5IDKA

Crystal structure of west nile virus ns2b-ns3 protease in complex with a capped dipeptide boronate inhibitor
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
224
structure length
204
Chain Sequence
DMWIERTADITWESDAEITGSSERVDVRLDDDGNFQLMGGVLWDTPSPKKGDTTTGVYRIMTRGLLGSYQAGAGVMVEGVFHTLWHTTKGAALMSGEGRLDPYWGSVKEDRLCYGGPWKLQHKWNGHDEVQMIVVEPGKNVKNVQTKPGVFKTPEGEIGAVTLDYPTGTSGSPIVDKNGDVIGLYGNGVIMPNGSYISAIVQGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Genome polyprotein,SERINE PROTEASE SUBUNIT NS2B, SERINE PROT
publication title Peptide-Boronic Acid Inhibitors of Flaviviral Proteases: Medicinal Chemistry and Structural Biology.
pubmed doi rcsb
source organism West nile virus
total genus 40
structure length 204
sequence length 224
chains with identical sequence B, C
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2016-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5idkA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5idkA01
3SNDA 2Z9JA 4DIIH 4ISHH 2NU1E 2A4QA 1ANEA 1KIGH 1ID5H 1O2NA 1QTFA 4Y8ZA 1OXGA 2UUKB 1FPHH 2A5IA 2ZFTA 5EXNA 4MTBA 2WUCA 2ZQ1A 3A7XA 1OWDA 1MBQA 2BZ6H 2B8OH 4AN7A 1LMWB 3AW0A 2QAAA 3Q3KA 1GI1A 3SHCH 6GCHF 1W2KH 3UY9A 1K9OE 2PR3A 1LQEA 2BD3A 3QN7A 3GY6A 1XVOA 1ZR0A 4GLYA 1GHZA 4XBCA 3ATKA 1P2QA 1UVUH 2PW8H 1GHBF 2ULLA 3ZVAA 1SPJA 1SGNE 5C1UA 2OBOA 1GG6C 1SMFE 2Z94A 1PQ8A 3H09A 4AB8A 1ELGA 1EX3A 2ODYB 3QZQA 1ACBE 1O5DH 4XBBA 1UHBA 2ZDKA 4MNWA 3MH4A 1HAYB 3T5FH 1UTPA 5F6MA 4AG2A 1H1BA 4HI3A 1UTLM 1WV7H 1G36A 2ALVA 3P92A 1UTNA 3T2NA 3BEIB 2VB0A 2VVVA 1O2ZA 3BTEE 1SLXB 3A8DA 4MPWA 5DP8A 1PFXC 2BLQA 2XBWA 1QBNA 2GGVB 2JH5D 1CGJE 1QJ1B 1B0FA 1FZZA 1YLDA 3SZNA 1XUJA 5CE1A 2AIPA 1O0DH 1MBMA 2FLBH 3KEEA 3ZZ7A 1GJ9B 3ZZ3A 3KQCA 5IDKA 3S0NA 1LVOA 3M7TA 4NSVA 5F8TA 1DY9A 1EPTA 1EZQA 2R2MB 2G5VA 3RXVA 1AY6H 4ISOA 3T29A 1O2GH 3PO1B 4DURA 1O3MA 2H2ZA 4F49A 1DT2A 1G9IE 5CMXH 3G01A 3LGUA 3SGQE 4GUXA 3RXFA 3F9EA 1UCYH 4I8HA 3FP7E 1AHTH 1W7GH 3BV9B 4BAKB 1TX6A 5GCHG 1KDQB 1ELBA 1FV9A 2A4OA 2GV7A 2EI8A 5EXMA 2O8WA 2ZPQA 4ABAA 1BTWA 1HAOH 3MO6A 1P2IA 1KXCA 1ZMNA 2ZU5A 1C1OA 1NESE 4AX9H 1DX5M 1YCPM 3ZVBA 2YNAA 3GY3A 1PQ7A 3V13A 1GJ5H 2FYQA 2H5CA 1K1PA 3BTFE 1CHOF 4TWWA 3PMHB 1DXWA 1EJNA 4I31A 3RXLA 1GCDA 1P3CA 1OP2A 2ZA5A 1K1MA 2AMDA 1LCYA 2HPQH 4ZHAA 2OD3B 3NXPA 4I8JA 4OS7A 4ZMAH 3ODDA 1SSXA 2TPIZ 1RFNA 1D3PB 3BIUH 1VITF 3HKJB 2AGIX 3SU4A 3D49H 3IG6B 3I78A 4X2XA 1GBBA 1SHYA 1FLEE 1GBLA 4NA9H 5HYOA 4WJG2 1CBWB 5C67A 3ESTA 4LXBH 1MTNB 2EEKA 4MPXA 1O2MA 3BG4C 1SGYE 1EKBB 4K5ZA 4A1TA 1HGTH 3LH1A 2Y5HA 1CA8B 1P2KA 2QGRA 1DICA 1OWHA 3I77A 3TIUA 1BTPA 1GJDB 2D26C 1SQTA 3SUDA 1RIWB 2ZU3A 1UTMA 3A8AA 4HTCH 3BTME 3MU5A 3UQOA 2H1UA 1C1RA 4JK5A 4KKDA 3L3TA 1AE8H 1P09A 4X0WU 3TH2H 2A45B 1TQ0B 3RXEA 5DPAA 3FAOA 3O8DA 1Y5BT 2CHAB 1LDTT 2I6SA 4X8TH 4TWYA 4BANB 4OGXA 4DT7B 1AO5A 2P94A 4Z0KA 4B73A 1ELTA 3A7TA 3NPSA 1ETRH 5E0HA 3A81A 4ISIH 4D8NA 2GMTB 1QRWA 3ZV9A 4X1SU 2AFQB 4CR9A 2HWLB 3CS0A 4JYTA 1P2MA 1XXDA 1Y59T 3BTKE 4MPUA 1AB9B 1JXPA 1SQAA 1DY8A 1HJ9A 5L6NH 1QL7A 1ZHRA 2FZZA 3KQDA 5FBIA 3MYWA 1HIAB 4B2BA 1W3CA 2OBQA 2ZCKP 2BDCA 4I7YH 1THSH 4IW4E 2J95A 2YOLA 3ZVDA 1O2QA 1QURH 1Z6JH 2VIOA 2Y7XA 1W0ZU 1W7XH 1XUGA 2OQ5A 4CRFA 2ZFSA 2V0BA 1ZRBA 2GCHF 3H7TA 4NG9H 2V6NA 2WZQA 3LT3A 3KF2A 3GISB 5FX6A 2ZNKH 2PWXA 1O3AA 2FS9A 1TIOA 5JBCS 1DS2E 2Y5GA 1O3NA 1GJ8B 3M37A 5B6OA 2IJOB 4GCHF 1WU1A 2VH0A 1GGDB 1GI8B 1T32A 3U8OH 1TMTH 2RCEA 3A87A 3DHKH 2WHXA 3O8RA 2FS8A 2WPLS 4TY7A 1OKXA 3MNSA 4JCNA 2CF9H 1YPKH 3OSYA 3PV5A 2UWOA 3D65E 3VGCB 4ZHLU 3DFJA 4YT6H 1P3EA 1O2SA 1ZOMA 1SBWA 4ABJA 5HM9A 5ABWA 4ZKSU 3AW1A 5DO4H 1D3TB 1GI4A 1QIXB 1UHBB 2A0QB 3PWCA 1FUJA 1O5BB 1Y8TA 1SGRE 4ABFA 1C5TA 1GMDF 2ZZUH 4A92A 3SJ9A 1O30A 1QHRB 5TJXA 3E0PB 2ZCHP 1SFIA 2PFEA 3GOVB 1GI2A 3SBKA 2OK5A 1YPHE 1SL3A 2UWLA 1O3JA 3RMNH 4LZ4B 1BCUH 1P2JA 1FNIA 3P70B 1S5SA 4ASHA 4NIYA 3FFGA 1DXPA 2XWBI 2NWNA 1P05A 3SU3A 1L2EA 3LDXH 1EPTB 1NN6A 3GYLB 1K1NA 1JIRA 2A1DB 2VGCB 3PO1C 2SNVA 3SI4H 1BBRK 3KQBA 1SHHB 1C4Y2 2FMJA 1AE5A 3STIA 1C5WB 3PV4A 3PV2A 2OLGA 1MTUA 1YPLH 2J9NA 2BOHB 3OY6U 1AVXA 3A88A 1NRPH 3ZVEA 1C5VA 1HFDA 4BAMB 4MLFB 4K2YA 1IQMA 2WPIS 2A5AA 1W13U 4ZXXH 2PKAA 1Y3WA 3TH4H 4H4FA 1YM0A 3Q3XA 1F92A 2BHGA 1UCYE 5I25A 3W95A 5GIBA 4UE7H 4WWYA 1N6XA 1O35A 1MKWK 1MTVA 1L4DA 3KL6A 1DANH 1SOZA 1BUIA 1TABE 1MCTA 2SFAA 1SGFA 3M5OA 3CENA 3K6YA 4TYDA 1HB0B 1K1OA 2WV4A 3RXOA 1CHOG 1E37B 1FY4A 1GJBB 1TOCB 2FTMA 3LGVA 5ESBA 2A7JA 1CBWC 2QC2A 1BITA 1MTNC 3HK3B 3HGNA 2I6QA 1TA2A 2AH4X 1S6FA 1W11U 2G00A 1D3DB 2BM2A 1LQDB 3GYMA 1DFPA 1VITG 1SGTA 2TRMA 1QB1A 3K9XB 2FWWA 1ORFA 2HVXA 1RIWC 5FXLA 1BTUA 2VVUA 1O2LA 3UOPA 3ZZAA 2STBE 2XCFA 1DLEA 1EAXA 1TWXB 2AMPA 4KTSA 3RM0H 4CHAB 1PQAA 4ABGA 1YBWA 1Y5UT 1QJ6B 2CHAC 4U30A 1MMJN 3VFEA 1YCPH 1ZSJA 1V2RT 1Q31A 1QRXA 2WPMS 1IQEA 4OS2A 3T62A 3A84A 1SGPE 2P95A 1P2NA 1K1JA 1MD8A 1YYY1 2GMTC 4B2CA 1HAGE 1BJUA 1C9PA 2ZTXA 1DVAH 2BTCE 1GJCB 5B6LA 3KNXA 1CHGA 5J4SA 3VEQB 2Z9GA 1G3DA 4K1SA 4Y10E 3S7HB 3SW2B 1AB9C 3VB7A 2Y6TA 1SVPA 2FODA 3MWIU 2BDYA 2ZDLA 3QLPH 1MKXK 1VGCB 1Z7KA 3GCOA 2EC9H 2ZFQH 5A0CA 1C2FA 1TLDA 2BQ7B 5EPYA 2C4FH 2H6MA 5EU8A 4CRAA 4OS4A 1KLIH 1VJ9U 3TITA 1FY8E 2XCNA 1E38B 1JOUB 2O8MA 1JRSA 5T6DA 2ANYA 4DY7B 1OX1A 1GHYH 1PJPA 1GBKA 1SI5H 1NT1A 1V2PT 3SO3A 3QX5H 2ZHFH 2BY8X 2EI6A 3SORA 1CT0E 2ALPA 1O2PA 5K0HA 4O3TA 4NIWA 2NU0E 1O3IA 3JZ2B 3V3MA 3LGTA 4H6SB 1UVOA 3R0FA 3PMJA 4X6OA 1S6HA 1GGDC 1A2CH 3TNTA 2WYJA 4UDWH 4ABEA 1TALA 1QY6A 1X7AC 1XKAC 2FIRH 2FOEA 2WINI 1FY5A 2G4UA 2GCHG 3TGKE 1W0YH 1ZJKA 2QA9E 4AG1A 5EXLA 2GTBA 1GVZA 4FUJA 5HXFA 2AIQA 3OYPA 1O3FA 3RP2A 2XBYA 3SV2H 5T6FA 1NU9A 5BRRE 3VGCC 1IQJA 1GBDA 3NUMA 3N7OA 1PPFE 1G3CA 3AK5A 3ZZDA 1P01A 8GCHG 2BDBA 2C8ZB 2FOCA 2BX3A 2QXIA 3LONA 1NM6A 4H6TA 5AFYH 1V2JT 1MZDA 1ZTKA 2CJIA 4KELA 3SJ8A 2Z3EA 4U32A 2RA3A 3MU4A 2B5TB 3PTBA 4BTTB 2WUBA 1UMAH 1UTJA 1Y5AT 5LPRA 3RMOH 5A09A 1Z6EA 1OP0A 2QCYA 4JYVH 4AYVB 2P16A 2GX4A 1HAHH 3SHAH 1C5UA 1WOFA 3P17H 3LU9B 5C5OA 5F03A 1S81A 1V2NT 1GMDG 2OUAA 4CRCA 1ZPZA 2B7DH 1BMNH 1EPTC 3UR9A 5JPMH 2OC8A 1BBRH 1XXFA 5IYTA 1D3QB 2ZEBA 2VGCC 4YLQH 1K2I1 1XMNB 1JRTA 5JDUB 3EAJA 2M5TA 3EA7A 1WAYB 4E05H 2LNCA 2ZPRA 1UK4A 2Q6GA 3UR6A 1EB2A 1RTKA 1O31A 1SFQB 5H4IB 1C1WH 2FM2A 3C27B 1O3EA 3SU1A 1NS3A 3OX7U 2KAIA 5JBBS 1G2LA 1ESAA 3BTGE 2J94A 2PSXA 2CMYA 4K3JA 1IQFA 1GHAG 1QQUA 1O3DA 2JETB 3EA8A 3LPRA 4X8SH 1E35B 1NFXA 1O3GA 2GDEH 5GXPA 1AUJA 4CH8B 1CT2E 5EW1H 1LKBA 4GVUA 3I29A 4FUFA 1TPPA 1AZZA 4A1XA 6CHAB 4RKOB 3K65B 1AN1E 2QXJA 2XTTB 2Y7ZA 3TJOA 1RRKA 2ZI2H 2D2DA 1HXFH 1OWIA 3MU1A 4X8VH 3NKKA 1EJAA 2O8LA 3P95A 1RD3B 6LPRA 1TA6A 1SLUB 1Y3VA 7ESTE 1ANBA 1UVTH 1HPGA 1MAYA 2GT7A 1P04A 1O34A 4NA7A 2ZGJA 1C2IA 1A0HB 1D4PB 4VGCB 1MQ5A 1NO9H 3GY4A 5C20A 1HLTH 2BD2A 3GDSA 1ELEE 2PKSB 2BXUH 1V2KT 2TGTA 5EQQA 1UJ1A 1RS0A 3UREA 4UEHH 2G5NA 3MNXA 4B1TA 4Z6AH 3RU4E 1RGQA 1C1MA 1MTWA 1BOQA 4IMZA 2BY6X 4BAOB 3UIRA 3K2UA 4J1YA 3ZVFA 1DUEA 2FTLE 2ZDMA 1DUAA 3AAUA 1TX7A 4F4OC 4CHAC 3QDZB 4MDSA 4GHTA 2FYRA 4K60A 2BD8A 3MMGA 4LZ1H 4UONA 1DE7H 1HRTH 4KTCA 1GL0E 2AEIH 1MCVA 4AFZA 2PGQB 4Q7YA 2BY9X 1ETSH 2Y82A 2Z9IA 2C8XB 4XFQA 3GCNA 3E6PH 4RSPA 1QCPA 3FANA 2A7CA 4IBLH 1GHWH 1HAVA 1SG8B 1T8LA 1J17T 1TYNA 3U1JB 4LOYH 1NPMA 2VIPA 4TY6A 1MTSA 2PLXA 4ABIA 2VU8E 1P9SA 1VGCC 1IQKA 1DLKB 2J92A 3FZDA 2J38A 2NU3E 4B71A 1J8AA 3SV8A 1BZXE 1K1LA 1ZMLA 2R3YA 1GJ7B 5LH8A 1FPCH 1LO6A 1UTKA 4X6PA 2D8WA 1JBUH 5EQSA 3NK8A 1Z1IA 3OTJE 4HGCA 1F0RA 3U69H 3KGPA 3T25A 1B5GH 2FP7B 4RN6A 1CO7E 4BOHA 2WV9A 2H5DA 1U6QA 2Q6DA 1P2OA 2CV3A 2G4TA 4BAQB 7LPRA 2SGQE 4UFDH 1F5LA 4WMEA 4ZHMU 1OWKA 1P9UA 4M9FA 3RU4D 1GMHF 4Y79A 2ZGCA 2FLRH 1GI0A 3LOXA 2YNBA 1QFKH 1AI8H 1J15A 2SNWA 2BQWB 2ZGBH 2FPZA 1N8OB 4BXWA 4M7GA 1A5HA 1FAXA 1Y3UA 1QA7A 3SV7A 3FP6E 2BD9A 1Y3YA 5JBAS 3DFLA 4B74A 5C1YA 3RLWH 3ZVCA 5AHGH 1K21H 1A46H 1O3BA 4JMYA 2SGFE 1A7SA 5AVDA 2V3OH 3K6ZA 3EA9A 4JYUH 3V0XA 2CGAA 3E0NB 2ZFPH 1FN8A 4JZFH 4Y0YE 3C1KA 3B8JA 1T7CA 2G55A 1BHXB 2O9QA 2XC5A 4B6FA 3IITA 1A3BH 3PMBB 5DP3A 3U98H 1LPKB 2F9VA 5A0BA 3P6ZB 4Q7ZA 1O36A 5LPFA 4MQAA 4TPYA 3ITIA 4PROA 5A2MH 1GBTA 3RC6A 1TE0A 4GPGA 3MH7A 3RXMA 5JB8S 4NIXA 1GVKB 2QIQA 2ZGHA 4I32A 1C1PA 4KGAA 1GI9B 1G37A 2FI5E 1LTOA 1ELAA 2ZDNA 4ZROA 1F7ZA 1TPAE 3SUGA 2QN5T 1C2DA 4XBDA 4E06H 4K8BA 4UFGH 2GCTB 1HYLA 2ZTYA 4I8GA 1FI8A 2OXSA 3RUOA 1P57B 1ABJH 1B7XB 2PUXB 5F8XA 1BBRE 3KIDU 1KYNA 4DIHH 1P06A 1O2TA 2KAIB 1A5GH 4YOGA 1H8IH 4FUIA 1F0SA 3RXTA 1P10A 2VH6A 2AGEX 2ZFRH 3TU7H 1GI6A 1CQQA 1GBJA 1LVYA 2JETC 2QF3A 1SQOA 1TOMH 2ZHWH 1GBMA 2BLOA 1RXPA 2W3IA 3F6UH 3GY2A 2GDDA 1BMMH 1A3EH 4YESB 1M9UA 3Q76A 1YP9A 1ZRKA 6CHAC 5C2ZA 2SGDE 2ANWA 3S7KB 1BMLA 1HV7A 2SGPE 3GCTF 1E36B 2ANMH 4Y71A 4NA8A 2A5KA 4FUDA 2FOHA 4NSYA 5HMAA 1PPHE 3ATWA 1HAXB 1TRMA 4WXIA 2BMGB 3SUEA 4MNVA 1SGCA 5FAHA 1C5LH 1KTSB 1O3LA 1PPBH 2QY0B 1DSTA 3PLBA 6GCHG 4VGCC 3TNSA 2FOBA 1O38A 2XWAA 3M3VA 5FHTA 1ELVA 3F9HA 2BDGA 1THRH 1BTYA 3MU8A 1GHBG 2PKSC 1HAPH 2F9BH 3QK1A 4CBOA 1MU6B 1TMUH 4KP0A 2ZU2A 5L2YH 2W26A 2R2WU 3RLYH 1AQ7A 1AFEH 2R0LA 1GI7B 2Z7FE 4B75A 1BHXF 2QF0A 3M61U 3LH3A 1C2EA 2HRVA 4XE4A 4WH8A 2BD7A 1QQ4A 4D7FA 2ZC9H 2QXGA 3ZZBA 2GZ9A 2HNTF 2BVRH 5EOKA 2F9PA 4NWKA 3BTTE 4OGYA 1INCA 3PWBA 3MNBA 3T28A 1D6WA 3SOSA 4YLUA 2BB4A 1KTTB 4UD9H 4XOJA 3ZYDA 2ZHEH 4E7RG 1YPHC 3EDXB 1HAVB 1HAZB 1OYQA 3MNCA 2ZDAH 1BRUP 2FI4E 1XVMA 1YGCH 2WPHS 4WMFA 1A4WH 1O3CA 3DT0H 2RDLA 2HOBA 2BX4A 1AUTC 1S0RA 1TB6H 5EG4A 4YZUA 3RXSA 3SNCA 1C1QA 1O39A 3QTVH 1ELCA 2ZHDA 4IN1A 3ZZ4A 4WXVA 3F9FA 1TONA 1F5KU 4UFEH 4DG4A 2SGAA 4CRGA 3DA9B 1AD8H 1IQHA 1GBFA 4ABBA 8LPRA 5A8ZA 2ZP0H 3HKIB 3SZEA 3TJUA 1WSSH 3P8NA 2OINA 2AS9A 4KTUA 1SB1H 4ABHA 5LPEA 1W12U 5DJ7A 2VWMA 1SGIB 1NRSH 2FOMB 3A89A 3SQHE 1WTGH 1NFYA 4DOQA 2QYIA 1ZSLA 2J4IA 1C5PA 1O2YA 2P3TB 4D9QA 1C4U2 2ZKSA 3CS7A 1T8NA 1TRYA 1UTQA 3VB6A 4ZKOU 5DP9A 1QBOA 1YPEH 1AWHB 1A61H 3RXQA 1OOKB 7GCHF 1QL9A 3FVFB 1ANDA 2V3HH 2FOAA 1K1IA 1MQ6A 2A2QH 6ESTA 4AOQA 3QGJA 2HNTE 2ZQ2A 1WQSA 1N8OC 1J16A 1F5RA 5E0GA 1VCQA 2H9TH 1P12E 3PTNA 1AVWA 4OS5A 3FP8E 1GL1A 1PPZA 2ZG0H 3AAVA 3VB4A 3UWIA 1O2RA 1O5GH 3SI3H 3S69A 2RG3A 1KY9A 2OQUA 4A5TS 4X2YA 3RM2H 1TNLA 1K28D 3TK5A 3RMLH 1O2JA 1C5NH 3SU2A 3UNQA 3SU5A 4Y11E 2P93A 2XBVA 1O33A 4X2WA 3O8CA 3GDUA 4ABDA 5ETXA 1P8VC 1C9TA 3PYHA 2TGPZ 3R3GB 3TGJE 4A6LA 1V3XA 4DCDA 1EAWA 2WPKS 3GY5A 1XM1A 1UCYK 1GDNA 1EZSC 1W14U 2F9OA 1ZGVA 2ODPA 4HFPB 1O2KA 4HZHA 1EOJA 2GP9B 3LGWA 1KXBA 8KME2 2C90B 1J9CH 3M36A 2O8UA 3T27A 2Q1JA 1WTHD 3RXJA 1SR5C 1EUFA 2GCTC 4Y7AA 3RC5A 1BTXA 1W10U 3A83A 2CXVA 2VIQA 3NCLA 1Q3XA 3PM3A 2G8TA 4GSOA 1SGDE 3ZZ9A 4XSKU 4YM9A 3RXDA 1O32A 3U9AH 3V7TA 3UQVA 1ZSKA 1NFWA 4LK4A 2VIDA 1HNEE 4Y8YA 1JWTA 2FX6A 1FQ3A 3IWMA 1PYTD 1GBEA 4Y6DA 4CRBA 1TGSZ 4ESTE 3QZRA 1ARCA 2H9HA 3ZZ8A 1GI5A 4GCHG 1KXDA 1YKTA 2VWNA 2A2XH 1XUFA 1YPMH 3S9BA 4FU9A 1C5QA 1BB0B 4B2AA 1BT7A 2OC0A 3BSQA 4AORA 1HBTH 1JIMA 2HGTH 4YO9A 2ZWLH 3SNAA 1UVSH 4X8UH 2WYGA 5C5NA 3AVZA 3EGKH 3GCTG 3BTQE 1O5FH 4X2VA 1TRNA 2Q6FA 1TBQH 3LJOA 7KMEH 1EOLA 5DP5A 3TLOA 5AFZH 1MUEB 1TGTA 3UPEA 1OPHB 3QO6A 4ZKRU 3MHWU 2ZU1A 1P03A 5EGMA 1B0EA 1SLVB 3M3SA 3DUXH 1LHGH 2PHBA 1BJVA 3TPIZ 3CP7A 1PPCE 3LGYA 1HXEH 2C8WB 1VITH 4I33A 4MPVA 3VXEH 2XBXA 1C2MA 2F83A 3TK6A 1N6YA 2GVFA 3P8OA 1CGHA 1TGBA 5C1XA 2PUQH 3SV9A 1GBIA 2OC7A 2PTCE 1HIAA 4Y0ZE 3UOUA 3U8TH 4IS5A 2ILNA 2FEQH 4NGAH 1KXAA 2HPPH 2PKAB 1FONA 1IHSH 1NRNH 1C5YB 2XW9A 5FBEA 4H42U 1SOTA 3U1IB 1AKSA 5I46H 5JBTA 2EI7A 4JZ1A 3GICB 4IGDA 1D9IA 1MKWH 1O2VA 2GZ8A 3S9CA 1AVGH 3KN2A 1TGNA 4FUCA 2ZF0H 4INHA 3M5LA 4NZQA 1GJ6A 1T4UH 2BLVA 2ZHQH 2VBCA 1TNJA 1XX9A 1EZUC 1XUKA 3RXHA 2PV9B 5E8EH 2A7HA 1A0JA 1QL8A 2AERH 2F9NA 1KXEA 3VB5A 4AGKA 1O5CB 3A86A 1RTLA 3H7OA 2Z9LA 3GCHB 1Z8JB 4INLA 1T8MA 2IPHA 4O03A 2VJ1A 3D62A 4FXGH 1O2UA 1QJ7B 1P0SH 1LPZB 4OS6A 1KXFA 4CREA 2TGDA 4ZKNU 3M7UA 2GKVE 3RXAA 1AFQB 2P8OB 5SGAE 3MTYA 2AYWA 4CR5A 1VCPA 1EASA 1K22H 4NFFA 1OYTH 5JYIA 2RA0A 3KCGH 5C3NA 2C8YB 1PQ5A 5A8YA 7GCHG 1FDPA 4TPIZ 1DWDH 5PTPA 1EATA 1C1SA 2VWOA 5L2ZH 1ZZZA 1V2QT 1F0TA 1C5OH 1E0FD 1DSUA 3TGIE 3Q3YA 1H4WA 3LIWA 5DP6A 5J4QA 4AGJA 1EQ9A 1CGIE 1O5EH 1OWJA 3RXUA 3SGBE 3QTOH 3E8LA 1MKXH 1N1LA 3UUZA 1IOEA 4RKJB 1Q2WA 4NZLA 2IN2A 3URCA 3STJA 1EP6A 1L1GA 1QB6A 3L33A 3UNSA 3OTPA 1BTHH 1J14A 2VIVA 3ZVGA 4FVDA 5FCKA 3KHVA 5GPIB 4Y7BA 1WUNH 1JMOH 3P8FA 4BAHB 2DE9A 1V2LT 5EPNA 2V35A 4O97A 2THFB 1ZLRA 2W5EA 2QV1A 1WYKA 1F0UA 4JK6A 3BTHE 2TBSA 3TJNA 1LHCH 2ASUB 1BMAA 2DE8A 4X1NU 4ZXYH 1O3PB 3Q77A 2CF8H 1GBHA 1ZMJA 2BD5A 1A1RA 5A8XA 4I8KA 2ZCLP 1OP8A 2JH6D 1G3BA 4JZEH 1TAWA 4IC6A 3RXKA 1O2OA 4QT8C 5EW2H 1T4VH 5GNDA 1ABIH 3GDVA 3M7QA 1YLCA 3E91A 4K1EA 5DP7A 1AZ8A 1YC0A 3ATMA 1GWAA 1C5ZB 2IJD1 1HCGA 2NU4E 1DPOA 1IAUA 9LPRA 2ZDVH 2NU2E 1Z8IB 3TVJB 2P3UB 2XRCA 4DW2U 3JZ1B 4R0IA 4D9RA 3SQEE 1V2ST 1HAIH 5K7RA 1FIWA 1LPGB 2C93B 2OP9A 1ELFA 1CVWH 2FXRA 1NFUA 3A82A 2J2UA 1BDAA 3ZV8A 1H8DH 2TIOA 3HATH 2ZECA 2G52A 1IQGA 4FU8A 4R8TB 3ATIA 2UWPA 5T6GA 1FMGA 1GVLA 5GJ4B 3ELAH 2CN0H 5FPYA 2LPRA 4Y76A 1YCPK 3UNRA 2BDIA 1BRCE 3ZYEA 1PPGE 2PGBB 4AFUA 1NU7B 1S84A 5TCAA 1V2MT 1YPJH 2FESH 4GAWA 1GI3A 3BTWE 2GZ7A 1L1JA 1LKAA 2HALA 4NIVA 3RC4A 1GMCF 2A31A 1G32B 2OC1A 3WY8A 2WV5A 4DGJA 1O3OA 2G51A 1GDUA 4YOIA 1UVPA 1VZQH 1QRZA 1V2UT 3SJIA 1YF4A 1L0ZA 3RXPA 1ZPBA 2UUYA 1ZTLA 2BDAA 4BTIB 4I8LA 3E16B 4RI0A 1GHVH 1CT4E 3BIVH 3BTDE 1G30B 3M5NA 2F4LA 3OU0A 1HUTH 1MZAA 1AKSB 1O5AB 2UUFB 5CHAB 1MU8B 1CA0B 1FJSA 4OS1A 1C1UH 4BNRA 3A7YA 3URDA 1NROH 4JZIA 4Q2KA 3V12A 2Y81A 1F2SE 5LGOA 1ESBA 4CBNA 2JH0D 1TFXA 1HJAB 3A85A 3F68H 1O3KA 2BOKA 2XXLA 1XUHA 2O8TA 8GCHF 1ZTJA 3QUMP 3EYDA 3LJJA 3AASA 1MD7A 3MO9A 1O2XA 1XKBC 1IHTH 4GHQA 4AB9A 5TCCA 1ZGIA 3LKWA 2PSYA 3BG8A 3RXGA 1KLJH 3GCHC 2BD4A 1C2KA 4Q7XA 2Z9KA 3NWUA 3W94A 1GDQA 2VNTA 4BTUB 1L1NA 1VCWA 1ZYOA 1D6RA 4XDEA 3LC5A 2BY5X 1FY1A 4B76A 1C5SA 1DWEH 1TBZH 1FAKH 3L6PA 4D76A 1EZXC 2OTVA 1C5XB 1OS8A 1ARBA 2J34A 1AFQC 3RXRA 2P8OC 1Y3XA 1G2MA 3A80A 5DP4A 4DJZB 3HPTB 3EQ0H 4YOJA 1TPSA 5DG6A 3TJVA 4SGAE 3A7ZA 1RJXB 2F3CE 1DWCH 1FY3A 1GCTB 1FIZA 1NC6A 1QNJA 3RXBA 3MH6A 3EE0B 2SGEE 1DITH 1NTPA 5FPSA 3MH5A 1DM4B 3SU6A 1FN6A 1GBCA 2GD4B 1LHEH 1ZJDA 1C4V2 1S85A 1YPGH 3B23B 3M5MA 4ZAEA 2DUCA 2VWLA 1VR1H 1C2LA 1HDTH 2ZO3H 3TH3H 5DKMA 4A7IB 1SC8U 4WY3A 8ESTE 4FUGA 1QBVH 1TNIA 3DD2H 4DVAU 1GHAF 1IQNA 2QXHA 4O9VA 1ZHMA 1C1NA 1Z1JA 4MVNA 3O8BA 1P11E 2FOFA 2ZTZA 1GHXH 1L4ZA 2FOGA 1NY22 4FUBA 2A4RA 1EXFA 1VJAU 2R9PA 3A7WA 3A8BA 3SUFA 3PROA 2XNIA 2W7UA 4SGBE 2FO9A 5GDSH 2GT8A 1V2TT 3NZIA 1LHDH 1Z8RA 2OCVB 3MFJA 2JKHA 4MNYA 4NWLA 3BN9A 2FI3E 1QGFA 1WCZA 1UO6A 1KSNA 1AGJA 4O3UA 3KQEA 3QWCH 3E90B 4B6EA 5DGJA 1O2HA 2Y80A 2TGAA 1ZHPA 1OWEA 5ESTE 4FU7A 1GG6B 1BTZA 3RXIA 4JZDH 2WPJS 4ISLA 5T1VA 1QR3E 3PLKA 3MI4A 1GJAB 5L30H 4CRDA 1ZPCA 1ESTA 4ZH8A 2R0KA 1Z8GA 2UUJB 1SGFG 2ODQA 2A32A 2W3KA 2Z3CA 3A8CA 3ODFA 2F9UA 1BRAA 2IOTA 5E2PA 1NRQH 1O2IA 1PPEE 2ZFFH 1TMBH 4THNH 1A5IA 1DOJA 2P3FH 1RTFB 2ZIQH 4OM9A 3VPKA 3UTUH 1C2HA 3MOCA 3MU0A 3GY8A 4NFEA 2Z6BD 4E7NA 4U01A 3Q00A 1GMHG 1C1TA 2G81E 3HGPA 1V2WT 3SU0A 4IN2A 1LVBA 1WBGB 2EA3A 3BEFB 5GCHF 5T3HA 5BPEA 3F1SB 2K1QA 1ELDE 1AMHA 2A4GA 2D1JA 1TX8A 4MNXA 2FDAA 3PLPA 1T31A 4X6NA 3U8RH 2XC4A 2BXTH 2BLWA 1EAUA 3LGIA 4IC5A 1SGQE 4INKA 3QGNB 4AYYB 3BF6H 1PYTC 3ZZ6A 2ZPSA 1V6DA 4AFQA 1O2WA 1EP5A 1H9IE 3UFAA 1EB1H 2C3SA 2ESTE 2HNTC 1TGCA 5FCRA 1DWBH 1G3EA 1AIXH 1OSSA 1KDQA 4WH6A 3SJOA 2BYAX 3SJKA 1BIOA 2BVXH 1C2JA 1ETTH 5E2OA 3A7VA 2B9LA 1GJ4H 2H9EH 1MAXA 5FX5A 4AFSA 4K8YA 3M3TA 1GPZA 4ISNA 3M35A 3UWJH 1W8BH 4WVPE 1BRBE 4AZ2B 5E0JA 4IMQA 1IQIA 3SNBA 4MG3A 1C1VH 5GWZA 1KLTA 5DK1A 1GMCG 1DDJA 1A0LA 1CU1A 3B9FH 1EAIA 4K69A 1SLWB 1EJMA 1H9HE 1IQLA 1WQVH 1V2OT 1S0QA 5CHAC 2BQ6B 2ZU4A 1CA0C 3P8GA 2AMQA 4FUHA 3RDZA 3S9AA 2Y5FA 1BQYA 1TBRH 1C5MD 2XYAA 3H5CB 5EODA 3BG4B 5HGGA 1TQ7B 1LHFH 3ENSB 3LC3A 3FZZA 4FUEA 3GY7A 4YTAA 4WMDA 1HJAC 4WF8A 4U2WA 4X6MA 5EQRA 4UFFH 3BEUA 2VVCA 4Q80A 1TNKA 3ZZ5A 1S83A 3SN8A 1UK3A 4A1VA 4K1TA 3T26A 4X1QU 1HJ8A 1SGEE 2W7SA 1BA8B 3TK9A 3SYJA 2AGGX 3SV6A 3SNEA 1AU8A 1TNGA 1NRRH 4X1RU 5F8ZA 2VIWA 1V2VT 2BDHA 1S82A 3SGAE 1MH0A 1QA0A 3F9GA 1LVMA 5FPTA 5JB9S 1UTOA 4FVBA 4BXSA 2STAE 2R3UA 3VB3A 4NCYA 2ZGXH 4D7GA 5HM2A 2FX4A 2BY7X 2F91A 2GV6A 1FXYA 3VXFH 3RMMH 4X1PU 1QB9A 3RU4T 3PMAB 2Z3DA 1C5RA 5A0AE 1O3HA 3ZZCA 1CSOE 2VINA 9ESTA 1UK2A 1TNHA 5AF9H 2BZAA 1THPB 1GCTC 1P02A 2XC0A 4CH2B 4J2YB 1XUIA 1O37A 4ZUHA 1GBAA 1C2GA 3E1XB 3RXCA 2P59A 2ANKH 2BVSH 1AWFH 1NZQH 3ATLA 1ANCA 5G4BA 1H9LB 1WXRA 4YT7H 1CE5A 1Z71A 2B0FA 3HK6B 1TPOA 3E3TA 1T8OA 4Y8XA 3D23A 2PTNA 2HLCA 3OY5U 3PB1E 1E34B 3MO3A
chains in the Genus database with same CATH superfamily
3SNDA 2Z9JA 4DIIH 4ISHH 2NU1E 2A4QA 1ANEA 1KIGH 1ID5H 1O2NA 1QTFA 4Y8ZA 1OXGA 2UUKB 1FPHH 2A5IA 2ZFTA 2W6ID 5EXNA 1YY3A 4MTBA 2WUCA 2ZQ1A 3A7XA 1OWDA 1MBQA 2BZ6H 2B8OH 4AN7A 1LMWB 1W0KD 3AW0A 2QAAA 3Q3KA 1GI1A 3SHCH 6GCHF 1W2KH 3UY9A 1K9OE 2PR3A 1LQEA 2BD3A 3QN7A 3GY6A 1XVOA 1ZR0A 4GLYA 1GHZA 4XBCA 3ATKA 1P2QA 1UVUH 2PW8H 1GHBF 2ULLA 3ZVAA 1SPJA 1SGNE 5C1UA 2OBOA 1GG6C 1SMFE 2Z94A 1PQ8A 3H09A 4AB8A 1ELGA 1EX3A 2ODYB 3QZQA 1ACBE 1O5DH 4XBBA 1UHBA 2ZDKA 4MNWA 3MH4A 1HAYB 3T5FH 1UTPA 5F6MA 1BMFD 4AG2A 1H1BA 4HI3A 1UTLM 1WV7H 1G36A 2ALVA 3P92A 1UTNA 3T2NA 3BEIB 2VB0A 2VVVA 1O2ZA 3BTEE 1SLXB 3A8DA 4MPWA 5DP8A 1PFXC 2BLQA 2XBWA 1QBNA 2GGVB 2JH5D 1CGJE 1QJ1B 1B0FA 1FZZA 1YLDA 3SZNA 1XUJA 5CE1A 2AIPA 1O0DH 1MBMA 2FLBH 3KEEA 3ZZ7A 1GJ9B 3ZZ3A 5DSFA 3KQCA 5IDKA 3S0NA 1LVOA 3M7TA 4NSVA 5F8TA 1DY9A 1EPTA 1EZQA 2R2MB 2G5VA 3RXVA 1AY6H 4ISOA 2GJGA 3T29A 1O2GH 3PO1B 4DURA 1O3MA 2H2ZA 4F49A 1DT2A 1G9IE 5CMXH 3G01A 3FOAA 3LGUA 3SGQE 4GUXA 3RXFA 3F9EA 1UCYH 4I8HA 3FP7E 1AHTH 1W7GH 3W1EA 3BV9B 4BAKB 1TX6A 5GCHG 1KDQB 1ELBA 1FV9A 2A4OA 2GV7A 2EI8A 5EXMA 2O8WA 2ZPQA 4ABAA 1BTWA 1HAOH 3MO6A 1P2IA 1KXCA 1ZMNA 2ZU5A 1C1OA 1NESE 4AX9H 1DX5M 1YCPM 1MABB 3ZVBA 2YNAA 3GY3A 1PQ7A 3V13A 1GJ5H 2FYQA 2H5CA 1K1PA 3BTFE 1CHOF 4TWWA 3PMHB 1DXWA 1EJNA 4I31A 3RXLA 1GCDA 1P3CA 1OP2A 2ZA5A 1K1MA 2AMDA 1LCYA 2HPQH 4ZHAA 4ASUD 2OD3B 3NXPA 1E1RD 4I8JA 4OS7A 4ZMAH 3ODDA 1SSXA 2TPIZ 1RFNA 1D3PB 3BIUH 1VITF 3HKJB 2AGIX 3SU4A 3D49H 3IG6B 3I78A 4X2XA 1GBBA 1SHYA 1FLEE 1GBLA 4NA9H 5HYOA 4WJG2 1CBWB 5C67A 2EY4C 3ESTA 4LXBH 1MTNB 2EEKA 4MPXA 1O2MA 3BG4C 1SGYE 1EKBB 4K5ZA 4A1TA 1HGTH 3LH1A 2Y5HA 1CA8B 1P2KA 2QGRA 1DICA 1OWHA 3I77A 3TIUA 3DCLA 1BTPA 1GJDB 3VG8A 2D26C 1SQTA 3SUDA 1RIWB 2ZU3A 1UTMA 3A8AA 4HTCH 3BTME 3MU5A 3UQOA 2H1UA 1C1RA 4JK5A 4KKDA 3L3TA 1AE8H 1P09A 4X0WU 3TH2H 2A45B 1TQ0B 3RXEA 5DPAA 3FAOA 4F55A 3O8DA 1Y5BT 2CHAB 1LDTT 2KCPA 2I6SA 4X8TH 2WSSD 4TWYA 4BANB 4OGXA 4DT7B 1AO5A 2P94A 4Z0KA 4B73A 1ELTA 3A7TA 3NPSA 1ETRH 5E0HA 3A81A 4FETA 4ISIH 4D8NA 2GMTB 1QRWA 3ZV9A 4X1SU 1EFRD 2AFQB 4CR9A 2HWLB 3CS0A 4JYTA 1P2MA 1XXDA 1Y59T 3BTKE 4MPUA 1AB9B 1JXPA 1SQAA 1DY8A 1HJ9A 5L6NH 1QL7A 2HLDD 1ZHRA 2FZZA 3KQDA 5FBIA 3MYWA 1HIAB 3WWBA 4B2BA 1W3CA 2OBQA 2ZCKP 2BDCA 4I7YH 1THSH 3F2FA 2J95A 2YOLA 4IW4E 3ZVDA 4YXWD 1O2QA 4Q4LA 1QURH 1Z6JH 2VIOA 2Y7XA 1W0ZU 1W7XH 1XUGA 2OQ5A 4CRFA 2ZFSA 2V0BA 1KMHB 1ZRBA 2GCHF 3H7TA 4NG9H 2V6NA 1W0JD 2WZQA 3LT3A 3KF2A 3GISB 5FX6A 2ZNKH 2PWXA 1O3AA 2FS9A 1TIOA 5JBCS 1DS2E 2Y5GA 1O3NA 1GJ8B 3M37A 5B6OA 2IJOB 4GCHF 1WU1A 2VH0A 1GGDB 1GI8B 1T32A 3U8OH 1TMTH 2RCEA 3A87A 2WHXA 3DHKH 3O8RA 2FS8A 2WPLS 4XRNA 4TY7A 1OKXA 3MNSA 4JCNA 2CF9H 3WW7A 1YPKH 3OSYA 3PV5A 2UWOA 3D65E 3VGCB 4ZHLU 3DFJA 4YT6H 1P3EA 1O2SA 1ZOMA 1SBWA 4ABJA 5HM9A 5ABWA 4ZKSU 3AW1A 5DO4H 1YWUA 4ACAA 1D3TB 1GI4A 3OE7D 1QIXB 1UHBB 2A0QB 3PWCA 1FUJA 1O5BB 1Y8TA 1SGRE 4ABFA 1C5TA 1GMDF 2ZZUH 1OHHD 4A92A 3SJ9A 1O30A 1QHRB 5TJXA 1NBME 3E0PB 2ZCHP 1SFIA 2PFEA 3GOVB 1GI2A 3SBKA 2OK5A 1YPHE 1SL3A 2UWLA 1O3JA 3RMNH 4LZ4B 1BCUH 3F0OA 2EQNA 1P2JA 1FNIA 3P70B 1S5SA 4ASHA 4NIYA 3FFGA 1DXPA 2XWBI 2NWNA 1P05A 3SU3A 1L2EA 3LDXH 1EPTB 1NN6A 3GYLB 1K1NA 1JIRA 2A1DB 2VGCB 3PO1C 2SNVA 3SI4H 1BBRK 3KQBA 1SHHB 1C4Y2 2FMJA 1AE5A 3STIA 1C5WB 3PV4A 3PV2A 2OLGA 1MTUA 1YPLH 2J9NA 2BOHB 3OY6U 1AVXA 3A88A 1NRPH 3ZVEA 1C5VA 1HFDA 4BAMB 4MLFB 4K2YA 1IQMA 2WPIS 2A5AA 1W13U 4ZXXH 2PKAA 1Y3WA 3TH4H 4H4FA 1YM0A 3Q3XA 5EIYA 1F92A 2BHGA 1UCYE 2LP6A 5I25A 3W95A 5GIBA 4UE7H 4WWYA 1N6XA 1O35A 3WWFA 1MKWK 1MTVA 1L4DA 3KL6A 3F2GA 1DANH 1SOZA 1BUIA 1TABE 1MCTA 2SFAA 1SGFA 3M5OA 3CENA 3K6YA 4TYDA 1HB0B 1K1OA 2WV4A 3RXOA 1CHOG 1E37B 1FY4A 1GJBB 1TOCB 2FTMA 3LGVA 5ESBA 2A7JA 1CBWC 2QC2A 1BITA 1MTNC 3HK3B 3HGNA 2I6QA 1TA2A 2AH4X 1S6FA 1NBMD 1W11U 2G00A 1D3DB 2BM2A 5DN6D 1LQDB 3GYMA 1DFPA 1VITG 1SGTA 2TRMA 1QB1A 3K9XB 2FWWA 1ORFA 2HVXA 1RIWC 5FXLA 1BTUA 2VVUA 1O2LA 3UOPA 2J97A 4RT1A 3ZZAA 2STBE 2XCFA 1DLEA 1EAXA 1TWXB 2AMPA 4KTSA 3RM0H 4CHAB 1PQAA 4ABGA 1YBWA 1Y5UT 1QJ6B 2CHAC 4U30A 1MMJN 4HG6A 3VFEA 1YCPH 1ZSJA 1V2RT 1Q31A 1QRXA 2WPMS 1IQEA 4OS2A 3T62A 3A84A 1SGPE 2P95A 1P2NA 1K1JA 1COWD 1MD8A 1YYY1 2GMTC 4B2CA 1HAGE 1BJUA 1C9PA 2ZTXA 1E79D 1DVAH 2BTCE 1GJCB 5B6LA 3KNXA 1CHGA 5J4SA 3VEQB 2Z9GA 1G3DA 4K1SA 4Y10E 3S7HB 3SW2B 1AB9C 3VB7A 2Y6TA 1SVPA 2FODA 3MWIU 2BDYA 2QF4A 2ZDLA 3QLPH 1MKXK 1VGCB 1Z7KA 1H8ED 3GCOA 2EC9H 2ZFQH 3OEED 5A0CA 1C2FA 1TLDA 2BQ7B 5EPYA 2C4FH 2H6MA 5EU8A 4CRAA 4OS4A 1KLIH 1VJ9U 3TITA 1FY8E 2XCNA 1E38B 1JOUB 2O8MA 1JRSA 5T6DA 2ANYA 4DY7B 1OX1A 1GHYH 1PJPA 1GBKA 1SI5H 2KZ4A 1NT1A 1V2PT 3SO3A 3QX5H 2ZHFH 4Q63A 2BY8X 2EI6A 3SORA 1CT0E 2ALPA 1O2PA 5K0HA 4O3TA 4NIWA 2NU0E 1O3IA 3JZ2B 3V3MA 3LGTA 4H6SB 1UVOA 3R0FA 3PMJA 4X6OA 1S6HA 1GGDC 1A2CH 3TNTA 2WYJA 4UDWH 4ABEA 1TALA 1QY6A 1X7AC 1XKAC 2FIRH 2FOEA 2WINI 1FY5A 2G4UA 2GCHG 3TGKE 1W0YH 2HVYB 1ZJKA 2QA9E 4AG1A 5EXLA 2GTBA 1GVZA 4FUJA 5HXFA 2AIQA 3OYPA 1O3FA 3RP2A 2XBYA 3SV2H 5T6FA 1NU9A 5BRRE 3VGCC 1IQJA 1GBDA 3NUMA 3N7OA 1PPFE 1G3CA 3AK5A 3ZZDA 1P01A 8GCHG 2BDBA 2C8ZB 2FOCA 2BX3A 2QXIA 3LONA 1NM6A 4H6TA 5AFYH 3U28C 1V2JT 1MZDA 1ZTKA 2CJIA 4KELA 3SJ8A 2Z3EA 4U32A 2RA3A 3MU4A 2B5TB 3PTBA 4BTTB 2WUBA 1UMAH 4TT3D 1UTJA 1Y5AT 5LPRA 3RMOH 5A09A 1Z6EA 1OP0A 2QCYA 4JYVH 4AYVB 2P16A 2GX4A 1HAHH 3SHAH 1C5UA 1WOFA 3P17H 3LU9B 5C5OA 5F03A 2M2AA 1S81A 1V2NT 1GMDG 2OUAA 4CRCA 1ZPZA 2B7DH 1BMNH 1EPTC 3UR9A 5JPMH 2OC8A 1BBRH 1XXFA 5IYTA 1D3QB 5C94A 2ZEBA 2VGCC 4YLQH 1K2I1 1XMNB 1JRTA 5JDUB 3EAJA 2M5TA 3EA7A 1WAYB 4E05H 5CHBA 2LNCA 2ZPRA 1UK4A 2Q6GA 3UR6A 1EB2A 1RTKA 1O31A 1SFQB 5H4IB 1C1WH 2FM2A 3C27B 1O3EA 3SU1A 1NS3A 3OX7U 2KAIA 5JBBS 1G2LA 1ESAA 3BTGE 2J94A 2PSXA 2K0QA 2CMYA 4K3JA 1IQFA 1GHAG 1QQUA 1O3DA 2JETB 3EA8A 3LPRA 4X8SH 1E35B 1NFXA 1O3GA 2GDEH 5GXPA 1AUJA 4CH8B 1CT2E 5EW1H 1LKBA 4GVUA 3I29A 4FUFA 1TPPA 1AZZA 4A1XA 6CHAB 4RKOB 3K65B 1AN1E 2QXJA 2XTTB 2Y7ZA 3TJOA 1RRKA 2ZI2H 2D2DA 1HXFH 1OWIA 3MU1A 4X8VH 3NKKA 1EJAA 2O8LA 3P95A 1RD3B 6LPRA 1TA6A 1SLUB 1Y3VA 7ESTE 1ANBA 1UVTH 1HPGA 1MAYA 2GT7A 1P04A 3PRBA 1O34A 4NA7A 2ZGJA 1C2IA 1A0HB 1D4PB 4VGCB 1MQ5A 1NO9H 3GY4A 5C20A 1HLTH 2BD2A 3GDSA 1ELEE 2PKSB 2BXUH 1V2KT 2TGTA 5EQQA 1UJ1A 1RS0A 3UREA 4UEHH 2G5NA 3MNXA 4B1TA 4Z6AH 3RU4E 1RGQA 1C1MA 1MTWA 1BOQA 4IMZA 2JIZD 2BY6X 4BAOB 3UIRA 3K2UA 4J1YA 3ZVFA 1DUEA 2FTLE 2ZDMA 1DUAA 3AAUA 2JJ2D 1TX7A 4F4OC 4CHAC 3QDZB 4MDSA 4GHTA 2FYRA 4K60A 2BD8A 3MMGA 4LZ1H 4UONA 1DE7H 1HRTH 4KTCA 1GL0E 2AEIH 1MCVA 4AFZA 2PGQB 4Q7YA 2BY9X 5KECA 1ETSH 3F2HA 2Y82A 2Z9IA 2C8XB 4XFQA 3GCNA 3E6PH 4RSPA 1QCPA 3FANA 2A7CA 4IBLH 1GHWH 1HAVA 1SG8B 1T8LA 1J17T 1TYNA 3U1JB 4LOYH 1NPMA 2VIPA 4TY6A 1MTSA 2PLXA 4ABIA 2VU8E 1P9SA 1VGCC 1IQKA 1DLKB 2J92A 3FZDA 2J38A 2NU3E 4B71A 1J8AA 3SV8A 1BZXE 1K1LA 1ZMLA 2R3YA 1GJ7B 5LH8A 1FPCH 1LO6A 1VKYA 1UTKA 4X6PA 2D8WA 1JBUH 5EQSA 3NK8A 1Z1IA 3ZIAD 2XNDD 3OTJE 3F0PA 4HGCA 1F0RA 3U69H 3KGPA 3T25A 1B5GH 2FP7B 4RN6A 2AHME 1CO7E 4BOHA 5HKKD 2WV9A 2H5DA 1U6QA 2Q6DA 1P2OA 2CV3A 2G4TA 4BAQB 7LPRA 2SGQE 4UFDH 1F5LA 4WMEA 4ZHMU 1OWKA 1P9UA 4M9FA 3RU4D 1GMHF 4Y79A 2ZGCA 2KX4A 2FLRH 1GI0A 3LOXA 2YNBA 1QFKH 1AI8H 1J15A 2SNWA 2BQWB 2ZGBH 2FPZA 1N8OB 4BXWA 4M7GA 1A5HA 1FAXA 1Y3UA 1QA7A 3SV7A 3FP6E 2BD9A 1Y3YA 5JBAS 3DFLA 4B74A 5C1YA 3RLWH 3ZVCA 5AHGH 1K21H 1A46H 1O3BA 4JMYA 2SGFE 1A7SA 5AVDA 2V3OH 3K6ZA 3EA9A 4JYUH 3V0XA 2CGAA 3E0NB 2ZFPH 1FN8A 4JZFH 4Y0YE 3C1KA 3B8JA 1T7CA 2G55A 1BHXB 2O9QA 2XC5A 4B6FA 3IITA 1A3BH 3PMBB 5DP3A 3U98H 1LPKB 2F9VA 2K8IA 5A0BA 3P6ZB 4Q7ZA 1O36A 5LPFA 4MQAA 4TPYA 3ITIA 4PROA 5A2MH 1GBTA 3RC6A 1TE0A 2IPQX 4GPGA 3MH7A 3RXMA 5JB8S 4NIXA 1GVKB 2QIQA 2ZGHA 4I32A 1C1PA 4KGAA 1GI9B 1G37A 2FI5E 1LTOA 1ELAA 2ZDNA 4ZROA 1F7ZA 1TPAE 3SUGA 2QN5T 1C2DA 4XBDA 4E06H 4K8BA 4UFGH 2GCTB 1HYLA 2ZTYA 4I8GA 1FI8A 2OXSA 3RUOA 1P57B 1ABJH 1B7XB 1YLNA 2PUXB 5F8XA 1BBRE 3KIDU 1KYNA 4DIHH 1P06A 1O2TA 2KAIB 1A5GH 4YOGA 1H8IH 4FUIA 1F0SA 3RXTA 1P10A 2VH6A 2AGEX 2ZFRH 4TSFD 3TU7H 2XOKD 1K0HA 1GI6A 1CQQA 1GBJA 1LVYA 2JETC 2QF3A 1SQOA 1TOMH 2ZHWH 1GBMA 2BLOA 1RXPA 2W3IA 3F6UH 3GY2A 2GDDA 1BMMH 1A3EH 4YESB 1M9UA 3Q76A 1YP9A 1ZRKA 6CHAC 5C2ZA 2SGDE 2ANWA 3S7KB 1BMLA 1HV7A 2SGPE 3GCTF 1E36B 2ANMH 4Y71A 4NA8A 2A5KA 4FUDA 2FOHA 4NSYA 5HMAA 1PPHE 3ATWA 1HAXB 2KR7A 1TRMA 4WXIA 2BMGB 3SUEA 4MNVA 1SGCA 5FAHA 1C5LH 1KTSB 3UB0A 1O3LA 1PPBH 2QY0B 1DSTA 3PLBA 6GCHG 4VGCC 3TNSA 2FOBA 1O38A 2XWAA 2WPDD 3M3VA 5FHTA 1ELVA 1FX0B 3F9HA 2BDGA 1THRH 1BTYA 2PP6A 3MU8A 1GHBG 2PKSC 1HAPH 2F9BH 3QK1A 4CBOA 1MU6B 1TMUH 4KP0A 2ZU2A 5L2YH 2W26A 2R2WU 3RLYH 1AQ7A 1AFEH 2R0LA 1GI7B 2Z7FE 2V3MA 4B75A 1BHXF 2YMSD 2QF0A 3M61U 3LH3A 1C2EA 2HRVA 4XE4A 4WH8A 2BD7A 1QQ4A 4D7FA 2ZC9H 2QXGA 3ZZBA 2GZ9A 2HNTF 2BVRH 5C0TA 5EOKA 2F9PA 4NWKA 3BTTE 4OGYA 1INCA 3PWBA 3MNBA 3T28A 1D6WA 3SOSA 4YLUA 2BB4A 1KTTB 4UD9H 1WDIA 4XOJA 3ZYDA 2ZHEH 4E7RG 1YPHC 3EDXB 1HAVB 1HAZB 1OYQA 3MNCA 2ZDAH 1BRUP 2FI4E 1XVMA 1YGCH 2WPHS 4WMFA 1A4WH 1O3CA 3DT0H 4XD7D 2RDLA 2HOBA 2BX4A 1AUTC 1S0RA 1TB6H 5EG4A 4YZUA 3FO8D 2JJ1D 3RXSA 3SNCA 1C1QA 1O39A 3QTVH 1ELCA 2ZHDA 4IN1A 3ZZ4A 4WXVA 3F9FA 1TONA 1F5KU 4UFEH 4DG4A 2SGAA 4CRGA 3DA9B 1AD8H 1IQHA 1GBFA 4ABBA 8LPRA 5A8ZA 2ZP0H 3HKIB 4RT0A 3SZEA 3TJUA 1WSSH 3P8NA 2OINA 2AS9A 4KTUA 1SB1H 4ABHA 5LPEA 1W12U 5DJ7A 2VWMA 1SGIB 1NRSH 2FOMB 3A89A 3SQHE 2L6OA 1WTGH 1NFYA 4DOQA 2QYIA 1ZSLA 2J4IA 1C5PA 1O2YA 2P3TB 4D9QA 1C4U2 3DSPA 2ZKSA 3CS7A 1T8NA 1TRYA 3KYGA 1UTQA 3VB6A 4ZKOU 5DP9A 1QBOA 1YPEH 1AWHB 1A61H 3RXQA 1OOKB 7GCHF 1QL9A 3FVFB 1ANDA 2V3HH 2FOAA 1K1IA 1MQ6A 2A2QH 6ESTA 4AOQA 3QGJA 2HNTE 2ZQ2A 1WQSA 1N8OC 1J16A 1F5RA 5E0GA 1VCQA 2H9TH 5KEDA 1P12E 3PTNA 1AVWA 4OS5A 3FP8E 1GL1A 1PPZA 2ZG0H 3AAVA 3VB4A 3UWIA 1O2RA 1O5GH 3SI3H 3S69A 2RG3A 1KY9A 1SQRA 2OQUA 1SKYE 4A5TS 4X2YA 3RM2H 1TNLA 1K28D 3TK5A 3RMLH 1O2JA 1C5NH 3GS9A 3SU2A 3UNQA 3SU5A 4Y11E 2P93A 2XBVA 1O33A 4X2WA 3O8CA 3GDUA 4ABDA 5ETXA 1P8VC 1C9TA 3PYHA 2TGPZ 3R3GB 3TGJE 4A6LA 1V3XA 4DCDA 1EAWA 2WPKS 3GY5A 1XM1A 1UCYK 1GDNA 1EZSC 1W14U 2F9OA 1ZGVA 2ODPA 4HFPB 1O2KA 4HZHA 1EOJA 2GP9B 3LGWA 1KXBA 8KME2 2C90B 1J9CH 2CK3D 3M36A 2KCYA 2O8UA 3T27A 2Q1JA 4ACBA 1WTHD 3RXJA 1SR5C 1EUFA 2GCTC 4Y7AA 3RC5A 1BTXA 1W10U 3A83A 2CXVA 2VIQA 3NCLA 1Q3XA 3PM3A 5FL7D 2G8TA 4GSOA 1SGDE 3ZZ9A 4XSKU 4YM9A 3RXDA 1O32A 3KYFA 3U9AH 3V7TA 3UQVA 1ZSKA 1NFWA 4LK4A 2VIDA 5KGOA 1HNEE 4Y8YA 1JWTA 2FX6A 1FQ3A 3IWMA 1PYTD 1GBEA 4Y6DA 4CRBA 1TGSZ 4ESTE 5HIYA 3QZRA 5HIZA 1ARCA 2H9HA 3ZZ8A 1GI5A 4GCHG 1KXDA 1YKTA 2VWNA 2A2XH 1XUFA 1YPMH 3S9BA 4F48B 4FU9A 1C5QA 1BB0B 4B2AA 1BT7A 2OC0A 3BSQA 4AORA 1HBTH 1JIMA 2HGTH 4YO9A 2ZWLH 3SNAA 1UVSH 4X8UH 2WYGA 5C5NA 3AVZA 3EGKH 3GCTG 3BTQE 1O5FH 4X2VA 1TRNA 2Q6FA 1TBQH 3LJOA 7KMEH 1EOLA 5DP5A 3TLOA 5AFZH 1MUEB 1TGTA 3UPEA 1OPHB 3QO6A 4ZKRU 3N7EA 3MHWU 2ZU1A 1P03A 5EGMA 1B0EA 1SLVB 3M3SA 3DUXH 1QZ8A 1LHGH 2PHBA 1BJVA 3TPIZ 3CP7A 1PPCE 3LGYA 1HXEH 2C8WB 1VITH 4I33A 4MPVA 3VXEH 2XBXA 1C2MA 2F83A 3TK6A 1N6YA 2GVFA 3P8OA 1CGHA 1TGBA 5C1XA 2PUQH 3SV9A 1GBIA 2OC7A 2PTCE 1HIAA 4Y0ZE 3UOUA 3U8TH 4IS5A 2ILNA 2FEQH 4NGAH 1KXAA 2HPPH 2PKAB 1FONA 1IHSH 1NRNH 1C5YB 2XW9A 5FBEA 4H42U 1SOTA 3U1IB 1AKSA 4FOUC 5I46H 5JBTA 2EI7A 4JZ1A 3GICB 4IGDA 2YMSB 1D9IA 1MKWH 1O2VA 2GZ8A 3S9CA 1AVGH 3KN2A 1TGNA 4FUCA 2ZF0H 4INHA 3M5LA 4NZQA 1GJ6A 1T4UH 2BLVA 2ZHQH 2VBCA 1TNJA 1XX9A 1EZUC 1XUKA 5EJ1A 3RXHA 2PV9B 3NRLA 2A7HA 1A0JA 1QL8A 2AERH 2F9NA 5E8EH 4ZCNA 1KXEA 3VB5A 4AGKA 1O5CB 3A86A 1RTLA 3H7OA 2Z9LA 3GCHB 1Z8JB 4INLA 1T8MA 2IPHA 4O03A 2VJ1A 3D62A 4FXGH 1O2UA 1QJ7B 1P0SH 1LPZB 4OS6A 1KXFA 4CREA 2TGDA 4ZKNU 5C0UA 3M7UA 2GKVE 3RXAA 1AFQB 2P8OB 5SGAE 3MTYA 2AYWA 4CR5A 1VCPA 1EASA 2J5UA 1K22H 4NFFA 1OYTH 5JYIA 2RA0A 3KCGH 5C3NA 2C8YB 1PQ5A 5A8YA 7GCHG 1FDPA 2KCOA 4TPIZ 1DWDH 5PTPA 1EATA 1C1SA 2VWOA 5L2ZH 1ZZZA 1V2QT 1F0TA 1C5OH 3N7DA 5EJLA 1E0FD 1DSUA 3TGIE 3Q3YA 1H4WA 3LIWA 5DP6A 5J4QA 4AGJA 1EQ9A 1CGIE 1O5EH 1OWJA 3RXUA 3SGBE 3FN8A 3QTOH 3E8LA 1MKXH 1N1LA 3CNRA 3UUZA 1IOEA 4RKJB 1Q2WA 4NZLA 2IN2A 3URCA 3STJA 1EP6A 1L1GA 1QB6A 1E1QD 3L33A 3OTPA 3UNSA 1BTHH 2KFWA 3OFND 1J14A 2VIVA 3ZVGA 4FVDA 5FCKA 5CDFE 2J98A 3KHVA 5GPIB 4Y7BA 1WUNH 1JMOH 2QE7D 3P8FA 4BAHB 2DE9A 1V2LT 5EPNA 2V35A 4O97A 2THFB 1ZLRA 2W5EA 2QV1A 1WYKA 1F0UA 4JK6A 3BTHE 2TBSA 3KQ5A 3TJNA 1LHCH 2ASUB 1BMAA 2DE8A 4X1NU 4ZXYH 1O3PB 3Q77A 2JDID 2CF8H 1GBHA 1ZMJA 2BD5A 1A1RA 5A8XA 4I8KA 2ZCLP 1OP8A 2JH6D 1G3BA 4JZEH 1TAWA 4IC6A 3RXKA 1O2OA 4QT8C 5EW2H 1T4VH 5GNDA 1ABIH 3GDVA 3M7QA 1YLCA 3E91A 4K1EA 5DP7A 1AZ8A 1YC0A 3ATMA 1GWAA 1C5ZB 2IJD1 1HCGA 3UAIC 2NU4E 1DPOA 1IAUA 9LPRA 2ZDVH 4DT4A 2NU2E 1Z8IB 3TVJB 2P3UB 2XRCA 4DW2U 3JZ1B 4R0IA 4D9RA 3SQEE 1V2ST 1HAIH 5K7RA 1FIWA 1LPGB 2C93B 2OP9A 1ELFA 1CVWH 2FXRA 1NFUA 3DSOA 3A82A 2J2UA 1BDAA 3ZV8A 1H8DH 2TIOA 3HATH 2ZECA 2G52A 1IQGA 4FU8A 4R8TB 3ATIA 2UWPA 5T6GA 1FMGA 1GVLA 5GJ4B 3ELAH 2CN0H 5FPYA 2LPRA 4Y76A 1YCPK 3UNRA 2BDIA 1BRCE 3ZYEA 1PPGE 2PGBB 4AFUA 1NU7B 1S84A 5TCAA 4P00A 1V2MT 1YPJH 2FESH 4GAWA 5F53A 1GI3A 3BTWE 2GZ7A 1L1JA 1LKAA 2HALA 4NIVA 3RC4A 1GMCF 2A31A 1G32B 2OC1A 3WY8A 2WV5A 4DGJA 1O3OA 2G51A 1GDUA 4YOIA 1UVPA 1VZQH 1QRZA 1V2UT 3SJIA 1YF4A 1L0ZA 3RXPA 1ZPBA 2UUYA 1ZTLA 2BDAA 4BTIB 4I8LA 3E16B 4RI0A 1GHVH 1CT4E 3BIVH 3F3BA 3BTDE 1G30B 3M5NA 2F4LA 3OU0A 1HUTH 1MZAA 1AKSB 1O5AB 2UUFB 5CHAB 1MU8B 1CA0B 1FJSA 1S6LA 2YMSC 4OS1A 1C1UH 4BNRA 3A7YA 3URDA 1NROH 4JZIA 4Q2KA 3V12A 2Y81A 1F2SE 5LGOA 3EE7A 1ESBA 4CBNA 2JH0D 1TFXA 1HJAB 2W6JD 3A85A 3F68H 1O3KA 2BOKA 2XXLA 1XUHA 2O8TA 8GCHF 1ZTJA 3DSGA 3QUMP 3EYDA 3LJJA 5C17A 3AASA 1MD7A 3MO9A 1O2XA 1XKBC 1IHTH 4GHQA 2RFKC 4AB9A 5TCCA 1ZGIA 3LKWA 2PSYA 3BG8A 3RXGA 1KLJH 1H8HD 3GCHC 2BD4A 1C2KA 4Q7XA 2Z9KA 3NWUA 3W94A 1GDQA 2VNTA 4BTUB 1L1NA 1VCWA 1ZYOA 1D6RA 4XDEA 3LC5A 2BY5X 1FY1A 4B76A 1C5SA 1DWEH 1TBZH 1FAKH 3L6PA 4D76A 1EZXC 2OTVA 1C5XB 1OS8A 1ARBA 2J34A 1AFQC 3RXRA 2P8OC 1Y3XA 1G2MA 3A80A 5DP4A 4DJZB 3HPTB 3EQ0H 4YOJA 1TPSA 5DG6A 3TJVA 4SGAE 3A7ZA 1RJXB 2F3CE 1DWCH 1FY3A 1GCTB 1FIZA 1NC6A 1QNJA 3RXBA 3MH6A 3EE0B 2SGEE 1DITH 1NTPA 5FPSA 3MH5A 1DM4B 3SU6A 1FN6A 1GBCA 2GD4B 1LHEH 1ZJDA 1C4V2 1S85A 1YPGH 3B23B 1UW7A 3M5MA 4ZAEA 2DUCA 2V7QD 1VR1H 1C2LA 1HDTH 2VWLA 2ZO3H 3TH3H 5DKMA 4A7IB 1SC8U 4WY3A 8ESTE 4FUGA 1QBVH 1TNIA 3DD2H 4AC9A 4DVAU 1GHAF 1IQNA 2QXHA 4O9VA 1ZHMA 1C1NA 1Z1JA 4MVNA 3O8BA 1P11E 2FOFA 2ZTZA 1GHXH 1L4ZA 2FOGA 1NY22 4FUBA 2A4RA 1EXFA 1VJAU 2R9PA 3A7WA 3A8BA 3SUFA 3PROA 2J98B 2XNIA 2W7UA 4SGBE 2FO9A 5GDSH 2GT8A 1V2TT 3NZIA 1LHDH 1Z8RA 2OCVB 3MFJA 2JKHA 4MNYA 4NWLA 3BN9A 2FI3E 1QGFA 1WCZA 1UO6A 1KSNA 1AGJA 4O3UA 3KQEA 3QWCH 3E90B 4B6EA 5DGJA 1O2HA 2Y80A 2TGAA 1ZHPA 1OWEA 5ESTE 4FU7A 1GG6B 1BTZA 3RXIA 4JZDH 2L74A 2WPJS 4ISLA 5T1VA 1QR3E 3PLKA 3MI4A 1GJAB 5L30H 4CRDA 1ZPCA 1ESTA 4ZH8A 2R0KA 1Z8GA 2UUJB 1SGFG 2ODQA 2A32A 2W3KA 2Z3CA 3A8CA 3ODFA 2F9UA 1BRAA 2IOTA 5E2PA 1NRQH 1O2IA 1PPEE 2ZFFH 1TMBH 4THNH 1A5IA 1DOJA 2P3FH 1RTFB 3MQKC 2ZIQH 4OM9A 3VPKA 3UTUH 2KCAA 1C2HA 3MOCA 3MU0A 3GY8A 4NFEA 2Z6BD 4E7NA 4U01A 3PRDA 3Q00A 1GMHG 1C1TA 2G81E 3HGPA 1V2WT 3SU0A 4IN2A 1LVBA 1WBGB 2EA3A 3BEFB 5GCHF 5T3HA 5BPEA 3F1SB 2K1QA 1ELDE 1AMHA 2A4GA 2D1JA 1TX8A 4MNXA 3OAAD 2FDAA 3PLPA 1T31A 4X6NA 3U8RH 2XC4A 2BXTH 2BLWA 1EAUA 3LGIA 4IC5A 1SGQE 4INKA 3QGNB 4AYYB 3BF6H 1PYTC 3ZZ6A 2ZPSA 1V6DA 4AFQA 1O2WA 1EP5A 1H9IE 3UFAA 1EB1H 2C3SA 2ESTE 2HNTC 1TGCA 5FCRA 1DWBH 1G3EA 1AIXH 1OSSA 1KDQA 4WH6A 3SJOA 2BYAX 3SJKA 1BIOA 2BVXH 1C2JA 1ETTH 5E2OA 3A7VA 2B9LA 3FKSD 1GJ4H 2H9EH 1MAXA 4Z1MD 5FX5A 4AFSA 4K8YA 3M3TA 1GPZA 4ISNA 3M35A 3UWJH 1W8BH 4WVPE 1BRBE 4AZ2B 2RDEA 5E0JA 4IMQA 1IQIA 4P02A 3SNBA 4MG3A 1C1VH 5GWZA 1KLTA 5DK1A 1GMCG 1DDJA 1A0LA 3N99A 1CU1A 3B9FH 1EAIA 4K69A 1SLWB 1EJMA 1H9HE 1IQLA 1WQVH 1V2OT 1S0QA 5CHAC 2BQ6B 2ZU4A 1CA0C 3P8GA 2AMQA 4FUHA 3RDZA 3S9AA 2Y5FA 1BQYA 1TBRH 1C5MD 2XYAA 3H5CB 5EODA 3BG4B 5HGGA 1TQ7B 1LHFH 3ENSB 3LC3A 3FZZA 4FUEA 3GY7A 4YTAA 4WMDA 1HJAC 4WF8A 4U2WA 2F43B 4I86A 4X6MA 5EQRA 4UFFH 3BEUA 2VVCA 4Q80A 1TNKA 3ZZ5A 1S83A 3SN8A 1UK3A 4A1VA 4K1TA 3T26A 4X1QU 1HJ8A 1SGEE 2W7SA 1BA8B 3SYJA 3TK9A 2AGGX 3SV6A 3SNEA 1AU8A 1TNGA 1NRRH 4X1RU 5F8ZA 2VIWA 1V2VT 2BDHA 1S82A 3SGAE 1MH0A 1QA0A 3F9GA 1LVMA 5FPTA 5JB9S 1UTOA 4FVBA 4BXSA 2STAE 2R3UA 3VB3A 4NCYA 2ZGXH 4D7GA 5HM2A 2FX4A 2BY7X 2F91A 5IK2D 2GV6A 1FXYA 3VXFH 3RMMH 4X1PU 1QB9A 3RU4T 3PMAB 2Z3DA 1C5RA 5A0AE 1O3HA 3ZZCA 1CSOE 2VINA 9ESTA 1UK2A 2LELA 1TNHA 5AF9H 2BZAA 1THPB 1GCTC 1P02A 2XC0A 4CH2B 5EJZA 4J2YB 2QF5A 1XUIA 1O37A 4ZUHA 1GBAA 1C2GA 3E1XB 3RXCA 2P59A 2ANKH 2BVSH 1AWFH 1NZQH 3ATLA 1ANCA 5G4BA 1H9LB 1WXRA 4YT7H 1CE5A 2KM0A 1Z71A 2B0FA 3HK6B 1TPOA 3E3TA 1T8OA 4Y8XA 3D23A 2PTNA 2HLCA 3OY5U 3PB1E 1E34B 3OEHD 3MO3A
chains in the Genus database with same CATH topology
3SNDA 2Z9JA 4DIIH 4ISHH 2NU1E 2A4QA 1ANEA 1KIGH 1ID5H 1O2NA 1QTFA 4Y8ZA 1OXGA 2UUKB 1FPHH 2A5IA 2ZFTA 2W6ID 5EXNA 4MTBA 2WUCA 2ZQ1A 3A7XA 1OWDA 1MBQA 2BZ6H 2B8OH 4AN7A 1LMWB 1W0KD 3AW0A 2QAAA 3Q3KA 1GI1A 3SHCH 6GCHF 1W2KH 3UY9A 1K9OE 2PR3A 1LQEA 2BD3A 3QN7A 3GY6A 1XVOA 1ZR0A 4GLYA 1GHZA 4XBCA 3ATKA 1P2QA 1UVUH 2PW8H 1GHBF 2ULLA 3ZVAA 1SPJA 1SGNE 5C1UA 2OBOA 1GG6C 1SMFE 2Z94A 1PQ8A 3H09A 4AB8A 1ELGA 1EX3A 2ODYB 3QZQA 1ACBE 1O5DH 4XBBA 1UHBA 2ZDKA 4MNWA 3MH4A 1HAYB 3T5FH 1UTPA 5F6MA 1BMFD 4AG2A 1H1BA 4HI3A 1UTLM 1WV7H 1G36A 2ALVA 3P92A 1UTNA 3T2NA 3BEIB 2VB0A 2VVVA 1O2ZA 3BTEE 1SLXB 3A8DA 4MPWA 5DP8A 1PFXC 2BLQA 2XBWA 1QBNA 2GGVB 2JH5D 1CGJE 1QJ1B 1B0FA 1FZZA 1YLDA 3SZNA 1XUJA 5CE1A 2AIPA 1O0DH 1MBMA 2FLBH 3KEEA 3ZZ7A 1GJ9B 3ZZ3A 5DSFA 3KQCA 5IDKA 3S0NA 1LVOA 3M7TA 4NSVA 5F8TA 1DY9A 1EPTA 1EZQA 2R2MB 2G5VA 3RXVA 1AY6H 4ISOA 3T29A 1O2GH 3PO1B 4DURA 1O3MA 2H2ZA 4F49A 1DT2A 1G9IE 5CMXH 3G01A 3FOAA 3LGUA 3SGQE 4GUXA 3RXFA 3F9EA 1UCYH 4I8HA 3FP7E 1AHTH 1W7GH 3W1EA 3BV9B 4BAKB 1TX6A 5GCHG 1KDQB 1ELBA 1FV9A 2A4OA 2GV7A 2EI8A 5EXMA 2O8WA 2ZPQA 4ABAA 1BTWA 1HAOH 3MO6A 1P2IA 1KXCA 1ZMNA 2ZU5A 1C1OA 1NESE 4AX9H 1DX5M 1YCPM 3ZVBA 1MABB 2YNAA 3GY3A 1PQ7A 3V13A 1GJ5H 2FYQA 2H5CA 1K1PA 3BTFE 1CHOF 4TWWA 3PMHB 1DXWA 1EJNA 4I31A 3RXLA 1GCDA 1P3CA 1OP2A 2ZA5A 1K1MA 2AMDA 1LCYA 2HPQH 4ZHAA 4ASUD 2OD3B 3NXPA 1E1RD 4I8JA 4OS7A 4ZMAH 3ODDA 1SSXA 2TPIZ 1RFNA 1D3PB 3BIUH 1VITF 3HKJB 2AGIX 3SU4A 3D49H 3IG6B 3I78A 4X2XA 1GBBA 1SHYA 1FLEE 1GBLA 4NA9H 5HYOA 4WJG2 1CBWB 5C67A 3ESTA 4LXBH 1MTNB 2EEKA 4MPXA 1O2MA 3BG4C 1SGYE 1EKBB 4K5ZA 4A1TA 1HGTH 3LH1A 2Y5HA 1CA8B 1P2KA 2QGRA 1DICA 1OWHA 3I77A 3TIUA 3DCLA 1BTPA 1GJDB 3VG8A 2D26C 1SQTA 3SUDA 1RIWB 2ZU3A 1UTMA 3A8AA 4HTCH 3BTME 3MU5A 3UQOA 2H1UA 1C1RA 4JK5A 4KKDA 3L3TA 1AE8H 1P09A 4X0WU 3TH2H 2A45B 1TQ0B 3RXEA 5DPAA 3FAOA 4F55A 3O8DA 1Y5BT 2CHAB 1LDTT 2KCPA 2I6SA 4X8TH 2WSSD 4TWYA 4BANB 4OGXA 4DT7B 1AO5A 2P94A 4Z0KA 4B73A 1ELTA 3A7TA 3NPSA 1ETRH 5E0HA 3A81A 4FETA 4ISIH 4D8NA 2GMTB 1QRWA 3ZV9A 4X1SU 1EFRD 2AFQB 4CR9A 2HWLB 3CS0A 4JYTA 1P2MA 1XXDA 1Y59T 3BTKE 4MPUA 1AB9B 1JXPA 1SQAA 1DY8A 1HJ9A 5L6NH 1QL7A 2HLDD 1ZHRA 2FZZA 3KQDA 5FBIA 3MYWA 1HIAB 3WWBA 4B2BA 1W3CA 2OBQA 2ZCKP 2BDCA 4I7YH 1THSH 4IW4E 2J95A 2YOLA 3F2FA 3ZVDA 4YXWD 1O2QA 4Q4LA 1QURH 1Z6JH 2VIOA 2Y7XA 1W0ZU 1W7XH 1XUGA 2OQ5A 4CRFA 2ZFSA 2V0BA 1KMHB 1ZRBA 2GCHF 3H7TA 4NG9H 2V6NA 1W0JD 2WZQA 3LT3A 3KF2A 3GISB 5FX6A 2ZNKH 2PWXA 1O3AA 2FS9A 1TIOA 5JBCS 1DS2E 2Y5GA 1O3NA 1GJ8B 3M37A 5B6OA 2IJOB 4GCHF 1WU1A 2VH0A 1GGDB 1GI8B 1T32A 3U8OH 1TMTH 2RCEA 3A87A 3DHKH 2WHXA 3O8RA 2FS8A 2WPLS 4TY7A 1OKXA 3MNSA 4JCNA 2CF9H 3WW7A 1YPKH 3OSYA 3PV5A 2UWOA 3D65E 3VGCB 4ZHLU 3DFJA 4YT6H 1P3EA 1O2SA 1ZOMA 1SBWA 4ABJA 5HM9A 5ABWA 4ZKSU 3AW1A 5DO4H 1D3TB 1GI4A 3OE7D 1QIXB 1UHBB 2A0QB 3PWCA 1FUJA 1O5BB 1Y8TA 1SGRE 4ABFA 1C5TA 1GMDF 2ZZUH 1OHHD 4A92A 3SJ9A 1O30A 1QHRB 5TJXA 1NBME 3E0PB 2ZCHP 1SFIA 2PFEA 3GOVB 1GI2A 3SBKA 2OK5A 1YPHE 1SL3A 2UWLA 1O3JA 3RMNH 4LZ4B 1BCUH 3F0OA 1P2JA 1FNIA 3P70B 1S5SA 4ASHA 4NIYA 3FFGA 1DXPA 2XWBI 2NWNA 1P05A 3SU3A 1L2EA 3LDXH 1EPTB 1NN6A 3GYLB 1K1NA 1JIRA 2A1DB 2VGCB 3PO1C 2SNVA 3SI4H 1BBRK 3KQBA 1SHHB 1C4Y2 2FMJA 1AE5A 3STIA 1C5WB 3PV4A 3PV2A 2OLGA 1MTUA 1YPLH 2J9NA 2BOHB 3OY6U 1AVXA 3A88A 1NRPH 3ZVEA 1C5VA 1HFDA 4BAMB 4MLFB 4K2YA 1IQMA 2WPIS 2A5AA 1W13U 4ZXXH 2PKAA 1Y3WA 3TH4H 4H4FA 1YM0A 3Q3XA 1F92A 2BHGA 1UCYE 5I25A 3W95A 5GIBA 4UE7H 4WWYA 1N6XA 1O35A 3WWFA 1MKWK 1MTVA 1L4DA 3KL6A 3F2GA 1DANH 1SOZA 1BUIA 1TABE 1MCTA 2SFAA 1SGFA 3M5OA 3CENA 3K6YA 4TYDA 1HB0B 1K1OA 2WV4A 3RXOA 1CHOG 1E37B 1FY4A 1GJBB 1TOCB 2FTMA 3LGVA 5ESBA 2A7JA 1CBWC 2QC2A 1BITA 1MTNC 3HK3B 3HGNA 2I6QA 1TA2A 2AH4X 1S6FA 1NBMD 1W11U 2G00A 1D3DB 2BM2A 5DN6D 1LQDB 3GYMA 1DFPA 1VITG 1SGTA 2TRMA 1QB1A 3K9XB 2FWWA 1ORFA 2HVXA 1RIWC 5FXLA 1BTUA 2VVUA 1O2LA 3UOPA 3ZZAA 2STBE 2XCFA 1DLEA 1EAXA 1TWXB 2AMPA 4KTSA 3RM0H 4CHAB 1PQAA 4ABGA 1YBWA 1Y5UT 1QJ6B 2CHAC 4U30A 1MMJN 3VFEA 1YCPH 1ZSJA 1V2RT 1Q31A 1QRXA 2WPMS 1IQEA 4OS2A 3T62A 3A84A 1SGPE 2P95A 1P2NA 1K1JA 1COWD 1MD8A 1YYY1 2GMTC 4B2CA 1HAGE 1BJUA 1C9PA 2ZTXA 1E79D 1DVAH 2BTCE 1GJCB 5B6LA 3KNXA 1CHGA 5J4SA 3VEQB 2Z9GA 1G3DA 4K1SA 4Y10E 3S7HB 3SW2B 1AB9C 3VB7A 2Y6TA 1SVPA 2FODA 3MWIU 2BDYA 2ZDLA 3QLPH 2QF4A 1MKXK 1VGCB 1Z7KA 1H8ED 3GCOA 2EC9H 2ZFQH 5A0CA 3OEED 1C2FA 1TLDA 2BQ7B 5EPYA 2C4FH 2H6MA 5EU8A 4CRAA 4OS4A 1KLIH 1VJ9U 3TITA 1FY8E 2XCNA 1E38B 1JOUB 2O8MA 1JRSA 5T6DA 2ANYA 4DY7B 1OX1A 1GHYH 1PJPA 1GBKA 1SI5H 2KZ4A 1NT1A 1V2PT 3SO3A 3QX5H 2ZHFH 4Q63A 2BY8X 2EI6A 3SORA 1CT0E 2ALPA 1O2PA 5K0HA 4O3TA 4NIWA 2NU0E 1O3IA 3JZ2B 3V3MA 3LGTA 4H6SB 1UVOA 3R0FA 3PMJA 4X6OA 1S6HA 1GGDC 1A2CH 3TNTA 2WYJA 4UDWH 4ABEA 1TALA 1QY6A 1X7AC 1XKAC 2FIRH 2FOEA 2WINI 1FY5A 2G4UA 2GCHG 3TGKE 1W0YH 1ZJKA 2QA9E 4AG1A 5EXLA 2GTBA 1GVZA 4FUJA 5HXFA 2AIQA 3OYPA 1O3FA 3RP2A 2XBYA 3SV2H 5T6FA 1NU9A 5BRRE 3VGCC 1IQJA 1GBDA 3NUMA 3N7OA 1PPFE 1G3CA 3AK5A 3ZZDA 1P01A 8GCHG 2BDBA 2C8ZB 2FOCA 2BX3A 2QXIA 3LONA 1NM6A 4H6TA 5AFYH 1V2JT 1MZDA 1ZTKA 2CJIA 4KELA 3SJ8A 2Z3EA 4U32A 2RA3A 3MU4A 2B5TB 3PTBA 4BTTB 2WUBA 1UMAH 4TT3D 1UTJA 1Y5AT 5LPRA 3RMOH 5A09A 1Z6EA 1OP0A 2QCYA 4JYVH 4AYVB 2P16A 2GX4A 1HAHH 3SHAH 1C5UA 1WOFA 3P17H 3LU9B 5C5OA 5F03A 2M2AA 1S81A 1V2NT 1GMDG 2OUAA 4CRCA 1ZPZA 2B7DH 1BMNH 1EPTC 3UR9A 5JPMH 2OC8A 1BBRH 1XXFA 5IYTA 1D3QB 2ZEBA 2VGCC 4YLQH 1K2I1 1XMNB 1JRTA 5JDUB 3EAJA 2M5TA 3EA7A 1WAYB 4E05H 5CHBA 2LNCA 2ZPRA 1UK4A 2Q6GA 3UR6A 1EB2A 1RTKA 1O31A 1SFQB 5H4IB 1C1WH 2FM2A 3C27B 1O3EA 3SU1A 1NS3A 3OX7U 2KAIA 5JBBS 1G2LA 1ESAA 3BTGE 2J94A 2PSXA 2K0QA 2CMYA 4K3JA 1IQFA 1GHAG 1QQUA 1O3DA 2JETB 3EA8A 3LPRA 4X8SH 1E35B 1NFXA 1O3GA 2GDEH 5GXPA 1AUJA 4CH8B 1CT2E 5EW1H 1LKBA 4GVUA 3I29A 4FUFA 1TPPA 1AZZA 4A1XA 6CHAB 4RKOB 3K65B 1AN1E 2QXJA 2XTTB 2Y7ZA 3TJOA 1RRKA 2ZI2H 2D2DA 1HXFH 1OWIA 3MU1A 4X8VH 3NKKA 1EJAA 2O8LA 3P95A 1RD3B 6LPRA 1TA6A 1SLUB 1Y3VA 7ESTE 1ANBA 1UVTH 1HPGA 1MAYA 2GT7A 1P04A 3PRBA 1O34A 4NA7A 2ZGJA 1C2IA 1A0HB 1D4PB 4VGCB 1MQ5A 1NO9H 3GY4A 5C20A 1HLTH 2BD2A 3GDSA 1ELEE 2PKSB 2BXUH 1V2KT 2TGTA 5EQQA 1UJ1A 1RS0A 3UREA 4UEHH 2G5NA 3MNXA 4B1TA 4Z6AH 3RU4E 1RGQA 1C1MA 1MTWA 1BOQA 4IMZA 2JIZD 2BY6X 4BAOB 3UIRA 3K2UA 4J1YA 3ZVFA 1DUEA 2FTLE 2ZDMA 1DUAA 3AAUA 2JJ2D 1TX7A 4F4OC 4CHAC 3QDZB 4MDSA 4GHTA 2FYRA 4K60A 2BD8A 3MMGA 4LZ1H 4UONA 1DE7H 1HRTH 4KTCA 1GL0E 2AEIH 1MCVA 4AFZA 2PGQB 4Q7YA 2BY9X 1ETSH 3F2HA 2Y82A 2Z9IA 2C8XB 4XFQA 3GCNA 3E6PH 4RSPA 1QCPA 3FANA 2A7CA 4IBLH 1GHWH 1HAVA 1SG8B 1T8LA 1J17T 1TYNA 3U1JB 4LOYH 1NPMA 2VIPA 4TY6A 1MTSA 2PLXA 4ABIA 2VU8E 1P9SA 1VGCC 1IQKA 1DLKB 2J92A 3FZDA 2J38A 2NU3E 4B71A 1J8AA 3SV8A 1BZXE 1K1LA 1ZMLA 2R3YA 1GJ7B 5LH8A 1FPCH 1LO6A 1UTKA 4X6PA 2D8WA 1JBUH 5EQSA 3NK8A 1Z1IA 3ZIAD 3OTJE 2XNDD 3F0PA 4HGCA 1F0RA 3U69H 3KGPA 3T25A 1B5GH 2FP7B 4RN6A 2AHME 1CO7E 4BOHA 5HKKD 2WV9A 2H5DA 1U6QA 2Q6DA 1P2OA 2CV3A 2G4TA 4BAQB 7LPRA 2SGQE 4UFDH 1F5LA 4WMEA 4ZHMU 1OWKA 1P9UA 4M9FA 3RU4D 1GMHF 4Y79A 2ZGCA 2FLRH 1GI0A 3LOXA 2YNBA 1QFKH 1AI8H 1J15A 2SNWA 2BQWB 2ZGBH 2FPZA 1N8OB 4BXWA 4M7GA 1A5HA 1FAXA 1Y3UA 1QA7A 3SV7A 3FP6E 2BD9A 1Y3YA 5JBAS 3DFLA 4B74A 5C1YA 3RLWH 3ZVCA 5AHGH 1K21H 1A46H 1O3BA 4JMYA 2SGFE 1A7SA 5AVDA 2V3OH 3K6ZA 3EA9A 4JYUH 3V0XA 2CGAA 3E0NB 2ZFPH 1FN8A 4JZFH 4Y0YE 3C1KA 3B8JA 1T7CA 2G55A 1BHXB 2O9QA 2XC5A 4B6FA 3IITA 1A3BH 3PMBB 5DP3A 3U98H 1LPKB 2F9VA 2K8IA 5A0BA 3P6ZB 4Q7ZA 1O36A 5LPFA 4MQAA 4TPYA 3ITIA 4PROA 5A2MH 1GBTA 3RC6A 1TE0A 4GPGA 3MH7A 3RXMA 5JB8S 4NIXA 1GVKB 2QIQA 2ZGHA 4I32A 1C1PA 4KGAA 1GI9B 1G37A 2FI5E 1LTOA 1ELAA 2ZDNA 4ZROA 1F7ZA 1TPAE 3SUGA 2QN5T 1C2DA 4XBDA 4E06H 4K8BA 4UFGH 2GCTB 1HYLA 2ZTYA 4I8GA 1FI8A 2OXSA 3RUOA 1P57B 1ABJH 1B7XB 2PUXB 5F8XA 1BBRE