4E7NA

Crystal structure of ahv_tl-i, a glycosylated snake-venom thrombin-like enzyme from agkistrodon halys
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
238
structure length
238
Chain Sequence
IIGGDECNINEHRFLVALYTSRSRTLFCGGTLINQEWVLTAAHCDRKNFRIKLGMHSKKVPNEDEQTRVPKEKFFCLSSKNYTLWDKDIMLIRLDSPVKNSKHIAPFSLPSSPPSVGSVCRIMGWGRISPTEGTYPDVPHCVNINLLEYEMCRAPYPEFELPATSRTLCAGILEGGKDTCKGDSGGPLICNGQFQGIASWGDDPCAQPHKPAAYTKVFDHLDWIENIIAGNTDASCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Snake-venom Thrombin-like Enzyme
publication title Crystal Structure of AhV_TL-I, a Glycosylated Snake-venom Thrombin-like Enzyme from Agkistrodon halys
rcsb
total genus 60
structure length 238
sequence length 238
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4e7nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4e7nA02
3L3TA 3QZQA 3S9CA 1EKBB 1G3BA 1Y3YA 1SL3A 3SGBE 3HATH 2J94A 4ABHA 1LHGH 3AAVA 1A0HB 2PSXA 1DSUA 2VIPA 1GJBB 1AI8H 1P2NA 5C5OA 2GTBA 3ZVDA 1ESBA 1JOUB 4XSKU 1SGTA 3LU9B 2VVUA 2F9PA 3H7TA 1WOFA 4K3JA 1TGCA 2UUJB 4HGCA 2OBQA 2GDDA 3BTDE 3QK1A 4X2WA 3TIUA 1H9LB 1K1OA 4MPXA 2ZCKP 1EAXA 3RMMH 2IOTA 1BRUP 4K60A 5GWZA 1W0ZU 2OP9A 5A0CA 4Y6DA 2ZGXH 1S6HA 2C8YB 1B0EA 1D3QB 1CT4E 4K2YA 2B0FA 5GPIB 1O2JA 1CGIE 1C1PA 2QV1A 4MNWA 2PKSC 1N8OB 4BAQB 1DWDH 2ALPA 1EP6A 1DXWA 3HKIB 3ELAH 1G2MA 4AGJA 1W7GH 4OS5A 1VCPA 3RXQA 1ANBA 4DOQA 1QR3E 2C8WB 3CS0A 1JMOH 1SQTA 1C1QA 2A5IA 1F0SA 2G5NA 5AVDA 1MU8B 5JDUB 2STBE 3V13A 1TPPA 1UVSH 1TABE 3BG8A 1RTFB 1AY6H 1SLWB 2ZWLH 1OWJA 1YCPH 1O2IA 4GCHF 3D49H 1OS8A 2YOLA 2P8OC 2CF8H 1J9CH 3QX5H 2GV6A 1MBMA 5FBEA 2HALA 3NCLA 2ZTYA 1AB9B 3ATLA 3SJIA 4I7YH 4X8VH 3K6YA 1FIWA 3KGPA 1VITF 3GY2A 3UWIA 5FPYA 5K0HA 4OS1A 3N7OA 1QQ4A 3U8TH 2Y6TA 4UFDH 3PO1C 1MQ5A 3SORA 1XUHA 5E2OA 2P3FH 1TOMH 4X2YA 2XC0A 4YZUA 1QURH 1XKAC 1EOJA 2BZAA 2OD3B 1EP5A 1GG6B 5LPEA 1BHXF 2R3YA 3M5MA 1P8VC 1HAIH 2Y80A 3RXUA 3MU4A 1C1UH 1UCYK 1LMWB 4A1XA 4FUJA 4WJG2 3EE0B 4D9RA 1TPOA 1GCTB 1UTOA 2A4OA 2PTCE 2Z7FE 3BEFB 1CO7E 2FOBA 3F9EA 1O2VA 3RXSA 5EQSA 5E0GA 1K1JA 1E37B 1DT2A 1F0UA 1O38A 3GICB 4E7RG 4DURA 2FP7B 2ZA5A 3UR6A 2ZGJA 2XNIA 1SI5H 1V2KT 4ABEA 1K9OE 2PKAA 1QCPA 3V0XA 1FY8E 3BN9A 3AW1A 2Y82A 2ANYA 1TGBA 1YYY1 4XFQA 2YNAA 4ESTE 2D26C 4WH6A 3LGTA 2J92A 1VCQA 1BQYA 4CRGA 1PPZA 1UK4A 1F5KU 3ENSB 1MTNB 1V6DA 1SGNE 1TPAE 4GCHG 2AERH 4DIHH 4YO9A 1A5GH 3SUGA 4IMZA 1Z6JH 3DA9B 1GJDB 1IQNA 1GHAF 1GWAA 2FM2A 2BLQA 4KTCA 1D3TB 1ELBA 1T8LA 3T28A 1GDNA 5G4BA 3S69A 1PJPA 1VITG 5I25A 1VJAU 3ZZ8A 2FZZA 3LJJA 1A4WH 3D23A 3LGWA 3PWBA 5JBTA 2XBVA 3I77A 4OS2A 4ZKSU 3RXTA 1FY5A 1ZJDA 3K65B 4B71A 3PYHA 1GHBF 1V2LT 4WF8A 2K1QA 1IQHA 1ZMLA 1BB0B 5FCKA 3GISB 4Q7ZA 3MO9A 1O5FH 1TNKA 5GXPA 5CHAC 2ZU4A 2SGDE 1ANEA 2VNTA 1Z6EA 2EEKA 2FOAA 2ZGHA 3DFJA 5BRRE 4X2VA 4DIIH 1JIMA 1DWBH 3H7OA 2FO9A 2PGQB 1TONA 4Y8YA 6ESTA 2FX6A 1EZSC 2B8OH 1CA8B 4H4FA 1O3EA 3PTBA 1DWEH 3OX7U 4MQAA 4THNH 1GI6A 1PFXC 1G32B 4Y10E 3SN8A 3ZV8A 1H9HE 4Q7XA 5L2ZH 1F0TA 1OWIA 3GY6A 1AFEH 1SGEE 2VGCB 1GJ7B 3OSYA 1KDQA 1IHSH 4GHQA 1IHTH 4KTSA 3ATMA 3E8LA 3S0NA 1B7XB 4NFEA 1V2TT 3K9XB 2ZDNA 2HVXA 1O2UA 4JK6A 1ZTLA 1HBTH 3GCHB 3SJ8A 1OWHA 4X8TH 2VH0A 4NIVA 2WPIS 1BTUA 2ZDVH 1L4ZA 3BTEE 1QB9A 2Q6DA 1GBHA 1ZSLA 1AGJA 1GHAG 1S82A 3AAUA 2CV3A 4I8LA 3KNXA 1LVOA 1GHVH 4CR9A 2RCEA 3T27A 1T31A 1TQ0B 1IQFA 1KTSB 1WV7H 2FWWA 1QB6A 1SB1H 3BF6H 3BV9B 5LGOA 4X8SH 3TGJE 3UOUA 1GHBG 1BRBE 2FXRA 3PMBB 3T5FH 3MYWA 3HK6B 2BOHB 1AE8H 3TK6A 4KELA 3PMAB 2BDGA 4INLA 1FNIA 1LHDH 1Y3WA 1ZHPA 2OC8A 4Y0YE 3PMHB 1NRPH 2NU1E 4I33A 1HAPH 1JXPA 2PGBB 2BD4A 4NWLA 2BD9A 1NTPA 2BD2A 1C5NH 1MBQA 2AGEX 2W3IA 2A4QA 3W95A 1XUKA 3AASA 1F7ZA 4LXBH 5DP9A 3VGCC 1G30B 3T2NA 1GMHF 2ZTXA 5FHTA 1QGFA 4A1VA 1EAIA 1TYNA 4FUGA 3SOSA 3ZVCA 1RIWB 2LPRA 3H5CB 1LKBA 1F92A 4D7FA 1P2QA 4TPIZ 1UK3A 1C5UA 1KYNA 2ZQ2A 3QLPH 4JYVH 1DY8A 1O36A 1QBNA 5EU8A 4K1TA 1D6RA 1IQEA 2FTMA 5LPFA 4CRBA 1Z8RA 3RUOA 1AUJA 4OS4A 2AMPA 2FTLE 1TRMA 1RTLA 2WYJA 3LC3A 3KQCA 1MCTA 1EX3A 5FXLA 2ZPRA 3MU0A 7ESTE 1SQOA 1O5BB 1TX7A 3EYDA 4JZDH 3BIUH 1TMTH 2BYAX 3UNRA 3E0PB 3S7HB 3SO3A 2ANWA 1GMCF 3NK8A 1PYTD 5AFYH 1LPGB 1LDTT 3SV2H 2C8XB 3LOXA 1NFUA 1XVOA 3JZ2B 3ZVFA 1CSOE 1UHBB 4GSOA 4YT7H 1HUTH 3DUXH 4ABBA 2V6NA 1AO5A 1ZJKA 2ZG0H 3SNDA 1CE5A 1O3NA 4O03A 1AKSB 1O5CB 1OP8A 3BEIB 3EA9A 1NN6A 4XBCA 2HPPH 4KTUA 1K2I1 2VB0A 3RXKA 3EAJA 3Q3XA 1IQLA 2UUYA 2V0BA 2C8ZB 1Y3UA 1O3PB 4CRCA 2ZQ1A 1D3PB 3RU4D 3SW2B 1T4VH 2AIPA 5A09A 3MO3A 4JZFH 3RMLH 1BJVA 3E3TA 5EQRA 2FOGA 1V2WT 2A5KA 3BG4C 4JZIA 4A92A 4A6LA 4WXIA 5GIBA 4I32A 3KHVA 1B5GH 5EG4A 1O2XA 1TGTA 3VB6A 5T6GA 2HGTH 1GMHG 3STIA 1V2RT 2J9NA 2TGTA 2ZFQH 3UPEA 1C2KA 1YCPK 1O3GA 2BXUH 3QGJA 4RN6A 2VIOA 1IQGA 1NRSH 4AFQA 1BHXB 1L1NA 1E36B 2ZHWH 3T29A 1AZZA 4WWYA 2FYRA 1ESTA 1GVKB 3RMOH 2R0KA 1DVAH 1GVLA 2XWAA 1GPZA 1Z71A 3U9AH 2P3UB 5A0AE 1WYKA 1YPHC 1T8MA 4R0IA 4AGKA 3HPTB 4ZUHA 1SGIB 1Y3XA 3P8GA 1PPGE 3T26A 1PPCE 1YBWA 2W26A 2XC5A 2Z9KA 3A86A 2V3HH 1DOJA 4YOIA 1TWXB 2CHAB 3ATWA 1GMCG 1Z8JB 3SUDA 1J15A 1O37A 2TIOA 2ZFTA 3A7XA 4WY3A 3SU3A 1C2LA 1SQAA 1KLIH 2Z9GA 1LHFH 2WPKS 1CT2E 2BDYA 4H6SB 1Y5UT 3D62A 1ZRKA 1HAHH 1HJAC 1KSNA 1L1JA 3RLWH 4X6OA 4K1EA 2H1UA 1FY4A 1UTPA 2QXIA 4Y7AA 2A4RA 4YLQH 5T6DA 1DPOA 1DE7H 4AORA 3SU6A 4NIXA 5JYIA 1DWCH 1J17T 3SHCH 1TRNA 1TQ7B 4LZ1H 1NS3A 4PROA 5F8TA 4E05H 1LVMA 2F9UA 1V2VT 1Q31A 4I8GA 5A2MH 1HJ9A 2BD8A 5GCHG 1H4WA 1SLXB 1ELTA 1ID5H 4O97A 3B23B 3M61U 1RFNA 3QUMP 1GI5A 4CR5A 3RXFA 3DHKH 1SFIA 2OTVA 2AIQA 2EI6A 1EXFA 1RD3B 5C1XA 4FU7A 1BUIA 2GP9B 2GD4B 1FONA 1GBLA 3SV6A 3VB7A 3MNBA 1BBRE 3KF2A 1A3EH 2PWXA 5E0JA 4CBOA 3MU8A 3O8BA 1HIAA 4K8BA 1P09A 1WTHD 2Z3CA 1S0QA 2EC9H 1TFXA 4X1PU 1O3CA 1BBRH 3PTNA 2ZGBH 2IJOB 3P8OA 2J2UA 2TGDA 3BTKE 4ASHA 4ABJA 1GBJA 2BD5A 3AVZA 7LPRA 2PLXA 1SLUB 3SU0A 1SGRE 2P16A 1EPTB 1HGTH 4CH8B 1O2LA 1XKBC 2ANKH 1DANH 2TGAA 1N8OC 1WSSH 3ZZ5A 1S84A 4KGAA 3PLBA 1A5IA 1TIOA 1GL1A 1L2EA 4X6NA 1M9UA 1P9SA 3STJA 4NA9H 1AHTH 3RXIA 1DLKB 3BTFE 1GI9B 5F6MA 1O30A 2F9BH 1FAKH 4ZMAH 1SOZA 5PTPA 1V2PT 1C4U2 1W11U 1SGQE 1HAOH 3ODDA 1Y3VA 1YPKH 3RXBA 5TCAA 1O2NA 4Q7YA 1ELGA 2H5CA 5F8XA 1ZTJA 1V2MT 2UUKB 1P12E 4Z6AH 3F1SB 5E2PA 1NFWA 2ODQA 1C5ZB 5DP4A 3M36A 4NFFA 1CQQA 2ZHEH 3OU0A 1BTXA 3M37A 4JZ1A 2ZU1A 3F6UH 1TAWA 3QDZB 4MNYA 5CE1A 3B8JA 1P3CA 3QN7A 3UUZA 1AD8H 1O5EH 1C4V2 2ZFRH 2IPHA 4AFSA 2ZC9H 1P04A 3MTYA 3NXPA 1O2KA 4TY6A 1BTZA 1GG6C 2GV7A 2P3TB 1ELEE 2WPMS 4X1NU 5T6FA 1MKXH 1GI8B 1DY9A 1ETRH 2QGRA 4ISNA 3ZZ9A 2XRCA 1K1PA 1WBGB 1GHYH 3F68H 4GLYA 2ZFSA 3EGKH 5L6NH 3ZVGA 2ASUB 3TU7H 1EB2A 1AU8A 3RP2A 1GCTC 4YOJA 2FLRH 4TWYA 6CHAB 2EI8A 2PUXB 2W7SA 4AFUA 4IGDA 2GMTB 2VU8E 1O3FA 4OGXA 1FY3A 1C2GA 4FUEA 1DM4B 4FUFA 2WV5A 1EZUC 1A46H 1TGNA 4CBNA 1NT1A 1OPHB 4QT8C 3TLOA 1TNJA 2G4UA 3A7ZA 2QC2A 3SZNA 1GJ6A 1KXCA 3ESTA 3P6ZB 2QIQA 4ZAEA 3O8DA 2ZU5A 1HAVA 3EA7A 3SNEA 2CXVA 1HXFH 1RJXB 3PV4A 4CREA 2OCVB 4Y76A 3UFAA 1C5RA 2BQ6B 1ELDE 1MTNC 2FOMB 3PB1E 3MO6A 3TH4H 1MD8A 3SV7A 1G36A 2ZNKH 1P02A 2ESTE 1GGDB 1LQDB 3SI4H 2R9PA 3U8RH 1A61H 1TX8A 2HOBA 2XWBI 3E1XB 3LDXH 1P2IA 2BQWB 1NRQH 1K1IA 2FI5E 1ACBE 1JRSA 3ATKA 2D1JA 1MH0A 1P57B 3SQEE 3SGAE 1D3DB 4DVAU 1BT7A 4A5TS 1MZDA 4FUIA 1H8IH 3SQHE 2SGAA 2ZHFH 4JK5A 3W94A 1P3EA 5DPAA 4ISLA 3LH1A 1ZMNA 1NFXA 4UDWH 1G9IE 3MNCA 4VGCC 5FPTA 2HLCA 2KAIB 5IYTA 2UWOA 4BTUB 1EJMA 4WMEA 1ZZZA 3TPIZ 2BD7A 1TNLA 1F5LA 4MPWA 8LPRA 3PLKA 5FCRA 1OWEA 1AIXH 1L0ZA 4YT6H 3RXAA 4IC6A 1C1OA 1HB0B 2W3KA 2NU3E 3S9AA 1WTGH 1P06A 1FAXA 1C9PA 2GZ9A 1TLDA 1AE5A 1OYQA 4GPGA 3CP7A 1O39A 2VGCC 3RC5A 3I29A 4E06H 3GCNA 2BDIA 1TA6A 4FUCA 4I8HA 4AYYB 2G51A 5DGJA 2D8WA 4NGAH 3QO6A 9ESTA 1Y59T 1C9TA 1FXYA 4FVDA 1QIXB 4IC5A 1QJ7B 3NZIA 1O2MA 4X0WU 2ZKSA 3V12A 1UJ1A 1PPBH 1C1VH 1GI4A 2AMDA 3F9FA 2OC1A 1ABJH 3GCHC 4ZXXH 8ESTE 2JETB 1PPEE 1ELCA 1UTLM 4GVUA 1MD7A 2AS9A 3Q3KA 1O2WA 3A84A 1K1MA 1C1TA 3E16B 5A8ZA 1Z1IA 3BIVH 2PHBA 3RXLA 1OYTH 3A8CA 4CH2B 4BTIB 1Z1JA 1YF4A 3SU5A 3M7QA 1D4PB 1C2FA 1GHWH 4IBLH 1C2DA 2PW8H 1L4DA 2ILNA 3QTVH 1UTKA 4X6PA 2XBWA 4FUBA 5GJ4B 1T8NA 3URDA 1BMLA 2I6SA 4FXGH 2BY5X 1PYTC 1O2TA 2F3CE 3PMJA 1TMUH 1RTKA 3GCOA 4RSPA 1GBBA 1XVMA 2UWLA 2FS9A 3TJUA 2G55A 3UNSA 1HAGE 4Q80A 4X1QU 1SG8B 1EOLA 1TMBH 2AGIX 5DG6A 4IW4E 3E0NB 1GMDF 1DDJA 2SGFE 1PPFE 1TPSA 3S9BA 3A81A 2GCTB 2C3SA 1KY9A 1A2CH 1CA0B 1V2NT 1Q2WA 3RXCA 1XMNB 5FX5A 2B7DH 4AN7A 2ZPSA 1C2HA 2Q6GA 1E35B 2VWMA 4Z0KA 2GX4A 2VIDA 1RIWC 1GDQA 3FP8E 1YPMH 1O2RA 3SJOA 1T4UH 1O2YA 1PQ5A 1NU9A 1LQEA 2UWPA 3LJOA 2SNVA 1TX6A 1SMFE 1V2QT 3SU2A 4MNVA 1TNHA 2JH5D 3SV9A 5DO4H 1UTMA 1A1RA 5ABWA 3S7KB 2ZCHP 2GKVE 1SSXA 3FVFB 2ZI2H 3RXGA 3ATIA 5K7RA 4HFPB 1NRRH 1P9UA 1EAUA 4ABGA 1S0RA 4OS7A 1ETTH 4MG3A 1NZQH 1O3MA 2P59A 3PROA 1DX5M 2G4TA 3DD2H 4D9QA 1CHGA 2VINA 4OS6A 1GJ9B 1ARBA 1QJ1B 1QB1A 2VIQA 1QHRB 2QXHA 1S81A 1FJSA 4ABFA 1JRTA 1IQIA 4ZROA 2PR3A 1RXPA 1VCWA 1OXGA 4BNRA 2XBYA 2BY7X 1BBRK 2J4IA 4Y8ZA 4LZ4B 3SUEA 3K6ZA 4NIYA 3TNTA 2HPQH 1BCUH 3EQ0H 1TNGA 1IQJA 2CMYA 3SUFA 3MOCA 4IS5A 5IDKA 2BVSH 1P2MA 4NA7A 1HIAB 2JKHA 1GI0A 1Y5BT 1NRNH 4Y79A 5JBAS 3LC5A 3SI3H 2ZECA 4LOYH 1QL7A 5SGAE 4B2CA 3MNXA 2LNCA 4B1TA 2ZIQH 2SGEE 4INHA 1AVWA 2Y7XA 1HYLA 4Y0ZE 2TBSA 3IWMA 1NU7B 4I8KA 3DT0H 1YLCA 4NSVA 1G3EA 1O3IA 2H9EH 2DUCA 4UFEH 5E8EH 4Y8XA 3A7VA 2BDBA 3KQDA 2ZCLP 1WQVH 5DJ7A 1AWHB 1O5DH 3FP7E 1NESE 1YPEH 1HJ8A 5C5NA 2BOKA 5A8YA 1OX1A 2XW9A 3VFEA 4E7NA 5L30H 1OWDA 3UQVA 1SFQB 5F03A 3HKJB 4CRDA 4NCYA 1GBEA 1H1BA 1KLJH 3F9GA 2FOCA 1EUFA 3ZVEA 1AQ7A 3PWCA 4CHAC 2WPHS 2A7CA 4H6TA 2GCHF 1LHCH 1LVBA 2FODA 4YLUA 2ZFFH 1QA7A 4WXVA 1LKAA 3LONA 3UIRA 5C67A 1C1MA 5EW2H 2Y5GA 1ZMJA 1LCYA 3VGCB 1FQ3A 1YPJH 1QY6A 4JCNA 2VVVA 3BSQA 1C2JA 1CBWC 2NWNA 5LPRA 1C5VA 3TNSA 2JH6D 1O3LA 3SJ9A 3LT3A 2CHAC 3CENA 1HV7A 3RXPA 1W3CA 3E6PH 4BOHA 1MKXK 1THSH 1O2PA 2ODYB 1SVPA 3M7TA 1K22H 3MH4A 2FI4E 5I46H 3M7UA 1GI2A 1MTUA 3ZV9A 1N1LA 1GBAA 1QFKH 1TE0A 4AZ2B 3BTHE 3LGVA 4RKJB 4ZHAA 3UWJH 1NC6A 1KIGH 1E38B 3P8NA 3HK3B 2A45B 1ZOMA 2WUBA 4AFZA 1ABIH 1GBDA 2XYAA 1QNJA 1QRXA 1EZXC 1GI3A 5C20A 2QA9E 4B76A 4O3UA 2G5VA 1EB1H 2UUFB 2FDAA 1AFQB 4NZQA 1O3AA 1PPHE 1PQ7A 1VJ9U 2AGGX 2VVCA 3NWUA 2A4GA 3RXRA 2BB4A 2PTNA 3LGIA 3UNQA 2HRVA 1CU1A 2ODPA 7GCHF 1ZPCA 4U30A 1O3OA 3T62A 5EOKA 2OC7A 2J34A 1ZPZA 4ZHMU 2BHGA 3LPRA 2ZPQA 1VGCB 1F5RA 2HNTC 1N6YA 4MTBA 3GY7A 1MKWH 2BX4A 5T3HA 1FY1A 4O9VA 1HDTH 1GBMA 2QYIA 4TY7A 1Z8GA 4DW2U 1GHZA 1C5SA 1O5GH 2F91A 2CGAA 5AHGH 4TPYA 3TITA 3SBKA 2V3OH 4K69A 1XUJA 1HAVB 3GDVA 3TK5A 3ZZ4A 1SHYA 2ZFPH 2CJIA 3SHAH 2H6MA 2GDEH 4U32A 9LPRA 5CMXH 3U69H 3GDUA 1W8BH 3JZ1B 1O5AB 2RA3A 1FI8A 3URCA 4BXSA 4AYVB 2QF0A 2RA0A 1OP0A 1THPB 1O2OA 3I78A 3U98H 8KME2 1BZXE 1GHXH 2OLGA 1ESAA 1TOCB 1C5YB 3LGYA 4Y11E 1MMJN 2Q1JA 1ZPBA 1O2QA 4UD9H 1P2OA 3GDSA 3ZZ7A 3ITIA 1X7AC 1G2LA 3EA8A 1TNIA 1EPTC 2AH4X 2RG3A 2A2XH 3M3VA 1QTFA 3UOPA 4BANB 1TALA 2WPJS 1FV9A 3Q3YA 3GYLB 2PKAB 3A80A 1IOEA 4UEHH 1DLEA 5JBBS 3KL6A 2A2QH 3GCTF 5JB8S 1ANDA 1UO6A 4Y7BA 1NO9H 5EGMA 3SJKA 1ZGVA 2PV9B 3SNBA 4INKA 1T7CA 4ISIH 1FUJA 4GUXA 1A5HA 1QRWA 4I8JA 1DFPA 1Q3XA 5DP6A 1EJNA 1W13U 1BTHH 1ZYOA 1GCDA 3A7WA 4BTTB 5J4QA 2IN2A 2F9NA 2A7HA 5EPYA 1C2IA 2BM2A 2XCFA 4ZH8A 1O3BA 1S5SA 2FOHA 3VB3A 1KLTA 1EQ9A 1G37A 2H2ZA 7GCHG 1B0FA 2C93B 1Z8IB 1HJAB 3B9FH 1UVPA 1FMGA 1QQUA 2OQ5A 2ZZUH 2ZU2A 4SGBE 5ETXA 2ZO3H 2WINI 3LGUA 3ODFA 1D6WA 2FEQH 1SGPE 6LPRA 1HAXB 3MH5A 1YP9A 3TGIE 1BTWA 1D9IA 2VH6A 4ZKOU 2P94A 3KIDU 1HFDA 4ABDA 1U6QA 2J95A 3MNSA 3ZZBA 3C1KA 3FZDA 1SGFA 1JWTA 1QJ6B 4BAHB 1GBFA 2GZ8A 2BX3A 1FIZA 2CF9H 2XXLA 3ZZDA 2ZDLA 1GBIA 1C5PA 3CS7A 1UK2A 1IAUA 4J1YA 3TVJB 4NG9H 2QF3A 1A7SA 3BTTE 3MU1A 1O3DA 1BTYA 1SBWA 4IN1A 3UTUH 3VB4A 2D2DA 1DSTA 1GI1A 2OXSA 4MDSA 1LVYA 6CHAC 2BVRH 2ZDKA 1UHBA 3L33A 2GMTC 2G8TA 1OOKB 3FFGA 1AB9C 1AVGH 1Y5AT 1AKSA 1KDQB 4MLFB 2Y5HA 2FLBH 4OGYA 3GCTG 1SGCA 4YESB 5L2YH 1P03A 3NKKA 1TBQH 5C1UA 2ALVA 2BLVA 2TGPZ 1SR5C 2WYGA 3ZYEA 2QXGA 3T25A 3E90B 1ORFA 4WVPE 1YPHE 1FZZA 1TBRH 2A1DB 1P2KA 4D7GA 4HI3A 1J16A 1P10A 1O2ZA 1P11E 2BY8X 4FUHA 4WH8A 1ZSKA 3VXFH 1K1NA 1MTWA 4FUDA 1GGDC 2ZHQH 2OBOA 1T32A 1NFYA 3M5OA 1GJAB 2PSYA 2P93A 1L1GA 1Y8TA 1IQMA 2Y81A 1C1RA 7KMEH 4GAWA 5EXMA 5DP5A 2HNTE 1MZAA 1C5LH 1GI7B 1UVOA 4M7GA 4X1SU 4FU8A 1XM1A 3NPSA 4XOJA 1K1LA 4BAKB 3MWIU 1DS2E 1ZSJA 3KN2A 4NA8A 2Q6FA 1KXEA 4X1RU 5HGGA 3EDXB 3MHWU 2A0QB 4DGJA 1AZ8A 2OQUA 1HNEE 1MTVA 5HMAA 1QL8A 1O32A 2R3UA 3R0FA 4YTAA 1BA8B 2PKSB 1EAWA 3RXHA 5HM9A 2FPZA 1GBTA 2BQ7B 1QRZA 2EI7A 1BTPA 2TRMA 1THRH 4YOGA 8GCHF 4JYTA 2Z9IA 2NU2E 3MU5A 3OYPA 1O3JA 1CGJE 1RS0A 4U2WA 2QY0B 2Y5FA 1O31A 1MAYA 3TK9A 3TJVA 1MU6B 4UFGH 1HAYB 4NIWA 2VWLA 2V35A 3RM0H 1E0FD 3TJOA 4DJZB 4JZEH 2P8OB 2F9OA 4ZHLU 2H5DA 4GHTA 3E91A 3SNCA 2JETC 1SGFG 3UREA 3MI4A 3RXOA 1C5TA 1BDAA 1BMAA 1K28D 2FESH 1C4Y2 3OY6U 3A8AA 2XCNA 1ZHMA 3RXMA 4YM9A 3L6PA 1GJCB 3TGKE 4UONA 1ETSH 3PO1B 4B75A 1A3BH 1FN6A 5HM2A 1NROH 3A89A 1ELAA 5J4SA 3P95A 1YCPM 4MPUA 2SGQE 5HYOA 2AYWA 1BITA 1KXAA 5JPMH 2B5TB 4Y71A 5TCCA 3A8BA 1TBZH 1KXBA 1A0JA 1J14A 2VIVA 2H9TH 4AB9A 4BXWA 4XBDA 2PFEA 2BDCA 4BAMB 2PUQH 3FZZA 1IQKA 3R3GB 1C5OH 1C5WB 1WU1A 1ZGIA 1ZTKA 2JH0D 6GCHF 3UY9A 3WY8A 3RXVA 5DP3A 2GCTC 3RU4T 2QCYA 1J8AA 2FX4A 4K8YA 1HLTH 3QTOH 1CA0C 3ZVAA 5C3NA 4DCDA 1EPTA 3BTME 1BMNH 4MPVA 2OINA 1RRKA 3SU1A 2ZF0H 1TB6H 1O2HA 1C1SA 3MMGA 3LKWA 4NZLA 1GJ5H 2HNTF 3RC4A 2O8LA 8GCHG 3OTJE 1VR1H 3O8CA 3V3MA 4ISOA 4U01A 3FANA 2W5EA 4KKDA 1WCZA 5DP7A 1FPCH 1RGQA 4VGCB 1MKWK 3P70B 2SNWA 4F4OC 3SU4A 2Z94A 5DK1A 2BMGB 5AF9H 1TGSZ 1YKTA 3RXJA 1C2MA 1HAZB 4WMFA 1FDPA 1S83A 2VWOA 4I31A 1YPGH 2NU4E 3A8DA 1HRTH 1BMMH 1W10U 1WUNH 3FAOA 2SGPE 3VPKA 3U1IB 4JMYA 2WPLS 5EQQA 1HCGA 3A7YA 3D65E 1C2EA 1PQAA 1UTQA 4H42U 1SGDE 1CGHA 4AB8A 4KP0A 2VJ1A 2XC4A 2P95A 4ZXYH 3TH2H 4BAOB 3ZZ6A 3ZVBA 4B74A 2C4FH 2ZTZA 3O8RA 5CHAB 1N6XA 2Z3DA 1GJ4H 1NM6A 2H9HA 2QAAA 2XTTB 3RM2H 1UTJA 1C5QA 3UR9A 4A1TA 4RKOB 1MTSA 2W7UA 3BEUA 3G01A 3KCGH 2EA3A 3RDZA 1QBOA 2A31A 6GCHG 1O34A 1ARCA 1O35A 1F0RA 5E0HA 1EASA 1SHHB 2BD3A 3GY8A 4XBBA 2QN5T 2GGVB 1Z7KA 4Q2KA 2ZEBA 1UVUH 3SV8A 3TH3H 1XUIA 3ZZCA 4X2XA 5B6OA 3GOVB 3FP6E 3M5LA 3UQOA 2ZU3A 4LK4A 1GBKA 2G00A 5FBIA 1H9IE 2G81E 2WV4A 3A85A 3VXEH 1QL9A 3M5NA 4WMDA 2C90B 2BY9X 1NY22 1S6FA 4CRFA 1OSSA 1C1NA 2TPIZ 3RMNH 4AG1A 2ZGCA 1O33A 4XDEA 3MH7A 4IMQA 1O3HA 1EJAA 4HTCH 2ZHDA 3GY3A 3HGPA 3NUMA 2BLOA 2O9QA 1V2JT 3BTQE 1P01A 3Q76A 2BY6X 3TJNA 2DE9A 4B73A 1GMDG 4O3TA 1E34B 2VIWA 3QGNB 1K21H 1UCYE 4ZKNU 1LHEH 5DKMA 4UFFH 2GT8A 4FU9A 4SGAE 1W2KH 2OUAA 1BOQA 1V2UT 1YM0A 1LPKB 1WAYB 3QZRA 2I6QA 1T8OA 1UCYH 3GY5A 1P05A 1W7XH 1TRYA 3ZZAA 1OWKA 5HXFA 1ELVA 5EODA 1MUEB 1V2ST 1MQ6A 1ZHRA 1SC8U 4IN2A 2STAE 1AUTC 3RC6A 1BRAA 1V2OT 1ELFA 1A0LA 4AX9H 5LH8A 1HXEH 1SOTA 2KAIA 5F8ZA 5JB9S 3PM3A 1AFQC 2HWLB 1DITH 3OY5U 2R2MB 4TYDA 1FN8A 1MAXA 1SGYE 3C27B 4AG2A 4HZHA 5ESTE 4ABAA 2OC0A 3AW0A 2BZ6H 4K5ZA 4CRAA 2ANMH 1VGCC 2A7JA 3IG6B 2A5AA 1KXFA 2AEIH 1AVXA 4NWKA 1ZRBA 2GZ7A 1JBUH 1KXDA 1O2SA 4TWWA 1AN1E 2VWNA 5AFZH 4D8NA 2R0LA 2Y7ZA 5EXNA 1SLVB 1ZLRA 3F9HA 1C1WH 1W14U 1XXDA 2AFQB 1VZQH 5C2ZA 2FI3E 5GCHF 1CHOF 3PLPA 1GVZA 5DP8A 1GJ8B 2GT7A 5EXLA 1AWFH 4X8UH 3U8OH 2BDAA 1F2SE 2GVFA 3A88A 3GY4A 3RXDA 3BTGE 3ZYDA 1UTNA 2FYQA 2O8WA 3IITA 2ZDAH 3A87A 1JIRA 2R2WU 3GYMA 5FPSA 3Q00A 3QWCH 5ESBA 2O8UA 4CHAB 4B2AA 1UMAH 3HGNA 1DUAA 4ZKRU 1KTTB 1LO6A 1WQSA 1H8DH 2XBXA 1W12U 4UE7H 1DXPA 1YC0A 4J2YB 3RU4E 1PQ8A 3BTWE 4NSYA 1OKXA 2DE8A 1CBWB 1SPJA 2F9VA 1EZQA 1G3DA 2GCHG 3SGQE 1BIOA 2QXJA 2ZP0H 3M3TA 3LH3A 3A83A 3BG4B 1CT0E 3P17H 1XUGA 2BTCE 1W0YH 2THFB 1TA2A 4D76A 1BJUA 2NU0E 1LTOA 2O8TA 3SNAA 2F83A 3MFJA 4ISHH 1DUEA 2RDLA 1GL0E 3RXEA 1YLDA 1EATA 5A8XA 1INCA 3U1JB 2O8MA 4ABIA 5GDSH 4B2BA 1C5MD 1NPMA 2Z6BD 2G52A 5TJXA 5C1YA 1DICA 1AMHA 3MH6A 2FS8A 3KQBA 1XUFA 5BPEA 1MCVA 2YNBA 4MNXA 1FLEE 1P0SH 2Z9JA 2B9LA 4K1SA 5H4IB 3ZZ3A 1CHOG 1O2GH 1O3KA 4X6MA 2FIRH 3VB5A 5JBCS 3M35A 3A82A 1YGCH 3M3SA 3K2UA 3KQEA 1ANCA 1BRCE 1QBVH 1HPGA 3LIWA 1LPZB 1FPHH 1GDUA 4DY7B 3V7TA 2ULLA 1O0DH 4AOQA 1XX9A 1G3CA 2J38A 1OP2A 2BVXH 2BLWA 2CN0H 1GBCA 4FVBA 2AMQA 2WUCA 2BXTH 3P8FA 4DG4A 4XE4A 1ZR0A 2BDHA 3VEQB 1C5XB 3P92A 1XXFA 3RLYH 2M5TA 1V3XA 4DT7B 4JYUH 1UVTH 2A32A 2ZDMA 1S85A 3A7TA 2Z9LA 2Z3EA 4A7IB 5A0BA 5FX6A 1VITH 1P2JA 2FOFA 3DFLA 3KEEA 4MVNA 5EW1H 4F49A 2FOEA 5EPNA 1CVWH 3Q77A 5FAHA 1YPLH 2FMJA 1QA0A 4R8TB 2SFAA
chains in the Genus database with same CATH superfamily
3L3TA 3QZQA 3S9CA 1EKBB 1G3BA 1Y3YA 1SL3A 3SGBE 3HATH 2J94A 4ABHA 1LHGH 3AAVA 1A0HB 2PSXA 1DSUA 2VIPA 1GJBB 1AI8H 1P2NA 5C5OA 2GTBA 3ZVDA 1ESBA 1JOUB 4XSKU 1SGTA 3LU9B 2VVUA 2F9PA 3H7TA 1WOFA 4K3JA 1TGCA 2UUJB 4HGCA 2OBQA 2GDDA 3BTDE 3QK1A 4X2WA 3TIUA 1H9LB 2KM0A 1K1OA 4MPXA 2ZCKP 1EAXA 3RMMH 2IOTA 1BRUP 4K60A 5GWZA 1W0ZU 2OP9A 5A0CA 4Y6DA 2ZGXH 1S6HA 2C8YB 1B0EA 1D3QB 1CT4E 4K2YA 2B0FA 5GPIB 1O2JA 1CGIE 1C1PA 2QV1A 4MNWA 2PKSC 1N8OB 4BAQB 1DWDH 2ALPA 3FO8D 1EP6A 1DXWA 3HKIB 3ELAH 1G2MA 4AGJA 1W7GH 4OS5A 1VCPA 3RXQA 1ANBA 4DOQA 5C0TA 1QR3E 3SZEA 2C8WB 3CS0A 1JMOH 1SQTA 1C1QA 2A5IA 1F0SA 2G5NA 5AVDA 1MU8B 5JDUB 2STBE 3V13A 1TPPA 2CK3D 2JIZD 2GJGA 1UVSH 1TABE 3BG8A 1RTFB 1AY6H 1SLWB 2ZWLH 1OWJA 1YCPH 1O2IA 4GCHF 3D49H 1OS8A 2YOLA 2P8OC 2CF8H 1J9CH 3QX5H 3DSGA 2GV6A 1MBMA 5FBEA 2HALA 3NCLA 2ZTYA 1AB9B 3ATLA 3SJIA 4I7YH 4X8VH 3K6YA 1FIWA 3KGPA 1VITF 3GY2A 3UWIA 5FPYA 5K0HA 4OS1A 3N7OA 1QQ4A 3U8TH 2Y6TA 4UFDH 3PO1C 1MQ5A 3SORA 1XUHA 5E2OA 2P3FH 1TOMH 4X2YA 2XC0A 4YZUA 1QURH 1XKAC 1EOJA 2BZAA 2OD3B 1EP5A 1GG6B 3KQ5A 5LPEA 1BHXF 2R3YA 3M5MA 1P8VC 1HAIH 2Y80A 3RXUA 3MU4A 1C1UH 1UCYK 1LMWB 4A1XA 4FUJA 4WJG2 3EE0B 4D9RA 1TPOA 1GCTB 1UTOA 2A4OA 2PTCE 2Z7FE 3BEFB 1CO7E 2FOBA 3F9EA 1O2VA 3RXSA 5EQSA 2HVYB 5E0GA 1K1JA 1E37B 1DT2A 1F0UA 1O38A 3GICB 4E7RG 4DURA 2FP7B 2ZA5A 3UR6A 2ZGJA 2XNIA 1SI5H 1V2KT 4ABEA 1K9OE 2PKAA 1QCPA 3V0XA 1FY8E 3BN9A 3AW1A 2Y82A 2ANYA 1TGBA 1YYY1 4XFQA 2YNAA 4ESTE 2D26C 4WH6A 3LGTA 2J92A 1VCQA 1BQYA 4CRGA 1PPZA 1UK4A 1F5KU 3ENSB 1MTNB 1V6DA 1SGNE 1TPAE 4GCHG 2AERH 4DIHH 4YO9A 1A5GH 3SUGA 4IMZA 1Z6JH 3DA9B 1GJDB 1IQNA 1GHAF 1GWAA 2FM2A 2BLQA 4KTCA 1D3TB 1ELBA 1T8LA 3T28A 1GDNA 5G4BA 3S69A 1PJPA 1VITG 3UB0A 5I25A 1VJAU 3ZZ8A 2FZZA 3LJJA 1A4WH 3D23A 3LGWA 3PWBA 5JBTA 2XBVA 3I77A 4OS2A 4ZKSU 3RXTA 1FY5A 1ZJDA 3K65B 4B71A 3F2HA 3PYHA 1GHBF 1V2LT 4WF8A 2K1QA 1IQHA 1ZMLA 1BB0B 5KGOA 5FCKA 3WW7A 3GISB 4Q7ZA 3MO9A 1O5FH 1TNKA 5GXPA 5CHAC 5C0UA 2ZU4A 2SGDE 1ANEA 2VNTA 1Z6EA 2EEKA 2FOAA 2ZGHA 3DFJA 5BRRE 4X2VA 4DIIH 1JIMA 3OEED 1DWBH 3H7OA 2FO9A 2PGQB 1TONA 4Y8YA 6ESTA 2FX6A 1EZSC 2B8OH 1CA8B 4H4FA 1O3EA 3PTBA 1DWEH 3OX7U 4MQAA 4THNH 1GI6A 1PFXC 1G32B 4Y10E 3SN8A 3ZV8A 1H9HE 4Q7XA 5L2ZH 1F0TA 1OWIA 3GY6A 1AFEH 1SGEE 2VGCB 1GJ7B 3OSYA 1KDQA 1IHSH 4GHQA 1IHTH 4KTSA 3ATMA 3E8LA 3S0NA 1B7XB 4NFEA 1V2TT 4F55A 3K9XB 2ZDNA 2HVXA 1O2UA 4JK6A 1ZTLA 1HBTH 3GCHB 4RT0A 3SJ8A 1OWHA 4X8TH 2VH0A 4XRNA 3PV5A 3DSOA 4NIVA 2WPIS 1BTUA 2ZDVH 1L4ZA 3BTEE 1QB9A 2Q6DA 1GBHA 1ZSLA 1AGJA 1GHAG 1S82A 3AAUA 2CV3A 1K0HA 4I8LA 3KNXA 1LVOA 1GHVH 4CR9A 2RCEA 3T27A 1T31A 1TQ0B 1IQFA 1KTSB 1WV7H 2FWWA 1QB6A 1SB1H 3BF6H 3BV9B 4Q63A 5LGOA 4X8SH 2WSSD 3TGJE 1NBME 3UOUA 1GHBG 1BRBE 2FXRA 3PMBB 3T5FH 3MYWA 2QF5A 3HK6B 2BOHB 1AE8H 3TK6A 4KELA 3PMAB 2BDGA 4INLA 1FNIA 1LHDH 1Y3WA 1ZHPA 2OC8A 2J97A 4Y0YE 3PMHB 1NRPH 2NU1E 4I33A 1HAPH 1JXPA 2PGBB 2BD4A 4NWLA 2BD9A 1NTPA 2BD2A 1C5NH 1MBQA 2AGEX 2W3IA 1VKYA 2A4QA 3W95A 1XUKA 3AASA 1F7ZA 4LXBH 3OEHD 5DP9A 3VGCC 1G30B 3T2NA 4B6EA 4HG6A 1GMHF 2ZTXA 5FHTA 1QGFA 4A1VA 1EAIA 1TYNA 4FUGA 3SOSA 3ZVCA 1RIWB 2LPRA 3H5CB 1LKBA 1F92A 1YLNA 4D7FA 1P2QA 4TPIZ 1UK3A 1C5UA 1KYNA 2ZQ2A 3QLPH 4JYVH 1DY8A 1O36A 1QBNA 5EU8A 4K1TA 1D6RA 1IQEA 2FTMA 5LPFA 4CRBA 1Z8RA 3RUOA 1AUJA 4OS4A 2AMPA 2FTLE 1TRMA 1RTLA 2WYJA 3LC3A 3KQCA 1MCTA 1EX3A 5FXLA 2ZPRA 3MU0A 7ESTE 1SQOA 3VG8A 1O5BB 1TX7A 3EYDA 4JZDH 3BIUH 1TMTH 2BYAX 3UNRA 3E0PB 3S7HB 3SO3A 2ANWA 1GMCF 3NK8A 2LELA 1PYTD 5AFYH 1LPGB 1LDTT 3SV2H 2C8XB 3LOXA 1NFUA 1XVOA 3JZ2B 3ZVFA 1CSOE 1UHBB 4GSOA 4YT7H 1HUTH 3DUXH 4ABBA 2V6NA 1AO5A 1ZJKA 2ZG0H 3SNDA 1CE5A 1O3NA 4O03A 1AKSB 1O5CB 1OP8A 2HLDD 3BEIB 3EA9A 1NN6A 4XBCA 2M2AA 2HPPH 4KTUA 1K2I1 2VB0A 3RXKA 3EAJA 3Q3XA 1IQLA 2UUYA 2V0BA 2C8ZB 1Y3UA 1O3PB 4CRCA 2K0QA 1D3PB 2ZQ1A 3RU4D 3SW2B 1T4VH 2AIPA 5A09A 3MO3A 4JZFH 3RMLH 1BJVA 3E3TA 5EQRA 2FOGA 1YY3A 1V2WT 2A5KA 3BG4C 4JZIA 4A92A 4A6LA 4WXIA 5GIBA 4I32A 3KHVA 1B5GH 5EG4A 1O2XA 1TGTA 3VB6A 5T6GA 2HGTH 1GMHG 3OTPA 3STIA 1V2RT 2J9NA 2TGTA 2ZFQH 3UPEA 1C2KA 1YCPK 1O3GA 2BXUH 3QGJA 4RN6A 2VIOA 1IQGA 1NRSH 4AFQA 1BHXB 1L1NA 1E36B 2ZHWH 3T29A 1AZZA 4WWYA 2FYRA 1ESTA 1GVKB 3RMOH 2R0KA 1DVAH 1GVLA 2XWAA 1GPZA 1Z71A 3U9AH 2P3UB 5A0AE 1WYKA 1YPHC 1T8MA 4R0IA 4AGKA 3HPTB 4ZUHA 1SGIB 4TSFD 1Y3XA 3P8GA 1PPGE 3T26A 1PPCE 1YBWA 2W26A 2XC5A 2Z9KA 3A86A 2V3HH 1DOJA 4YOIA 1TWXB 2CHAB 3ATWA 1GMCG 1Z8JB 3SUDA 1J15A 1O37A 2TIOA 2ZFTA 3A7XA 4WY3A 3SU3A 1C2LA 5HIYA 1SQAA 1KLIH 2Z9GA 1LHFH 2WPKS 1CT2E 2BDYA 4H6SB 1Y5UT 3D62A 1ZRKA 1HAHH 1HJAC 1KSNA 2AHME 1L1JA 3RLWH 4X6OA 4K1EA 2H1UA 1FY4A 4YXWD 1UTPA 2QXIA 4Y7AA 2A4RA 4YLQH 5T6DA 1DPOA 1DE7H 4AORA 3SU6A 4NIXA 5JYIA 1DWCH 1J17T 3SHCH 1TRNA 4P02A 1TQ7B 4LZ1H 1NS3A 4PROA 5F8TA 4E05H 1LVMA 2KX4A 2F9UA 1V2VT 1Q31A 4I8GA 5A2MH 1HJ9A 2BD8A 5GCHG 1H4WA 1SLXB 1ELTA 1ID5H 4O97A 3B23B 2KCOA 1RFNA 3M61U 3QUMP 1GI5A 4CR5A 3RXFA 3DHKH 1SFIA 2OTVA 2AIQA 2EI6A 1EXFA 1RD3B 5C1XA 4FU7A 1BUIA 2GP9B 2GD4B 1FONA 1GBLA 3SV6A 3VB7A 3MNBA 1BBRE 3KF2A 1A3EH 2PWXA 5E0JA 5EJZA 4CBOA 3MU8A 3O8BA 1HIAA 4K8BA 3N7DA 1E79D 1P09A 1WTHD 2Z3CA 1S0QA 2EC9H 1TFXA 4X1PU 1O3CA 1BBRH 3PTNA 2ZGBH 2IJOB 3P8OA 5DN6D 2J2UA 2TGDA 3BTKE 2VBCA 4ASHA 4ABJA 1GBJA 2BD5A 3AVZA 7LPRA 2PLXA 1SLUB 2RDEA 3SU0A 1SGRE 2P16A 1EPTB 1HGTH 3PV2A 4CH8B 1O2LA 1XKBC 1SQRA 2ANKH 3WWFA 1DANH 2TGAA 1N8OC 1WSSH 3ZZ5A 1S84A 4KGAA 3PLBA 1A5IA 1TIOA 5HIZA 1GL1A 1L2EA 4X6NA 1M9UA 1P9SA 2L74A 3STJA 4NA9H 1AHTH 3RXIA 1DLKB 3BTFE 1GI9B 5F6MA 1O30A 2F9BH 1FAKH 4ZMAH 1SOZA 3KYFA 5PTPA 1V2PT 1C4U2 1W11U 1SGQE 1HAOH 3ODDA 1Y3VA 1YPKH 3RXBA 5TCAA 1O2NA 4Q7YA 1ELGA 2H5CA 1S6LA 5F8XA 1ZTJA 1V2MT 2UUKB 1P12E 4Z6AH 3F1SB 5E2PA 1NFWA 2ODQA 1C5ZB 5DP4A 3M36A 4NFFA 1CQQA 2ZHEH 3OU0A 1BTXA 3M37A 4JZ1A 2ZU1A 3F6UH 1TAWA 3QDZB 4MNYA 5CE1A 3CNRA 3B8JA 1P3CA 3QN7A 3UUZA 1AD8H 1O5EH 1C4V2 2ZFRH 2IPHA 4AFSA 2QF4A 2ZC9H 1P04A 3MTYA 3NXPA 1O2KA 4TY6A 1BTZA 1GG6C 2GV7A 2P3TB 1ELEE 2WPMS 4X1NU 5T6FA 1MKXH 1GI8B 1DY9A 1ETRH 2QGRA 4AC9A 4ISNA 3ZZ9A 2XRCA 1K1PA 1WBGB 1GHYH 4XD7D 3F68H 4GLYA 2ZFSA 3EGKH 5L6NH 3ZVGA 2ASUB 3TU7H 1EB2A 1AU8A 3RP2A 1GCTC 4YOJA 2FLRH 4TWYA 6CHAB 2EI8A 2PUXB 2W7SA 4AFUA 4IGDA 2GMTB 2VU8E 1O3FA 4OGXA 1FY3A 1C2GA 4FUEA 1DM4B 4FUFA 2WV5A 1EZUC 1A46H 1TGNA 4CBNA 3DCLA 1NT1A 1OPHB 4QT8C 3TLOA 1TNJA 2G4UA 3A7ZA 2QC2A 3SZNA 1GJ6A 1KXCA 3ESTA 3P6ZB 2QIQA 1KMHB 4ZAEA 3O8DA 2XOKD 2ZU5A 1HAVA 3EA7A 3SNEA 2CXVA 1HXFH 1RJXB 3PV4A 4CREA 2OCVB 4Y76A 3UFAA 1C5RA 2BQ6B 1ELDE 1MTNC 2FOMB 3PB1E 3MO6A 3TH4H 1MD8A 3SV7A 1G36A 2ZNKH 1P02A 2ESTE 1COWD 1GGDB 1LQDB 3SI4H 2R9PA 3U8RH 1A61H 1TX8A 2HOBA 4RI0A 2XWBI 3E1XB 3LDXH 1P2IA 2BQWB 1NRQH 1K1IA 2FI5E 1ACBE 2KR7A 1JRSA 3ATKA 2D1JA 1MH0A 1P57B 3SQEE 3SGAE 1D3DB 4DVAU 1BT7A 2XNDD 4A5TS 1MZDA 4FUIA 1H8IH 3SQHE 5KEDA 2SGAA 2ZHFH 4JK5A 3W94A 1P3EA 5DPAA 4ISLA 3LH1A 1ZMNA 1NFXA 4UDWH 1G9IE 3MNCA 4VGCC 5FL7D 5FPTA 2HLCA 2KAIB 5IYTA 2UWOA 4BTUB 5KECA 1EJMA 4WMEA 2YMSC 1ZZZA 3TPIZ 2BD7A 3UAIC 1TNLA 1F5LA 4MPWA 8LPRA 3PLKA 5FCRA 1OWEA 1AIXH 1L0ZA 4YT6H 3RXAA 4IC6A 1C1OA 2KCYA 1HB0B 2RFKC 2W3KA 2NU3E 3S9AA 1WTGH 1P06A 1FAXA 1C9PA 2GZ9A 1TLDA 1AE5A 1OYQA 4GPGA 3CP7A 1O39A 2VGCC 3RC5A 3I29A 4E06H 3GCNA 2BDIA 1TA6A 4FUCA 4I8HA 4AYYB 2G51A 5DGJA 2D8WA 4NGAH 3QO6A 9ESTA 1Y59T 1C9TA 1FXYA 4FVDA 1QIXB 4IC5A 1QJ7B 3NZIA 1O2MA 4X0WU 2ZKSA 3V12A 1UJ1A 1PPBH 1C1VH 1GI4A 2AMDA 3F9FA 2OC1A 1ABJH 3GCHC 4ZXXH 8ESTE 2JETB 1PPEE 1ELCA 1UTLM 4GVUA 1MD7A 2AS9A 3Q3KA 1O2WA 3A84A 1K1MA 1C1TA 3E16B 5A8ZA 1Z1IA 3BIVH 2PHBA 3RXLA 1OYTH 2JJ2D 3A8CA 4CH2B 4BTIB 1Z1JA 1YF4A 3SU5A 3M7QA 1D4PB 1C2FA 1GHWH 4IBLH 1C2DA 2PW8H 1L4DA 2ILNA 3QTVH 1UTKA 4X6PA 2XBWA 4FUBA 5GJ4B 1T8NA 3DSPA 3URDA 1BMLA 1NBMD 2I6SA 4FXGH 2BY5X 1PYTC 1O2TA 2F3CE 3PMJA 1TMUH 1RTKA 3GCOA 4RSPA 1GBBA 1XVMA 2UWLA 2FS9A 3TJUA 2G55A 3UNSA 1HAGE 4Q80A 4X1QU 1SG8B 1EOLA 1TMBH 2AGIX 5DG6A 4IW4E 3E0NB 1GMDF 1DDJA 2SGFE 1PPFE 1TPSA 3S9BA 3A81A 2GCTB 2C3SA 1KY9A 1A2CH 1CA0B 1V2NT 1Q2WA 3RXCA 1XMNB 5FX5A 2B7DH 4AN7A 2ZPSA 2J98B 1C2HA 2Q6GA 1E35B 2VWMA 2W6JD 4Z0KA 2GX4A 2VIDA 1RIWC 1GDQA 3FP8E 1YPMH 4F48B 1O2RA 3SJOA 1T4UH 1O2YA 1PQ5A 1NU9A 2JDID 4ACAA 1LQEA 2UWPA 3LJOA 2SNVA 1TX6A 1SMFE 1V2QT 3SU2A 4MNVA 1TNHA 2JH5D 3SV9A 5DO4H 1UTMA 1A1RA 5ABWA 3S7KB 2ZCHP 2GKVE 1SSXA 3FVFB 2ZI2H 3PRBA 3RXGA 3ATIA 5K7RA 4HFPB 1NRRH 1P9UA 1EAUA 4ABGA 1S0RA 4OS7A 1ETTH 4MG3A 1NZQH 1O3MA 2P59A 3PROA 1DX5M 2G4TA 3DD2H 4D9QA 1CHGA 2VINA 4OS6A 1GJ9B 1ARBA 1QJ1B 1QB1A 2VIQA 1QHRB 2QXHA 1S81A 1UW7A 1FJSA 4ABFA 1JRTA 1IQIA 4ZROA 2PR3A 1RXPA 1VCWA 1OXGA 4BNRA 2XBYA 2EQNA 2BY7X 1BBRK 2J4IA 4Y8ZA 4LZ4B 3SUEA 3K6ZA 4NIYA 3TNTA 2HPQH 1BCUH 3EQ0H 1TNGA 1IQJA 2PP6A 2CMYA 3SUFA 3MOCA 4IS5A 5IDKA 2BVSH 1P2MA 4NA7A 1HIAB 2JKHA 1GI0A 1Y5BT 1NRNH 4Y79A 5JBAS 3LC5A 3SI3H 2ZECA 4LOYH 1QL7A 5SGAE 4B2CA 3MNXA 2LNCA 4B1TA 2ZIQH 2SGEE 4INHA 1AVWA 2Y7XA 3F0OA 1HYLA 4Y0ZE 2TBSA 3IWMA 1NU7B 4I8KA 3DT0H 1YLCA 4NSVA 1G3EA 1O3IA 2F43B 2H9EH 3N7EA 2DUCA 4UFEH 5E8EH 4Y8XA 3A7VA 2BDBA 2IPQX 3KQDA 2ZCLP 1WQVH 5DJ7A 1AWHB 1E1RD 1O5DH 3FP7E 1NESE 1YPEH 1HJ8A 5C5NA 2BOKA 5A8YA 1OX1A 2XW9A 3VFEA 4E7NA 5L30H 1OWDA 3OFND 3UQVA 1SFQB 5F03A 3HKJB 4CRDA 3FOAA 4NCYA 1GBEA 1H1BA 1KLJH 3F9GA 2FOCA 1EUFA 3ZVEA 1AQ7A 3PWCA 4CHAC 2WPHS 2A7CA 4H6TA 2GCHF 4Z1MD 1LHCH 1LVBA 2FODA 4YLUA 2ZFFH 1QA7A 4WXVA 1LKAA 3LONA 3UIRA 5C67A 1C1MA 5EW2H 2Y5GA 1ZMJA 1LCYA 3VGCB 1H8HD 1FQ3A 1YPJH 1QY6A 4JCNA 2VVVA 4ASUD 3BSQA 1C2JA 2QE7D 1CBWC 2NWNA 5LPRA 1C5VA 3TNSA 2JH6D 1O3LA 3SJ9A 3LT3A 2CHAC 3CENA 1HV7A 3RXPA 1W3CA 3E6PH 4BOHA 1MKXK 1THSH 1O2PA 3U28C 2ODYB 1SVPA 3M7TA 1K22H 3MH4A 2FI4E 5I46H 3M7UA 1GI2A 1MTUA 3ZV9A 1N1LA 1GBAA 1QFKH 1TE0A 4AZ2B 3BTHE 3LGVA 4RKJB 4ZHAA 3UWJH 1NC6A 1KIGH 1E38B 3P8NA 3HK3B 1BMFD 2A45B 1ZOMA 2WUBA 4AFZA 1ABIH 1GBDA 2XYAA 4ACBA 1QNJA 1QRXA 1EZXC 1GI3A 5C20A 2QA9E 4B76A 4O3UA 2G5VA 1EB1H 2UUFB 2FDAA 1AFQB 4NZQA 1O3AA 1PPHE 1PQ7A 1VJ9U 2AGGX 2VVCA 1MABB 3NWUA 2A4GA 3RXRA 2BB4A 2PTNA 3LGIA 3UNQA 2HRVA 1CU1A 2ODPA 7GCHF 1ZPCA 4U30A 1O3OA 3T62A 5EOKA 2OC7A 2J34A 1ZPZA 4ZHMU 2BHGA 3LPRA 2ZPQA 1VGCB 1F5RA 2HNTC 1N6YA 4MTBA 3GY7A 1MKWH 2BX4A 5T3HA 1FY1A 4O9VA 1HDTH 1GBMA 2QYIA 4TY7A 1Z8GA 2V7QD 2K8IA 1GHZA 1C5SA 1O5GH 2F91A 2CGAA 5AHGH 4TPYA 5DSFA 3TITA 3SBKA 2V3OH 4K69A 1XUJA 1HAVB 3GDVA 3TK5A 3ZZ4A 1SHYA 2ZFPH 2CJIA 3SHAH 2H6MA 2GDEH 4U32A 9LPRA 5CMXH 3WWBA 3U69H 3GDUA 1W8BH 3JZ1B 1O5AB 2RA3A 1FI8A 3URCA 4BXSA 4AYVB 2QF0A 2RA0A 1OP0A 1THPB 1O2OA 3I78A 3U98H 8KME2 1BZXE 1GHXH 2OLGA 1ESAA 1TOCB 1C5YB 3LGYA 4Y11E 1MMJN 2Q1JA 1ZPBA 1O2QA 4UD9H 1P2OA 3GDSA 3ZZ7A 3ITIA 1X7AC 1G2LA 3EA8A 1TNIA 1EPTC 2AH4X 2RG3A 2A2XH 3M3VA 1QTFA 3UOPA 4BANB 1TALA 3AK5A 2WPJS 1FV9A 3Q3YA 3GYLB 2PKAB 3A80A 1IOEA 4UEHH 1DLEA 5JBBS 3KL6A 2A2QH 3GCTF 5JB8S 1ANDA 1UO6A 4Y7BA 1NO9H 5EGMA 3SJKA 1ZGVA 2PV9B 3SNBA 4INKA 1T7CA 4ISIH 1FUJA 2WZQA 4GUXA 1A5HA 1QRWA 4I8JA 1DFPA 1Q3XA 5DP6A 1EJNA 1W13U 1BTHH 1ZYOA 1GCDA 3A7WA 4BTTB 5J4QA 2IN2A 2F9NA 2A7HA 5EPYA 1C2IA 2BM2A 2XCFA 4ZH8A 1O3BA 1S5SA 2FOHA 3VB3A 1KLTA 1EQ9A 1G37A 2H2ZA 3SYJA 7GCHG 1B0FA 2C93B 1Z8IB 1HJAB 3B9FH 1UVPA 1FMGA 1QQUA 2OQ5A 2ZZUH 2ZU2A 4SGBE 5ETXA 2ZO3H 2WINI 3LGUA 3ODFA 1D6WA 2FEQH 1SGPE 6LPRA 1HAXB 1OHHD 3F2FA 3MH5A 1YP9A 3TGIE 1BTWA 1D9IA 2VH6A 4ZKOU 2P94A 3KIDU 1HFDA 4ABDA 1U6QA 2J95A 3MNSA 3ZZBA 3C1KA 3FZDA 1SGFA 1JWTA 1QJ6B 4BAHB 1GBFA 2GZ8A 2BX3A 1FIZA 2CF9H 2XXLA 3ZZDA 2ZDLA 1GBIA 1C5PA 3CS7A 1UK2A 1IAUA 4FOUC 4J1YA 4NG9H 3TVJB 2L6OA 2QF3A 1A7SA 3BTTE 3MU1A 1O3DA 1BTYA 1SBWA 4IN1A 3UTUH 3FN8A 3VB4A 2D2DA 1DSTA 1GI1A 2OXSA 4MDSA 1LVYA 6CHAC 2BVRH 2ZDKA 1UHBA 3L33A 2GMTC 2G8TA 1OOKB 3FFGA 1AB9C 1AVGH 1Y5AT 1AKSA 1KDQB 4MLFB 2Y5HA 2FLBH 4OGYA 3GCTG 5HKKD 1SGCA 4YESB 5L2YH 1P03A 3NKKA 1TBQH 5C1UA 2ALVA 2BLVA 2TGPZ 1SR5C 2WYGA 3ZYEA 2QXGA 1EFRD 3T25A 3E90B 1ORFA 5EJ1A 4WVPE 1YPHE 1FZZA 1TBRH 2A1DB 1P2KA 4D7GA 4HI3A 1J16A 4OM9A 1P10A 1O2ZA 1P11E 2BY8X 4FUHA 4WH8A 1ZSKA 3VXFH 1K1NA 1MTWA 4FUDA 3PRDA 1GGDC 2ZHQH 1FX0B 2OBOA 1T32A 2IJD1 1NFYA 3M5OA 5C17A 1GJAB 2PSYA 2P93A 1L1GA 1Y8TA 1IQMA 2Y81A 3KYGA 1C1RA 7KMEH 4GAWA 5EXMA 1QZ8A 5DP5A 4RT1A 2HNTE 1MZAA 1C5LH 3H09A 1GI7B 1UVOA 4M7GA 4X1SU 4FU8A 1XM1A 3NPSA 4XOJA 1K1LA 4BAKB 3MWIU 1DS2E 1ZSJA 3KN2A 4NA8A 2Q6FA 1KXEA 4DT4A 4X1RU 5HGGA 3EDXB 3MHWU 2A0QB 4DGJA 1AZ8A 2OQUA 1HNEE 1MTVA 5HMAA 1QL8A 1O32A 2R3UA 3R0FA 4YTAA 1BA8B 2PKSB 1EAWA 3RXHA 2W6ID 5HM9A 2FPZA 1GBTA 2BQ7B 1QRZA 2EI7A 1BTPA 2TRMA 1THRH 4YOGA 8GCHF 4JYTA 2Z9IA 2NU2E 3MU5A 3OYPA 2WPDD 1O3JA 1CGJE 1RS0A 4U2WA 1W0JD 2QY0B 2Y5FA 4B6FA 1O31A 1MAYA 3TK9A 2JJ1D 3TJVA 1MU6B 4UFGH 1HAYB 4NIWA 2VWLA 2V35A 3RM0H 1E0FD 3TJOA 4DJZB 4JZEH 2P8OB 2F9OA 4ZHLU 2H5DA 4GHTA 3E91A 3SNCA 2JETC 1SGFG 2KCPA 3UREA 3MI4A 3RXOA 1C5TA 1BDAA 3F3BA 3F0PA 1BMAA 1K28D 2FESH 1C4Y2 3OY6U 3A8AA 3GS9A 2XCNA 5C94A 1ZHMA 3RXMA 4YM9A 3L6PA 1GJCB 3TGKE 4UONA 3N99A 1ETSH 3PO1B 4B75A 1A3BH 1FN6A 5HM2A 1NROH 3A89A 1ELAA 5J4SA 3P95A 1YCPM 4MPUA 1H8ED 2SGQE 5HYOA 2AYWA 1BITA 1KXAA 5JPMH 2B5TB 4Y71A 5TCCA 3A8BA 1TBZH 1KXBA 1A0JA 1J14A 3EE7A 2VIVA 2H9TH 4AB9A 4BXWA 5EJLA 4XBDA 2PFEA 2BDCA 4BAMB 2PUQH 2F4LA 1IQKA 3FZZA 3R3GB 1C5OH 1C5WB 1WU1A 1ZGIA 1ZTKA 2JH0D 6GCHF 3UY9A 3WY8A 3RXVA 5DP3A 2GCTC 3RU4T 2QCYA 1J8AA 2FX4A 4K8YA 1HLTH 3QTOH 1CA0C 3NRLA 3ZVAA 5C3NA 4DCDA 1EPTA 3BTME 1BMNH 4MPVA 2OINA 1RRKA 3SU1A 2ZF0H 1TB6H 1O2HA 1C1SA 3MMGA 3LKWA 4NZLA 1GJ5H 2HNTF 3RC4A 2O8LA 8GCHG 3OTJE 1VR1H 3O8CA 2WHXA 3V3MA 4ISOA 4U01A 1WDIA 3FANA 2W5EA 4KKDA 1WCZA 5DP7A 1FPCH 1RGQA 4VGCB 1MKWK 3P70B 2SNWA 4F4OC 3SU4A 2Z94A 5DK1A 2BMGB 5AF9H 1TGSZ 1YKTA 3RXJA 2YMSB 5F53A 1C2MA 1HAZB 4WMFA 1FDPA 1S83A 2VWOA 4I31A 1YPGH 2NU4E 3A8DA 1HRTH 1BMMH 1W10U 1WUNH 3FAOA 2SGPE 3VPKA 3U1IB 4JMYA 2WPLS 2WV9A 5EQQA 1HCGA 3A7YA 3ZIAD 3D65E 1C2EA 1PQAA 1UTQA 4H42U 1SGDE 1CGHA 4AB8A 5CHBA 4KP0A 2VJ1A 2XC4A 2P95A 4ZXYH 3OE7D 3TH2H 4BAOB 3ZZ6A 3ZVBA 4B74A 2C4FH 2ZTZA 3O8RA 4DW2U 5CHAB 1N6XA 4M9FA 2Z3DA 1GJ4H 1NM6A 2H9HA 2QAAA 2XTTB 3RM2H 1UTJA 4P00A 1C5QA 3UR9A 4A1TA 4RKOB 4FETA 1MTSA 2W7UA 2LP6A 3BEUA 3G01A 3KCGH 2EA3A 3RDZA 1QBOA 2A31A 6GCHG 1O34A 1ARCA 1O35A 2EY4C 1F0RA 5E0HA 1EASA 1SHHB 2BD3A 3GY8A 4XBBA 2QN5T 2GGVB 4ZCNA 1Z7KA 4Q2KA 2ZEBA 1UVUH 3SV8A 3TH3H 1XUIA 3ZZCA 4X2XA 5B6OA 3GOVB 3FP6E 3M5LA 3UQOA 2YMSD 2ZU3A 4LK4A 1GBKA 2G00A 5FBIA 1H9IE 2G81E 2WV4A 3A85A 3VXEH 2OK5A 1QL9A 3M5NA 4WMDA 2C90B 2BY9X 1NY22 1S6FA 4CRFA 1OSSA 1C1NA 2TPIZ 3RMNH 4AG1A 2ZGCA 1O33A 4XDEA 3MH7A 4IMQA 1O3HA 1EJAA 4HTCH 3F2GA 2ZHDA 3GY3A 3HGPA 3NUMA 2BLOA 2O9QA 1V2JT 3BTQE 1P01A 3Q76A 2BY6X 3TJNA 2DE9A 4B73A 5CDFE 1GMDG 3FKSD 4O3TA 1E34B 2KZ4A 2VIWA 1K21H 3QGNB 1UCYE 4ZKNU 1LHEH 5EIYA 1SKYE 5DKMA 4UFFH 2GT8A 4FU9A 4SGAE 1W2KH 2OUAA 1BOQA 1V2UT 1YM0A 1LPKB 1WAYB 3QZRA 2I6QA 1T8OA 1E1QD 1UCYH 3GY5A 1P05A 1W7XH 1TRYA 3ZZAA 1OWKA 5HXFA 1ELVA 5EODA 1MUEB 1V2ST 1MQ6A 1ZHRA 1SC8U 4IN2A 2STAE 1AUTC 3RC6A 1BRAA 1V2OT 1ELFA 1A0LA 4AX9H 5LH8A 1HXEH 1SOTA 2KAIA 5F8ZA 5JB9S 3PM3A 1AFQC 5T1VA 2HWLB 1DITH 3OY5U 2R2MB 4TYDA 3W1EA 1FN8A 1MAXA 1SGYE 2V3MA 3C27B 4AG2A 4HZHA 5ESTE 4ABAA 2OC0A 3AW0A 2BZ6H 4K5ZA 4CRAA 2ANMH 1VGCC 2A7JA 3IG6B 2A5AA 1KXFA 2AEIH 1AVXA 4NWKA 1ZRBA 2KFWA 2J5UA 2GZ7A 1JBUH 1KXDA 1O2SA 4TWWA 1AN1E 2VWNA 5AFZH 4D8NA 2R0LA 2Y7ZA 5B6LA 5EXNA 1SLVB 1ZLRA 3F9HA 1C1WH 1W14U 1XXDA 2AFQB 1VZQH 5C2ZA 2FI3E 5GCHF 1CHOF 3PLPA 1GVZA 5DP8A 1GJ8B 2GT7A 4Q4LA 1AWFH 4X8UH 5EXLA 3U8OH 2BDAA 1F2SE 2GVFA 3A88A 3GY4A 3RXDA 3MQKC 3BTGE 3ZYDA 1UTNA 2FYQA 2O8WA 3IITA 2ZDAH 3A87A 1WXRA 1JIRA 4I86A 2R2WU 3GYMA 5FPSA 3Q00A 3QWCH 5ESBA 2O8UA 4CHAB 4B2AA 1UMAH 1YWUA 3HGNA 1DUAA 4ZKRU 1KTTB 1LO6A 1WQSA 1H8DH 2XBXA 1W12U 4UE7H 1DXPA 1YC0A 4J2YB 3RU4E 1PQ8A 3BTWE 4NSYA 1OKXA 1W0KD 2DE8A 1CBWB 1SPJA 2F9VA 1EZQA 1G3DA 2GCHG 3SGQE 1BIOA 2QXJA 2ZP0H 3M3TA 3LH3A 3A83A 3BG4B 1CT0E 3P17H 1XUGA 2BTCE 1W0YH 2THFB 1TA2A 4D76A 1BJUA 2NU0E 1LTOA 2O8TA 3SNAA 2F83A 2J98A 3MFJA 3OAAD 5GNDA 4ISHH 1DUEA 2RDLA 1GL0E 3RXEA 1YLDA 1EATA 5A8XA 1INCA 3U1JB 2O8MA 4ABIA 5GDSH 4B2BA 1C5MD 1NPMA 2Z6BD 2G52A 5TJXA 5C1YA 1DICA 1AMHA 3MH6A 2FS8A 3KQBA 1XUFA 5BPEA 1MCVA 2YNBA 5IK2D 4MNXA 1FLEE 1P0SH 2Z9JA 2B9LA 4K1SA 5H4IB 3ZZ3A 1CHOG 1O2GH 1O3KA 4X6MA 2FIRH 3VB5A 5JBCS 3M35A 3A82A 1YGCH 3M3SA 3K2UA 3KQEA 1ANCA 1BRCE 1QBVH 1HPGA 3LIWA 1LPZB 1FPHH 1GDUA 4DY7B 3V7TA 2ULLA 1O0DH 4AOQA 1XX9A 1G3CA 2J38A 1OP2A 2BVXH 2BLWA 2CN0H 1GBCA 4FVBA 2AMQA 2WUCA 2BXTH 3P8FA 4DG4A 4XE4A 1ZR0A 2BDHA 3VEQB 1C5XB 3P92A 1XXFA 3RLYH 2M5TA 1V3XA 4DT7B 4JYUH 1UVTH 2A32A 2KCAA 2ZDMA 1S85A 3A7TA 4TT3D 2Z9LA 2Z3EA 4A7IB 5A0BA 5FX6A 1VITH 1P2JA 2FOFA 3DFLA 3KEEA 4MVNA 5EW1H 4F49A 2FOEA 5EPNA 1CVWH 3Q77A 5FAHA 1YPLH 2FMJA 1QA0A 4R8TB 2SFAA
chains in the Genus database with same CATH topology
3L3TA 3QZQA 3S9CA 1EKBB 1G3BA 1Y3YA 1SL3A 3SGBE 3HATH 2J94A 4ABHA 1LHGH 3AAVA 1A0HB 2PSXA 1DSUA 2VIPA 1GJBB 1AI8H 1P2NA 5C5OA 2GTBA 3ZVDA 1ESBA 1JOUB 4XSKU 1SGTA 3LU9B 2VVUA 2F9PA 3H7TA 1WOFA 4K3JA 1TGCA 2UUJB 4HGCA 2OBQA 2GDDA 3BTDE 3QK1A 4X2WA 3TIUA 1H9LB 1K1OA 4MPXA 2ZCKP 1EAXA 3RMMH 2IOTA 1BRUP 4K60A 5GWZA 1W0ZU 2OP9A 5A0CA 4Y6DA 2ZGXH 1S6HA 2C8YB 1B0EA 1D3QB 1CT4E 4K2YA 2B0FA 5GPIB 1O2JA 1CGIE 1C1PA 2QV1A 4MNWA 2PKSC 1N8OB 4BAQB 1DWDH 2ALPA 1EP6A 1DXWA 3HKIB 3ELAH 1G2MA 4AGJA 1W7GH 4OS5A 1VCPA 3RXQA 1ANBA 4DOQA 1QR3E 2C8WB 3CS0A 1JMOH 1SQTA 1C1QA 2A5IA 1F0SA 2G5NA 5AVDA 1MU8B 5JDUB 2STBE 3V13A 1TPPA 1UVSH 1TABE 3BG8A 1RTFB 1AY6H 1SLWB 2ZWLH 1OWJA 1YCPH 1O2IA 4GCHF 3D49H 1OS8A 2YOLA 2P8OC 2CF8H 1J9CH 3QX5H 2GV6A 1MBMA 5FBEA 2HALA 3NCLA 2ZTYA 1AB9B 3ATLA 3SJIA 4I7YH 4X8VH 3K6YA 1FIWA 3KGPA 1VITF 3GY2A 3UWIA 5FPYA 5K0HA 4OS1A 3N7OA 1QQ4A 3U8TH 2Y6TA 4UFDH 3PO1C 1MQ5A 3SORA 1XUHA 5E2OA 2P3FH 1TOMH 4X2YA 2XC0A 4YZUA 1QURH 1XKAC 1EOJA 2BZAA 2OD3B 1EP5A 1GG6B 5LPEA 1BHXF 2R3YA 3M5MA 1P8VC 1HAIH 2Y80A 3RXUA 3MU4A 1C1UH 1UCYK 1LMWB 4A1XA 4FUJA 4WJG2 3EE0B 4D9RA 1TPOA 1GCTB 1UTOA 2A4OA 2PTCE 2Z7FE 3BEFB 1CO7E 2FOBA 3F9EA 1O2VA 3RXSA 5EQSA 5E0GA 1K1JA 1E37B 1DT2A 1F0UA 1O38A 3GICB 4E7RG 4DURA 2FP7B 2ZA5A 3UR6A 2ZGJA 2XNIA 1SI5H 1V2KT 4ABEA 1K9OE 2PKAA 1QCPA 3V0XA 1FY8E 3BN9A 3AW1A 2Y82A 2ANYA 1TGBA 1YYY1 4XFQA 2YNAA 4ESTE 2D26C 4WH6A 3LGTA 2J92A 1VCQA 1BQYA 4CRGA 1PPZA 1UK4A 1F5KU 3ENSB 1MTNB 1V6DA 1SGNE 1TPAE 4GCHG 2AERH 4DIHH 4YO9A 1A5GH 3SUGA 4IMZA 1Z6JH 3DA9B 1GJDB 1IQNA 1GHAF 1GWAA 2FM2A 2BLQA 4KTCA 1D3TB 1ELBA 1T8LA 3T28A 1GDNA 5G4BA 3S69A 1PJPA 1VITG 5I25A 1VJAU 3ZZ8A 2FZZA 3LJJA 1A4WH 3D23A 3LGWA 3PWBA 5JBTA 2XBVA 3I77A 4OS2A 4ZKSU 3RXTA 1FY5A 1ZJDA 3K65B 4B71A 3PYHA 1GHBF 1V2LT 4WF8A 2K1QA 1IQHA 1ZMLA 1BB0B 5FCKA 3GISB 4Q7ZA 3MO9A 1O5FH 1TNKA 5GXPA 5CHAC 2ZU4A 2SGDE 1ANEA 2VNTA 1Z6EA 2EEKA 2FOAA 2ZGHA 3DFJA 5BRRE 4X2VA 4DIIH 1JIMA 1DWBH 3H7OA 2FO9A 2PGQB 1TONA 4Y8YA 6ESTA 2FX6A 1EZSC 2B8OH 1CA8B 4H4FA 1O3EA 3PTBA 1DWEH 3OX7U 4MQAA 4THNH 1GI6A 1PFXC 1G32B 4Y10E 3SN8A 3ZV8A 1H9HE 4Q7XA 5L2ZH 1F0TA 1OWIA 3GY6A 1AFEH 1SGEE 2VGCB 1GJ7B 3OSYA 1KDQA 1IHSH 4GHQA 1IHTH 4KTSA 3ATMA 3E8LA 3S0NA 1B7XB 4NFEA 1V2TT 3K9XB 2ZDNA 2HVXA 1O2UA 4JK6A 1ZTLA 1HBTH 3GCHB 3SJ8A 1OWHA 4X8TH 2VH0A 4NIVA 2WPIS 1BTUA 2ZDVH 1L4ZA 3BTEE 1QB9A 2Q6DA 1GBHA 1ZSLA 1AGJA 1GHAG 1S82A 3AAUA 2CV3A 4I8LA 3KNXA 1LVOA 1GHVH 4CR9A 2RCEA 3T27A 1T31A 1TQ0B 1IQFA 1KTSB 1WV7H 2FWWA 1QB6A 1SB1H 3BF6H 3BV9B 5LGOA 4X8SH 3TGJE 3UOUA 1GHBG 1BRBE 2FXRA 3PMBB 3T5FH 3MYWA 3HK6B 2BOHB 1AE8H 3TK6A 4KELA 3PMAB 2BDGA 4INLA 1FNIA 1LHDH 1Y3WA 1ZHPA 2OC8A 4Y0YE 3PMHB 1NRPH 2NU1E 4I33A 1HAPH 1JXPA 2PGBB 2BD4A 4NWLA 2BD9A 1NTPA 2BD2A 1C5NH 1MBQA 2AGEX 2W3IA 2A4QA 3W95A 1XUKA 3AASA 1F7ZA 4LXBH 5DP9A 3VGCC 1G30B 3T2NA 1GMHF 2ZTXA 5FHTA 1QGFA 4A1VA 1EAIA 1TYNA 4FUGA 3SOSA 3ZVCA 1RIWB 2LPRA 3H5CB 1LKBA 1F92A 4D7FA 1P2QA 4TPIZ 1UK3A 1C5UA 1KYNA 2ZQ2A 3QLPH 4JYVH 1DY8A 1O36A 1QBNA 5EU8A 4K1TA 1D6RA 1IQEA 2FTMA 5LPFA 4CRBA 1Z8RA 3RUOA 1AUJA 4OS4A 2AMPA 2FTLE 1TRMA 1RTLA 2WYJA 3LC3A 3KQCA 1MCTA 1EX3A 5FXLA 2ZPRA 3MU0A 7ESTE 1SQOA 1O5BB 1TX7A 3EYDA 4JZDH 3BIUH 1TMTH 2BYAX 3UNRA 3E0PB 3S7HB 3SO3A 2ANWA 1GMCF 3NK8A 1PYTD 5AFYH 1LPGB 1LDTT 3SV2H 2C8XB 3LOXA 1NFUA 1XVOA 3JZ2B 3ZVFA 1CSOE 1UHBB 4GSOA 4YT7H 1HUTH 3DUXH 4ABBA 2V6NA 1AO5A 1ZJKA 2ZG0H 3SNDA 1CE5A 1O3NA 4O03A 1AKSB 1O5CB 1OP8A 3BEIB 3EA9A 1NN6A 4XBCA 2HPPH 4KTUA 1K2I1 2VB0A 3RXKA 3EAJA 3Q3XA 1IQLA 2UUYA 2V0BA 2C8ZB 1Y3UA 1O3PB 4CRCA 2ZQ1A 1D3PB 3RU4D 3SW2B 1T4VH 2AIPA 5A09A 3MO3A 4JZFH 3RMLH 1BJVA 3E3TA 5EQRA 2FOGA 1V2WT 2A5KA 3BG4C 4JZIA 4A92A 4A6LA 4WXIA 5GIBA 4I32A 3KHVA 1B5GH 5EG4A 1O2XA 1TGTA 3VB6A 5T6GA 2HGTH 1GMHG 3STIA 1V2RT 2J9NA 2TGTA 2ZFQH 3UPEA 1C2KA 1YCPK 1O3GA 2BXUH 3QGJA 4RN6A 2VIOA 1IQGA 1NRSH 4AFQA 1BHXB 1L1NA 1E36B 2ZHWH 3T29A 1AZZA 4WWYA 2FYRA 1ESTA 1GVKB 3RMOH 2R0KA 1DVAH 1GVLA 2XWAA 1GPZA 1Z71A 3U9AH 2P3UB 5A0AE 1WYKA 1YPHC 1T8MA 4R0IA 4AGKA 3HPTB 4ZUHA 1SGIB 1Y3XA 3P8GA 1PPGE 3T26A 1PPCE 1YBWA 2W26A 2XC5A 2Z9KA 3A86A 2V3HH 1DOJA 4YOIA 1TWXB 2CHAB 3ATWA 1GMCG 1Z8JB 3SUDA 1J15A 1O37A 2TIOA 2ZFTA 3A7XA 4WY3A 3SU3A 1C2LA 1SQAA 1KLIH 2Z9GA 1LHFH 2WPKS 1CT2E 2BDYA 4H6SB 1Y5UT 3D62A 1ZRKA 1HAHH 1HJAC 1KSNA 1L1JA 3RLWH 4X6OA 4K1EA 2H1UA 1FY4A 1UTPA 2QXIA 4Y7AA 2A4RA 4YLQH 5T6DA 1DPOA 1DE7H 4AORA 3SU6A 4NIXA 5JYIA 1DWCH 1J17T 3SHCH 1TRNA 1TQ7B 4LZ1H 1NS3A 4PROA 5F8TA 4E05H 1LVMA 2F9UA 1V2VT 1Q31A 4I8GA 5A2MH 1HJ9A 2BD8A 5GCHG 1H4WA 1SLXB 1ELTA 1ID5H 4O97A 3B23B 3M61U 1RFNA 3QUMP 1GI5A 4CR5A 3RXFA 3DHKH 1SFIA 2OTVA 2AIQA 2EI6A 1EXFA 1RD3B 5C1XA 4FU7A 1BUIA 2GP9B 2GD4B 1FONA 1GBLA 3SV6A 3VB7A 3MNBA 1BBRE 3KF2A 1A3EH 2PWXA 5E0JA 4CBOA 3MU8A 3O8BA 1HIAA 4K8BA 1P09A 1WTHD 2Z3CA 1S0QA 2EC9H 1TFXA 4X1PU 1O3CA 1BBRH 3PTNA 2ZGBH 2IJOB 3P8OA 2J2UA 2TGDA 3BTKE 4ASHA 4ABJA 1GBJA 2BD5A 3AVZA 7LPRA 2PLXA 1SLUB 3SU0A 1SGRE 2P16A 1EPTB 1HGTH 4CH8B 1O2LA 1XKBC 2ANKH 1DANH 2TGAA 1N8OC 1WSSH 3ZZ5A 1S84A 4KGAA 3PLBA 1A5IA 1TIOA 1GL1A 1L2EA 4X6NA 1M9UA 1P9SA 3STJA 4NA9H 1AHTH 3RXIA 1DLKB 3BTFE 1GI9B 5F6MA 1O30A 2F9BH 1FAKH 4ZMAH 1SOZA 5PTPA 1V2PT 1C4U2 1W11U 1SGQE 1HAOH 3ODDA 1Y3VA 1YPKH 3RXBA 5TCAA 1O2NA 4Q7YA 1ELGA 2H5CA 5F8XA 1ZTJA 1V2MT 2UUKB 1P12E 4Z6AH 3F1SB 5E2PA 1NFWA 2ODQA 1C5ZB 5DP4A 3M36A 4NFFA 1CQQA 2ZHEH 3OU0A 1BTXA 3M37A 4JZ1A 2ZU1A 3F6UH 1TAWA 3QDZB 4MNYA 5CE1A 3B8JA 1P3CA 3QN7A 3UUZA 1AD8H 1O5EH 1C4V2 2ZFRH 2IPHA 4AFSA 2ZC9H 1P04A 3MTYA 3NXPA 1O2KA 4TY6A 1BTZA 1GG6C 2GV7A 2P3TB 1ELEE 2WPMS 4X1NU 5T6FA 1MKXH 1GI8B 1DY9A 1ETRH 2QGRA 4ISNA 3ZZ9A 2XRCA 1K1PA 1WBGB 1GHYH 3F68H 4GLYA 2ZFSA 3EGKH 5L6NH 3ZVGA 2ASUB 3TU7H 1EB2A 1AU8A 3RP2A 1GCTC 4YOJA 2FLRH 4TWYA 6CHAB 2EI8A 2PUXB 2W7SA 4AFUA 4IGDA 2GMTB 2VU8E 1O3FA 4OGXA 1FY3A 1C2GA 4FUEA 1DM4B 4FUFA 2WV5A 1EZUC 1A46H 1TGNA 4CBNA 1NT1A 1OPHB 4QT8C 3TLOA 1TNJA 2G4UA 3A7ZA 2QC2A 3SZNA 1GJ6A 1KXCA 3ESTA 3P6ZB 2QIQA 4ZAEA 3O8DA 2ZU5A 1HAVA 3EA7A 3SNEA 2CXVA 1HXFH 1RJXB 3PV4A 4CREA 2OCVB 4Y76A 3UFAA 1C5RA 2BQ6B 1ELDE 1MTNC 2FOMB 3PB1E 3MO6A 3TH4H 1MD8A 3SV7A 1G36A 2ZNKH 1P02A 2ESTE 1GGDB 1LQDB 3SI4H 2R9PA 3U8RH 1A61H 1TX8A 2HOBA 2XWBI 3E1XB 3LDXH 1P2IA 2BQWB 1NRQH 1K1IA 2FI5E 1ACBE 1JRSA 3ATKA 2D1JA 1MH0A 1P57B 3SQEE 3SGAE 1D3DB 4DVAU 1BT7A 4A5TS 1MZDA 4FUIA 1H8IH 3SQHE 2SGAA 2ZHFH 4JK5A 3W94A 1P3EA 5DPAA 4ISLA 3LH1A 1ZMNA 1NFXA 4UDWH 1G9IE 3MNCA 4VGCC 5FPTA 2HLCA 2KAIB 5IYTA 2UWOA 4BTUB 1EJMA 4WMEA 1ZZZA 3TPIZ 2BD7A 1TNLA 1F5LA 4MPWA 8LPRA 3PLKA 5FCRA 1OWEA 1AIXH 1L0ZA 4YT6H 3RXAA 4IC6A 1C1OA 1HB0B 2W3KA 2NU3E 3S9AA 1WTGH 1P06A 1FAXA 1C9PA 2GZ9A 1TLDA 1AE5A 1OYQA 4GPGA 3CP7A 1O39A 2VGCC 3RC5A 3I29A 4E06H 3GCNA 2BDIA 1TA6A 4FUCA 4I8HA 4AYYB 2G51A 5DGJA 2D8WA 4NGAH 3QO6A 9ESTA 1Y59T 1C9TA 1FXYA 4FVDA 1QIXB 4IC5A 1QJ7B 3NZIA 1O2MA 4X0WU 2ZKSA 3V12A 1UJ1A 1PPBH 1C1VH 1GI4A 2AMDA 3F9FA 2OC1A 1ABJH 3GCHC 4ZXXH 8ESTE 2JETB 1PPEE 1ELCA 1UTLM 4GVUA 1MD7A 2AS9A 3Q3KA 1O2WA 3A84A 1K1MA 1C1TA 3E16B 5A8ZA 1Z1IA 3BIVH 2PHBA 3RXLA 1OYTH 3A8CA 4CH2B 4BTIB 1Z1JA 1YF4A 3SU5A 3M7QA 1D4PB 1C2FA 1GHWH 4IBLH 1C2DA 2PW8H 1L4DA 2ILNA 3QTVH 1UTKA 4X6PA 2XBWA 4FUBA 5GJ4B 1T8NA 3URDA 1BMLA 2I6SA 4FXGH 2BY5X 1PYTC 1O2TA 2F3CE 3PMJA 1TMUH 1RTKA 3GCOA 4RSPA 1GBBA 1XVMA 2UWLA 2FS9A 3TJUA 2G55A 3UNSA 1HAGE 4Q80A 4X1QU 1SG8B 1EOLA 1TMBH 2AGIX 5DG6A 4IW4E 3E0NB 1GMDF 1DDJA 2SGFE 1PPFE 1TPSA 3S9BA 3A81A 2GCTB 2C3SA 1KY9A 1A2CH 1CA0B 1V2NT 1Q2WA 3RXCA 1XMNB 5FX5A 2B7DH 4AN7A 2ZPSA 1C2HA 2Q6GA 1E35B 2VWMA 4Z0KA 2GX4A 2VIDA 1RIWC 1GDQA 3FP8E 1YPMH 1O2RA 3SJOA 1T4UH 1O2YA 1PQ5A 1NU9A 1LQEA 2UWPA 3LJOA 2SNVA 1TX6A 1SMFE 1V2QT 3SU2A 4MNVA 1TNHA 2JH5D 3SV9A 5DO4H 1UTMA 1A1RA 5ABWA 3S7KB 2ZCHP 2GKVE 1SSXA 3FVFB 2ZI2H 3RXGA 3ATIA 5K7RA 4HFPB 1NRRH 1P9UA 1EAUA 4ABGA 1S0RA 4OS7A 1ETTH 4MG3A 1NZQH 1O3MA 2P59A 3PROA 1DX5M 2G4TA 3DD2H 4D9QA 1CHGA 2VINA 4OS6A 1GJ9B 1ARBA 1QJ1B 1QB1A 2VIQA 1QHRB 2QXHA 1S81A 1FJSA 4ABFA