1C1TA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1tA02
5H4IB 3SZNA 2BMGB 1BA8B 2GCHF 1BRAA 5FPSA 3MHWU 4IW4E 1QBNA 1EX3A 1OS8A 2A7JA 1UTKA 2BLWA 1TGTA 1AWFH 1FZZA 4F49A 1H9IE 4Y7AA 4MPUA 3CS0A 1ZHMA 2ANWA 1TA6A 4CRBA 1K1OA 5C1XA 3PYHA 1AUJA 2A4QA 3PWCA 1V3XA 3RXCA 2CMYA 1C2LA 5CMXH 1SMFE 4UE7H 1G9IE 1HPGA 3W95A 4WMFA 1JIMA 1QTFA 2FI5E 4THNH 2FX6A 3ODDA 2BDAA 4FUBA 1GVZA 2CXVA 4UFDH 1H9HE 1NU7B 1B5GH 2FOCA 4IS5A 2PHBA 1GMDF 1P2NA 2ZDKA 1EJAA 2G51A 3E0NB 3RXKA 1C5OH 4MTBA 2Z3DA 1BTPA 1CT0E 2R0LA 1W14U 1P01A 3DA9B 5EQQA 2BY5X 2XYAA 3ZVCA 2B0FA 1LVYA 1GL1A 3Q77A 2VB0A 2ZPQA 4AB8A 1ZLRA 3V7TA 3ZZ9A 1ORFA 3SUDA 1HAVB 3SU2A 1FDPA 1UVSH 5EODA 1RJXB 1UTOA 2AIQA 2ZU1A 4YT6H 2F3CE 5E8EH 1KTSB 2P3FH 4FUJA 2OP9A 1NFUA 1BCUH 1G37A 1LCYA 4ABAA 1MBMA 3H7OA 3BG4B 2HALA 3P70B 1F7ZA 4MPWA 2BHGA 2Y6TA 1G2MA 4B74A 3RXLA 3ITIA 1SOTA 4DCDA 1W0YH 1SLXB 1C9PA 2UUJB 1CU1A 1T4UH 4GAWA 1O3IA 1TNKA 3LGVA 1Q3XA 2JH0D 3SI3H 1RTFB 1AUTC 3GY6A 1CGIE 2LNCA 1FNIA 1B0FA 3SV6A 3KL6A 1XUIA 1ELCA 1GBBA 1ZSLA 3GOVB 1DFPA 3BG4C 1UVPA 2P16A 2ZECA 1AZZA 2ZCKP 1VCQA 2PUXB 1V2RT 2Z9IA 1SQAA 1GJDB 1UK4A 3KQCA 4AB9A 4Q2KA 1SGRE 2BVXH 1HXFH 2NU2E 4ZMAH 3VB4A 3D23A 1V6DA 1HV7A 2F9UA 1LO6A 2GKVE 3QLPH 1C5WB 3IG6B 1GBFA 1WUNH 1JIRA 4MNXA 2FX4A 2AIPA 5A0AE 3URDA 1MKXK 4DIIH 3OSYA 2A31A 3RUOA 2FZZA 2WPLS 5FX6A 2H9EH 1DXWA 3ZV8A 2BDIA 2CF9H 3VFEA 3NK8A 1A0LA 2ZQ2A 4FXGH 3PMJA 2ZFRH 3LGIA 3SU4A 2TGDA 3GCNA 3LGUA 1WSSH 4BAOB 3DUXH 3RU4E 3F6UH 1IQKA 3SGAE 1XUGA 3BTDE 3K65B 2UUYA 1EXFA 3SOSA 3OY5U 1O31A 2Y81A 1H9LB 3L3TA 4DURA 1D3PB 1ZJDA 2D2DA 2XBWA 2F9PA 1QA7A 1HIAB 2XRCA 3JZ1B 8GCHF 1O5AB 2FXRA 1WBGB 2Q6FA 2Z9LA 1ETTH 1P06A 1KLIH 1K1PA 3UR6A 2FODA 2Y7XA 4TYDA 5FHTA 3A7WA 1BBRK 3A8CA 1EATA 4YZUA 2GV7A 3M3SA 3SORA 1C5RA 3ATKA 4X1RU 5JBTA 1UCYE 1TWXB 3BTKE 1VJAU 2J4IA 1GJBB 4ISLA 2QXIA 2VIVA 5LGOA 1GCTB 5T6DA 2AGIX 2ZZUH 2XC5A 1Z7KA 1PYTD 2F9BH 1AGJA 1BIOA 4MNVA 5EU8A 2GMTB 1DLEA 2Z94A 3RMOH 3ZYEA 3MU5A 2FOEA 1KDQA 1O3MA 1GJ7B 3RXSA 2VJ1A 1AN1E 3S9AA 1YPJH 4H6TA 1C1PA 1SL3A 4JYTA 2VH6A 2ZC9H 4D9RA 1C5ZB 3TPIZ 2Y5FA 3M36A 2WPIS 3HKJB 1P2OA 1OX1A 1QB9A 2F9VA 5A09A 1D3TB 4FUHA 1MKWK 1AVXA 3UY9A 3M35A 1HXEH 3W94A 1GCTC 3T5FH 4CR5A 3KF2A 2QF3A 3I78A 5ETXA 2WPMS 2STAE 3RM2H 4NWLA 4ABJA 5JDUB 2FMJA 3PM3A 2GMTC 1QNJA 1ACBE 4FUGA 4JYVH 3RXPA 4E06H 1KXFA 5K0HA 1O2SA 1ZSJA 1MH0A 5JYIA 2XC0A 3QTVH 2QXGA 1DOJA 1O34A 3ZZ4A 1A3BH 2VNTA 1WTGH 2SGPE 1TAWA 3ATMA 1GHXH 1OP8A 4WMEA 1FJSA 1AQ7A 4A1XA 2ZO3H 1SGFA 1GI1A 4D7GA 5E0GA 2ZDAH 1KSNA 1MCVA 1P02A 1PPZA 2BY9X 1EZUC 4Y6DA 5CE1A 2TRMA 4Q80A 3UOUA 5A8XA 1C1VH 1LHDH 2NU0E 1G30B 3TK6A 2FOMB 2WYJA 1HB0B 2P95A 8GCHG 2H1UA 1F5LA 1F92A 1S81A 3TITA 4D7FA 1QRXA 1A3EH 2GVFA 5C1UA 1MTUA 4INHA 3T2NA 4CRAA 4DVAU 3QUMP 3BSQA 1ZYOA 2ANMH 3ZVGA 3SU1A 3ATIA 2TIOA 1EQ9A 1V2LT 4I8GA 3R0FA 1FIZA 1DDJA 1EKBB 2VIQA 4GHTA 3MNXA 2ZQ1A 4JZDH 1NFYA 1TFXA 5EPNA 1TLDA 1ABJH 1NS3A 3PLKA 1FAKH 1XUHA 3MOCA 1LHFH 1A0JA 1UTQA 5GCHF 2BD9A 5LPRA 5L2YH 2A5KA 1P12E 2BDYA 4WY3A 1L1GA 1P11E 3LIWA 4K5ZA 1BT7A 1T7CA 5T6FA 2SGDE 1S85A 2GDEH 1W13U 3A8BA 3SQEE 4KTSA 1TPOA 2CF8H 2H5DA 1C5MD 1LDTT 4LK4A 3PO1B 1MUEB 1GDQA 1VITG 3RP2A 3URCA 1IQGA 2V3HH 2K1QA 2OC1A 1X7AC 1Z8GA 2FESH 3HPTB 1C5TA 1MQ5A 2R2WU 1ZGIA 3PROA 4X2VA 1C4V2 1Y3UA 2UWPA 4BANB 4FVBA 3F9FA 2C93B 1O37A 3SI4H 1KXBA 1UVUH 2YOLA 1O2WA 2J95A 1GMCF 5E0JA 2FI4E 5ESTE 2P94A 1P10A 3CS7A 3EA9A 4CH2B 3ZZ5A 1TRMA 3KEEA 1G32B 3LDXH 1MAYA 3OTJE 5B6OA 3EGKH 4BAKB 5EPYA 4NSYA 4AGJA 2WYGA 3PO1C 4CRCA 3SUGA 2VVCA 4O3TA 3ZZ8A 4KTCA 3I77A 4ZH8A 4Y71A 3UNSA 1QY6A 1DUAA 3V13A 2Z7FE 2QYIA 1ETRH 2QXHA 4CREA 1MD8A 1TNIA 2Z6BD 4I7YH 4NCYA 2SGFE 3KGPA 2XBYA 2GP9B 1YCPM 2VIDA 2BDBA 2W5EA 3A7XA 4X1QU 4ZROA 4Y10E 3LH3A 4NZLA 1C2GA 3BF6H 1C2IA 4NZQA 4DGJA 1HYLA 2BY6X 2NU3E 4K8BA 2BQ6B 1C2FA 3MU8A 4B75A 1GI4A 1FPHH 3EYDA 3SJKA 1DY9A 1QL7A 5EQRA 1O33A 4YLQH 3EDXB 1ZTJA 2F83A 4AOQA 2LPRA 2BD2A 2OBQA 2ZFPH 1V2TT 2PSYA 4O3UA 1CHOG 1AHTH 2PKAB 1QRWA 1UTNA 3VB7A 1BBRH 3MU1A 2QA9E 5A8ZA 2BY8X 3RXUA 3SGQE 5GCHG 1HAHH 2AMPA 2XBXA 2VWMA 4WF8A 1PQ5A 3TIUA 1V2KT 1XKBC 1ESTA 1FLEE 5DO4H 1SB1H 2AGGX 2ZWLH 1WU1A 2FYQA 3MU4A 4ZUHA 2ZGXH 1O3GA 3AVZA 1NO9H 2HRVA 2GDDA 1YCPK 4Q7XA 3MO9A 3NCLA 1K28D 1HAYB 1G2LA 3M3TA 2FI3E 3LGTA 3GY4A 3K6ZA 1FQ3A 1O5EH 1C1RA 1LQDB 1OXGA 1TB6H 1VZQH 1KXDA 1TNLA 1PJPA 2Y82A 1O35A 3HK6B 3QZQA 2VIOA 4Y0YE 2OC0A 4UFEH 4FUDA 5TCCA 4UONA 1L2EA 1HAOH 1TQ0B 2AGEX 5TCAA 1MKWH 1O5GH 1SQOA 5DP4A 3BTGE 2VVUA 4X6PA 1ZJKA 1NT1A 3UQVA 1U6QA 1GMHG 4ABHA 3UPEA 1IOEA 1AI8H 1EJNA 2R9PA 2ZU3A 5EW1H 2O9QA 1A0HB 2ZI2H 4F4OC 5DP5A 8LPRA 2GD4B 3ATWA 2OQ5A 1ARCA 2C8XB 2OQUA 1HJAB 4B2CA 5FCRA 1Z8IB 1CT2E 1V2MT 2VINA 4U2WA 1MD7A 3HATH 2PKSB 3GICB 4FU7A 1EP6A 2FYRA 4NIWA 1S0RA 4Y79A 1BTZA 4IMZA 2B8OH 6GCHF 3A88A 1NC6A 4X2XA 1ZPBA 1J9CH 1SPJA 1F0TA 4ISIH 4X1SU 2RA3A 1YPGH 5EXNA 3LPRA 1WTHD 3S9BA 1T8NA 1HCGA 3M37A 4OS6A 3MH6A 1HJAC 1QJ1B 3QGJA 2RA0A 2VWNA 5FAHA 3SGBE 1WV7H 2BVRH 1EZXC 2GZ8A 4KGAA 4FUIA 2PKSC 1XMNB 1OYTH 4NIXA 4E7NA 1CE5A 2CN0H 4Z0KA 4DJZB 3A8AA 3IWMA 4WJG2 4JK6A 1YPLH 3LOXA 2EI7A 3OU0A 2FLRH 4RKJB 2WV5A 4B76A 3MWIU 1AZ8A 2SGEE 2XWAA 3KQBA 2Z9GA 4X8TH 4CRGA 4R8TB 2TBSA 3A85A 3KN2A 4NIVA 4FUFA 4D76A 1L4ZA 1V2WT 4YO9A 3TVJB 4U32A 3FZDA 1QBVH 2O8WA 1TGNA 2A1DB 1O3AA 3S7KB 1UJ1A 4K1TA 2A5AA 3ELAH 1C1SA 4OS5A 3RMLH 3GY3A 4IBLH 1SOZA 4Y11E 5EXMA 3DHKH 2W3IA 1V2VT 4H4FA 4AG1A 2BXUH 3ZZCA 4GUXA 1RGQA 2V35A 1ZHPA 3RDZA 3TU7H 5JB8S 4OS2A 1K2I1 1ZR0A 5DP9A 5E2PA 3PTNA 3Q76A 3SO3A 1C4Y2 1MTWA 3F9EA 4I8JA 4JK5A 2VIPA 3GCTF 3TK5A 2R0KA 1C2JA 3GY5A 2GGVB 1ZMJA 2IJOB 5E0HA 1EUFA 1BMMH 1WCZA 3O8BA 1C2EA 1MQ6A 1A2CH 3F9GA 2DE8A 4O03A 1BQYA 1EB1H 1TOMH 3A7YA 1GBHA 1SQTA 1Y5BT 1YC0A 2BTCE 1O5DH 1NESE 1INCA 3IITA 1G3BA 3S0NA 4GHQA 5C5OA 2ZEBA 3KHVA 4A7IB 1ZGVA 1A46H 2FP7B 5T3HA 2ZF0H 1SGDE 4MG3A 2ZHFH 1BTXA 1LVMA 3TJNA 3D62A 2H9HA 3SHCH 4MPVA 2OINA 2G52A 1BHXB 5DKMA 1FY5A 4AFZA 2RG3A 1V2PT 2BD7A 1JWTA 1GI6A 1GVKB 1TX7A 2OLGA 1W0ZU 2OD3B 3O8RA 2GZ7A 3QK1A 3SN8A 1NFXA 1YCPH 1YPEH 1OKXA 2GCHG 4RKOB 2VH0A 4NA9H 7ESTE 3KCGH 3RM0H 1ANBA 1UTPA 1D6RA 5DP3A 4MPXA 1EB2A 2C4FH 1SGNE 2KAIB 4Y8ZA 4K1SA 4A5TS 3PV4A 3LJOA 1A61H 2OC8A 1PPFE 3E90B 1K9OE 1GJ8B 2OXSA 3FVFB 2Q6GA 1NTPA 1YBWA 3LONA 1T8OA 3M61U 1GBIA 1YKTA 1EOLA 3GCOA 4E7RG 3BIVH 2AERH 4DIHH 2V0BA 1YLCA 1HUTH 4ESTE 2HNTC 3RC4A 2FEQH 1NRNH 3ZZ7A 1UCYK 5SGAE 1M9UA 5EW2H 1GMDG 1VGCB 2OUAA 2CHAB 1CO7E 1J17T 1O2KA 1LHEH 3GCTG 4GCHF 4K60A 6CHAB 4MNYA 2D8WA 4KKDA 3RMMH 1DSUA 1L1NA 3MYWA 3BV9B 2ZHWH 1ELAA 1O2LA 1TIOA 3TK9A 1ELFA 3K9XB 2SFAA 1UTJA 2G00A 3EE0B 3K6YA 1Z71A 3ZZAA 4J1YA 1C5NH 3K2UA 3TGJE 3RXDA 4K3JA 1KDQB 1T31A 3NKKA 1O2MA 1O2HA 1LVOA 2G8TA 1TGBA 2FLBH 2XW9A 3PTBA 1VGCC 1V2QT 4YT7H 3LU9B 1AE8H 2CHAC 3Q3KA 3O8CA 1MMJN 6CHAC 4Q7YA 1HAPH 1BRUP 1LKAA 3T29A 1GDNA 4X8VH 3TGIE 5FCKA 3VPKA 1O3OA 1UVTH 3E8LA 3TNSA 2GT8A 5HM2A 1YPHC 3RLWH 2Z3EA 1SSXA 1MZAA 4IN1A 1NY22 1MBQA 4B71A 3GCHB 1XUFA 1ZTLA 1RD3B 5DP6A 3RXRA 2WUBA 1C2KA 3EA8A 4CHAB 4PROA 1ETSH 3ZZ6A 4I8KA 1A7SA 1E36B 3GDUA 3VB6A 4R0IA 3OX7U 1Z6JH 1P03A 3PMHB 1OYQA 3E1XB 1TQ7B 5AHGH 1TPPA 3OY6U 1D6WA 1NN6A 1QJ7B 2ALPA 1G3DA 2G5VA 2C8ZB 1RTLA 4AFSA 5AFZH 2TGPZ 1QHRB 4I8HA 5HMAA 1EPTA 4XFQA 4E05H 1SGFG 1C1OA 5DP8A 2ASUB 1MTVA 3SU0A 2HVXA 2W7SA 3A7VA 1P04A 4OGYA 3SW2B 2HNTE 2WPKS 2ZDMA 3GCHC 1G36A 1O2NA 1HIAA 1K1LA 1Y3VA 4X2WA 4CHAC 2ZHEH 4AX9H 2PFEA 2XTTB 1CA0B 4WXVA 2JETB 3UFAA 1LVBA 1YP9A 3P92A 2J2UA 4K1EA 3RXOA 3A83A 4YLUA 3B8JA 2Y5HA 4X8UH 4LZ1H 1P2JA 4XSKU 2UUFB 1TRNA 1UHBA 1W7GH 3M5MA 4ZKRU 3BEIB 4OGXA 1N6XA 2WPJS 1O3BA 1Q31A 2OTVA 5F8TA 4U01A 1FIWA 3DFLA 7LPRA 2FOBA 1SGCA 1Z1IA 3ZVBA 1ELEE 4Z6AH 1CA0C 1TMUH 2BQ7B 1TYNA 4RSPA 1CSOE 5IYTA 2JETC 4X1PU 4QT8C 1DANH 3VGCB 1LHCH 2ODPA 4XOJA 1QQUA 1VCWA 4X6OA 1O2JA 1XXDA 2PV9B 1PQ8A 1YPHE 1S5SA 2ZDNA 1P2QA 4UDWH 1GHVH 1Y59T 1FV9A 2QIQA 1AWHB 1VCPA 1A4WH 1O32A 1GJAB 4AYVB 3F68H 1T8LA 1BZXE 1SHYA 1HDTH 1GI9B 1GBJA 1C5XB 3NZIA 4Y8XA 1SGEE 3FZZA 1ELDE 4SGBE 1IQNA 3A82A 1S83A 1E0FD 1YPMH 5DGJA 1GGDB 4JZEH 3ZVAA 3VGCC 3T27A 1KIGH 1ZTKA 2GZ9A 2BXTH 3D49H 1XUKA 3ZZBA 1Y5AT 4D9QA 3UTUH 1IQHA 4CH8B 1TX6A 1TBRH 2QXJA 2ZFQH 5AFYH 4YTAA 1KLJH 1UMAH 1P0SH 5HGGA 1F2SE 1UO6A 1FPCH 1RRKA 2OBOA 1W8BH 2AH4X 1ZPCA 2Z9JA 1FUJA 1GHYH 3MO3A 4IC6A 3ZVFA 4ABBA 1H8IH 4BXWA 1DSTA 4I33A 2XCFA 2ZGJA 2Z9KA 2GCTB 2PUQH 3DT0H 3GYLB 3L33A 2QC2A 5PTPA 1O2YA 2ZGBH 1HAGE 4X8SH 3SU6A 1OWEA 1TMBH 4XBBA 1ZMLA 4WH6A 1GGDC 4WH8A 1GBLA 1P2IA 4I31A 4HTCH 1GBEA 4K8YA 3UIRA 4TY7A 1C1UH 2QGRA 1UCYH 1JBUH 2ZDLA 3AASA 1W12U 3SNBA 1XVMA 2UUKB 4FUEA 1AFQB 3KQEA 4ZXYH 3A80A 1C2DA 4D8NA 2GCTC 1ELBA 1C4U2 3RC6A 4XBCA 3ZYDA 2HPQH 1J16A 1SGIB 2D1JA 3M7TA 2QN5T 3MTYA 1O3KA 3PLPA 6ESTA 1ANDA 1BTYA 3SNEA 1C5VA 3NWUA 2R3UA 4A6LA 1K21H 3BIUH 3A81A 5C1YA 2Q6DA 3RXTA 1BMNH 1Z6EA 1Y5UT 1QL9A 2FTMA 5AVDA 1AO5A 1GCDA 1AFQC 1SBWA 1D3QB 3NPSA 3L6PA 1N6YA 4AN7A 3GY2A 1PYTC 2BQWB 1FY4A 3CP7A 2PSXA 3TH3H 3E91A 1DPOA 1TALA 3TJUA 5JB9S 3AAUA 5A8YA 2FM2A 2QF0A 1F0SA 1D3DB 3A84A 3UWIA 1BMAA 2ANYA 5LPFA 1NRSH 1P05A 2FWWA 2AEIH 4DY7B 5LPEA 3U8OH 3RU4D 3M7QA 4GPGA 4AFQA 4CBOA 3GYMA 4GSOA 1L0ZA 1C2MA 4MLFB 1F5RA 4BOHA 2DUCA 1CGJE 3KQDA 2G81E 2R2MB 2ZGCA 3EQ0H 1H4WA 2YNAA 2GT7A 2GX4A 2RCEA 3UREA 1O2RA 2HOBA 2FS8A 1AKSB 5J4SA 3Q3XA 1GMCG 3Q3YA 4LXBH 1KLTA 2B7DH 1SGPE 3ZVEA 2FOFA 1IAUA 3PMBB 1QA0A 2AYWA 4AFUA 4NFFA 1WQVH 1O5CB 4B2AA 2ZA5A 1EZQA 5T6GA 2ZNKH 1ELGA 3BEUA 3UQOA 1BDAA 3AW1A 1GI2A 4FVDA 1O3LA 1UTMA 2H6MA 1BB0B 2UWLA 1FONA 2BOHB 2A2XH 1T4VH 1A5IA 4M7GA 2WV4A 5EG4A 5EGMA 1T8MA 4H42U 2B5TB 3RXFA 1F5KU 2TPIZ 3P8NA 1K1NA 2H9TH 7GCHF 5GXPA 1XKAC 1QB6A 1CGHA 1Q2WA 1DM4B 4WXIA 2BD8A 1E37B 1Z1JA 3B23B 3VXEH 1HBTH 3LC3A 4YM9A 1GHWH 1P3CA 1GHZA 4TPYA 1ABIH 2NU1E 1LPKB 3NUMA 2BX3A 3FAOA 1DITH 2FTLE 3RLYH 1TMTH 2PW8H 1KXCA 5EXLA 4ZHAA 3VB3A 2EEKA 2ZKSA 5F03A 1RXPA 2Z3CA 1MCTA 1TONA 2J94A 4JYUH 4ZKNU 1YGCH 1O2ZA 1FY1A 2VWOA 3BTME 4AORA 1O2VA 4UFFH 1GI5A 2VVVA 2CV3A 5K7RA 4BNRA 7KMEH 1GHBF 1D9IA 4Y8YA 3U98H 3U9AH 1YPKH 1C5SA 2V3OH 3ZZ3A 1O38A 1O3EA 1SLVB 1N1LA 2CJIA 2ZCLP 3BN9A 5ABWA 3N7OA 2DE9A 2HLCA 1GHAF 2O8LA 4U30A 3FP8E 3RXAA 5LH8A 4FU8A 2XC4A 2BD3A 1C5QA 1KXEA 2FIRH 2B9LA 3HGNA 1XUJA 3PMAB 1G3CA 1EP5A 4MDSA 3R3GB 2G4UA 2P8OB 3E3TA 2ZFTA 3U69H 5TJXA 1V2NT 1FN6A 1AIXH 3G01A 2ODYB 3FFGA 2P3UB 3A7ZA 1IQLA 1IQFA 1KYNA 1K1MA 1QR3E 1P57B 1TPAE 1JRTA 1CVWH 3SBKA 3SJ8A 3V0XA 4DOQA 3A8DA 1WAYB 2ZCHP 1NRQH 4B73A 1ID5H 1LMWB 1O36A 5DP7A 4BAHB 1S82A 1HRTH 5JBCS 2HNTF 2QY0B 4J2YB 4KELA 4A1TA 4DT7B 5FBIA 4Y7BA 1OP0A 1GVLA 2AMQA 1NFWA 2QCYA 3TGKE 2P8OC 2R3YA 4Y0ZE 1JRSA 2FO9A 1OPHB 2P93A 1N8OB 4BXSA 1AFEH 7GCHG 4ZKSU 2ODQA 1BITA 3GY8A 3BTFE 2C8YB 4INKA 4K2YA 1AMHA 2I6QA 4FUCA 1GJCB 2BLVA 1O0DH 2BD5A 5L2ZH 4B1TA 1HAIH 1S6HA 4BAQB 6GCHG 2BDCA 1EASA 3QWCH 5F8XA 3SV9A 2PTNA 1V2ST 4JZ1A 2C3SA 1EAXA 1JXPA 1O2UA 3RXMA 1CBWB 1QQ4A 2PR3A 2IPHA 3U8TH 1K1JA 4TWYA 1EJMA 1Y3WA 4MNWA 1TBZH 3BG8A 5F6MA 1DY8A 1AD8H 1N8OC 1L4DA 2C8WB 5F8ZA 1O3FA 3SUFA 1TGCA 1VITH 1GHBG 2JH5D 1YF4A 3M7UA 2ZPSA 2BX4A 1C1TA 3TJOA 1GHAG 1DLKB 1O3CA 1JMOH 3ZVDA 3P6ZB 4X1NU 1FY8E 1P3EA 2ZG0H 1CBWC 2BVSH 3GISB 4JMYA 1C1NA 1L1JA 1BJUA 4OS1A 3UUZA 1ZRKA 3RC5A 2O8MA 2V6NA 4RN6A 1BTWA 4CR9A 3QTOH 4K69A 2ZDVH 4ABFA 1DICA 5FXLA 2A45B 3M5LA 1NROH 1E35B 2BD4A 1CT4E 1VJ9U 3A86A 4GLYA 4HGCA 3SV8A 3SJIA 2ANKH 1LPGB 5BRRE 1HAVA 3GDVA 4ABDA 4GVUA 1OWDA 2EC9H 4CRDA 3U1JB 5C5NA 1PPEE 9LPRA 2A4OA 1C9TA 1TNHA 4I32A 3JZ2B 1BJVA 3DD2H 3UR9A 1K1IA 5E2OA 1WYKA 1THPB 1MAXA 2G4TA 1ANCA 3V3MA 1GBTA 1PPCE 2QV1A 3U8RH 1SHHB 1GG6B 3TH4H 1NZQH 2AMDA 1HAXB 2QAAA 2F9OA 4X6NA 5JBBS 2H2ZA 3HKIB 2WINI 1IQMA 3P17H 1Y3XA 4A1VA 3QZRA 2BZAA 4O97A 3SU3A 3A87A 3SHAH 3RXHA 2A2QH 1QFKH 4AG2A 3B9FH 2BY7X 1IQJA 4LZ4B 1O2IA 4AGKA 4NG9H 3ESTA 1UVOA 2BLQA 3A89A 3HK3B 3SNDA 1GL0E 3BTQE 4SGAE 1GG6C 1SGYE 2KAIA 5AF9H 1GJ4H 1QIXB 4NA7A 2ZU5A 1HNEE 1DWBH 1EPTB 2SGAA 1P9UA 3T62A 3HGPA 1THSH 1NRPH 4ZAEA 4BTUB 1FMGA 3H7TA 1Z8JB 1KXAA 2PLXA 2XXLA 3E6PH 1C1WH 5DK1A 3RXIA 2ZHDA 3MFJA 2ZTZA 3UWJH 2VIWA 5A0CA 1ZZZA 4UEHH 1SVPA 3BTHE 1TOCB 3FANA 4WMDA 4LOYH 1XM1A 4A92A 1HJ9A 4VGCB 3S7HB 1TA2A 3EA7A 1E38B 2ZTXA 3S9CA 1W10U 2JKHA 1SC8U 2PWXA 1A5GH 1F0UA 4AYYB 3TLOA 3A7TA 1YYY1 1HLTH 1AVWA 5JBAS 2A5IA 1O2TA 1Y8TA 1EPTC 1TBQH 4TY6A 1ESBA 1NM6A 1GBMA 2ULLA 1UHBB 3RXEA 2EA3A 4ISHH 3SU5A 3E0PB 1J15A 2W7UA 3SUEA 1C2HA 1BOQA 1LHGH 4ZXXH 4ISOA 4HZHA 5I46H 2ILNA 2Y5GA 1JOUB 4VGCC 3RXQA 1ZOMA 3WY8A 3KNXA 2GV6A 2SGQE 2THFB 4ASHA 2HGTH 1QURH 3U1IB 4Y76A 1GBKA 1VITF 1BUIA 3KIDU 5FBEA 1ZHRA 4NA8A 5HXFA 1DVAH 1P2KA 2A7HA 1HGTH 5DG6A 1IHSH 4GCHG 3BTTE 1EAUA 3P8OA 2UWOA 1C5PA 3LKWA 3STJA 1PQ7A 3CENA 4JZFH 5EQSA 1BBRE 2OC7A 2ZIQH 2J9NA 1OP2A 1O3DA 1C5UA 4WVPE 1QBOA 1BTHH 1P9SA 2VU8E 2Q1JA 3O8DA 1UK2A 2JH6D 3TJVA 1QJ6B 1FI8A 2YNBA 2XWBI 3UNRA 1O2OA 2W3KA 2XCNA 1TE0A 2VGCB 2STBE 5ESBA 1LKBA 3ODFA 1FN8A 1V2OT 4KTUA 1LTOA 1DUEA 3LGWA 1O2GH 4BTIB 5GPIB 1GI7B 1SI5H 1PQAA 6LPRA 1XX9A 1G3EA 4ZKOU 2PGQB 2O8UA 3LGYA 1OSSA 2XNIA 5C2ZA 1P8VC 5C20A 1O5FH 3MNSA 4ZHMU 2GTBA 1GBCA 3DFJA 3SNCA 3VEQB 2NU4E 4X0WU 1MU8B 5EOKA 1QB1A 4TPIZ 1RIWB 1DX5M 1HJ8A 5J4QA 2ZTYA 3PWBA 2VGCC 1GJ9B 1GBDA 1IQIA 1GI3A 3GY7A 5L30H 3ENSB 1UK3A 4FU9A 2D26C 1J14A 3TNTA 1SGTA 4XBDA 1DT2A 1W2KH 2BDHA 4HI3A 5HM9A 1CHOF 2ZU4A 1GJ5H 4X2YA 2WPHS 3GDSA 2FPZA 3C27B 1MU6B 1ELVA 1IQEA 3FP7E 5GDSH 3BTEE 4YOGA 3MH5A 1V2UT 4UFGH 1Y3YA 3QN7A 3RXBA 1K22H 3T28A 3SNAA 3V12A 3QX5H 2VWLA 5CHAB 1BRCE 4TWWA 3MNCA 5JPMH 4ZHLU 2IN2A 3BEFB 1RIWC 1KTTB 1NRRH 1GBAA 3D65E 1PPGE 2IOTA 4XE4A 1O3PB 1ZPZA 2ZFFH 1AB9B 2ZU2A 1O3JA 1V2JT 1SR5C 2CGAA 1ARBA 1DS2E 3S69A 1NU9A 1B7XB 1CHGA 2F9NA 4KP0A 4Q7ZA 1THRH 9ESTA 1LQEA 1TGSZ 2A7CA 1FXYA 4NSVA 2I6SA 5C67A 2EI8A 3OYPA 5CHAC 1EAIA 2J34A 5GIBA 2WUCA 5FPYA 1HFDA 1BRBE 2AS9A 4YOJA 4AZ2B 1AVGH 4MQAA 1LPZB 1GWAA 1ANEA 4UD9H 2BLOA 1EOJA 2A4RA 2BZ6H 4BTTB 1XVOA 1TRYA 1YLDA 3ATLA 4YESB 2BDGA 1GDUA 1W3CA 1CQQA 1S84A 2ESTE 1GMHF 2G5NA 1P09A 1AB9C 3LH1A 2H5CA 5IDKA 3H5CB 2A4GA 1KY9A 1ZRBA 2PGBB 1D4PB 1MKXH 1QL8A 5I25A 1C1MA 2W26A 1C5YB 3PLBA 1OOKB 1QRZA 4IGDA 1XXFA 3VXFH 4ABEA 3F9HA 1UTLM 2P59A 1OWIA 1DWDH 1Z8RA 3Q00A 2SNVA 1ESAA 3QGNB 1E34B 1RTKA 3MU0A 3TH2H 1O3NA 1O30A 1FY3A 3F1SB 1T32A 3SJ9A 3T25A 2ZPRA 3UNQA 1O2PA 2XBVA 3UOPA 3SJOA 3FP6E 2BB4A 1H8DH 5GWZA 5DJ7A 3I29A 4INLA 2SNWA 3RMNH 4DW2U 3C1KA 2Y80A 2A32A 2F91A 1NPMA 4X6MA 3MO6A 4B2BA 5FX5A 4NIYA 1FAXA 5G4BA 3RXVA 1C1QA 1S6FA 2P3TB 4YOIA 5C3NA 1SLWB 1BTUA 1ZSKA 4O9VA 1A1RA 1OWHA 1RS0A 1VR1H 4NWKA 4XDEA 8ESTE 3LC5A 1MZDA 2ZFSA 1WQSA 1A5HA 3SQHE 3AW0A 4IMQA 3RXJA 4BAMB 3VB5A 3BTWE 1W11U 2OCVB 4NFEA 1ELTA 3MMGA 2HWLB 2FOGA 4OS7A 1OWJA 3STIA 2PKAA 2EI6A 2TGAA 3RU4T 5BPEA 5GJ4B 4CRFA 3E16B 1PPHE 1TNJA 1AU8A 4I8LA 2ALVA 3LJJA 2BYAX 1O2XA 1HAZB 1DXPA 1O39A 1DWCH 1TNGA 3M5NA 2J92A 4ABIA 2FOHA 4JZIA 2NWNA 1O2QA 3QDZB 1SG8B 3MH4A 1CA8B 1MTSA 1QGFA 3QO6A 4IC5A 1QCPA 4JCNA 4IN2A 1MTNB 2PTCE 2C90B 2ZGHA 1PFXC 3RXGA 1RFNA 1H1BA 3AAVA 5FPTA 4DG4A 2O8TA 2AFQB 1AY6H 3MI4A 4HFPB 1GPZA 1S0QA 5A0BA 1ZMNA 2ZHQH 2Y7ZA 3SV7A 1DE7H 2M5TA 1AKSA 2G55A 1DWEH 2A0QB 1SGQE 1GI8B 2ZP0H 1F0RA 4H6SB 1PPBH 2J38A 3P8FA 3LT3A 1MTNC 2TGTA 3P8GA 3PB1E 1SFQB 1P2MA 1SLUB 3M3VA 3T26A 1EZSC 1OWKA 1TPSA 1TX8A 3MNBA 3P95A 4ABGA 1GI0A 2BM2A 4ISNA 4WWYA 1BMLA 4OS4A 5DPAA 3ZV9A 2RDLA 5A2MH 1SFIA 1GJ6A 1AE5A 2HPPH 3SV2H 3NXPA 1C5LH 3M5OA 4MVNA 1EAWA 5L6NH 3MH7A 1O5BB 4CBNA 1W7XH 1O3HA 1B0EA 1IHTH 1BHXF 2FDAA 1YM0A 3ZZDA 1J8AA 4NGAH 2FS9A 3EAJA 1WOFA 2BOKA 2FOAA 8KME2 1TABE 5HYOA
chains in the Genus database with same CATH superfamily
5H4IB 3SZNA 2BMGB 1BA8B 2GCHF 1BRAA 1W0JD 5FPSA 3MHWU 4IW4E 1QBNA 3OEED 1EX3A 3GS9A 1OS8A 2A7JA 1UTKA 2BLWA 1TGTA 2KFWA 1AWFH 1FZZA 2GJGA 4F49A 1H9IE 4Y7AA 4MPUA 5KECA 3CS0A 1ZHMA 2ANWA 1TA6A 4CRBA 1K1OA 3PV5A 5C1XA 3PYHA 1AUJA 2A4QA 3PWCA 1V3XA 3RXCA 2CMYA 1C2LA 5CMXH 1SMFE 4UE7H 1G9IE 1HPGA 3W95A 4WMFA 1JIMA 1QTFA 2FI5E 4THNH 2FX6A 3ODDA 2BDAA 4FUBA 1GVZA 2CXVA 4UFDH 1H9HE 1NU7B 1B5GH 2FOCA 2VBCA 4IS5A 2PHBA 1GMDF 1P2NA 2ZDKA 1EJAA 2G51A 3E0NB 3RXKA 1C5OH 4MTBA 2Z3DA 1BTPA 1CT0E 2R0LA 1W14U 1E1RD 1P01A 3DA9B 3F0PA 5EQQA 2BY5X 2XYAA 3ZVCA 2B0FA 1LVYA 1GL1A 1YY3A 3Q77A 2VB0A 2ZPQA 4AB8A 1ZLRA 3V7TA 3ZZ9A 3AK5A 1ORFA 3SUDA 1HAVB 3SU2A 1FDPA 1UVSH 5EODA 5EJZA 2AHME 1RJXB 1UTOA 2AIQA 2ZU1A 4YT6H 2QF5A 2F3CE 5E8EH 1KTSB 2P3FH 5EJ1A 4FUJA 2OP9A 1NFUA 5EJLA 1BCUH 1G37A 2W6JD 1LCYA 4ABAA 1MBMA 3H7OA 3BG4B 2HALA 3P70B 1F7ZA 4MPWA 2BHGA 2Y6TA 1G2MA 4B74A 3RXLA 3ITIA 1SOTA 4DCDA 1W0YH 1SLXB 1C9PA 2UUJB 1CU1A 1T4UH 4GAWA 1O3IA 1TNKA 3LGVA 1Q3XA 2JH0D 3SI3H 1RTFB 1AUTC 3GY6A 1CGIE 2LNCA 1FNIA 1B0FA 3SV6A 3KL6A 1XUIA 1ELCA 1GBBA 1ZSLA 3GOVB 1DFPA 3BG4C 1UVPA 2P16A 2ZECA 1AZZA 2IPQX 2ZCKP 1VCQA 3N7DA 2PUXB 1V2RT 2Z9IA 1SQAA 1GJDB 1UK4A 3KQCA 4AB9A 4Q2KA 1SGRE 2BVXH 1HXFH 2NU2E 4ZMAH 3VB4A 3D23A 1V6DA 1HV7A 3FO8D 2F9UA 1LO6A 2GKVE 3QLPH 1C5WB 3IG6B 1GBFA 1WUNH 1JIRA 2KR7A 4MNXA 2FX4A 2AIPA 2CK3D 5A0AE 3URDA 1MKXK 4DIIH 3OSYA 2A31A 3RUOA 2FZZA 2WPLS 5FX6A 2H9EH 2HLDD 1DXWA 3ZV8A 2BDIA 2CF9H 3VFEA 3NK8A 1A0LA 2ZQ2A 4FXGH 3PMJA 2ZFRH 3LGIA 3SU4A 2TGDA 3GCNA 3LGUA 3F2FA 1WSSH 4BAOB 3DUXH 3RU4E 3F6UH 1IQKA 3SGAE 1XUGA 4YXWD 3BTDE 4FOUC 3K65B 2UUYA 1EXFA 3SOSA 3OY5U 1O31A 2Y81A 1H9LB 3L3TA 4DURA 1D3PB 1ZJDA 2D2DA 2XBWA 2F9PA 1QA7A 1HIAB 2XRCA 3JZ1B 8GCHF 1O5AB 2FXRA 1WBGB 2Q6FA 2Z9LA 1ETTH 1P06A 1KLIH 1K1PA 3UR6A 2FODA 2Y7XA 4TYDA 5FHTA 3A7WA 1BBRK 3A8CA 1EATA 4YZUA 5EIYA 2GV7A 3M3SA 3SORA 1C5RA 3ATKA 4X1RU 2JIZD 1UCYE 5JBTA 1TWXB 3BTKE 1VJAU 2J4IA 1GJBB 4ISLA 2QXIA 2VIVA 2K0QA 5LGOA 1GCTB 5T6DA 2AGIX 2ZZUH 2XC5A 1Z7KA 1PYTD 2F9BH 1AGJA 1BIOA 4MNVA 5EU8A 2GMTB 1DLEA 2Z94A 3RMOH 3ZYEA 3MU5A 2FOEA 1KDQA 1O3MA 1GJ7B 3RXSA 2VJ1A 1AN1E 3S9AA 3EE7A 1YPJH 4H6TA 1C1PA 1SL3A 4JYTA 2VH6A 2ZC9H 4D9RA 1C5ZB 3TPIZ 2Y5FA 3M36A 2WPIS 3HKJB 1P2OA 1OX1A 1QB9A 2F9VA 5A09A 1D3TB 4FUHA 1MKWK 1AVXA 3UY9A 3M35A 1HXEH 3W94A 1GCTC 3T5FH 4CR5A 3KF2A 2QF3A 3I78A 5ETXA 2WPMS 2STAE 3RM2H 4NWLA 4ABJA 5JDUB 2FMJA 3PM3A 2GMTC 1QNJA 1ACBE 4FUGA 4JYVH 3RXPA 4E06H 4Z1MD 1KXFA 5K0HA 5HIYA 1O2SA 1ZSJA 1MH0A 5JYIA 2XC0A 3QTVH 2QXGA 1DOJA 1O34A 3ZZ4A 1A3BH 2VNTA 1WTGH 2SGPE 1TAWA 3ATMA 1GHXH 1OP8A 4WMEA 1FJSA 1AQ7A 4A1XA 2ZO3H 1SGFA 1GI1A 4D7GA 5E0GA 1VKYA 2ZDAH 1KSNA 1MCVA 1P02A 1PPZA 2BY9X 1EZUC 2XNDD 4Y6DA 5CE1A 2TRMA 4Q80A 3UOUA 3PRDA 5A8XA 1C1VH 1LHDH 2NU0E 1G30B 3TK6A 2F43B 2FOMB 2WYJA 1HB0B 2P95A 8GCHG 2H1UA 1F5LA 1F92A 1S81A 3TITA 4D7FA 1QRXA 1A3EH 2GVFA 5C1UA 1MTUA 4INHA 3T2NA 4CRAA 4DVAU 3QUMP 3BSQA 1ZYOA 2ANMH 3ZVGA 3SU1A 3ATIA 2TIOA 1EQ9A 1V2LT 4I8GA 3R0FA 1FIZA 1DDJA 1EKBB 2VIQA 4GHTA 2L6OA 3MNXA 2ZQ1A 3N99A 4JZDH 1NFYA 3WWFA 1TFXA 5EPNA 1TLDA 1ABJH 1NS3A 3PLKA 1FAKH 1XUHA 3MOCA 1LHFH 1A0JA 1UTQA 5GCHF 2BD9A 5LPRA 5L2YH 2A5KA 1P12E 2KCPA 2BDYA 4WY3A 1L1GA 1EFRD 1P11E 3LIWA 4K5ZA 1BT7A 1T7CA 5T6FA 2SGDE 1S85A 2GDEH 1W13U 3A8BA 3SQEE 4KTSA 1TPOA 2CF8H 2H5DA 1C5MD 1LDTT 4LK4A 3PO1B 1MUEB 1GDQA 1VITG 3RP2A 3URCA 1IQGA 2V3HH 2K1QA 2OC1A 1X7AC 1Z8GA 2FESH 3HPTB 1C5TA 1MQ5A 2R2WU 1ZGIA 3PROA 4X2VA 1C4V2 1Y3UA 2UWPA 4BANB 4FVBA 3F9FA 2C93B 1O37A 3SI4H 1KXBA 1UVUH 5C0TA 2YOLA 1O2WA 2J95A 1GMCF 5E0JA 2FI4E 5ESTE 2P94A 1P10A 3CS7A 3EA9A 4CH2B 3ZZ5A 1TRMA 3KEEA 1G32B 3LDXH 1MAYA 3OTJE 5B6OA 3EGKH 4BAKB 5EPYA 4NSYA 4AGJA 2WYGA 3PO1C 4CRCA 3SUGA 2J98A 2VVCA 4O3TA 3ZZ8A 4KTCA 3I77A 4ZH8A 4Y71A 3UNSA 1QY6A 1DUAA 3V13A 2Z7FE 5HKKD 2QYIA 1ETRH 2QXHA 4CREA 1MD8A 1TNIA 2Z6BD 4I7YH 4NCYA 2SGFE 3KGPA 2XBYA 2GP9B 1YCPM 2VIDA 2BDBA 2W5EA 3A7XA 4X1QU 4ZROA 4Y10E 3LH3A 3OTPA 4NZLA 1C2GA 1YWUA 3BF6H 1C2IA 4NZQA 4DGJA 1HYLA 2BY6X 2NU3E 4K8BA 2BQ6B 1C2FA 3MU8A 4B75A 1GI4A 1FPHH 3EYDA 3SJKA 1DY9A 1QL7A 5EQRA 1O33A 4YLQH 3EDXB 1ZTJA 2F83A 4AOQA 2LPRA 2BD2A 2OBQA 2ZFPH 1V2TT 2PSYA 4O3UA 1NBME 1CHOG 1AHTH 2PKAB 1QRWA 1UTNA 3VB7A 1BBRH 3MU1A 2QA9E 5A8ZA 2BY8X 3RXUA 2J5UA 3SGQE 5GCHG 1HAHH 2AMPA 2XBXA 2VWMA 2YMSB 4WF8A 1PQ5A 3TIUA 1V2KT 1XKBC 1ESTA 1FLEE 5DO4H 1SB1H 2AGGX 2ZWLH 1WU1A 2FYQA 3MU4A 4ZUHA 2ZGXH 1O3GA 4I86A 3AVZA 1NO9H 2HRVA 1H8ED 2GDDA 1YCPK 4Q7XA 3MO9A 3NCLA 1K28D 1HAYB 1G2LA 3M3TA 2FI3E 3LGTA 3GY4A 3K6ZA 1FQ3A 1O5EH 4ACAA 1C1RA 1LQDB 1OXGA 1TB6H 1VZQH 1KXDA 1TNLA 1PJPA 2Y82A 1O35A 3HK6B 3H09A 2VIOA 3QZQA 4Y0YE 2OC0A 4UFEH 4FUDA 5TCCA 4UONA 1L2EA 2YMSC 1HAOH 1TQ0B 2AGEX 5TCAA 1MKWH 1O5GH 1SQOA 4HG6A 5DP4A 3BTGE 2VVUA 4X6PA 1ZJKA 1NT1A 3UQVA 1U6QA 1GMHG 4ABHA 3UPEA 1IOEA 1AI8H 2WSSD 1EJNA 2R9PA 2ZU3A 5EW1H 2O9QA 1A0HB 1YLNA 2ZI2H 4F4OC 5DP5A 8LPRA 2GD4B 3ATWA 2OQ5A 1ARCA 2C8XB 2OQUA 1HJAB 4B2CA 5FCRA 1Z8IB 1CT2E 1V2MT 2VINA 4U2WA 1MD7A 3HATH 2PKSB 3GICB 4FU7A 4ACBA 1BMFD 1EP6A 2FYRA 4NIWA 1S0RA 4Y79A 1BTZA 4IMZA 2B8OH 3W1EA 6GCHF 3A88A 1NC6A 4X2XA 1ZPBA 1J9CH 1SPJA 1F0TA 4ISIH 4X1SU 2RA3A 1YPGH 5EXNA 3LPRA 4F48B 1WTHD 3S9BA 1T8NA 1HCGA 3F0OA 3M37A 4OS6A 3MH6A 1HJAC 1QJ1B 3QGJA 2RA0A 2VWNA 5FAHA 3SGBE 1WV7H 2EQNA 2BVRH 1EZXC 2GZ8A 4KGAA 4FUIA 2PKSC 1XMNB 1OYTH 4NIXA 4E7NA 3KYFA 1CE5A 2CN0H 4Z0KA 4DJZB 3A8AA 3IWMA 4WJG2 4JK6A 1YPLH 3LOXA 2EI7A 4FETA 3OU0A 3U28C 2FLRH 4RKJB 2WV5A 4B76A 3MWIU 1AZ8A 2SGEE 2XWAA 3KQBA 2Z9GA 4X8TH 4CRGA 4R8TB 2TBSA 3A85A 3KN2A 4NIVA 1S6LA 4FUFA 4D76A 1L4ZA 1V2WT 4YO9A 3TVJB 4U32A 3FZDA 1QBVH 2O8WA 1TGNA 2A1DB 1O3AA 3S7KB 1UJ1A 4K1TA 2A5AA 3ELAH 1C1SA 5C94A 4OS5A 3PV2A 3RMLH 3GY3A 4IBLH 1SOZA 4Y11E 5EXMA 3DHKH 2W3IA 1V2VT 4H4FA 4AG1A 2BXUH 3ZZCA 4GUXA 1RGQA 2V35A 1ZHPA 3RDZA 3TU7H 5JB8S 4OS2A 1K2I1 1ZR0A 3FOAA 5DP9A 2PP6A 5E2PA 3PTNA 3Q76A 3SO3A 1C4Y2 1MTWA 2EY4C 3F9EA 4I8JA 4JK5A 2VIPA 3GCTF 3TK5A 2R0KA 1C2JA 3GY5A 2GGVB 1ZMJA 2IJOB 5E0HA 1EUFA 1BMMH 1WCZA 3O8BA 1C2EA 1MQ6A 1A2CH 3F9GA 2DE8A 4O03A 1BQYA 3WWBA 1EB1H 1TOMH 3A7YA 1GBHA 1SQTA 1Y5BT 1YC0A 2BTCE 1O5DH 1NESE 1INCA 3IITA 1G3BA 3S0NA 4GHQA 5C5OA 2KCOA 2ZEBA 2W6ID 3KHVA 4A7IB 1ZGVA 1A46H 2FP7B 5T3HA 2ZF0H 1SGDE 4MG3A 2ZHFH 1BTXA 1LVMA 3TJNA 3D62A 2H9HA 3SHCH 4MPVA 2OINA 2G52A 1BHXB 5DKMA 2K8IA 3ZIAD 1FY5A 4AFZA 2RG3A 1V2PT 2BD7A 1JWTA 3UAIC 1GI6A 1GVKB 1TX7A 2OLGA 1W0ZU 2OD3B 3O8RA 2GZ7A 3QK1A 3SN8A 1NFXA 1YCPH 1YPEH 1OKXA 2GCHG 4RKOB 2VH0A 4NA9H 1E79D 7ESTE 3KCGH 3RM0H 1ANBA 1UTPA 2V3MA 1D6RA 5DP3A 4MPXA 1EB2A 2C4FH 1SGNE 2KAIB 4Y8ZA 4K1SA 4A5TS 3PV4A 3LJOA 1A61H 2OC8A 1PPFE 3E90B 1K9OE 1GJ8B 2OXSA 3FVFB 2Q6GA 4ASUD 1NTPA 1YBWA 3LONA 1T8OA 3M61U 1GBIA 1YKTA 1EOLA 3GCOA 4E7RG 3BIVH 2AERH 4DIHH 2V0BA 1YLCA 1HUTH 2RFKC 4ESTE 2HNTC 3RC4A 2FEQH 1NRNH 3ZZ7A 1UCYK 5SGAE 1M9UA 5EW2H 1GMDG 1VGCB 2OUAA 5DN6D 2CHAB 1CO7E 1J17T 1O2KA 1LHEH 3GCTG 4GCHF 4K60A 6CHAB 4MNYA 2D8WA 4KKDA 3RMMH 1DSUA 1L1NA 3MYWA 3BV9B 2ZHWH 1ELAA 1O2LA 1TIOA 3TK9A 1ELFA 3K9XB 2SFAA 1UTJA 2G00A 3EE0B 3K6YA 1Z71A 3ZZAA 4J1YA 1C5NH 3K2UA 3TGJE 3RXDA 4K3JA 1KDQB 1T31A 3NKKA 1O2MA 1O2HA 1LVOA 2G8TA 1TGBA 2FLBH 2XW9A 3PTBA 1VGCC 1V2QT 4YT7H 3LU9B 1AE8H 2CHAC 3Q3KA 3O8CA 1MMJN 6CHAC 4Q7YA 1HAPH 1BRUP 1LKAA 3T29A 1GDNA 4X8VH 3TGIE 5FCKA 3VPKA 1O3OA 1UVTH 3E8LA 1H8HD 2WV9A 3TNSA 2GT8A 5HM2A 1YPHC 3RLWH 2Z3EA 1SSXA 1MZAA 4Q4LA 4IN1A 1NY22 1MBQA 4B71A 3GCHB 1XUFA 1ZTLA 1RD3B 5DP6A 3RXRA 2WUBA 1C2KA 3EA8A 4CHAB 4PROA 1ETSH 3ZZ6A 4I8KA 1A7SA 1E36B 3GDUA 3VB6A 4R0IA 3OX7U 1Z6JH 1P03A 3PMHB 1OYQA 3E1XB 1TQ7B 5AHGH 1TPPA 3OY6U 1D6WA 1NN6A 1QJ7B 2ALPA 1G3DA 2G5VA 2C8ZB 1RTLA 4AFSA 5AFZH 2TGPZ 1QHRB 4I8HA 5HMAA 1EPTA 4XFQA 4E05H 1SGFG 1C1OA 5DP8A 2ASUB 1MTVA 3SU0A 2HVXA 2W7SA 2QE7D 3A7VA 1P04A 4OGYA 3SW2B 2HNTE 2WPKS 2ZDMA 3GCHC 1G36A 1O2NA 1HIAA 1K1LA 1Y3VA 4X2WA 4CHAC 5T1VA 2ZHEH 3SZEA 4AX9H 2PFEA 2XTTB 1CA0B 4WXVA 2JETB 3UFAA 1LVBA 1YP9A 3P92A 2J2UA 4K1EA 3RXOA 3A83A 4YLUA 3B8JA 2Y5HA 2F4LA 4X8UH 4LZ1H 1P2JA 4XSKU 2UUFB 1TRNA 1UHBA 2L74A 1W7GH 3M5MA 4ZKRU 3BEIB 4OGXA 1N6XA 2WPJS 1O3BA 1Q31A 2OTVA 5F8TA 4U01A 1FIWA 3DFLA 7LPRA 2FOBA 1SGCA 1Z1IA 3ZVBA 1ELEE 4Z6AH 1CA0C 1TMUH 2BQ7B 1TYNA 4RSPA 1CSOE 5IYTA 2JETC 4X1PU 4QT8C 1DANH 3VGCB 1LHCH 2ODPA 4XOJA 1QQUA 1VCWA 4X6OA 1O2JA 1XXDA 2PV9B 1PQ8A 1YPHE 1S5SA 2ZDNA 1P2QA 4UDWH 1GHVH 1Y59T 1FV9A 2QIQA 1AWHB 1VCPA 1A4WH 1O32A 1GJAB 2QF4A 4RT0A 4AYVB 3F68H 1T8LA 1BZXE 1SHYA 1HDTH 1GI9B 1GBJA 1C5XB 3NZIA 4Y8XA 1SGEE 3FZZA 1ELDE 4SGBE 1IQNA 3A82A 1S83A 1E0FD 1YPMH 5DGJA 1GGDB 4JZEH 3ZVAA 3VGCC 3T27A 1KIGH 1ZTKA 2GZ9A 2BXTH 3D49H 1XUKA 3ZZBA 1Y5AT 4D9QA 2J98B 3UTUH 1IQHA 4CH8B 1TX6A 1TBRH 2QXJA 2ZFQH 5AFYH 4YTAA 1UW7A 1KLJH 1UMAH 1P0SH 5HGGA 1F2SE 1UO6A 1FPCH 1RRKA 2OBOA 1W8BH 2AH4X 1ZPCA 2Z9JA 1FUJA 1GHYH 2KM0A 3MO3A 4IC6A 3ZVFA 4ABBA 1H8IH 4BXWA 1DSTA 4I33A 2XCFA 2ZGJA 2Z9KA 2GCTB 2PUQH 3DT0H 3GYLB 3L33A 2QC2A 5PTPA 1O2YA 2ZGBH 1HAGE 4X8SH 3SU6A 1OWEA 1TMBH 4XBBA 1ZMLA 4WH6A 1GGDC 4WH8A 1GBLA 1P2IA 4I31A 4HTCH 4AC9A 1GBEA 4K8YA 3UIRA 4B6EA 4TY7A 1C1UH 3PRBA 2QGRA 1UCYH 1JBUH 2ZDLA 3AASA 1W12U 3SNBA 3VG8A 1XVMA 2UUKB 4FUEA 5CDFE 1AFQB 3KQEA 4ZXYH 3A80A 1C2DA 4D8NA 2GCTC 1ELBA 1C4U2 3RC6A 4XBCA 3ZYDA 2HPQH 1J16A 1SGIB 2D1JA 3M7TA 2QN5T 3MTYA 1O3KA 3PLPA 6ESTA 1ANDA 1BTYA 1COWD 5C0UA 3SNEA 1C5VA 3NWUA 2R3UA 4A6LA 1K21H 3BIUH 3A81A 5C1YA 2Q6DA 1E1QD 3RXTA 1BMNH 1Z6EA 1Y5UT 1QL9A 2FTMA 5AVDA 1AO5A 1GCDA 2KZ4A 1AFQC 1SBWA 1D3QB 2JJ2D 3NPSA 3L6PA 1N6YA 4AN7A 4DT4A 3GY2A 1PYTC 2BQWB 1FY4A 3CP7A 2PSXA 3TH3H 3E91A 1DPOA 1TALA 3TJUA 5JB9S 3AAUA 5A8YA 2FM2A 2QF0A 1F0SA 1D3DB 3A84A 3UWIA 1BMAA 2ANYA 5LPFA 1NRSH 1P05A 2FWWA 2AEIH 4DY7B 5LPEA 3U8OH 3RU4D 3M7QA 4GPGA 4AFQA 4CBOA 3GYMA 2JJ1D 4GSOA 1L0ZA 1C2MA 4MLFB 1F5RA 4BOHA 2DUCA 1CGJE 3KQDA 5KGOA 2G81E 2R2MB 2ZGCA 3EQ0H 1H4WA 2YNAA 2GT7A 2GX4A 2RCEA 3UREA 1O2RA 2HOBA 2FS8A 1AKSB 5J4SA 3Q3XA 1GMCG 3Q3YA 4LXBH 1KLTA 2B7DH 1SGPE 3ZVEA 2FOFA 1IAUA 3PMBB 1QZ8A 1QA0A 2AYWA 4AFUA 4NFFA 1WQVH 1O5CB 4B2AA 2ZA5A 1EZQA 5T6GA 2HVYB 2ZNKH 1ELGA 3BEUA 3UQOA 1BDAA 3AW1A 1GI2A 4FVDA 1O3LA 1UTMA 2H6MA 1BB0B 2UWLA 1FONA 2BOHB 2A2XH 1T4VH 1A5IA 4M7GA 2WV4A 5EG4A 5EGMA 1T8MA 4H42U 1WXRA 2B5TB 3RXFA 1F5KU 2TPIZ 3P8NA 1K1NA 2H9TH 7GCHF 5GXPA 1XKAC 1QB6A 1CGHA 1Q2WA 1DM4B 4WXIA 2BD8A 1E37B 1Z1JA 3B23B 3VXEH 1HBTH 3LC3A 4YM9A 1GHWH 1P3CA 1GHZA 4TPYA 1ABIH 2NU1E 1LPKB 3NUMA 2BX3A 3FAOA 1DITH 2FTLE 3RLYH 1TMTH 2PW8H 1KXCA 5EXLA 4ZHAA 3VB3A 2EEKA 2ZKSA 5F03A 1RXPA 2Z3CA 1MCTA 1TONA 2J94A 4JYUH 3DSGA 4ZKNU 1YGCH 1O2ZA 1FY1A 2VWOA 3BTME 4AORA 1O2VA 4UFFH 1GI5A 2VVVA 5C17A 2CV3A 5K7RA 4BNRA 7KMEH 1GHBF 1D9IA 4Y8YA 4M9FA 3U98H 3U9AH 1YPKH 1C5SA 2V3OH 3ZZ3A 1O38A 1O3EA 1SLVB 1N1LA 2CJIA 2ZCLP 3BN9A 5ABWA 3N7OA 2DE9A 2HLCA 1GHAF 2O8LA 4U30A 3FP8E 3RXAA 5LH8A 4FU8A 2XC4A 2BD3A 1C5QA 1KXEA 3KYGA 2FIRH 2B9LA 3F3BA 3HGNA 1XUJA 3PMAB 1G3CA 1EP5A 4MDSA 3R3GB 3CNRA 2G4UA 2P8OB 3E3TA 2ZFTA 3U69H 5TJXA 1V2NT 1FN6A 1AIXH 3G01A 2ODYB 2IJD1 3FFGA 2P3UB 3A7ZA 1IQLA 1IQFA 1KYNA 1K1MA 1QR3E 1P57B 1TPAE 3SYJA 1JRTA 1CVWH 3SBKA 3SJ8A 3V0XA 4DOQA 3A8DA 1WAYB 2ZCHP 1NRQH 4B73A 1ID5H 1LMWB 1O36A 5DP7A 4BAHB 1S82A 1HRTH 5JBCS 2HNTF 2QY0B 4J2YB 4KELA 4A1TA 4DT7B 5FBIA 1OHHD 4Y7BA 1OP0A 1GVLA 2AMQA 1NFWA 2QCYA 3TGKE 2P8OC 2R3YA 4Y0ZE 1JRSA 5DSFA 2FO9A 1OPHB 2P93A 1N8OB 4BXSA 1AFEH 7GCHG 4ZKSU 2ODQA 1BITA 3GY8A 3BTFE 2C8YB 4INKA 4K2YA 1AMHA 2I6QA 4FUCA 1GJCB 2BLVA 1O0DH 2BD5A 5L2ZH 4B1TA 1HAIH 4XD7D 1S6HA 4BAQB 6GCHG 2BDCA 1EASA 3QWCH 5F8XA 3SV9A 2PTNA 1V2ST 4JZ1A 2C3SA 1EAXA 1JXPA 1O2UA 3RXMA 1CBWB 1QQ4A 2PR3A 2IPHA 3U8TH 1K1JA 4TWYA 1EJMA 1Y3WA 4MNWA 1TBZH 3BG8A 5F6MA 1DY8A 1AD8H 1N8OC 1L4DA 2C8WB 5F8ZA 1O3FA 3SUFA 1TGCA 1VITH 1GHBG 2JH5D 1YF4A 3M7UA 2ZPSA 2BX4A 1C1TA 4ZCNA 4RI0A 3TJOA 1GHAG 1DLKB 1O3CA 1JMOH 3ZVDA 3P6ZB 1SQRA 4X1NU 1FY8E 1P3EA 2ZG0H 1CBWC 2BVSH 3GISB 4JMYA 1C1NA 1L1JA 1BJUA 3DSPA 4OS1A 3UUZA 1ZRKA 3RC5A 2O8MA 3UB0A 2V6NA 4RN6A 5CHBA 1BTWA 2KCYA 4CR9A 3QTOH 4K69A 2ZDVH 4ABFA 1DICA 5FXLA 2A45B 3M5LA 1NROH 1E35B 2BD4A 1CT4E 1VJ9U 3A86A 4GLYA 4HGCA 3SV8A 3SJIA 2V7QD 2ANKH 1LPGB 5BRRE 1HAVA 3GDVA 4ABDA 5B6LA 4GVUA 1OWDA 3OAAD 2EC9H 4CRDA 1NBMD 5C5NA 3U1JB 1PPEE 9LPRA 2A4OA 1C9TA 1TNHA 4I32A 3JZ2B 1BJVA 3DD2H 3UR9A 3NRLA 1K1IA 5E2OA 1WYKA 1THPB 1MAXA 2G4TA 1ANCA 2XOKD 1GBTA 1PPCE 3V3MA 2QV1A 3U8RH 1SHHB 2M2AA 1GG6B 3TH4H 1NZQH 2AMDA 5KEDA 1HAXB 2QAAA 5IK2D 2F9OA 4X6NA 5JBBS 2H2ZA 3HKIB 2WINI 3FN8A 1IQMA 3P17H 1Y3XA 4A1VA 3QZRA 2BZAA 4O97A 3SU3A 3A87A 3SHAH 3RXHA 2A2QH 1QFKH 4AG2A 3B9FH 2BY7X 1IQJA 4LZ4B 1O2IA 4AGKA 4NG9H 1FX0B 3ESTA 1UVOA 2BLQA 3A89A 3HK3B 3SNDA 1GL0E 3BTQE 3N7EA 4SGAE 1GG6C 1SGYE 2KAIA 5AF9H 1GJ4H 1QIXB 4NA7A 2ZU5A 1HNEE 1DWBH 1EPTB 2SGAA 1P9UA 3T62A 3HGPA 1THSH 1NRPH 4ZAEA 4BTUB 1FMGA 3H7TA 2KX4A 3OFND 1Z8JB 1KXAA 2PLXA 2XXLA 3E6PH 1C1WH 5DK1A 3RXIA 2ZHDA 3MFJA 2ZTZA 5GNDA 3UWJH 2VIWA 5A0CA 1ZZZA 4UEHH 1SVPA 2KCAA 1TOCB 3BTHE 3FANA 3DCLA 4WMDA 4LOYH 1XM1A 4A92A 1HJ9A 4VGCB 3S7HB 1TA2A 3EA7A 3WW7A 1E38B 2ZTXA 3S9CA 1W10U 2JKHA 1SC8U 2PWXA 1A5GH 1F0UA 4AYYB 3TLOA 3A7TA 1YYY1 1HLTH 1AVWA 5JBAS 2A5IA 1O2TA 3DSOA 1Y8TA 1EPTC 1TBQH 4TY6A 1ESBA 1NM6A 1GBMA 2ULLA 1UHBB 3RXEA 2EA3A 4ISHH 3SU5A 3E0PB 1J15A 2W7UA 3SUEA 1C2HA 1BOQA 1LHGH 3KQ5A 4ZXXH 4ISOA 4HZHA 5I46H 2ILNA 2WPDD 2Y5GA 1JOUB 4VGCC 3RXQA 1ZOMA 3WY8A 3KNXA 2GV6A 2SGQE 2THFB 4ASHA 2HGTH 1QURH 3U1IB 4Y76A 1GBKA 1VITF 1BUIA 3KIDU 5FBEA 4RT1A 1ZHRA 4NA8A 5HXFA 1DVAH 1P2KA 2A7HA 1HGTH 5DG6A 1IHSH 4GCHG 3BTTE 1EAUA 3P8OA 3OE7D 2UWOA 1C5PA 3LKWA 3STJA 1PQ7A 3CENA 4JZFH 5EQSA 1BBRE 2OC7A 2ZIQH 2J9NA 1OP2A 1O3DA 1C5UA 4WVPE 1QBOA 1BTHH 1P9SA 2VU8E 2Q1JA 3O8DA 1UK2A 2JH6D 2YMSD 3TJVA 1QJ6B 1FI8A 2YNBA 2XWBI 3UNRA 1O2OA 2W3KA 2XCNA 1TE0A 2VGCB 2STBE 5ESBA 1LKBA 3ODFA 1FN8A 1V2OT 4KTUA 1LTOA 1DUEA 3LGWA 1O2GH 4BTIB 5GPIB 1GI7B 1SI5H 1PQAA 6LPRA 1XX9A 1G3EA 4ZKOU 2PGQB 2O8UA 3LGYA 1OSSA 2XNIA 5C2ZA 1P8VC 5C20A 1O5FH 3MNSA 4ZHMU 2GTBA 1GBCA 3DFJA 3SNCA 3VEQB 2NU4E 4X0WU 1MU8B 5EOKA 1QB1A 4TPIZ 1RIWB 1DX5M 1HJ8A 5J4QA 2ZTYA 3PWBA 2VGCC 1GJ9B 1GBDA 1IQIA 1GI3A 3GY7A 5L30H 3ENSB 1UK3A 4FU9A 2D26C 1J14A 1WDIA 3TNTA 1SKYE 1SGTA 4XBDA 2LELA 1DT2A 1W2KH 2BDHA 4HI3A 5HM9A 1CHOF 2ZU4A 1GJ5H 4X2YA 2WPHS 3GDSA 2FPZA 3C27B 1MU6B 1ELVA 1IQEA 3FP7E 5GDSH 3BTEE 4YOGA 3MH5A 1V2UT 4UFGH 1Y3YA 3QN7A 3RXBA 1K22H 3T28A 3SNAA 3V12A 3QX5H 2VWLA 5CHAB 1BRCE 4TWWA 3MNCA 5JPMH 4ZHLU 2IN2A 3BEFB 1RIWC 1KTTB 1NRRH 1GBAA 3D65E 1PPGE 2IOTA 2LP6A 4XE4A 1O3PB 1ZPZA 2ZFFH 1AB9B 2ZU2A 1O3JA 1V2JT 1SR5C 3OEHD 2CGAA 2JDID 1ARBA 1DS2E 3S69A 1NU9A 1B7XB 1CHGA 2F9NA 4KP0A 4Q7ZA 1THRH 9ESTA 1LQEA 1TGSZ 2A7CA 1FXYA 4NSVA 2I6SA 5C67A 2EI8A 3OYPA 5CHAC 1EAIA 2J34A 5GIBA 5F53A 2WUCA 5FPYA 1HFDA 1BRBE 2AS9A 4Q63A 5FL7D 4YOJA 4AZ2B 1AVGH 4MQAA 1LPZB 1GWAA 1ANEA 4UD9H 2BLOA 1EOJA 2A4RA 2BZ6H 4BTTB 1XVOA 1TRYA 1YLDA 3ATLA 4YESB 2BDGA 1GDUA 1W3CA 1CQQA 1S84A 2ESTE 1GMHF 2G5NA 1P09A 1AB9C 3LH1A 2H5CA 5IDKA 3H5CB 2A4GA 1KY9A 4TSFD 1ZRBA 2PGBB 1D4PB 1MKXH 1QL8A 5I25A 1C1MA 3F2HA 2W26A 1C5YB 3PLBA 1OOKB 1QRZA 4IGDA 1XXFA 3VXFH 4ABEA 3F9HA 1UTLM 2P59A 1OWIA 1DWDH 1Z8RA 3Q00A 2SNVA 4P00A 1ESAA 3QGNB 1E34B 1RTKA 3MU0A 4F55A 3TH2H 1O3NA 1O30A 1FY3A 3F1SB 1T32A 3SJ9A 3T25A 2ZPRA 3UNQA 1O2PA 2XBVA 3UOPA 3SJOA 3FP6E 2BB4A 1H8DH 5GWZA 5DJ7A 3I29A 4INLA 2SNWA 3RMNH 4DW2U 3C1KA 2Y80A 2WZQA 2A32A 2F91A 1NPMA 4X6MA 3MO6A 4B2BA 5FX5A 4NIYA 1FAXA 5G4BA 3RXVA 1C1QA 1S6FA 2P3TB 4YOIA 5C3NA 1SLWB 1BTUA 1ZSKA 3F2GA 4O9VA 1A1RA 1OWHA 1RS0A 1K0HA 1VR1H 4NWKA 4XDEA 8ESTE 3LC5A 1MZDA 2ZFSA 1WQSA 1A5HA 4XRNA 3SQHE 3AW0A 4IMQA 3RXJA 4BAMB 3VB5A 3BTWE 1W11U 4OM9A 2OCVB 4NFEA 1ELTA 3MMGA 2HWLB 2FOGA 4OS7A 1OWJA 3STIA 2PKAA 2EI6A 2TGAA 3RU4T 5BPEA 5GJ4B 4CRFA 3E16B 1PPHE 1TNJA 1AU8A 4I8LA 2ALVA 5HIZA 3LJJA 2BYAX 3FKSD 1O2XA 1HAZB 1DXPA 1O39A 1DWCH 1TNGA 1KMHB 3M5NA 2J92A 4ABIA 2FOHA 4JZIA 2NWNA 1O2QA 3QDZB 1SG8B 3MH4A 1CA8B 1MTSA 1QGFA 3QO6A 4IC5A 1QCPA 4JCNA 4IN2A 1MTNB 2PTCE 4P02A 3MQKC 2C90B 2ZGHA 1PFXC 3RXGA 1RFNA 1H1BA 3AAVA 5FPTA 2RDEA 4DG4A 2O8TA 2AFQB 1AY6H 3MI4A 2OK5A 4HFPB 1GPZA 1S0QA 5A0BA 4B6FA 2J97A 1ZMNA 2ZHQH 2Y7ZA 3SV7A 1DE7H 2M5TA 1AKSA 2G55A 1DWEH 2A0QB 1SGQE 1GI8B 2ZP0H 1F0RA 4H6SB 1PPBH 2J38A 3P8FA 3LT3A 1MTNC 2TGTA 3P8GA 3PB1E 1MABB 1SFQB 1P2MA 1SLUB 1W0KD 3M3VA 3T26A 1EZSC 1OWKA 1TPSA 1TX8A 3MNBA 3P95A 4ABGA 1GI0A 2BM2A 4ISNA 4WWYA 1BMLA 4OS4A 4TT3D 5DPAA 3ZV9A 2RDLA 5A2MH 1SFIA 1GJ6A 1AE5A 2HPPH 3SV2H 3NXPA 1C5LH 3M5OA 4MVNA 1EAWA 5L6NH 3MH7A 1O5BB 4CBNA 1W7XH 1O3HA 1B0EA 1IHTH 1BHXF 2FDAA 2WHXA 1YM0A 3ZZDA 1J8AA 4NGAH 2FS9A 3EAJA 1WOFA 2BOKA 2FOAA 8KME2 1TABE 5HYOA
chains in the Genus database with same CATH topology
5H4IB 3SZNA 2BMGB 1BA8B 2GCHF 1BRAA 5FPSA 3MHWU 4IW4E 1QBNA 1EX3A 1OS8A 2A7JA 1UTKA 2BLWA 1TGTA 1AWFH 1FZZA 4F49A 1H9IE 4Y7AA 4MPUA 3CS0A 1ZHMA 2ANWA 1TA6A 4CRBA 1K1OA 5C1XA 3PYHA 1AUJA 2A4QA 3PWCA 1V3XA 3RXCA 2CMYA 1C2LA 5CMXH 1SMFE 4UE7H 1G9IE 1HPGA 3W95A 4WMFA 1JIMA 1QTFA 2FI5E 4THNH 2FX6A 3ODDA 2BDAA 4FUBA 1GVZA 2CXVA 4UFDH 1H9HE 1NU7B 1B5GH 2FOCA 4IS5A 2PHBA 1GMDF 1P2NA 2ZDKA 1EJAA 2G51A 3E0NB 3RXKA 1C5OH 4MTBA 2Z3DA 1BTPA 1CT0E 2R0LA 1W14U 1P01A 3DA9B 5EQQA 2BY5X 2XYAA 3ZVCA 2B0FA 1LVYA 1GL1A 3Q77A 2VB0A 2ZPQA 4AB8A 1ZLRA 3V7TA 3ZZ9A 1ORFA 3SUDA 1HAVB 3SU2A 1FDPA 1UVSH 5EODA 1RJXB 1UTOA 2AIQA 2ZU1A 4YT6H 2F3CE 5E8EH 1KTSB 2P3FH 4FUJA 2OP9A 1NFUA 1BCUH 1G37A 1LCYA 4ABAA 1MBMA 3H7OA 3BG4B 2HALA 3P70B 1F7ZA 4MPWA 2BHGA 2Y6TA 1G2MA 4B74A 3RXLA 3ITIA 1SOTA 4DCDA 1W0YH 1SLXB 1C9PA 2UUJB 1CU1A 1T4UH 4GAWA 1O3IA 1TNKA 3LGVA 1Q3XA 2JH0D 3SI3H 1RTFB 1AUTC 3GY6A 1CGIE 2LNCA 1FNIA 1B0FA 3SV6A 3KL6A 1XUIA 1ELCA 1GBBA 1ZSLA 3GOVB 1DFPA 3BG4C 1UVPA 2P16A 2ZECA 1AZZA 2ZCKP 1VCQA 2PUXB 1V2RT 2Z9IA 1SQAA 1GJDB 1UK4A 3KQCA 4AB9A 4Q2KA 1SGRE 2BVXH 1HXFH 2NU2E 4ZMAH 3VB4A 3D23A 1V6DA 1HV7A 2F9UA 1LO6A 2GKVE 3QLPH 1C5WB 3IG6B 1GBFA 1WUNH 1JIRA 4MNXA 2FX4A 2AIPA 5A0AE 3URDA 1MKXK 4DIIH 3OSYA 2A31A 3RUOA 2FZZA 2WPLS 5FX6A 2H9EH 1DXWA 3ZV8A 2BDIA 2CF9H 3VFEA 3NK8A 1A0LA 2ZQ2A 4FXGH 3PMJA 2ZFRH 3LGIA 3SU4A 2TGDA 3GCNA 3LGUA 1WSSH 4BAOB 3DUXH 3RU4E 3F6UH 1IQKA 3SGAE 1XUGA 3BTDE 3K65B 2UUYA 1EXFA 3SOSA 3OY5U 1O31A 2Y81A 1H9LB 3L3TA 4DURA 1D3PB 1ZJDA 2D2DA 2XBWA 2F9PA 1QA7A 1HIAB 2XRCA 3JZ1B 8GCHF 1O5AB 2FXRA 1WBGB 2Q6FA 2Z9LA 1ETTH 1P06A 1KLIH 1K1PA 3UR6A 2FODA 2Y7XA 4TYDA 5FHTA 3A7WA 1BBRK 3A8CA 1EATA 4YZUA 2GV7A 3M3SA 3SORA 1C5RA 3ATKA 4X1RU 5JBTA 1UCYE 1TWXB 3BTKE 1VJAU 2J4IA 1GJBB 4ISLA 2QXIA 2VIVA 5LGOA 1GCTB 5T6DA 2AGIX 2ZZUH 2XC5A 1Z7KA 1PYTD 2F9BH 1AGJA 1BIOA 4MNVA 5EU8A 2GMTB 1DLEA 2Z94A 3RMOH 3ZYEA 3MU5A 2FOEA 1KDQA 1O3MA 1GJ7B 3RXSA 2VJ1A 1AN1E 3S9AA 1YPJH 4H6TA 1C1PA 1SL3A 4JYTA 2VH6A 2ZC9H 4D9RA 1C5ZB 3TPIZ 2Y5FA 3M36A 2WPIS 3HKJB 1P2OA 1OX1A 1QB9A 2F9VA 5A09A 1D3TB 4FUHA 1MKWK 1AVXA 3UY9A 3M35A 1HXEH 3W94A 1GCTC 3T5FH 4CR5A 3KF2A 2QF3A 3I78A 5ETXA 2WPMS 2STAE 3RM2H 4NWLA 4ABJA 5JDUB 2FMJA 3PM3A 2GMTC 1QNJA 1ACBE 4FUGA 4JYVH 3RXPA 4E06H 1KXFA 5K0HA 1O2SA 1ZSJA 1MH0A 5JYIA 2XC0A 3QTVH 2QXGA 1DOJA 1O34A 3ZZ4A 1A3BH 2VNTA 1WTGH 2SGPE 1TAWA 3ATMA 1GHXH 1OP8A 4WMEA 1FJSA 1AQ7A 4A1XA 2ZO3H 1SGFA 1GI1A 4D7GA 5E0GA 2ZDAH 1KSNA 1MCVA 1P02A 1PPZA 2BY9X 1EZUC 4Y6DA 5CE1A 2TRMA 4Q80A 3UOUA 5A8XA 1C1VH 1LHDH 2NU0E 1G30B 3TK6A 2FOMB 2WYJA 1HB0B 2P95A 8GCHG 2H1UA 1F5LA 1F92A 1S81A 3TITA 4D7FA 1QRXA 1A3EH 2GVFA 5C1UA 1MTUA 4INHA 3T2NA 4CRAA 4DVAU 3QUMP 3BSQA 1ZYOA 2ANMH 3ZVGA 3SU1A 3ATIA 2TIOA 1EQ9A 1V2LT 4I8GA 3R0FA 1FIZA 1DDJA 1EKBB 2VIQA 4GHTA 3MNXA 2ZQ1A 4JZDH 1NFYA 1TFXA 5EPNA 1TLDA 1ABJH 1NS3A 3PLKA 1FAKH 1XUHA 3MOCA 1LHFH 1A0JA 1UTQA 5GCHF 2BD9A 5LPRA 5L2YH 2A5KA 1P12E 2BDYA 4WY3A 1L1GA 1P11E 3LIWA 4K5ZA 1BT7A 1T7CA 5T6FA 2SGDE 1S85A 2GDEH 1W13U 3A8BA 3SQEE 4KTSA 1TPOA 2CF8H 2H5DA 1C5MD 1LDTT 4LK4A 3PO1B 1MUEB 1GDQA 1VITG 3RP2A 3URCA 1IQGA 2V3HH 2K1QA 2OC1A 1X7AC 1Z8GA 2FESH 3HPTB 1C5TA 1MQ5A 2R2WU 1ZGIA 3PROA 4X2VA 1C4V2 1Y3UA 2UWPA 4BANB 4FVBA 3F9FA 2C93B 1O37A 3SI4H 1KXBA 1UVUH 2YOLA 1O2WA 2J95A 1GMCF 5E0JA 2FI4E 5ESTE 2P94A 1P10A 3CS7A 3EA9A 4CH2B 3ZZ5A 1TRMA 3KEEA 1G32B 3LDXH 1MAYA 3OTJE 5B6OA 3EGKH 4BAKB 5EPYA 4NSYA 4AGJA 2WYGA 3PO1C 4CRCA 3SUGA 2VVCA 4O3TA 3ZZ8A 4KTCA 3I77A 4ZH8A 4Y71A 3UNSA 1QY6A 1DUAA 3V13A 2Z7FE 2QYIA 1ETRH 2QXHA 4CREA 1MD8A 1TNIA 2Z6BD 4I7YH 4NCYA 2SGFE 3KGPA 2XBYA 2GP9B 1YCPM 2VIDA 2BDBA 2W5EA 3A7XA 4X1QU 4ZROA 4Y10E 3LH3A 4NZLA 1C2GA 3BF6H 1C2IA 4NZQA 4DGJA 1HYLA 2BY6X 2NU3E 4K8BA 2BQ6B 1C2FA 3MU8A 4B75A 1GI4A 1FPHH 3EYDA 3SJKA 1DY9A 1QL7A 5EQRA 1O33A 4YLQH 3EDXB 1ZTJA 2F83A 4AOQA 2LPRA 2BD2A 2OBQA 2ZFPH 1V2TT 2PSYA 4O3UA 1CHOG 1AHTH 2PKAB 1QRWA 1UTNA 3VB7A 1BBRH 3MU1A 2QA9E 5A8ZA 2BY8X 3RXUA 3SGQE 5GCHG 1HAHH 2AMPA 2XBXA 2VWMA 4WF8A 1PQ5A 3TIUA 1V2KT 1XKBC 1ESTA 1FLEE 5DO4H 1SB1H 2AGGX 2ZWLH 1WU1A 2FYQA 3MU4A 4ZUHA 2ZGXH 1O3GA 3AVZA 1NO9H 2HRVA 2GDDA 1YCPK 4Q7XA 3MO9A 3NCLA 1K28D 1HAYB 1G2LA 3M3TA 2FI3E 3LGTA 3GY4A 3K6ZA 1FQ3A 1O5EH 1C1RA 1LQDB 1OXGA 1TB6H 1VZQH 1KXDA 1TNLA 1PJPA 2Y82A 1O35A 3HK6B 3QZQA 2VIOA 4Y0YE 2OC0A 4UFEH 4FUDA 5TCCA 4UONA 1L2EA 1HAOH 1TQ0B 2AGEX 5TCAA 1MKWH 1O5GH 1SQOA 5DP4A 3BTGE 2VVUA 4X6PA 1ZJKA 1NT1A 3UQVA 1U6QA 1GMHG 4ABHA 3UPEA 1IOEA 1AI8H 1EJNA 2R9PA 2ZU3A 5EW1H 2O9QA 1A0HB 2ZI2H 4F4OC 5DP5A 8LPRA 2GD4B 3ATWA 2OQ5A 1ARCA 2C8XB 2OQUA 1HJAB 4B2CA 5FCRA 1Z8IB 1CT2E 1V2MT 2VINA 4U2WA 1MD7A 3HATH 2PKSB 3GICB 4FU7A 1EP6A 2FYRA 4NIWA 1S0RA 4Y79A 1BTZA 4IMZA 2B8OH 6GCHF 3A88A 1NC6A 4X2XA 1ZPBA 1J9CH 1SPJA 1F0TA 4ISIH 4X1SU 2RA3A 1YPGH 5EXNA 3LPRA 1WTHD 3S9BA 1T8NA 1HCGA 3M37A 4OS6A 3MH6A 1HJAC 1QJ1B 3QGJA 2RA0A 2VWNA 5FAHA 3SGBE 1WV7H 2BVRH 1EZXC 2GZ8A 4KGAA 4FUIA 2PKSC 1XMNB 1OYTH 4NIXA 4E7NA 1CE5A 2CN0H 4Z0KA 4DJZB 3A8AA 3IWMA 4WJG2 4JK6A 1YPLH 3LOXA 2EI7A 3OU0A 2FLRH 4RKJB 2WV5A 4B76A 3MWIU 1AZ8A 2SGEE 2XWAA 3KQBA 2Z9GA 4X8TH 4CRGA 4R8TB 2TBSA 3A85A 3KN2A 4NIVA 4FUFA 4D76A 1L4ZA 1V2WT 4YO9A 3TVJB 4U32A 3FZDA 1QBVH 2O8WA 1TGNA 2A1DB 1O3AA 3S7KB 1UJ1A 4K1TA 2A5AA 3ELAH 1C1SA 4OS5A 3RMLH 3GY3A 4IBLH 1SOZA 4Y11E 5EXMA 3DHKH 2W3IA 1V2VT 4H4FA 4AG1A 2BXUH 3ZZCA 4GUXA 1RGQA 2V35A 1ZHPA 3RDZA 3TU7H 5JB8S 4OS2A 1K2I1 1ZR0A 5DP9A 5E2PA 3PTNA 3Q76A 3SO3A 1C4Y2 1MTWA 3F9EA 4I8JA 4JK5A 2VIPA 3GCTF 3TK5A 2R0KA 1C2JA 3GY5A 2GGVB 1ZMJA 2IJOB 5E0HA 1EUFA 1BMMH 1WCZA 3O8BA 1C2EA 1MQ6A 1A2CH 3F9GA 2DE8A 4O03A 1BQYA 1EB1H 1TOMH 3A7YA 1GBHA 1SQTA 1Y5BT 1YC0A 2BTCE 1O5DH 1NESE 1INCA 3IITA 1G3BA 3S0NA 4GHQA 5C5OA 2ZEBA 3KHVA 4A7IB 1ZGVA 1A46H 2FP7B 5T3HA 2ZF0H 1SGDE 4MG3A 2ZHFH 1BTXA 1LVMA 3TJNA 3D62A 2H9HA 3SHCH 4MPVA 2OINA 2G52A 1BHXB 5DKMA 1FY5A 4AFZA 2RG3A 1V2PT 2BD7A 1JWTA 1GI6A 1GVKB 1TX7A 2OLGA 1W0ZU 2OD3B 3O8RA 2GZ7A 3QK1A 3SN8A 1NFXA 1YCPH 1YPEH 1OKXA 2GCHG 4RKOB 2VH0A 4NA9H 7ESTE 3KCGH 3RM0H 1ANBA 1UTPA 1D6RA 5DP3A 4MPXA 1EB2A 2C4FH 1SGNE 2KAIB 4Y8ZA 4K1SA 4A5TS 3PV4A 3LJOA 1A61H 2OC8A 1PPFE 3E90B 1K9OE 1GJ8B 2OXSA 3FVFB 2Q6GA 1NTPA 1YBWA 3LONA 1T8OA 3M61U 1GBIA 1YKTA 1EOLA 3GCOA 4E7RG 3BIVH 2AERH 4DIHH 2V0BA 1YLCA 1HUTH 4ESTE 2HNTC 3RC4A 2FEQH 1NRNH 3ZZ7A 1UCYK 5SGAE 1M9UA 5EW2H 1GMDG 1VGCB 2OUAA 2CHAB 1CO7E 1J17T 1O2KA 1LHEH 3GCTG 4GCHF 4K60A 6CHAB 4MNYA 2D8WA 4KKDA 3RMMH 1DSUA 1L1NA 3MYWA 3BV9B 2ZHWH 1ELAA 1O2LA 1TIOA 3TK9A 1ELFA 3K9XB 2SFAA 1UTJA 2G00A 3EE0B 3K6YA 1Z71A 3ZZAA 4J1YA 1C5NH 3K2UA 3TGJE 3RXDA 4K3JA 1KDQB 1T31A 3NKKA 1O2MA 1O2HA 1LVOA 2G8TA 1TGBA 2FLBH 2XW9A 3PTBA 1VGCC 1V2QT 4YT7H 3LU9B 1AE8H 2CHAC 3Q3KA 3O8CA 1MMJN 6CHAC 4Q7YA 1HAPH 1BRUP 1LKAA 3T29A 1GDNA 4X8VH 3TGIE 5FCKA 3VPKA 1O3OA 1UVTH 3E8LA 3TNSA 2GT8A 5HM2A 1YPHC 3RLWH 2Z3EA 1SSXA 1MZAA 4IN1A 1NY22 1MBQA 4B71A 3GCHB 1XUFA 1ZTLA 1RD3B 5DP6A 3RXRA 2WUBA 1C2KA 3EA8A 4CHAB 4PROA 1ETSH 3ZZ6A 4I8KA 1A7SA 1E36B 3GDUA 3VB6A 4R0IA 3OX7U 1Z6JH 1P03A 3PMHB 1OYQA 3E1XB 1TQ7B 5AHGH 1TPPA 3OY6U 1D6WA 1NN6A 1QJ7B 2ALPA 1G3DA 2G5VA 2C8ZB 1RTLA 4AFSA 5AFZH 2TGPZ 1QHRB 4I8HA 5HMAA 1EPTA 4XFQA 4E05H 1SGFG 1C1OA 5DP8A 2ASUB 1MTVA 3SU0A 2HVXA 2W7SA 3A7VA 1P04A 4OGYA 3SW2B 2HNTE 2WPKS 2ZDMA 3GCHC 1G36A 1O2NA 1HIAA 1K1LA 1Y3VA 4X2WA 4CHAC 2ZHEH 4AX9H 2PFEA 2XTTB 1CA0B 4WXVA 2JETB 3UFAA 1LVBA 1YP9A 3P92A 2J2UA 4K1EA 3RXOA 3A83A 4YLUA 3B8JA 2Y5HA 4X8UH 4LZ1H 1P2JA 4XSKU 2UUFB 1TRNA 1UHBA 1W7GH 3M5MA 4ZKRU 3BEIB 4OGXA 1N6XA 2WPJS 1O3BA 1Q31A 2OTVA 5F8TA 4U01A 1FIWA 3DFLA 7LPRA 2FOBA 1SGCA 1Z1IA 3ZVBA 1ELEE 4Z6AH 1CA0C 1TMUH 2BQ7B 1TYNA 4RSPA 1CSOE 5IYTA 2JETC 4X1PU 4QT8C 1DANH 3VGCB 1LHCH 2ODPA 4XOJA 1QQUA 1VCWA 4X6OA 1O2JA 1XXDA 2PV9B 1PQ8A 1YPHE 1S5SA 2ZDNA 1P2QA 4UDWH 1GHVH 1Y59T 1FV9A 2QIQA 1AWHB 1VCPA 1A4WH 1O32A 1GJAB 4AYVB 3F68H 1T8LA 1BZXE 1SHYA 1HDTH 1GI9B 1GBJA 1C5XB 3NZIA 4Y8XA