2BB4A

Porcine pancreatic elastase complexed with beta-casomorphin-7 and asp-phe at ph 5.0
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords beta-casomorphin-7
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bb4A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bb4A01
4U32A 3A8AA 2BM2A 1TBRH 1IOEA 1AKSB 4LXBH 1BITA 1KLJH 1GI2A 3VB4A 1YM0A 2ILNA 3V0XA 1VCWA 2UUKB 3V3MA 2OCVB 3LGUA 3BG4B 1DFPA 4NFEA 4I32A 1RTKA 1RD3B 1IHTH 1VITG 3SOSA 1QNJA 1NRQH 1T32A 5JBAS 3T25A 1NFYA 2BDYA 4UONA 1WSSH 3LPRA 1VJAU 4DIIH 3LGTA 1O2JA 1NC6A 1SPJA 1O2IA 2Z9KA 1GG6C 1XUHA 4HFPB 4JYUH 1TBZH 4CHAC 3K6ZA 2C8YB 2DE9A 2C8ZB 3VFEA 1RS0A 3RC5A 1XKAC 3GY2A 1K22H 2A5KA 2R0KA 3SU3A 1QGFA 4GAWA 3ZZ6A 4DOQA 2FX6A 8GCHF 1TQ7B 5GJ4B 1C5QA 1HAIH 2ZGXH 1H1BA 5A0CA 1CHOF 1P8VC 4A7IB 5B6OA 1HPGA 2CMYA 1OWEA 1TABE 2SGQE 2QCYA 4NA9H 3ATWA 4RKOB 3DD2H 3KQDA 3NCLA 1NRPH 1P3EA 1ANBA 2O8LA 2WPMS 5C5OA 1TPSA 4CRGA 1TLDA 1EB2A 1P2NA 1YCPK 2UWPA 1GBFA 4D9RA 5GXPA 1LO6A 2SFAA 1BJUA 1Q3XA 4BXSA 1BDAA 2FPZA 3QLPH 3RXUA 3MU0A 1WV7H 2IOTA 2VWNA 4MPXA 3SJIA 4K2YA 1H9LB 2BYAX 1NO9H 2ZO3H 2J9NA 2NU4E 1S84A 1P05A 1EZSC 1SLXB 1KXBA 2BTCE 4I31A 3RU4E 3U8OH 2VH0A 2ZHDA 3E91A 2H2ZA 3URDA 4CR9A 3GCTF 1TNGA 1GHWH 2ZG0H 3U69H 2A5IA 3P17H 5A0AE 1ORFA 2A7CA 5G4BA 3E0NB 1UO6A 1GVZA 2P59A 1FN6A 3FVFB 3SV2H 2FXRA 1AZZA 4NA8A 1DWEH 1O2ZA 1VR1H 1O3AA 3UREA 2GCHF 4BTUB 4MQAA 7ESTE 2ZDLA 1IAUA 1J16A 1AVXA 1HNEE 1C2LA 3SU6A 2RA0A 4NA7A 1V2RT 4JYVH 3SJ9A 2Z6BD 1QQUA 3SNAA 1O3KA 1HDTH 1GJCB 7LPRA 4I33A 1UK4A 1XUGA 2GDDA 5J4QA 2OBQA 4B2CA 1GI5A 3RXEA 5HMAA 1NU9A 1SC8U 3P6ZB 4X6MA 1BHXB 3KEEA 4IMZA 2A2QH 3LDXH 1ZHPA 1NFXA 2Y5GA 2VIQA 5DKMA 5C1UA 5AF9H 2FS8A 2TGPZ 2C3SA 5CE1A 1LQDB 2R0LA 1HRTH 1CHOG 2R3UA 4H4FA 4WXIA 2IPHA 4IMQA 4DG4A 3UOUA 1GJDB 3K2UA 3EYDA 3K65B 2AYWA 3RXHA 4B2AA 1SG8B 5A0BA 3ZZ3A 1ZPZA 5TJXA 1SQOA 2BD2A 4I8LA 2EC9H 1UVOA 3LGIA 1E34B 2ZHFH 1MH0A 4CBOA 1GMCF 2BZ6H 2PSYA 1EZXC 2FOGA 3IWMA 5C5NA 5DP7A 2BQ7B 3MI4A 4YLQH 2A4OA 5JBBS 1T4UH 1P02A 4TY7A 2QC2A 1LVYA 2B8OH 1LHCH 3M7UA 2BDIA 1LVBA 1SHHB 1HIAB 2VWLA 1MTUA 2QAAA 1FZZA 2A4RA 4UFDH 1DWDH 2GGVB 3ATMA 4FUBA 2GV6A 1QA0A 1UHBA 1IQMA 3EQ0H 1BTYA 3SUDA 1FAKH 4U2WA 4GVUA 4H6SB 1KIGH 1SGEE 1V6DA 4TY6A 5C67A 1ZJKA 5GCHG 4IS5A 1SOTA 2PTNA 3KQBA 2FI4E 2TGAA 2VINA 3RU4T 2FOEA 2ZCHP 5C2ZA 1HXEH 3A7WA 4JZDH 1KDQB 1MD8A 1BUIA 2HWLB 1YPHE 1DXPA 4NIVA 1DITH 1IQFA 1TOMH 3F9HA 2CXVA 1Y5UT 1FY1A 4XBBA 3A8BA 5JPMH 1TX6A 3I29A 4ZKSU 1OP2A 1A7SA 1MTNC 4INHA 1MAYA 2XCNA 1ZGVA 1TNLA 1SHYA 1P0SH 3P92A 1FIZA 2UUYA 3TVJB 7KMEH 4TPIZ 4MNVA 1MTSA 1GVLA 1D3QB 1D6RA 1O35A 2V0BA 4Y8XA 3SNCA 1EQ9A 4BANB 3TK9A 5ESTE 6LPRA 1BTHH 1O2SA 3EAJA 5I46H 3LIWA 2C93B 4BAMB 2UUFB 3UQVA 2VIWA 2WYGA 5FPYA 1N8OB 1BTPA 4ZKRU 1SL3A 1DE7H 1ZJDA 1DM4B 1PPFE 5TCCA 5A2MH 4ABFA 5FXLA 2QIQA 1HAOH 2NU0E 4Y7AA 1YPKH 1FAXA 1FQ3A 2QGRA 1VITH 1XXDA 1GWAA 2Q6FA 5E0GA 2H5DA 3RMOH 1LKBA 2R2WU 2ZDVH 1CA0B 3MO9A 3SGQE 5T6DA 4ZKNU 2TGDA 4AFQA 1O3NA 1PPZA 1CA0C 1THPB 1UJ1A 2D26C 3I78A 4THNH 4X8TH 3MFJA 2BLOA 4ABGA 2OQUA 3PWCA 1C1UH 3BTTE 3RXQA 4CBNA 4K1TA 3R3GB 4I7YH 4MLFB 1O33A 3RXPA 1UHBB 4Q2KA 1O5BB 1ZHRA 1EB1H 4D9QA 1GBLA 4OS7A 1O3OA 2ZP0H 2Z3CA 3QUMP 2FI3E 2PLXA 1BRBE 1GJ9B 1FIWA 2ZHEH 4X1NU 2BDBA 4A92A 1OP0A 4GHQA 4YT6H 2Z3DA 3O8RA 4LZ4B 4XDEA 1QRWA 3BEUA 4D76A 1Z1JA 2JH6D 4TWWA 3U98H 1KXDA 1DLKB 2H9HA 3GY4A 1EPTA 1GI1A 1Z8RA 1O2HA 2WPIS 3T5FH 5DP5A 1UMAH 1FONA 4B73A 1C2EA 4J2YB 5F6MA 4CR5A 1PYTD 4ZROA 1H4WA 4FUEA 5EG4A 2BVXH 1T8NA 1W0YH 5K7RA 4ABDA 1ZZZA 1HJAB 1TGBA 3A81A 5EGMA 3TNTA 3A83A 2FEQH 2P8OB 3VB6A 1DDJA 3QGNB 5IDKA 2GX4A 1A61H 2SNWA 4U01A 2VVCA 4X8VH 2ZCKP 1IQEA 2ZDNA 1JIRA 1ZPCA 3KL6A 3UWJH 2A7HA 2W7UA 1S5SA 4AB9A 2FYRA 2GCTC 1TFXA 2WPKS 4WF8A 1P2IA 4NSVA 1S6FA 2P3UB 2ZQ1A 4O03A 2QN5T 3EGKH 1Y59T 5E2PA 1ZMLA 2Y82A 1IQIA 1HXFH 1TYNA 1SR5C 1KYNA 1NT1A 4WMEA 1P03A 3QTVH 3RMMH 1FY5A 2TBSA 4FU9A 5LGOA 1YPEH 1ZTLA 1FPCH 2A31A 3ATKA 1UTMA 3A88A 1GBJA 3E0PB 4AYYB 2OC8A 7GCHF 1O36A 1MMJN 1W8BH 3QN7A 4FUFA 4IW4E 3V13A 1QRXA 2GZ9A 3LT3A 2XWBI 4BAQB 2GZ8A 3TIUA 2Z3EA 1EJMA 4FU8A 4XBDA 3SU4A 3AVZA 3SV9A 3KF2A 4Y8YA 3MU4A 3MNXA 4B2BA 1H9IE 1L1NA 2ZGHA 3SNBA 1MQ6A 2PW8H 2QXIA 2B9LA 1E37B 1HAYB 2XWAA 2BD4A 5K0HA 2CF9H 2HGTH 1C2IA 1ZR0A 1FJSA 3HK6B 3HK3B 1DY8A 1TNJA 3ZZ4A 2F9NA 2HALA 1EAWA 3LKWA 1CT4E 3H7OA 3GCNA 4GSOA 2BY7X 4YESB 2BVSH 1O5AB 1JWTA 4Y10E 3GY3A 2FODA 1U6QA 1UCYE 3RXCA 2PHBA 1ZOMA 4ISLA 4WMFA 1AZ8A 1NRNH 4SGAE 3UQOA 1GJ4H 1TNKA 4XOJA 5EW2H 1C5YB 5EODA 4Q7YA 1OP8A 2VWMA 4CRCA 3SN8A 5L30H 2XCFA 3ATIA 1GMHG 4MDSA 1GHAG 1XUIA 2ZGCA 3BTKE 3PMBB 3FANA 3OX7U 1Z6EA 2PUQH 4Y6DA 1O3EA 9ESTA 1HAHH 2W3KA 5CHAB 1W12U 3RXTA 1YPJH 3CP7A 2BX4A 4MTBA 1UTPA 3U8RH 1TGSZ 3FFGA 3FZDA 4YO9A 1T8LA 1YYY1 1V2LT 3PTBA 2NWNA 3A8CA 3PLPA 2AGEX 2ZGJA 1YPLH 2SGDE 1VZQH 4Y7BA 1AB9B 2IJOB 1HGTH 1O37A 1QB9A 1DUEA 5E8EH 1Y8TA 3MU8A 2FIRH 1LTOA 3VPKA 1A46H 1NY22 2PWXA 1UVSH 4AGJA 5A09A 1E36B 2STAE 4WXVA 2BY6X 2WUCA 4Y8ZA 4H42U 1C9TA 1Z8GA 1Y3UA 1Z71A 1VGCC 2BDCA 1GBCA 1O3HA 1C5NH 2OXSA 4DY7B 4WJG2 3ZZ8A 1XUFA 3IITA 4I8JA 4AN7A 5I25A 2ZFFH 1O2PA 2QYIA 4LOYH 1KLTA 2ZECA 1DSUA 2ZU5A 4XE4A 2F83A 1TRNA 2G52A 4F4OC 4JK6A 1GDNA 3VXEH 4LK4A 1O2WA 1O2YA 2Z9JA 2HLCA 3RXMA 4X2YA 3N7OA 3U1IB 1QL7A 2ZTZA 3G01A 3ZVDA 1LPZB 1PPCE 2WYJA 1OWKA 1MD7A 3ODFA 3GDSA 2W5EA 1BMAA 8ESTE 4FUGA 1O3IA 1ANDA 2ALPA 4YOJA 1OOKB 3NKKA 1YCPM 1NFUA 4QT8C 1EUFA 5DGJA 3Q77A 3QZQA 2WINI 1UK3A 2AIQA 1HAVA 2PTCE 4ESTE 2P93A 4MVNA 4KP0A 2J95A 3TH2H 3BEIB 5E2OA 1HAVB 1NFWA 1P09A 2SGAA 2G8TA 1W2KH 2FDAA 2VGCB 2GZ7A 3FZZA 1C5UA 4IC5A 1QQ4A 1NRRH 3PO1C 4INLA 1TPPA 3F1SB 2Z9GA 3E90B 3QGJA 3BV9B 4BAOB 2G5NA 1NPMA 1O3JA 3MOCA 3TJUA 1K1JA 1SB1H 1TNHA 4AFZA 1O5GH 5GCHF 2OLGA 2BD9A 1O3LA 3AAUA 1XUKA 5DJ7A 1A0HB 4K1SA 1ZSLA 3T2NA 2AMPA 1UVTH 2FMJA 2CF8H 4ISNA 4B75A 2TPIZ 1MKWH 1OS8A 1TRMA 1XKBC 3ITIA 1QCPA 4NZQA 4SGBE 3LGYA 1AHTH 1O3PB 4Y76A 1ETSH 2PKAB 1GBDA 1TPAE 2F9BH 2PSXA 1T7CA 3TITA 1GG6B 5LPFA 1DUAA 3RDZA 3M5OA 1H8IH 1C4V2 3GCHC 1BMMH 1ELFA 2QF3A 2OC1A 1N6YA 2LNCA 1OX1A 1SGRE 2XBWA 2V35A 3MO6A 1C2KA 1YC0A 3MO3A 4FVBA 3RM0H 2Y5FA 1QJ7B 1OXGA 2BD7A 2ESTE 2EI6A 1G3BA 1GHYH 1GBMA 1GCDA 3KQEA 1H9HE 1XUJA 2ANWA 2ODQA 1W0ZU 2C4FH 3MMGA 4UFEH 4FUCA 1BHXF 4IC6A 1NRSH 4B71A 1T8MA 2PUXB 2JETB 3SUGA 1SLWB 1Y5AT 1O2KA 1SOZA 1TE0A 1GGDC 3MH5A 3PWBA 3EE0B 1DY9A 5C1YA 1SQTA 2F9VA 3KQCA 1P57B 2BX3A 3RC4A 2EEKA 1BRUP 1IHSH 1AUJA 1UTJA 1P9UA 2M5TA 2ZDKA 3M35A 1PYTC 1C2DA 1VCPA 1QRZA 1CU1A 3STJA 1DOJA 1S0QA 1MTNB 1J8AA 4ABEA 1O2NA 5EPNA 1NTPA 1P11E 3TJOA 1MU8B 1NN6A 5IYTA 3RXDA 1YP9A 2FP7B 3UNSA 2CHAB 1ZTJA 1GI0A 1ELEE 1C1VH 2Z9LA 1D6WA 4FUHA 3EA7A 1CVWH 1C1RA 3SHCH 1TX7A 3PLBA 2OC7A 4D7GA 2P3TB 1W7XH 5HM2A 2F9PA 4JZ1A 5AHGH 3AW1A 3SHAH 1QR3E 2ANMH 3RMNH 3TNSA 1DVAH 3LGWA 8GCHG 3FP8E 1QBNA 3ZZ9A 4JZEH 2BD3A 1UK2A 2FS9A 2Y5HA 3DFJA 3GDVA 3BN9A 3T62A 1J14A 1ACBE 4X2XA 2FTLE 1SVPA 2H9TH 1VJ9U 1C4U2 1K28D 3E16B 3OU0A 1C5XB 1WQVH 3A7VA 4WVPE 1HIAA 3SQEE 2D8WA 2BOKA 3M7QA 5L2YH 3QK1A 1UVPA 1XXFA 1JIMA 2AEIH 1RXPA 2ANYA 2CJIA 2YNAA 3GY5A 3HPTB 4M7GA 2AS9A 1IQJA 3MNSA 1F5KU 1J9CH 4UFGH 1O2XA 2FOCA 3TPIZ 9LPRA 5E0HA 1LQEA 3LJJA 1CGHA 1JXPA 2BXUH 3RXJA 2R3YA 3A86A 3SUFA 1HAZB 1SMFE 4X2WA 2I6SA 1CHGA 1BBRE 1LCYA 2NU2E 1TGTA 1PJPA 4JMYA 1WCZA 2IN2A 1YGCH 2FZZA 4BAHB 2Y7XA 3MH7A 5ETXA 3PO1B 1HAPH 1JBUH 2PKSB 1DSTA 3BTGE 4A1VA 5A8YA 3QX5H 4A1XA 3RC6A 2ZEBA 4Y0ZE 3V7TA 1ZPBA 3OTJE 1MKXH 2JH0D 4NZLA 3M7TA 2ZNKH 3L6PA 3PV4A 1ANEA 5F8XA 1LVOA 1Y3XA 2W26A 4XBCA 5FPTA 1WBGB 1OWJA 2ZWLH 1F5LA 5BRRE 2P8OC 3VGCB 1BOQA 5DP4A 2ALVA 3F9EA 5C1XA 1AQ7A 3P70B 4A5TS 3HATH 4WWYA 2ZU4A 2BY5X 2SGFE 1BTWA 1MBMA 3BF6H 3UR9A 3ZZ7A 2QY0B 2XW9A 1F5RA 1O2MA 3A89A 3FP7E 1ZMNA 2CHAC 1CE5A 1GHXH 4K3JA 1V2PT 1HAGE 1GL1A 2ZPRA 4ISIH 1TAWA 3DUXH 1AD8H 3K9XB 3ZZCA 3Q00A 3H7TA 1AFQC 3SNDA 2GT8A 4O3UA 4LZ1H 1HFDA 3UNQA 3A84A 2ODYB 3EA8A 1WU1A 4J1YA 1B7XB 2BQWB 3BIUH 4IBLH 5EQSA 1N6XA 1O5CB 2Q6GA 1TNIA 1A5IA 3GCTG 3EA9A 2ZC9H 4YOGA 5C20A 5EXNA 1V2VT 1V2QT 1L0ZA 3BG4C 3S7HB 3WY8A 1HJ9A 1YPHC 3TGJE 2F91A 1WYKA 5GDSH 3NWUA 3SUEA 4FUIA 4DT7B 1GI8B 2SGEE 3HKIB 1ZTKA 4ZHMU 2ZF0H 4JZFH 6CHAC 1EP6A 3A87A 1ANCA 2R9PA 5F8ZA 1ZRBA 1LKAA 2FLRH 3U8TH 4AFUA 5L2ZH 2BMGB 1SGFG 3L3TA 1RTLA 3SGBE 3MH4A 4DVAU 1KSNA 1V2MT 4DGJA 1P04A 2ZFSA 4AB8A 4OS6A 1DX5M 4FUDA 4BTIB 1EXFA 1CT0E 7GCHG 1QJ6B 4YTAA 3SV8A 1K1MA 3SZNA 1NESE 4B76A 1GJ8B 3BTEE 2CN0H 5JB8S 5EXLA 1AFQB 1TGCA 1KDQA 2AMQA 2HPQH 4XSKU 2NU3E 1MCVA 2ANKH 2VIOA 4ZXXH 4B74A 1CGJE 1GDUA 1C2JA 1ELBA 1GBIA 5AFZH 1UTLM 1KTTB 4UD9H 2WPJS 2FOFA 1BRCE 1C9PA 1VITF 2P94A 4FU7A 4TWYA 1ZHMA 1AGJA 4X6PA 1TA2A 1K9OE 2K1QA 3A85A 4IGDA 1S82A 3C1KA 2HNTC 3SO3A 3UWIA 3LGVA 6ESTA 1G3CA 2GMTB 2XYAA 4CRFA 2ZHWH 3BTQE 2BY9X 1ESBA 3PYHA 2HNTE 1PQ5A 1BCUH 1ZLRA 2AGIX 5EXMA 4ZH8A 2ZHQH 1ELCA 2EI8A 1A3EH 1CBWC 3E6PH 1K1NA 1ELAA 3AAVA 1E35B 4GCHG 1B5GH 4YT7H 4ZHLU 1QA7A 5EQQA 1DWCH 2D2DA 3KCGH 2W7SA 3UNRA 4VGCB 1IQGA 1QIXB 1SGNE 2GTBA 2OP9A 4I8GA 3ZV8A 1TMTH 1TONA 1OKXA 3MU5A 1O31A 4CRBA 1A4WH 3STIA 1OWIA 1FY8E 1O3DA 3D65E 2V6NA 3LH1A 3MH6A 1TB6H 3VB3A 2PR3A 4BTTB 2XC5A 1AVGH 1UTQA 4A1TA 1GHVH 3T26A 4KGAA 2RG3A 5DP3A 3D49H 3A7XA 1O2TA 1OWDA 1EATA 1BBRK 4IN1A 4NGAH 5JYIA 5AVDA 3GISB 4ABHA 1ELGA 4X2VA 1OYQA 1KXEA 1YPMH 4UEHH 2ZDAH 2SGPE 3PB1E 1THRH 4AORA 1C1SA 4BXWA 5C3NA 3A80A 1UTOA 3ZVAA 4AX9H 1QB1A 1CBWB 1TPOA 1D9IA 1L1GA 3KGPA 2Z9IA 4YOIA 3TJNA 3SQHE 2HNTF 3QTOH 4FXGH 4AZ2B 1G3DA 1HJAC 1P12E 1BIOA 1O3MA 1O2QA 1A0JA 2P16A 2P95A 4K5ZA 3ZV9A 5F8TA 2J34A 1GJ5H 1PQ7A 1E38B 1AY6H 2GD4B 3O8CA 2G51A 2ZTYA 1P10A 2FOMB 2LPRA 2ZI2H 1C5VA 1F0RA 1GI3A 1Z1IA 1GBAA 3SGAE 2ZCLP 1F0TA 1UVUH 1GMDF 3ZYEA 1MKXK 1QY6A 4HZHA 3SU0A 1FLEE 1G2MA 2ZA5A 2O8UA 3ZVBA 1D4PB 1INCA 5A8ZA 3SJOA 2ZZUH 4GCHF 5AFYH 1P2KA 4U30A 3TGKE 3LOXA 3CS0A 1Z8IB 3UTUH 1GJ7B 4Y79A 2ZDMA 3S0NA 3TH4H 1AKSA 2PV9B 3QO6A 4ABAA 4K69A 1MTWA 1V2KT 1C1NA 1AO5A 1JMOH 1SFIA 5E0JA 1QL9A 1ETTH 4BNRA 3P8GA 1S6HA 1W11U 3D62A 3RUOA 1C1MA 3ZZAA 5DPAA 4O97A 1O2GH 2BOHB 1CO7E 2VVVA 1BJVA 3GY8A 3VEQB 2D1JA 1EASA 4NWKA 1F7ZA 4A6LA 2ODPA 3A7TA 1EJAA 1V2ST 4RSPA 3CENA 6GCHF 1GCTC 4WH6A 3RXGA 1GBEA 4VGCC 3ODDA 3SJKA 2A2XH 2QXHA 4B1TA 2FYQA 2BDGA 3OY6U 1P06A 1GMDG 2RCEA 3T27A 4NG9H 1DWBH 4CHAB 2A0QB 1EPTC 4X6OA 3RU4D 1NM6A 4CREA 5GPIB 4D8NA 3P8NA 2BXTH 2UWLA 1MZDA 4Y11E 4ZUHA 3BTDE 3MWIU 1JRTA 5PTPA 2A1DB 2XC4A 4YM9A 2QV1A 4JZIA 1V2JT 2KAIB 1SLVB 3BTME 1L1JA 2A4GA 1F2SE 4MPUA 3ZVGA 1CQQA 1SGTA 2C90B 2KAIA 1C5RA 1GHZA 2OBOA 3M61U 8KME2 2ULLA 1GJ6A 1OYTH 4DCDA 2BVRH 3GCOA 1ESTA 1ARCA 1ARBA 1HUTH 2WPLS 1FN8A 2Q6DA 5LPEA 1TIOA 3EDXB 4AYVB 3SU2A 1LPGB 1TQ0B 1A0LA 5ABWA 1O2LA 2EI7A 1IQKA 3LONA 3PTNA 1S83A 3F9GA 4Z6AH 1UCYK 4ZKOU 2HRVA 3RXVA 2XNIA 2Q1JA 3DT0H 1XVOA 1C5LH 4TPYA 3SI3H 3ZYDA 3O8DA 3C27B 5HM9A 2ZU1A 2RDLA 2R2MB 3I77A 4KTCA 4X8SH 3ZVFA 2ZIQH 3A7ZA 1VCQA 1FMGA 1TMBH 1G9IE 2WUBA 2I6QA 1GHBG 5FX6A 1EZUC 1O2RA 5DP9A 2AIPA 3BTWE 1GBTA 1B0EA 1CGIE 1PPBH 1DS2E 2G00A 3UPEA 3A8DA 5TCAA 1BTZA 5SGAE 1O5DH 1WTGH 2WPHS 1YCPH 3M5NA 4K1EA 3ZVCA 1AMHA 1Q31A 2G81E 3K6YA 4JK5A 5HXFA 5CHAC 1ID5H 1IQNA 2VIVA 4ISHH 1K1IA 1O5EH 1YLDA 5EU8A 1W14U 3MNCA 1W13U 1WAYB 5DP6A 3LH3A 2H1UA 1FY4A 3SU5A 2O8TA 1ELVA 1RTFB 1TX8A 2W3IA 3IG6B 1SGDE 2QXGA 1UTKA 3Q3YA 1Z7KA 2ZGBH 3SV7A 2G4UA 1RIWC 1O2OA 4RKJB 2BY8X 2XBVA 1BTUA 3DHKH 5FAHA 4D7FA 3PROA 1IQLA 1P2OA 2GCHG 1JOUB 3RM2H 1C2MA 2OQ5A 2TIOA 2WV4A 4KELA 2F9OA 4GPGA 1C5ZB 5FPSA 3FP6E 1O38A 2OC0A 1EPTB 4MG3A 1O3GA 1P2MA 1TGNA 4X8UH 4MPVA 1AN1E 2BB4A 3CS7A 1AI8H 1AE8H 1QB6A 3OYPA 3PMAB 1A1RA 1PQAA 4OGXA 3HGPA 2BLQA 3RXFA 1O3CA 2FESH 3A7YA 1Z6JH 2YNBA 3TH3H 2J94A 2Y80A 3AW0A 1NS3A 4H6TA 2A45B 3QWCH 2AGGX 5T6FA 4E7RG 3RXKA 2GKVE 1OSSA 1S85A 1SGFA 2ZFTA 2B7DH 5L6NH 2ZU3A 4KKDA 2PGQB 4NIWA 1O34A 1PFXC 1F0UA 4HGCA 2BDHA 1LMWB 2BLVA 1W10U 1BB0B 2OTVA 4AFSA 2JKHA 1ETRH 1AB9C 1O0DH 2ZQ2A 3F6UH 1A2CH 3GICB 1G3EA 2AH4X 1K1PA 3MU1A 2V3OH 1BA8B 1EX3A 2GP9B 1BQYA 3UOPA 1GMCG 1RGQA 1SBWA 2Y6TA 4ABIA 1D3PB 3M5LA 1EAXA 2Y81A 1Q2WA 4KTUA 2G5VA 4IN2A 1RFNA 1X7AC 4AG1A 4K8YA 2F3CE 3ENSB 5JBCS 1C1OA 1EJNA 3B9FH 1N8OC 2BD5A 1BT7A 1J15A 1P2JA 2THFB 2C8XB 3S69A 2GDEH 3T29A 3SJ8A 2B0FA 2A5AA 3RLYH 3E8LA 1RJXB 3LC3A 1THSH 1TWXB 1V3XA 1C2FA 1NZQH 1HB0B 3LC5A 4X1PU 3GOVB 3BTFE 4R8TB 1GJAB 3RP2A 1E0FD 1SGIB 2J4IA 2FOAA 2DUCA 1S0RA 1GI7B 1P2QA 2VH6A 1EP5A 4ZXYH 3DA9B 4NFFA 3UIRA 1WTHD 1AUTC 4Y0YE 5DG6A 3BG8A 2AFQB 2A32A 3T28A 4O3TA 4GUXA 1V2UT 1O2VA 1SGQE 4E06H 4X6NA 4GLYA 4JYTA 1GCTB 3KHVA 3BTHE 3AASA 4NIYA 3SV6A 1GDQA 1SI5H 4WH8A 3Q3KA 1AWHB 4PROA 5HGGA 1FI8A 3HKJB 2A7JA 4K8BA 4NIXA 1ZSJA 5FCRA 4NWLA 1UCYH 5ESBA 2GT7A 1BMNH 2VGCC 2Y7ZA 5EOKA 5FHTA 1W3CA 2FOBA 1SGCA 1BRAA 4ASHA 1TA6A 1CA8B 3S7KB 3TGIE 1NROH 4RN6A 1GGDB 1MUEB 5A8XA 1PPGE 2FM2A 2GV7A 3BSQA 1EAUA 1QURH 2BHGA 1D3DB 5CMXH 1C2GA 2ZFPH 1TALA 1V2OT 1A5HA 2UWOA 2VIDA 4MNWA 3SI4H 5LPRA 1K1LA 3VGCC 1XMNB 2FWWA 3RLWH 2GVFA 3W94A 1ELDE 1TMUH 2FI5E 1QBVH 4XFQA 2ZKSA 1GVKB 2CGAA 4HTCH 4UDWH 2PKAA 3Q3XA 3RXOA 1WOFA 3H5CB 1DANH 1GI4A 2FOHA 4AG2A 1TRYA 4WMDA 2JH5D 5DP8A 6GCHG 3A82A 1RIWB 3NK8A 1C1WH 3O8BA 1RRKA 2PFEA 2ZPSA 3MHWU 2XXLA 2AMDA 2V3HH 4R0IA 1YPGH 4AGKA 1Y5BT 1BMLA 2H9EH 1C5OH 4JCNA 2PGBB 1V2TT 2ZPQA 4INKA 3P8OA 4ABBA 3VB7A 1ABIH 2HPPH 1K1OA 1DXWA 1C2HA 1NU7B 4FVDA 2O8MA 3TK5A 4Q7XA 4E05H 2XBXA 4OS5A 1C5SA 1CT2E 3HGNA 1W7GH 2Z7FE 3RMLH 2VNTA 2BQ6B 4ISOA 1L2EA 4TYDA 2VWOA 5JB9S 1AVWA 4ABJA 1G36A 1PPHE 2HOBA 1FNIA 3F68H 3VB5A 3MTYA 1EOJA 1FXYA 1YKTA 3FAOA 1YF4A 3UUZA 2FTMA 4UFFH 1AIXH 3M3TA 1UTNA 1F92A 4WY3A 1ZSKA 1BTXA 3RXLA 2OD3B 8LPRA 1XVMA 2J92A 4MNXA 2BZAA 4CH8B 1MQ5A 4CRDA 1C5MD 1J17T 5JDUB 2ASUB 3GY7A 3V12A 1FPHH 1MKWK 5T3HA 3D23A 1G30B 1EKBB 1L4ZA 3F9FA 3PM3A 2ZTXA 4UE7H 3KN2A 4Q80A 3E1XB 3OY5U 4Z0KA 4X0WU 1MAXA 1KTSB 3M37A 2J2UA 1QHRB 3GYLB 3M3SA 3NZIA 2FO9A 1LDTT 1QTFA 1G2LA 1C1QA 3ATLA 1ABJH 1TBQH 3RXIA 2G55A 5DO4H 1K2I1 4OS1A 5F03A 5JBTA 3S9BA 4YZUA 1ZYOA 3P95A 5FCKA 4E7NA 3UFAA 1AWFH 5GWZA 1QFKH 2STBE 2TGTA 2VU8E 1LPKB 1ZRKA 3QDZB 1S81A 3E3TA 1A3BH 3SU1A 1ELTA 3ZZDA 2H6MA 3MYWA 1KLIH 2G4TA 1GBBA 1EAIA 4AOQA 1AFEH 3TU7H 2QA9E 1GBHA 3Q76A 1CSOE 5GIBA 3SORA 1O32A 4BAKB 1BBRH 3DFLA 2ZFRH 1SGYE 1C1PA 1LHFH 3S9AA 2DE8A 1SFQB 2O9QA 4O9VA 1O39A 1MBQA 1OPHB 1C5TA 3QZRA 3M36A 2AERH 4KTSA 3BEFB 1XM1A 1YBWA 3NUMA 3W95A 1C5WB 1MZAA 1JRSA 3ZVEA 1WQSA 2EA3A 2UUJB 3SNEA 1GPZA 1D3TB 1Y3WA 1KXCA 2YOLA 1SLUB 1YLCA 5BPEA 1G32B 1HBTH 1O5FH 4Q7ZA 4FUJA 3B23B 3KIDU 5FBIA 1QL8A 5T6GA 1GHAF 1AE5A 1GJBB 2QXJA 3B8JA 2NU1E 1C5PA 3GYMA 1EZQA 1XX9A 1Z8JB 1VGCB 1HV7A 3U9AH 2J38A 1B0FA 3M3VA 5EQRA 3M5MA 4X1SU 1M9UA 2BLWA 1DLEA 2FX4A 3L33A 2GMTC 1PQ8A 5EPYA 4MPWA 3URCA 1SQAA 3NPSA 1GI9B 2VJ1A 1LHGH 3UY9A 1PPEE 3PLKA 4NSYA 2FLBH 3RXAA 1T8OA 5DK1A 3KNXA 4X1RU 4Y71A 2F9UA 3SBKA 5FX5A 3R0FA 1O2UA 1FV9A 3RXSA 4NCYA 1P01A 2ZU2A 3GCHB 4I8HA 5LH8A 3VXFH 2XBYA 2C8WB 1DT2A 4BOHA 2OUAA 1Y3YA 1EOLA 1T4VH 1ZMJA 1K21H 1GI6A 4ZHAA 1O30A 2CV3A 2OINA 3BIVH 2VB0A 1AU8A 1P3CA 3MNBA 3OSYA 1GBKA 3JZ2B 3GY6A 3RXRA 1KY9A 1HYLA 2RA3A 1F0SA 3PMHB 1V2WT 1LVMA 3S9CA 4CRAA 5J4SA 4DW2U 1WUNH 2ZFQH 1FDPA 1L4DA 2QF0A 1FUJA 2XTTB 4K60A 5H4IB 3GDUA 4I8KA 2A4QA 1C1TA 1DPOA 2H5CA 1KXFA 2VIPA 3P8FA 2XRCA 4OS2A 1HCGA 4OGYA 2O8WA 4HI3A 2BD8A 1O3BA 3PMJA 2VVUA 1O3FA 5FBEA 3U1JB 1HLTH 5HYOA 1C4Y2 4DJZB 1LHEH 3TK6A 1GHBF 1SSXA 1HJ8A 1QJ1B 4OS4A 4YLUA 5EW1H 6CHAB 1G37A 2TRMA 3RXBA 1Y3VA 1GL0E 1V2NT 4ZAEA 2B5TB 1HAXB 1GMHF 2GCTB 4ZMAH 1DICA 1MU6B 1ZGIA 2XC0A 1IQHA 2HVXA 2SNVA 1A5GH 1H8DH 1MCTA 3LJOA 4GHTA 2WV5A 1BZXE 1P9SA 4X1QU 2BDAA 2Z94A 1OWHA 4DIHH 3ESTA 1TOCB 2PKSC 3LU9B 3TLOA 3UR6A 1QBOA 3SW2B 4DURA 1LHDH 4CH2B 3ZZBA 2JETC 1ESAA 1SGPE 3JZ1B 1N1LA 1FY3A 2P3FH 1T31A 3TJVA 3NXPA 4MNYA 1KXAA 3ZZ5A 1MTVA 4F49A 3ELAH
chains in the Genus database with same CATH superfamily
4U32A 3A8AA 2BM2A 1TBRH 1IOEA 1AKSB 4LXBH 1BITA 2WSSD 1KLJH 1GI2A 3VB4A 1YM0A 2ILNA 3V0XA 1VCWA 2UUKB 3V3MA 2OCVB 3LGUA 3BG4B 1DFPA 4NFEA 4I32A 1RTKA 1RD3B 1IHTH 1VITG 3SOSA 1QNJA 1NRQH 1T32A 5JBAS 3T25A 1NFYA 2BDYA 4UONA 1WSSH 3LPRA 1VJAU 4DIIH 3LGTA 1O2JA 1NC6A 1SPJA 1O2IA 2Z9KA 1GG6C 1XUHA 4HFPB 4JYUH 1TBZH 4CHAC 3K6ZA 2C8YB 2DE9A 2C8ZB 3VFEA 1RS0A 3RC5A 1XKAC 3CNRA 1K22H 3GY2A 2A5KA 2R0KA 3SU3A 1QGFA 4GAWA 3ZZ6A 4DOQA 2FX6A 8GCHF 1TQ7B 5GJ4B 1C5QA 1HAIH 2ZGXH 2K0QA 1H1BA 5A0CA 1CHOF 1P8VC 4A7IB 5B6OA 1HPGA 2CMYA 1OWEA 1TABE 2SGQE 2QCYA 4NA9H 3ATWA 4RKOB 3DD2H 3KQDA 3NCLA 1NRPH 1P3EA 1ANBA 2O8LA 2WPMS 5C5OA 1TPSA 4CRGA 1TLDA 1EB2A 1P2NA 1YCPK 2UWPA 1GBFA 4D9RA 5GXPA 1LO6A 2SFAA 1BJUA 1Q3XA 4BXSA 1BDAA 2FPZA 3QLPH 3RXUA 3MU0A 1WV7H 2IOTA 2VWNA 4MPXA 3SJIA 4K2YA 1H9LB 2BYAX 1NO9H 2ZO3H 4OM9A 2J9NA 2NU4E 1S84A 1P05A 1EZSC 1SLXB 1KXBA 2BTCE 4I31A 3RU4E 3U8OH 2VH0A 2ZHDA 3E91A 2H2ZA 3URDA 1WDIA 4CR9A 3GCTF 1TNGA 1GHWH 2ZG0H 3U69H 2A5IA 3P17H 5A0AE 1ORFA 2A7CA 5G4BA 3E0NB 1UO6A 1GVZA 2P59A 1FN6A 3FVFB 3SV2H 2FXRA 1AZZA 4NA8A 1DWEH 1O2ZA 2J98A 1VR1H 1O3AA 3UREA 2GCHF 4BTUB 4MQAA 7ESTE 2ZDLA 1IAUA 1J16A 1AVXA 1HNEE 1C2LA 3SU6A 2RA0A 4NA7A 1V2RT 4JYVH 3SJ9A 2Z6BD 1QQUA 3SNAA 1O3KA 1HDTH 1GJCB 7LPRA 4I33A 1UK4A 1XUGA 2GDDA 5J4QA 2OBQA 4B2CA 1GI5A 3RXEA 5HMAA 1NU9A 1SC8U 3P6ZB 4X6MA 1BHXB 3KEEA 4IMZA 2A2QH 3LDXH 1ZHPA 1NFXA 2Y5GA 2VIQA 5DKMA 5C1UA 5AF9H 2FS8A 2TGPZ 4F49A 2C3SA 5CE1A 1LQDB 2R0LA 1HRTH 1CHOG 2R3UA 4H4FA 4WXIA 2IPHA 4IMQA 4DG4A 5IK2D 3UOUA 1GJDB 3K2UA 3EYDA 3K65B 3ZIAD 2AYWA 3RXHA 2IPQX 4B2AA 1SG8B 5A0BA 3ZZ3A 1ZPZA 5TJXA 1SQOA 2BD2A 4I8LA 2EC9H 1UVOA 3LGIA 1E34B 2ZHFH 1MH0A 4CBOA 1GMCF 2BZ6H 2PSYA 1EZXC 2FOGA 3IWMA 5C5NA 5DP7A 2BQ7B 3MI4A 4YLQH 2A4OA 5JBBS 1T4UH 1P02A 4TY7A 2QC2A 1LVYA 2B8OH 1LHCH 3M7UA 2BDIA 1LVBA 1SHHB 2WHXA 1HIAB 2VWLA 1MTUA 2QAAA 1FZZA 2A4RA 4UFDH 1DWDH 2GGVB 3ATMA 4FUBA 2GV6A 1QA0A 1UHBA 1IQMA 3EQ0H 1BTYA 4XRNA 3SUDA 1FAKH 4U2WA 4GVUA 4H6SB 1KIGH 1SGEE 1V6DA 4TY6A 5C67A 1ZJKA 5GCHG 4IS5A 1SOTA 2PTNA 3KQBA 2FI4E 2TGAA 2VINA 3RU4T 2FOEA 2ZCHP 5C2ZA 1HXEH 3A7WA 4JZDH 1KDQB 1MD8A 1BUIA 2HWLB 1YPHE 1DXPA 4NIVA 1DITH 1IQFA 1TOMH 3F9HA 2CXVA 5CDFE 1Y5UT 1FY1A 4XBBA 3A8BA 3N7DA 4F48B 1TX6A 3I29A 4ZKSU 5JPMH 3KYGA 1OP2A 1A7SA 1MTNC 4INHA 1MAYA 1E1QD 2XCNA 1ZGVA 1TNLA 1SHYA 1P0SH 3P92A 4M9FA 1FIZA 2UUYA 3TVJB 7KMEH 4TPIZ 4MNVA 1KMHB 1MTSA 1GVLA 1D3QB 1D6RA 1O35A 2V0BA 4Y8XA 3SNCA 1EQ9A 4BANB 3TK9A 5ESTE 6LPRA 1BTHH 1O2SA 3EAJA 5I46H 3LIWA 2C93B 4BAMB 2UUFB 3UQVA 2VIWA 2WYGA 5FPYA 1N8OB 1BTPA 4ZKRU 3VG8A 1SL3A 1DE7H 1ZJDA 1DM4B 1PPFE 5TCCA 5A2MH 4ABFA 5FXLA 2QIQA 1HAOH 2NU0E 4Y7AA 1YPKH 1FAXA 1FQ3A 2QGRA 1VITH 1XXDA 1GWAA 2Q6FA 5E0GA 2H5DA 3RMOH 1LKBA 2R2WU 2ZDVH 1CA0B 3MO9A 3SGQE 5T6DA 4ZKNU 2TGDA 4AFQA 1O3NA 1PPZA 1CA0C 1THPB 1UJ1A 2D26C 3I78A 4THNH 4X8TH 3MFJA 2BLOA 4ABGA 2OQUA 3PWCA 1C1UH 3BTTE 3RXQA 5KEDA 4CBNA 4K1TA 3R3GB 4I7YH 4MLFB 1O33A 3RXPA 1UHBB 3OTPA 4Q2KA 1O5BB 1ZHRA 1EB1H 4D9QA 1GBLA 4OS7A 1O3OA 2ZP0H 2Z3CA 3QUMP 2EQNA 2FI3E 2PLXA 1BRBE 1GJ9B 1FIWA 2ZHEH 4X1NU 2BDBA 4A92A 1OP0A 3SYJA 4GHQA 4YT6H 2Z3DA 3F2GA 3O8RA 4LZ4B 4XDEA 1QRWA 3BEUA 4D76A 1Z1JA 2JH6D 3OEHD 4TWWA 3U98H 1KXDA 1DLKB 2H9HA 3GY4A 1EPTA 1GI1A 1Z8RA 1O2HA 2WPIS 3T5FH 5DP5A 1UMAH 1FONA 4B73A 1C2EA 4J2YB 1SKYE 5F6MA 5C0UA 4CR5A 1PYTD 4ZROA 1H4WA 4FOUC 4FUEA 5EG4A 2BVXH 2J5UA 1T8NA 1W0YH 5K7RA 1NBMD 4ABDA 1ZZZA 1HJAB 1TGBA 3A81A 5EGMA 3TNTA 3A83A 5C17A 2FEQH 2P8OB 3VB6A 1DDJA 3QGNB 5IDKA 2GX4A 1A61H 2SNWA 4U01A 2VVCA 4X8VH 2ZCKP 1IQEA 2ZDNA 1JIRA 1ZPCA 3KL6A 3UWJH 2A7HA 2W7UA 1S5SA 4AB9A 2FYRA 2GCTC 1TFXA 3KYFA 2WPKS 4WF8A 1P2IA 4NSVA 1S6FA 2P3UB 2ZQ1A 4O03A 2QN5T 3EGKH 1Y59T 5E2PA 1ZMLA 2Y82A 1IQIA 1HXFH 1TYNA 1SR5C 1KYNA 3N99A 1NT1A 4WMEA 1P03A 3QTVH 1NBME 3RMMH 1FY5A 2TBSA 4FU9A 5LGOA 1YPEH 1ZTLA 1FPCH 2A31A 2WPDD 3ATKA 1UTMA 3A88A 1GBJA 3E0PB 4AYYB 2OC8A 7GCHF 1O36A 1MMJN 1W8BH 3QN7A 4FUFA 4IW4E 3V13A 1QRXA 2GZ9A 3LT3A 2XWBI 4BAQB 2GZ8A 3WWFA 3TIUA 2Z3EA 1EJMA 4FU8A 4XBDA 3SU4A 3AVZA 3SV9A 3KF2A 4Y8YA 3MU4A 3MNXA 4B2BA 1H9IE 1L1NA 2ZGHA 3SNBA 1MQ6A 2PW8H 2QXIA 2B9LA 1COWD 1E37B 1HAYB 2XWAA 2BD4A 5K0HA 2CF9H 2HGTH 1C2IA 1ZR0A 1FJSA 3HK6B 3HK3B 1DY8A 1TNJA 3ZZ4A 2F9NA 2PP6A 2HALA 1EAWA 3LKWA 1CT4E 3H7OA 3GCNA 4GSOA 2BY7X 4YESB 2KCPA 2BVSH 1O5AB 1JWTA 4Y10E 3GY3A 2FODA 1U6QA 1UCYE 1E79D 3RXCA 2PHBA 1ZOMA 4ISLA 4WMFA 1AZ8A 1NRNH 4SGAE 3UQOA 1GJ4H 1EFRD 1TNKA 4XOJA 5EW2H 1C5YB 5EODA 4Q7YA 1OP8A 2VWMA 4CRCA 3SN8A 5L30H 2XCFA 3ATIA 5HKKD 1GMHG 4MDSA 1GHAG 1XUIA 2ZGCA 1YLNA 3BTKE 3PMBB 3FANA 3OX7U 1Z6EA 2PUQH 4Y6DA 1O3EA 9ESTA 1HAHH 2W3KA 5CHAB 1W12U 5HIZA 3RXTA 1YPJH 3CP7A 2BX4A 4MTBA 1UTPA 3U8RH 1TGSZ 3FFGA 2LP6A 3FZDA 4YO9A 1T8LA 1YYY1 1V2LT 3PTBA 2NWNA 1VKYA 3A8CA 3PLPA 2AGEX 2ZGJA 1YPLH 2SGDE 1VZQH 3DSGA 1AB9B 2IJOB 2KZ4A 4Y7BA 1HGTH 1O37A 1QB9A 1DUEA 5E8EH 1Y8TA 3MU8A 2FIRH 1LTOA 3VPKA 1A46H 1NY22 2PWXA 1UVSH 4AGJA 5A09A 1E36B 2STAE 4WXVA 5C0TA 2BY6X 2WUCA 4Y8ZA 2V3MA 4H42U 1YY3A 1H8ED 1C9TA 1Z8GA 1Y3UA 1Z71A 2KFWA 1VGCC 2BDCA 1GBCA 1O3HA 1C5NH 2OXSA 4DY7B 4WJG2 3ZZ8A 1XUFA 3IITA 4Z1MD 4I8JA 4AN7A 5I25A 2ZFFH 1O2PA 2QYIA 4LOYH 1KLTA 2ZECA 1DSUA 2ZU5A 4XE4A 2F83A 1TRNA 2G52A 2L6OA 4F4OC 4JK6A 1GDNA 3VXEH 4LK4A 1O2WA 1O2YA 2Z9JA 2HLCA 3RXMA 4X2YA 3N7OA 2M2AA 3U1IB 1QL7A 2ZTZA 3G01A 3ZVDA 1LPZB 5EIYA 1PPCE 2WYJA 1OWKA 1MD7A 3ODFA 3GDSA 2W5EA 1BMAA 8ESTE 4FUGA 1O3IA 1ANDA 2ALPA 4YOJA 1OOKB 3NKKA 1YCPM 1NFUA 4QT8C 1EUFA 5DGJA 3Q77A 3QZQA 2WINI 1UK3A 2AIQA 1HAVA 2PTCE 4ESTE 2P93A 4MVNA 4KP0A 2J95A 3TH2H 3BEIB 5E2OA 1HAVB 1NFWA 1P09A 2SGAA 2G8TA 1W2KH 2FDAA 2VGCB 2GZ7A 3FZZA 3UB0A 1C5UA 4IC5A 1QQ4A 1NRRH 3PO1C 4INLA 1TPPA 3F1SB 2Z9GA 3E90B 3QGJA 3BV9B 4BAOB 2G5NA 1NPMA 1O3JA 3MOCA 3TJUA 1K1JA 1SB1H 1TNHA 4AFZA 1O5GH 5GCHF 2OLGA 2BD9A 1O3LA 3AAUA 1XUKA 5DJ7A 1A0HB 4K1SA 1ZSLA 3T2NA 2AMPA 1UVTH 2FMJA 2CF8H 4ISNA 4B75A 2TPIZ 1MKWH 1OS8A 1TRMA 1XKBC 3ITIA 1QCPA 4NZQA 4SGBE 3LGYA 1AHTH 1O3PB 3FOAA 4Y76A 1ETSH 2PKAB 1GBDA 1TPAE 2F9BH 2PSXA 1T7CA 3TITA 2OK5A 1GG6B 5LPFA 2YMSB 1DUAA 3RDZA 3M5OA 1H8IH 1C4V2 3GCHC 1BMMH 1ELFA 2QF3A 2OC1A 1N6YA 3EE7A 2LNCA 1OX1A 1SGRE 3PV2A 2XBWA 2V35A 3MO6A 1C2KA 1YC0A 3MO3A 4FVBA 3RM0H 2Y5FA 1QJ7B 3F0OA 1OXGA 2BD7A 2ESTE 2EI6A 1G3BA 1GHYH 1GBMA 1GCDA 3KQEA 1H9HE 1XUJA 2ODQA 2ANWA 1W0ZU 2C4FH 3MMGA 4UFEH 4FUCA 4HG6A 1BHXF 4IC6A 1NRSH 4B71A 1T8MA 2PUXB 2JETB 3SUGA 1SLWB 1Y5AT 1O2KA 2KCYA 1SOZA 1TE0A 1GGDC 3MH5A 3PWBA 3EE0B 1DY9A 5C1YA 1SQTA 2F9VA 3KQCA 1P57B 2BX3A 3RC4A 2EEKA 1BRUP 1IHSH 1AUJA 1UTJA 1P9UA 2M5TA 2ZDKA 3M35A 4ZCNA 1PYTC 1C2DA 1VCPA 1QRZA 1CU1A 3STJA 1DOJA 1S0QA 1MTNB 1J8AA 4ABEA 1O2NA 5EPNA 1NTPA 1P11E 3TJOA 1MU8B 1NN6A 5IYTA 3RXDA 1YP9A 2FP7B 3UNSA 2CHAB 1ZTJA 1GI0A 1ELEE 1C1VH 2Z9LA 1D6WA 4FUHA 3EA7A 1CVWH 1C1RA 3SHCH 1TX7A 3PLBA 2OC7A 3OFND 4D7GA 2P3TB 1W7XH 5HM2A 2F9PA 4JZ1A 5AHGH 3AW1A 3SHAH 1QR3E 2ANMH 3RMNH 3TNSA 1DVAH 3LGWA 8GCHG 3FP8E 1QBNA 3ZZ9A 4JZEH 2BD3A 5DSFA 1UK2A 2FS9A 2Y5HA 3DFJA 3GDVA 3BN9A 3T62A 1J14A 4AC9A 1ACBE 4X2XA 2FTLE 1SVPA 2H9TH 1VJ9U 1C4U2 1K28D 2KCAA 3E16B 3OU0A 1C5XB 1WQVH 3A7VA 4WVPE 1HIAA 3SQEE 2D8WA 2BOKA 3M7QA 5L2YH 3QK1A 1UVPA 1XXFA 1JIMA 2AEIH 1RXPA 2ANYA 2CJIA 2YNAA 3GY5A 3HPTB 4M7GA 2AS9A 1IQJA 3MNSA 1F5KU 1J9CH 4UFGH 1O2XA 2FOCA 2CK3D 3TPIZ 9LPRA 5E0HA 1LQEA 3LJJA 1CGHA 1JXPA 2BXUH 3RXJA 2R3YA 3A86A 3SUFA 1HAZB 1SMFE 4X2WA 2I6SA 3KQ5A 1CHGA 1BBRE 1LCYA 2NU2E 1TGTA 1PJPA 4JMYA 1WCZA 2IN2A 2J98B 4RI0A 1YGCH 4TSFD 2FZZA 4BAHB 2Y7XA 3MH7A 5ETXA 3PO1B 1HAPH 1JBUH 2PKSB 1DSTA 3BTGE 4A1VA 5A8YA 3QX5H 4A1XA 1FX0B 3RC6A 2ZEBA 4Y0ZE 3V7TA 1ZPBA 3OTJE 1MKXH 2JH0D 4NZLA 3M7TA 2ZNKH 3L6PA 3PV4A 1ANEA 5F8XA 1LVOA 1Y3XA 2YMSC 2W26A 4XBCA 5FPTA 1WBGB 1OWJA 2ZWLH 1F5LA 5BRRE 2P8OC 3VGCB 1BOQA 5DP4A 2ALVA 3F9EA 5C1XA 1AQ7A 3P70B 4A5TS 3HATH 4WWYA 2ZU4A 2BY5X 2SGFE 1BTWA 1MBMA 3BF6H 3UR9A 3ZZ7A 2QY0B 3DSPA 1F5RA 1O2MA 2XW9A 3A89A 3FP7E 1ZMNA 2CHAC 1CE5A 1GHXH 4K3JA 1V2PT 1HAGE 1GL1A 2QE7D 2ZPRA 4ISIH 1TAWA 3DUXH 1AD8H 3K9XB 3ZZCA 3Q00A 3H7TA 1AFQC 5EJ1A 3SNDA 3AK5A 2GT8A 4O3UA 4LZ1H 1HFDA 3UNQA 3A84A 2ODYB 3EA8A 1WU1A 4J1YA 1B7XB 2BQWB 3BIUH 4IBLH 5EQSA 1N6XA 1O5CB 2Q6GA 1TNIA 1A5IA 3GCTG 3EA9A 2ZC9H 4YOGA 5C20A 5EXNA 1V2VT 1V2QT 1L0ZA 3BG4C 3S7HB 3WY8A 1HJ9A 1YPHC 3TGJE 2F91A 1WYKA 5GDSH 3NWUA 3SUEA 4FUIA 4DT7B 1GI8B 2SGEE 3OE7D 3HKIB 1ZTKA 4ZHMU 2ZF0H 4JZFH 6CHAC 1EP6A 3A87A 1ANCA 2R9PA 5F8ZA 1ZRBA 1LKAA 2FLRH 3U8TH 4AFUA 5L2ZH 2BMGB 1SGFG 3L3TA 1W0JD 3PRDA 1RTLA 3SGBE 3MH4A 4DVAU 1KSNA 1V2MT 4DGJA 1P04A 2ZFSA 4AB8A 4OS6A 1DX5M 4FUDA 4F55A 4BTIB 1EXFA 1CT0E 3SZEA 7GCHG 3PRBA 1QJ6B 4YTAA 3SV8A 1K1MA 3SZNA 1NESE 4B76A 1GJ8B 3BTEE 2CN0H 5JB8S 5EXLA 1AFQB 3F2HA 1TGCA 1KDQA 2AMQA 2HPQH 4XSKU 2NU3E 5EJZA 1MCVA 2ANKH 2VIOA 4ZXXH 4B74A 1CGJE 1GDUA 1C2JA 1ELBA 1GBIA 5AFZH 1UTLM 1KTTB 4UD9H 2WPJS 2FOFA 1BRCE 1C9PA 1VITF 2P94A 4FU7A 4TWYA 1ZHMA 1AGJA 4X6PA 1TA2A 1K9OE 2K1QA 3A85A 4IGDA 1S82A 3C1KA 2HNTC 2XNDD 3SO3A 3LGVA 3UWIA 6ESTA 1G3CA 2GMTB 2XYAA 4CRFA 2ZHWH 3BTQE 2BY9X 2QF5A 1ESBA 3PYHA 2HNTE 1SQRA 1PQ5A 1BCUH 1ZLRA 2AGIX 5EXMA 4ZH8A 2ZHQH 1ELCA 2EI8A 3WWBA 1A3EH 1CBWC 3E6PH 2JJ2D 1K1NA 1ELAA 3AAVA 1E35B 4GCHG 1B5GH 4YT7H 4ZHLU 1QA7A 5EQQA 1DWCH 2D2DA 3KCGH 2W7SA 3UNRA 4VGCB 1IQGA 1QIXB 1SGNE 2GTBA 2OP9A 4I8GA 3ZV8A 1TMTH 1TONA 1OKXA 3MU5A 1O31A 4CRBA 1A4WH 3STIA 1OWIA 1FY8E 1O3DA 2KR7A 3D65E 2V6NA 3LH1A 3MH6A 1TB6H 5HIYA 3VB3A 2PR3A 4BTTB 2XC5A 1AVGH 1UTQA 4A1TA 1GHVH 3T26A 4KGAA 2RG3A 5DP3A 3D49H 1BMFD 3A7XA 1O2TA 1OWDA 1EATA 1BBRK 4IN1A 4NGAH 5JYIA 5AVDA 3GISB 3WW7A 4ABHA 1ELGA 4X2VA 1OYQA 1WXRA 1KXEA 1YPMH 4UEHH 2ZDAH 2SGPE 3PB1E 1THRH 4AORA 1C1SA 4BXWA 5C3NA 2JIZD 3A80A 1UTOA 3ZVAA 4AX9H 4P02A 1QB1A 1CBWB 1TPOA 1D9IA 1L1GA 3KGPA 2Z9IA 2QF4A 4YOIA 3TJNA 3SQHE 2HNTF 3QTOH 4FXGH 4AZ2B 4B6EA 1G3DA 1HJAC 1P12E 1BIOA 1O3MA 1O2QA 1A0JA 2P16A 2P95A 4K5ZA 3ZV9A 2HVYB 5F8TA 2J34A 1GJ5H 1PQ7A 3F2FA 1E38B 1AY6H 2GD4B 3O8CA 2G51A 2ZTYA 1P10A 2FOMB 2LPRA 2ZI2H 1C5VA 1F0RA 1GI3A 1Z1IA 1GBAA 3SGAE 2ZCLP 1F0TA 1UVUH 1GMDF 3ZYEA 1MKXK 1QY6A 4HZHA 3SU0A 1FLEE 4TT3D 1G2MA 2ZA5A 2O8UA 3ZVBA 1D4PB 1INCA 5A8ZA 4Q63A 2W6ID 2ZZUH 4GCHF 3SJOA 5AFYH 1P2KA 4U30A 3TGKE 3LOXA 1YWUA 3CS0A 1Z8IB 3UTUH 1GJ7B 4Y79A 2ZDMA 3MQKC 3S0NA 3TH4H 4B6FA 1AKSA 2PV9B 3QO6A 4ABAA 4K69A 1MTWA 1V2KT 1C1NA 1AO5A 1JMOH 1SFIA 5E0JA 1QL9A 1ETTH 4BNRA 3P8GA 1S6HA 1W11U 3D62A 3RUOA 1C1MA 3ZZAA 5DPAA 4O97A 1O2GH 2BOHB 1CO7E 2VVVA 3FO8D 1BJVA 3GY8A 3VEQB 2D1JA 1S6LA 1EASA 4NWKA 1F7ZA 4A6LA 2ODPA 3A7TA 1EJAA 1V2ST 2JJ1D 4RSPA 3CENA 6GCHF 1GCTC 4WH6A 3FKSD 3RXGA 1GBEA 4VGCC 3ODDA 3SJKA 2QXHA 2A2XH 4B1TA 2FYQA 2BDGA 3OY6U 1P06A 1GMDG 2RCEA 3T27A 5CHBA 4NG9H 1DWBH 4CHAB 2A0QB 1EPTC 4X6OA 3RU4D 1NM6A 4CREA 5GPIB 4D8NA 3P8NA 2BXTH 2UWLA 1MZDA 4Y11E 4ZUHA 3BTDE 3MWIU 1JRTA 5PTPA 2A1DB 2XC4A 3FN8A 4YM9A 2QV1A 4JZIA 1V2JT 2KAIB 1SLVB 3BTME 1L1JA 2A4GA 1F2SE 4MPUA 3ZVGA 1CQQA 1SGTA 2C90B 2KAIA 1C5RA 1GHZA 2OBOA 3M61U 8KME2 2ULLA 1GJ6A 1OYTH 4DCDA 2BVRH 3GCOA 1ESTA 1ARCA 1ARBA 4RT0A 1HUTH 2XOKD 2WPLS 1FN8A 2Q6DA 5LPEA 1TIOA 3EDXB 4AYVB 3SU2A 1LPGB 1TQ0B 1H8HD 1A0LA 5ABWA 1O2LA 2EI7A 1IQKA 3LONA 3PTNA 1S83A 3F9GA 4Z6AH 1UCYK 5KGOA 4ZKOU 2HRVA 3RXVA 2XNIA 2Q1JA 3DT0H 1XVOA 1C5LH 4TPYA 4Q4LA 3SI3H 3ZYDA 3O8DA 3C27B 5HM9A 1W0KD 2ZU1A 2RDLA 2R2MB 3I77A 4KTCA 4X8SH 3ZVFA 2ZIQH 3A7ZA 1VCQA 1FMGA 1TMBH 1G9IE 2WUBA 2I6QA 1GHBG 1OHHD 5FX6A 1EZUC 1O2RA 2F43B 5DP9A 2AIPA 3U28C 3BTWE 1GBTA 1B0EA 1CGIE 1PPBH 1DS2E 2G00A 3DCLA 3UPEA 3A8DA 5TCAA 1BTZA 5SGAE 1O5DH 1WTGH 3F3BA 2WPHS 2KX4A 1YCPH 3M5NA 4K1EA 3ZVCA 1AMHA 1Q31A 2G81E 3K6YA 4JK5A 5HXFA 5CHAC 1ID5H 1IQNA 2VIVA 4ISHH 4XD7D 1K1IA 1O5EH 1YLDA 5EU8A 1W14U 2JDID 3MNCA 1W13U 1WAYB 5DP6A 2YMSD 3LH3A 2H1UA 1FY4A 2IJD1 3SU5A 2O8TA 1ELVA 1RTFB 1TX8A 2W3IA 3IG6B 2AHME 1SGDE 2QXGA 1UTKA 3Q3YA 1Z7KA 2ZGBH 1K0HA 3SV7A 2G4UA 1RIWC 1O2OA 5FL7D 4RKJB 2BY8X 2XBVA 1BTUA 3DHKH 5FAHA 4D7FA 3PROA 1IQLA 1P2OA 2GCHG 1JOUB 3RM2H 1C2MA 2OQ5A 2TIOA 2WV4A 4KELA 2F9OA 4GPGA 1C5ZB 5FPSA 3FP6E 5B6LA 1O38A 2OC0A 1EPTB 4MG3A 1O3GA 1P2MA 1TGNA 4X8UH 4MPVA 1AN1E 2BB4A 3CS7A 1AI8H 1AE8H 1QB6A 3OYPA 3PMAB 1A1RA 1PQAA 4OGXA 3HGPA 2BLQA 3RXFA 1O3CA 3F0PA 2FESH 3A7YA 1Z6JH 2YNBA 3TH3H 2J94A 2Y80A 3AW0A 1NS3A 4H6TA 2A45B 2F4LA 3QWCH 2AGGX 5T6FA 4E7RG 3RXKA 2GKVE 1OSSA 1S85A 1SGFA 2ZFTA 2B7DH 5L6NH 2ZU3A 4KKDA 2PGQB 4NIWA 1O34A 1PFXC 1F0UA 4HGCA 2BDHA 1LMWB 2BLVA 1W10U 1BB0B 2OTVA 4AFSA 2JKHA 1ETRH 1AB9C 1O0DH 2ZQ2A 3F6UH 3PV5A 1A2CH 3GICB 1G3EA 2AH4X 1K1PA 3MU1A 2V3OH 1BA8B 1EX3A 5T1VA 2GP9B 1BQYA 3UOPA 1GMCG 1RGQA 1SBWA 2Y6TA 4ABIA 1D3PB 3M5LA 1EAXA 2Y81A 1Q2WA 4KTUA 4ASUD 2G5VA 4IN2A 1RFNA 1X7AC 4AG1A 4K8YA 2F3CE 3ENSB 5JBCS 1C1OA 1EJNA 3B9FH 1N8OC 4ACBA 2BD5A 1BT7A 1J15A 1P2JA 2LELA 2THFB 2C8XB 3S69A 2GDEH 3T29A 3SJ8A 2B0FA 2A5AA 3RLYH 4YXWD 3E8LA 1RJXB 3LC3A 2VBCA 5KECA 1THSH 1TWXB 1V3XA 1C2FA 1NZQH 3OAAD 1HB0B 3LC5A 4X1PU 3GOVB 3BTFE 4R8TB 1GJAB 3RP2A 1E0FD 1SGIB 2J4IA 2FOAA 4ACAA 2W6JD 2DUCA 1S0RA 1GI7B 1P2QA 2VH6A 1EP5A 4ZXYH 3DA9B 4NFFA 3UIRA 1WTHD 1AUTC 4Y0YE 5DG6A 3BG8A 2AFQB 2A32A 3T28A 2EY4C 4O3TA 4GUXA 1V2UT 1O2VA 1SGQE 4E06H 4X6NA 4GLYA 4JYTA 5DN6D 1GCTB 3KHVA 3BTHE 3AASA 4NIYA 3SV6A 1GDQA 1SI5H 4WH8A 3Q3KA 3N7EA 3OEED 1AWHB 4PROA 5HGGA 4FETA 1FI8A 3HKJB 2A7JA 4K8BA 4NIXA 1ZSJA 5FCRA 4NWLA 1UCYH 5ESBA 2GT7A 1BMNH 2VGCC 2Y7ZA 5EOKA 5FHTA 1W3CA 2FOBA 1SGCA 1BRAA 2WZQA 1TA6A 1CA8B 4ASHA 3S7KB 3TGIE 1NROH 4RN6A 1GGDB 1MUEB 5A8XA 1PPGE 2FM2A 2GV7A 3BSQA 1EAUA 1QURH 2BHGA 1D3DB 5CMXH 1C2GA 2ZFPH 1TALA 1V2OT 1A5HA 2UWOA 2VIDA 4MNWA 3SI4H 5LPRA 1K1LA 1E1RD 3VGCC 1XMNB 2FWWA 3RLWH 2GVFA 3W94A 1ELDE 1TMUH 2FI5E 1QBVH 4P00A 4XFQA 2ZKSA 1GVKB 2CGAA 4HTCH 4UDWH 2PKAA 3Q3XA 3RXOA 5C94A 2HLDD 1WOFA 2WV9A 3H5CB 1DANH 1GI4A 2FOHA 4AG2A 1TRYA 4WMDA 2JH5D 5DP8A 5F53A 6GCHG 3NRLA 3A82A 1RIWB 3NK8A 1C1WH 3O8BA 1RRKA 2PFEA 2ZPSA 3MHWU 2XXLA 2AMDA 2V3HH 4R0IA 1YPGH 4AGKA 1Y5BT 1BMLA 2H9EH 1C5OH 4JCNA 2PGBB 1V2TT 2ZPQA 4INKA 3P8OA 4ABBA 3VB7A 1ABIH 2HPPH 1K1OA 1DXWA 1C2HA 1NU7B 4FVDA 2O8MA 3TK5A 3GS9A 4Q7XA 4E05H 2XBXA 4OS5A 1C5SA 1CT2E 3HGNA 1W7GH 2Z7FE 3RMLH 2VNTA 2BQ6B 4ISOA 1L2EA 4TYDA 2VWOA 5JB9S 1AVWA 4ABJA 1G36A 1PPHE 2HOBA 1FNIA 3F68H 3VB5A 3MTYA 1EOJA 1UW7A 1FXYA 1YKTA 3FAOA 1YF4A 3UUZA 2FTMA 4UFFH 1AIXH 3M3TA 1UTNA 1F92A 4WY3A 1ZSKA 1BTXA 3RXLA 2OD3B 8LPRA 1XVMA 2J92A 4MNXA 2BZAA 4CH8B 1MQ5A 4CRDA 1C5MD 1J17T 5JDUB 2ASUB 3GY7A 3V12A 1FPHH 1MKWK 5T3HA 3D23A 1G30B 1EKBB 1L4ZA 3F9FA 3PM3A 2ZTXA 4UE7H 3KN2A 4Q80A 3E1XB 3OY5U 4Z0KA 4X0WU 1MAXA 1KTSB 3M37A 2J2UA 1QHRB 3GYLB 3M3SA 3NZIA 2FO9A 1LDTT 1QTFA 1G2LA 1C1QA 3ATLA 5EJLA 1ABJH 1TBQH 3RXIA 2G55A 5DO4H 1K2I1 4OS1A 5F03A 5JBTA 3S9BA 4YZUA 1ZYOA 3P95A 5FCKA 4E7NA 3UFAA 1AWFH 5GWZA 2RFKC 1QFKH 2STBE 2TGTA 2VU8E 1LPKB 1ZRKA 3QDZB 1S81A 3E3TA 1A3BH 3SU1A 1ELTA 3ZZDA 2H6MA 3MYWA 1KLIH 2RDEA 2G4TA 1GBBA 1EAIA 4AOQA 1AFEH 3TU7H 2QA9E 1GBHA 3Q76A 1CSOE 5GIBA 3SORA 1O32A 4BAKB 1BBRH 3DFLA 2ZFRH 1SGYE 1C1PA 1LHFH 3S9AA 2DE8A 1SFQB 2O9QA 4O9VA 1O39A 1MBQA 1OPHB 1C5TA 3QZRA 3M36A 2AERH 4KTSA 4RT1A 3BEFB 3W1EA 1XM1A 1YBWA 3NUMA 3W95A 1C5WB 1MZAA 1JRSA 3ZVEA 1WQSA 2EA3A 2UUJB 3SNEA 1GPZA 1D3TB 1Y3WA 1KXCA 2YOLA 1SLUB 1YLCA 5BPEA 1G32B 1HBTH 1O5FH 4Q7ZA 4FUJA 3B23B 3KIDU 5FBIA 1QL8A 5T6GA 1GHAF 1AE5A 1GJBB 2QXJA 3UAIC 3B8JA 2NU1E 1C5PA 3GYMA 1EZQA 1XX9A 3H09A 1Z8JB 4DT4A 1VGCB 1HV7A 3U9AH 2J38A 1B0FA 3M3VA 5EQRA 2J97A 3M5MA 4I86A 4X1SU 1M9UA 2BLWA 1DLEA 2FX4A 3L33A 2GMTC 1PQ8A 5EPYA 1QZ8A 4MPWA 3URCA 1SQAA 3NPSA 1GI9B 2VJ1A 1LHGH 3UY9A 1PPEE 3PLKA 4NSYA 2FLBH 3RXAA 1T8OA 5DK1A 3KNXA 4X1RU 4Y71A 2F9UA 3SBKA 5FX5A 3R0FA 1O2UA 1FV9A 3RXSA 4NCYA 1P01A 2ZU2A 3GCHB 4I8HA 1MABB 5LH8A 3VXFH 2XBYA 2C8WB 1DT2A 4BOHA 2OUAA 1Y3YA 1EOLA 1T4VH 1ZMJA 1K21H 1GI6A 4ZHAA 1O30A 2CV3A 2OINA 3BIVH 2VB0A 1AU8A 1P3CA 3MNBA 3OSYA 1GBKA 3JZ2B 3GY6A 3RXRA 1KY9A 1HYLA 2RA3A 1F0SA 3PMHB 1V2WT 1LVMA 2KM0A 3S9CA 4CRAA 5J4SA 4DW2U 1WUNH 2ZFQH 2QF0A 1FDPA 1L4DA 2GJGA 1FUJA 2XTTB 4K60A 5H4IB 3GDUA 4I8KA 2A4QA 1C1TA 1DPOA 2H5CA 1KXFA 2VIPA 3P8FA 2XRCA 4OS2A 1HCGA 4OGYA 2O8WA 4HI3A 2BD8A 1O3BA 3DSOA 3PMJA 2VVUA 1O3FA 5FBEA 3U1JB 5GNDA 1HLTH 5HYOA 1C4Y2 4DJZB 1LHEH 3TK6A 1GHBF 1SSXA 1HJ8A 1QJ1B 4OS4A 4YLUA 5EW1H 6CHAB 1G37A 2TRMA 3RXBA 1Y3VA 1GL0E 1V2NT 2L74A 4ZAEA 2B5TB 1HAXB 1GMHF 2GCTB 4ZMAH 1DICA 1MU6B 1ZGIA 1IQHA 2HVXA 2XC0A 2SNVA 1A5GH 1H8DH 1MCTA 3LJOA 4GHTA 2WV5A 1BZXE 1P9SA 2KCOA 4X1QU 2BDAA 2Z94A 1OWHA 4DIHH 3ESTA 1TOCB 2PKSC 3LU9B 3TLOA 3UR6A 1QBOA 3SW2B 4DURA 1LHDH 4CH2B 3ZZBA 2JETC 1ESAA 1SGPE 3JZ1B 1N1LA 1FY3A 2P3FH 1T31A 3TJVA 3NXPA 2K8IA 4MNYA 1KXAA 3ZZ5A 1MTVA 2V7QD 3ELAH
chains in the Genus database with same CATH topology
4U32A 3A8AA 2BM2A 1TBRH 1IOEA 1AKSB 4LXBH 1BITA 1KLJH 1GI2A 3VB4A 1YM0A 2ILNA 3V0XA 1VCWA 2UUKB 3V3MA 2OCVB 3LGUA 3BG4B 1DFPA 4NFEA 4I32A 1RTKA 1RD3B 1IHTH 1VITG 3SOSA 1QNJA 1NRQH 1T32A 5JBAS 3T25A 1NFYA 2BDYA 4UONA 1WSSH 3LPRA 1VJAU 4DIIH 3LGTA 1O2JA 1NC6A 1SPJA 1O2IA 2Z9KA 1GG6C 1XUHA 4HFPB 4JYUH 1TBZH 4CHAC 3K6ZA 2C8YB 2DE9A 2C8ZB 3VFEA 1RS0A 3RC5A 1XKAC 3GY2A 1K22H 2A5KA 2R0KA 3SU3A 1QGFA 4GAWA 3ZZ6A 4DOQA 2FX6A 8GCHF 1TQ7B 5GJ4B 1C5QA 1HAIH 2ZGXH 1H1BA 5A0CA 1CHOF 1P8VC 4A7IB 5B6OA 1HPGA 2CMYA 1OWEA 1TABE 2SGQE 2QCYA 4NA9H 3ATWA 4RKOB 3DD2H 3KQDA 3NCLA 1NRPH 1P3EA 1ANBA 2O8LA 2WPMS 5C5OA 1TPSA 4CRGA 1TLDA 1EB2A 1P2NA 1YCPK 2UWPA 1GBFA 4D9RA 5GXPA 1LO6A 2SFAA 1BJUA 1Q3XA 4BXSA 1BDAA 2FPZA 3QLPH 3RXUA 3MU0A 1WV7H 2IOTA 2VWNA 4MPXA 3SJIA 4K2YA 1H9LB 2BYAX 1NO9H 2ZO3H 2J9NA 2NU4E 1S84A 1P05A 1EZSC 1SLXB 1KXBA 2BTCE 4I31A 3RU4E 3U8OH 2VH0A 2ZHDA 3E91A 2H2ZA 3URDA 4CR9A 3GCTF 1TNGA 1GHWH 2ZG0H 3U69H 2A5IA 3P17H 5A0AE 1ORFA 2A7CA 5G4BA 3E0NB 1UO6A 1GVZA 2P59A 1FN6A 3FVFB 3SV2H 2FXRA 1AZZA 4NA8A 1DWEH 1O2ZA 1VR1H 1O3AA 3UREA 2GCHF 4BTUB 4MQAA 7ESTE 2ZDLA 1IAUA 1J16A 1AVXA 1HNEE 1C2LA 3SU6A 2RA0A 4NA7A 1V2RT 4JYVH 3SJ9A 2Z6BD 1QQUA 3SNAA 1O3KA 1HDTH 1GJCB 7LPRA 4I33A 1UK4A 1XUGA 2GDDA 5J4QA 2OBQA 4B2CA 1GI5A 3RXEA 5HMAA 1NU9A 1SC8U 3P6ZB 4X6MA 1BHXB 3KEEA 4IMZA 2A2QH 3LDXH 1ZHPA 1NFXA 2Y5GA 2VIQA 5DKMA 5C1UA 5AF9H 2FS8A 2TGPZ 2C3SA 5CE1A 1LQDB 2R0LA 1HRTH 1CHOG 2R3UA 4H4FA 4WXIA 2IPHA 4IMQA 4DG4A 3UOUA 1GJDB 3K2UA 3EYDA 3K65B 2AYWA 3RXHA 4B2AA 1SG8B 5A0BA 3ZZ3A 1ZPZA 5TJXA 1SQOA 2BD2A 4I8LA 2EC9H 1UVOA 3LGIA 1E34B 2ZHFH 1MH0A 4CBOA 1GMCF 2BZ6H 2PSYA 1EZXC 2FOGA 3IWMA 5C5NA 5DP7A 2BQ7B 3MI4A 4YLQH 2A4OA 5JBBS 1T4UH 1P02A 4TY7A 2QC2A 1LVYA 2B8OH 1LHCH 3M7UA 2BDIA 1LVBA 1SHHB 1HIAB 2VWLA 1MTUA 2QAAA 1FZZA 2A4RA 4UFDH 1DWDH 2GGVB 3ATMA 4FUBA 2GV6A 1QA0A 1UHBA 1IQMA 3EQ0H 1BTYA 3SUDA 1FAKH 4U2WA 4GVUA 4H6SB 1KIGH 1SGEE 1V6DA 4TY6A 5C67A 1ZJKA 5GCHG 4IS5A 1SOTA 2PTNA 3KQBA 2FI4E 2TGAA 2VINA 3RU4T 2FOEA 2ZCHP 5C2ZA 1HXEH 3A7WA 4JZDH 1KDQB 1MD8A 1BUIA 2HWLB 1YPHE 1DXPA 4NIVA 1DITH 1IQFA 1TOMH 3F9HA 2CXVA 1Y5UT 1FY1A 4XBBA 3A8BA 5JPMH 1TX6A 3I29A 4ZKSU 1OP2A 1A7SA 1MTNC 4INHA 1MAYA 2XCNA 1ZGVA 1TNLA 1SHYA 1P0SH 3P92A 1FIZA 2UUYA 3TVJB 7KMEH 4TPIZ 4MNVA 1MTSA 1GVLA 1D3QB 1D6RA 1O35A 2V0BA 4Y8XA 3SNCA 1EQ9A 4BANB 3TK9A 5ESTE 6LPRA 1BTHH 1O2SA 3EAJA 5I46H 3LIWA 2C93B 4BAMB 2UUFB 3UQVA 2VIWA 2WYGA 5FPYA 1N8OB 1BTPA 4ZKRU 1SL3A 1DE7H 1ZJDA 1DM4B 1PPFE 5TCCA 5A2MH 4ABFA 5FXLA 2QIQA 1HAOH 2NU0E 4Y7AA 1YPKH 1FAXA 1FQ3A 2QGRA 1VITH 1XXDA 1GWAA 2Q6FA 5E0GA 2H5DA 3RMOH 1LKBA 2R2WU 2ZDVH 1CA0B 3MO9A 3SGQE 5T6DA 4ZKNU 2TGDA 4AFQA 1O3NA 1PPZA 1CA0C 1THPB 1UJ1A 2D26C 3I78A 4THNH 4X8TH 3MFJA 2BLOA 4ABGA 2OQUA 3PWCA 1C1UH 3BTTE 3RXQA 4CBNA 4K1TA 3R3GB 4I7YH 4MLFB 1O33A 3RXPA 1UHBB 4Q2KA 1O5BB 1ZHRA 1EB1H 4D9QA 1GBLA 4OS7A 1O3OA 2ZP0H 2Z3CA 3QUMP 2FI3E 2PLXA 1BRBE 1GJ9B 1FIWA 2ZHEH 4X1NU 2BDBA 4A92A 1OP0A 4GHQA 4YT6H 2Z3DA 3O8RA 4LZ4B 4XDEA 1QRWA 3BEUA 4D76A 1Z1JA 2JH6D 4TWWA 3U98H 1KXDA 1DLKB 2H9HA 3GY4A 1EPTA 1GI1A 1Z8RA 1O2HA 2WPIS 3T5FH 5DP5A 1UMAH 1FONA 4B73A 1C2EA 4J2YB 5F6MA 4CR5A 1PYTD 4ZROA 1H4WA 4FUEA 5EG4A 2BVXH 1T8NA 1W0YH 5K7RA 4ABDA 1ZZZA 1HJAB 1TGBA 3A81A 5EGMA 3TNTA 3A83A 2FEQH 2P8OB 3VB6A 1DDJA 3QGNB 5IDKA 2GX4A 1A61H 2SNWA 4U01A 2VVCA 4X8VH 2ZCKP 1IQEA 2ZDNA 1JIRA 1ZPCA 3KL6A 3UWJH 2A7HA 2W7UA 1S5SA 4AB9A 2FYRA 2GCTC 1TFXA 2WPKS 4WF8A 1P2IA 4NSVA 1S6FA 2P3UB 2ZQ1A 4O03A 2QN5T 3EGKH 1Y59T 5E2PA 1ZMLA 2Y82A 1IQIA 1HXFH 1TYNA 1SR5C 1KYNA 1NT1A 4WMEA 1P03A 3QTVH 3RMMH 1FY5A 2TBSA 4FU9A 5LGOA 1YPEH 1ZTLA 1FPCH 2A31A 3ATKA 1UTMA 3A88A 1GBJA 3E0PB 4AYYB 2OC8A 7GCHF 1O36A 1MMJN 1W8BH 3QN7A 4FUFA 4IW4E 3V13A 1QRXA 2GZ9A 3LT3A 2XWBI 4BAQB 2GZ8A 3TIUA 2Z3EA 1EJMA 4FU8A 4XBDA 3SU4A 3AVZA 3SV9A 3KF2A 4Y8YA 3MU4A 3MNXA 4B2BA 1H9IE 1L1NA 2ZGHA 3SNBA 1MQ6A 2PW8H 2QXIA 2B9LA 1E37B 1HAYB 2XWAA 2BD4A 5K0HA 2CF9H 2HGTH 1C2IA 1ZR0A 1FJSA 3HK6B 3HK3B 1DY8A 1TNJA 3ZZ4A 2F9NA 2HALA 1EAWA 3LKWA 1CT4E 3H7OA 3GCNA 4GSOA 2BY7X 4YESB 2BVSH 1O5AB 1JWTA 4Y10E 3GY3A 2FODA 1U6QA 1UCYE 3RXCA 2PHBA 1ZOMA 4ISLA 4WMFA 1AZ8A 1NRNH 4SGAE 3UQOA 1GJ4H 1TNKA 4XOJA 5EW2H 1C5YB 5EODA 4Q7YA 1OP8A 2VWMA 4CRCA 3SN8A 5L30H 2XCFA 3ATIA 1GMHG 4MDSA 1GHAG 1XUIA 2ZGCA 3BTKE 3PMBB 3FANA 3OX7U 1Z6EA 2PUQH 4Y6DA 1O3EA 9ESTA 1HAHH 2W3KA 5CHAB 1W12U 3RXTA 1YPJH 3CP7A 2BX4A 4MTBA 1UTPA 3U8RH 1TGSZ 3FFGA 3FZDA 4YO9A 1T8LA 1YYY1 1V2LT 3PTBA 2NWNA 3A8CA 3PLPA 2AGEX 2ZGJA 1YPLH 2SGDE 1VZQH 4Y7BA 1AB9B 2IJOB 1HGTH 1O37A 1QB9A 1DUEA 5E8EH 1Y8TA 3MU8A 2FIRH 1LTOA 3VPKA 1A46H 1NY22 2PWXA 1UVSH 4AGJA 5A09A 1E36B 2STAE 4WXVA 2BY6X 2WUCA 4Y8ZA 4H42U 1C9TA 1Z8GA 1Y3UA 1Z71A 1VGCC 2BDCA 1GBCA 1O3HA 1C5NH 2OXSA 4DY7B 4WJG2 3ZZ8A 1XUFA 3IITA 4I8JA 4AN7A 5I25A 2ZFFH 1O2PA 2QYIA 4LOYH 1KLTA 2ZECA 1DSUA 2ZU5A 4XE4A 2F83A 1TRNA 2G52A 4F4OC 4JK6A 1GDNA 3VXEH 4LK4A 1O2WA 1O2YA 2Z9JA 2HLCA 3RXMA 4X2YA 3N7OA 3U1IB 1QL7A 2ZTZA 3G01A 3ZVDA 1LPZB 1PPCE 2WYJA 1OWKA 1MD7A 3ODFA 3GDSA 2W5EA 1BMAA 8ESTE 4FUGA 1O3IA 1ANDA 2ALPA 4YOJA 1OOKB 3NKKA 1YCPM 1NFUA 4QT8C 1EUFA 5DGJA 3Q77A 3QZQA 2WINI 1UK3A 2AIQA 1HAVA 2PTCE 4ESTE 2P93A 4MVNA 4KP0A 2J95A 3TH2H 3BEIB 5E2OA 1HAVB 1NFWA 1P09A 2SGAA 2G8TA 1W2KH 2FDAA 2VGCB 2GZ7A 3FZZA 1C5UA 4IC5A 1QQ4A 1NRRH 3PO1C 4INLA 1TPPA 3F1SB 2Z9GA 3E90B 3QGJA 3BV9B 4BAOB 2G5NA 1NPMA 1O3JA 3MOCA 3TJUA 1K1JA 1SB1H 1TNHA 4AFZA 1O5GH 5GCHF 2OLGA 2BD9A 1O3LA 3AAUA 1XUKA 5DJ7A 1A0HB 4K1SA 1ZSLA 3T2NA 2AMPA 1UVTH 2FMJA 2CF8H 4ISNA 4B75A 2TPIZ 1MKWH 1OS8A 1TRMA 1XKBC 3ITIA 1QCPA 4NZQA 4SGBE 3LGYA 1AHTH 1O3PB 4Y76A 1ETSH 2PKAB 1GBDA 1TPAE 2F9BH 2PSXA 1T7CA 3TITA 1GG6B 5LPFA 1DUAA 3RDZA 3M5OA 1H8IH 1C4V2 3GCHC 1BMMH 1ELFA 2QF3A 2OC1A 1N6YA 2LNCA 1OX1A 1SGRE 2XBWA 2V35A 3MO6A 1C2KA 1YC0A 3MO3A 4FVBA 3RM0H 2Y5FA 1QJ7B 1OXGA 2BD7A 2ESTE 2EI6A 1G3BA 1GHYH 1GBMA 1GCDA 3KQEA 1H9HE 1XUJA 2ANWA 2ODQA 1W0ZU 2C4FH 3MMGA 4UFEH 4FUCA 1BHXF 4IC6A 1NRSH 4B71A 1T8MA 2PUXB 2JETB 3SUGA 1SLWB 1Y5AT 1O2KA 1SOZA 1TE0A 1GGDC 3MH5A 3PWBA 3EE0B 1DY9A 5C1YA 1SQTA 2F9VA 3KQCA 1P57B 2BX3A 3RC4A 2EEKA 1BRUP 1IHSH 1AUJA 1UTJA 1P9UA 2M5TA 2ZDKA 3M35A 1PYTC 1C2DA 1VCPA 1QRZA 1CU1A 3STJA 1DOJA 1S0QA 1MTNB 1J8AA 4ABEA 1O2NA 5EPNA 1NTPA 1P11E 3TJOA 1MU8B 1NN6A 5IYTA 3RXDA 1YP9A 2FP7B 3UNSA 2CHAB 1ZTJA 1GI0A 1ELEE 1C1VH 2Z9LA 1D6WA 4FUHA 3EA7A 1CVWH 1C1RA 3SHCH 1TX7A 3PLBA 2OC7A 4D7GA 2P3TB 1W7XH 5HM2A 2F9PA 4JZ1A 5AHGH 3AW1A 3SHAH 1QR3E 2ANMH 3RMNH 3TNSA 1DVAH 3LGWA 8GCHG 3FP8E 1QBNA 3ZZ9A 4JZEH 2BD3A 1UK2A 2FS9A 2Y5HA 3DFJA 3GDVA 3BN9A 3T62A 1J14A 1ACBE 4X2XA 2FTLE 1SVPA 2H9TH 1VJ9U 1C4U2 1K28D 3E16B 3OU0A 1C5XB 1WQVH 3A7VA 4WVPE 1HIAA 3SQEE 2D8WA 2BOKA 3M7QA 5L2YH 3QK1A 1UVPA 1XXFA 1JIMA 2AEIH 1RXPA 2ANYA 2CJIA 2YNAA 3GY5A 3HPTB 4M7GA 2AS9A 1IQJA 3MNSA 1F5KU 1J9CH 4UFGH 1O2XA 2FOCA 3TPIZ 9LPRA 5E0HA 1LQEA 3LJJA 1CGHA 1JXPA 2BXUH 3RXJA 2R3YA 3A86A 3SUFA 1HAZB 1SMFE 4X2WA 2I6SA 1CHGA 1BBRE 1LCYA 2NU2E 1TGTA 1PJPA 4JMYA 1WCZA 2IN2A 1YGCH 2FZZA 4BAHB 2Y7XA 3MH7A 5ETXA 3PO1B 1HAPH 1JBUH 2PKSB 1DSTA 3BTGE 4A1VA 5A8YA 3QX5H 4A1XA 3RC6A 2ZEBA 4Y0ZE 3V7TA 1ZPBA 3OTJE 1MKXH 2JH0D 4NZLA 3M7TA 2ZNKH 3L6PA 3PV4A 1ANEA 5F8XA 1LVOA 1Y3XA 2W26A 4XBCA 5FPTA 1WBGB 1OWJA 2ZWLH 1F5LA 5BRRE 2P8OC 3VGCB 1BOQA 5DP4A 2ALVA 3F9EA 5C1XA 1AQ7A 3P70B 4A5TS 3HATH 4WWYA 2ZU4A 2BY5X 2SGFE 1BTWA 1MBMA 3BF6H 3UR9A 3ZZ7A 2QY0B 2XW9A 1F5RA 1O2MA 3A89A 3FP7E 1ZMNA 2CHAC 1CE5A 1GHXH 4K3JA 1V2PT 1HAGE 1GL1A 2ZPRA 4ISIH 1TAWA 3DUXH 1AD8H 3K9XB 3ZZCA 3Q00A 3H7TA 1AFQC 3SNDA 2GT8A 4O3UA 4LZ1H 1HFDA 3UNQA 3A84A 2ODYB 3EA8A 1WU1A 4J1YA 1B7XB 2BQWB 3BIUH 4IBLH 5EQSA 1N6XA 1O5CB 2Q6GA 1TNIA 1A5IA 3GCTG 3EA9A 2ZC9H 4YOGA 5C20A 5EXNA 1V2VT 1V2QT 1L0ZA 3BG4C 3S7HB 3WY8A 1HJ9A 1YPHC 3TGJE 2F91A 1WYKA 5GDSH 3NWUA 3SUEA 4FUIA 4DT7B 1GI8B 2SGEE 3HKIB 1ZTKA 4ZHMU 2ZF0H 4JZFH 6CHAC 1EP6A 3A87A 1ANCA 2R9PA 5F8ZA 1ZRBA 1LKAA 2FLRH