4E7NA

Crystal structure of ahv_tl-i, a glycosylated snake-venom thrombin-like enzyme from agkistrodon halys
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
238
structure length
238
Chain Sequence
IIGGDECNINEHRFLVALYTSRSRTLFCGGTLINQEWVLTAAHCDRKNFRIKLGMHSKKVPNEDEQTRVPKEKFFCLSSKNYTLWDKDIMLIRLDSPVKNSKHIAPFSLPSSPPSVGSVCRIMGWGRISPTEGTYPDVPHCVNINLLEYEMCRAPYPEFELPATSRTLCAGILEGGKDTCKGDSGGPLICNGQFQGIASWGDDPCAQPHKPAAYTKVFDHLDWIENIIAGNTDASCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Snake-venom Thrombin-like Enzyme
publication title Crystal Structure of AhV_TL-I, a Glycosylated Snake-venom Thrombin-like Enzyme from Agkistrodon halys
rcsb
molecule tags Hydrolase
total genus 60
structure length 238
sequence length 238
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4e7nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4e7nA02
3NKKA 1ZSJA 2ZG0H 2BD2A 2Z9GA 3T2NA 1YF4A 2PHBA 1MTNC 3P8GA 4BANB 1WTHD 5K0HA 1EXFA 1C1NA 3UOPA 4AX9H 1IQLA 1D3PB 4A7IB 1UVPA 2TPIZ 1O2UA 3A7XA 1NRSH 1HDTH 4LXBH 4X8UH 1O5AB 3KQBA 4YZUA 1ZOMA 4LOYH 2JH0D 1EPTB 5FCKA 2PTCE 3RP2A 2GV7A 2A5KA 3U1IB 1FMGA 2QF3A 1G3CA 1AUJA 1Z7KA 1GJBB 3PTBA 2AIQA 5F6MA 3Q76A 2OD3B 1C5ZB 4B2AA 1BRAA 2VGCC 1NESE 1NY22 1O3HA 2ANYA 1LHEH 4SGBE 5A2MH 3A83A 2V0BA 1JXPA 1P2NA 3MHWU 4Y8YA 3ATMA 1LMWB 1EJNA 4ISNA 3RXIA 4E06H 4YTAA 4NCYA 1CE5A 3EGKH 3LC5A 1PQ8A 1UCYK 2A7HA 1BCUH 3GY8A 1BJVA 2THFB 5A0CA 2V6NA 1Z6EA 2J2UA 1EUFA 1O2SA 2BVXH 3GCNA 4R0IA 3RC6A 1NS3A 2RDLA 2ZFPH 4X1PU 2G5NA 1C1WH 3RMNH 4WH8A 3LJOA 4GHTA 2I6QA 1W7GH 3JZ2B 2FOHA 3TH4H 2ZQ2A 1Y8TA 1P3EA 1GJ4H 1S0RA 5EOKA 1P2QA 2R2WU 4CR9A 2WUBA 4DVAU 2A5IA 1P10A 1ESBA 1KLTA 1KXCA 2OQ5A 3MO6A 2UUFB 2BDIA 5DPAA 4FVBA 1TA2A 1BT7A 2GD4B 1ZMJA 1K1IA 1G32B 1B5GH 1MZAA 3VB7A 1L0ZA 1FY4A 1SC8U 1LO6A 1O2IA 4UD9H 3SJ8A 3S9BA 3T5FH 5AFYH 3SZNA 4AGKA 1QGFA 4K5ZA 1DT2A 2BY8X 3UTUH 4BAOB 4IMZA 1BHXF 4K69A 1FAXA 1FY8E 6CHAB 2ZDKA 5DG6A 1V2ST 1EJAA 5A0BA 3M61U 1W12U 2C8ZB 2FOAA 3UIRA 1OP8A 3ZVAA 3O8BA 1A5GH 5AVDA 3PMBB 1C1QA 2GCHF 3KN2A 4OS7A 4DJZB 2F9NA 4AYYB 4B2CA 3GCTF 1TRMA 1GI9B 3DHKH 1C5XB 4NIYA 1P09A 1HAVA 1Z71A 1OWJA 1DANH 2BY7X 1CA0B 1ELGA 1S84A 2GT7A 1RTLA 1O3NA 1TGCA 3ATWA 2ZI2H 1Y3UA 5GDSH 1O5CB 1CT4E 2VH6A 3SQEE 1EQ9A 1GBBA 1QB6A 3M7UA 4IN1A 1WTGH 1FY5A 4JZ1A 2ZPSA 3SQHE 3SU0A 3AW1A 2FI4E 1TPSA 1TBZH 2ZU5A 1CA0C 4ABEA 1SLVB 1XM1A 1SVPA 1FNIA 1O2NA 5DP5A 2GGVB 2H9HA 4XOJA 2ZFRH 3MWIU 1D6RA 4U30A 7LPRA 2SGAA 1DOJA 1ORFA 2YNBA 2IPHA 1SFQB 4K60A 4OGYA 3ODDA 3K2UA 5C2ZA 1A7SA 1YP9A 1GBLA 3ATIA 3GYLB 1AO5A 4CBOA 4X2XA 4NFEA 3W94A 3PMHB 2VINA 5F8TA 5FX6A 1ANDA 2O8MA 3GYMA 2Y6TA 3HKIB 2A4GA 1GMDG 1KTSB 2UWOA 3M3VA 3MH4A 5C5NA 4WY3A 3GCHB 8GCHF 1O2XA 5EQSA 1SMFE 3TJVA 4CHAC 3DD2H 3RM2H 3RXLA 4D9QA 1TGSZ 2Y82A 1VCPA 1PPZA 4JCNA 1C1PA 1C9PA 1W10U 3BTDE 1BB0B 2RA3A 4GLYA 2AMPA 1FN6A 1ZRKA 1J14A 3TJUA 4FUDA 5CHAB 4KP0A 2V3HH 3SJIA 3QZRA 1SB1H 4MVNA 2HWLB 3ATLA 1O37A 1T8MA 1KIGH 4I8HA 5FCRA 1UTNA 2ANKH 3H7TA 5L2ZH 2PKSB 1ZPZA 3PV4A 1SGPE 2A0QB 5K7RA 3QO6A 4DOQA 1G2LA 5LPFA 1E38B 1TNHA 2FI3E 4BNRA 5JBTA 1LPZB 2QYIA 5A0AE 2EI8A 3M37A 3B23B 1W2KH 5JBCS 4TWYA 1G30B 5CHAC 4WXIA 1AKSA 2PLXA 1LVOA 2XC5A 2TGDA 3AAVA 1O3LA 2A32A 1D3DB 3LKWA 3MH5A 3MO3A 2W3KA 1O2YA 1O3EA 1QCPA 3MNCA 1NPMA 1Z1JA 2PKSC 2G51A 3TPIZ 3RXQA 1DWBH 3B9FH 3TH3H 2OC1A 3SUGA 4FU8A 1ID5H 1C2JA 1LCYA 1UTJA 4FUEA 4KTCA 1ELFA 1INCA 2I6SA 1W0ZU 3BIVH 3MH7A 3ZVGA 5H4IB 2Q6DA 5C1XA 4E7RG 1PFXC 2OP9A 5FPYA 3T62A 5B6OA 5LGOA 2PFEA 3O8RA 4XDEA 1O3OA 1HGTH 1RRKA 3RXDA 4YLQH 4D7GA 1YBWA 3P8FA 3RU4T 4DCDA 2PW8H 1GHBG 1GVZA 1SGIB 2Z3CA 2GZ9A 1GHAF 6GCHF 5GCHG 2P94A 3Q00A 5C1YA 1F0UA 4AYVB 1OSSA 1OPHB 2FLBH 3F9FA 3UNSA 3LPRA 4I33A 4ABAA 5T6DA 4B2BA 2WPJS 2XBWA 1EX3A 1O2VA 1NM6A 1MQ6A 4HZHA 4K8BA 2FTMA 2ZCKP 2UUJB 3A7WA 3E1XB 4TYDA 1UK4A 2BLQA 1AE5A 4KTSA 5JB9S 3FP7E 2HPPH 2DUCA 4AGJA 1RFNA 1O3MA 2G4TA 5FXLA 3LGIA 1GBCA 5DP8A 3FANA 5FX5A 2FM2A 1IAUA 3GY4A 5C1UA 3K9XB 1C5TA 1ZJKA 2AGGX 2BDHA 3FAOA 2O8TA 3TLOA 3L3TA 1DLKB 3EYDA 3RMOH 3DUXH 1XVOA 1TABE 1CHGA 3D23A 4ZAEA 1GVLA 5LH8A 1HCGA 1W0YH 1YPKH 3VB6A 3SNDA 5JYIA 4DIHH 1EP6A 3PB1E 3RMMH 1CSOE 1QBVH 4MNYA 2R0LA 1DUAA 3MU1A 3EAJA 4BXSA 1MMJN 1D6WA 3S7KB 1E34B 2D1JA 1RTFB 2KAIB 5EW1H 3BTQE 9ESTA 1TNJA 5EPYA 1CHOG 1LVMA 4JYUH 1IQEA 1Y3WA 3LDXH 3GDSA 1BHXB 2V35A 3QWCH 1IQKA 1VJ9U 3BEIB 2Z9IA 2OQUA 2BDGA 1C2DA 4AN7A 4MPVA 1LKBA 1E35B 4B1TA 1GDQA 2XC4A 2A31A 1CVWH 5F8ZA 2ZGJA 3QGJA 5E0JA 2BLWA 2CGAA 4MNWA 3BG4C 5FBIA 1GJ8B 1BTUA 3UY9A 1YCPK 2PKAB 5C20A 2ZU1A 1P2MA 1A2CH 1MH0A 1A1RA 1CU1A 1GBKA 1P9SA 1DY8A 2F91A 4ISOA 1C5VA 1ANCA 4IS5A 1ZGIA 3BTWE 1Y3VA 2ZWLH 2AMDA 3LH3A 3UNRA 1PPGE 1QL8A 2TBSA 3S9AA 3MH6A 2FEQH 4NZLA 2GTBA 2OLGA 1O36A 3RXTA 1SR5C 5HXFA 1SQTA 1BTPA 3SV9A 1RXPA 3QTVH 1BITA 1LPKB 1MKWK 3KGPA 3SHCH 3M7TA 3MNSA 1GBEA 2ODYB 3RXCA 1TMUH 3IWMA 1IQGA 4Q80A 3QUMP 3ZVEA 2SFAA 2F3CE 2Y5GA 2Q6GA 4TPYA 3BF6H 1NU7B 1UVTH 1NC6A 1CGJE 4BAHB 4KTUA 2VIOA 4OS1A 1DSTA 1SHYA 3BTTE 3LONA 1GJCB 1NRRH 1UMAH 3MU4A 1L1GA 4NWKA 1THSH 1KXFA 4O3TA 4ISHH 3SNCA 1S85A 2WV5A 4NA7A 1RTKA 4ZKRU 2GX4A 2FOGA 4X1QU 2BD4A 3DFJA 4F49A 3P8NA 2FXRA 4ZHLU 1ANBA 4IMQA 1P05A 2AERH 1NFWA 1C5WB 3FZDA 1BRBE 3N7OA 3URDA 1HAPH 2A5AA 2BM2A 1DXPA 3LC3A 1KLJH 3HGNA 3ZZ6A 1UTLM 1F0RA 2ZHDA 1O2GH 2FO9A 4JYTA 1C5MD 2OTVA 7GCHF 4TY6A 4TPIZ 1O32A 4ZMAH 2AYWA 1DE7H 4J1YA 1ELDE 3PWBA 4MG3A 1NN6A 4M7GA 2PUQH 4YT7H 1KXAA 1TALA 1TPAE 2W7SA 4O3UA 1A4WH 2QXJA 5TJXA 3F9HA 3QZQA 3NWUA 1LTOA 1OOKB 2FOMB 2ZIQH 5G4BA 1TPPA 2XYAA 2AEIH 1ZZZA 1DFPA 1F92A 1ABIH 1GG6B 1QRZA 1WYKA 1MCTA 2AIPA 4AFZA 4B76A 1K22H 3RXBA 1QR3E 5PTPA 2TGTA 1WQVH 1NFYA 1SLXB 3SU6A 1MTNB 1EB1H 5HGGA 4D8NA 4BTIB 3E6PH 1BBRH 4DT7B 2FYRA 1MKXK 1C5LH 5DKMA 3ESTA 4CH2B 2Y5FA 1DWEH 1GG6C 5C67A 1K21H 2TIOA 3ZVCA 3TK6A 4K3JA 1KSNA 3NPSA 8KME2 1UTQA 2NWNA 2FIRH 1TWXB 2VGCB 3AAUA 3NUMA 4DIIH 1P0SH 4MPWA 1XUFA 1O34A 1HAIH 1O5EH 1ZSLA 3RU4D 2FOCA 2ODQA 1SI5H 2BOKA 5A8XA 1C1SA 2C90B 1T31A 3A82A 2QIQA 4KELA 4CR5A 3SOSA 2QC2A 2BXUH 4AG2A 4A1XA 1C4Y2 2R3YA 1AGJA 1EATA 2GT8A 4TY7A 2ANMH 2ULLA 1C5OH 1V2WT 4XBDA 2ZHFH 1FJSA 3UNQA 5FPSA 2BD8A 3E91A 2BDCA 1LVYA 1EJMA 1VZQH 1TQ7B 2HPQH 3SGAE 1HAGE 1V2KT 2PSXA 3GOVB 1G2MA 4CRDA 1H9HE 1RGQA 1TIOA 2FMJA 1GHZA 3EA8A 3Q77A 4NFFA 3P8OA 4YESB 1A3EH 1IHTH 2ZFSA 4NA8A 1CT2E 3V7TA 1DWDH 2AS9A 3ZZBA 2Y5HA 1D9IA 1O2MA 1BTXA 3RXRA 3A8BA 1CGIE 1DITH 2BQWB 1G3BA 2W7UA 1TGNA 2ZFTA 4FUFA 1Y3XA 1GHYH 1ELEE 3KHVA 1AQ7A 2A4OA 1P03A 3QX5H 4A1VA 3OY6U 2VVUA 4X1SU 1FY3A 2DE9A 4FVDA 3SJ9A 1F5RA 1GBTA 1TX6A 4O97A 5EQQA 1BQYA 1ZR0A 7KMEH 1HXEH 4GVUA 3A7ZA 2XRCA 3MU0A 1FV9A 2D26C 3ZV8A 1UJ1A 2H2ZA 3T28A 3SI4H 1C1TA 3DT0H 5CMXH 4ABGA 1GBAA 2HVXA 2FZZA 1RS0A 5HM2A 1EAUA 2G52A 4Y10E 2BY5X 2XC0A 4H4FA 2ZCLP 1SGYE 1JRTA 1SOZA 3GCOA 1F5KU 3TK9A 2EA3A 4NIXA 2PGBB 1UTMA 1WSSH 1SLUB 5DP9A 1BMLA 1QQUA 4XFQA 1SLWB 2EC9H 1YPHE 3KQDA 4I32A 4B75A 3P95A 4JZDH 1BMNH 3D65E 4BXWA 4RSPA 1ESTA 1CO7E 1BMAA 3BV9B 3NXPA 4U01A 8ESTE 1H8IH 2ILNA 1PPBH 4ABFA 5ETXA 2M5TA 3ZVBA 1IQNA 3RXSA 1W11U 3ZZ4A 2HOBA 1JIMA 1AVGH 2BLVA 4Q7ZA 5GJ4B 1TBRH 1K9OE 1AFEH 1Z8JB 1HAZB 2WYJA 1KYNA 1GHVH 1CT0E 1BDAA 1C2KA 1VITF 3M5OA 3RXMA 1C5PA 2ZGBH 1BTZA 2VVVA 4INHA 3RXPA 2GV6A 3P6ZB 5EPNA 4UE7H 3TITA 5GXPA 3Q3YA 1TMBH 1V2LT 5AHGH 5ESBA 3M3TA 4BAKB 1HFDA 2JETB 4WVPE 2R2MB 1EZSC 1QJ6B 2OC0A 1HRTH 3CS0A 4ZXXH 2BZ6H 1BBRE 3G01A 1ETSH 1O2HA 3P92A 1OWEA 5DGJA 3L33A 1UTOA 3P17H 1EZQA 1S0QA 3A81A 5EXNA 3I29A 2B0FA 3T27A 1K1PA 1TGTA 1QURH 2FYQA 1BIOA 2ESTE 1OKXA 2ZF0H 1C2FA 1QA7A 2JETC 3HKJB 2J34A 2QV1A 2BXTH 4FXGH 1QFKH 4CHAB 2OINA 1EOJA 2JH5D 2XCNA 3S69A 4JZEH 3U98H 2H9EH 1FXYA 4X6PA 1V2QT 2ZNKH 4YM9A 4Y76A 1O3IA 2XWAA 1S6HA 1ELVA 1EZXC 1WQSA 2QXIA 4Z0KA 4GCHF 1MD8A 3PLKA 2VWNA 4HGCA 4UFGH 2AGIX 1C1OA 2GCHG 3A8DA 2VB0A 1FAKH 2Z9JA 2H5DA 5DP7A 2QN5T 3GCTG 3SI3H 1OX1A 3TU7H 1RJXB 4AORA 3R0FA 4Y79A 3ZYDA 2G4UA 2GMTC 3UQOA 1IHSH 1TOMH 4INKA 4WH6A 4YT6H 1YC0A 1BMMH 1MAYA 2V3OH 2BX4A 1O2PA 3GDVA 5JB8S 1HPGA 4ZHMU 4WMDA 1C9TA 1XUJA 3LJJA 1GI1A 2ANWA 1ANEA 1C2LA 4ABJA 5GPIB 1AVWA 1AUTC 3HGPA 2ZTXA 3PMJA 2SGDE 1CQQA 2ZFQH 3A88A 1Y3YA 2CHAB 1AFQC 4I8GA 5EG4A 1KDQA 1A5HA 1T8OA 2H1UA 3A8CA 4D76A 2SGEE 5FAHA 1AI8H 5EU8A 3S9CA 1HAVB 1ZTKA 2ZECA 1S82A 1J16A 2CXVA 1GVKB 3LT3A 5E2OA 1AB9C 3STIA 1OYQA 2YNAA 1A5IA 1PYTC 3SJKA 1YPGH 2VU8E 1FY1A 3KIDU 1BRCE 1HB0B 1W3CA 4JK6A 2B8OH 1P02A 1P57B 2ODPA 1NT1A 2CHAC 3RLYH 2F9BH 2GDDA 2ZPRA 1C1VH 4YLUA 4B73A 1NROH 2A4QA 3LGWA 4B74A 4D7FA 4MQAA 3RLWH 3A7VA 3RC4A 4UONA 1W14U 2SGFE 2TRMA 1C5YB 2FP7B 3SNBA 3RXJA 8GCHG 1SG8B 1TNKA 1GI8B 3O8CA 1G37A 1P01A 1GMCF 2CJIA 5C5OA 5DO4H 1SGEE 4I8LA 1GHWH 1O5GH 4D9RA 1BZXE 1GGDC 2UUKB 1DUEA 4JYVH 3CP7A 2Y7XA 4FUJA 1P04A 2FOEA 1GJ6A 1LHDH 1SGFG 2HNTE 1L2EA 3LGUA 4YOGA 2G55A 4X2YA 3PO1B 4IGDA 5JBAS 1OP0A 1SL3A 1HIAA 3GY7A 4OS6A 3AVZA 1S6FA 4HFPB 2VNTA 2BY6X 5T3HA 1W7XH 1H8DH 3B8JA 1ZHRA 3D49H 4OS4A 3M5LA 1LDTT 1SFIA 1J8AA 4KKDA 1N8OB 2STBE 1C2EA 1LQEA 3RXVA 3GICB 1AE8H 1D4PB 2G8TA 5A09A 1V2UT 4WXVA 3RU4E 1F0TA 4MDSA 3UUZA 2O8UA 1LHFH 2ASUB 1P2JA 3PO1C 3RXFA 5BRRE 2JH6D 1K1MA 3VEQB 1O2KA 1FLEE 1FDPA 1MZDA 2AH4X 3URCA 1GMHF 3GY3A 2W26A 4UEHH 2BTCE 2P3UB 3PROA 2IN2A 3TK5A 3V13A 4THNH 1N8OC 3SGQE 2BX3A 1C4U2 1HBTH 1QB1A 2UWLA 3I77A 1J15A 3BG4B 1AKSB 4U2WA 1GCTB 1FI8A 1PPHE 7ESTE 2VIPA 1VCQA 4RN6A 4UFEH 1ZTLA 1GHAG 3SU1A 6GCHG 4NG9H 3LH1A 3QLPH 1OWKA 1UO6A 3WY8A 1QJ1B 2FWWA 4WMEA 3LOXA 1O2OA 1EAWA 1GDUA 2RA0A 2SGPE 4ABHA 1NU9A 1C1RA 2BQ6B 1FIWA 3PM3A 2ZPQA 1GI6A 2C8WB 3ZZ7A 2GCTC 4WF8A 1GCTC 4NA9H 1C2IA 1HV7A 4X1NU 1ELCA 1A0HB 1EKBB 4YOIA 2BMGB 1UHBA 3BEUA 1P9UA 2C3SA 3SHAH 1UVSH 1V6DA 2CN0H 4QT8C 3UWJH 4DY7B 1FPHH 1MTSA 1W8BH 1GI0A 1ZMLA 1YLDA 5DK1A 4X6OA 1TONA 1C5RA 3GISB 2QY0B 5GWZA 5L6NH 1S83A 1MU6B 1TOCB 2NU0E 1BOQA 4AFSA 4O9VA 1O3CA 3TGIE 1GHXH 1Y5BT 3LU9B 5F03A 4FUHA 3V12A 2XNIA 1UTKA 1B7XB 1O3FA 5T6FA 1DWCH 1GL0E 1V2RT 1QRXA 2J38A 1AMHA 1O2JA 1OS8A 1MTUA 2VWLA 4ZKNU 2IOTA 3U69H 1C4V2 3VFEA 4K8YA 3I78A 1Z1IA 1ZLRA 3BTME 3EDXB 1ZTJA 3T25A 2BDAA 2VJ1A 1C2MA 3SV2H 1HJAB 3M5NA 4E7NA 3SNEA 3FZZA 1GBFA 1RIWB 4JZFH 3ZZ8A 1MQ5A 1HJ9A 2FPZA 3QTOH 1S5SA 2G5VA 3SW2B 4A5TS 1A0JA 3RM0H 1T7CA 2GDEH 2BHGA 1XXDA 1PPCE 1AD8H 1HJ8A 2ZA5A 3K65B 4FUCA 3DA9B 3SUDA 3ZVDA 1KTTB 4NSVA 2IJOB 2C4FH 4Y8ZA 1ELTA 3ZZCA 3H5CB 1BA8B 1SQOA 1YKTA 4AFUA 4RKJB 1W13U 3HPTB 2BD9A 2LNCA 3U8RH 2OXSA 3VGCC 1O2WA 2HALA 1IQIA 1QB9A 2STAE 3FFGA 1J9CH 1HJAC 5L2YH 1EPTA 2ZP0H 1RIWC 1SGNE 4VGCB 4GPGA 3VB5A 2F83A 4K1TA 3EA7A 1SGQE 2GKVE 1THRH 5LPRA 1NTPA 4ASHA 3NK8A 4WJG2 1ETRH 2GZ8A 2J94A 3KF2A 3SUEA 3U9AH 4H42U 4CRGA 5E0HA 1UK2A 4ZKSU 1Q3XA 1GJ9B 3IITA 1TNIA 1C5UA 1BJUA 1NRQH 4ZH8A 3MNXA 4A6LA 3RUOA 3TJOA 1KY9A 1MUEB 3MOCA 5I25A 1ZHPA 5CE1A 4GUXA 2Y81A 1YPHC 2R0KA 1K28D 2ZDVH 4LZ4B 2EI6A 4ISLA 3SNAA 2BOHB 2AGEX 4VGCC 1WAYB 4OS5A 1DVAH 3EQ0H 1AU8A 4Y0YE 4XE4A 3T26A 3UR9A 1SBWA 1LQDB 1NRNH 2ZDLA 2PR3A 5EQRA 2TGPZ 2FS8A 1D3TB 1PQ7A 3ATKA 1ARBA 2HLCA 1LVBA 3TH2H 1YM0A 1ZJDA 2RCEA 3CENA 3F9EA 1GI3A 2ZFFH 1SGDE 3ITIA 1VCWA 1JMOH 2Z3DA 1ZHMA 2A4RA 1YYY1 1F0SA 2O8WA 3VB3A 5JDUB 1WCZA 4H6SB 2XTTB 3UWIA 1TQ0B 1EAXA 1C5SA 1ZRBA 3MTYA 1J17T 3AASA 1T8LA 1GI4A 1NFUA 5C3NA 5FPTA 2WPIS 3V3MA 2JKHA 1K2I1 2EEKA 2ZGCA 1L4DA 2W3IA 2ZCHP 2WPLS 1XUIA 2H6MA 7GCHG 2VIWA 1C5NH 3FP6E 1C1UH 2BDYA 2XCFA 1P06A 5AFZH 2Z9LA 5DP3A 5EODA 2WINI 2QGRA 2B7DH 1UCYH 3UPEA 1AVXA 3MYWA 3UREA 1DS2E 2GVFA 3ZZDA 3KEEA 3TJNA 2XXLA 2ZHEH 3VB4A 1BBRK 1SQAA 3BG8A 3ZZAA 1YPEH 1E37B 4AFQA 2G81E 4FUBA 3OYPA 3L6PA 4NSYA 1TYNA 3ZVFA 1IQJA 1XUHA 1O33A 1P8VC 1HYLA 4RKOB 1H1BA 2OBQA 3CS7A 1O3GA 3O8DA 1O5DH 1DDJA 2ZTZA 3D62A 4FUIA 3A84A 4ZHAA 3RMLH 1V2JT 3RXUA 1O39A 3VPKA 4I8KA 1ABJH 2WUCA 2FODA 1TFXA 1ZPBA 4HI3A 5E0GA 2QXHA 4ABDA 1AY6H 2SGQE 4INLA 3S7HB 2Z9KA 5F8XA 4NZQA 1YLCA 1QY6A 3M35A 2RG3A 4CRAA 4DG4A 1EPTC 4LK4A 1GCDA 4Y6DA 3BTGE 2OCVB 1V3XA 3OTJE 2C8YB 4GSOA 3BIUH 1Y59T 3UOUA 4ZKOU 2A45B 2R3UA 1IQHA 1TA6A 4TWWA 4I8JA 1LHGH 2VIDA 3BTEE 3BSQA 3A85A 1NFXA 4NGAH 1KXEA 3PYHA 1QTFA 4FU7A 5EXMA 3STJA 2ZDMA 1P12E 2UUYA 1AHTH 3PLBA 5JPMH 1YPJH 2BQ7B 1P2KA 1C1MA 4K1EA 1QJ7B 2ZDAH 1BRUP 1PYTD 3W95A 3NCLA 2J9NA 1SGTA 1N6XA 4NWLA 1GPZA 2BYAX 1FONA 2FOFA 2B5TB 3QN7A 1QBNA 1MBQA 1UVUH 2YOLA 3HATH 4MLFB 3F1SB 2K1QA 2F9OA 2ZC9H 3JZ1B 4BAQB 5HYOA 2WPMS 5L30H 3EA9A 3M3SA 4O03A 2BB4A 3SN8A 1C5QA 4X2WA 1XKBC 4Y71A 1Z8GA 4Y7AA 3SORA 1TGBA 3S0NA 3GDUA 1CGHA 3F9GA 1L1NA 1EASA 1ETTH 2H5CA 3FVFB 4JK5A 3ENSB 4IC6A 4LZ1H 1NZQH 1VR1H 4OGXA 2XW9A 4R8TB 2F9VA 3U1JB 2A2QH 1Z6JH 2J95A 2ZGXH 1TNGA 4Y8XA 1SGRE 6LPRA 1O3DA 1QNJA 4JZIA 1JRSA 1O3KA 2PTNA 2ZTYA 3DFLA 3A86A 3E0NB 1FZZA 2Y80A 4ABBA 1GMDF 4WWYA 1XUGA 1PPEE 4U32A 1O38A 2BZAA 2HNTC 1O2LA 1GBMA 3F6UH 1IQMA 2NU1E 1X7AC 3A7TA 1AZ8A 2PUXB 3RXHA 1EZUC 1O2RA 3SU4A 1G9IE 1ESAA 5FHTA 3E0PB 3QGNB 2G00A 1TMTH 6CHAC 1O30A 1JIRA 1WBGB 1BTWA 3SJOA 1C2GA 1MAXA 2BY9X 4MTBA 1V2TT 1PPFE 2CF8H 1NRPH 1HLTH 4I31A 2GMTB 1T32A 1P11E 4BTTB 2HRVA 4X6NA 5HMAA 1O2TA 1A61H 3A7YA 2LPRA 2XBYA 2C8XB 1O2QA 1XMNB 3OSYA 1THPB 1UCYE 1HAXB 4E05H 2ZGHA 1P2IA 4AB8A 4GAWA 4XSKU 1L1JA 1A3BH 1LHCH 3K6YA 1D3QB 2A2XH 1M9UA 3IG6B 3E90B 3SV6A 2UWPA 1VITG 1AFQB 4CRBA 3LGVA 1XXFA 2J4IA 1GBIA 4H6TA 2FI5E 5DP6A 3MMGA 5HM9A 4CREA 2PSYA 2P95A 2P59A 1EAIA 1O35A 3SV8A 1DXWA 1AB9B 3SUFA 1AIXH 2VVCA 4YOJA 4K2YA 2FX4A 3KQCA 4AZ2B 2VWMA 4Z6AH 1GL1A 4XBCA 4Y11E 2AMQA 4UDWH 3AW0A 2ZHWH 1MCVA 5ESTE 1T8NA 1EP5A 1FQ3A 2Z6BD 1B0EA 4XBBA 1T4VH 2NU2E 1GHBF 1ZSKA 1XVMA 1GBDA 3C27B 1HNEE 4FUGA 5EGMA 1OYTH 1VGCB 2QXGA 1O3AA 1WU1A 3H7OA 1FN8A 4PROA 3Q3KA 5GCHF 1H4WA 1S81A 3U8OH 1XUKA 4Y0ZE 4KGAA 4NIVA 1OWDA 1AWHB 4FU9A 1YCPM 3GCHC 2Q6FA 1MBMA 2ZO3H 3LIWA 5GIBA 2CMYA 3P70B 2P8OB 4IC5A 1GWAA 3V0XA 4CRCA 1RD3B 1L4ZA 4MPUA 1N1LA 1Z8IB 4GCHG 4AOQA 4WMFA 1G3DA 1GGDB 3M36A 4ISIH 1VGCC 6ESTA 2FLRH 3QDZB 3MI4A 1WV7H 2ZU4A 2KAIA 2C93B 1IOEA 5DJ7A 1HUTH 1YPLH 1F7ZA 3PLPA 3RXEA 2A1DB 3PMAB 1G3EA 5E2PA 1V2OT 4DGJA 2AFQB 1C2HA 3KCGH 2CF9H 3RC5A 2P8OC 2FDAA 1TE0A 2EI7A 1QIXB 9LPRA 2FTLE 3ZYEA 1E36B 3K6ZA 2DE8A 3SGBE 1A0LA 2ZZUH 1JBUH 1GI2A 2P93A 3ODFA 2HGTH 1H9LB 2OUAA 3GY6A 2PKAA 2GP9B 1QRWA 1DICA 3BTKE 1GJ7B 8LPRA 2OC8A 2XBVA 1CHOF 5E8EH 1N6YA 3LGTA 1LPGB 4SGAE 3M5MA 4ABIA 3UR6A 5FBEA 1AWFH 2QF0A 2D2DA 2F9PA 1SSXA 1TRYA 2VH0A 3TNSA 2ALPA 1HXFH 2VIVA 1TRNA 4BTUB 3C1KA 1H9IE 3SU2A 1F2SE 1ELBA 3KNXA 5I46H 1PJPA 1YPMH 1KDQB 1JWTA 1ZGVA 1MTVA 4K1SA 2P3TB 3A87A 1GBHA 4CRFA 3A89A 1TBQH 1HAHH 2GCTB 3BEFB 3MU8A 1GMCG 2BD3A 4CBNA 2NU4E 4ZUHA 2O9QA 4DW2U 2Z94A 1LKAA 1V2MT 1YCPH 3RXAA 2P16A 2WV4A 3SU5A 4A1TA 3SO3A 3ZZ3A 1UTPA 2BD7A 2A7JA 1K1LA 4MNXA 5J4SA 1HAYB 4MNVA 1IQFA 2ALVA 1P2OA 3ELAH 1DM4B 1ARCA 1KXBA 2SNVA 3MNBA 1QQ4A 1TAWA 2NU3E 3A8AA 1OP2A 4IW4E 4A92A 5J4QA 3TGJE 5LPEA 5A8ZA 4UFFH 4X8TH 3SBKA 2FX6A 2ZU3A 2FOBA 2SNWA 5DP4A 3TVJB 1TPOA 1GDNA 1QL9A 1MKWH 1K1OA 4F4OC 1T4UH 1O2ZA 1SGFA 3TGKE 3OX7U 1ZYOA 2FS9A 1O3PB 2ZU2A 1P3CA 4X1RU 2Q1JA 4B71A 2HNTF 3RXGA 2D8WA 1KLIH 3E8LA 3MFJA 2QA9E 3M7QA 1UVOA 1WOFA 3T29A 1BTYA 1CBWB 1JOUB 2Y7ZA 4X2VA 1GMHG 1TNLA 1VITH 3E3TA 4Q7XA 1HIAB 1BTHH 3ZZ5A 2P3FH 4BOHA 1ZPCA 4X8SH 5IDKA 3OU0A 2QCYA 1TLDA 1ACBE 1V2PT 3MO9A 2PV9B 1O3BA 1V2VT 3BTHE 2BLOA 2B9LA 2VWOA 4OS2A 3KQEA 4X0WU 1OWHA 1E0FD 1O0DH 2GZ7A 3U8TH 3VGCB 3MU5A 4Q2KA 4BAMB 1HAOH 1SHHB 1DX5M 3QK1A 1CBWC 3RXKA 4GHQA 3PWCA 4NIWA 1FPCH 1B0FA 4DURA 2WPHS 1K1NA 2J92A 3SU3A 4IBLH 5JBBS 1O5BB 5SGAE 3ZV9A 4YO9A 3HK3B 4CH8B 1QBOA 1DY9A 1AZZA 3RXOA 2Z3EA 1EB2A 2XWBI 3F68H 1TB6H 4Q7YA 5EXLA 5AF9H 1Q2WA 1XX9A 3TIUA 2H9TH 2OC7A 2PGQB 1O5FH 1TX8A 3TNTA 3E16B 1V2NT 1MD7A 2ZHQH 4MPXA 2BVRH 1OXGA 1Z8RA 1Q31A 3SV7A 1FUJA 5ABWA 1A46H 1OWIA 4JMYA 1YGCH 5TCCA 2PWXA 1MU8B 1VJAU 1BUIA 3NZIA 1AN1E 4ZXYH 5IYTA 5EW2H 1PQAA 2ZEBA 1EOLA 1GJDB 1MKXH 2WPKS 1GJAB 3RDZA 4HTCH 3UFAA 3UQVA 1GI5A 1UHBB 2CV3A 5TCAA 1NO9H 1SOTA 2R9PA 3EE0B 2FESH 1QL7A 1G36A 1K1JA 2Z7FE 2ZQ1A 4J2YB 4Y7BA 1UK3A 4AG1A 2ZDNA 2ZKSA 1QHRB 1O31A 3KL6A 3VXFH 3OY5U 3VXEH 4ESTE 1ZMNA 3A80A 4I7YH 2TGAA 2W5EA 1TX7A 3LGYA 1CA8B 1U6QA 1DPOA 1DLEA 3PTNA 4X6MA 4X8VH 2VIQA 1KXDA 4UFDH 1DSUA 5A8YA 4ZROA 1SPJA 1MTWA 1O3JA 1XKAC 1Y5UT 3BTFE 3HK6B 2F9UA 2O8LA 2WYGA 4IN2A 1PQ5A 2XBXA 1GI7B 3BN9A 2BVSH 2BD5A 3FP8E 5T6GA 1FIZA 3ZZ9A 4AB9A 3Q3XA 1QA0A 1WUNH 1GJ5H 2A7CA 1GBJA 3R3GB 3GY2A 1F5LA 2QAAA 3GY5A 1ELAA 2BDBA 5BPEA 2OBOA 1SGCA 1Y5AT
chains in the Genus database with same CATH superfamily
3NKKA 1ZSJA 2ZG0H 2BD2A 2Z9GA 3T2NA 1YF4A 2PHBA 1MTNC 3P8GA 4BANB 1WTHD 5FL7D 5K0HA 1EXFA 1C1NA 3UOPA 4AX9H 1IQLA 1D3PB 4A7IB 4DT4A 1UVPA 2TPIZ 1O2UA 3A7XA 1NRSH 1HDTH 4LXBH 4X8UH 1O5AB 3KQBA 4YZUA 1ZOMA 4LOYH 4XRNA 2JH0D 1EPTB 5FCKA 2PTCE 3RP2A 2GV7A 2A5KA 3U1IB 1FMGA 2QF3A 1G3CA 1AUJA 1Z7KA 1GJBB 3PTBA 4FETA 2AIQA 5F6MA 3Q76A 2OD3B 1C5ZB 4B2AA 1BRAA 2VGCC 1NESE 1NY22 1O3HA 2ANYA 1LHEH 4SGBE 5A2MH 3A83A 2V0BA 1JXPA 1P2NA 3MHWU 4Y8YA 3ATMA 1LMWB 1EJNA 4ISNA 3RXIA 4E06H 4YTAA 4NCYA 1CE5A 3EGKH 3LC5A 1PQ8A 1UCYK 2A7HA 1BCUH 3GY8A 5KGOA 1BJVA 2THFB 5A0CA 2V6NA 1Z6EA 2J2UA 1EUFA 3EE7A 1O2SA 2BVXH 3GCNA 4R0IA 3RC6A 1NS3A 2RDLA 2ZFPH 4X1PU 2G5NA 1C1WH 3GS9A 3RMNH 4WH8A 3LJOA 4GHTA 2I6QA 1W7GH 3JZ2B 2FOHA 3TH4H 2ZQ2A 1Y8TA 1P3EA 1GJ4H 1S0RA 5EOKA 2QF4A 1P2QA 2R2WU 4CR9A 2WUBA 4DVAU 2A5IA 2LELA 1P10A 1ESBA 1KLTA 1KXCA 2OQ5A 3MO6A 2UUFB 2BDIA 5DPAA 4FVBA 1TA2A 1BT7A 2GD4B 1ZMJA 1K1IA 1G32B 1VKYA 1B5GH 1MZAA 3VB7A 1L0ZA 1FY4A 1SC8U 1LO6A 1O2IA 2W6ID 4UD9H 3SJ8A 3S9BA 3T5FH 5AFYH 3SZNA 4AGKA 1QGFA 4K5ZA 1DT2A 2BY8X 3UTUH 4BAOB 4IMZA 4P00A 1BHXF 4K69A 1FAXA 1FY8E 6CHAB 2ZDKA 5DG6A 1V2ST 1EJAA 5A0BA 3M61U 1W12U 2C8ZB 2FOAA 3UIRA 1OP8A 3ZVAA 3O8BA 1A5GH 5AVDA 3PMBB 1C1QA 2GCHF 3KN2A 4OS7A 4DJZB 2F9NA 4AYYB 4B2CA 5IK2D 3GCTF 1TRMA 1GI9B 3DHKH 1C5XB 4NIYA 1P09A 1HAVA 1Z71A 1OWJA 1DANH 2BY7X 1CA0B 1ELGA 1S84A 2IPQX 2GT7A 1RTLA 1O3NA 1TGCA 3ATWA 2ZI2H 2JDID 1Y3UA 5GDSH 3NRLA 1O5CB 5KECA 1CT4E 2VH6A 3SQEE 2RFKC 1EQ9A 1GBBA 1QB6A 3M7UA 4IN1A 1WTGH 1FY5A 4JZ1A 2ZPSA 3SQHE 2PP6A 2K0QA 3SU0A 3AW1A 3F2GA 2FI4E 1TPSA 1TBZH 2ZU5A 1CA0C 4ABEA 1SLVB 1XM1A 1SVPA 1FNIA 1O2NA 5DP5A 3VG8A 2GGVB 2H9HA 4XOJA 2ZFRH 2GJGA 3MWIU 1D6RA 4U30A 7LPRA 2SGAA 1DOJA 1ORFA 2YNBA 2IPHA 1SFQB 4K60A 4OGYA 3ODDA 3K2UA 5C2ZA 1A7SA 1YP9A 1GBLA 3ATIA 3GYLB 1AO5A 4CBOA 4X2XA 4NFEA 3W94A 3PMHB 2VINA 5F8TA 3W1EA 5FX6A 1ANDA 2O8MA 3GYMA 3KQ5A 2Y6TA 3HKIB 2A4GA 1GMDG 1KTSB 2UWOA 3M3VA 4HG6A 3MH4A 5C5NA 4WY3A 3GCHB 8GCHF 1O2XA 5EQSA 1SMFE 3TJVA 4CHAC 3DD2H 3RM2H 3RXLA 4D9QA 1TGSZ 2Y82A 1VCPA 1PPZA 4JCNA 1C1PA 1C9PA 1W10U 3BTDE 1BB0B 2RA3A 4GLYA 2AMPA 1FN6A 1ZRKA 1J14A 3TJUA 4FUDA 5CHAB 4KP0A 2V3HH 3SJIA 3QZRA 1SB1H 4MVNA 2HWLB 3ATLA 1O37A 1T8MA 1KIGH 4I8HA 5FCRA 1UTNA 5GNDA 2ANKH 3H7TA 5L2ZH 2PKSB 1ZPZA 3PV4A 1SGPE 2A0QB 5K7RA 3QO6A 4DOQA 1G2LA 5LPFA 1E38B 1TNHA 2FI3E 4BNRA 5JBTA 1LPZB 2QYIA 5A0AE 2EI8A 3M37A 3B23B 1W2KH 5JBCS 4TWYA 1G30B 5CHAC 4WXIA 1AKSA 2WV9A 2PLXA 1LVOA 2XC5A 2TGDA 3AAVA 1O3LA 2A32A 1D3DB 3LKWA 3MH5A 3MO3A 2W3KA 1O2YA 1O3EA 1QCPA 3MNCA 1NPMA 1Z1JA 2PKSC 2G51A 3TPIZ 3RXQA 1DWBH 3B9FH 3TH3H 2OC1A 3SUGA 4FU8A 3DSOA 1ID5H 1C2JA 1LCYA 1UTJA 4FUEA 4KTCA 1ELFA 1INCA 2I6SA 3F2FA 1W0ZU 3BIVH 3MH7A 3ZVGA 5H4IB 2Q6DA 5C1XA 4E7RG 1PFXC 2OP9A 5FPYA 3T62A 5B6OA 5LGOA 2PFEA 5C17A 3O8RA 4XDEA 1O3OA 1HGTH 1RRKA 3RXDA 4YLQH 4D7GA 1YBWA 3P8FA 4Q4LA 3RU4T 4DCDA 2PW8H 1GHBG 1GVZA 1SGIB 2Z3CA 2GZ9A 1GHAF 6GCHF 5GCHG 2P94A 3Q00A 5C1YA 1F0UA 4AYVB 1OSSA 1OPHB 2FLBH 3F9FA 3UNSA 3LPRA 4I33A 4ABAA 5T6DA 3ZIAD 4B2BA 2WPJS 2XBWA 1EX3A 1O2VA 1NM6A 1MQ6A 4HZHA 4K8BA 2FTMA 2ZCKP 2UUJB 3A7WA 3E1XB 4TYDA 1UK4A 5F53A 2BLQA 2JIZD 1AE5A 1FX0B 4KTSA 5JB9S 3FP7E 2HPPH 2DUCA 4AGJA 1RFNA 1O3MA 4Z1MD 2G4TA 5FXLA 3LGIA 1GBCA 5DP8A 3FANA 5FX5A 2FM2A 1IAUA 3GY4A 5C1UA 3K9XB 1C5TA 1ZJKA 2AGGX 2BDHA 3FAOA 2O8TA 1E79D 3TLOA 3L3TA 1DLKB 3EYDA 3RMOH 3DUXH 1XVOA 1TABE 1CHGA 3D23A 4ZAEA 1GVLA 5LH8A 1HCGA 1W0YH 1YPKH 3VB6A 3SNDA 5JYIA 4DIHH 1EP6A 3PB1E 3RMMH 1CSOE 1QBVH 1YWUA 2R0LA 1DUAA 4MNYA 3MU1A 3OAAD 3EAJA 2F43B 4BXSA 1MMJN 1D6WA 3S7KB 1E34B 2D1JA 1RTFB 2KAIB 5EW1H 3BTQE 4ACAA 9ESTA 1TNJA 5EPYA 1CHOG 1LVMA 4JYUH 1IQEA 1Y3WA 3LDXH 3GDSA 1BHXB 2V35A 3QWCH 1IQKA 1VJ9U 3BEIB 2Z9IA 2OQUA 2BDGA 1C2DA 4AN7A 4MPVA 1LKBA 1E35B 4B1TA 1GDQA 2XC4A 2A31A 1CVWH 5CDFE 5F8ZA 2ZGJA 3QGJA 5E0JA 2BLWA 2CGAA 4MNWA 3BG4C 5FBIA 1GJ8B 2WSSD 1BTUA 4B6FA 3UY9A 1UW7A 1YCPK 2PKAB 5C20A 2ZU1A 1P2MA 1A2CH 1MH0A 1A1RA 1CU1A 1GBKA 1P9SA 1DY8A 2F91A 4ISOA 2J5UA 1C5VA 1ANCA 4IS5A 1ZGIA 3BTWE 1Y3VA 2ZWLH 2AMDA 3LH3A 3UNRA 1PPGE 1QL8A 2TBSA 3S9AA 3MH6A 2FEQH 4NZLA 2GTBA 2OLGA 1O36A 3RXTA 1SR5C 5HXFA 1SQTA 1BTPA 3SV9A 1RXPA 3QTVH 1BITA 1LPKB 1MKWK 3KGPA 3SHCH 3M7TA 3MNSA 1GBEA 2ODYB 3RXCA 1TMUH 3IWMA 1IQGA 4Q80A 3QUMP 3ZVEA 2SFAA 2F3CE 2Y5GA 2Q6GA 4TPYA 3BF6H 1NU7B 1UVTH 1NC6A 1CGJE 4BAHB 4KTUA 2VIOA 3UB0A 4OS1A 1DSTA 1SHYA 3BTTE 3LONA 1GJCB 1NRRH 4AC9A 1UMAH 3MU4A 2LP6A 1L1GA 4NWKA 1THSH 1KXFA 4O3TA 4ISHH 3SNCA 1S85A 1E1RD 3FN8A 2WV5A 4NA7A 1RTKA 4ZKRU 2GX4A 2FOGA 4X1QU 2BD4A 3DFJA 4F49A 3P8NA 2FXRA 4ZHLU 1ANBA 4IMQA 1P05A 2AERH 1NFWA 1C5WB 3FZDA 1BRBE 3N7OA 3URDA 3SZEA 4F55A 1HAPH 2A5AA 2BM2A 1DXPA 3LC3A 1KLJH 5C0TA 3HGNA 3ZZ6A 2YMSB 1UTLM 1F0RA 2ZHDA 1O2GH 2FO9A 4JYTA 1C5MD 2OTVA 7GCHF 4TY6A 4TPIZ 1O32A 4ZMAH 2AYWA 1DE7H 4J1YA 1ELDE 3PWBA 4MG3A 1NN6A 4M7GA 2PUQH 4YT7H 1KXAA 1TALA 1TPAE 2W7SA 4O3UA 1A4WH 2QXJA 5TJXA 3F9HA 3QZQA 3NWUA 1LTOA 1OOKB 2FOMB 2ZIQH 5G4BA 1TPPA 2XYAA 2AEIH 1ZZZA 1DFPA 1F92A 1ABIH 1GG6B 2YMSC 1OHHD 1QRZA 1WYKA 1MCTA 2AIPA 4AFZA 4B76A 1K22H 3RXBA 1QR3E 5PTPA 2AHME 2TGTA 1WQVH 1NFYA 1SLXB 3SU6A 1MTNB 1EB1H 5HGGA 4D8NA 4BTIB 3E6PH 1BBRH 4DT7B 2FYRA 1MKXK 1C5LH 5DKMA 3ESTA 4CH2B 2Y5FA 1DWEH 1GG6C 5C67A 1K21H 2CK3D 2TIOA 3ZVCA 3TK6A 4K3JA 1KSNA 4ZCNA 3NPSA 8KME2 1UTQA 2NWNA 2FIRH 1TWXB 2VGCB 3AAUA 3NUMA 4DIIH 1P0SH 4MPWA 1XUFA 1O34A 1HAIH 1O5EH 1ZSLA 3RU4D 2FOCA 2ODQA 1SI5H 2KR7A 2BOKA 5A8XA 1C1SA 4M9FA 2C90B 1T31A 3A82A 2QIQA 4KELA 4CR5A 3SOSA 2QC2A 2QF5A 2BXUH 4AG2A 4A1XA 1C4Y2 2R3YA 1AGJA 1EATA 2GT8A 4TY7A 2ANMH 2ULLA 1C5OH 1V2WT 4XBDA 2ZHFH 1FJSA 1H8ED 5FPSA 3UNQA 2BD8A 3E91A 2BDCA 1LVYA 1EJMA 1VZQH 1TQ7B 2HPQH 3SGAE 1HAGE 1V2KT 2PSXA 3GOVB 1G2MA 4CRDA 1H9HE 1RGQA 1TIOA 2FMJA 1GHZA 3EA8A 3Q77A 4NFFA 3P8OA 4YESB 1A3EH 1IHTH 2ZFSA 2VBCA 4NA8A 1CT2E 3V7TA 1DWDH 2AS9A 3ZZBA 2Y5HA 1D9IA 1O2MA 1BTXA 3RXRA 3A8BA 1CGIE 1DITH 2BQWB 1G3BA 5B6LA 2W7UA 1TGNA 2ZFTA 4FUFA 1Y3XA 1GHYH 1ELEE 3KHVA 1AQ7A 2A4OA 1P03A 3QX5H 4A1VA 3OY6U 2VVUA 4X1SU 1FY3A 2DE9A 4FVDA 3SJ9A 1F5RA 1GBTA 3OFND 1TX6A 4O97A 5EQQA 1BQYA 1ZR0A 7KMEH 1HXEH 4GVUA 3A7ZA 2XRCA 3MU0A 5CHBA 1FV9A 2D26C 3ZV8A 5KEDA 1UJ1A 2H2ZA 3T28A 3SI4H 1C1TA 3DT0H 5CMXH 4ABGA 1GBAA 2HVXA 2FZZA 1RS0A 5HM2A 1EAUA 2G52A 4Y10E 2BY5X 2XC0A 4H4FA 2ZCLP 1SGYE 1JRTA 1SOZA 3GCOA 1F5KU 3TK9A 2J97A 2EA3A 4NIXA 2PGBB 1UTMA 1WSSH 1SLUB 5DP9A 1BMLA 1QQUA 4XFQA 1SLWB 2EC9H 1YPHE 3KQDA 4I32A 4B75A 3P95A 4JZDH 1BMNH 5T1VA 3D65E 4BXWA 4RSPA 1ESTA 1CO7E 1BMAA 3BV9B 3NXPA 4U01A 8ESTE 1H8IH 2ILNA 1PPBH 4ABFA 5ETXA 2M5TA 3ZVBA 1IQNA 3RXSA 1W11U 3ZZ4A 2HOBA 1JIMA 1AVGH 2BLVA 4Q7ZA 5GJ4B 1TBRH 1K9OE 1AFEH 1Z8JB 1HAZB 2WYJA 1KYNA 1GHVH 1CT0E 1BDAA 1C2KA 1VITF 3M5OA 3RXMA 1C5PA 2ZGBH 1BTZA 2VVVA 4INHA 3RXPA 2GV6A 3P6ZB 5EPNA 4UE7H 3TITA 5GXPA 3Q3YA 1TMBH 1V2LT 5AHGH 5ESBA 3M3TA 4BAKB 1HFDA 2JETB 4WVPE 2R2MB 1EZSC 1QJ6B 4I86A 2OC0A 1HRTH 1WDIA 3CS0A 3DSPA 4ZXXH 2BZ6H 1BBRE 3G01A 1ETSH 1O2HA 3P92A 1OWEA 5DGJA 3L33A 1UTOA 3P17H 1EZQA 1S0QA 3A81A 5EXNA 3I29A 2B0FA 3T27A 1K1PA 1TGTA 1QURH 2FYQA 1BIOA 2ESTE 5HIYA 1OKXA 2ZF0H 1C2FA 1QA7A 2JETC 3HKJB 2J34A 2QV1A 2BXTH 4FXGH 1QFKH 4CHAB 2OINA 1EOJA 2JH5D 2XCNA 3S69A 4JZEH 3U98H 2H9EH 1FXYA 4X6PA 1V2QT 2ZNKH 4YM9A 4Y76A 1O3IA 2RDEA 2XWAA 1S6HA 1ELVA 1EZXC 1WQSA 2QXIA 4Z0KA 4GCHF 1MD8A 3PLKA 2VWNA 4HGCA 4UFGH 2XOKD 2AGIX 1C1OA 2GCHG 3A8DA 2VB0A 1FAKH 2Z9JA 2H5DA 5DP7A 2QN5T 3U28C 3GCTG 3SI3H 1OX1A 3TU7H 1RJXB 4AORA 3R0FA 4Y79A 3ZYDA 2G4UA 2GMTC 3UQOA 1IHSH 1TOMH 4INKA 4WH6A 4YT6H 1YC0A 1BMMH 1MAYA 2V3OH 2BX4A 1O2PA 3GDVA 5JB8S 1HPGA 4ZHMU 4WMDA 1C9TA 1XUJA 3LJJA 1GI1A 2WHXA 2ANWA 1ANEA 1C2LA 4ABJA 5GPIB 1AVWA 2V7QD 1AUTC 3HGPA 2ZTXA 1QZ8A 5HIZA 3PMJA 2SGDE 1CQQA 2ZFQH 3A88A 1Y3YA 2CHAB 1AFQC 4I8GA 5EG4A 1KDQA 1A5HA 1T8OA 2H1UA 3A8CA 4D76A 2SGEE 5FAHA 1AI8H 5EU8A 3S9CA 1HAVB 1ZTKA 2ZECA 1S82A 1J16A 2CXVA 1GVKB 3F0OA 3LT3A 5E2OA 1AB9C 3STIA 1OYQA 2YNAA 1A5IA 1PYTC 3SJKA 1YPGH 2VU8E 1FY1A 3KIDU 1BRCE 1HB0B 1W3CA 4JK6A 2B8OH 1P02A 1P57B 2ODPA 1NT1A 2CHAC 3WWBA 3RLYH 2F9BH 2GDDA 2ZPRA 1C1VH 4YLUA 4B73A 1NROH 2A4QA 3LGWA 4TT3D 4B74A 4MQAA 4D7FA 3RLWH 3A7VA 3RC4A 4UONA 1W14U 2SGFE 2TRMA 1C5YB 2FP7B 3PRDA 3RXJA 3SNBA 8GCHG 1SG8B 1TNKA 3KYFA 1GI8B 3O8CA 1G37A 1P01A 1GMCF 2CJIA 5C5OA 5DO4H 1SGEE 4I8LA 2OK5A 1GHWH 1O5GH 4D9RA 1BZXE 1GGDC 2UUKB 1DUEA 4JYVH 3CP7A 2Y7XA 4FUJA 1YY3A 1P04A 2FOEA 3FKSD 1GJ6A 1LHDH 1SGFG 2XNDD 2HNTE 1L2EA 3LGUA 4YOGA 2J98A 3SYJA 2G55A 4X2YA 3FO8D 3OE7D 3PO1B 4IGDA 5JBAS 1OP0A 3DSGA 1SL3A 1HIAA 3GY7A 4OS6A 3AVZA 1S6FA 4HFPB 2VNTA 2BY6X 5T3HA 1W7XH 3PRBA 1H8DH 3B8JA 1ZHRA 3D49H 4OS4A 3M5LA 1LDTT 1SFIA 1J8AA 4KKDA 1N8OB 2STBE 1C2EA 1LQEA 3RXVA 3GICB 1AE8H 1D4PB 2G8TA 5A09A 1V2UT 4WXVA 3OEHD 1F0TA 3RU4E 4MDSA 3UUZA 2O8UA 1LHFH 2ASUB 1P2JA 3PO1C 3RXFA 5BRRE 2JH6D 1K1MA 3VEQB 1O2KA 3F0PA 1FLEE 1FDPA 1MZDA 2AH4X 3URCA 1GMHF 3GY3A 2W26A 4UEHH 2YMSD 2BTCE 2P3UB 3PROA 2IN2A 3TK5A 3V13A 4RT0A 4THNH 1N8OC 3SGQE 2BX3A 2KZ4A 1C4U2 1HBTH 1QB1A 2UWLA 3I77A 1J15A 2KX4A 1AKSB 3BG4B 4U2WA 1GCTB 1FI8A 1PPHE 7ESTE 2VIPA 1VCQA 4RN6A 1NBMD 4UFEH 1ZTLA 1GHAG 3SU1A 6GCHG 4NG9H 3LH1A 1W0KD 3QLPH 1OWKA 1UO6A 3WY8A 1QJ1B 2FWWA 4WMEA 3LOXA 1O2OA 1EAWA 1GDUA 2RA0A 2SGPE 4ABHA 1NU9A 1C1RA 2BQ6B 1FIWA 3PM3A 2ZPQA 2KCPA 1K0HA 1GI6A 2C8WB 3ZZ7A 2GCTC 4WF8A 1GCTC 4NA9H 1C2IA 1HV7A 4X1NU 1ELCA 1A0HB 1EKBB 4YOIA 2BMGB 1UHBA 2HLDD 1P9UA 3BEUA 2C3SA 3SHAH 1UVSH 1V6DA 2CN0H 4QT8C 3UWJH 4DY7B 1FPHH 1MTSA 1W8BH 2JJ1D 1GI0A 1ZMLA 1YLDA 5DK1A 4X6OA 1TONA 1C5RA 3GISB 2QY0B 5GWZA 5L6NH 1S83A 1MU6B 1TOCB 2NU0E 1BOQA 4AFSA 4O9VA 1O3CA 3TGIE 1GHXH 1Y5BT 3LU9B 5F03A 3UAIC 4FUHA 3V12A 2XNIA 1UTKA 1B7XB 1O3FA 5T6FA 1DWCH 1GL0E 1V2RT 1QRXA 2J38A 1AMHA 1O2JA 1OS8A 2EY4C 1MTUA 2VWLA 4ZKNU 2IOTA 3U69H 1C4V2 3VFEA 4K8YA 3I78A 1Z1IA 1ZLRA 3BTME 3EDXB 1ZTJA 3T25A 2BDAA 2VJ1A 1C2MA 3SV2H 1HJAB 3M5NA 4E7NA 2EQNA 3FZZA 3SNEA 1GBFA 1RIWB 4JZFH 3ZZ8A 1MQ5A 1HJ9A 2FPZA 3QTOH 1S5SA 2G5VA 3SW2B 4A5TS 1A0JA 3RM0H 1T7CA 2JJ2D 2GDEH 2BHGA 1XXDA 1PPCE 1AD8H 1HJ8A 2ZA5A 3K65B 4FUCA 3DA9B 3SUDA 3ZVDA 4F48B 1KTTB 4NSVA 2HVYB 2IJOB 2C4FH 4Y8ZA 1ELTA 3ZZCA 3H5CB 1BA8B 1SQOA 1YKTA 2K8IA 4AFUA 4RKJB 1W13U 3HPTB 2BD9A 2LNCA 3U8RH 2OXSA 3VGCC 1O2WA 2QE7D 2HALA 1IQIA 1QB9A 2STAE 3FFGA 1J9CH 1HJAC 5L2YH 1EPTA 2ZP0H 1RIWC 1SGNE 4VGCB 4GPGA 3VB5A 2F83A 4K1TA 3EA7A 1SGQE 2GKVE 1THRH 5LPRA 1NTPA 4ASHA 4RI0A 3NK8A 4WJG2 1ETRH 2GZ8A 2J94A 3KF2A 3SUEA 3U9AH 4H42U 4CRGA 5E0HA 1UK2A 4ZKSU 1Q3XA 1GJ9B 3IITA 1TNIA 1C5UA 1BJUA 1NRQH 4ZH8A 3MNXA 2KCAA 4A6LA 3RUOA 3N99A 1KY9A 1MUEB 3MOCA 3TJOA 5I25A 1ZHPA 5CE1A 4GUXA 2Y81A 1YPHC 2R0KA 1K28D 2ZDVH 4LZ4B 2EI6A 4ISLA 3SNAA 2BOHB 2AGEX 4VGCC 1WAYB 4OS5A 1DVAH 3EQ0H 1AU8A 4Y0YE 4XE4A 3T26A 3UR9A 1SBWA 1LQDB 1NRNH 2ZDLA 2PR3A 5EQRA 2TGPZ 2FS8A 1D3TB 1SQRA 1PQ7A 3ATKA 1ARBA 2HLCA 1LVBA 3OTPA 3TH2H 1YM0A 1ZJDA 2RCEA 3CENA 3F9EA 1GI3A 2ZFFH 1SGDE 3ITIA 1VCWA 1JMOH 2KCYA 2Z3DA 1ZHMA 2A4RA 1YYY1 1F0SA 2O8WA 3VB3A 5JDUB 1WCZA 4RT1A 4H6SB 2XTTB 3UWIA 1TQ0B 2WZQA 1EAXA 1C5SA 1ZRBA 3MTYA 1J17T 3AASA 1T8LA 1GI4A 1NFUA 5C3NA 5FPTA 2WPIS 3V3MA 2JKHA 1K2I1 2EEKA 2ZGCA 1L4DA 2W3IA 2ZCHP 2WPLS 1XUIA 2H6MA 7GCHG 3N7EA 2VIWA 1C5NH 3FP6E 1C1UH 2BDYA 2XCFA 1P06A 5AFZH 2Z9LA 5DP3A 5EODA 2WINI 2QGRA 2B7DH 1UCYH 3UPEA 1AVXA 3DCLA 3MYWA 3UREA 1DS2E 2GVFA 3ZZDA 3KEEA 3PV2A 3TJNA 2XXLA 2ZHEH 3VB4A 1BBRK 1SQAA 3BG8A 3ZZAA 1YPEH 1E37B 4AFQA 2G81E 4FUBA 3OYPA 3L6PA 4NSYA 1TYNA 3ZVFA 1IQJA 1XUHA 1O33A 1P8VC 1HYLA 4RKOB 1H1BA 2OBQA 3CS7A 1O3GA 3O8DA 1O5DH 1DDJA 2ZTZA 3D62A 4FUIA 3A84A 4ZHAA 3RMLH 1V2JT 3RXUA 1O39A 5DSFA 3VPKA 4I8KA 1ABJH 2WUCA 2FODA 1TFXA 1ZPBA 4HI3A 5E0GA 2QXHA 4ABDA 1AY6H 2SGQE 4INLA 3S7HB 2Z9KA 5F8XA 4NZQA 1YLCA 1QY6A 3M35A 2RG3A 4CRAA 4DG4A 3WW7A 1EPTC 4LK4A 1GCDA 4Y6DA 3BTGE 2OCVB 1V3XA 3OTJE 2C8YB 4GSOA 3BIUH 1Y59T 3F3BA 3UOUA 4ZKOU 2A45B 2R3UA 1IQHA 1TA6A 4TWWA 4I8JA 1LHGH 2VIDA 3BTEE 3BSQA 3A85A 1NFXA 4NGAH 1KXEA 2M2AA 1QTFA 3PYHA 4FU7A 1H8HD 5EXMA 3STJA 2ZDMA 1YLNA 1P12E 3WWFA 2UUYA 1AHTH 3PLBA 1COWD 5JPMH 1YPJH 2BQ7B 1P2KA 1C1MA 4K1EA 1QJ7B 2ZDAH 1BRUP 1PYTD 3N7DA 3W95A 3NCLA 2J9NA 1SGTA 1N6XA 4NWLA 1GPZA 2BYAX 1FONA 2FOFA 2B5TB 3QN7A 1QBNA 1MBQA 1UVUH 2YOLA 3HATH 4MLFB 3F1SB 2K1QA 2F9OA 2ZC9H 3JZ1B 4BAQB 5HYOA 2WPMS 5L30H 3EA9A 3M3SA 4O03A 2BB4A 3SN8A 1C5QA 4X2WA 1XKBC 4Y71A 4TSFD 1SKYE 1Z8GA 4Y7AA 3SORA 1TGBA 3S0NA 4Q63A 3GDUA 1CGHA 3F9GA 1L1NA 1EASA 1ETTH 2H5CA 3FVFB 4JK5A 3ENSB 4IC6A 4LZ1H 1NZQH 1VR1H 4OGXA 2XW9A 4R8TB 2F9VA 3U1JB 2A2QH 1Z6JH 2J95A 2ZGXH 1TNGA 2L74A 1SGRE 4Y8XA 6LPRA 1O3DA 1QNJA 1EFRD 4JZIA 1JRSA 1O3KA 2PTNA 2ZTYA 3DFLA 3A86A 3E0NB 1FZZA 2Y80A 1NBME 5EJZA 1GMDF 4ABBA 4WWYA 1XUGA 1PPEE 4U32A 1O38A 3H09A 2V3MA 2BZAA 2HNTC 1O2LA 1GBMA 3F6UH 1IQMA 2NU1E 1X7AC 3A7TA 1AZ8A 2PUXB 3RXHA 1EZUC 1O2RA 3SU4A 1G9IE 1ESAA 5FHTA 3E0PB 3QGNB 2G00A 1TMTH 6CHAC 1O30A 1JIRA 1WBGB 1BTWA 3SJOA 1C2GA 1MAXA 2BY9X 4MTBA 1V2TT 1PPFE 2CF8H 1NRPH 1HLTH 4I31A 2GMTB 1T32A 1P11E 4BTTB 2HRVA 4X6NA 5HMAA 1O2TA 1A61H 4B6EA 3A7YA 2LPRA 2XBYA 2C8XB 1O2QA 3AK5A 1XMNB 3OSYA 1MABB 1THPB 1UCYE 1HAXB 1S6LA 4E05H 2ZGHA 1P2IA 4AB8A 4GAWA 4XSKU 1L1JA 1A3BH 1LHCH 3F2HA 3K6YA 1D3QB 2A2XH 1M9UA 3IG6B 3E90B 3SV6A 2UWPA 1VITG 1AFQB 4CRBA 3LGVA 1XXFA 2J4IA 1GBIA 4H6TA 2FI5E 5DP6A 3MMGA 5HM9A 4CREA 2PSYA 2P95A 2P59A 4XD7D 1EAIA 1O35A 3SV8A 1DXWA 1AB9B 3SUFA 1AIXH 2VVCA 4YOJA 4K2YA 2FX4A 3KQCA 4AZ2B 2VWMA 4Z6AH 1GL1A 4XBCA 4Y11E 3CNRA 2AMQA 4UDWH 3AW0A 2ZHWH 1MCVA 5ESTE 1T8NA 1EP5A 1FQ3A 2Z6BD 1B0EA 4XBBA 1T4VH 2F4LA 1GHBF 1ZSKA 1XVMA 1GBDA 2NU2E 1HNEE 3C27B 4FUGA 1OYTH 1VGCB 2QXGA 5EGMA 1O3AA 1WU1A 3H7OA 1FN8A 4PROA 3Q3KA 5GCHF 1H4WA 1W0JD 1S81A 3U8OH 1XUKA 4Y0ZE 4KGAA 4NIVA 4ACBA 1OWDA 1AWHB 4FU9A 1YCPM 3GCHC 2Q6FA 1MBMA 2ZO3H 3LIWA 5C94A 5GIBA 2CMYA 3P70B 1KMHB 2P8OB 4IC5A 1GWAA 3V0XA 4CRCA 1RD3B 1L4ZA 4MPUA 1N1LA 1Z8IB 4GCHG 4AOQA 4WMFA 1G3DA 1GGDB 3M36A 4ISIH 1VGCC 6ESTA 2FLRH 3QDZB 3MI4A 1WV7H 2ZU4A 2KAIA 2KCOA 2C93B 1IOEA 5DJ7A 1HUTH 1YPLH 1F7ZA 3PLPA 3RXEA 2A1DB 3PMAB 1G3EA 5E2PA 1V2OT 2WPDD 4DGJA 2AFQB 1C2HA 3KCGH 2CF9H 3RC5A 2FDAA 2P8OC 1TE0A 2EI7A 1QIXB 9LPRA 2KM0A 2FTLE 3ZYEA 1E36B 3K6ZA 2DE8A 3SGBE 1A0LA 2ZZUH 1JBUH 1GI2A 2P93A 3ODFA 2HGTH 1H9LB 2OUAA 3GY6A 2PKAA 2GP9B 4YXWD 1QRWA 1DICA 3BTKE 1GJ7B 8LPRA 2OC8A 2XBVA 1CHOF 5E8EH 1N6YA 3LGTA 1LPGB 4SGAE 3M5MA 4ABIA 3UR6A 5FBEA 1AWFH 2QF0A 2D2DA 2F9PA 1SSXA 1TRYA 2VH0A 3TNSA 2ALPA 1HXFH 2VIVA 1TRNA 4BTUB 3C1KA 1H9IE 3SU2A 1F2SE 4FOUC 1E1QD 1ELBA 3KNXA 5I46H 1PJPA 1YPMH 1KDQB 1JWTA 1ZGVA 1MTVA 4K1SA 2P3TB 3A87A 1GBHA 4CRFA 3A89A 1TBQH 1HAHH 2GCTB 3BEFB 3MU8A 1GMCG 2BD3A 4CBNA 2NU4E 4ZUHA 2O9QA 4DW2U 2Z94A 1LKAA 1V2MT 1YCPH 3RXAA 2P16A 2WV4A 3SU5A 4A1TA 3SO3A 3ZZ3A 1UTPA 2BD7A 2A7JA 1K1LA 5EJLA 4MNXA 5J4SA 1HAYB 4MNVA 1IQFA 2ALVA 1P2OA 3ELAH 1DM4B 1ARCA 1KXBA 2SNVA 3MNBA 1QQ4A 1TAWA 2NU3E 3A8AA 1OP2A 4IW4E 4A92A 5J4QA 3TGJE 5LPEA 5A8ZA 4UFFH 4X8TH 3SBKA 2FX6A 2ZU3A 2FOBA 2SNWA 3MQKC 5DP4A 3TVJB 4ASUD 1TPOA 1GDNA 1QL9A 1MKWH 1K1OA 4F4OC 1T4UH 1O2ZA 1SGFA 3TGKE 3OX7U 1ZYOA 2FS9A 1O3PB 2ZU2A 1P3CA 4X1RU 2Q1JA 4B71A 2HNTF 5HKKD 3RXGA 2D8WA 1KLIH 3E8LA 3MFJA 2QA9E 3M7QA 1UVOA 1WOFA 3T29A 1BTYA 2J98B 1CBWB 1JOUB 2Y7ZA 4X2VA 1GMHG 1TNLA 1VITH 3E3TA 1BMFD 4Q7XA 1HIAB 1BTHH 3ZZ5A 3FOAA 2P3FH 4BOHA 1ZPCA 4X8SH 5IDKA 3OU0A 2QCYA 1TLDA 1ACBE 1V2PT 3MO9A 2PV9B 1O3BA 1V2VT 3BTHE 2BLOA 2B9LA 2VWOA 4OS2A 3KQEA 4X0WU 3KYGA 1OWHA 1E0FD 1O0DH 2GZ7A 2KFWA 4OM9A 3U8TH 3VGCB 3MU5A 4Q2KA 4BAMB 1HAOH 1SHHB 1DX5M 3QK1A 1CBWC 3RXKA 4GHQA 3PWCA 4NIWA 1FPCH 1B0FA 4DURA 2WPHS 1K1NA 2J92A 3SU3A 4IBLH 5JBBS 1O5BB 5SGAE 3ZV9A 4YO9A 3HK3B 4CH8B 1QBOA 1DY9A 1AZZA 3RXOA 2Z3EA 1EB2A 2XWBI 3F68H 1TB6H 4Q7YA 5EXLA 5AF9H 1Q2WA 1XX9A 3TIUA 2H9TH 2OC7A 2PGQB 1O5FH 1TX8A 3TNTA 3E16B 1V2NT 1MD7A 2ZHQH 4MPXA 2BVRH 1OXGA 1Z8RA 1Q31A 3SV7A 1FUJA 5ABWA 1A46H 1OWIA 4JMYA 1YGCH 5TCCA 2PWXA 1MU8B 1VJAU 1BUIA 2IJD1 1AN1E 3NZIA 4ZXYH 5IYTA 5EW2H 1PQAA 2ZEBA 1EOLA 1GJDB 1MKXH 2WPKS 1GJAB 3RDZA 4HTCH 3UFAA 2L6OA 3UQVA 1GI5A 1UHBB 2CV3A 5TCAA 1NO9H 1SOTA 3PV5A 2R9PA 3EE0B 5EJ1A 2FESH 1QL7A 1G36A 1K1JA 2Z7FE 2ZQ1A 4J2YB 4Y7BA 1WXRA 1UK3A 4AG1A 2ZDNA 2ZKSA 5DN6D 5EIYA 1QHRB 1O31A 3KL6A 3VXFH 3OY5U 3VXEH 4ESTE 1ZMNA 3A80A 4I7YH 2TGAA 2W5EA 1TX7A 2W6JD 3LGYA 1CA8B 1U6QA 1DPOA 1DLEA 3PTNA 4X6MA 4X8VH 2VIQA 1KXDA 4UFDH 3OEED 4P02A 1DSUA 5A8YA 4ZROA 1SPJA 1MTWA 1O3JA 1XKAC 1Y5UT 3BTFE 3HK6B 2F9UA 2O8LA 5C0UA 2WYGA 4IN2A 1PQ5A 2XBXA 1GI7B 3BN9A 2BVSH 2BD5A 3FP8E 5T6GA 1FIZA 3ZZ9A 4AB9A 3Q3XA 1QA0A 1WUNH 1GJ5H 2A7CA 1GBJA 3R3GB 3GY2A 1F5LA 2QAAA 3GY5A 1ELAA 2BDBA 5BPEA 2OBOA 1SGCA 1Y5AT
chains in the Genus database with same CATH topology
3NKKA 1ZSJA 2ZG0H 2BD2A 2Z9GA 3T2NA 1YF4A 2PHBA 1MTNC 3P8GA 4BANB 1WTHD 5K0HA 1EXFA 1C1NA 3UOPA 4AX9H 1IQLA 1D3PB 4A7IB 1UVPA 2TPIZ 1O2UA 3A7XA 1NRSH 1HDTH 4LXBH 4X8UH 1O5AB 3KQBA 4YZUA 1ZOMA 4LOYH 2JH0D 1EPTB 5FCKA 2PTCE 3RP2A 2GV7A 2A5KA 3U1IB 1FMGA 2QF3A 1G3CA 1AUJA 1Z7KA 1GJBB 3PTBA 2AIQA 5F6MA 3Q76A 2OD3B 1C5ZB 4B2AA 1BRAA 2VGCC 1NESE 1NY22 1O3HA 2ANYA 1LHEH 4SGBE 5A2MH 3A83A 2V0BA 1JXPA 1P2NA 3MHWU 4Y8YA 3ATMA 1LMWB 1EJNA 4ISNA 3RXIA 4E06H 4YTAA 4NCYA 1CE5A 3EGKH 3LC5A 1PQ8A 1UCYK 2A7HA 1BCUH 3GY8A 1BJVA 2THFB 5A0CA 2V6NA 1Z6EA 2J2UA 1EUFA 1O2SA 2BVXH 3GCNA 4R0IA 3RC6A 1NS3A 2RDLA 2ZFPH 4X1PU 2G5NA 1C1WH 3RMNH 4WH8A 3LJOA 4GHTA 2I6QA 1W7GH 3JZ2B 2FOHA 3TH4H 2ZQ2A 1Y8TA 1P3EA 1GJ4H 1S0RA 5EOKA 1P2QA 2R2WU 4CR9A 2WUBA 4DVAU 2A5IA 1P10A 1ESBA 1KLTA 1KXCA 2OQ5A 3MO6A 2UUFB 2BDIA 5DPAA 4FVBA 1TA2A 1BT7A 2GD4B 1ZMJA 1K1IA 1G32B 1B5GH 1MZAA 3VB7A 1L0ZA 1FY4A 1SC8U 1LO6A 1O2IA 4UD9H 3SJ8A 3S9BA 3T5FH 5AFYH 3SZNA 4AGKA 1QGFA 4K5ZA 1DT2A 2BY8X 3UTUH 4BAOB 4IMZA 1BHXF 4K69A 1FAXA 1FY8E 6CHAB 2ZDKA 5DG6A 1V2ST 1EJAA 5A0BA 3M61U 1W12U 2C8ZB 2FOAA 3UIRA 1OP8A 3ZVAA 3O8BA 1A5GH 5AVDA 3PMBB 1C1QA 2GCHF 3KN2A 4OS7A 4DJZB 2F9NA 4AYYB 4B2CA 3GCTF 1TRMA 1GI9B 3DHKH 1C5XB 4NIYA 1P09A 1HAVA 1Z71A 1OWJA 1DANH 2BY7X 1CA0B 1ELGA 1S84A 2GT7A 1RTLA 1O3NA 1TGCA 3ATWA 2ZI2H 1Y3UA 5GDSH 1O5CB 1CT4E 2VH6A 3SQEE 1EQ9A 1GBBA 1QB6A 3M7UA 4IN1A 1WTGH 1FY5A 4JZ1A 2ZPSA 3SQHE 3SU0A 3AW1A 2FI4E 1TPSA 1TBZH 2ZU5A 1CA0C 4ABEA 1SLVB 1XM1A 1SVPA 1FNIA 1O2NA 5DP5A 2GGVB 2H9HA 4XOJA 2ZFRH 3MWIU 1D6RA 4U30A 7LPRA 2SGAA 1DOJA 1ORFA 2YNBA 2IPHA 1SFQB 4K60A 4OGYA 3ODDA 3K2UA 5C2ZA 1A7SA 1YP9A 1GBLA 3ATIA 3GYLB 1AO5A 4CBOA 4X2XA 4NFEA 3W94A 3PMHB 2VINA 5F8TA 5FX6A 1ANDA 2O8MA 3GYMA 2Y6TA 3HKIB 2A4GA 1GMDG 1KTSB 2UWOA 3M3VA 3MH4A 5C5NA 4WY3A 3GCHB 8GCHF 1O2XA 5EQSA 1SMFE 3TJVA 4CHAC 3DD2H 3RM2H 3RXLA 4D9QA 1TGSZ 2Y82A 1VCPA 1PPZA 4JCNA 1C1PA 1C9PA 1W10U 3BTDE 1BB0B 2RA3A 4GLYA 2AMPA 1FN6A 1ZRKA 1J14A 3TJUA 4FUDA 5CHAB 4KP0A 2V3HH 3SJIA 3QZRA 1SB1H 4MVNA 2HWLB 3ATLA 1O37A 1T8MA 1KIGH 4I8HA 5FCRA 1UTNA 2ANKH 3H7TA 5L2ZH 2PKSB 1ZPZA 3PV4A 1SGPE 2A0QB 5K7RA 3QO6A 4DOQA 1G2LA 5LPFA 1E38B 1TNHA 2FI3E 4BNRA 5JBTA 1LPZB 2QYIA 5A0AE 2EI8A 3M37A 3B23B 1W2KH 5JBCS 4TWYA 1G30B 5CHAC 4WXIA 1AKSA 2PLXA 1LVOA 2XC5A 2TGDA 3AAVA 1O3LA 2A32A 1D3DB 3LKWA 3MH5A 3MO3A 2W3KA 1O2YA 1O3EA 1QCPA 3MNCA 1NPMA 1Z1JA 2PKSC 2G51A 3TPIZ 3RXQA 1DWBH 3B9FH 3TH3H 2OC1A 3SUGA 4FU8A 1ID5H 1C2JA 1LCYA 1UTJA 4FUEA 4KTCA 1ELFA 1INCA 2I6SA 1W0ZU 3BIVH 3MH7A 3ZVGA 5H4IB 2Q6DA 5C1XA 4E7RG 1PFXC 2OP9A 5FPYA 3T62A 5B6OA 5LGOA 2PFEA 3O8RA 4XDEA 1O3OA 1HGTH 1RRKA 3RXDA 4YLQH 4D7GA 1YBWA 3P8FA 3RU4T 4DCDA 2PW8H 1GHBG 1GVZA 1SGIB 2Z3CA 2GZ9A 1GHAF 6GCHF 5GCHG 2P94A 3Q00A 5C1YA 1F0UA 4AYVB 1OSSA 1OPHB 2FLBH 3F9FA 3UNSA 3LPRA 4I33A 4ABAA 5T6DA 4B2BA 2WPJS 2XBWA 1EX3A 1O2VA 1NM6A 1MQ6A 4HZHA 4K8BA 2FTMA 2ZCKP 2UUJB 3A7WA 3E1XB 4TYDA 1UK4A 2BLQA 1AE5A 4KTSA 5JB9S 3FP7E 2HPPH 2DUCA 4AGJA 1RFNA 1O3MA 2G4TA 5FXLA 3LGIA 1GBCA 5DP8A 3FANA 5FX5A 2FM2A 1IAUA 3GY4A 5C1UA 3K9XB 1C5TA 1ZJKA 2AGGX 2BDHA 3FAOA 2O8TA 3TLOA 3L3TA 1DLKB 3EYDA 3RMOH 3DUXH 1XVOA 1TABE 1CHGA 3D23A 4ZAEA 1GVLA 5LH8A 1HCGA 1W0YH 1YPKH 3VB6A 3SNDA 5JYIA 4DIHH 1EP6A 3PB1E 3RMMH 1CSOE 1QBVH 4MNYA 2R0LA 1DUAA 3MU1A 3EAJA 4BXSA 1MMJN 1D6WA 3S7KB 1E34B 2D1JA 1RTFB 2KAIB 5EW1H 3BTQE 9ESTA 1TNJA 5EPYA 1CHOG 1LVMA 4JYUH 1IQEA 1Y3WA 3LDXH 3GDSA 1BHXB 2V35A 3QWCH 1IQKA 1VJ9U 3BEIB 2Z9IA 2OQUA 2BDGA 1C2DA 4AN7A 4MPVA 1LKBA 1E35B 4B1TA 1GDQA 2XC4A 2A31A 1CVWH 5F8ZA 2ZGJA 3QGJA 5E0JA 2BLWA 2CGAA 4MNWA 3BG4C 5FBIA 1GJ8B 1BTUA 3UY9A 1YCPK 2PKAB 5C20A 2ZU1A 1P2MA 1A2CH 1MH0A 1A1RA 1CU1A 1GBKA 1P9SA 1DY8A 2F91A 4ISOA 1C5VA 1ANCA 4IS5A 1ZGIA 3BTWE 1Y3VA 2ZWLH 2AMDA 3LH3A 3UNRA 1PPGE 1QL8A 2TBSA 3S9AA 3MH6A 2FEQH 4NZLA 2GTBA 2OLGA 1O36A 3RXTA 1SR5C 5HXFA 1SQTA 1BTPA 3SV9A 1RXPA 3QTVH 1BITA 1LPKB 1MKWK 3KGPA 3SHCH 3M7TA 3MNSA 1GBEA 2ODYB 3RXCA 1TMUH 3IWMA 1IQGA 4Q80A 3QUMP 3ZVEA 2SFAA 2F3CE 2Y5GA 2Q6GA 4TPYA 3BF6H 1NU7B 1UVTH 1NC6A 1CGJE 4BAHB 4KTUA 2VIOA 4OS1A 1DSTA 1SHYA 3BTTE 3LONA 1GJCB 1NRRH 1UMAH 3MU4A 1L1GA 4NWKA 1THSH 1KXFA 4O3TA 4ISHH 3SNCA 1S85A 2WV5A 4NA7A 1RTKA 4ZKRU 2GX4A 2FOGA 4X1QU 2BD4A 3DFJA 4F49A 3P8NA 2FXRA 4ZHLU 1ANBA 4IMQA 1P05A 2AERH 1NFWA 1C5WB 3FZDA 1BRBE 3N7OA 3URDA 1HAPH 2A5AA 2BM2A 1DXPA 3LC3A 1KLJH 3HGNA 3ZZ6A 1UTLM 1F0RA 2ZHDA 1O2GH 2FO9A 4JYTA 1C5MD 2OTVA 7GCHF 4TY6A 4TPIZ 1O32A 4ZMAH 2AYWA 1DE7H 4J1YA 1ELDE 3PWBA 4MG3A 1NN6A 4M7GA 2PUQH 4YT7H 1KXAA 1TALA 1TPAE 2W7SA 4O3UA 1A4WH 2QXJA 5TJXA 3F9HA 3QZQA 3NWUA 1LTOA 1OOKB 2FOMB 2ZIQH 5G4BA 1TPPA 2XYAA 2AEIH 1ZZZA 1DFPA 1F92A 1ABIH 1GG6B 1QRZA 1WYKA 1MCTA 2AIPA 4AFZA 4B76A 1K22H 3RXBA 1QR3E 5PTPA 2TGTA 1WQVH 1NFYA 1SLXB 3SU6A 1MTNB 1EB1H 5HGGA 4D8NA 4BTIB 3E6PH 1BBRH 4DT7B 2FYRA 1MKXK 1C5LH 5DKMA 3ESTA 4CH2B 2Y5FA 1DWEH 1GG6C 5C67A 1K21H 2TIOA 3ZVCA 3TK6A 4K3JA 1KSNA 3NPSA 8KME2 1UTQA 2NWNA 2FIRH 1TWXB 2VGCB 3AAUA 3NUMA 4DIIH 1P0SH 4MPWA 1XUFA 1O34A 1HAIH 1O5EH 1ZSLA 3RU4D 2FOCA 2ODQA 1SI5H 2BOKA 5A8XA 1C1SA 2C90B 1T31A 3A82A 2QIQA 4KELA 4CR5A 3SOSA 2QC2A 2BXUH 4AG2A 4A1XA 1C4Y2 2R3YA 1AGJA 1EATA 2GT8A 4TY7A 2ANMH 2ULLA 1C5OH 1V2WT 4XBDA 2ZHFH 1FJSA 3UNQA 5FPSA 2BD8A 3E91A 2BDCA 1LVYA 1EJMA 1VZQH 1TQ7B 2HPQH 3SGAE 1HAGE 1V2KT 2PSXA 3GOVB 1G2MA 4CRDA 1H9HE 1RGQA 1TIOA 2FMJA 1GHZA 3EA8A 3Q77A 4NFFA 3P8OA 4YESB 1A3EH 1IHTH 2ZFSA 4NA8A 1CT2E 3V7TA 1DWDH 2AS9A 3ZZBA 2Y5HA 1D9IA 1O2MA 1BTXA 3RXRA 3A8BA 1CGIE 1DITH 2BQWB 1G3BA 2W7UA 1TGNA 2ZFTA 4FUFA 1Y3XA 1GHYH 1ELEE 3KHVA 1AQ7A 2A4OA 1P03A 3QX5H 4A1VA 3OY6U 2VVUA 4X1SU 1FY3A 2DE9A 4FVDA 3SJ9A 1F5RA 1GBTA 1TX6A 4O97A 5EQQA 1BQYA 1ZR0A 7KMEH 1HXEH 4GVUA 3A7ZA 2XRCA 3MU0A 1FV9A 2D26C 3ZV8A 1UJ1A 2H2ZA 3T28A 3SI4H 1C1TA 3DT0H 5CMXH 4ABGA 1GBAA 2HVXA 2FZZA 1RS0A 5HM2A 1EAUA 2G52A 4Y10E 2BY5X 2XC0A 4H4FA 2ZCLP 1SGYE 1JRTA 1SOZA 3GCOA 1F5KU 3TK9A 2EA3A 4NIXA 2PGBB 1UTMA 1WSSH 1SLUB 5DP9A 1BMLA 1QQUA 4XFQA 1SLWB 2EC9H 1YPHE 3KQDA 4I32A 4B75A 3P95A 4JZDH 1BMNH 3D65E 4BXWA 4RSPA 1ESTA 1CO7E 1BMAA 3BV9B 3NXPA 4U01A 8ESTE 1H8IH 2ILNA 1PPBH 4ABFA 5ETXA 2M5TA 3ZVBA 1IQNA 3RXSA 1W11U 3ZZ4A 2HOBA 1JIMA 1AVGH 2BLVA 4Q7ZA 5GJ4B 1TBRH 1K9OE 1AFEH 1Z8JB 1HAZB 2WYJA 1KYNA 1GHVH 1CT0E 1BDAA 1C2KA 1VITF 3M5OA 3RXMA 1C5PA 2ZGBH 1BTZA 2VVVA 4INHA 3RXPA 2GV6A 3P6ZB 5EPNA 4UE7H 3TITA 5GXPA 3Q3YA 1TMBH 1V2LT 5AHGH 5ESBA 3M3TA 4BAKB 1HFDA 2JETB 4WVPE 2R2MB 1EZSC 1QJ6B 2OC0A 1HRTH 3CS0A 4ZXXH 2BZ6H 1BBRE 3G01A 1ETSH 1O2HA 3P92A 1OWEA 5DGJA 3L33A 1UTOA 3P17H 1EZQA 1S0QA 3A81A 5EXNA 3I29A 2B0FA 3T27A 1K1PA 1TGTA 1QURH 2FYQA 1BIOA 2ESTE 1OKXA 2ZF0H 1C2FA 1QA7A 2JETC 3HKJB 2J34A 2QV1A 2BXTH 4FXGH 1QFKH 4CHAB 2OINA 1EOJA 2JH5D 2XCNA 3S69A 4JZEH 3U98H 2H9EH 1FXYA 4X6PA 1V2QT 2ZNKH 4YM9A 4Y76A 1O3IA 2XWAA 1S6HA 1ELVA 1EZXC 1WQSA 2QXIA 4Z0KA 4GCHF 1MD8A 3PLKA 2VWNA 4HGCA 4UFGH 2AGIX 1C1OA 2GCHG 3A8DA 2VB0A 1FAKH 2Z9JA 2H5DA 5DP7A 2QN5T 3GCTG 3SI3H 1OX1A 3TU7H 1RJXB 4AORA 3R0FA 4Y79A 3ZYDA 2G4UA 2GMTC 3UQOA 1IHSH 1TOMH 4INKA 4WH6A 4YT6H 1YC0A 1BMMH 1MAYA 2V3OH 2BX4A 1O2PA 3GDVA 5JB8S 1HPGA 4ZHMU 4WMDA 1C9TA 1XUJA 3LJJA 1GI1A 2ANWA 1ANEA 1C2LA 4ABJA 5GPIB 1AVWA 1AUTC 3HGPA 2ZTXA 3PMJA 2SGDE 1CQQA 2ZFQH 3A88A 1Y3YA 2CHAB 1AFQC 4I8GA 5EG4A 1KDQA 1A5HA 1T8OA 2H1UA 3A8CA 4D76A 2SGEE 5FAHA 1AI8H 5EU8A 3S9CA 1HAVB 1ZTKA 2ZECA 1S82A 1J16A 2CXVA 1GVKB 3LT3A 5E2OA 1AB9C 3STIA 1OYQA 2YNAA 1A5IA 1PYTC 3SJKA 1YPGH 2VU8E 1FY1A 3KIDU 1BRCE 1HB0B 1W3CA 4JK6A 2B8OH 1P02A 1P57B 2ODPA 1NT1A 2CHAC 3RLYH 2F9BH 2GDDA 2ZPRA 1C1VH 4YLUA 4B73A 1NROH 2A4QA 3LGWA 4B74A 4D7FA 4MQAA 3RLWH 3A7VA 3RC4A 4UONA 1W14U 2SGFE 2TRMA 1C5YB 2FP7B 3SNBA 3RXJA 8GCHG 1SG8B 1TNKA 1GI8B 3O8CA 1G37A 1P01A 1GMCF 2CJIA 5C5OA 5DO4H 1SGEE 4I8LA 1GHWH 1O5GH 4D9RA 1BZXE 1GGDC 2UUKB 1DUEA 4JYVH 3CP7A 2Y7XA 4FUJA 1P04A 2FOEA 1GJ6A 1LHDH 1SGFG 2HNTE 1L2EA 3LGUA 4YOGA 2G55A 4X2YA 3PO1B 4IGDA 5JBAS 1OP0A 1SL3A 1HIAA 3GY7A 4OS6A