SOZA 5AVDA 2C93B 2OD3B 3A7XA 1NRNH 2J95A 1GGDC 1GBKA 1VJAU 1A7SA 1SQTA 2ZZUH 1GHBG 3K65B 1GHBF 3M5OA 3OY6U 2DE9A 1C1TA 1Z6EA 3QGNB 2Z9JA 2JETB 4A92A 2R3UA 4X1NU 4AB8A 3M3SA 1ZRKA 1UK3A 3U9AH 1P2IA 1GHZA 3RU4E 1TMTH 2W7UA 2Q6GA 2O8WA 2VINA 4AYVB 3W94A 2BLVA 4UONA 3HGNA 3GDSA 5BRRE 1V2QT 1MAXA 4DOQA 2AMQA 1AZ8A 1C9TA 3KQEA 1YF4A 2TGPZ 5FHTA 1AI8H 1UHBB 2W3KA 1D3DB 3QTVH 2H1UA 1S6FA 9ESTA 1OKXA 3ZZ7A 3TPIZ 1MD8A 2ZDAH 2PWXA 3RMOH 3W95A 1WYKA 1C1VH 4D8NA 1GJ6A 1ZGIA 2UUJB 1O5BB 1SVPA 3A8BA 4E7RG 1CT4E 1CT2E 1GI0A 1S84A 3TK5A 1T7CA 4A1TA 2VVCA 1Z8GA 1FMGA 1NRRH 2R0LA 3A82A 1LPGB 2A5KA 3BTFE 1FZZA 1O2QA 3HK3B 4FVBA 4B73A 1E0FD 2G5VA 3VXFH 1O35A 3SN8A 2FS8A 2IOTA 3RXEA 2GT7A 3ODFA 2BLOA 1XMNB 1E38B 3N7OA 1GDNA 3ATWA 1HXEH 2ANYA 2PSYA 1QURH 3OU0A 1K1JA 3MNSA 3T29A 4RKJB 1O2NA 4ZUHA 4BXWA 1J17T 1Z6JH 1H8DH 2C90B 4GVUA 1TWXB 1VZQH 1XKBC 2A7JA 5E2OA 2FIRH 1CBWB 1OWIA 2BOKA 1V3XA 2IJOB 1FLEE 1D3TB 1HJAB 2G4TA 1S82A 1SGNE 2TGTA 4K3JA 5K0HA 3AAVA 1MD7A 4SGBE 1QA7A 4MPWA 1EJNA 1HGTH 1MAYA 4TY6A 4UFEH 1ZPCA 1SGQE 2AS9A 1TYNA 3MH6A 1GJBB 3M7UA 2FTLE 2P8OB 1ETRH 1DSUA 3L33A 2ZHEH 3KQDA 2BDHA 2FYQA 1UCYK 2AMPA 3V12A 1QL7A 1TBRH 3VB7A 1YC0A 1WTHD 1XUJA 1D9IA 5GPIB 3UFAA 2Y82A 4I33A 4AB9A 1F5LA 3NK8A 3PMBB 4YO9A 5CE1A 1V6DA 4THNH 4Y79A 1V2VT 3PLPA 3U8OH 3P8FA 2FPZA 4FXGH 1FJSA 4HTCH 1B5GH 2C4FH 2OBQA 5T6FA 1NFXA 1O3OA 5T3HA 3RXVA 1KTSB 1UHBA 3BTQE 1SC8U 1C9PA 4WH6A 1TBZH 2ZGCA 3PWBA 3GY4A 4Q7XA 4YZUA 1C1PA 1SG8B 1T4UH 1G3EA 1OWEA 2VB0A 3TK6A 5C2ZA 3A86A 1UTLM 2ZFSA 2QN5T 4ISOA 1YPLH 1QL8A 4MNWA 2BVXH 3BTKE 1KSNA 4WMDA 1RTLA 1ZR0A 2GTBA 2ALVA 1O3EA 2GP9B 2H9EH 2OTVA 2ZDMA 3SNAA 2BYAX 4CRBA 1A5GH 1C2MA 2FESH 1JIMA 3ZV8A 2G5NA 2AGIX 2B9LA 1P3CA 2UUYA 1DFPA 5IDKA 1C1WH 2NWNA 3M61U 1ETSH 4KKDA 1JBUH 2XTTB 1CO7E 5GJ4B 2I6QA 3DHKH 1AWHB 2ZC9H 3RXFA 2GD4B 1QBNA 2WUBA 3R0FA 4YM9A 1GI3A 4Z0KA 4FU7A 2FI5E 2XRCA 3F9EA 2BZAA 1OSSA 2ZHFH 2ZA5A 1A1RA 1GHYH 1S85A 2BHGA 1WOFA 2IN2A 3SU6A 4DIIH 2GX4A 3MH4A 1HB0B 2OUAA 3QDZB 2QCYA 1O2UA 5FBIA 4ABEA 4YESB 1O38A 1EOJA 1YKTA 1Y3VA 2FOAA 1SHHB 3SV2H 4XFQA 2FM2A 2G8TA 1IQMA 5ABWA 1O2GH
chains in the Genus database with same CATH superfamily
2HVXA 2ZCKP 4A6LA 1HUTH 1GBMA 2VGCC 2IJD1 3O8CA 1EOLA 3FANA 2FI3E 4X2XA 3RC4A 2WPLS 1NBMD 4CREA 4LZ4B 3MH7A 3QO6A 3OFND 1GWAA 1ANBA 1A0JA 2HNTF 4RKOB 1OWJA 2XBXA 2TPIZ 1HLTH 1MKWK 1O3BA 3MU8A 2BY8X 5GNDA 3G01A 3GCHC 3F2GA 4A1VA 3LH3A 3FAOA 1SGFG 4KP0A 5C17A 2CN0H 2KCPA 1TOMH 2ZTZA 1H8HD 2WPKS 3B9FH 4B2AA 1XUIA 2ZDNA 4NFEA 2PUQH 5ESTE 3RC5A 1D6RA 4OS2A 3BIVH 1P9SA 1QBVH 3BTDE 4WY3A 2KZ4A 3E8LA 3MNBA 1K2I1 1XUHA 2PTCE 1BBRK 2PGBB 1BOQA 3SNEA 4IMZA 4CR9A 2QXHA 5FX6A 1GJ4H 1OWDA 2GVFA 3UPEA 6CHAC 1Y5AT 4K60A 1AIXH 1P06A 3TGJE 2ZFRH 1ELAA 2Z94A 4NIVA 2BXTH 3FP7E 2GZ8A 3R3GB 1F0RA 4H42U 5HIYA 1KLIH 1KYNA 1YPGH 3UWIA 1ZTKA 1L2EA 3BTGE 2LPRA 2GCHG 4OGYA 5EQSA 4ABBA 1FX0B 4GHTA 2GCHF 4GUXA 5DKMA 3GY7A 1GI1A 1C5MD 3VB5A 3SU4A 5F8TA 1LHDH 1ZTLA 3SOSA 1C2EA 1Q31A 2K8IA 1C5LH 1ID5H 4NSVA 3WWFA 2BVRH 1EPTB 2WPMS 1H9IE 1PYTC 1N8OC 2JDID 2V7QD 2XNIA 3PO1B 3D23A 1AE8H 4YT6H 3A7VA 1E37B 1GBHA 1P10A 3LC5A 1Y3WA 2A7CA 5EGMA 2SGDE 1S0QA 2G51A 4PROA 5E2PA 1ZGVA 1TAWA 1G36A 2G55A 4ACAA 1YPEH 2ANMH 3UB0A 2HOBA 4XOJA 1ZYOA 1XVOA 1GBTA 3PRDA 4XBCA 2A4QA 3F68H 3BEUA 4ESTE 3DFJA 3UNRA 2FOEA 5H4IB 2EEKA 3SUEA 3U28C 4AG2A 2Z9KA 4MPUA 1IQJA 1T8NA 1MMJN 3ELAH 1PQ8A 3GOVB 5EJZA 3ZVCA 3GY3A 1PFXC 3SHCH 2VWOA 3BTHE 3UR9A 1WCZA 4U2WA 1MCTA 2A2QH 4GHQA 1DT2A 1DY8A 1O5GH 3SU5A 1ELCA 1IQHA 2BDBA 1O39A 2BOHB 2XW9A 2ILNA 1NU7B 1VR1H 1CQQA 1S6HA 1GI5A 3F9GA 1AO5A 2BX4A 1QJ7B 4X8SH 1SLVB 2Z9LA 3LGIA 1BRCE 1FN6A 3UQOA 1ZJKA 1GMCG 3PMHB 1MTNC 1QQUA 2GZ9A 1WU1A 1O34A 1GBIA 2AMDA 3E3TA 1EKBB 4FUIA 4MVNA 3M5NA 1IQEA 1O2IA 3JZ2B 2VWMA 4OS6A 2AHME 3SQEE 4BTUB 1NFYA 3CENA 1VKYA 2FOHA 1EAXA 1ELVA 1RTKA 1MH0A 3PMAB 3IG6B 3RLWH 2GMTC 3RXLA 5A0BA 4UDWH 1LPZB 4FU9A 1KMHB 1V2LT 2QGRA 5A0CA 4Q63A 2Y7ZA 4O3TA 1C1QA 1HAYB 2ZPSA 2A32A 1W7XH 1QL9A 2D2DA 3TLOA 3P8GA 3ZZ3A 4I8KA 4INLA 4AZ2B 4X8VH 2ZCLP 1J14A 5L30H 5HM2A 1L1NA 1FY1A 2BVSH 2H5CA 2RG3A 3OSYA 1GMHG 4FUFA 5EXLA 1LCYA 1EZXC 1GMHF 2R2WU 1EB1H 5F8XA 1DDJA 1G3BA 3V7TA 1GCTC 1OHHD 4TWYA 5AFZH 4D7GA 1O33A 1AY6H 4DCDA 2C8XB 3KN2A 1P01A 2GZ7A 3KL6A 5FCKA 1GDUA 5C67A 4NIYA 3FP8E 1B0FA 3MU0A 2CHAB 2FWWA 1QBOA 3U8TH 2F9UA 4WXVA 4CBOA 1ESBA 4ABDA 1HAVA 2SGEE 3QUMP 1EATA 1OOKB 1W0ZU 3WY8A 5L2YH 5FL7D 2ANKH 1A0HB 1SGCA 4ISLA 1DPOA 3RC6A 1TFXA 4AORA 4AN7A 1FY8E 1ANCA 1GG6C 2KR7A 3CS0A 4AGJA 1SR5C 4E05H 1OP2A 4FUDA 1QRWA 5CDFE 3FVFB 1WUNH 1DWEH 1AD8H 4X1RU 4CHAB 1PJPA 2PHBA 2HPPH 3D65E 3GCTG 2YMSC 1HAOH 1SLWB 1ZOMA 3GCTF 3P95A 2V3HH 3EA8A 1QB6A 2WPIS 3URDA 1AUJA 2ZGJA 2LELA 4Y76A 1EUFA 3MI4A 1GJ8B 1O36A 4M7GA 1O5EH 3VEQB 3SORA 1SGPE 1ESAA 2VH6A 4R8TB 5T1VA 1C4Y2 1L1GA 3ZZ4A 2SNVA 1QNJA 2ZKSA 1TA6A 2O9QA 1WQSA 1XKAC 2ZI2H 3RXIA 1BJUA 4OS1A 1Y5BT 1YWUA 3DA9B 1EP5A 4NZQA 4BAKB 4Y7AA 4UFFH 1VJ9U 3TJOA 4ZKSU 1OS8A 1UCYE 3A80A 2VIQA 3RXHA 2CXVA 2KCAA 2H5DA 1GVKB 2R2MB 4ISNA 4AYYB 1O2XA 3M3VA 1GBFA 1ZTJA 2PR3A 3PWCA 2CF9H 5T6DA 1HAXB 1NS3A 1QCPA 5JPMH 1O0DH 2FOMB 3UR6A 2Z6BD 1YPJH 3K6ZA 1QRZA 2HALA 1PQ7A 5C20A 2P59A 3U98H 1C1MA 2FTMA 1TA2A 2J34A 1YCPM 1C4V2 3PRBA 1Q3XA 3B23B 2OK5A 2XYAA 2FP7B 1P04A 5GXPA 1C2KA 3M37A 4ABHA 1G3DA 1O3AA 3BEFB 5F6MA 1L4DA 4A1XA 5EQRA 3PV4A 5JBTA 1BHXB 1C5PA 1JRTA 3SUDA 5C94A 5C5NA 1EZQA 1PPCE 2ZGBH 3TVJB 2BY6X 4INKA 3SJKA 2IPQX 4AC9A 3LGVA 1QFKH 1C5WB 1EAWA 1QB9A 1JRSA 3KQ5A 4D9RA 3TJNA 1C5XB 2PGQB 2VVVA 4X2WA 1O3IA 5EXNA 1O2SA 4IW4E 3L6PA 2JETC 3RUOA 1DANH 1SFQB 2JH0D 1J16A 2CF8H 4JCNA 1QHRB 5FPYA 1O2PA 1L1JA 3E6PH 1ESTA 3D62A 3SZEA 5EIYA 4LXBH 1FUJA 3PM3A 2XBVA 2PUXB 3MU5A 1GBLA 3CS7A 5EPYA 1C2JA 1JIRA 4NZLA 1BTYA 3EQ0H 1P03A 1C2HA 3DSOA 1BQYA 2HNTC 3OYPA 1QQ4A 3BTME 2PKSB 3GY8A 4Q2KA 2L6OA 1DSTA 2H6MA 1IQFA 1HXFH 2Q1JA 1AZZA 2Y5FA 1OYQA 3UOUA 1GI6A 2TGAA 1P3EA 3LKWA 1EJAA 2Z3EA 1U6QA 1ELEE 5E0JA 4AFQA 2F43B 6ESTA 1K21H 1TNGA 4Z1MD 1YCPK 1HPGA 3A81A 2QE7D 1BTUA 1V2WT 2F3CE 4CH8B 3MTYA 1ZPBA 3WWBA 1QTFA 1F5RA 1K9OE 4OM9A 3EE7A 2AFQB 1NU9A 4WWYA 4IS5A 1XXDA 2D8WA 3QK1A 3S69A 1C5NH 5JDUB 1F5KU 3SU2A 1YPMH 1BA8B 1AB9B 2STAE 4IC5A 3MHWU 3A7WA 1M9UA 2XBWA 3EA9A 2M2AA 3A8CA 2EI6A 1C2FA 2K0QA 2ZU5A 1E1RD 1L4ZA 3DSPA 5HXFA 3HK6B 1O3LA 1BBRE 2FMJA 1WDIA 3TIUA 3ODDA 2BD5A 3E1XB 1C5OH 1GDQA 4IGDA 3MH5A 2RA0A 1XM1A 5LGOA 1NRQH 1C1NA 1C5YB 1CU1A 3SBKA 5DK1A 4YOGA 3RDZA 1V2TT 1HJAC 3SJ8A 1SSXA 3RU4T 3SV9A 1VITH 2W26A 1P0SH 4TPYA 1MZAA 1HRTH 4NIXA 5C5OA 4CH2B 1O5AB 2GJGA 1GBJA 1N1LA 3CNRA 1DXWA 2OC0A 5EW1H 1OPHB 2AIPA 2P8OC 3M3TA 6LPRA 2VIOA 1JWTA 1F7ZA 3PTNA 1FNIA 1O5DH 3A7ZA 3KQCA 3QZQA 3UAIC 1S0RA 4R0IA 2BDIA 2ZFPH 3F9FA 2WYJA 3PV5A 1UCYH 3S7KB 1XUFA 1A0LA 1UVUH 4JMYA 2BY9X 2XCNA 4Y8ZA 1O2RA 1O3PB 3LONA 4MNYA 1V2RT 2BD3A 1J15A 2HPQH 5EQQA 1O3CA 4GSOA 2TRMA 3LJJA 4Y71A 4KTUA 1THSH 2ZIQH 3M36A 3SNBA 1LKAA 2CJIA 1K1NA 1LDTT 4AFUA 4UFGH 3SU0A 4DG4A 3SGBE 3W1EA 5LH8A 4I8LA 1SFIA 1CT0E 4UFDH 1SGYE 3ZZ6A 1UVPA 1SGFA 3EGKH 1E36B 1QB1A 1SQOA 2VU8E 5EW2H 5DP3A 4AFZA 2BY5X 2KFWA 3TNTA 2JH6D 4H6TA 2BM2A 3ZZAA 1TABE 3DT0H 7KMEH 4WH8A 5DP9A 4DGJA 4MG3A 5I46H 2ZTYA 5EODA 1GHXH 2F9PA 1ZMNA 4FUBA 2P93A 1RRKA 2BB4A 2SGQE 5DP8A 1BHXF 3BG4C 4TPIZ 4Y11E 1SKYE 3E16B 1CA0B 2PKAB 4A5TS 1WSSH 1HAPH 1GVZA 1MKXH 1GL1A 1O3JA 1O2VA 3KGPA 3ZIAD 1GJ5H 2ZO3H 1BDAA 1D4PB 1EX3A 5PTPA 1AFEH 4CRDA 4D76A 1L0ZA 3T26A 3H7TA 1SGEE 1UTPA 4CRGA 2RCEA 4IN2A 3NPSA 1A2CH 1EJMA 1TGNA 2A31A 1DX5M 4MLFB 5CHAB 1Z71A 4MPXA 2XC0A 4CBNA 4IN1A 1DWCH 3ESTA 1WV7H 2EC9H 1Q2WA 1HDTH 4K1EA 3EA7A 2P16A 4FUHA 4ZAEA 3I78A 2HRVA 3FZDA 1G32B 4IBLH 4U30A 2G52A 1A3BH 2CV3A 2ZU4A 1OWHA 1KXEA 1ZHMA 2FEQH 2AGEX 3T28A 4DVAU 1HIAB 2EI8A 1NN6A 5K7RA 1NFUA 1TBQH 1FI8A 1O5CB 1QY6A 1SI5H 3F9HA 1E34B 3LH1A 3LPRA 3T27A 2ZPRA 1TRYA 2OC1A 1C4U2 1QA0A 2OC8A 1YPHC 2RA3A 2PFEA 4CRFA 1Y3YA 1RTFB 3PLKA 4GCHG 1MKWH 4NWKA 3SNCA 7GCHG 1TQ0B 2SFAA 1P8VC 3SU1A 4GCHF 7GCHF 1V2NT 8KME2 4ZMAH 1B7XB 1BMNH 1NRPH 1S5SA 3S0NA 1COWD 2P3FH 3GYMA 1CA8B 3OAAD 4YTAA 2QF3A 3SW2B 3MYWA 5C3NA 5AF9H 2JH5D 1YYY1 3RMMH 2VWLA 1DLKB 2BQ6B 1SLUB 1K22H 1P05A 3KF2A 2ODPA 2Y7XA 1BBRH 1GI2A 1TNJA 8GCHG 1YGCH 3S9CA 1S6LA 8GCHF 1ZHRA 1D6WA 4XE4A 2GT8A 1YY3A 1LHFH 2V3MA 1NESE 2ZP0H 1P2JA 1DE7H 3DSGA 1BMAA 2DE8A 2VWNA 2XC5A 4KTCA 3ZYEA 1HFDA 1VGCB 2SGFE 1AWFH 2THFB 5F03A 2O8UA 3EAJA 1EPTC 1YBWA 1P2OA 3TITA 2A7HA 1GMDG 1P09A 2PKAA 1AKSB 5HKKD 2FOGA 5T6GA 3BF6H 1BRAA 1THPB 1QGFA 1GMDF 2A1DB 3PO1C 1GJAB 4DT7B 2ZU1A 3SO3A 1DUEA 1JOUB 1CVWH 2GV6A 5C0UA 1IQGA 4MDSA 4ABJA 3RXDA 1C5TA 3DUXH 4RT1A 1EQ9A 2GDDA 1OX1A 1P2KA 1ETTH 1NBME 3ZVFA 1AHTH 2BXUH 4MPVA 2J5UA 1MBQA 3C27B 3KQBA 4Q80A 3F0OA 2P3TB 3BSQA 1UTJA 1SGIB 2HNTE 3NCLA 2V6NA 2ZQ2A 1TE0A 1O3FA 1GJCB 3SUFA 2XCFA 3RXOA 4NA8A 3VGCB 3O8RA 1G37A 1E79D 1AGJA 1MU6B 1G2LA 3ENSB 3O8DA 1NY22 3GISB 1O31A 1Z8IB 1ZSLA 1KXAA 1W12U 2STBE 1S81A 1C2GA 1DITH 3V3MA 4JYVH 4E7NA 1SOTA 5EJ1A 2BD8A 1MQ5A 1AVWA 2WYGA 1AMHA 3Q77A 4YLQH 1AU8A 4X8UH 2A0QB 1LTOA 1HAZB 1HIAA 2NU2E 1P12E 4Q7YA 3ATIA 3A83A 5CMXH 2B7DH 1QJ1B 4X2YA 1O32A 3CP7A 1C1SA 1GMCF 3LC3A 4OS7A 1IQIA 4YXWD 4I8HA 1TALA 3RXRA 1C5SA 1JXPA 4ZKOU 1BT7A 3PMJA 3TGKE 1IHSH 3STJA 1F0UA 3EYDA 5G4BA 1E1QD 2QF0A 3UNQA 3O8BA 2Y5GA 5LPEA 1P9UA 1PPBH 3M35A 1FY3A 3TH3H 2AERH 5KGOA 1TPOA 4F55A 1MTNB 3PTBA 3ITIA 1YLDA 5J4SA 2WV4A 1FY4A 2OQUA 5DGJA 1OYTH 2FOBA 4X6OA 2C8YB 2B0FA 5JBCS 4NIWA 1MQ6A 1W14U 1GBCA 2VIWA 2ANWA 1PPFE 3SJOA 3UY9A 5JBBS 1LVYA 2Y6TA 1TB6H 4I86A 1G30B 1GJ9B 4XSKU 4DIHH 3F0PA 2VVUA 4BXSA 1O5FH 2CHAC 1ZSKA 1C1UH 1MZDA 1EPTA 5IYTA 3ZVAA 3Q3YA 4U01A 3FO8D 2QXIA 1NPMA 1LVBA 1EP6A 2UUKB 1NT1A 4X1PU 2J92A 1RIWB 4ZKRU 3UOPA 2AH4X 4DT4A 3LGTA 1LMWB 3RXUA 2ZWLH 3QZRA 3TK9A 2BLQA 2ZECA 5LPRA 1Y5UT 2ZFQH 5DPAA 4X0WU 3LOXA 3P6ZB 4K1TA 3VG8A 2NU0E 4B1TA 3KHVA 2W5EA 2QY0B 2Q6FA 1FPHH 2BZ6H 2GCTB 1V2JT 1W0YH 3F1SB 1A4WH 4I32A 3RXKA 2BD2A 5GWZA 2Z9GA 1LQDB 3IWMA 3TJUA 4ASUD 5F8ZA 4X6MA 2QAAA 3BIUH 2ZPQA 1O2KA 3SNDA 1IQLA 3I29A 5E0GA 2ZCHP 2EI7A 3D49H 1Z8RA 2G4UA 1NTPA 1HV7A 5SGAE 3BTTE 1SHYA 3ZZCA 1Y8TA 3QLPH 4IMQA 1FONA 4LOYH 3P17H 1SGRE 1RGQA 1NRSH 2PTNA 1O3GA 2O8TA 4NSYA 4NCYA 3QN7A 2PW8H 3LIWA 2V35A 3RU4D 1F2SE 1ZLRA 3SI3H 1G2MA 4WMEA 3S9AA 1TGTA 2G81E 3A8AA 1HYLA 5E0HA 2ZG0H 1A61H 2ZU3A 3KIDU 4AFSA 2ZU2A 4A7IB 2A4RA 1FIWA 2GKVE 2IPHA 4VGCC 1AFQB 2AYWA 3UWJH 1SQAA 4CRAA 1BB0B 2FI4E 2Y81A 3FFGA 3GY6A 2DUCA 4K2YA 2FX4A 4JZFH 3U69H 1UTNA 1ANDA 3SUGA 4ZHLU 4ABIA 1D3QB 5EG4A 3MO6A 4F4OC 5FPTA 2QC2A 1D3PB 2H2ZA 4BOHA 2WPHS 4NFFA 2FS9A 4D7FA 9LPRA 4BAQB 4O3UA 1O2LA 3OX7U 4SGAE 4XBDA 4Q4LA 5DP4A 5J4QA 5HM9A 1XX9A 2QV1A 3HGPA 1A3EH 4O9VA 1FIZA 3ZVDA 2TBSA 4K69A 3A7TA 4INHA 3E0NB 1HJ8A 3BV9B 3KEEA 3SJIA 3AAUA 2EQNA 3SGAE 1DXPA 1YPHE 1LHCH 1WQVH 5A8XA 1GGDB 3RXAA 3Q76A 2HWLB 1VCQA 2PLXA 1DOJA 3SV6A 1QZ8A 4FUEA 4HGCA 2OXSA 4U32A 2F9OA 7LPRA 2ZTXA 4XBBA 2A2XH 1C5VA 5AHGH 4ZROA 3T2NA 1FPCH 4B75A 1G9IE 2FO9A 1FV9A 4FVDA 1TLDA 1YP9A 4MNVA 4ACBA 2D26C 3OTPA 3A88A 4ISHH 1YPKH 2PKSC 2A4GA 2JKHA 1NM6A 1MTUA 1KXDA 1T8OA 3LU9B 2JIZD 3RXSA 4DY7B 2QXJA 2A5AA 5AFYH 1MTSA 5ESBA 1Z7KA 2OBOA 1ACBE 1MU8B 4RT0A 2ULLA 1DS2E 1THRH 2VH0A 1SGDE 3GY2A 2G00A 1UTQA 5JYIA 1ELBA 1UO6A 3GCOA 4KGAA 4O03A 4E06H 4ZHMU 3MOCA 3TNSA 2A45B 1X7AC 7ESTE 5EJLA 5FBEA 1KLJH 2Y80A 4RN6A 3PB1E 1BTPA 2FXRA 4Y10E 3OTJE 3UREA 4HZHA 1YCPH 3SI4H 1AB9C 3ZVGA 1UJ1A 1FAKH 3UNSA 1GHWH 3UIRA 1WTGH 4GAWA 5E8EH 2P95A 1RJXB 3E90B 2YNBA 1TNLA 4BAOB 2ZGHA 1BITA 1K28D 3VFEA 2BQWB 3S7HB 1O3DA 1DY9A 1WBGB 3ZVBA 4JZ1A 1T8LA 3RM2H 2L74A 2I6SA 1S83A 1E35B 1FN8A 1Z8JB 2SGPE 1V2UT 1PPHE 5DSFA 4BAHB 1RS0A 2PSXA 1CBWC 3SQHE 1BMMH 4NA7A 2RDLA 4B6EA 1W2KH 1F0TA 1TGBA 4X6NA 2A5IA 1HAIH 1V2ST 2BLWA 4Y6DA 1P2QA 3SZNA 1AVXA 2WV5A 3GICB 4NA9H 4Y8YA 5L2ZH 3STIA 2OQ5A 3NZIA 4I8JA 2PP6A 1H8ED 1BIOA 2OLGA 2ZHQH 3E0PB 3GYLB 3HATH 4NGAH 1SL3A 3LGUA 2EA3A 1AN1E 1BCUH 5EOKA 1W13U 2WPDD 4UE7H 2KCYA 2A4OA 1QIXB 3FN8A 2VIDA 8LPRA 1GBBA 1KXCA 1Y59T 1MBMA 2QYIA 2FLBH 5DP7A 3RXQA 4NWLA 2BTCE 2XWAA 1PQAA 5GIBA 1GI4A 3KYGA 1SB1H 4MNXA 2VJ1A 2ZDVH 1V2MT 1JMOH 1C2IA 1CGHA 4FU8A 2J38A 2BDCA 2R9PA 3MFJA 1H8IH 3ZZBA 3ZV9A 2W6JD 2Z3DA 1EB2A 3B8JA 3ZYDA 4F49A 3PYHA 3RXPA 2J98B 1C2LA 4WXIA 1EASA 1VCWA 1PQ5A 4K8BA 5HGGA 1FXYA 1A5HA 4JYUH 1T8MA 2FOFA 5FPSA 3RM0H 1TMUH 1BZXE 4Z6AH 5HMAA 4BANB 3TJVA 3A85A 2BD7A 4BNRA 2H9TH 4HFPB 2D1JA 3H7OA 4MTBA 1K1LA 4WVPE 1GBAA 4ZXXH 5TCAA 5B6LA 2VIPA 1BTZA 3IITA 3P70B 4AGKA 1O3KA 3URCA 1ANEA 1KIGH 3T25A 1C2DA 3PROA 3ATMA 2AEIH 5C0TA 1ZRBA 4FETA 1LPKB 1LQEA 1HJ9A 2GGVB 3M7QA 5B6OA 5L6NH 3BTEE 1FDPA 1K1OA 2F9BH 1CA0C 1TOCB 1UMAH 1O37A 1UTMA 1EXFA 4H6SB 1TPSA 1V2KT 1TPPA 1GL0E 4ABFA 5TJXA 3QTOH 1CGJE 1MKXK 1G3CA 2F83A 3SYJA 3UUZA 1P2NA 4DURA 4OS4A 3BG4B 3BEIB 3EDXB 1C5ZB 1TPAE 1KXFA 4O97A 4B6FA 2ODQA 1UK4A 2B8OH 1TNKA 3MO3A 1ELTA 3GCNA 3MWIU 5CHAC 1OXGA 4I7YH 2BY7X 2AIQA 3TH2H 1C1RA 1J9CH 4MQAA 1KDQB 4DW2U 1UK2A 4X1QU 2RFKC 5JB8S 1H4WA 2ZFTA 1Z1JA 1KY9A 3ZZ5A 1LVMA 1UTOA 2XWBI 1TQ7B 1TRMA 1YLCA 3SHAH 3FOAA 2UWLA 1UVSH 3QWCH 1GCDA 1V2PT 2NU1E 2J94A 1PPEE 4Y0ZE 3T62A 1GJDB 3WW7A 1GBDA 4X1SU 4GPGA 3VPKA 1UVOA 3E91A 1N6YA 1MUEB 4OS5A 1TGCA 2OC7A 2ZHDA 4FUCA 5C1XA 3F2FA 4XD7D 2VGCB 2ZHWH 1GPZA 1O2ZA 5EU8A 1DM4B 1ABIH 1GJ7B 2J9NA 2Z7FE 3NKKA 4ZKNU 1H9LB 1LKBA 3AVZA 3M5MA 4ZHAA 1UVTH 2C8WB 3RXTA 2F9VA 3NXPA 1DLEA 4JZIA 3RXMA 3A87A 3EE0B 5F53A 2C3SA 2P94A 1AQ7A 3GCHB 1FAXA 3LDXH 2Q6DA 2R0KA 3RXJA 2WZQA 2FDAA 1KLTA 1EZUC 2BQ7B 2ZF0H 3RXGA 1PPGE 1YM0A 1AVGH 2ODYB 2UWPA 1W11U 1H9HE 1TRNA 1BTXA 1BMFD 3OEED 2BMGB 2J98A 1CSOE 3TU7H 4ZH8A 4FOUC 1BTWA 1F92A 1W3CA 2CK3D 1SGTA 2ALPA 1P57B 5DP5A 1ZMLA 1UTKA 1ZPZA 2NU3E 1AE5A 2W7SA 1MTWA 1LHGH 4ABGA 3V0XA 6CHAB 8ESTE 2B5TB 1NO9H 4WJG2 2VBCA 1VGCC 3BTWE 4QT8C 1MCVA 1GI8B 1EAIA 1C5UA 2BDYA 3AW0A 3I77A 3PV2A 1ZSJA 3C1KA 2XC4A 2QA9E 1KXBA 1A5IA 2H9HA 1QRXA 1GI7B 1T31A 1NC6A 2WUCA 2ZEBA 4CRCA 1PPZA 3A7YA 3LT3A 1GHAG 1HNEE 1O2JA 4X8TH 3M7TA 2HLCA 3Q3XA 1F0SA 1GHAF 4Y0YE 5FXLA 3HKJB 4WF8A 2V0BA 4AG1A 3Q00A 1NROH 1QJ6B 3RLYH 3RXCA 3AASA 1HAVB 1O2HA 1N8OB 1K0HA 2FZZA 2XXLA 1O30A 1K1PA 1OWKA 2KAIB 3NUMA 5I25A 1NZQH 2JJ2D 2KM0A 1O3NA 4WMFA 3ATKA 1T32A 1TGSZ 2BDGA 4K8YA 1O2WA 2FODA 3VGCC 2O8LA 5GCHG 1SPJA 3RMNH 5GCHF 2WPJS 1KDQA 1ELDE 2QIQA 3KYFA 2ZFFH 3FP6E 3K2UA 5TCCA 3TGIE 1HCGA 1XUGA 3QX5H 4B2CA 1GI9B 2JJ1D 5JBAS 1N6XA 5JB9S 1W10U 3P8OA 4I8GA 1O2MA 4DJZB 2C8ZB 3VB6A 4KTSA 3OE7D 2NU4E 3K6YA 3RP2A 3V13A 2SGAA 4ISIH 3U1JB 2VNTA 1TMBH 4IC6A 4JYTA 4CR5A 1XXFA 2Z9IA 1RD3B 3P92A 3ZZ8A 1SBWA 1CHOG 1BJVA 4FUGA 1CHOF 1ELFA 2Z3CA 3L3TA 2FYRA 1TONA 2YNAA 1TX8A 1HAGE 1EAUA 2VIVA 1P02A 4BTTB 4B74A 4UEHH 1VITG 4YOIA 3BN9A 4B76A 3N7DA 1UW7A 1VITF 3U8RH 3M5LA 1LVOA 4X2VA 5A2MH 1W0KD 3LGYA 1VCPA 3Q3KA 1KTTB 4YOJA 3AK5A 4BAMB 1W0JD 4GLYA 2QF5A 3H5CB 2ZDLA 1B0EA 2FX6A 1TX6A 3GY5A 4TYDA 2FOCA 1O3MA 2GV7A 3GDVA 4Q7ZA 1O2YA 2WV9A 3VXEH 1IQKA 3GS9A 1DICA 5HYOA 4K1SA 1BUIA 3MMGA 4LK4A 2HLDD 3ZZ9A 5GDSH 2UWOA 4I31A 4ZCNA 2GMTB 3OY5U 4XDEA 4Y7BA 1CHGA 3DCLA 2WSSD 1XUKA 1NFWA 4TY7A 5ETXA 4ZXYH 2UUFB 3AW1A 4JZDH 4K5ZA 1P2MA 5DO4H 3KCGH 3S9BA 4ABAA 1DWBH 5A0AE 1FY5A 1Y3XA 3KNXA 3MU1A 4LZ1H 1ZZZA 4TWWA 2F91A 5FCRA 4B2BA 2P3UB 4B71A 1IOEA 6GCHG 1BRUP 5HIZA 1V2OT 3HKIB 6GCHF 3ZVEA 1GCTB 1Y3UA 1AKSA 2FLRH 3VB3A 1RIWC 3PLBA 1C5QA 2HGTH 1GVLA 4TT3D 3A84A 1MTVA 3MU4A 1BTHH 4AOQA 1DUAA 4HI3A 1IQNA 1QR3E 3A8DA 4OGXA 1OP8A 2XBYA 1TX7A 1TNHA 4UD9H 3UTUH 4CHAC 5BPEA 1O3HA 2KAIA 3ATLA 2OINA 2GCTC 4KELA 2WHXA 4Y8XA 5FAHA 3F6UH 3T5FH 1HBTH 5KEDA 2BX3A 2ESTE 2CMYA 1GG6B 4BTIB 3DFLA 2TIOA 2J97A 5DJ7A 2KX4A 5LPFA 2CGAA 2O8MA 1HAHH 3JZ1B 3LJOA 2YOLA 1O2OA 1SLXB 5C1UA 5EXMA 1GBEA 2ZDKA 1TIOA 4ASHA 5DP6A 2LNCA 1TNIA 2YMSB 4YT7H 1K1IA 4JK6A 1RXPA 4RI0A 1K1MA 4FUJA 3SGQE 3GDUA 2J4IA 1Z1IA 3NWUA 2TGDA 2OCVB 4J1YA 3HPTB 2BDAA 5FX5A 4D9QA 1AUTC 1ARCA 3SV7A 3SV8A 1EZSC 1GHVH 1WAYB 2W3IA 2ZNKH 4J2YB 3U1IB 2PV9B 5A8YA 2K1QA 1CGIE 3QGJA 2WINI 4HG6A 5A8ZA 3ZZDA 3SJ9A 3A89A 3BG8A 2F9NA 1ABJH 5EPNA 1T4VH 1OP0A 1ZMJA 4YLUA 2BD4A 1ZHPA 4JZEH 2ASUB 2QXGA 1CE5A 1FQ3A 3MNXA 2M5TA 1SMFE 1DWDH 2SNWA 1P11E 3DD2H 1RFNA 1ORFA 3RMLH 4RSPA 1AFQC 1W7GH 2AGGX 4AX9H 2R3YA 3FZZA 3RXBA 1ELGA 3MNCA 1J8AA 2ZGXH 1W8BH 1BMLA 3SU3A 1O2TA 1A46H 1LHEH 1DVAH 2LP6A 4X6PA 1C1OA 2Y5HA 4NG9H 4H4FA 3TH4H 4VGCB 2GDEH 1IHTH 3LGWA 1ARBA 3MO9A 1XVMA 1H1BA 1INCA 1C5RA 2J2UA 3F3BA 4P02A 3UQVA 1ZJDA 3VB4A 1IAUA 2ZQ1A 4JK5A 1PYTD 5C1YA 2BD9A 3K9XB 5DG6A 5A09A 2OP9A 2V3OH 1LO6A 3P8NA 1BRBE 1SOZA 5AVDA 2C93B 2OD3B 3A7XA 1NRNH 2J95A 5DN6D 1GGDC 1GBKA 1VJAU 1A7SA 1SQTA 2ZZUH 1GHBG 3K65B 1GHBF 3M5OA 3OY6U 2DE9A 1C1TA 1Z6EA 3QGNB 2HVYB 1YLNA 2Z9JA 2JETB 4A92A 2R3UA 3MQKC 4X1NU 4AB8A 4F48B 3M3SA 1ZRKA 1UK3A 3U9AH 5KECA 1P2IA 1GHZA 3RU4E 1TMTH 2W7UA 2Q6GA 2O8WA 2VINA 4AYVB 3W94A 2BLVA 4UONA 3HGNA 3GDSA 5BRRE 1V2QT 1MAXA 4DOQA 2AMQA 1AZ8A 1C9TA 3KQEA 1EFRD 1YF4A 2EY4C 2TGPZ 5FHTA 1AI8H 1UHBB 2W3KA 1D3DB 3QTVH 2H1UA 1S6FA 9ESTA 1OKXA 3ZZ7A 3TPIZ 1MD8A 2ZDAH 2PWXA 3RMOH 3W95A 1WYKA 1C1VH 4D8NA 1GJ6A 1ZGIA 2UUJB 1O5BB 1SVPA 3A8BA 4E7RG 1CT4E 1CT2E 1GI0A 1S84A 3TK5A 1T7CA 4A1TA 2VVCA 1Z8GA 1FMGA 1NRRH 2R0LA 3A82A 1LPGB 2A5KA 1SQRA 3H09A 3BTFE 2KCOA 1FZZA 1O2QA 3HK3B 4FVBA 4XRNA 4B73A 1E0FD 2G5VA 3VXFH 3N7EA 1O35A 3SN8A 2FS8A 2IOTA 3RXEA 2GT7A 3ODFA 2BLOA 1XMNB 1E38B 3N7OA 1GDNA 3ATWA 1HXEH 2ANYA 2PSYA 1QURH 3OU0A 3F2HA 1K1JA 3MNSA 4P00A 3T29A 4RKJB 1O2NA 4ZUHA 4BXWA 4M9FA 1J17T 1Z6JH 1H8DH 2C90B 4GVUA 1TWXB 1VZQH 1XKBC 5IK2D 2A7JA 5E2OA 2FIRH 1CBWB 1OWIA 2W6ID 2BOKA 2XNDD 1V3XA 2IJOB 1FLEE 1D3TB 1HJAB 1MABB 2G4TA 1S82A 3FKSD 1SGNE 2TGTA 4K3JA 5K0HA 3AAVA 1MD7A 4SGBE 1QA7A 4MPWA 1EJNA 1HGTH 1MAYA 4TY6A 4UFEH 1ZPCA 1SGQE 2AS9A 3N99A 2YMSD 1TYNA 3MH6A 1GJBB 3M7UA 2FTLE 1ETRH 1DSUA 2P8OB 3L33A 2ZHEH 3KQDA 2BDHA 2FYQA 1UCYK 2AMPA 3V12A 1QL7A 1TBRH 3VB7A 1YC0A 1WTHD 1XUJA 1D9IA 5GPIB 3UFAA 2Y82A 4I33A 4AB9A 1F5LA 3NK8A 3PMBB 3NRLA 4YO9A 5CE1A 1V6DA 4THNH 4Y79A 1V2VT 3PLPA 3U8OH 3P8FA 2FPZA 4FXGH 1FJSA 4HTCH 1B5GH 2C4FH 2OBQA 5T6FA 1NFXA 1O3OA 5T3HA 3RXVA 1KTSB 1UHBA 3BTQE 1SC8U 1C9PA 4WH6A 1TBZH 2ZGCA 3PWBA 3GY4A 5CHBA 4Q7XA 4YZUA 1C1PA 1SG8B 1T4UH 1G3EA 1OWEA 2VB0A 3TK6A 5C2ZA 3A86A 1UTLM 2ZFSA 2QN5T 4ISOA 1YPLH 1QL8A 4MNWA 2BVXH 3BTKE 1KSNA 4WMDA 1RTLA 1ZR0A 2GTBA 2ALVA 1O3EA 2GP9B 2H9EH 2OTVA 2ZDMA 3SNAA 2BYAX 4CRBA 1A5GH 1C2MA 2FESH 1JIMA 3ZV8A 2RDEA 2G5NA 2AGIX 2B9LA 1P3CA 2UUYA 1DFPA 5IDKA 1C1WH 2NWNA 3M61U 1ETSH 4KKDA 1JBUH 2XTTB 1CO7E 5GJ4B 2I6QA 3DHKH 1AWHB 2ZC9H 3RXFA 2GD4B 1QBNA 2WUBA 3R0FA 4YM9A 1GI3A 4Z0KA 4FU7A 2FI5E 2XRCA 3F9EA 2BZAA 1OSSA 2ZHFH 2ZA5A 1A1RA 1GHYH 1S85A 2BHGA 1WOFA 2IN2A 3OEHD 4TSFD 3SU6A 4DIIH 2GX4A 3MH4A 1HB0B 2OUAA 3QDZB 2QCYA 1O2UA 5FBIA 4ABEA 4YESB 1O38A 1EOJA 1WXRA 1YKTA 1Y3VA 2FOAA 2XOKD 1SHHB 3SV2H 2QF4A 2FM2A 2G8TA 4XFQA 1IQMA 2F4LA 5ABWA 1O2GH
chains in the Genus database with same CATH topology
2HVXA 2ZCKP 4A6LA 1HUTH 1GBMA 2VGCC 3O8CA 1EOLA 3FANA 2FI3E 4X2XA 3RC4A 2WPLS 4CREA 4LZ4B 3MH7A 3QO6A 1GWAA 1ANBA 1A0JA 2HNTF 4RKOB 1OWJA 2XBXA 2TPIZ 1HLTH 1MKWK 1O3BA 3MU8A 2BY8X 3G01A 3GCHC 4A1VA 3LH3A 3FAOA 1SGFG 4KP0A 2CN0H 1TOMH 2ZTZA 2WPKS 3B9FH 4B2AA 1XUIA 2ZDNA 4NFEA 2PUQH 5ESTE 3RC5A 1D6RA 4OS2A 3BIVH 1P9SA 1QBVH 3BTDE 4WY3A 3E8LA 3MNBA 1K2I1 1XUHA 2PTCE 1BBRK 2PGBB 1BOQA 3SNEA 4IMZA 4CR9A 2QXHA 5FX6A 1GJ4H 1OWDA 2GVFA 3UPEA 6CHAC 1Y5AT 4K60A 1AIXH 1P06A 3TGJE 2ZFRH 1ELAA 2Z94A 4NIVA 2BXTH 3FP7E 2GZ8A 3R3GB 1F0RA 4H42U 1KLIH 1KYNA 1YPGH 3UWIA 1ZTKA 1L2EA 3BTGE 2LPRA 2GCHG 4OGYA 5EQSA 4ABBA 4GHTA 2GCHF 4GUXA 5DKMA 3GY7A 1GI1A 1C5MD 3VB5A 3SU4A 5F8TA 1LHDH 1ZTLA 3SOSA 1C2EA 1Q31A 1C5LH 1ID5H 4NSVA 2BVRH 1EPTB 2WPMS 1H9IE 1PYTC 1N8OC 2XNIA 3PO1B 3D23A 1AE8H 4YT6H 3A7VA 1E37B 1GBHA 1P10A 3LC5A 1Y3WA 2A7CA 5EGMA 2SGDE 1S0QA 2G51A 4PROA 5E2PA 1ZGVA 1TAWA 1G36A 2G55A 1YPEH 2ANMH 2HOBA 4XOJA 1ZYOA 1XVOA 1GBTA 4XBCA 2A4QA 3F68H 3BEUA 4ESTE 3DFJA 3UNRA 2FOEA 5H4IB 2EEKA 3SUEA 4AG2A 2Z9KA 4MPUA 1IQJA 1T8NA 1MMJN 3ELAH 1PQ8A 3GOVB 3ZVCA 3GY3A 1PFXC 3SHCH 2VWOA 3BTHE 3UR9A 1WCZA 4U2WA 1MCTA 2A2QH 4GHQA 1DT2A 1DY8A 1O5GH 3SU5A 1ELCA 1IQHA 2BDBA 1O39A 2BOHB 2XW9A 2ILNA 1NU7B 1VR1H 1CQQA 1S6HA 1GI5A 3F9GA 1AO5A 2BX4A 1QJ7B 4X8SH 1SLVB 2Z9LA 3LGIA 1BRCE 1FN6A 3UQOA 1ZJKA 1GMCG 3PMHB 1MTNC 1QQUA 2GZ9A 1WU1A 1O34A 1GBIA 2AMDA 3E3TA 1EKBB 4FUIA 4MVNA 3M5NA 1IQEA 1O2IA 3JZ2B 2VWMA 4OS6A 3SQEE 4BTUB 1NFYA 3CENA 2FOHA 1EAXA 1ELVA 1RTKA 1MH0A 3PMAB 3IG6B 3RLWH 2GMTC 3RXLA 5A0BA 4UDWH 1LPZB 4FU9A 1V2LT 2QGRA 5A0CA 2Y7ZA 4O3TA 1C1QA 1HAYB 2ZPSA 2A32A 1W7XH 1QL9A 2D2DA 3TLOA 3P8GA 3ZZ3A 4I8KA 4INLA 4AZ2B 4X8VH 2ZCLP 1J14A 5L30H 5HM2A 1L1NA 1FY1A 2BVSH 2H5CA 2RG3A 3OSYA 1GMHG 4FUFA 5EXLA 1LCYA 1EZXC 1GMHF 2R2WU 1EB1H 5F8XA 1DDJA 1G3BA 3V7TA 1GCTC 5AFZH 4TWYA 4D7GA 1O33A 1AY6H 4DCDA 2C8XB 3KN2A 1P01A 2GZ7A 3KL6A 5FCKA 1GDUA 5C67A 4NIYA 3FP8E 1B0FA 3MU0A 2CHAB 2FWWA 1QBOA 3U8TH 2F9UA 4WXVA 4CBOA 1ESBA 4ABDA 1HAVA 2SGEE 3QUMP 1EATA 1OOKB 1W0ZU 3WY8A 5L2YH 2ANKH 1A0HB 1SGCA 4ISLA 1DPOA 3RC6A 1TFXA 4AORA 4AN7A 1FY8E 1ANCA 1GG6C 3CS0A 4AGJA 1SR5C 4E05H 1OP2A 4FUDA 1QRWA 3FVFB 1WUNH 1DWEH 1AD8H 4X1RU 4CHAB 1PJPA 2PHBA 2HPPH 3D65E 3GCTG 1HAOH 1SLWB 1ZOMA 3GCTF 3P95A 2V3HH 3EA8A 1QB6A 2WPIS 3URDA 1AUJA 2ZGJA 4Y76A 1EUFA 3MI4A 1GJ8B 1O36A 4M7GA 1O5EH 3VEQB 3SORA 1SGPE 1ESAA 2VH6A 4R8TB 1C4Y2 1L1GA 3ZZ4A 2SNVA 1QNJA 2ZKSA 1TA6A 2O9QA 1WQSA 1XKAC 2ZI2H 3RXIA 1BJUA 4OS1A 1Y5BT 3DA9B 1EP5A 4NZQA 4BAKB 4Y7AA 4UFFH 1VJ9U 3TJOA 4ZKSU 1OS8A 1UCYE 3A80A 2VIQA 3RXHA 2CXVA 2H5DA 1GVKB 2R2MB 4ISNA 4AYYB 1O2XA 3M3VA 1GBFA 1ZTJA 2PR3A 3PWCA 2CF9H 5T6DA 1HAXB 1NS3A 1QCPA 5JPMH 1O0DH 2FOMB 3UR6A 2Z6BD 1YPJH 3K6ZA 1QRZA 2HALA 1PQ7A 5C20A 2P59A 3U98H 1C1MA 2FTMA 1TA2A 2J34A 1YCPM 1C4V2 1Q3XA 3B23B 2XYAA 2FP7B 1P04A 5GXPA 1C2KA 3M37A 4ABHA 1G3DA 1O3AA 3BEFB 5F6MA 1L4DA 4A1XA 5EQRA 3PV4A 5JBTA 1BHXB 1C5PA 1JRTA 3SUDA 5C5NA 1EZQA 1PPCE 2ZGBH 3TVJB 2BY6X 4INKA 3SJKA 3LGVA 1QFKH 1C5WB 1EAWA 1QB9A 1JRSA 4D9RA 3TJNA 1C5XB 2PGQB 2VVVA 4X2WA 1O3IA 5EXNA 1O2SA 4IW4E 3L6PA 2JETC 3RUOA 1DANH 1SFQB 2JH0D 1J16A 2CF8H 4JCNA 1QHRB 5FPYA 1O2PA 1L1JA 3E6PH 1ESTA 3D62A 4LXBH 1FUJA 3PM3A 2XBVA 2PUXB 3MU5A 1GBLA 3CS7A 5EPYA 1C2JA 1JIRA 4NZLA 1BTYA 3EQ0H 1P03A 1C2HA 1BQYA 2HNTC 3OYPA 1QQ4A 3BTME 2PKSB 3GY8A 4Q2KA 1DSTA 2H6MA 1IQFA 1HXFH 2Q1JA 1AZZA 2Y5FA 1OYQA 3UOUA 1GI6A 2TGAA 1P3EA 3LKWA 1EJAA 2Z3EA 1U6QA 1ELEE 5E0JA 4AFQA 6ESTA 1K21H 1TNGA 1YCPK 1HPGA 3A81A 1BTUA 1V2WT 2F3CE 4CH8B 3MTYA 1ZPBA 1QTFA 1F5RA 1K9OE 2AFQB 1NU9A 4WWYA 4IS5A 1XXDA 2D8WA 3QK1A 3S69A 1C5NH 5JDUB 1F5KU 3SU2A 1YPMH 1BA8B 1AB9B 2STAE 4IC5A 3MHWU 3A7WA 1M9UA 2XBWA 3EA9A 3A8CA 2EI6A 1C2FA 2ZU5A 1L4ZA 5HXFA 3HK6B 1O3LA 1BBRE 2FMJA 3TIUA 3ODDA 2BD5A 3E1XB 1C5OH 1GDQA 4IGDA 3MH5A 2RA0A 1XM1A 5LGOA 1NRQH 1C1NA 1C5YB 1CU1A 3SBKA 5DK1A 4YOGA 3RDZA 1V2TT 1HJAC 3SJ8A 1SSXA 3RU4T 3SV9A 1VITH 2W26A 1P0SH 4TPYA 1MZAA 1HRTH 4NIXA 5C5OA 4CH2B 1O5AB 1GBJA 1N1LA 1DXWA 2OC0A 5EW1H 1OPHB 2AIPA 2P8OC 3M3TA 6LPRA 2VIOA 1JWTA 1F7ZA 3PTNA 1FNIA 1O5DH 3A7ZA 3KQCA 3QZQA 1S0RA 4R0IA 2BDIA 2ZFPH 3F9FA 2WYJA 1UCYH 3S7KB 1XUFA 1A0LA 1UVUH 4JMYA 2BY9X 2XCNA 4Y8ZA 1O2RA 1O3PB 3LONA 4MNYA 1V2RT 2BD3A 1J15A 2HPQH 5EQQA 1O3CA 4GSOA 2TRMA 3LJJA 4Y71A 4KTUA 1THSH 2ZIQH 3M36A 3SNBA 1LKAA 2CJIA 1K1NA 1LDTT 4AFUA 4UFGH 3SU0A 4DG4A 3SGBE 5LH8A 4I8LA 1SFIA 1CT0E 4UFDH 1SGYE 3ZZ6A 1UVPA 1SGFA 3EGKH 1E36B 1QB1A 1SQOA 2VU8E 5EW2H 5DP3A 4AFZA 2BY5X 3TNTA 2JH6D 4H6TA 2BM2A 3ZZAA 1TABE 3DT0H 7KMEH 4WH8A 5DP9A 4DGJA 4MG3A 5I46H 2ZTYA 5EODA 1GHXH 2F9PA 1ZMNA 4FUBA 2P93A 1RRKA 2BB4A 2SGQE 5DP8A 1BHXF 3BG4C 4TPIZ 4Y11E 3E16B 1CA0B 2PKAB 4A5TS 1WSSH 1HAPH 1GVZA 1MKXH 1GL1A 1O3JA 1O2VA 3KGPA 1GJ5H 2ZO3H 1BDAA 1D4PB 1EX3A 5PTPA 1AFEH 4CRDA 4D76A 1L0ZA 3T26A 3H7TA 1SGEE 1UTPA 4CRGA 2RCEA 4IN2A 3NPSA 1A2CH 1EJMA 1TGNA 2A31A 1DX5M 4MLFB 5CHAB 1Z71A 4MPXA 2XC0A 4CBNA 4IN1A 1DWCH 3ESTA 1WV7H 2EC9H 1Q2WA 1HDTH 4K1EA 3EA7A 2P16A 4FUHA 4ZAEA 3I78A 2HRVA 3FZDA 1G32B 4IBLH 4U30A 2G52A 1A3BH 2CV3A 2ZU4A 1OWHA 1KXEA 1ZHMA 2FEQH 2AGEX 3T28A 4DVAU 1HIAB 2EI8A 1NN6A 5K7RA 1NFUA 1TBQH 1FI8A 1O5CB 1QY6A 1SI5H 3F9HA 1E34B 3LH1A 3LPRA 3T27A 2ZPRA 1TRYA 2OC1A 1C4U2 1QA0A 2OC8A 1YPHC 2RA3A 2PFEA 4CRFA 1Y3YA 1RTFB 3PLKA 4GCHG 1MKWH 4NWKA 3SNCA 7GCHG 1TQ0B 2SFAA 1P8VC 3SU1A 4GCHF 7GCHF 1V2NT 8KME2 4ZMAH 1B7XB 1BMNH 1NRPH 1S5SA 3S0NA 2P3FH 3GYMA 1CA8B 4YTAA 2QF3A 3SW2B 3MYWA 5C3NA 5AF9H 2JH5D 1YYY1 3RMMH 2VWLA 1DLKB 2BQ6B 1SLUB 1K22H 1P05A 3KF2A 2ODPA 2Y7XA 1BBRH 1GI2A 1TNJA 8GCHG 1YGCH 3S9CA 8GCHF 1ZHRA 1D6WA 4XE4A 2GT8A 1LHFH 1NESE 2ZP0H 1P2JA 1DE7H 1BMAA 2DE8A 2VWNA 2XC5A 4KTCA 3ZYEA 1HFDA 1VGCB 2SGFE 1AWFH 2THFB 5F03A 2O8UA 3EAJA 1EPTC 1YBWA 1P2OA 3TITA 2A7HA 1GMDG 1P09A 2PKAA 1AKSB 2FOGA 5T6GA 3BF6H 1BRAA 1THPB 1QGFA 1GMDF 2A1DB 3PO1C 1GJAB 4DT7B 2ZU1A 3SO3A 1DUEA 1JOUB 1CVWH 2GV6A 1IQGA 4MDSA 4ABJA 3RXDA 1C5TA 3DUXH 1EQ9A 2GDDA 1OX1A 1P2KA 1ETTH 3ZVFA 1AHTH 2BXUH 4MPVA 1MBQA 3C27B 3KQBA 4Q80A 2P3TB 3BSQA 1UTJA 1SGIB 2HNTE 3NCLA 2V6NA 2ZQ2A 1TE0A 1O3FA 1GJCB 3SUFA 2XCFA 3RXOA 4NA8A 3VGCB 3O8RA 1G37A 1AGJA 1MU6B 1G2LA 3ENSB 3O8DA 1NY22 3GISB 1O31A 1Z8IB 1ZSLA 1KXAA 1W12U 2STBE 1S81A 1C2GA 1DITH 3V3MA 4JYVH 4E7NA 1SOTA 2BD8A 1MQ5A 1AVWA 2WYGA 1AMHA 3Q77A 4YLQH 1AU8A 4X8UH 2A0QB 1LTOA 1HAZB 1HIAA 2NU2E 1P12E 4Q7YA 3ATIA 3A83A 5CMXH 2B7DH 1QJ1B 4X2YA 1O32A 3CP7A 1C1SA 1GMCF 3LC3A 4OS7A 1IQIA 4I8HA 1TALA 3RXRA 1C5SA 1JXPA 4ZKOU 1BT7A 3PMJA 3TGKE 1IHSH 3STJA 1F0UA 3EYDA 5G4BA 2QF0A 3UNQA 3O8BA 2Y5GA 5LPEA 1P9UA 1PPBH 3M35A 1FY3A 3TH3H 2AERH 1TPOA 1MTNB 3PTBA 3ITIA 1YLDA 5J4SA 2WV4A 1FY4A 2OQUA 5DGJA 1OYTH 2FOBA 4X6OA 2C8YB 2B0FA 5JBCS 4NIWA 1MQ6A 1W14U 1GBCA 2VIWA 2ANWA 1PPFE 3SJOA 3UY9A 5JBBS 1LVYA 2Y6TA 1TB6H 1G30B 1GJ9B 4XSKU 4DIHH 2VVUA 4BXSA 1O5FH 2CHAC 1ZSKA 1C1UH 1MZDA 1EPTA 5IYTA 3ZVAA 3Q3YA 4U01A 2QXIA 1NPMA 1LVBA 1EP6A 2UUKB 1NT1A 4X1PU 2J92A 1RIWB 4ZKRU 3UOPA 2AH4X 3LGTA 1LMWB 3RXUA 2ZWLH 3QZRA 3TK9A 2BLQA 2ZECA 5LPRA 1Y5UT 2ZFQH 5DPAA 4X0WU 3LOXA 3P6ZB 4K1TA 2NU0E 4B1TA 3KHVA 2W5EA 2QY0B 2Q6FA 1FPHH 2BZ6H 2GCTB 1V2JT 1W0YH 3F1SB 1A4WH 4I32A 3RXKA 2BD2A 5GWZA 2Z9GA 1LQDB 3IWMA 3TJUA 5F8ZA 4X6MA 2QAAA 3BIUH 2ZPQA 1O2KA 3SNDA 1IQLA 3I29A 5E0GA 2ZCHP 2EI7A 3D49H 1Z8RA 2G4UA 1NTPA 1HV7A 5SGAE 3BTTE 1SHYA 3ZZCA 1Y8TA 3QLPH 4IMQA 1FONA 4LOYH 3P17H 1SGRE 1RGQA 1NRSH 2PTNA 1O3GA 2O8TA 4NSYA 4NCYA 3QN7A 2PW8H 3LIWA 2V35A 3RU4D 1F2SE 1ZLRA 3SI3H 1G2MA 4WMEA 3S9AA 1TGTA 2G81E 3A8AA 1HYLA 5E0HA 2ZG0H 1A61H 2ZU3A 3KIDU 4AFSA 2ZU2A 4A7IB 2A4RA 1FIWA 2GKVE 2IPHA 4VGCC 1AFQB 2AYWA 3UWJH 1SQAA 4CRAA 1BB0B 2FI4E 2Y81A 3FFGA 3GY6A 2DUCA 4K2YA 2FX4A 4JZFH 3U69H 1UTNA 1ANDA 3SUGA 4ZHLU 4ABIA 1D3QB 5EG4A 3MO6A 4F4OC 5FPTA 2QC2A 1D3PB 2H2ZA 4BOHA 2WPHS 4NFFA 2FS9A 4D7FA 9LPRA 4BAQB 4O3UA 1O2LA 3OX7U 4SGAE 4XBDA 5DP4A 5J4QA 5HM9A 1XX9A 2QV1A 3HGPA