2BB4A

Porcine pancreatic elastase complexed with beta-casomorphin-7 and asp-phe at ph 5.0
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-casomorphin-7
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bb4A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bb4A01
3SNDA 2ZU4A 2ZFPH 1MCTA 5DP8A 1MTUA 1C4U2 1C1TA 3SNBA 4WXIA 4KTUA 1NM6A 1NTPA 2P59A 5C2ZA 1KLTA 2VNTA 5HM9A 1AWFH 3M37A 1FDPA 5F8TA 4XFQA 1FIWA 4ABBA 1UHBA 3PV4A 4X2VA 5DK1A 4YOJA 3HKJB 3TGJE 3UOUA 4NCYA 5K7RA 2FPZA 1ANEA 1KLIH 2XBWA 1UO6A 1P2IA 1O3OA 1QA7A 4MNVA 3V7TA 3S69A 1HUTH 4ZHAA 2ZFQH 1XVOA 3SQHE 3U1JB 3EAJA 2ZKSA 4TWWA 4CRCA 1XUKA 1JBUH 3Q3YA 4KTCA 4BANB 4IMQA 4GHQA 1GG6C 1JOUB 2TGTA 3LGVA 4OS7A 4K5ZA 1F0TA 3Q00A 1CGJE 1LO6A 5E2PA 2EI8A 2J2UA 4INLA 1SGFG 3SBKA 1YPEH 1QQUA 2ZDKA 5FCRA 2H5DA 1O2GH 4YM9A 1GJBB 4IW4E 2ZGCA 1P9UA 1ZZZA 2FI4E 1W7XH 3LJJA 1ZHMA 3LU9B 4R0IA 3SORA 1W0YH 4U2WA 4B2AA 3GISB 2YNBA 4WH6A 1D3PB 4TYDA 5A0AE 1UVUH 4INHA 2PKAA 1P9SA 1T32A 1B5GH 2HLCA 4I8GA 3S7KB 4ABFA 4LZ1H 1DWCH 3FP6E 1IQEA 3RXLA 1B7XB 1O2NA 3O8CA 4MPXA 1GBFA 2VWLA 3ZYEA 5A8YA 4Y8ZA 1GL1A 1Y5AT 1ESTA 1V2UT 4U01A 4IS5A 1FY5A 4ABDA 2P16A 1AB9C 1GBEA 1GJ7B 4ISLA 2BD3A 1MTVA 1SGFA 3K6ZA 4NA8A 1HAXB 3PROA 1C2LA 1OWEA 2A2QH 2GVFA 4ZHLU 2ZTZA 1LQDB 1P8VC 1ZRBA 1IQHA 2BD8A 3STJA 5I25A 5IYTA 3RXCA 4E06H 3R3GB 1GJ6A 2FS9A 1W8BH 3VGCB 1XUGA 2ZU2A 2ALVA 1EOJA 1P05A 1AWHB 2A4RA 3KEEA 3BTTE 1SGYE 5EXLA 2UUFB 5LPRA 1MZDA 1O34A 3SQEE 3RXSA 2SFAA 4WY3A 5HGGA 1XMNB 2QCYA 1SC8U 1C5TA 5T6FA 1Z8JB 1MKWH 4NA7A 1RFNA 2SGFE 4CREA 1GL0E 4MVNA 4BTTB 1ZRKA 1F5LA 2Z9KA 3OX7U 1MTNB 5DP3A 1AFEH 2VIQA 4HZHA 4NIYA 2PV9B 3BEIB 4YT7H 2QXJA 4XE4A 3VB4A 2XNIA 2PFEA 1HLTH 3PLPA 3E0NB 1PPFE 7LPRA 3F9GA 5C1XA 3E6PH 1IQFA 4F4OC 8GCHG 3MHWU 2V35A 1C5LH 4Y71A 5DP7A 1HYLA 1O3JA 4XBCA 1C5WB 2OP9A 1FI8A 1TNHA 3E1XB 3T25A 1L4ZA 1EPTA 4X1SU 3U8RH 2GCTC 1TABE 1BRBE 1K2I1 3ATWA 2FOCA 1SGNE 2G5NA 3TIUA 1K1LA 1P04A 2G5VA 2ZFRH 4FU9A 3RMMH 1OWDA 1UCYE 1WQSA 3L3TA 3AW0A 1OYTH 2IOTA 4ABIA 1BDAA 2XYAA 2BQ7B 1ELEE 4LZ4B 1AKSA 4Y8XA 1C1OA 1TGNA 4B74A 3CS0A 3ITIA 3UPEA 3VEQB 1H9IE 1NY22 3RDZA 2AGEX 5FXLA 1AI8H 2R3UA 2SNVA 3OY5U 1ELAA 2ZDAH 1S82A 1S6FA 1O30A 1TOCB 1IQJA 1ZTKA 2FO9A 1NRRH 1C1NA 2ZQ1A 5E0JA 1O2VA 1P10A 4UFDH 3VXFH 1ABIH 3RMNH 1P2QA 2PR3A 2GT8A 4YLUA 1BITA 2AGIX 1MBMA 1TYNA 4KKDA 5HXFA 4WMDA 1W3CA 5E2OA 5J4QA 2D1JA 2AMQA 4D7GA 2GV7A 2HNTE 4O9VA 2UUYA 2BDHA 4GAWA 3C1KA 1LQEA 3W94A 2Q6DA 5HYOA 1A61H 1ZPZA 4AOQA 1T4UH 4XBBA 1DWEH 2GMTC 1MAYA 2J38A 1Y5UT 4CHAC 5FCKA 1ZSKA 4TY7A 5DP5A 3PWCA 1H9LB 4ZHMU 3Q3KA 2JETC 3EYDA 6LPRA 3EA9A 2PSYA 1UVSH 2FTMA 5EPNA 2FOBA 1N1LA 3RC5A 3FP8E 4H6SB 4NA9H 5LGOA 4H6TA 2AERH 1SOZA 3NXPA 2XTTB 1TALA 1PQ5A 2BB4A 1LVMA 2TBSA 3ZZ3A 1K1JA 1GBIA 1MAXA 1OSSA 2A4OA 3MU8A 3F9EA 1M9UA 3B9FH 3OY6U 3AAVA 4DVAU 3E3TA 2ILNA 2ZHEH 2OQ5A 1HXEH 1O5FH 2BDYA 2EEKA 1GJ5H 3BSQA 1LHEH 2K1QA 1T7CA 4I8JA 1NU7B 5DP4A 4MLFB 3GY6A 1NS3A 2QXHA 4B1TA 1C5NH 4GLYA 4LXBH 3TK6A 3RM2H 4NIVA 2GZ9A 2ZECA 2P3TB 3IWMA 3N7OA 2CF8H 1S83A 3K2UA 1G30B 4IGDA 1C5SA 1D9IA 5DP6A 1GBHA 2B5TB 5EG4A 3HPTB 1TA6A 1ETSH 3KF2A 2ZEBA 3MO3A 1SHYA 4JYUH 4Q7YA 2Q6FA 3SV6A 3NPSA 1WYKA 5LPFA 2QIQA 3UQOA 1TBZH 1BTZA 2TIOA 1THSH 4HTCH 1RGQA 2ZHWH 2BD5A 1GI4A 1QL7A 1W10U 4FVDA 2XBYA 4FUEA 1ESBA 1HAVA 1QY6A 2BYAX 3ZZ7A 3ZZBA 3BTHE 2F9NA 2Y82A 1MMJN 1W12U 1SQOA 2VH0A 1H1BA 3PMJA 2ZDNA 2P95A 4AGJA 1O32A 3S9BA 3D65E 3UR6A 1GVLA 1O37A 2FODA 2OTVA 2OBQA 3QK1A 1T4VH 4BXWA 1XUHA 4Q2KA 2G51A 1JIRA 3TH2H 1GPZA 3SU6A 4ISOA 1GBMA 1O3NA 1HBTH 1O2LA 1YM0A 3U69H 1QL8A 5JB8S 2C4FH 4X1NU 1UTLM 3A85A 1WAYB 2ZDVH 3MTYA 1RIWC 1T31A 2J94A 1P12E 4FUBA 1DXWA 1J14A 1Z1JA 1O2HA 4Z6AH 5AF9H 1A4WH 3SJ8A 1DSUA 3JZ2B 2FTLE 1GI6A 2Z9LA 4Q7XA 4YZUA 1EAXA 1HAYB 1D6WA 1DANH 1P03A 3FANA 4AYVB 5EW1H 3MU0A 1ELTA 1GHWH 1DT2A 3EGKH 1HAOH 4A1VA 2ZFFH 2CF9H 4DCDA 1MD7A 3ZVFA 3TNTA 1VJAU 3RXMA 1HJAB 3GYMA 4X6PA 3BTDE 1SGDE 3LC3A 1XKAC 3UQVA 1WBGB 4ABEA 3V0XA 4D9QA 1BTYA 3SGBE 1D3DB 1AQ7A 1GG6B 1SGTA 4SGBE 5A2MH 1KDQB 5A0CA 2GCHF 2W5EA 4Y8YA 1H8IH 1MCVA 1CVWH 1YLCA 2ZHQH 3A7TA 1GVZA 3RLWH 1P2MA 1O3FA 2G81E 3EE0B 3GY7A 3LT3A 1FMGA 3ZV9A 2A0QB 1QCPA 1PQAA 2NU2E 5FX5A 3PWBA 2NU0E 2ZO3H 4NZLA 1H8DH 2P3UB 5AVDA 2ZZUH 1O2WA 4I32A 1P3CA 1EJMA 4Q7ZA 5HM2A 1OYQA 1RTKA 4FUJA 1ZHRA 3GDSA 4M7GA 3E16B 3ENSB 1NZQH 1ELFA 4WMEA 3BTKE 1LPZB 1TNKA 2ZPQA 1LVOA 5DGJA 4A1XA 3V12A 3SOSA 4X6NA 3GDUA 1C2GA 5CHAB 2FDAA 2BTCE 3RXOA 1CA8B 4O3TA 5A09A 2BDAA 3DHKH 1O3EA 3SNCA 1FAKH 3A7VA 1DWBH 1FY4A 3CENA 1RXPA 3F6UH 1NT1A 4AB8A 2Y7ZA 1NFUA 1C5VA 1SVPA 3SUDA 1EJNA 3SNAA 3CS7A 1WU1A 2GP9B 3LPRA 1EASA 4J2YB 2J92A 3LH1A 2QN5T 3M5MA 4ABGA 2R3YA 4B73A 1CHOF 3ZZ9A 3JZ1B 1IHTH 4DT7B 1PPEE 1ZMNA 4DIHH 1QBVH 4GPGA 1O3AA 1C4V2 3RU4D 2AFQB 5JB9S 1ETRH 2BZAA 6CHAC 1RJXB 4BXSA 3BF6H 2C3SA 3UIRA 4CBOA 2A7JA 1G3DA 1AVWA 2BZ6H 5EXNA 3H7OA 3OSYA 2ZC9H 1TPOA 1D3TB 1LPKB 3MMGA 2A5AA 1EPTC 4Y10E 4I8LA 4X1RU 3SHAH 5FBIA 4AGKA 3TPIZ 2F9PA 1C2FA 1GHYH 3ZV8A 1ELDE 4FU8A 1P2OA 3A82A 2NU1E 1H4WA 1KY9A 2WUCA 4K3JA 1V2PT 1EP5A 1KLJH 1GVKB 3A7ZA 1S0RA 1HJ9A 1GJ9B 4CRFA 3RMOH 1O2XA 3MWIU 5C1UA 2GCTB 1BTHH 3E0PB 1TWXB 2UWPA 4OS1A 3A88A 3M7TA 3IG6B 5EW2H 1A3BH 1KYNA 2Q1JA 2O8LA 5E0HA 5C67A 1Y3UA 1GGDC 2CV3A 2J34A 4MPVA 4AN7A 2RA3A 1EUFA 1O5CB 3V3MA 7GCHF 1ZSJA 2VVCA 5C5NA 2R9PA 3H5CB 3U8OH 1N8OB 1TPSA 2JH0D 2FOMB 5DJ7A 2BY8X 3M3TA 4X1QU 1FN6A 1Y59T 1CGIE 2ULLA 4A5TS 3GCTG 4ZKOU 3DD2H 2QYIA 1A7SA 4CRDA 4D8NA 2ZGBH 3O8BA 2HPQH 3OU0A 3L33A 1GI0A 4SGAE 1Z8RA 1RD3B 4ZAEA 4O3UA 1H9HE 3KQDA 2O8UA 1LVBA 1C4Y2 1FQ3A 1SGCA 4FVBA 1PJPA 4JK5A 1QURH 1CA0B 1AUJA 4THNH 1DS2E 5E8EH 2RDLA 2D8WA 4NWKA 1TRNA 1V2MT 2AS9A 5EQSA 1VITG 1HRTH 4ISIH 4TPIZ 3LONA 4CH2B 4ZROA 1TE0A 1J17T 1SLXB 2ASUB 3BTQE 3RXQA 2ZDLA 3MNSA 4IBLH 4D9RA 1O2YA 3MNCA 4K8YA 3DFLA 4A6LA 2STBE 3ZVGA 1L1JA 1O3PB 5J4SA 2EI7A 2FXRA 2BMGB 1KXAA 1HGTH 4IN1A 3T26A 3QDZB 3M61U 3RXUA 1HAHH 1C1VH 3A8CA 2Z3CA 2FESH 4Y6DA 2TPIZ 1EQ9A 2SGAA 3UTUH 5GIBA 1VZQH 1Y3VA 3BG4C 1GJ4H 3KGPA 2OC7A 1GHXH 3UOPA 2GCHG 1AVXA 1TX8A 2QXGA 2RA0A 4VGCC 1P0SH 2FEQH 2FMJA 4Y79A 2ZTXA 2A7CA 1O2IA 1QQ4A 4UDWH 2DE8A 1BJVA 1N6XA 4JCNA 4KELA 1E38B 2F9VA 1GCTC 2D26C 3ZZ4A 4X8VH 2ODQA 2UWOA 3SJKA 2XCNA 2QF3A 3PMHB 1A5IA 4E7NA 1BTPA 2ZTYA 1SGEE 3MH4A 1KXFA 3D23A 2ZPRA 3A81A 3MU5A 1VGCB 3RXIA 3RXFA 4B76A 3A84A 3MYWA 4Q80A 1UTJA 3KQCA 1O2ZA 4MQAA 4QT8C 1O2UA 3PO1B 3RUOA 4DY7B 3VB5A 1INCA 1S0QA 4YOGA 1BBRK 1BQYA 1HNEE 5DG6A 5JDUB 2Z9IA 1YKTA 1BHXB 2QGRA 3HGPA 4YO9A 2FI3E 1HAGE 1PQ7A 3GDVA 3PTBA 1C9TA 2NWNA 1HCGA 1XX9A 1UK3A 4ASHA 1O3HA 4BAOB 3ZZDA 1C5OH 2GV6A 2XCFA 4GVUA 1ELGA 1CO7E 1O3MA 2LPRA 1UTMA 2Y7XA 3A80A 3NUMA 3PB1E 1PPHE 1LHDH 4ZXXH 1IQNA 4JZEH 1GBTA 1GI5A 1C5YB 1DDJA 1RS0A 2BOKA 2G52A 1PYTD 1HFDA 3QN7A 1TNJA 2BLQA 1E36B 1CHOG 2GTBA 2G00A 1W2KH 1WSSH 2BDCA 3RXBA 1CBWC 1IQIA 1RIWB 1FONA 4E7RG 2PSXA 3TJOA 4RN6A 1DUAA 5BPEA 1VCPA 3SUEA 1UVOA 3ELAH 1AZ8A 1F0SA 2WINI 3MO6A 3UY9A 2HWLB 1PQ8A 2UUKB 2W7SA 3SU3A 1BTUA 1K9OE 1TBQH 2IJOB 5A0BA 1O2OA 3GOVB 1EZUC 2VGCB 2FM2A 3PLKA 3UUZA 2OQUA 4IMZA 3KQEA 3A87A 4WMFA 1A3EH 2I6SA 4MNXA 4ZMAH 1YPHC 5TJXA 2GKVE 1S81A 3SZNA 3VB7A 4AFQA 1B0FA 1YCPK 3UREA 3DUXH 2I6QA 1EZQA 1A5GH 1SQAA 1V2LT 1LHFH 5GWZA 5EODA 1DX5M 1DPOA 2H9HA 2BHGA 1ACBE 1TLDA 3MNXA 3RXHA 5F03A 7GCHG 1LKAA 2EC9H 4X8SH 1SPJA 1TIOA 2HGTH 5JYIA 2F9UA 1BB0B 2ZNKH 2BM2A 4OGXA 2VIPA 2ZHDA 4U30A 1HAPH 4LK4A 1TRMA 3GY3A 1GHAG 1D3QB 2BQWB 5ABWA 4MPUA 2P8OB 3GYLB 3NZIA 1JWTA 4JYTA 4BAHB 1W0ZU 2B9LA 2ANMH 1TQ7B 3VXEH 4MPWA 1J9CH 2VWOA 1HIAA 1GBDA 1THPB 2QXIA 1O2QA 1LCYA 3UFAA 5FPYA 1UTKA 1O2MA 2FP7B 4AFUA 2BXUH 2CGAA 1TFXA 2PLXA 2BLWA 1TNIA 3SU5A 6ESTA 2CXVA 3ZVCA 4X8UH 3V13A 1C2DA 5GCHG 2WPIS 3TVJB 1WQVH 2V0BA 1O5EH 2OC8A 1AZZA 1L4DA 4BTIB 1XXDA 3KQBA 1FXYA 3HK3B 2O9QA 3FVFB 1G32B 1C1QA 1MD8A 1AMHA 1T8OA 3LGUA 1GDUA 2CN0H 3LH3A 1W11U 3TITA 3RXVA 4UEHH 3VPKA 3GCNA 2C8ZB 3ZYDA 1AFQB 4YTAA 1O36A 3FAOA 1DITH 2BLOA 1EX3A 1YPMH 4NGAH 9ESTA 4K2YA 1ZGVA 1KDQA 1GBAA 4DG4A 1LDTT 1F7ZA 1THRH 3MU1A 3FP7E 2AMDA 3LJOA 1FUJA 3NK8A 2AH4X 2PKSB 1S84A 1C5PA 1BA8B 4X6OA 3L6PA 1TOMH 1Y5BT 3NWUA 1ELCA 3GCOA 1V2QT 1B0EA 1YYY1 1GMCG 2B8OH 4D76A 2F91A 3GCHC 2ZU1A 2YNAA 4INKA 2GGVB 3P8GA 2VVVA 4GUXA 1C5MD 4A92A 1NRSH 1CGHA 2AMPA 1UTOA 5GDSH 1EJAA 1AUTC 2B7DH 2WV5A 1BRUP 5AFZH 1AO5A 3GCTF 1ORFA 3A83A 1O2RA 1C1SA 3UNQA 5C5OA 3RXDA 2SGQE 2RCEA 1ELVA 3FZZA 4XOJA 1EOLA 1PPBH 2THFB 1K1IA 3LDXH 3SJOA 4AFSA 2A4GA 3RXAA 3T29A 2BQ6B 1SB1H 4CR9A 2FX4A 3SO3A 4AFZA 3LOXA 1FNIA 1PPGE 1C5ZB 1RTLA 1KXBA 3ZZ5A 2CHAB 2V6NA 1BBRH 3MO9A 2DUCA 1LTOA 3F9FA 3ZVBA 1LMWB 1FZZA 2Z6BD 1A0LA 4UFFH 3TK5A 1MTNC 1VITF 2W3KA 1C2EA 1UCYK 1VCWA 1O2TA 3TK9A 1DY9A 1DY8A 2OC1A 1C1RA 1GMHF 3Q77A 2SGEE 3S7HB 3UNRA 4JMYA 2CJIA 1OWKA 2J4IA 1AN1E 2FI5E 1F5RA 1NO9H 1Q31A 3SV9A 4A7IB 1GJCB 1Y3XA 4IC5A 1IHSH 2ZQ2A 3RXKA 3SGQE 1KXDA 1G36A 2R0KA 3M5LA 2P3FH 1E34B 1HAZB 1K1OA 8KME2 5K0HA 3I29A 3M3VA 3F9HA 1ZR0A 1G3CA 1GI3A 1SLVB 4RKJB 2PUXB 4O97A 1TX7A 2BXTH 3RXGA 4UFGH 5EQQA 1XXFA 5FPSA 4K1TA 3TNSA 1SQTA 1HJ8A 2H2ZA 1F0RA 3PYHA 4K1SA 3ODDA 1TBRH 4Y76A 1MU8B 4ZH8A 2G4UA 5EPYA 1L1NA 3A7YA 4XDEA 4WH8A 1WTGH 3P95A 1BMLA 2RG3A 5BRRE 2FYQA 2R2MB 3PMAB 2WPHS 3EA7A 4JYVH 1TPAE 3STIA 5A8ZA 1NPMA 1NRPH 3HGNA 1C5QA 2ZI2H 3ATKA 1QJ1B 1FPCH 1NU9A 5F6MA 2XW9A 3S0NA 2WYGA 1PYTC 3AASA 2VIOA 3VFEA 1AB9B 1RRKA 2SGPE 1C2HA 1CE5A 1OS8A 5EQRA 1FV9A 2A31A 1W13U 4OS5A 4OS6A 5T6GA 2O8WA 1TGTA 1X7AC 1YLDA 1BTWA 3SI4H 4AZ2B 2Y6TA 5L2YH 2A5IA 1KTSB 2XXLA 1DLEA 3P17H 2A2XH 3SNEA 4KTSA 5DP9A 4TWYA 1GDNA 1DVAH 2ZPSA 2BD9A 3EA8A 3UWIA 4BOHA 5HMAA 2VINA 1BMMH 2FOEA 1V2VT 1ZJDA 2ZF0H 1OP8A 1FJSA 3BTEE 1EAUA 1G2LA 3RC4A 1GHZA 2AEIH 5DO4H 1U6QA 3D62A 5FBEA 1VITH 2AIQA 3GY5A 2ZGJA 3SN8A 1XUJA 5JPMH 3RXEA 3T5FH 5JBTA 1TB6H 2CMYA 3U98H 4B2CA 4KP0A 3M5OA 1GI2A 4FUCA 1KSNA 1SGPE 1A2CH 2C8WB 2H1UA 1T8LA 1XUFA 2DE9A 1SOTA 2EI6A 2BVSH 2H5CA 3SJ9A 3O8RA 2VU8E 1OP2A 4AB9A 1IOEA 2FX6A 3E90B 3PTNA 2H6MA 4Y7BA 1AU8A 2BVXH 2HNTF 5FPTA 3MOCA 4ESTE 4AYYB 1IQMA 1GJAB 3GY2A 1P2JA 1UTPA 1ZPCA 3TGIE 3QTVH 3OTJE 5FHTA 4H4FA 1EAIA 1TMUH 1EZSC 5C20A 3OYPA 3RM0H 2ZFSA 3A8BA 7ESTE 3QLPH 3P6ZB 1DFPA 5T3HA 1SR5C 4CRGA 3QTOH 1O3CA 1SFQB 3QGNB 3BN9A 3SV8A 4A1TA 2VIDA 2BY9X 1GHAF 2XBXA 3KL6A 1GMDF 2ODYB 4ZKRU 3RU4T 3ATLA 2ZGHA 3A8AA 3ESTA 1V2JT 1WOFA 1A5HA 1O5AB 5LPEA 1L1GA 4Z0KA 4I7YH 4HGCA 2QA9E 1SI5H 3T2NA 4DW2U 3CP7A 2WPKS 2HNTC 3C27B 5CMXH 1VJ9U 1Q3XA 1ZYOA 1J16A 1ZHPA 1P3EA 1YBWA 1C2IA 2VH6A 1TRYA 3AVZA 5GCHF 1QRZA 1O33A 3P70B 1JRSA 3NKKA 2Z3EA 2ZIQH 2GMTB 2ALPA 2ZG0H 1FIZA 1UTQA 4NWLA 4CHAB 1P06A 1GMHG 1Y3WA 1ZTLA 2JETB 2SNWA 2OC0A 1QFKH 1JIMA 3AW1A 1UK2A 1CHGA 4XBDA 1GBKA 2KAIB 2JKHA 3DT0H 4MNWA 4ISHH 2IPHA 1OWIA 4WWYA 1C1PA 2OXSA 3BIVH 3D49H 4X6MA 1CT2E 1UCYH 2A4QA 3M5NA 3SU2A 2QAAA 1AIXH 1P09A 1V2RT 3SUGA 1HJAC 2BDGA 1P02A 4LOYH 4AX9H 3WY8A 2OINA 1T8MA 1PFXC 2ZFTA 3SUFA 3KNXA 2TGDA 3SGAE 1AD8H 1TMTH 2VWNA 4R8TB 4X0WU 3MI4A 3I77A 1AVGH 1S85A 1IAUA 3DA9B 2O8TA 1FY3A 4MG3A 1O5GH 1QB9A 1SL3A 3FFGA 1GMCF 3TH3H 3O8DA 2XC5A 1GI9B 1K22H 3ATMA 2PW8H 2P93A 1TGSZ 3PLBA 1UTNA 1KTTB 2GDEH 2WPJS 1DOJA 1ZJKA 2V3OH 1OXGA 1V2WT 3FZDA 3TGKE 1IQLA 4DIIH 1C5UA 3LIWA 3ZZ6A 1NRNH 1ZLRA 1BJUA 1PPCE 2LNCA 4D7FA 1AE5A 4ZKNU 4UFEH 1O39A 6GCHG 4DOQA 2Z94A 2PUQH 2BD7A 2VB0A 3GCHB 3ZZAA 3BTGE 2P94A 3KIDU 1QJ6B 1CT0E 1AY6H 1OWJA 4O03A 1UMAH 2GDDA 1C1MA 2Y5FA 5CHAC 3M36A 1GBBA 5PTPA 2Z9JA 3MH5A 1DICA 1BTXA 2FOHA 3VB3A 1EKBB 1ELBA 3H7TA 3F1SB 1W7GH 3TH4H 1MTWA 2C8YB 5EU8A 2FZZA 2ZU3A 3MU4A 5C1YA 1ZSLA 4U32A 2YOLA 3HKIB 1O5BB 1GCDA 3K9XB 1YC0A 1CT4E 4WJG2 1Z7KA 3BEUA 4GSOA 1QIXB 3URDA 1BUIA 1OX1A 3NCLA 1NESE 1ZTJA 4HFPB 2AGGX 5L30H 3E91A 4FXGH 2Y5HA 4MNYA 1A46H 1P57B 4X2YA 1HV7A 4ABJA 1UHBB 2TGPZ 2WYJA 2A1DB 1TGBA 5E0GA 3T28A 4GHTA 1NFWA 2A7HA 2D2DA 2STAE 3SV2H 1HDTH 4WVPE 1DM4B 1F2SE 2QC2A 1FN8A 3BIUH 4BTUB 1YPLH 4BAMB 1V6DA 3F68H 2HALA 4OGYA 1QBNA 1K1NA 1OOKB 1EAWA 3HATH 1XM1A 2ZA5A 3URCA 5FAHA 2H9EH 1GHBF 1XVMA 5EXMA 3U1IB 1G9IE 1O2SA 3S9CA 3AAUA 4NFEA 2R2WU 3LKWA 1MQ6A 3SV7A 1HAIH 4FUDA 4B71A 1ZMJA 1K28D 1TGCA 4I8HA 5H4IB 4X2WA 4AG2A 1DE7H 1G3EA 1O2KA 1D6RA 1GI7B 1N8OC 2PKAB 1F5KU 1OWHA 2BDIA 2HPPH 2W26A 2ESTE 1CSOE 2PHBA 4F49A 4JK6A 1C2KA 1EZXC 1BRCE 2G8TA 4CBNA 1V3XA 5F8XA 1VCQA 1DXPA 1GMDG 1C2MA 2GX4A 1BCUH 2FLBH 4X8TH 4GCHG 1Q2WA 1UVPA 1UJ1A 1MKXK 3RC6A 3A7XA 4XSKU 1HXFH 1ANBA 3GICB 1Z8GA 1QA0A 1D4PB 3A7WA 3MH6A 1L2EA 3E8LA 1BIOA 1FAXA 2NU4E 1MQ5A 1O38A 5SGAE 3RMLH 3A86A 1O31A 1YP9A 2BY7X 3LGYA 1GBJA 1P2NA 2XC4A 1CA0C 1TAWA 3RP2A 2F3CE 2BY5X 4UE7H 1Z1IA 2VJ1A 4B75A 3GY8A 1SG8B 4FUIA 1O2JA 4NZQA 4DGJA 1GBLA 2JH5D 1C1UH 2FWWA 1QRWA 2PGQB 1LHCH 3QX5H 4NIXA 1C5RA 1TQ0B 1AE8H 1F0UA 2VIVA 1E35B 1TMBH 1QRXA 1S6HA 1C5XB 5DKMA 1Y3YA 1DLKB 2A32A 3LGIA 4H42U 1NROH 5DPAA 2PTCE 4NFFA 1BT7A 2ANYA 2A45B 4I31A 4YOIA 5L6NH 1UK4A 1O0DH 2BVRH 1ZOMA 1G37A 3QZQA 3SU0A 1ESAA 1ID5H 2Y5GA 3SU1A 1YPKH 2HRVA 1SMFE 3U9AH 3ODFA 1TNGA 3LC5A 3P8FA 1V2OT 1K1MA 2OLGA 2WUBA 3SJIA 2WPMS 1C9PA 1EP6A 1OKXA 2FOGA 2GZ7A 1YCPM 2W3IA 2JH6D 1BHXF 1QBOA 1GI8B 1KIGH 2Z7FE 6CHAB 4JZ1A 1C1WH 5C3NA 1BZXE 4IC6A 1SHHB 4PROA 1MTSA 1QGFA 4JZFH 2ZWLH 1LKBA 4RKOB 3P92A 2QF0A 1EB1H 3KHVA 2A5KA 4FU7A 3BTFE 1DWDH 1EPTB 2AYWA 2VVUA 1P2KA 1S5SA 3DFJA 4RSPA 1A0JA 3Q76A 1Z6EA 4NIWA 2XWBI 2J9NA 2TGAA 5AHGH 4Y11E 4FUFA 5L2ZH 5I46H 2G55A 4KGAA 1QB1A 2PWXA 2BD2A 5AFYH 1BRAA 2OBOA 1VR1H 3M3SA 4ABAA 1P11E 1GI1A 1AKSB 3QGJA 1VGCC 4Y0ZE 4YT6H 1JXPA 1EB2A 5JBBS 3ZZCA 5GPIB 1GGDB 2ODPA 3PO1C 2J95A 3VGCC 2ANKH 2BOHB 4FUHA 4X1PU 1CQQA 1XKBC 2OCVB 4NG9H 2HOBA 1GJDB 2H9TH 2VWMA 4CRAA 1N6YA 4MTBA 5GXPA 3PM3A 1CU1A 3KCGH 2VIWA 1EATA 1V2TT 5A8XA 1OPHB 1O3KA 1ANCA 2ZDMA 1ETTH 1SFIA 1YPJH 3B23B 1AGJA 4BNRA 1SBWA 5TCAA 2PTNA 8LPRA 3GY4A 5JBCS 2WV4A 3LGWA 2FS8A 1BMAA 1IQGA 4OS4A 1G2MA 5T6DA 1HIAB 2V3HH 1YF4A 1ABJH 1K21H 1MZAA 3SHCH 2M5TA 1JMOH 8ESTE 3T27A 3BEFB 1GBCA 1WCZA 1WTHD 1E37B 2UUJB 3RXTA 2XRCA 3A89A 2Y81A 2FIRH 3P8OA 1O5DH 1LVYA 5FX6A 2Q6GA 1YGCH 4IN2A 4ZXYH 3TJNA 4ABHA 1WUNH 1HPGA 2VGCC 4AG1A 1Z6JH 5IDKA 2FLRH 1NFXA 3MNBA 1EXFA 3Q3XA 2F9OA 1QNJA 2XBVA 3MFJA 3BTWE 3SU4A 2BX3A 5CE1A 1J15A 2F9BH 4MDSA 4ZKSU 1O3LA 1YPHE 3UWJH 1GHBG 4YLQH 3U8TH 1FLEE 3I78A 1OP0A 1IQKA 4WXVA 3EDXB 2ZCKP 4UD9H 3RXPA 1TA2A 3BG4B 2QY0B 4DJZB 2BD4A 1F92A 1Z71A 2ZHFH 1SGQE 2ZCHP 5ESTE 2GD4B 4TY6A 1SGIB 1DUEA 2FYRA 4NSVA 3RXRA 4VGCB 1YCPH 5GJ4B 2BY6X 1MH0A 1O3DA 4I33A 2W7UA 2UWLA 2OD3B 3RLYH 1J8AA 5ETXA 1L0ZA 1FY8E 6GCHF 1ANDA 1TNLA 3K65B 4BAQB 5ESBA 2XWAA 1MUEB 2P8OC 1GCTB 3ZZ8A 1NC6A 3TLOA 2SGDE 1ARCA 3UR9A 1GWAA 3ZVAA 3IITA 4JZIA 4B2BA 1C2JA 5TCCA 1HAVB 2BLVA 3QO6A 4CH8B 3S9AA 1QB6A 4K1EA 1SLWB 1MBQA 1ZMLA 1MKXH 3RU4E 1SLUB 1MKWK 1TPPA 5EGMA 4DURA 1ZPBA 3TJUA 3RXJA 3SI3H 1LPGB 1BMNH 2ANWA 9LPRA 3TJVA 2OUAA 5B6OA 1FY1A 2R0LA 2GT7A 3TU7H 1O2PA 1WV7H 1O3GA 2KAIA 2C93B 1NRQH 1QL9A 3BTME 1K1PA 4J1YA 4JZDH 1TONA 4I8KA 1QHRB 1YPGH 3ZVEA 3HK6B 3SW2B 1GDQA 2EA3A 1AFQC 1SGRE 4HI3A 1Z8IB 2IN2A 4K69A 1A1RA 4E05H 2G4TA 2ZGXH 2TRMA 1E0FD 1P01A 2ZU5A 1BBRE 2B0FA 1GHVH 1CBWB 2NU3E 1LHGH 3KN2A 1KXEA 8GCHF 1O35A 1V2ST 1AHTH 4ISNA 4WF8A 1ARBA 2BDBA 2PKSC 5F8ZA 3LGTA 4K8BA 2FOAA 1UVTH 3B8JA 1G3BA 2C8XB 2O8MA 1JRTA 1T8NA 3ATIA 5EOKA 3P8NA 1QTFA 3BV9B 3UNSA 1MU6B 3MH7A 2WPLS 1QR3E 7KMEH 4ZUHA 3EQ0H 2Y80A 1XUIA 1ZGIA 4NSYA 4BAKB 2XC0A 4K60A 2C90B 2Z9GA 1NFYA 1GJ8B 4CR5A 5G4BA 3W95A 1FPHH 1TX6A 4UONA 3T62A 4OS2A 2ZP0H 3M35A 5JBAS 2ZCLP 4YESB 3BG8A 3VB6A 1PPZA 2FOFA 3M7UA 4CRBA 1A0HB 3A8DA 4Y7AA 4GCHF 3PMBB 1RTFB 1HB0B 4FUGA 2Z3DA 1DSTA 1V2NT 2F83A 1KXCA 4X2XA 1V2KT 3K6YA 1NN6A 3QUMP 3M7QA 1BOQA 1Y8TA 3G01A 2BX4A 3R0FA 2AIPA 2HVXA 3QZRA 2GZ8A 4AORA 5LH8A 2PGBB 2CHAC 3QWCH 1SSXA 4Y0YE 3ZVDA 1O3BA 4TPYA 1O3IA 1W14U 1QJ7B 2QV1A
chains in the Genus database with same CATH superfamily
3SNDA 2ZU4A 2ZFPH 1MCTA 5DP8A 1MTUA 1C4U2 1C1TA 3SNBA 2WZQA 4WXIA 4KTUA 1NM6A 2J98A 1NTPA 2P59A 5C2ZA 1KLTA 2VNTA 5HM9A 1AWFH 3M37A 1FDPA 5F8TA 4XFQA 1FIWA 4ABBA 1UHBA 3PV4A 4X2VA 5DK1A 4YOJA 3HKJB 3TGJE 3UOUA 4NCYA 5K7RA 2FPZA 1ANEA 1KLIH 2XBWA 1UO6A 1P2IA 1O3OA 1QA7A 4MNVA 3V7TA 3S69A 1HUTH 4ZHAA 2ZFQH 1XVOA 3SQHE 3U1JB 2IPQX 3EAJA 2YMSC 4B6FA 2ZKSA 4TWWA 4CRCA 3SZEA 1XUKA 1JBUH 3Q3YA 4KTCA 4BANB 4IMQA 4GHQA 3PV2A 1GG6C 1JOUB 2TGTA 3LGVA 4OS7A 4K5ZA 1F0TA 3Q00A 5HKKD 1CGJE 1LO6A 5E2PA 2EI8A 2J2UA 4INLA 1SGFG 3SBKA 1YPEH 1QQUA 2ZDKA 5FCRA 2H5DA 1O2GH 4YM9A 1GJBB 4IW4E 2ZGCA 1P9UA 1ZZZA 2FI4E 2W6JD 3N7EA 1W7XH 3LJJA 1ZHMA 3LU9B 4R0IA 3SORA 2PP6A 1W0YH 4U2WA 2RFKC 4B2AA 3GISB 2YNBA 4WH6A 1D3PB 4TYDA 5A0AE 1UVUH 2KCOA 4INHA 2PKAA 1P9SA 1T32A 1B5GH 2HLCA 4I8GA 3S7KB 4ABFA 4LZ1H 1DWCH 3FP6E 1IQEA 3RXLA 1B7XB 1O2NA 3O8CA 4MPXA 2JJ1D 1GBFA 2VWLA 3ZYEA 5A8YA 4Y8ZA 1GL1A 1Y5AT 1ESTA 1V2UT 4U01A 4IS5A 1FY5A 4ABDA 2P16A 1AB9C 1GBEA 1GJ7B 4ISLA 2BD3A 2KFWA 1MTVA 1SGFA 3K6ZA 4NA8A 1HAXB 3PROA 1C2LA 1OWEA 2A2QH 2GVFA 4ZHLU 2ZTZA 1LQDB 1P8VC 1ZRBA 1IQHA 2BD8A 2HLDD 3STJA 5I25A 5IYTA 3RXCA 4E06H 3R3GB 1GJ6A 2FS9A 1W8BH 4M9FA 3VGCB 1XUGA 2ZU2A 2ALVA 1EOJA 1P05A 1AWHB 2A4RA 4F55A 3KEEA 3BTTE 1SGYE 5EXLA 2UUFB 5LPRA 1MZDA 2M2AA 1O34A 3SQEE 3RXSA 5EJLA 2SFAA 4WY3A 5HGGA 1XMNB 2QCYA 1SC8U 1C5TA 5T6FA 1Z8JB 1MKWH 4NA7A 1RFNA 2SGFE 4CREA 1GL0E 4MVNA 4BTTB 1ZRKA 1F5LA 2Z9KA 3OX7U 1MTNB 5DP3A 1AFEH 2VIQA 4FOUC 4HZHA 4NIYA 2PV9B 3BEIB 4YT7H 5C0TA 2F43B 2QXJA 4XE4A 3VB4A 2XNIA 2PFEA 1HLTH 3PLPA 3E0NB 1PPFE 7LPRA 3F9GA 5C1XA 3E6PH 1IQFA 4F4OC 8GCHG 3MHWU 2V35A 1C5LH 4Y71A 5DP7A 1HYLA 1O3JA 4XBCA 2EQNA 1C5WB 4Q63A 2OP9A 1FI8A 1TNHA 3E1XB 3T25A 1L4ZA 1EPTA 4X1SU 3U8RH 2GCTC 1TABE 1BRBE 1K2I1 3ATWA 2FOCA 1SGNE 2G5NA 3TIUA 1K1LA 1P04A 2G5VA 2ZFRH 4FU9A 3RMMH 1OWDA 1UCYE 1WQSA 3L3TA 3AW0A 1OYTH 2IOTA 4ABIA 1BDAA 2XYAA 2BQ7B 1ELEE 4LZ4B 1AKSA 4Y8XA 1C1OA 1TGNA 4B74A 3CS0A 3ITIA 3UPEA 3VEQB 1H9IE 1NY22 3RDZA 2AGEX 5FXLA 1AI8H 2R3UA 2SNVA 3OY5U 1ELAA 2ZDAH 1S82A 1S6FA 1O30A 1TOCB 1IQJA 1ZTKA 2FO9A 1NRRH 1C1NA 2ZQ1A 5E0JA 1O2VA 1P10A 4UFDH 3VXFH 1ABIH 3RMNH 1P2QA 2PR3A 2GT8A 4YLUA 1BITA 2AGIX 1MBMA 1TYNA 4KKDA 5HXFA 4WMDA 1W3CA 5E2OA 5J4QA 2D1JA 2AMQA 4D7GA 2GV7A 2HNTE 4O9VA 2UUYA 2BDHA 4GAWA 3C1KA 1LQEA 3W94A 2Q6DA 5HYOA 1A61H 1ZPZA 3H09A 3W1EA 4AOQA 1T4UH 4XBBA 1DWEH 2GMTC 3FKSD 1MAYA 2J38A 1Y5UT 4CHAC 5FCKA 1ZSKA 4TY7A 5DP5A 3OAAD 3PWCA 1H9LB 4ZHMU 3Q3KA 2JETC 3EYDA 6LPRA 3EA9A 2PSYA 1UVSH 5C94A 2FTMA 5EPNA 2FOBA 1N1LA 3RC5A 3FP8E 4H6SB 4NA9H 5LGOA 4H6TA 2AERH 1SOZA 3NXPA 2XTTB 1TALA 1PQ5A 2BB4A 1LVMA 2TBSA 3ZZ3A 1K1JA 1GBIA 1MAXA 1OSSA 2A4OA 3MU8A 3F9EA 1M9UA 3B9FH 3OY6U 3AAVA 4XD7D 4DVAU 3E3TA 2ILNA 2ZHEH 2OQ5A 1HXEH 1W0JD 1O5FH 2BDYA 2EEKA 1GJ5H 3BSQA 1LHEH 2K1QA 1T7CA 4I8JA 1NU7B 5DP4A 4MLFB 3GY6A 1NS3A 2QXHA 4B1TA 1C5NH 4GLYA 4LXBH 3TK6A 3RM2H 4NIVA 2GZ9A 2ZECA 2P3TB 3IWMA 3N7OA 2CF8H 1S83A 3K2UA 1G30B 4IGDA 1C5SA 1D9IA 5DP6A 1GBHA 2B5TB 5EG4A 3HPTB 1TA6A 1ETSH 3KF2A 2ZEBA 3MO3A 1SHYA 4JYUH 4Q7YA 1E79D 2Q6FA 3SV6A 3NPSA 1WYKA 5LPFA 2QIQA 3UQOA 1TBZH 1E1QD 1BTZA 2TIOA 1THSH 4HTCH 1RGQA 2ZHWH 2BD5A 1GI4A 1QL7A 1W10U 4FVDA 2XBYA 4FUEA 1ESBA 1HAVA 1QY6A 2BYAX 3ZZ7A 3ZZBA 3BTHE 4Q4LA 2F9NA 2Y82A 1MMJN 1W12U 1SQOA 2KCYA 2VH0A 1H1BA 3PMJA 2ZDNA 2P95A 4AGJA 1O32A 3S9BA 3D65E 3UR6A 2FODA 1GVLA 1O37A 1UW7A 2OTVA 2OBQA 3QK1A 1T4VH 4BXWA 1XUHA 4Q2KA 2G51A 1JIRA 3TH2H 1GPZA 3SU6A 4ISOA 1GBMA 1O3NA 1HBTH 1O2LA 1YM0A 3U69H 1QL8A 5JB8S 2C4FH 4X1NU 1UTLM 3A85A 1WAYB 2ZDVH 3MTYA 1RIWC 1T31A 2J94A 1P12E 4FUBA 1DXWA 1J14A 1Z1JA 1O2HA 4Z6AH 5AF9H 1A4WH 3SJ8A 1DSUA 3JZ2B 2FTLE 1GI6A 2Z9LA 4Q7XA 4YZUA 1EAXA 1HAYB 1D6WA 1DANH 1P03A 3FANA 4AYVB 5EW1H 3N99A 3MU0A 1ELTA 1GHWH 1DT2A 5DSFA 3EGKH 1HAOH 4A1VA 2ZFFH 2CF9H 4DCDA 1MD7A 3ZVFA 3TNTA 1VJAU 3RXMA 1HJAB 2W6ID 3GYMA 4X6PA 3BTDE 1SGDE 2YMSB 3LC3A 1XKAC 3UQVA 1WBGB 4ABEA 3V0XA 4D9QA 1BTYA 3SGBE 1D3DB 1AQ7A 1GG6B 1SGTA 4SGBE 5A2MH 1KDQB 5A0CA 2GCHF 2W5EA 4Y8YA 1H8IH 1MCVA 1CVWH 1YLCA 2ZHQH 3A7TA 1GVZA 3RLWH 1P2MA 1O3FA 2G81E 3EE0B 3GY7A 3LT3A 1FMGA 3ZV9A 2A0QB 1QCPA 1PQAA 2NU2E 5FX5A 3PWBA 2NU0E 2ZO3H 4NZLA 1H8DH 2P3UB 5AVDA 2ZZUH 1O2WA 4I32A 1P3CA 1EJMA 4Q7ZA 5HM2A 1OYQA 1RTKA 4FUJA 1ZHRA 3GDSA 4M7GA 3E16B 3ENSB 1NZQH 1ELFA 4WMEA 3BTKE 1LPZB 1TNKA 2ZPQA 1LVOA 5DGJA 4RT1A 4A1XA 3V12A 3SOSA 4X6NA 3GDUA 1C2GA 5CHAB 2FDAA 2BTCE 3F2HA 3RXOA 1CA8B 4O3TA 5A09A 2BDAA 3DHKH 1O3EA 3SNCA 1FAKH 3A7VA 1DWBH 1FY4A 3CENA 1RXPA 3F6UH 1NT1A 4AB8A 2Y7ZA 1NFUA 1C5VA 1SVPA 3SUDA 1EJNA 3SNAA 3AK5A 3CS7A 1WU1A 2GP9B 3LPRA 1EASA 4J2YB 2J92A 3LH1A 2QN5T 3M5MA 1YY3A 4ABGA 2R3YA 4B73A 1CHOF 3ZZ9A 3JZ1B 1IHTH 3KYGA 4DT7B 1PPEE 1ZMNA 4DIHH 1QBVH 4GPGA 1O3AA 1C4V2 3RU4D 2AFQB 5JB9S 1ETRH 2BZAA 3GS9A 6CHAC 1RJXB 4BXSA 3BF6H 2C3SA 3UIRA 4CBOA 2A7JA 1G3DA 1AVWA 2BZ6H 5EXNA 3H7OA 3OSYA 2ZC9H 5C0UA 1TPOA 1D3TB 1LPKB 3MMGA 2A5AA 1EPTC 4Y10E 4I8LA 4X1RU 3SHAH 5FBIA 4AGKA 3TPIZ 2F9PA 1C2FA 1GHYH 3ZV8A 1ELDE 4FU8A 1P2OA 3A82A 2NU1E 1H4WA 1KY9A 2WUCA 4K3JA 1V2PT 1EP5A 1KLJH 1GVKB 3A7ZA 1S0RA 3F2GA 1HJ9A 1GJ9B 4CRFA 3RMOH 1O2XA 3MWIU 5C1UA 2GCTB 1BTHH 3E0PB 1TWXB 2UWPA 4OS1A 3A88A 3M7TA 3IG6B 5EW2H 1A3BH 3FOAA 1KYNA 2Q1JA 2O8LA 5E0HA 5C67A 1Y3UA 1GGDC 2CV3A 2J34A 4MPVA 4AN7A 2RA3A 1YLNA 1EUFA 1O5CB 3V3MA 7GCHF 1ZSJA 2VVCA 3KQ5A 5C5NA 2R9PA 3H5CB 4AC9A 3U8OH 1N8OB 1TPSA 2JH0D 2FOMB 5DJ7A 2BY8X 3M3TA 4X1QU 1FN6A 1Y59T 2XNDD 5EJZA 1CGIE 2ULLA 4A5TS 3GCTG 4ZKOU 3DD2H 2QYIA 1A7SA 4CRDA 4D8NA 2ZGBH 1NBMD 3O8BA 4HG6A 2HPQH 3OU0A 3L33A 1GI0A 4SGAE 1Z8RA 1RD3B 3UAIC 4ZAEA 4O3UA 1H9HE 3KQDA 2O8UA 1LVBA 1C4Y2 1FQ3A 1SGCA 4FVBA 1PJPA 4JK5A 1QURH 1CA0B 1AUJA 4THNH 1QZ8A 1DS2E 5E8EH 2RDLA 2D8WA 4NWKA 1TRNA 1V2MT 2AS9A 2WV9A 5EQSA 1VITG 1HRTH 4ISIH 4TPIZ 3LONA 4CH2B 4ZROA 1TE0A 1J17T 2ASUB 1SLXB 3BTQE 3RXQA 2ZDLA 3MNSA 4IBLH 4D9RA 1O2YA 3MNCA 2J5UA 4K8YA 3DFLA 4A6LA 2STBE 3ZVGA 1L1JA 1O3PB 5J4SA 2QF4A 2EI7A 2FXRA 2BMGB 1KXAA 1HGTH 4IN1A 2WPDD 3QDZB 3T26A 3M61U 3RXUA 1HAHH 1C1VH 3A8CA 2Z3CA 2FESH 4Y6DA 2TPIZ 1EQ9A 2SGAA 3UTUH 5GIBA 1VZQH 1Y3VA 3BG4C 1GJ4H 3KGPA 2OC7A 1GHXH 3UOPA 4I86A 2GCHG 1AVXA 1TX8A 2QXGA 2RA0A 4VGCC 1P0SH 2FEQH 2FMJA 4Y79A 2ZTXA 2A7CA 1O2IA 1QQ4A 4UDWH 2DE8A 1BJVA 5EIYA 1N6XA 4JCNA 4KELA 1E38B 2F9VA 1GCTC 2D26C 3ZZ4A 4X8VH 2ODQA 2UWOA 3SJKA 2XCNA 2QF3A 2LELA 3PMHB 5HIYA 1A5IA 4E7NA 1BTPA 2ZTYA 4Z1MD 1SGEE 3MH4A 1KXFA 3D23A 2ZPRA 2L74A 3A81A 3MU5A 1VGCB 3RXIA 3RXFA 4B76A 3A84A 3MYWA 4Q80A 1UTJA 3KQCA 1O2ZA 4MQAA 4QT8C 1O2UA 3PO1B 3RUOA 4DY7B 3VB5A 1INCA 1S0QA 4YOGA 1BBRK 5FL7D 1BQYA 1HNEE 5DG6A 5JDUB 2Z9IA 1YKTA 1BHXB 2QGRA 3HGPA 4YO9A 2FI3E 1HAGE 1PQ7A 3GDVA 3PTBA 1C9TA 1HCGA 2NWNA 1XX9A 1UK3A 4ASHA 1O3HA 4BAOB 2CK3D 3ZZDA 1C5OH 2GV6A 2XCFA 4GVUA 1ELGA 3F0OA 1CO7E 1O3MA 1UTMA 2LPRA 3F2FA 5B6LA 2Y7XA 3A80A 3NUMA 3PB1E 1PPHE 1LHDH 4ZXXH 1IQNA 4JZEH 1GBTA 1GI5A 1C5YB 1DDJA 1RS0A 2BOKA 2G52A 1PYTD 1HFDA 3QN7A 1TNJA 2BLQA 3N7DA 1E36B 1CHOG 2GTBA 2G00A 1W2KH 1WSSH 2BDCA 3RXBA 1CBWC 1IQIA 1RIWB 1FONA 4E7RG 2PSXA 3TJOA 4RN6A 1DUAA 5BPEA 1VCPA 3SUEA 1UVOA 3ELAH 1AZ8A 1F0SA 2WINI 3MO6A 3UY9A 2HWLB 1PQ8A 2UUKB 2W7SA 3SU3A 1BTUA 4RI0A 1K9OE 1TBQH 2IJOB 5A0BA 1O2OA 3GOVB 1EZUC 2VGCB 2FM2A 3PLKA 3UUZA 2OQUA 4IMZA 3KQEA 3A87A 4WMFA 1A3EH 1WXRA 2I6SA 4MNXA 4ZMAH 1YPHC 3WWBA 5TJXA 2GKVE 1S81A 3SZNA 3VB7A 4AFQA 1B0FA 1YCPK 3UREA 3DUXH 2I6QA 2JJ2D 1EZQA 1A5GH 1SQAA 1V2LT 1LHFH 5GWZA 5EODA 1DX5M 1DPOA 2H9HA 2BHGA 1ACBE 1TLDA 3MNXA 3RXHA 5F03A 7GCHG 1LKAA 2EC9H 4X8SH 1SPJA 1TIOA 2HGTH 5JYIA 2F9UA 1BB0B 2ZNKH 2BM2A 4TT3D 4OGXA 2VIPA 2ZHDA 4U30A 1HAPH 4LK4A 1TRMA 3GY3A 1GHAG 1D3QB 2BQWB 5ABWA 4MPUA 2P8OB 3GYLB 3NZIA 1JWTA 4JYTA 4BAHB 1W0ZU 2B9LA 2ANMH 1TQ7B 3VXEH 5IK2D 4MPWA 1J9CH 2VWOA 1HIAA 1GBDA 1THPB 2QXIA 1O2QA 1LCYA 3UFAA 5FPYA 1UTKA 1O2MA 2FP7B 4AFUA 2BXUH 2CGAA 1TFXA 2PLXA 5KEDA 2BLWA 1TNIA 3SU5A 6ESTA 2CXVA 3ZVCA 4XRNA 4X8UH 3V13A 1C2DA 5GCHG 2WPIS 3TVJB 1WQVH 2OK5A 2V0BA 1O5EH 2OC8A 1AZZA 1L4DA 4ZCNA 4BTIB 1XXDA 3KQBA 1FXYA 3HK3B 2O9QA 1WDIA 3FVFB 1G32B 1C1QA 1MD8A 1AMHA 1T8OA 3LGUA 1GDUA 2CN0H 3LH3A 1W11U 3TITA 3RXVA 4UEHH 3VPKA 3GCNA 2C8ZB 3ZYDA 1AFQB 4YTAA 5CDFE 1O36A 3FAOA 3PV5A 1DITH 3EE7A 2BLOA 1EX3A 1YPMH 4NGAH 9ESTA 4K2YA 1ZGVA 1KDQA 1GBAA 4DG4A 1LDTT 1F7ZA 1THRH 3MU1A 3FP7E 2AMDA 3LJOA 1FUJA 3NK8A 2AH4X 2PKSB 1S84A 1C5PA 1BA8B 4X6OA 3L6PA 1TOMH 1Y5BT 3NWUA 1ELCA 3GCOA 1V2QT 1B0EA 1YYY1 1GMCG 2B8OH 4D76A 2F91A 3GCHC 2ZU1A 2YNAA 4INKA 2GGVB 3P8GA 2VVVA 4GUXA 1C5MD 4A92A 1NRSH 1K0HA 1CGHA 2YMSD 2AMPA 1UTOA 5GDSH 1EJAA 1AUTC 2B7DH 2WV5A 1BRUP 5AFZH 1AO5A 3GCTF 1ORFA 3A83A 1O2RA 1C1SA 3UNQA 5C5OA 3RXDA 2SGQE 2RCEA 1ELVA 5F53A 3FZZA 4XOJA 1EOLA 1PPBH 2THFB 1K1IA 3LDXH 3SJOA 3UB0A 4AFSA 2A4GA 3RXAA 3T29A 2BQ6B 1SB1H 4CR9A 2FX4A 3SO3A 4AFZA 3LOXA 1FNIA 1PPGE 1C5ZB 1RTLA 1KXBA 3ZZ5A 2CHAB 3OFND 2V6NA 1BBRH 3MO9A 2DUCA 1LTOA 3F9FA 3ZVBA 1LMWB 1FZZA 2Z6BD 1A0LA 4UFFH 3TK5A 1MTNC 1VITF 2W3KA 1C2EA 1UCYK 1VCWA 1O2TA 2KCPA 3MQKC 3TK9A 1DY9A 1DY8A 2OC1A 1C1RA 1GMHF 3Q77A 2SGEE 3S7HB 3UNRA 4JMYA 2CJIA 1OWKA 2J4IA 1AN1E 2FI5E 1F5RA 1NO9H 1Q31A 3SV9A 4A7IB 1GJCB 1Y3XA 4IC5A 1IHSH 2ZQ2A 3RXKA 3SGQE 1KXDA 1G36A 2R0KA 3M5LA 2P3FH 1E34B 1HAZB 1K1OA 8KME2 5K0HA 3I29A 3M3VA 3F9HA 1ZR0A 1G3CA 1GI3A 1SLVB 4RKJB 2PUXB 4O97A 1TX7A 2BXTH 3RXGA 4UFGH 5EQQA 1XXFA 4ASUD 5FPSA 4K1TA 3TNSA 1SQTA 1HJ8A 2H2ZA 1F0RA 3PYHA 4K1SA 3ODDA 1TBRH 4Y76A 1MU8B 2XOKD 4ZH8A 2G4UA 5EPYA 1L1NA 3A7YA 4XDEA 4WH8A 1WTGH 3FN8A 3P95A 1BMLA 2RG3A 5BRRE 2FYQA 2R2MB 3PMAB 2WPHS 2WSSD 3EA7A 4JYVH 1TPAE 3STIA 5A8ZA 1NPMA 1NRPH 3HGNA 5T1VA 1C5QA 2ZI2H 3ATKA 1QJ1B 1FPCH 1NU9A 5F6MA 2XW9A 3S0NA 2WYGA 1PYTC 3AASA 2VIOA 2AHME 3VFEA 1AB9B 1RRKA 2SGPE 3OEED 1C2HA 4ACBA 1CE5A 1OS8A 2IJD1 2JIZD 5EQRA 1FV9A 2A31A 1W13U 4OS5A 4OS6A 5T6GA 2O8WA 1TGTA 1X7AC 1YLDA 1BTWA 3SI4H 4AZ2B 2Y6TA 5L2YH 2A5IA 1KTSB 2XXLA 1DLEA 3P17H 2A2XH 3SNEA 4KTSA 5DP9A 4TWYA 1GDNA 1DVAH 2ZPSA 2BD9A 3EA8A 3UWIA 4BOHA 5HMAA 2VINA 1BMMH 2FOEA 1V2VT 1ZJDA 2ZF0H 1OP8A 1FJSA 3BTEE 5KECA 1EAUA 2KX4A 1G2LA 3RC4A 1GHZA 2AEIH 4ACAA 3KYFA 5DO4H 1U6QA 3D62A 5FBEA 1VITH 2AIQA 3GY5A 2ZGJA 3SN8A 1XUJA 2LP6A 5JPMH 2F4LA 3RXEA 3T5FH 5JBTA 1TB6H 2V7QD 2CMYA 3U98H 4B2CA 4KP0A 3M5OA 1GI2A 4FUCA 1KSNA 1SGPE 3SYJA 1A2CH 2C8WB 2H1UA 1T8LA 1XUFA 2DE9A 1SOTA 1VKYA 2EI6A 2BVSH 2H5CA 3SJ9A 3O8RA 2VU8E 1OP2A 4AB9A 1IOEA 2FX6A 3E90B 3PTNA 2H6MA 4Y7BA 1AU8A 2BVXH 2HNTF 5FPTA 3MOCA 4ESTE 5HIZA 4AYYB 1IQMA 1GJAB 3GY2A 1P2JA 1UTPA 1ZPCA 3TGIE 3QTVH 3OTJE 4DT4A 5FHTA 4H4FA 1EAIA 1TMUH 1EZSC 5C20A 3OYPA 3RM0H 2ZFSA 3A8BA 7ESTE 3QLPH 3P6ZB 1DFPA 5T3HA 1SR5C 4CRGA 3QTOH 2EY4C 1O3CA 1SFQB 3DSPA 3QGNB 3BN9A 3SV8A 4A1TA 2VIDA 2BY9X 1GHAF 2XBXA 3KL6A 1GMDF 2ODYB 4ZKRU 3RU4T 3ATLA 2ZGHA 3A8AA 3ESTA 2L6OA 1H8HD 1V2JT 2HVYB 1WOFA 1A5HA 1O5AB 5LPEA 1L1GA 4Z0KA 4I7YH 4HGCA 3ZIAD 2QA9E 1SI5H 3T2NA 4DW2U 3CP7A 2WPKS 1OHHD 4P02A 2HNTC 3C27B 5CMXH 1VJ9U 1Q3XA 1ZYOA 1J16A 1ZHPA 1P3EA 1YBWA 1C2IA 2VH6A 1TRYA 3AVZA 5GCHF 1QRZA 1O33A 3P70B 1JRSA 3NKKA 3OTPA 2Z3EA 2ZIQH 2GMTB 2ALPA 2ZG0H 1FIZA 1UTQA 4NWLA 4CHAB 1SQRA 1P06A 1GMHG 1Y3WA 1ZTLA 2JETB 2SNWA 2OC0A 1QFKH 1JIMA 3AW1A 1UK2A 1CHGA 1W0KD 1GBKA 2KAIB 4XBDA 2JKHA 3DT0H 4MNWA 4ISHH 2IPHA 1OWIA 4WWYA 1C1PA 2OXSA 3BIVH 3D49H 4X6MA 1CT2E 1UCYH 2A4QA 3M5NA 3SU2A 2QAAA 1AIXH 1P09A 1V2RT 2K8IA 3SUGA 1HJAC 3F0PA 2BDGA 1P02A 4LOYH 4AX9H 3WY8A 3CNRA 2OINA 1T8MA 1PFXC 1MABB 2ZFTA 3SUFA 3KNXA 2TGDA 3SGAE 1AD8H 1TMTH 2VWNA 4R8TB 4X0WU 3MI4A 3I77A 1AVGH 1S85A 1IAUA 3DA9B 2O8TA 4TSFD 1FY3A 4MG3A 1O5GH 3DSOA 1QB9A 2KZ4A 1SL3A 3FFGA 1GMCF 3TH3H 3O8DA 2XC5A 1GI9B 1BMFD 1K22H 3ATMA 2KM0A 2PW8H 2P93A 1TGSZ 3PLBA 1UTNA 1KTTB 2GDEH 2WPJS 1DOJA 1ZJKA 2V3OH 1OXGA 1V2WT 3FZDA 3TGKE 1IQLA 4DIIH 1C5UA 3LIWA 3ZZ6A 1NRNH 1ZLRA 1BJUA 1PPCE 2LNCA 4D7FA 1AE5A 4ZKNU 4UFEH 1O39A 6GCHG 4DOQA 2Z94A 2PUQH 2BD7A 2VB0A 3GCHB 3ZZAA 3WW7A 3BTGE 2P94A 3KIDU 1QJ6B 1CT0E 1AY6H 1OWJA 4O03A 1UMAH 2GDDA 1C1MA 2Y5FA 5CHAC 3M36A 1GBBA 5PTPA 2Z9JA 3MH5A 1DICA 1BTXA 2FOHA 3VB3A 1EKBB 1ELBA 3H7TA 3F1SB 1W7GH 3TH4H 1MTWA 2C8YB 5EU8A 2FZZA 2ZU3A 3MU4A 5C1YA 1ZSLA 4U32A 2YOLA 3HKIB 1O5BB 1GCDA 3K9XB 1YC0A 1CT4E 5DN6D 4WJG2 1Z7KA 3BEUA 4GSOA 1QIXB 3URDA 1BUIA 1OX1A 3NCLA 1NESE 3VG8A 3F3BA 1ZTJA 2J98B 4HFPB 2AGGX 5L30H 3E91A 4FXGH 2Y5HA 4MNYA 1A46H 2RDEA 1P57B 4X2YA 1HV7A 4ABJA 4B6EA 1UHBB 2TGPZ 2WYJA 2A1DB 1TGBA 5E0GA 3T28A 4GHTA 1NFWA 2A7HA 2D2DA 2STAE 3SV2H 1HDTH 4WVPE 1DM4B 1F2SE 1H8ED 2QC2A 1FN8A 3BIUH 4BTUB 1YPLH 4BAMB 1V6DA 3F68H 2HALA 4OGYA 1QBNA 1K1NA 1OOKB 1EAWA 2KR7A 3HATH 1XM1A 2ZA5A 3URCA 5FAHA 2H9EH 1GHBF 1XVMA 5EXMA 3U1IB 1G9IE 1O2SA 3S9CA 3AAUA 3DSGA 2R2WU 3LKWA 4NFEA 1MQ6A 3SV7A 1HAIH 4FUDA 1SKYE 2GJGA 4B71A 1ZMJA 1K28D 1TGCA 4I8HA 5H4IB 4X2WA 4AG2A 1DE7H 1G3EA 1O2KA 1D6RA 1GI7B 1N8OC 2PKAB 1F5KU 2J97A 1OWHA 2BDIA 2HPPH 2W26A 2ESTE 1CSOE 5CHBA 2PHBA 4F49A 4JK6A 1C2KA 1EZXC 1BRCE 2G8TA 2JDID 4CBNA 1V3XA 5F8XA 1VCQA 1DXPA 1GMDG 1C2MA 2GX4A 1BCUH 2FLBH 4X8TH 4GCHG 1Q2WA 1UVPA 1UJ1A 1MKXK 3RC6A 3A7XA 4XSKU 1HXFH 1ANBA 3GICB 1Z8GA 1QA0A 1D4PB 3A7WA 3MH6A 1L2EA 3E8LA 1BIOA 3DCLA 1FAXA 2NU4E 1MQ5A 1O38A 5SGAE 3RMLH 3A86A 1O31A 1YP9A 2BY7X 3LGYA 1GBJA 1P2NA 2XC4A 1CA0C 1TAWA 3RP2A 2F3CE 2QE7D 2BY5X 4UE7H 1Z1IA 2VJ1A 4B75A 3GY8A 1SG8B 4FUIA 1O2JA 4NZQA 4DGJA 1GBLA 3U28C 2JH5D 1C1UH 2FWWA 1QRWA 2PGQB 1LHCH 4FETA 3QX5H 1E1RD 4NIXA 1C5RA 1TQ0B 4RT0A 1AE8H 1F0UA 2VIVA 1E35B 1TMBH 1QRXA 1S6HA 1C5XB 5DKMA 1Y3YA 1DLKB 2A32A 1YWUA 3LGIA 4H42U 5GNDA 1NROH 5DPAA 2PTCE 4NFFA 5KGOA 1BT7A 2ANYA 2A45B 4I31A 4YOIA 5L6NH 1UK4A 1O0DH 2BVRH 1ZOMA 3WWFA 1G37A 3QZQA 3SU0A 1ESAA 1ID5H 2Y5GA 3SU1A 1YPKH 2HRVA 1SMFE 3U9AH 3ODFA 1FX0B 1TNGA 3LC5A 3P8FA 1V2OT 1K1MA 2OLGA 2WUBA 3SJIA 2WPMS 1C9PA 1EP6A 1OKXA 2FOGA 2GZ7A 1YCPM 2W3IA 2JH6D 1BHXF 1QBOA 1GI8B 1KIGH 2Z7FE 6CHAB 4JZ1A 1C1WH 5C3NA 2WHXA 4OM9A 1BZXE 4IC6A 1SHHB 4PROA 1MTSA 1QGFA 4JZFH 2ZWLH 1LKBA 1COWD 3P92A 2QF0A 1EB1H 3KHVA 4RKOB 2A5KA 4FU7A 3BTFE 1DWDH 1EPTB 2AYWA 2VVUA 1P2KA 1S5SA 3DFJA 4RSPA 1A0JA 3Q76A 1Z6EA 4NIWA 2XWBI 2VBCA 2J9NA 2TGAA 5AHGH 4Y11E 1KMHB 4FUFA 5L2ZH 5I46H 2G55A 4KGAA 1QB1A 2PWXA 2BD2A 5AFYH 1BRAA 2OBOA 1VR1H 3M3SA 4ABAA 1P11E 1GI1A 1EFRD 1AKSB 3QGJA 1VGCC 4Y0ZE 4YT6H 1JXPA 1EB2A 5JBBS 3ZZCA 5GPIB 1GGDB 2ODPA 3PO1C 2J95A 3VGCC 2ANKH 2BOHB 4FUHA 4X1PU 1CQQA 1XKBC 2OCVB 4NG9H 2HOBA 1GJDB 2H9TH 2V3MA 2VWMA 4CRAA 1N6YA 4MTBA 5GXPA 3PM3A 1CU1A 3KCGH 3OEHD 2VIWA 1EATA 1V2TT 5A8XA 1OPHB 1O3KA 1ANCA 2ZDMA 1ETTH 1SFIA 1YPJH 3B23B 1AGJA 4BNRA 1SBWA 5TCAA 2PTNA 8LPRA 3GY4A 5JBCS 2WV4A 3LGWA 2FS8A 1BMAA 1IQGA 4OS4A 1G2MA 5T6DA 1HIAB 2V3HH 1YF4A 1ABJH 1K21H 1MZAA 3FO8D 3SHCH 2M5TA 1JMOH 8ESTE 3T27A 3BEFB 1GBCA 1WCZA 1WTHD 1E37B 2UUJB 3RXTA 2XRCA 3A89A 2Y81A 2FIRH 3P8OA 1O5DH 1LVYA 5FX6A 2Q6GA 1YGCH 4IN2A 4ZXYH 3TJNA 4ABHA 1WUNH 1HPGA 3PRDA 2VGCC 4AG1A 4P00A 1Z6JH 5IDKA 2FLRH 1NFXA 3MNBA 1EXFA 3Q3XA 2F9OA 1QNJA 2XBVA 3MFJA 3BTWE 1S6LA 3SU4A 2BX3A 5CE1A 1J15A 2F9BH 4MDSA 4ZKSU 1O3LA 1YPHE 3UWJH 1GHBG 4YLQH 3U8TH 1FLEE 3I78A 1OP0A 1IQKA 4WXVA 3EDXB 2ZCKP 4UD9H 3RXPA 1TA2A 3BG4B 2QY0B 4DJZB 2BD4A 1F92A 1Z71A 2ZHFH 1SGQE 2ZCHP 5ESTE 2GD4B 4TY6A 1SGIB 1DUEA 2FYRA 4NSVA 3RXRA 4VGCB 1YCPH 5GJ4B 2BY6X 1MH0A 1O3DA 4I33A 2W7UA 2UWLA 2OD3B 3RLYH 1J8AA 5ETXA 1L0ZA 1FY8E 6GCHF 1ANDA 1TNLA 3K65B 4BAQB 5ESBA 2XWAA 1MUEB 2P8OC 1GCTB 3ZZ8A 1NC6A 3TLOA 2SGDE 1ARCA 3UR9A 1GWAA 3ZVAA 3IITA 4JZIA 4B2BA 1C2JA 5TCCA 1HAVB 2BLVA 3QO6A 3NRLA 4CH8B 3S9AA 1QB6A 4K1EA 1SLWB 1MBQA 1ZMLA 1MKXH 2QF5A 3RU4E 1SLUB 1MKWK 1TPPA 5EGMA 4DURA 2K0QA 1ZPBA 3TJUA 3RXJA 3SI3H 1LPGB 1BMNH 2ANWA 9LPRA 3TJVA 2OUAA 2KCAA 5B6OA 1FY1A 2R0LA 2GT7A 3TU7H 1O2PA 1WV7H 1O3GA 2KAIA 2C93B 1NRQH 1QL9A 3BTME 1K1PA 4J1YA 4JZDH 1TONA 4I8KA 1QHRB 1YPGH 3ZVEA 3HK6B 3SW2B 1GDQA 2EA3A 1AFQC 1SGRE 4HI3A 1Z8IB 2IN2A 4K69A 1A1RA 4E05H 2G4TA 2ZGXH 2TRMA 1E0FD 1P01A 2ZU5A 1BBRE 2B0FA 1GHVH 1CBWB 1LHGH 2NU3E 3KN2A 1KXEA 8GCHF 5EJ1A 1O35A 1V2ST 1AHTH 4ISNA 4WF8A 1ARBA 5C17A 2BDBA 2PKSC 5F8ZA 3LGTA 4K8BA 2FOAA 1UVTH 3B8JA 1G3BA 2C8XB 2O8MA 1JRTA 1T8NA 4F48B 3ATIA 3OE7D 5EOKA 3P8NA 1NBME 1QTFA 3BV9B 3UNSA 1MU6B 3MH7A 2WPLS 1QR3E 7KMEH 4ZUHA 3EQ0H 2Y80A 1XUIA 1ZGIA 4NSYA 4BAKB 2XC0A 4K60A 2C90B 2Z9GA 1NFYA 1GJ8B 4CR5A 5G4BA 3W95A 1FPHH 1TX6A 4UONA 3T62A 4OS2A 2ZP0H 3M35A 5JBAS 2ZCLP 4YESB 3BG8A 3VB6A 1PPZA 2FOFA 3M7UA 4CRBA 1A0HB 3A8DA 4Y7AA 4GCHF 3PMBB 1RTFB 1HB0B 4FUGA 2Z3DA 1DSTA 4YXWD 1V2NT 2F83A 1KXCA 4X2XA 1V2KT 3K6YA 1NN6A 3PRBA 3QUMP 3M7QA 1BOQA 1Y8TA 3G01A 2BX4A 3R0FA 2AIPA 2HVXA 3QZRA 2GZ8A 4AORA 5LH8A 2PGBB 2CHAC 3QWCH 1SSXA 4Y0YE 3ZVDA 1O3BA 4TPYA 1O3IA 1W14U 1QJ7B 2QV1A
chains in the Genus database with same CATH topology
3SNDA 2ZU4A 2ZFPH 1MCTA 5DP8A 1MTUA 1C4U2 1C1TA 3SNBA 4WXIA 4KTUA 1NM6A 1NTPA 2P59A 5C2ZA 1KLTA 2VNTA 5HM9A 1AWFH 3M37A 1FDPA 5F8TA 4XFQA 1FIWA 4ABBA 1UHBA 3PV4A 4X2VA 5DK1A 4YOJA 3HKJB 3TGJE 3UOUA 4NCYA 5K7RA 2FPZA 1ANEA 1KLIH 2XBWA 1UO6A 1P2IA 1O3OA 1QA7A 4MNVA 3V7TA 3S69A 1HUTH 4ZHAA 2ZFQH 1XVOA 3SQHE 3U1JB 3EAJA 2ZKSA 4TWWA 4CRCA 1XUKA 1JBUH 3Q3YA 4KTCA 4BANB 4IMQA 4GHQA 1GG6C 1JOUB 2TGTA 3LGVA 4OS7A 4K5ZA 1F0TA 3Q00A 1CGJE 1LO6A 5E2PA 2EI8A 2J2UA 4INLA 1SGFG 3SBKA 1YPEH 1QQUA 2ZDKA 5FCRA 2H5DA 1O2GH 4YM9A 1GJBB 4IW4E 2ZGCA 1P9UA 1ZZZA 2FI4E 1W7XH 3LJJA 1ZHMA 3LU9B 4R0IA 3SORA 1W0YH 4U2WA 4B2AA 3GISB 2YNBA 4WH6A 1D3PB 4TYDA 5A0AE 1UVUH 4INHA 2PKAA 1P9SA 1T32A 1B5GH 2HLCA 4I8GA 3S7KB 4ABFA 4LZ1H 1DWCH 3FP6E 1IQEA 3RXLA 1B7XB 1O2NA 3O8CA 4MPXA 1GBFA 2VWLA 3ZYEA 5A8YA 4Y8ZA 1GL1A 1Y5AT 1ESTA 1V2UT 4U01A 4IS5A 1FY5A 4ABDA 2P16A 1AB9C 1GBEA 1GJ7B 4ISLA 2BD3A 1MTVA 1SGFA 3K6ZA 4NA8A 1HAXB 3PROA 1C2LA 1OWEA 2A2QH 2GVFA 4ZHLU 2ZTZA 1LQDB 1P8VC 1ZRBA 1IQHA 2BD8A 3STJA 5I25A 5IYTA 3RXCA 4E06H 3R3GB 1GJ6A 2FS9A 1W8BH 3VGCB 1XUGA 2ZU2A 2ALVA 1EOJA 1P05A 1AWHB 2A4RA 3KEEA 3BTTE 1SGYE 5EXLA 2UUFB 5LPRA 1MZDA 1O34A 3SQEE 3RXSA 2SFAA 4WY3A 5HGGA 1XMNB 2QCYA 1SC8U 1C5TA 5T6FA 1Z8JB 1MKWH 4NA7A 1RFNA 2SGFE 4CREA 1GL0E 4MVNA 4BTTB 1ZRKA 1F5LA 2Z9KA 3OX7U 1MTNB 5DP3A 1AFEH 2VIQA 4HZHA 4NIYA 2PV9B 3BEIB 4YT7H 2QXJA 4XE4A 3VB4A 2XNIA 2PFEA 1HLTH 3PLPA 3E0NB 1PPFE 7LPRA 3F9GA 5C1XA 3E6PH 1IQFA 4F4OC 8GCHG 3MHWU 2V35A 1C5LH 4Y71A 5DP7A 1HYLA 1O3JA 4XBCA 1C5WB 2OP9A 1FI8A 1TNHA 3E1XB 3T25A 1L4ZA 1EPTA 4X1SU 3U8RH 2GCTC 1TABE 1BRBE 1K2I1 3ATWA 2FOCA 1SGNE 2G5NA 3TIUA 1K1LA 1P04A 2G5VA 2ZFRH 4FU9A 3RMMH 1OWDA 1UCYE 1WQSA 3L3TA 3AW0A 1OYTH 2IOTA 4ABIA 1BDAA 2XYAA 2BQ7B 1ELEE 4LZ4B 1AKSA 4Y8XA 1C1OA 1TGNA 4B74A 3CS0A 3ITIA 3UPEA 3VEQB 1H9IE 1NY22 3RDZA 2AGEX 5FXLA 1AI8H 2R3UA 2SNVA 3OY5U 1ELAA 2ZDAH 1S82A 1S6FA 1O30A 1TOCB 1IQJA 1ZTKA 2FO9A 1NRRH 1C1NA 2ZQ1A 5E0JA 1O2VA 1P10A 4UFDH 3VXFH 1ABIH 3RMNH 1P2QA 2PR3A 2GT8A 4YLUA 1BITA 2AGIX 1MBMA 1TYNA 4KKDA 5HXFA 4WMDA 1W3CA 5E2OA 5J4QA 2D1JA 2AMQA 4D7GA 2GV7A 2HNTE 4O9VA 2UUYA 2BDHA 4GAWA 3C1KA 1LQEA 3W94A 2Q6DA 5HYOA 1A61H 1ZPZA 4AOQA 1T4UH 4XBBA 1DWEH 2GMTC 1MAYA 2J38A 1Y5UT 4CHAC 5FCKA 1ZSKA 4TY7A 5DP5A 3PWCA 1H9LB 4ZHMU 3Q3KA 2JETC 3EYDA 6LPRA 3EA9A 2PSYA 1UVSH 2FTMA 5EPNA 2FOBA 1N1LA 3RC5A 3FP8E 4H6SB 4NA9H 5LGOA 4H6TA 2AERH 1SOZA 3NXPA 2XTTB 1TALA 1PQ5A 2BB4A 1LVMA 2TBSA 3ZZ3A 1K1JA 1GBIA 1MAXA 1OSSA 2A4OA 3MU8A 3F9EA 1M9UA 3B9FH 3OY6U 3AAVA 4DVAU 3E3TA 2ILNA 2ZHEH 2OQ5A 1HXEH 1O5FH 2BDYA 2EEKA 1GJ5H 3BSQA 1LHEH 2K1QA 1T7CA 4I8JA 1NU7B 5DP4A 4MLFB 3GY6A 1NS3A 2QXHA 4B1TA 1C5NH 4GLYA 4LXBH 3TK6A 3RM2H 4NIVA 2GZ9A 2ZECA 2P3TB 3IWMA 3N7OA 2CF8H 1S83A 3K2UA 1G30B 4IGDA 1C5SA 1D9IA 5DP6A 1GBHA 2B5TB 5EG4A 3HPTB 1TA6A 1ETSH 3KF2A 2ZEBA 3MO3A 1SHYA 4JYUH 4Q7YA 2Q6FA 3SV6A 3NPSA 1WYKA 5LPFA 2QIQA 3UQOA 1TBZH 1BTZA 2TIOA 1THSH 4HTCH 1RGQA 2ZHWH 2BD5A 1GI4A 1QL7A 1W10U 4FVDA 2XBYA 4FUEA 1ESBA 1HAVA 1QY6A 2BYAX 3ZZ7A 3ZZBA 3BTHE 2F9NA 2Y82A 1MMJN 1W12U 1SQOA 2VH0A 1H1BA 3PMJA 2ZDNA 2P95A 4AGJA 1O32A 3S9BA 3D65E 3UR6A 1GVLA 1O37A 2FODA 2OTVA 2OBQA 3QK1A 1T4VH 4BXWA 1XUHA 4Q2KA 2G51A 1JIRA 3TH2H 1GPZA 3SU6A 4ISOA 1GBMA 1O3NA 1HBTH 1O2LA 1YM0A 3U69H 1QL8A 5JB8S 2C4FH 4X1NU 1UTLM 3A85A 1WAYB 2ZDVH 3MTYA 1RIWC 1T31A 2J94A 1P12E 4FUBA 1DXWA 1J14A 1Z1JA 1O2HA 4Z6AH 5AF9H 1A4WH 3SJ8A 1DSUA 3JZ2B 2FTLE 1GI6A 2Z9LA 4Q7XA 4YZUA 1EAXA 1HAYB 1D6WA 1DANH 1P03A 3FANA 4AYVB 5EW1H 3MU0A 1ELTA 1GHWH 1DT2A 3EGKH 1HAOH 4A1VA 2ZFFH 2CF9H 4DCDA 1MD7A 3ZVFA 3TNTA 1VJAU 3RXMA 1HJAB 3GYMA 4X6PA 3BTDE 1SGDE 3LC3A 1XKAC 3UQVA 1WBGB 4ABEA 3V0XA 4D9QA 1BTYA 3SGBE 1D3DB 1AQ7A 1GG6B 1SGTA 4SGBE 5A2MH 1KDQB 5A0CA 2GCHF 2W5EA 4Y8YA 1H8IH 1MCVA 1CVWH 1YLCA 2ZHQH 3A7TA 1GVZA 3RLWH 1P2MA 1O3FA 2G81E 3EE0B 3GY7A 3LT3A 1FMGA 3ZV9A 2A0QB 1QCPA 1PQAA 2NU2E 5FX5A 3PWBA 2NU0E 2ZO3H 4NZLA 1H8DH 2P3UB 5AVDA 2ZZUH 1O2WA 4I32A 1P3CA 1EJMA 4Q7ZA 5HM2A 1OYQA 1RTKA 4FUJA 1ZHRA 3GDSA 4M7GA 3E16B 3ENSB 1NZQH 1ELFA 4WMEA 3BTKE 1LPZB 1TNKA 2ZPQA 1LVOA 5DGJA 4A1XA 3V12A 3SOSA 4X6NA 3GDUA 1C2GA 5CHAB 2FDAA 2BTCE 3RXOA 1CA8B 4O3TA 5A09A 2BDAA 3DHKH 1O3EA 3SNCA 1FAKH 3A7VA 1DWBH 1FY4A 3CENA 1RXPA 3F6UH 1NT1A 4AB8A 2Y7ZA 1NFUA 1C5VA 1SVPA 3SUDA 1EJNA 3SNAA 3CS7A 1WU1A 2GP9B 3LPRA 1EASA 4J2YB 2J92A 3LH1A 2QN5T 3M5MA 4ABGA 2R3YA 4B73A 1CHOF 3ZZ9A 3JZ1B 1IHTH 4DT7B 1PPEE 1ZMNA 4DIHH 1QBVH 4GPGA 1O3AA 1C4V2 3RU4D 2AFQB 5JB9S 1ETRH 2BZAA 6CHAC 1RJXB 4BXSA 3BF6H 2C3SA 3UIRA 4CBOA 2A7JA 1G3DA 1AVWA 2BZ6H 5EXNA 3H7OA 3OSYA 2ZC9H 1TPOA 1D3TB 1LPKB 3MMGA 2A5AA 1EPTC 4Y10E 4I8LA 4X1RU 3SHAH 5FBIA 4AGKA 3TPIZ 2F9PA 1C2FA 1GHYH 3ZV8A 1ELDE 4FU8A 1P2OA 3A82A 2NU1E 1H4WA 1KY9A 2WUCA 4K3JA 1V2PT 1EP5A 1KLJH 1GVKB 3A7ZA 1S0RA 1HJ9A 1GJ9B 4CRFA 3RMOH 1O2XA 3MWIU 5C1UA 2GCTB 1BTHH 3E0PB 1TWXB 2UWPA 4OS1A 3A88A 3M7TA 3IG6B 5EW2H 1A3BH 1KYNA 2Q1JA 2O8LA 5E0HA 5C67A 1Y3UA 1GGDC 2CV3A 2J34A 4MPVA 4AN7A 2RA3A 1EUFA 1O5CB 3V3MA 7GCHF 1ZSJA 2VVCA 5C5NA 2R9PA 3H5CB 3U8OH 1N8OB 1TPSA 2JH0D 2FOMB 5DJ7A 2BY8X 3M3TA 4X1QU 1FN6A 1Y59T 1CGIE 2ULLA 4A5TS 3GCTG 4ZKOU 3DD2H 2QYIA 1A7SA 4CRDA 4D8NA 2ZGBH 3O8BA 2HPQH 3OU0A 3L33A 1GI0A 4SGAE 1Z8RA 1RD3B 4ZAEA 4O3UA 1H9HE 3KQDA 2O8UA 1LVBA 1C4Y2 1FQ3A 1SGCA 4FVBA 1PJPA 4JK5A 1QURH 1CA0B 1AUJA 4THNH 1DS2E 5E8EH 2RDLA 2D8WA 4NWKA 1TRNA 1V2MT 2AS9A 5EQSA 1VITG 1HRTH 4ISIH 4TPIZ 3LONA 4CH2B 4ZROA 1TE0A 1J17T 1SLXB 2ASUB 3BTQE 3RXQA 2ZDLA 3MNSA 4IBLH 4D9RA 1O2YA 3MNCA 4K8YA 3DFLA 4A6LA 2STBE 3ZVGA 1L1JA 1O3PB 5J4SA 2EI7A 2FXRA 2BMGB 1KXAA 1HGTH 4IN1A 3T26A 3QDZB 3M61U 3RXUA 1HAHH 1C1VH 3A8CA 2Z3CA 2FESH 4Y6DA 2TPIZ 1EQ9A 2SGAA 3UTUH 5GIBA 1VZQH 1Y3VA 3BG4C 1GJ4H 3KGPA 2OC7A 1GHXH 3UOPA 2GCHG 1AVXA 1TX8A 2QXGA 2RA0A 4VGCC 1P0SH 2FEQH 2FMJA 4Y79A 2ZTXA 2A7CA 1O2IA 1QQ4A 4UDWH 2DE8A 1BJVA 1N6XA 4JCNA 4KELA 1E38B 2F9VA 1GCTC 2D26C 3ZZ4A 4X8VH 2ODQA 2UWOA 3SJKA 2XCNA 2QF3A 3PMHB 1A5IA 4E7NA 1BTPA 2ZTYA 1SGEE 3MH4A 1KXFA 3D23A 2ZPRA 3A81A 3MU5A 1VGCB 3RXIA 3RXFA 4B76A 3A84A 3MYWA 4Q80A 1UTJA 3KQCA 1O2ZA 4MQAA 4QT8C 1O2UA 3PO1B 3RUOA 4DY7B 3VB5A 1INCA 1S0QA 4YOGA 1BBRK 1BQYA 1HNEE 5DG6A 5JDUB 2Z9IA 1YKTA 1BHXB 2QGRA 3HGPA 4YO9A 2FI3E 1HAGE 1PQ7A 3GDVA 3PTBA 1C9TA 2NWNA 1HCGA 1XX9A 1UK3A 4ASHA 1O3HA 4BAOB 3ZZDA 1C5OH 2GV6A 2XCFA 4GVUA 1ELGA 1CO7E 1O3MA 2LPRA 1UTMA 2Y7XA 3A80A 3NUMA 3PB1E 1PPHE 1LHDH 4ZXXH 1IQNA 4JZEH 1GBTA 1GI5A 1C5YB 1DDJA 1RS0A 2BOKA 2G52A 1PYTD 1HFDA 3QN7A 1TNJA 2BLQA 1E36B 1CHOG 2GTBA 2G00A 1W2KH 1WSSH 2BDCA 3RXBA 1CBWC 1IQIA 1RIWB 1FONA 4E7RG 2PSXA 3TJOA 4RN6A 1DUAA 5BPEA 1VCPA 3SUEA 1UVOA 3ELAH 1AZ8A 1F0SA 2WINI 3MO6A 3UY9A 2HWLB 1PQ8A 2UUKB 2W7SA 3SU3A 1BTUA 1K9OE 1TBQH 2IJOB 5A0BA 1O2OA 3GOVB 1EZUC 2VGCB 2FM2A 3PLKA 3UUZA 2OQUA 4IMZA 3KQEA 3A87A 4WMFA 1A3EH 2I6SA 4MNXA 4ZMAH 1YPHC 5TJXA 2GKVE 1S81A 3SZNA 3VB7A 4AFQA 1B0FA 1YCPK 3UREA 3DUXH 2I6QA 1EZQA 1A5GH 1SQAA 1V2LT 1LHFH 5GWZA 5EODA 1DX5M 1DPOA 2H9HA 2BHGA 1ACBE 1TLDA 3MNXA 3RXHA 5F03A 7GCHG 1LKAA 2EC9H 4X8SH 1SPJA 1TIOA 2HGTH 5JYIA 2F9UA 1BB0B 2ZNKH 2BM2A 4OGXA 2VIPA 2ZHDA 4U30A 1HAPH 4LK4A 1TRMA 3GY3A 1GHAG 1D3QB 2BQWB 5ABWA 4MPUA 2P8OB 3GYLB 3NZIA 1JWTA 4JYTA 4BAHB 1W0ZU 2B9LA 2ANMH 1TQ7B 3VXEH 4MPWA 1J9CH 2VWOA 1HIAA 1GBDA 1THPB 2QXIA 1O2QA 1LCYA 3UFAA 5FPYA 1UTKA 1O2MA 2FP7B 4AFUA 2BXUH 2CGAA 1TFXA 2PLXA 2BLWA 1TNIA 3SU5A 6ESTA 2CXVA 3ZVCA 4X8UH 3V13A 1C2DA 5GCHG 2WPIS 3TVJB 1WQVH 2V0BA 1O5EH 2OC8A 1AZZA 1L4DA 4BTIB 1XXDA 3KQBA 1FXYA 3HK3B 2O9QA 3FVFB 1G32B 1C1QA 1MD8A 1AMHA 1T8OA 3LGUA 1GDUA 2CN0H 3LH3A 1W11U 3TITA 3RXVA 4UEHH 3VPKA 3GCNA 2C8ZB 3ZYDA 1AFQB 4YTAA 1O36A 3FAOA 1DITH 2BLOA 1EX3A 1YPMH 4NGAH 9ESTA 4K2YA 1ZGVA 1KDQA 1GBAA 4DG4A 1LDTT 1F7ZA 1THRH 3MU1A 3FP7E 2AMDA 3LJOA 1FUJA 3NK8A 2AH4X 2PKSB 1S84A 1C5PA 1BA8B 4X6OA 3L6PA 1TOMH 1Y5BT 3NWUA 1ELCA 3GCOA 1V2QT 1B0EA 1YYY1 1GMCG 2B8OH 4D76A 2F91A 3GCHC 2ZU1A 2YNAA