1WYKA

Sindbis virus capsid protein (114-264)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
152
structure length
152
Chain Sequence
MRLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTYTSEHPEGFYNWHHGAVQYSGGRFTIPRGVGGRGDSGRPIMDNSGRVVAIVLGGADEGTRTALSVVTWNSKGKTIKTTPEGTEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SINDBIS VIRUS CAPSID PROTEIN
publication title Probing the potential glycoprotein binding site of sindbis virus capsid protein with dioxane and model building.
pubmed doi rcsb
source organism Sindbis virus
molecule tags Viral protein, hydrolase
total genus 30
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1998-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wykA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wykA01
1NT1A 1A61H 2PHBA 1TRNA 4H4FA 1ORFA 1ACBE 2P59A 3A7WA 4GSOA 4X1QU 3ZZ8A 3PYHA 3I29A 4UDWH 2ZU4A 2AH4X 1IQIA 1ETRH 3PO1C 4ABJA 1O2JA 2FOFA 2H1UA 1IQFA 1C1NA 3GDVA 4OS7A 1C5UA 4X2YA 1Z8RA 3GICB 3LC5A 1DANH 2EA3A 2V35A 3AAUA 4CHAC 1O2QA 1WV7H 1S6FA 2CGAA 2ZGJA 3UQVA 5GIBA 3UPEA 2WUBA 4BTIB 4XSKU 4KGAA 4TWYA 4ZUHA 1M9UA 4K69A 3A7YA 1GDUA 1OWJA 1O34A 4K8BA 4DJZB 4DIIH 1HAVB 2BLQA 1RGQA 2Y5GA 4DIHH 3V3MA 4JZIA 1GI3A 4MNVA 1A0HB 1DUAA 1IQEA 1FNIA 5F8ZA 1ABIH 4AN7A 2PKSC 3QK1A 3W95A 3CS7A 3OTJE 3SBKA 1MQ5A 3CP7A 3O8BA 4Q7ZA 1JWTA 1SGEE 3AASA 4Y11E 1HDTH 2AMDA 1Q3XA 1W3CA 4OS1A 4BTTB 1GMDF 3A8BA 5EW2H 3KIDU 4Y8YA 1TWXB 4B2AA 2O8TA 4AOQA 4VGCC 1O5DH 3RC6A 5GXPA 4GHQA 2PKSB 3VB7A 4NWKA 1AUJA 2ZHWH 3SV7A 2VB0A 1O3KA 1ZHMA 4O3TA 5L6NH 1YKTA 4ZHLU 1F5KU 2XXLA 2ZTYA 5F6MA 1SGDE 4UFGH 1GBDA 3UIRA 4XE4A 1O0DH 4BXWA 1GI0A 3H7TA 3NWUA 2R0LA 2Z9JA 2QYIA 2AGIX 3LC3A 4OS2A 1HAYB 3TK6A 3SJ9A 4MG3A 1EASA 1GBTA 2ZFTA 3M7TA 3SJOA 4U32A 2J4IA 3FAOA 2GZ8A 4DT7B 1C2HA 3BTFE 1EUFA 3PM3A 1L2EA 2XCNA 1EX3A 1O5GH 3BG4C 3B8JA 4AX9H 1QNJA 1FAKH 2FX4A 1BB0B 1O3GA 1QB1A 4Y0YE 4UEHH 4NA7A 1YPGH 2SNWA 2W26A 4TY7A 2XWBI 5GDSH 1MMJN 1KXFA 1WU1A 1QY6A 3IWMA 4KTCA 3RXLA 5FBEA 3K6YA 2FOMB 2HOBA 2F91A 1PYTD 3MU5A 2ZHEH 3M5NA 4MNWA 1O39A 1J15A 1V2RT 3MWIU 2P94A 1SGYE 2BD2A 2VIQA 1T8MA 2JETB 1L1GA 1ELDE 2IOTA 1ZTJA 1ZSKA 1A1RA 2PKAB 1EXFA 4NG9H 3GCHC 4X6NA 3GY4A 2FM2A 1JRTA 2O8LA 1YPLH 2GVFA 1QQ4A 1O2HA 4E7RG 5JPMH 1CGJE 1GVKB 1ESTA 1WTHD 3BEFB 1ZSLA 5IYTA 1GJ7B 2ZPQA 7ESTE 3PV4A 2O8UA 1FN6A 4CBNA 2B7DH 3GCHB 3SU1A 2OC0A 2FOCA 1UMAH 3A82A 3HATH 3QX5H 1HAIH 2M5TA 2FP7B 1ESAA 1TOCB 5EW1H 3NKKA 3E91A 1GMDG 5EQQA 3BN9A 3A85A 1BTUA 1FXYA 2ANMH 2DUCA 4RN6A 3TJUA 5A8XA 3ZVGA 2C8ZB 1QL9A 3R3GB 1A5IA 2ZPSA 5L2ZH 1GDQA 5L2YH 2AGEX 1V2VT 4YM9A 2Z9KA 1EAIA 1FY4A 4AB9A 1EB2A 4JCNA 2OP9A 3SGBE 4ABHA 1GBLA 1XUGA 2VWLA 4ZXXH 4YT6H 3UQOA 7LPRA 1EAXA 2Y7XA 1JMOH 1HFDA 1ZPCA 2G55A 3ZZ4A 4FUJA 1S84A 1HB0B 3MFJA 1BTYA 3QGNB 3V12A 5EG4A 4IMZA 2OC8A 5GWZA 4JZFH 4Y7BA 1O3FA 3STIA 1RTFB 5EGMA 2A32A 1TRMA 4E7NA 4GVUA 5JB9S 4UFEH 1GBMA 1L0ZA 1G3BA 3T29A 1AWHB 2EEKA 1QCPA 1O5CB 4UFFH 1BHXB 2ZHFH 3RXIA 2V6NA 1FY1A 1MTUA 1OWIA 2OXSA 5DG6A 1PPBH 1GHWH 3M7UA 3PROA 1GVZA 6LPRA 3MO3A 3RMNH 1T8OA 3RXHA 3ZVFA 3E6PH 3KQBA 2ZFQH 1V2OT 1ANEA 2BQ7B 2A7HA 1O3JA 1SGPE 1FY8E 1TGNA 4AYYB 2XRCA 1C2FA 1TNHA 2VVUA 2Z3DA 4XBCA 1QRZA 3ZVBA 1P11E 4WMFA 5K7RA 4QT8C 1JIMA 1K2I1 2OQ5A 3M3TA 1CT0E 4ZKOU 1OXGA 5DP3A 3ZVDA 4MTBA 2ZNKH 8ESTE 2ZFSA 2HPPH 4LZ1H 1PQ5A 2XBYA 1W14U 4DVAU 2Y5FA 3QLPH 1NFYA 3DT0H 1N1LA 4MNYA 1K1MA 4WMEA 5JBTA 3RP2A 5JBBS 1TNKA 3RM2H 4I33A 1NS3A 1A0JA 1H1BA 4I8HA 1UVPA 5EU8A 1ELGA 4Q7XA 2K1QA 4BXSA 1DUEA 1XM1A 2FLBH 1PPGE 5HM9A 1LVOA 2ASUB 1DXWA 1GBJA 1C5TA 2D8WA 2A5IA 3HK6B 3LOXA 1BCUH 5GJ4B 2ZZUH 3GYLB 5E8EH 1O3DA 1O2TA 1W11U 1VJAU 2G51A 1WQVH 4MPWA 4DOQA 4DG4A 5F8TA 1FIZA 4ISOA 3TH4H 2R3UA 1P2IA 2D26C 1FV9A 2TGTA 3ATIA 4O03A 1IOEA 1W0ZU 3GCOA 4DY7B 4ZROA 2SGQE 1GJ6A 1G32B 5SGAE 1O3HA 2OD3B 1WQSA 1O3NA 2HRVA 2ZDNA 1ABJH 3VB3A 3SGQE 1FY3A 3BTDE 1P12E 1TLDA 1UO6A 4LOYH 4X0WU 4E05H 4NIVA 1EZXC 5ABWA 5ETXA 1UK4A 1ETTH 1GI2A 1UVTH 1W13U 2PUQH 4SGAE 3LGUA 1THPB 1KDQA 3SU6A 1GHAF 4O97A 2BY9X 7KMEH 5EODA 1HIAA 1VR1H 2P3TB 4Y6DA 1EATA 4K8YA 2O9QA 1G37A 2A5KA 4INKA 2CHAC 1Z6EA 1W10U 1QR3E 2HNTF 1G36A 3SNDA 3QN7A 3UR9A 4A5TS 2WPJS 3FFGA 4YT7H 3MYWA 1C1OA 1BRBE 1ELVA 3M5OA 4ABGA 2G5VA 1ZHPA 2FEQH 1C1MA 2XBVA 2GCTC 5DJ7A 3U1IB 4WF8A 4ABDA 1C5SA 3Q77A 2BD8A 2BM2A 1DX5M 1GI9B 5AFYH 3U98H 2Y82A 2H9EH 1DWDH 1YM0A 2ZU1A 3PB1E 2V0BA 3MTYA 3EA7A 3PTNA 1EPTC 1O2GH 1VITF 4J2YB 2XWAA 3S7KB 4X6OA 2Y81A 1UTKA 4B2CA 1GHZA 2ZTZA 1BITA 3BTEE 5ESTE 1PQ7A 2Z9LA 1KTTB 1H9HE 1NFWA 2CN0H 3M5LA 1GI4A 5A8ZA 3FP8E 1W7GH 1Y3VA 5CE1A 1C2KA 1L4ZA 1D6RA 3SNBA 2JH6D 1GMHF 3BSQA 3BTKE 4OS4A 2PGQB 1HUTH 2BD3A 4AG1A 3ITIA 1KXDA 1GBFA 4LXBH 1LQDB 3BF6H 1SR5C 2FDAA 3KQCA 2VNTA 1SFQB 4NFEA 1LHFH 1Q2WA 6GCHF 3K65B 1OWHA 1MKXH 2UUJB 2OUAA 4ZKSU 3O8DA 1F2SE 1SGQE 1C5XB 1H8DH 1CO7E 1GI7B 1O3LA 1QBNA 3ZZ9A 1G2MA 2F9BH 1O2IA 1MAYA 4NA8A 1MBQA 1ZSJA 3SHCH 2P3FH 1GHAG 2OTVA 1QTFA 3JZ2B 1IQJA 1BMNH 2TBSA 1AIXH 1TFXA 3LJJA 3VFEA 1E36B 1UVUH 1V3XA 4JZDH 5T6DA 3TNSA 1HXEH 4K5ZA 1ZGIA 2ZDMA 1A5GH 2O8MA 1BTPA 2G4UA 3SQHE 1C2DA 1GL1A 4YZUA 4ABAA 2F9PA 4ABEA 1G3CA 2FIRH 1HGTH 1HRTH 3BTGE 1DICA 1THSH 1C5YB 1QRWA 1C1TA 1ANCA 3ATKA 1NZQH 2H9TH 1VITG 4WJG2 3SJ8A 1DS2E 2Y80A 1TGTA 1J8AA 4J1YA 2FODA 1LVYA 3MNCA 1Z8GA 1ZZZA 5AFZH 2F9OA 1D6WA 3MU8A 3BV9B 1FIWA 2WUCA 3TH2H 1QFKH 4D7FA 2A45B 1KXBA 3E0PB 4NFFA 2ODQA 5FPYA 3RXDA 1Z6JH 4JK6A 2PFEA 1Z1JA 2NWNA 2FOHA 1LPZB 4CREA 2VIVA 1BMAA 3I78A 2GV6A 1AQ7A 1ZMNA 2Q1JA 4AZ2B 4H6TA 3A7ZA 1MTVA 1GMHG 3SO3A 3D62A 4BAQB 4F4OC 1ZMLA 2OBQA 2FTMA 2BB4A 3OSYA 1NRSH 3RXAA 3AAVA 3M37A 1P9SA 2FXRA 8KME2 2GP9B 1OPHB 1ZJKA 3RMMH 5LPRA 1XUJA 1ZR0A 1T32A 2CF9H 2VIOA 1T8LA 2SGDE 5LPFA 2RA0A 3LGYA 2WV4A 1T8NA 1F0SA 2GZ7A 2Z6BD 2I6SA 2W7UA 2BLVA 2FPZA 4WY3A 1PPZA 1GI6A 1P3EA 1YPMH 1GBCA 4AG2A 1PPHE 1F92A 2HLCA 4ISHH 2V3OH 3ZZDA 1CE5A 4MDSA 3EA9A 3LT3A 3OYPA 3RXEA 2P3UB 9LPRA 3T62A 2A4GA 3AW1A 3RU4D 1AE5A 4AFSA 1CBWB 2ZHDA 2XTTB 2QXGA 1IQHA 1UCYE 3KGPA 2ZEBA 4F49A 1TGBA 2EI7A 1BA8B 1KDQB 1WSSH 2EI8A 2UUFB 2PR3A 3NZIA 3BTHE 1HIAB 1F5LA 2VIWA 3UWJH 2Y6TA 3TGKE 2HGTH 4WWYA 1O2NA 1HCGA 1UTLM 2TGAA 1SI5H 4DURA 4WH8A 1TGCA 1TPPA 5DPAA 3HPTB 1TABE 4GLYA 1BT7A 1GHYH 1NRRH 2XYAA 4FUFA 1FAXA 1P2JA 4FU8A 1TA2A 1XMNB 1Y5BT 1O3BA 3EAJA 1IQLA 4WMDA 2AERH 1NPMA 3MO6A 2R2WU 1O3IA 1K28D 1FDPA 1EJMA 4AYVB 2RA3A 3V7TA 3BIUH 5JYIA 3BTME 3RXSA 1O2YA 2BD9A 5DP9A 3SNCA 4CRAA 1QB6A 3SU4A 1HAHH 4K2YA 5IDKA 1GHVH 2Z94A 2QC2A 4XFQA 2AEIH 3QWCH 4H42U 1NN6A 3UFAA 5E0JA 3GY3A 3SW2B 1LVMA 3U8RH 2WINI 2G81E 4IC6A 3U1JB 1AB9B 5FHTA 1ETSH 2AFQB 1LKBA 2R2MB 1PFXC 1V2QT 1K1PA 3SN8A 2GGVB 2G00A 1FY5A 2F9UA 2XW9A 1Q31A 3DFLA 3AW0A 3PMJA 2GD4B 3SQEE 2V3HH 1SPJA 1WBGB 2STAE 4FUHA 1RS0A 1EQ9A 5E0GA 1C5PA 1K1LA 1SSXA 3VB4A 2J94A 4JYTA 3T5FH 1O5AB 4FUBA 3RM0H 1QJ6B 4IMQA 1IQMA 2P16A 5AHGH 1BTZA 1IQNA 1LVBA 1MH0A 4X8VH 4YTAA 3MMGA 1CVWH 2JETC 1VZQH 5C20A 3E3TA 1PPCE 4SGBE 1YCPM 1C5NH 2UWPA 1XXDA 3MNSA 1DDJA 4IN2A 2RDLA 1VCPA 2VINA 2ZHQH 3LU9B 3P6ZB 2G4TA 4BAHB 4KELA 4THNH 1O37A 1SB1H 2WPLS 1C4V2 4XBDA 1SG8B 1DLKB 1BBRK 3QTOH 3HKIB 3E16B 2ZDVH 3PMBB 1O3MA 1GI8B 1ZRKA 1DXPA 5T6FA 2GT8A 1ZOMA 4KTUA 1NRPH 3CS0A 1P2OA 3P8NA 3H5CB 4HGCA 1WAYB 1AZZA 3NCLA 3P70B 3TH3H 2P95A 1CGIE 1K1OA 3HK3B 3PWCA 1AZ8A 1OP8A 1ANBA 1JXPA 1W2KH 2ZQ1A 1LMWB 1TIOA 2ZCLP 5J4SA 3SGAE 2ZGXH 5EOKA 1SBWA 1HNEE 1MZAA 2B5TB 1QB9A 4NZLA 1Y3WA 2CF8H 3KEEA 3Q3XA 4KP0A 3A7XA 3OX7U 1AHTH 4R0IA 3SUGA 3F68H 2A2XH 2OC7A 2W3KA 1C1UH 1FZZA 2Y5HA 1F7ZA 3MH6A 3TIUA 3MU0A 5PTPA 3KQEA 1YBWA 4NCYA 2FI5E 5C1XA 3RU4T 4DGJA 1SQAA 3A86A 1O2WA 4A1TA 1CT4E 1VGCB 3BTWE 1EPTA 3D49H 4X2VA 2ZU2A 2ZO3H 1A46H 3A8DA 1ZTLA 4X2XA 1TONA 1FN8A 1DWBH 1UTJA 1DE7H 3SUFA 1B0FA 1O3PB 5C1YA 4WH6A 1Z7KA 1D3QB 4ESTE 1P05A 3RXTA 4YESB 5LH8A 3U69H 5J4QA 3H7OA 2OQUA 3SZNA 1F0TA 3MH7A 1TNLA 1MAXA 3BTTE 1P0SH 1IAUA 4XOJA 1K22H 1QBOA 1C1RA 3EA8A 4FUGA 1T7CA 1SLXB 2ILNA 4OS6A 3TJOA 3ELAH 1O36A 1A3BH 3A7TA 4CRBA 4IS5A 1GGDB 5B6OA 1GBEA 3D23A 1BRAA 8LPRA 3EGKH 3T28A 1SFIA 2NU2E 1ELEE 3RXBA 2C93B 2SGEE 2PWXA 3PLKA 2HALA 4WXIA 4ZKRU 3T27A 4I8LA 1GWAA 1FI8A 3SV8A 4BTUB 1O5FH 2RCEA 1Z8JB 5FXLA 4CRDA 1ELCA 3L3TA 1LQEA 4K60A 4IN1A 3SORA 1E34B 3M61U 1LKAA 1BMLA 2H5CA 4NA9H 3KF2A 1DY9A 1EJNA 3P17H 4WXVA 4FU9A 1V2ST 3VGCB 1IQGA 3MNXA 4HI3A 2BDYA 3E90B 2BVXH 4JYVH 1C1SA 3F9HA 1EAWA 2VH6A 1O2XA 3MU4A 2IPHA 2WPHS 1XVMA 1HYLA 1N6XA 1CSOE 2QXHA 4FXGH 4OGYA 2BMGB 2ZTXA 3QUMP 4BAOB 4CRCA 1P10A 3A89A 4Y8ZA 1NO9H 4Y10E 1P03A 3UNQA 1SC8U 2J38A 1GJ8B 1OX1A 1T4UH 2QIQA 4CR5A 1AGJA 2A5AA 4BANB 1LHGH 1Y5UT 1BJVA 1O30A 5JB8S 1GJCB 1IHTH 1TBZH 1J9CH 4D7GA 1HJAB 1MQ6A 2SGAA 1GJ5H 1SGRE 2W7SA 5T3HA 4O9VA 3SUDA 2GT7A 1LHCH 2WPIS 1CQQA 5EQSA 4FUDA 3QGJA 1DWCH 3DD2H 1O3AA 5DP8A 1AKSA 2Q6DA 1KTSB 3ENSB 3GY7A 4D76A 1TQ7B 2BLOA 2KAIA 2QF3A 4IW4E 2AS9A 1V6DA 5DP5A 4CBOA 4LK4A 3ODDA 4ABIA 1INCA 3FZDA 2PGBB 3ZZ6A 1PPFE 3Q76A 5FCKA 5T6GA 2PV9B 2J95A 3PWBA 4D8NA 1V2MT 4FU7A 4Z0KA 4B74A 3RC5A 2H9HA 3LKWA 1EOLA 1YYY1 3IITA 1ELBA 3W94A 3EYDA 1G30B 3MOCA 1D3TB 4TPYA 2BY8X 3STJA 1NC6A 1ZLRA 2ANKH 4AFZA 3NK8A 1SGNE 1IQKA 1UTPA 4GHTA 4I32A 3ESTA 3RXJA 1C5LH 4HZHA 2ZCHP 4JYUH 1ZHRA 1Y8TA 2JH0D 2GMTB 1CHOF 3ZVAA 1GPZA 1QRXA 1YC0A 3NUMA 1MTSA 2F3CE 3URCA 5FBIA 1H4WA 1P2NA 3O8CA 2P8OB 4MLFB 2QN5T 2EI6A 1Y3UA 4JZEH 1ZJDA 2BDHA 1OSSA 1C1VH 2A2QH 3N7OA 4UE7H 1P3CA 3B9FH 5F03A 4ZXYH 3RXKA 1N8OB 1AFEH 1O2VA 4ZKNU 2Z9GA 3E8LA 1QA7A 4NWLA 5HXFA 1VITH 5EPYA 1MTWA 2C4FH 3T2NA 1DFPA 3VXEH 1YF4A 3NXPA 2HWLB 4I7YH 3LONA 2BQ6B 4JZ1A 2Z3CA 4NZQA 1KLJH 1WUNH 4NSVA 3GOVB 4JMYA 3KQDA 1FMGA 1AE8H 4OS5A 5C67A 2ZGCA 4Y71A 1E0FD 2EC9H 2ODPA 2PSYA 4TWWA 3UR6A 1Y59T 1TNJA 1LDTT 1V2WT 1O2PA 1DITH 2C8XB 1HPGA 2FLRH 2ZA5A 5TJXA 5CMXH 3GISB 5DKMA 1AMHA 3ZV8A 3P8OA 3PTBA 3RLYH 6CHAC 1YPKH 1ZTKA 1OYQA 2CXVA 2BDBA 4X6PA 1NRQH 3GY6A 1DPOA 3UUZA 1PJPA 1GHBF 3BG8A 1D4PB 3EE0B 3A83A 1Z1IA 3GY2A 5DP6A 2BX4A 1K21H 2FOGA 1FPHH 5A0CA 6CHAB 4B2BA 4R8TB 1O38A 2HNTC 3TGJE 3MNBA 2FOEA 1BRUP 1YP9A 2FI3E 1J16A 3VB5A 3KHVA 1WOFA 4RSPA 5HGGA 2SFAA 2I6QA 1TX6A 2ZDLA 2J9NA 9ESTA 1CHOG 2J34A 4I8JA 1CA0B 2UWLA 3SI3H 3ZV9A 4Y0ZE 2A4OA 2GTBA 2A7JA 2VU8E 4YO9A 3VPKA 2ALPA 3RLWH 4XDEA 1EZUC 1CT2E 4B76A 2C8YB 2BDAA 4JK5A 1SLVB 1X7AC 3S9BA 1S5SA 4FVBA 4K1SA 2Z3EA 2WPMS 4Z6AH 1C2MA 1UK2A 1GHXH 1A4WH 1V2TT 1TPSA 5DK1A 1AVXA 3URDA 1DM4B 2BLWA 2D1JA 4HTCH 3SU2A 2TRMA 4YLQH 2ZKSA 2C90B 1C1QA 2AMPA 4MPUA 3UNSA 2A0QB 3QDZB 1EOJA 1SLWB 1VCQA 2PTCE 1PQ8A 2FYRA 2BQWB 1EKBB 3V0XA 3ZZAA 3ZYEA 5DO4H 1BOQA 4ZHAA 3LGVA 5A09A 2XBWA 2ZFRH 3ZVCA 3ZZ5A 2HPQH 1LPKB 4X2WA 3SV9A 4GPGA 6GCHG 4RKOB 4Q7YA 1RIWC 3EQ0H 5EPNA 5A0AE 4ZAEA 1MU8B 1W0YH 4CH2B 3MI4A 2GX4A 1RTKA 3PLBA 5A0BA 3BIVH 3F1SB 3QO6A 2F9NA 1TPOA 1CBWC 1GHBG 1GJ9B 4KTSA 5C3NA 5JBCS 1HAOH 1XKBC 1P04A 1SOTA 4Y7AA 1S83A 5HMAA 5L30H 1EAUA 5FPTA 2QF0A 3LGTA 1F0RA 1YCPH 5FCRA 1RIWB 1LHEH 2QXIA 1ZYOA 3RXVA 2ZG0H 4X8UH 1K9OE 2KAIB 1H9IE 1YCPK 1O5EH 2TGDA 2VWMA 1KXAA 5TCAA 1EP5A 1GCDA 1P2QA 1RRKA 1LPGB 4U30A 2WYGA 2A4RA 5GPIB 1AFQC 4B75A 1TMBH 1GI5A 3M7QA 2VGCB 2WPKS 1Z8IB 3S0NA 1UTOA 1AUTC 1S85A 3GCNA 3PLPA 3UWIA 5BPEA 5G4BA 1L1NA 1UTNA 2P93A 3BTQE 3SOSA 2B0FA 2O8WA 3UOUA 1OOKB 1IHSH 3UOPA 1QQUA 1Z71A 3RUOA 1AFQB 4X1PU 4MPXA 2Z9IA 3Q3KA 4NIWA 3OY6U 1A3EH 4OGXA 3PO1B 1V2LT 4MVNA 1GL0E 3TJVA 3RXMA 1C2EA 1O35A 2JKHA 2QAAA 1KXCA 1AB9C 5GCHF 4I31A 4CHAB 1TNIA 4CR9A 2B8OH 5C5OA 1HLTH 1L4DA 3VB6A 1TALA 3VEQB 2ZWLH 1WTGH 3S69A 1GCTC 3F9FA 3BEUA 3NPSA 4U2WA 4E06H 3C1KA 5BRRE 3ODFA 3P8GA 3GY8A 3S7HB 1RTLA 1LCYA 2BZAA 3OY5U 2XC0A 1C5QA 3TVJB 1KXEA 1A0LA 1TB6H 4B71A 1HXFH 3A84A 1V2NT 3RXQA 1G9IE 1C5RA 1GCTB 2VVVA 1N6YA 5EQRA 3QZRA 1ZRBA 1A7SA 5LGOA 5E0HA 1CHGA 5EXNA 3AVZA 4Y79A 3RMLH 2BYAX 2ZP0H 4UONA 3ATWA 1BZXE 1BQYA 1QL8A 2ZCKP 3GCTF 3ZYDA 5AVDA 4VGCB 4Y8XA 3HGNA 3JZ1B 3E1XB 4IGDA 2R9PA 4RKJB 3LGWA 1MBMA 4BNRA 3VXFH 7GCHF 1C4Y2 4WVPE 1SQOA 3GYMA 1BHXF 1EZSC 2AGGX 2PSXA 2C8WB 1EJAA 4ZMAH 1BBRH 3ZZ3A 1HAPH 2PW8H 4X8TH 4AFQA 1O2ZA 2XCFA 3PMHB 1NFUA 1EB1H 4YLUA 1C5OH 1KY9A 1TE0A 1UVOA 1TQ0B 3SU5A 1ZPZA 1GJ4H 2BY7X 2CJIA 1OWEA 8GCHF 1J14A 1AD8H 2FWWA 3MO9A 3TGIE 3BG4B 2PUXB 5E2PA 2HNTE 4GCHF 3SI4H 1VJ9U 1LHDH 1SGTA 5TCCA 1MZDA 4U01A 3MH4A 1NESE 5FAHA 1JIRA 4X1SU 1HAXB 1PYTC 3R0FA 3QZQA 2W3IA 1QURH 3TITA 2LPRA 4K3JA 2ZFFH 3CENA 2ZU3A 4YOGA 5GCHG 1BTHH 1OWKA 1ZGVA 1RXPA 2WV5A 4BOHA 1HAZB 3FP7E 1VGCC 2BD7A 3O8RA 1AO5A 1S82A 2TGPZ 4AGKA 1FQ3A 4TPIZ 1YPHE 3SUEA 1ANDA 4HFPB 1NROH 2CMYA 5EXLA 1E38B 2G5NA 3RC4A 2FS8A 1C9PA 2J2UA 1HV7A 2GZ9A 1O2MA 2UUKB 2ZQ2A 4TY6A 3UREA 4IC5A 1B0EA 1Y3YA 4FUCA 1SGCA 3C27B 1GBHA 1O33A 4MQAA 5CHAC 3KNXA 1O2RA 1SVPA 3ATLA 3UTUH 2IJOB 3A81A 1B7XB 2FMJA 1KLIH 2VWOA 2W5EA 1L1JA 3K2UA 3RXRA 3U9AH 2DE8A 2AIPA 2XC5A 1ZMJA 2PTNA 3GCTG 1C5VA 1QGFA 2Z7FE 3S9CA 1TRYA 4AFUA 1AVWA 1GGDC 1DSTA 1SMFE 1H8IH 1HBTH 1P06A 5CHAB 5FPSA 7GCHG 3UY9A 2ZDKA 2XBXA 3A8AA 4XBBA 1BRCE 1C2JA 4AORA 4YOJA 1S0QA 5LPEA 3RMOH 1ELTA 1LO6A 5DP7A 2LNCA 4X6MA 1MCTA 2VIDA 3RXFA 1MCVA 4B73A 3I77A 8GCHG 3TK9A 5DGJA 5A8YA 1AU8A 1O2LA 2CV3A 1TOMH 1RFNA 1YPJH 3G01A 1V2KT 3VGCC 3L33A 1GBBA 1XVOA 1LTOA 4MPVA 4GCHG 1MD7A 1W7XH 3B23B 4TYDA 2ANWA 3ZZ7A 2ZFPH 4D9RA 2Q6FA 3DUXH 1ELAA 2BZ6H 1GVLA 1SGFA 2B9LA 3ZVEA 3SJKA 1F5RA 4GUXA 4UD9H 3KCGH 2AIQA 3FP6E 4FVDA 1VCWA 2NU1E 4ABFA 1UCYH 4O3UA 3BEIB 4A92A 2ZDAH 3A88A 5C2ZA 1P2KA 3SV6A 5K0HA 1UCYK 1UHBA 1XUIA 2Q6GA 2ZF0H 1NFXA 4I8GA 5HM2A 3A87A 4CRGA 1DVAH 3RU4E 2FZZA 3P8FA 1GG6C 5FX6A 4BAMB 3TU7H 1UJ1A 2FX6A 5ESBA 2ALVA 1O3CA 1S6HA 2YOLA 1HJAC 1YGCH 1QA0A 4Q80A 3SJIA 2GCHF 1XX9A 1QJ1B 5JBAS 4ISIH 3QTVH 2NU4E 1AVGH 1GBIA 2D2DA 5A2MH 1GBKA 1GG6B 3GDUA 1BJUA 1G3EA 4X1NU 3T26A 2J92A 2WYJA 4LZ4B 1GI1A 4ZH8A 4X1RU 2FS9A 1FPCH 3K6ZA 1P09A 1MTNC 1O3EA 4NGAH 1AI8H 1SLUB 2NU3E 2IN2A 1DY8A 2ULLA 1C9TA 1FLEE 1SHHB 1DSUA 3TLOA 3F9GA 1BTWA 1NU9A 2FYQA 1SGIB 2VVCA 4KKDA 1BMMH 1CGHA 2H5DA 6ESTA 1JOUB 1QHRB 1UK3A 1MTNB 2BDCA 2A4QA 1MUEB 2BHGA 3HGPA 2ZGHA 3U8OH 2ZGBH 4NIYA 1FUJA 4K1EA 1UTMA 4ASHA 1MU6B 1BDAA 3KL6A 3F6UH 3T25A 1K1IA 3SU3A 5C5NA 3SHAH 5I25A 3ZZBA 1TGSZ 1DLEA 3M3SA 2GMTC 4INHA 1O2OA 3SV2H 2QA9E 1C2GA 2A1DB 1V2UT 3LPRA 2ZECA 3EDXB 4M7GA 3MH5A 1C1WH 2VH0A 1O2SA 3PMAB 4FUIA 1WYKA 1KLTA 2P8OC 2HVXA 4K1TA 2A7CA 1OP0A 1XUFA 2FI4E 1TAWA 1JBUH 2FTLE 1EZQA 3LGIA 2FOAA 1KYNA 3IG6B 1ZPBA 1PQAA 1Y3XA 2BVRH 1DOJA 1HAVA 4X8SH 1RD3B 1D3DB 1KIGH 1N8OC 1YLCA 4A1XA 4Y76A 1YPEH 1ESBA 2QCYA 3K9XB 4ZHMU 1MD8A 5C1UA 1GDNA 1ARBA 1P2MA 4I8KA 2BX3A 3HKJB 1QL7A 2RG3A 2AYWA 4Q2KA 4A1VA 4DW2U 5I46H 3ATMA 2GDDA 4MNXA 1TX8A 1F0UA 2JH5D 1WCZA 1GMCF 3FZZA 2CHAB 2ZIQH 2BD5A 1AWFH 2C3SA 2GCHG 3U8TH 1J17T 3LJOA 1SOZA 2AMQA 4PROA 3M5MA 2BD4A 2QV1A 3Q00A 3A8CA 2XNIA 1TBQH 2BDIA 1SQTA 1W8BH 2GV7A 1P01A 3V13A 1GJAB 3P92A 2YNBA 1O5BB 2F83A 2GCTB 2H6MA 2F9VA 3MHWU 4D9QA 1Y5AT 3M36A 3RXUA 3M3VA 2BXTH 3TNTA 2UUYA 3FVFB 1CA8B 2BXUH 1SL3A 1EPTB 3LH1A 2BY5X 3UNRA 1QJ7B 2GDEH 2XC4A 4IBLH 2SNVA 2TIOA 1FONA 1TA6A 1YLDA 1G2LA 1H9LB 1K1JA 1C1PA 3TJNA 1PPEE 3L6PA 1EP6A 1OP2A 1BBRE 5H4IB 1O3OA 1D9IA 3SNEA 1GJDB 1NTPA 1A2CH 1NM6A 1W12U 3S9AA 1TPAE 3WY8A 1TBRH 2STBE 1HJ9A 1CA0C 1U6QA 2ZC9H 3A7VA 1DT2A 1O31A 2ODYB 1XUKA 1MKWH 4YOIA 1ID5H 2VWNA 1C4U2 3SU0A 5AF9H 1MKXK 1CU1A 2BTCE 2FESH 3TPIZ 2FO9A 2GKVE 1TMUH 3GY5A 1MKWK 3P95A 2TPIZ 1AN1E 1T31A 2ANYA 1BIOA 2OC1A 1AY6H 2PKAA 3LH3A 4CRFA 1SGFG 1HJ8A 1K1NA 1S0RA 5HYOA 2R0KA 2OBOA 1BTXA 1OKXA 1RJXB 1C2LA 3RXCA 3RDZA 3E0NB 1P02A 1D3PB 2NU0E 1OWDA 1OS8A 1SHYA 2H2ZA 2PLXA 3OU0A 2DE9A 2ZI2H 1YPHC 2OLGA 5F8XA 4AB8A 2ZPRA 1GBAA 1C5MD 3TK5A 4UFDH 1O2UA 1NU7B 3M35A 1T4VH 1GMCG 1TMTH 1HAGE 3D65E 4BAKB 3KN2A 5JDUB 1TNGA 2THFB 3MU1A 1GJBB 1S81A 1QIXB 1JRSA 3DHKH 3Q3YA 3RXGA 4ISLA 1UHBB 1ARCA 1TX7A 4ISNA 3GDSA 3ZZCA 4NIXA 1P57B 1O2KA 2BOHB 4ABBA 1XUHA 3LDXH 2QGRA 2VJ1A 3A80A 2QXJA 5FX5A 3RXOA 4AGJA 1O32A 2BOKA 3F9EA 4INLA 1C5WB 1V2PT 1KSNA 2G8TA 2Y7ZA 3LIWA 4A6LA 1BUIA 2BVSH 1A5HA 2SGFE 1UVSH 5DP4A 1V2JT 2BDGA 4B1TA 2FOBA 1ELFA 2SGPE 1NY22 2A31A 4DCDA 4H6SB 2BY6X 3FANA 2UWOA 4FUEA 2ZU5A 2G52A 3SNAA 4NSYA 1G3DA 1DWEH 1B5GH 2OCVB 1XXFA 4CH8B 1THRH 5EXMA 2R3YA 1E35B 1FJSA 3DFJA 2OINA 2YNAA 1TYNA 2VIPA 1E37B 1XKAC 1UTQA 1QBVH 1AKSB 3DA9B 1P8VC 2VGCC 1C2IA 2QY0B 4GAWA 5E2OA 3RXPA 1C5ZB 1OYTH 2ESTE 1P9UA 1NRNH 4A7IB
chains in the Genus database with same CATH superfamily
1NT1A 1A61H 2PHBA 1TRNA 4H4FA 1ORFA 1ACBE 2P59A 3A7WA 4GSOA 4X1QU 3ZZ8A 3PYHA 3I29A 4UDWH 2ZU4A 2AH4X 1IQIA 1ETRH 3PO1C 4ABJA 1O2JA 2FOFA 2H1UA 1IQFA 1C1NA 4RI0A 3GDVA 4OS7A 1C5UA 4X2YA 1Z8RA 3GICB 3LC5A 1DANH 2EA3A 2F4LA 2V35A 3AAUA 4CHAC 1O2QA 1WV7H 1S6FA 2CGAA 2ZGJA 3UQVA 5GIBA 3UPEA 2WUBA 4BTIB 4XSKU 4KGAA 4TWYA 4ZUHA 1M9UA 4K69A 3A7YA 1GDUA 1OWJA 1O34A 4K8BA 4DJZB 4DIIH 1HAVB 2BLQA 1RGQA 2Y5GA 3F2GA 4DIHH 3V3MA 4JZIA 1GI3A 4MNVA 1A0HB 1DUAA 1IQEA 1FNIA 5F8ZA 1ABIH 4AN7A 2PKSC 3QK1A 3W95A 3CS7A 3OTJE 3SBKA 1MQ5A 3CP7A 3O8BA 4Q7ZA 1JWTA 1SGEE 3AASA 4Y11E 1HDTH 2AMDA 1Q3XA 1W3CA 4OS1A 4BTTB 1GMDF 3A8BA 5EW2H 3KIDU 4Y8YA 1TWXB 4B2AA 2O8TA 4AOQA 4VGCC 1O5DH 3RC6A 5GXPA 4GHQA 2PKSB 3VB7A 4NWKA 1AUJA 2ZHWH 3SV7A 2VB0A 1O3KA 1ZHMA 4O3TA 5L6NH 1YKTA 4ZHLU 1F5KU 2XXLA 2ZTYA 5F6MA 1SGDE 4UFGH 1GBDA 3UIRA 4XE4A 1O0DH 4BXWA 1GI0A 3H7TA 3NWUA 2R0LA 2Z9JA 2QYIA 2AGIX 3LC3A 4OS2A 1HAYB 3TK6A 3SJ9A 4MG3A 1EASA 1GBTA 2ZFTA 3M7TA 3SJOA 4U32A 4ASUD 2J4IA 3FAOA 2GZ8A 4DT7B 1C2HA 3BTFE 1EUFA 3PM3A 1L2EA 2XCNA 1EX3A 1O5GH 3BG4C 3B8JA 2KM0A 4AX9H 1QNJA 1FAKH 2FX4A 1BB0B 1O3GA 1QB1A 4Y0YE 4UEHH 4NA7A 1YPGH 2WPDD 2SNWA 2W26A 4TY7A 2XWBI 5GDSH 1MMJN 1KXFA 1WU1A 1QY6A 3IWMA 4KTCA 3RXLA 5FBEA 3K6YA 2FOMB 2HOBA 2F91A 3MQKC 1PYTD 3MU5A 2ZHEH 1W0KD 3M5NA 4MNWA 1O39A 1J15A 1V2RT 3MWIU 2P94A 1SGYE 2BD2A 2VIQA 1T8MA 2JETB 1L1GA 1ELDE 2IOTA 1ZTJA 1ZSKA 1A1RA 2PKAB 1EXFA 4NG9H 3GCHC 4X6NA 3GY4A 2FM2A 1JRTA 5KECA 3PRBA 2O8LA 1YPLH 2GVFA 1QQ4A 1O2HA 4E7RG 5JPMH 1CGJE 1GVKB 1ESTA 1WTHD 3BEFB 1ZSLA 5IYTA 1GJ7B 2ZPQA 7ESTE 3PV4A 2O8UA 1FN6A 4CBNA 2B7DH 3GCHB 3SU1A 2OC0A 2FOCA 1UMAH 3A82A 3HATH 3QX5H 1HAIH 2M5TA 2FP7B 1ESAA 1TOCB 5EW1H 3NKKA 3E91A 4RT0A 1GMDG 5EQQA 3BN9A 3A85A 1BTUA 1FXYA 2ANMH 2DUCA 4RN6A 3TJUA 5A8XA 3ZVGA 2C8ZB 1QL9A 3R3GB 1A5IA 2ZPSA 5L2ZH 1GDQA 5L2YH 1YWUA 2AGEX 1V2VT 4YM9A 2Z9KA 1EAIA 1FY4A 5CHBA 4AB9A 1EB2A 4JCNA 2OP9A 3SGBE 4ABHA 1GBLA 1XUGA 2VWLA 4ZXXH 4YT6H 3UQOA 7LPRA 1EAXA 2Y7XA 1JMOH 1HFDA 1ZPCA 2G55A 3ZZ4A 4FUJA 1S84A 1HB0B 3MFJA 1BTYA 2RFKC 3QGNB 3V12A 5EG4A 4IMZA 2OC8A 5GWZA 4JZFH 4Y7BA 1O3FA 3STIA 1RTFB 5EGMA 2A32A 1TRMA 3PRDA 4E7NA 4GVUA 2KCAA 5JB9S 4UFEH 1GBMA 1L0ZA 1G3BA 3T29A 1AWHB 2EEKA 2K0QA 1QCPA 1O5CB 4UFFH 1BHXB 2ZHFH 3RXIA 2V6NA 1FY1A 1MTUA 1OWIA 2OXSA 5DG6A 1PPBH 5C94A 1GHWH 3M7UA 3PROA 1GVZA 6LPRA 3MO3A 3RMNH 1T8OA 3RXHA 3ZVFA 3E6PH 3KQBA 3OE7D 2ZFQH 1V2OT 1ANEA 2BQ7B 2A7HA 1O3JA 1SGPE 1FY8E 1TGNA 4AYYB 2XRCA 1C2FA 1TNHA 2VVUA 2Z3DA 4XBCA 1QRZA 3ZVBA 1P11E 4WMFA 5K7RA 4QT8C 1JIMA 1K2I1 2OQ5A 3M3TA 1CT0E 4ZKOU 1OXGA 5DP3A 3ZVDA 4MTBA 2ZNKH 8ESTE 2ZFSA 2HPPH 4P00A 4LZ1H 1PQ5A 2XBYA 1W14U 4DVAU 2Y5FA 3QLPH 1NFYA 3DT0H 1N1LA 4MNYA 1K1MA 2J5UA 4WMEA 5JBTA 3RP2A 5JBBS 1TNKA 2QF4A 3RM2H 4I33A 1NS3A 1A0JA 2LELA 1H1BA 4I8HA 3GS9A 1UVPA 5EU8A 1ELGA 4Q7XA 2K1QA 4BXSA 1DUEA 1XM1A 2FLBH 1PPGE 5B6LA 5HM9A 1LVOA 2ASUB 1DXWA 1GBJA 1C5TA 2D8WA 2A5IA 3HK6B 3LOXA 1BCUH 5GJ4B 2ZZUH 3GYLB 5E8EH 1O3DA 1O2TA 1W11U 1VJAU 2G51A 1WQVH 4MPWA 4DOQA 4DG4A 1OHHD 1FIZA 2V3MA 4ISOA 5F8TA 3TH4H 3DSPA 2R3UA 1P2IA 2D26C 1FV9A 2JJ2D 2TGTA 3ATIA 1QZ8A 4O03A 1IOEA 3WWBA 1W0ZU 3GCOA 4DY7B 4ZROA 2SGQE 1GJ6A 1G32B 1WDIA 5SGAE 1O3HA 2OD3B 1WQSA 1O3NA 2HRVA 2ZDNA 1ABJH 3VB3A 3SGQE 1FY3A 3BTDE 1P12E 1TLDA 1UO6A 4LOYH 4X0WU 4E05H 4NIVA 1EZXC 5ABWA 5ETXA 1UK4A 1ETTH 1GI2A 1UVTH 1W13U 2PUQH 4SGAE 3LGUA 1THPB 1KDQA 3SU6A 1GHAF 2PP6A 4O97A 2BY9X 7KMEH 5EODA 1HIAA 1VR1H 2P3TB 4Y6DA 1EATA 4K8YA 2O9QA 1G37A 2A5KA 4INKA 2CHAC 1Z6EA 1W10U 1QR3E 2HNTF 1G36A 3SNDA 3QN7A 3UR9A 4A5TS 2WPJS 3FFGA 4YT7H 3MYWA 1C1OA 1BRBE 1ELVA 3M5OA 4ABGA 2G5VA 1ZHPA 2EQNA 2FEQH 1C1MA 2XBVA 2GCTC 5DJ7A 3U1IB 4WF8A 4ABDA 1C5SA 3Q77A 2BD8A 2BM2A 1DX5M 1GI9B 5AFYH 3U98H 2Y82A 2H9EH 1DWDH 1YM0A 2ZU1A 3PB1E 2V0BA 3MTYA 3EA7A 3PTNA 1EPTC 1O2GH 1VITF 2VBCA 3H09A 4J2YB 2XWAA 3S7KB 4X6OA 5EJZA 2Y81A 1UTKA 4B2CA 1GHZA 2ZTZA 1BITA 3BTEE 5ESTE 1PQ7A 2Z9LA 1KTTB 1H9HE 1NFWA 2CN0H 3M5LA 1GI4A 5A8ZA 3FP8E 1W7GH 1Y3VA 5CE1A 1C2KA 3NRLA 4ZCNA 1L4ZA 1D6RA 3SNBA 2JH6D 1GMHF 3BSQA 3BTKE 4OS4A 2PGQB 1HUTH 2BD3A 4AG1A 1SKYE 1KXDA 3ITIA 1GBFA 4LXBH 1LQDB 3BF6H 5T1VA 1SR5C 2FDAA 3KQCA 2VNTA 1SFQB 4NFEA 1LHFH 1Q2WA 3SZEA 6GCHF 3K65B 1OWHA 2QE7D 1MKXH 2UUJB 4TT3D 2OUAA 4ZKSU 3O8DA 1F2SE 1SGQE 5DN6D 1C5XB 1H8DH 1CO7E 1GI7B 1O3LA 1QBNA 3ZZ9A 1G2MA 2F9BH 1O2IA 1MAYA 4NA8A 1MBQA 1ZSJA 3SHCH 5KGOA 2P3FH 1GHAG 2OTVA 1QTFA 3JZ2B 1IQJA 1BMNH 2TBSA 1AIXH 1TFXA 3LJJA 3VFEA 1E36B 1UVUH 1V3XA 4JZDH 5T6DA 3TNSA 1HXEH 4K5ZA 1ZGIA 2ZDMA 2HVYB 1A5GH 2O8MA 1BTPA 1KMHB 2G4UA 3SQHE 1C2DA 1GL1A 4YZUA 4ABAA 4AC9A 2CK3D 2F9PA 3F2HA 4ABEA 1G3CA 2FIRH 1HGTH 1HRTH 4ACAA 3BTGE 1DICA 3FKSD 1THSH 1C5YB 1QRWA 1C1TA 1ANCA 3ATKA 1NZQH 2H9TH 1VITG 4WJG2 3SJ8A 1DS2E 2Y80A 1TGTA 1J8AA 4J1YA 2FODA 1LVYA 3MNCA 1Z8GA 1ZZZA 5AFZH 2F9OA 1D6WA 3MU8A 3BV9B 1FIWA 2WUCA 3TH2H 1QFKH 4D7FA 2A45B 1KXBA 4TSFD 3E0PB 4NFFA 2ODQA 5FPYA 3RXDA 1Z6JH 4JK6A 2PFEA 1Z1JA 2NWNA 2FOHA 1LPZB 4CREA 2VIVA 1BMAA 3I78A 2GV6A 1AQ7A 1ZMNA 2Q1JA 4AZ2B 4H6TA 3A7ZA 1MTVA 1GMHG 3SO3A 3D62A 4BAQB 4F4OC 1ZMLA 2OBQA 2FTMA 2BB4A 3OSYA 1NRSH 3RXAA 3AAVA 3FN8A 3M37A 1P9SA 2FXRA 8KME2 2GP9B 1OPHB 1ZJKA 3RMMH 5LPRA 1XUJA 1ZR0A 1T32A 2CF9H 2VIOA 1T8LA 2SGDE 5LPFA 2RA0A 3LGYA 3FOAA 2WV4A 1T8NA 4OM9A 1F0SA 2GZ7A 2Z6BD 2I6SA 2W7UA 2BLVA 2FPZA 4WY3A 1PPZA 1GI6A 1P3EA 1YPMH 1GBCA 4P02A 4AG2A 1PPHE 1F92A 2HLCA 4ISHH 2V3OH 3ZZDA 1W0JD 4FOUC 1CE5A 4MDSA 3EA9A 3LT3A 3OYPA 3RXEA 2P3UB 9LPRA 3DSOA 3T62A 2A4GA 3AW1A 3RU4D 1AE5A 4AFSA 1CBWB 3OTPA 2ZHDA 2XTTB 2QXGA 1IQHA 1UCYE 3KGPA 2ZEBA 4F49A 1TGBA 2EI7A 2YMSB 1BA8B 1KDQB 1WSSH 2EI8A 2UUFB 5C17A 2PR3A 3NZIA 3BTHE 1HIAB 1F5LA 2VIWA 3UWJH 2Y6TA 3TGKE 2HGTH 4WWYA 1O2NA 1HCGA 1UTLM 3SYJA 2TGAA 1SI5H 4DURA 4WH8A 1TGCA 1TPPA 5DPAA 3HPTB 1TABE 3VG8A 4GLYA 3DSGA 1BT7A 1GHYH 1NRRH 2XYAA 4FUFA 1FAXA 1P2JA 4FU8A 1TA2A 1XMNB 1Y5BT 1O3BA 3EAJA 1IQLA 4WMDA 2AERH 2AHME 1NPMA 3MO6A 2R2WU 1O3IA 1K28D 1FDPA 1EJMA 4AYVB 2RA3A 3V7TA 3BIUH 5JYIA 3BTME 3RXSA 1O2YA 2BD9A 5DP9A 3SNCA 4CRAA 1QB6A 3SU4A 1HAHH 4K2YA 1EFRD 5IDKA 1GHVH 2Z94A 2QC2A 4XFQA 2AEIH 3PV2A 3QWCH 4H42U 1NN6A 3UFAA 5E0JA 3GY3A 5HIZA 3SW2B 1LVMA 3U8RH 2WINI 1YY3A 2G81E 4IC6A 3U1JB 1AB9B 2V7QD 1ETSH 5FHTA 2AFQB 1LKBA 2R2MB 1PFXC 1V2QT 1K1PA 3SN8A 2GGVB 2G00A 1FY5A 2F9UA 1H8HD 1Q31A 2XW9A 3DFLA 3AW0A 3PMJA 2GD4B 3SQEE 2V3HH 1SPJA 1WBGB 2STAE 4FUHA 1RS0A 1EQ9A 5E0GA 1C5PA 1K1LA 2KCYA 1SSXA 3VB4A 2J94A 4JYTA 3T5FH 1O5AB 5C0TA 4FUBA 3RM0H 1QJ6B 4IMQA 1IQMA 2P16A 5AHGH 1BTZA 1IQNA 1LVBA 1MH0A 4X8VH 4YTAA 3MMGA 1CVWH 2JETC 1VZQH 5C20A 3E3TA 1PPCE 4SGBE 1YCPM 1C5NH 2UWPA 1XXDA 2KCPA 3MNSA 1DDJA 4IN2A 2RDLA 1VCPA 2JJ1D 2VINA 2ZHQH 3LU9B 3P6ZB 1NBMD 2G4TA 4BAHB 4KELA 4THNH 1O37A 1SB1H 2WPLS 1C4V2 4XBDA 1SG8B 1DLKB 1BBRK 3QTOH 3HKIB 3E16B 2ZDVH 3PMBB 1O3MA 1GI8B 1ZRKA 1DXPA 5T6FA 2GT8A 1ZOMA 4KTUA 5KEDA 1NRPH 3CS0A 1P2OA 3P8NA 3H5CB 4HGCA 1WAYB 1BMFD 1AZZA 3NCLA 3P70B 3TH3H 2P95A 1CGIE 1K1OA 3F3BA 3HK3B 3PWCA 2F43B 1AZ8A 1OP8A 1ANBA 1JXPA 1W2KH 2ZQ1A 1LMWB 1TIOA 2ZCLP 5J4SA 3SGAE 2ZGXH 5EOKA 1SBWA 1HNEE 1MZAA 2B5TB 1QB9A 4NZLA 1Y3WA 2CF8H 3KEEA 3Q3XA 4KP0A 3A7XA 3OX7U 1AHTH 2L6OA 4R0IA 3SUGA 3F68H 2A2XH 2OC7A 2W3KA 1C1UH 1FZZA 2Y5HA 1F7ZA 3MH6A 3TIUA 3MU0A 5PTPA 3KQEA 1YBWA 4NCYA 2FI5E 5C1XA 3RU4T 4DGJA 1SQAA 3A86A 1O2WA 4A1TA 1CT4E 1VGCB 3BTWE 1EPTA 3D49H 2OK5A 4X2VA 2ZU2A 2WSSD 2ZO3H 1A46H 2KZ4A 1H8ED 3A8DA 4XRNA 1ZTLA 4X2XA 1TONA 1FN8A 4Z1MD 1DWBH 1UTJA 1DE7H 3SUFA 1B0FA 1O3PB 5C1YA 4WH6A 1Z7KA 1D3QB 4ESTE 1P05A 3RXTA 4YESB 5LH8A 3U69H 5J4QA 3H7OA 2OQUA 3SZNA 1F0TA 3MH7A 1TNLA 1MAXA 3BTTE 1P0SH 1IAUA 4XOJA 1K22H 1QBOA 1C1RA 3EA8A 4FUGA 1T7CA 1SLXB 2ILNA 4OS6A 3TJOA 3ELAH 1O36A 5GNDA 1A3BH 3A7TA 4CRBA 4IS5A 1GGDB 5B6OA 1GBEA 3D23A 1BRAA 8LPRA 2QF5A 3EGKH 5IK2D 3T28A 1SFIA 2NU2E 1ELEE 3RXBA 2C93B 2SGEE 2PWXA 3PLKA 2HALA 4WXIA 4ZKRU 3T27A 4I8LA 1WXRA 1GWAA 1FI8A 3SV8A 2KX4A 1O5FH 2RCEA 4BTUB 1Z8JB 5FXLA 4CRDA 4ACBA 1ELCA 2J98A 3L3TA 1LQEA 4K60A 4IN1A 3SORA 1E34B 3M61U 1LKAA 1BMLA 2H5CA 4NA9H 3KF2A 1EJNA 1DY9A 3P17H 4WXVA 4FU9A 1V2ST 3VGCB 1IQGA 3MNXA 4HI3A 2BDYA 3E90B 2BVXH 4JYVH 1C1SA 3F9HA 1EAWA 2VH6A 1O2XA 3MU4A 2IPHA 2WPHS 1XVMA 4FETA 1HYLA 1N6XA 1CSOE 2QXHA 4FXGH 4OGYA 2BMGB 5EJLA 2ZTXA 3QUMP 4BAOB 4CRCA 1P10A 3A89A 4Y8ZA 1NO9H 4Y10E 1P03A 3UNQA 1SC8U 2J38A 1GJ8B 1OX1A 1T4UH 2QIQA 4CR5A 1AGJA 2A5AA 4BANB 1LHGH 1Y5UT 1BJVA 1O30A 5JB8S 1GJCB 1IHTH 1TBZH 1J9CH 4D7GA 1HJAB 1MQ6A 2SGAA 1GJ5H 1SGRE 2W7SA 5T3HA 4O9VA 3SUDA 2GT7A 1LHCH 2WPIS 1CQQA 5EQSA 4FUDA 3QGJA 1DWCH 3DD2H 1O3AA 4YXWD 5DP8A 1AKSA 2Q6DA 1KTSB 3ENSB 3GY7A 4D76A 1TQ7B 2BLOA 2KAIA 2QF3A 4IW4E 2AS9A 1V6DA 5DP5A 4CBOA 4LK4A 3ODDA 4ABIA 1INCA 4B6FA 3FZDA 2PGBB 3ZZ6A 1PPFE 3Q76A 5FCKA 5T6GA 2PV9B 2J95A 2KFWA 3PWBA 4D8NA 1V2MT 4FU7A 4Z0KA 4B74A 3RC5A 2H9HA 3LKWA 1EOLA 1YYY1 3IITA 1ELBA 3W94A 2IJD1 3EYDA 1G30B 3MOCA 1D3TB 4TPYA 2BY8X 3STJA 1NC6A 1ZLRA 2ANKH 4AFZA 3NK8A 5FL7D 1SGNE 1IQKA 1UTPA 4GHTA 4I32A 3ESTA 3RXJA 1C5LH 4HZHA 2ZCHP 4JYUH 1ZHRA 1Y8TA 2JH0D 2GMTB 1CHOF 3ZVAA 1GPZA 1QRXA 1YC0A 3NUMA 1MTSA 2F3CE 3URCA 5FBIA 1H4WA 1P2NA 3O8CA 2P8OB 4MLFB 2QN5T 2EI6A 2WV9A 1Y3UA 4JZEH 1ZJDA 2BDHA 1OSSA 1C1VH 2A2QH 3N7OA 4UE7H 1P3CA 3B9FH 5F03A 4ZXYH 3RXKA 1N8OB 1AFEH 1O2VA 4ZKNU 2Z9GA 3E8LA 1QA7A 4NWLA 5HXFA 1VITH 5EPYA 3WWFA 1MTWA 2C4FH 3T2NA 1DFPA 3VXEH 1YF4A 3NXPA 2HWLB 4I7YH 3LONA 2BQ6B 4JZ1A 2Z3CA 4NZQA 1E1QD 1KLJH 1WUNH 4NSVA 3GOVB 4JMYA 3KQDA 1FMGA 1AE8H 4OS5A 5C67A 2ZGCA 4Y71A 1E0FD 2EC9H 2ODPA 2PSYA 4TWWA 3UR6A 1Y59T 1TNJA 1LDTT 1V2WT 1O2PA 1DITH 2C8XB 1HPGA 2FLRH 2ZA5A 5TJXA 5CMXH 3GISB 5DKMA 1AMHA 3ZV8A 3P8OA 3PTBA 3RLYH 6CHAC 1YPKH 1ZTKA 1OYQA 2CXVA 2BDBA 2XOKD 4X6PA 1NRQH 2IPQX 3GY6A 1DPOA 3UUZA 1PJPA 1GHBF 3BG8A 1D4PB 3KYGA 3EE0B 3A83A 1Z1IA 3GY2A 5DP6A 2BX4A 1K21H 2FOGA 1FPHH 3F0PA 5A0CA 6CHAB 4B2BA 4R8TB 1O38A 2HNTC 3TGJE 4B6EA 3MNBA 2FOEA 1BRUP 1YP9A 2FI3E 1J16A 3VB5A 3KHVA 1WOFA 4RSPA 5HGGA 2SFAA 2I6QA 1TX6A 2ZDLA 2J9NA 9ESTA 1CHOG 2J34A 4I8JA 1CA0B 2UWLA 3SI3H 3ZV9A 4Y0ZE 2A4OA 2GTBA 2A7JA 2VU8E 4YO9A 3VPKA 2ALPA 2J98B 3RLWH 4XDEA 1EZUC 5HKKD 1CT2E 4B76A 3OAAD 4XD7D 2C8YB 2BDAA 4JK5A 1SLVB 1X7AC 3S9BA 1S5SA 4FVBA 4K1SA 2Z3EA 2WPMS 4Z6AH 1C2MA 1UK2A 1GHXH 1A4WH 1V2TT 1TPSA 4Q4LA 5DK1A 3PV5A 1AVXA 3URDA 1DM4B 2BLWA 2D1JA 4HTCH 3SU2A 2TRMA 4YLQH 2ZKSA 2C90B 1C1QA 2AMPA 4MPUA 3UNSA 2A0QB 3U28C 3QDZB 1EOJA 1SLWB 1VCQA 2PTCE 1PQ8A 2FYRA 2BQWB 1EKBB 3V0XA 3ZZAA 2LP6A 3ZYEA 5DO4H 1BOQA 4ZHAA 3LGVA 5A09A 2XBWA 2ZFRH 3ZVCA 2K8IA 3ZZ5A 2HPQH 1LPKB 4X2WA 3SV9A 4GPGA 6GCHG 4RKOB 4Q7YA 1RIWC 3EQ0H 5EPNA 5A0AE 4ZAEA 1MU8B 1W0YH 4CH2B 3OEHD 3MI4A 1VKYA 2GX4A 5EIYA 1RTKA 3PLBA 5A0BA 3BIVH 3F1SB 3QO6A 2EY4C 2F9NA 1TPOA 1CBWC 1GHBG 1GJ9B 4KTSA 5C3NA 5JBCS 1HAOH 1XKBC 1P04A 1SOTA 4Y7AA 1S83A 5HMAA 5L30H 1EAUA 5FPTA 2QF0A 2YMSC 3LGTA 1F0RA 1YCPH 5FCRA 5EJ1A 1RIWB 1LHEH 3OEED 2QXIA 1ZYOA 3RXVA 2ZG0H 4X8UH 1K9OE 2KAIB 1H9IE 1YCPK 1O5EH 2TGDA 2VWMA 1KXAA 5TCAA 3WW7A 1EP5A 1GCDA 1P2QA 1RRKA 1LPGB 4U30A 2WYGA 2A4RA 5GPIB 1AFQC 4B75A 1TMBH 1GI5A 3M7QA 2VGCB 3ZIAD 2WPKS 1Z8IB 3S0NA 1UTOA 1COWD 1AUTC 1S85A 3GCNA 3PLPA 3UWIA 5BPEA 5G4BA 1L1NA 1UTNA 2P93A 3BTQE 3SOSA 2B0FA 2O8WA 3UOUA 1OOKB 1IHSH 3UOPA 1QQUA 2GJGA 1Z71A 3RUOA 1E79D 1AFQB 4X1PU 4MPXA 2Z9IA 3Q3KA 4NIWA 3OY6U 1A3EH 4OGXA 3PO1B 1V2LT 1E1RD 4MVNA 1GL0E 1UW7A 3TJVA 3RXMA 1C2EA 1O35A 2JKHA 2QAAA 1KXCA 1AB9C 5GCHF 2JIZD 4I31A 4CHAB 1TNIA 4CR9A 2B8OH 5C5OA 1HLTH 1L4DA 3VB6A 1TALA 3VEQB 2ZWLH 1WTGH 3S69A 1GCTC 3OFND 3F9FA 1FX0B 3BEUA 3NPSA 4U2WA 4E06H 3C1KA 5BRRE 3ODFA 2HLDD 3GY8A 3P8GA 3S7HB 1RTLA 1LCYA 2BZAA 3OY5U 1S6LA 2XC0A 1C5QA 3TVJB 1KXEA 1A0LA 1TB6H 4B71A 1HXFH 3A84A 1V2NT 3RXQA 1G9IE 1C5RA 1GCTB 2VVVA 3EE7A 1N6YA 5EQRA 3QZRA 1ZRBA 1A7SA 5LGOA 4RT1A 5E0HA 1CHGA 5EXNA 3AVZA 4Y79A 3RMLH 2BYAX 2ZP0H 4UONA 3ATWA 1BZXE 1BQYA 1QL8A 2ZCKP 3GCTF 3ZYDA 5AVDA 4VGCB 4Y8XA 3HGNA 3JZ1B 3E1XB 4IGDA 2R9PA 4RKJB 3LGWA 1MBMA 4BNRA 3VXFH 7GCHF 1C4Y2 4F55A 4WVPE 1SQOA 3GYMA 1BHXF 1EZSC 2AGGX 2PSXA 2C8WB 1EJAA 4ZMAH 1BBRH 3ZZ3A 1HAPH 2PW8H 4X8TH 4AFQA 1O2ZA 2XCFA 3PMHB 1NFUA 1EB1H 4YLUA 1C5OH 1KY9A 1TE0A 1UVOA 1TQ0B 3SU5A 1ZPZA 1GJ4H 2BY7X 2CJIA 1OWEA 8GCHF 1J14A 1AD8H 2FWWA 3MO9A 3TGIE 3BG4B 2PUXB 5E2PA 2HNTE 4M9FA 4GCHF 3SI4H 1VJ9U 1LHDH 1SGTA 5TCCA 1MZDA 4U01A 3MH4A 1NESE 5FAHA 1JIRA 4X1SU 1HAXB 1PYTC 3R0FA 3QZQA 3UB0A 2W3IA 1QURH 3TITA 2LPRA 4K3JA 2ZFFH 3CENA 2ZU3A 4YOGA 5GCHG 1BTHH 1OWKA 1ZGVA 1RXPA 2WV5A 4BOHA 1HAZB 3FP7E 1VGCC 2BD7A 3O8RA 1AO5A 1S82A 2TGPZ 4AGKA 1FQ3A 4TPIZ 1YPHE 3SUEA 1ANDA 4HFPB 1NROH 2CMYA 5EXLA 1E38B 2G5NA 3RC4A 2FS8A 1C9PA 2J2UA 1HV7A 2GZ9A 1O2MA 2UUKB 2ZQ2A 4TY6A 3UREA 4DT4A 4IC5A 1B0EA 1Y3YA 4FUCA 1SGCA 3C27B 1GBHA 1O33A 4MQAA 5CHAC 3KNXA 1O2RA 1SVPA 3ATLA 3UTUH 2IJOB 3A81A 1B7XB 2FMJA 4I86A 1KLIH 2VWOA 2W5EA 1L1JA 3K2UA 3RXRA 3U9AH 3DCLA 4Q63A 2DE8A 2AIPA 2XC5A 1ZMJA 2PTNA 3GCTG 1C5VA 1QGFA 2Z7FE 3S9CA 1TRYA 4AFUA 1AVWA 1GGDC 1DSTA 1SMFE 1H8IH 1HBTH 1P06A 5CHAB 5FPSA 7GCHG 3UY9A 3W1EA 2ZDKA 2XBXA 3A8AA 4XBBA 1BRCE 1C2JA 1YLNA 4AORA 4YOJA 1S0QA 5LPEA 3RMOH 1ELTA 1LO6A 5DP7A 2LNCA 4X6MA 1MCTA 2VIDA 3RXFA 4F48B 1MCVA 4B73A 3KYFA 3I77A 8GCHG 3TK9A 5DGJA 5A8YA 1AU8A 1O2LA 2CV3A 1TOMH 1RFNA 1YPJH 3G01A 1V2KT 3VGCC 3L33A 1GBBA 1XVOA 1LTOA 4MPVA 4GCHG 1MD7A 1W7XH 3B23B 4TYDA 2ANWA 3ZZ7A 2ZFPH 4D9RA 2Q6FA 3DUXH 3F2FA 1ELAA 2BZ6H 1GVLA 1SGFA 2B9LA 3ZVEA 3SJKA 1F5RA 4GUXA 4UD9H 3N99A 3KCGH 2AIQA 3FP6E 4FVDA 1VCWA 2NU1E 4ABFA 1UCYH 3F0OA 4O3UA 3BEIB 4A92A 2ZDAH 3A88A 5C2ZA 1P2KA 3SV6A 5K0HA 1UCYK 1UHBA 1XUIA 2Q6GA 2ZF0H 1NFXA 4I8GA 5HM2A 3A87A 4CRGA 1DVAH 2WZQA 3RU4E 2FZZA 3P8FA 1GG6C 5FX6A 4BAMB 3TU7H 1UJ1A 2FX6A 5ESBA 3UAIC 2ALVA 1O3CA 1S6HA 2YOLA 1HJAC 1YGCH 1QA0A 4Q80A 3SJIA 2GCHF 1XX9A 1QJ1B 5JBAS 4ISIH 3QTVH 2NU4E 1AVGH 1GBIA 2D2DA 5A2MH 1GBKA 1GG6B 3GDUA 1BJUA 1G3EA 4X1NU 3T26A 2J92A 2WYJA 4LZ4B 1GI1A 4ZH8A 4X1RU 2FS9A 1FPCH 3K6ZA 1P09A 1MTNC 1O3EA 4NGAH 1AI8H 1SLUB 2NU3E 2IN2A 2W6JD 1DY8A 2ULLA 1C9TA 4HG6A 2M2AA 1FLEE 1SHHB 1DSUA 3TLOA 3F9GA 1BTWA 1NU9A 2FYQA 1SGIB 2VVCA 4KKDA 1BMMH 1CGHA 2H5DA 6ESTA 1JOUB 1QHRB 1UK3A 1MTNB 3AK5A 2BDCA 2A4QA 1MUEB 2BHGA 3HGPA 2ZGHA 3U8OH 2ZGBH 4NIYA 1FUJA 4K1EA 1UTMA 4ASHA 2J97A 1MU6B 1BDAA 3KL6A 3F6UH 3T25A 1K1IA 3SU3A 5C5NA 3SHAH 5I25A 2XNDD 3ZZBA 1TGSZ 1DLEA 3M3SA 2GMTC 4INHA 1O2OA 3SV2H 2QA9E 1C2GA 2A1DB 1V2UT 3LPRA 2ZECA 3EDXB 4M7GA 3MH5A 1C1WH 2VH0A 1O2SA 3PMAB 4FUIA 1WYKA 1KLTA 2P8OC 2HVXA 2JDID 4K1TA 2A7CA 1OP0A 1XUFA 2FI4E 1TAWA 1JBUH 2FTLE 1EZQA 3LGIA 2FOAA 1KYNA 3IG6B 1ZPBA 1PQAA 1Y3XA 2BVRH 1DOJA 1HAVA 4X8SH 1RD3B 1D3DB 1KIGH 1N8OC 1YLCA 4A1XA 4Y76A 5C0UA 1YPEH 1ESBA 2QCYA 3K9XB 4ZHMU 1MD8A 5C1UA 1GDNA 1ARBA 1P2MA 1NBME 4I8KA 2BX3A 2W6ID 3HKJB 1QL7A 2RG3A 2AYWA 4Q2KA 4A1VA 4DW2U 5I46H 3ATMA 2GDDA 4MNXA 1TX8A 1F0UA 2JH5D 1WCZA 1GMCF 3FZZA 2CHAB 2ZIQH 2BD5A 1AWFH 2C3SA 2GCHG 3U8TH 1J17T 3LJOA 5HIYA 1SOZA 2AMQA 4PROA 3M5MA 2BD4A 2QV1A 3Q00A 3A8CA 2XNIA 1TBQH 2BDIA 1SQTA 1W8BH 2GV7A 1P01A 3V13A 1GJAB 3P92A 2YNBA 1O5BB 2F83A 2GCTB 2H6MA 2F9VA 3MHWU 4D9QA 1Y5AT 3M36A 3RXUA 3M3VA 2BXTH 3TNTA 2UUYA 3FVFB 1CA8B 2BXUH 1SL3A 1EPTB 3LH1A 2WHXA 2BY5X 3UNRA 1QJ7B 5DSFA 2GDEH 2XC4A 4IBLH 2SNVA 2TIOA 1FONA 1TA6A 1YLDA 1G2LA 1H9LB 1K1JA 1C1PA 3TJNA 1PPEE 2KCOA 3L6PA 1EP6A 1OP2A 1BBRE 5H4IB 1O3OA 1D9IA 3SNEA 1GJDB 1NTPA 1A2CH 1NM6A 1W12U 3S9AA 1TPAE 3WY8A 1TBRH 2STBE 1HJ9A 1CA0C 1U6QA 2ZC9H 3A7VA 1DT2A 1O31A 2ODYB 1XUKA 1MKWH 4YOIA 1ID5H 2VWNA 1C4U2 3SU0A 5AF9H 1MKXK 1CU1A 2BTCE 2FESH 3TPIZ 2FO9A 2GKVE 1TMUH 3GY5A 2L74A 1MKWK 3P95A 2TPIZ 1AN1E 1T31A 2ANYA 1BIOA 2OC1A 1AY6H 2PKAA 3LH3A 4CRFA 1SGFG 1HJ8A 1K1NA 1S0RA 5HYOA 2R0KA 1BTXA 1OKXA 2OBOA 1RJXB 1C2LA 3KQ5A 3RXCA 3RDZA 3E0NB 1P02A 1D3PB 2NU0E 1OWDA 1OS8A 1SHYA 2H2ZA 2PLXA 3OU0A 2DE9A 2ZI2H 1YPHC 2OLGA 5F8XA 4AB8A 2ZPRA 5F53A 1GBAA 1C5MD 3TK5A 4UFDH 1O2UA 1NU7B 3M35A 1T4VH 1GMCG 1TMTH 3N7EA 1HAGE 3D65E 4BAKB 3KN2A 5JDUB 1TNGA 2THFB 3MU1A 1GJBB 1S81A 1QIXB 1JRSA 3DHKH 3Q3YA 3RXGA 4ISLA 1UHBB 1ARCA 1TX7A 2KR7A 4ISNA 3GDSA 3ZZCA 4NIXA 1P57B 1O2KA 2BOHB 4ABBA 1XUHA 1SQRA 3LDXH 2QGRA 2VJ1A 3A80A 2QXJA 5FX5A 3RXOA 4AGJA 1O32A 2BOKA 3CNRA 3F9EA 4INLA 3FO8D 1C5WB 1V2PT 1KSNA 2G8TA 2Y7ZA 3LIWA 4A6LA 1BUIA 2BVSH 1A5HA 2RDEA 2SGFE 1UVSH 5DP4A 1V2JT 2BDGA 4B1TA 2FOBA 1ELFA 2SGPE 1NY22 2A31A 4DCDA 4H6SB 2BY6X 3FANA 2UWOA 4FUEA 2ZU5A 2G52A 3SNAA 4NSYA 5CDFE 1G3DA 1DWEH 1B5GH 2OCVB 2YMSD 1XXFA 4CH8B 1K0HA 1THRH 5EXMA 2R3YA 1MABB 1E35B 1FJSA 3DFJA 2OINA 2YNAA 1TYNA 2VIPA 1E37B 1XKAC 1UTQA 1QBVH 1AKSB 3DA9B 1P8VC 2VGCC 1C2IA 2QY0B 4GAWA 3N7DA 5E2OA 3RXPA 1C5ZB 1OYTH 2ESTE 1P9UA 1NRNH 4A7IB
chains in the Genus database with same CATH topology
1NT1A 1A61H 2PHBA 1TRNA 4H4FA 1ORFA 1ACBE 2P59A 3A7WA 4GSOA 4X1QU 3ZZ8A 3PYHA 3I29A 4UDWH 2ZU4A 2AH4X 1IQIA 1ETRH 3PO1C 4ABJA 1O2JA 2FOFA 2H1UA 1IQFA 1C1NA 3GDVA 4OS7A 1C5UA 4X2YA 1Z8RA 3GICB 3LC5A 1DANH 2EA3A 2V35A 3AAUA 4CHAC 1O2QA 1WV7H 1S6FA 2CGAA 2ZGJA 3UQVA 5GIBA 3UPEA 2WUBA 4BTIB 4XSKU 4KGAA 4TWYA 4ZUHA 1M9UA 4K69A 3A7YA 1GDUA 1OWJA 1O34A 4K8BA 4DJZB 4DIIH 1HAVB 2BLQA 1RGQA 2Y5GA 4DIHH 3V3MA 4JZIA 1GI3A 4MNVA 1A0HB 1DUAA 1IQEA 1FNIA 5F8ZA 1ABIH 4AN7A 2PKSC 3QK1A 3W95A 3CS7A 3OTJE 3SBKA 1MQ5A 3CP7A 3O8BA 4Q7ZA 1JWTA 1SGEE 3AASA 4Y11E 1HDTH 2AMDA 1Q3XA 1W3CA 4OS1A 4BTTB 1GMDF 3A8BA 5EW2H 3KIDU 4Y8YA 1TWXB 4B2AA 2O8TA 4AOQA 4VGCC 1O5DH 3RC6A 5GXPA 4GHQA 2PKSB 3VB7A 4NWKA 1AUJA 2ZHWH 3SV7A 2VB0A 1O3KA 1ZHMA 4O3TA 5L6NH 1YKTA 4ZHLU 1F5KU 2XXLA 2ZTYA 5F6MA 1SGDE 4UFGH 1GBDA 3UIRA 4XE4A 1O0DH 4BXWA 1GI0A 3H7TA 3NWUA 2R0LA 2Z9JA 2QYIA 2AGIX 3LC3A 4OS2A 1HAYB 3TK6A 3SJ9A 4MG3A 1EASA 1GBTA 2ZFTA 3M7TA 3SJOA 4U32A 2J4IA 3FAOA 2GZ8A 4DT7B 1C2HA 3BTFE 1EUFA 3PM3A 1L2EA 2XCNA 1EX3A 1O5GH 3BG4C 3B8JA 4AX9H 1QNJA 1FAKH 2FX4A 1BB0B 1O3GA 1QB1A 4Y0YE 4UEHH 4NA7A 1YPGH 2SNWA 2W26A 4TY7A 2XWBI 5GDSH 1MMJN 1KXFA 1WU1A 1QY6A 3IWMA 4KTCA 3RXLA 5FBEA 3K6YA 2FOMB 2HOBA 2F91A 1PYTD 3MU5A 2ZHEH 3M5NA 4MNWA 1O39A 1J15A 1V2RT 3MWIU 2P94A 1SGYE 2BD2A 2VIQA 1T8MA 2JETB 1L1GA 1ELDE 2IOTA 1ZTJA 1ZSKA 1A1RA 2PKAB 1EXFA 4NG9H 3GCHC 4X6NA 3GY4A 2FM2A 1JRTA 2O8LA 1YPLH 2GVFA 1QQ4A 1O2HA 4E7RG 5JPMH 1CGJE 1GVKB 1ESTA 1WTHD 3BEFB 1ZSLA 5IYTA 1GJ7B 2ZPQA 7ESTE 3PV4A 2O8UA 1FN6A 4CBNA 2B7DH 3GCHB 3SU1A 2OC0A 2FOCA 1UMAH 3A82A 3HATH 3QX5H 1HAIH 2M5TA 2FP7B 1ESAA 1TOCB 5EW1H 3NKKA 3E91A 1GMDG 5EQQA 3BN9A 3A85A 1BTUA 1FXYA 2ANMH 2DUCA 4RN6A 3TJUA 5A8XA 3ZVGA 2C8ZB 1QL9A 3R3GB 1A5IA 2ZPSA 5L2ZH 1GDQA 5L2YH 2AGEX 1V2VT 4YM9A 2Z9KA 1EAIA 1FY4A 4AB9A 1EB2A 4JCNA 2OP9A 3SGBE 4ABHA 1GBLA 1XUGA 2VWLA 4ZXXH 4YT6H 3UQOA 7LPRA 1EAXA 2Y7XA 1JMOH 1HFDA 1ZPCA 2G55A 3ZZ4A 4FUJA 1S84A 1HB0B 3MFJA 1BTYA 3QGNB 3V12A 5EG4A 4IMZA 2OC8A 5GWZA 4JZFH 4Y7BA 1O3FA 3STIA 1RTFB 5EGMA 2A32A 1TRMA 4E7NA 4GVUA 5JB9S 4UFEH 1GBMA 1L0ZA 1G3BA 3T29A 1AWHB 2EEKA 1QCPA 1O5CB 4UFFH 1BHXB 2ZHFH 3RXIA 2V6NA 1FY1A 1MTUA 1OWIA 2OXSA 5DG6A 1PPBH 1GHWH 3M7UA 3PROA 1GVZA 6LPRA 3MO3A 3RMNH 1T8OA 3RXHA 3ZVFA 3E6PH 3KQBA 2ZFQH 1V2OT 1ANEA 2BQ7B 2A7HA 1O3JA 1SGPE 1FY8E 1TGNA 4AYYB 2XRCA 1C2FA 1TNHA 2VVUA 2Z3DA 4XBCA 1QRZA 3ZVBA 1P11E 4WMFA 5K7RA 4QT8C 1JIMA 1K2I1 2OQ5A 3M3TA 1CT0E 4ZKOU 1OXGA 5DP3A 3ZVDA 4MTBA 2ZNKH 8ESTE 2ZFSA 2HPPH 4LZ1H 1PQ5A 2XBYA 1W14U 4DVAU 2Y5FA 3QLPH 1NFYA 3DT0H 1N1LA 4MNYA 1K1MA 4WMEA 5JBTA 3RP2A 5JBBS 1TNKA 3RM2H 4I33A 1NS3A 1A0JA 1H1BA 4I8HA 1UVPA 5EU8A 1ELGA 4Q7XA 2K1QA 4BXSA 1DUEA 1XM1A 2FLBH 1PPGE 5HM9A 1LVOA 2ASUB 1DXWA 1GBJA 1C5TA 2D8WA 2A5IA 3HK6B 3LOXA 1BCUH 5GJ4B 2ZZUH 3GYLB 5E8EH 1O3DA 1O2TA 1W11U 1VJAU 2G51A 1WQVH 4MPWA 4DOQA 4DG4A 5F8TA 1FIZA 4ISOA 3TH4H 2R3UA 1P2IA 2D26C 1FV9A 2TGTA 3ATIA 4O03A 1IOEA 1W0ZU 3GCOA 4DY7B 4ZROA 2SGQE 1GJ6A 1G32B 5SGAE 1O3HA 2OD3B 1WQSA 1O3NA 2HRVA 2ZDNA 1ABJH 3VB3A 3SGQE 1FY3A 3BTDE 1P12E 1TLDA 1UO6A 4LOYH 4X0WU 4E05H 4NIVA 1EZXC 5ABWA 5ETXA 1UK4A 1ETTH 1GI2A 1UVTH 1W13U 2PUQH 4SGAE 3LGUA 1THPB 1KDQA 3SU6A 1GHAF 4O97A 2BY9X 7KMEH 5EODA 1HIAA 1VR1H 2P3TB 4Y6DA 1EATA 4K8YA 2O9QA 1G37A 2A5KA 4INKA 2CHAC 1Z6EA 1W10U 1QR3E 2HNTF 1G36A 3SNDA 3QN7A 3UR9A 4A5TS 2WPJS 3FFGA 4YT7H 3MYWA 1C1OA 1BRBE 1ELVA 3M5OA 4ABGA 2G5VA 1ZHPA 2FEQH 1C1MA 2XBVA 2GCTC 5DJ7A 3U1IB 4WF8A 4ABDA 1C5SA 3Q77A 2BD8A 2BM2A 1DX5M 1GI9B 5AFYH 3U98H 2Y82A 2H9EH 1DWDH 1YM0A 2ZU1A 3PB1E 2V0BA 3MTYA 3EA7A 3PTNA 1EPTC 1O2GH 1VITF 4J2YB 2XWAA 3S7KB 4X6OA 2Y81A 1UTKA 4B2CA 1GHZA 2ZTZA 1BITA 3BTEE 5ESTE 1PQ7A 2Z9LA 1KTTB 1H9HE 1NFWA 2CN0H 3M5LA 1GI4A 5A8ZA 3FP8E 1W7GH 1Y3VA 5CE1A 1C2KA 1L4ZA 1D6RA 3SNBA 2JH6D 1GMHF 3BSQA 3BTKE 4OS4A 2PGQB 1HUTH 2BD3A 4AG1A 3ITIA 1KXDA 1GBFA 4LXBH 1LQDB 3BF6H 1SR5C 2FDAA 3KQCA 2VNTA 1SFQB 4NFEA 1LHFH 1Q2WA 6GCHF 3K65B 1OWHA 1MKXH 2UUJB 2OUAA 4ZKSU 3O8DA 1F2SE 1SGQE 1C5XB 1H8DH 1CO7E 1GI7B 1O3LA 1QBNA 3ZZ9A 1G2MA 2F9BH 1O2IA 1MAYA 4NA8A 1MBQA 1ZSJA 3SHCH 2P3FH 1GHAG 2OTVA 1QTFA 3JZ2B 1IQJA 1BMNH 2TBSA 1AIXH 1TFXA 3LJJA 3VFEA 1E36B 1UVUH 1V3XA 4JZDH 5T6DA 3TNSA 1HXEH 4K5ZA 1ZGIA 2ZDMA 1A5GH 2O8MA 1BTPA 2G4UA 3SQHE 1C2DA 1GL1A 4YZUA 4ABAA 2F9PA 4ABEA 1G3CA 2FIRH 1HGTH 1HRTH 3BTGE 1DICA 1THSH 1C5YB 1QRWA 1C1TA 1ANCA 3ATKA 1NZQH 2H9TH 1VITG 4WJG2 3SJ8A 1DS2E 2Y80A 1TGTA 1J8AA 4J1YA 2FODA 1LVYA 3MNCA 1Z8GA 1ZZZA 5AFZH 2F9OA 1D6WA 3MU8A 3BV9B 1FIWA 2WUCA 3TH2H 1QFKH 4D7FA 2A45B 1KXBA 3E0PB 4NFFA 2ODQA 5FPYA 3RXDA 1Z6JH 4JK6A 2PFEA 1Z1JA 2NWNA 2FOHA 1LPZB 4CREA 2VIVA 1BMAA 3I78A 2GV6A 1AQ7A 1ZMNA 2Q1JA 4AZ2B 4H6TA 3A7ZA 1MTVA 1GMHG 3SO3A 3D62A 4BAQB 4F4OC 1ZMLA 2OBQA 2FTMA 2BB4A 3OSYA 1NRSH 3RXAA 3AAVA 3M37A 1P9SA 2FXRA 8KME2 2GP9B 1OPHB 1ZJKA 3RMMH 5LPRA 1XUJA 1ZR0A 1T32A 2CF9H 2VIOA 1T8LA 2SGDE 5LPFA 2RA0A 3LGYA 2WV4A 1T8NA 1F0SA 2GZ7A 2Z6BD 2I6SA 2W7UA 2BLVA 2FPZA 4WY3A 1PPZA 1GI6A 1P3EA 1YPMH 1GBCA 4AG2A 1PPHE 1F92A 2HLCA 4ISHH 2V3OH 3ZZDA 1CE5A 4MDSA 3EA9A 3LT3A 3OYPA 3RXEA 2P3UB 9LPRA 3T62A 2A4GA 3AW1A 3RU4D 1AE5A 4AFSA 1CBWB 2ZHDA 2XTTB 2QXGA 1IQHA 1UCYE 3KGPA 2ZEBA 4F49A 1TGBA 2EI7A 1BA8B 1KDQB 1WSSH 2EI8A 2UUFB 2PR3A 3NZIA 3BTHE 1HIAB 1F5LA 2VIWA 3UWJH 2Y6TA 3TGKE 2HGTH 4WWYA 1O2NA 1HCGA 1UTLM 2TGAA 1SI5H 4DURA 4WH8A 1TGCA 1TPPA 5DPAA 3HPTB 1TABE 4GLYA 1BT7A 1GHYH 1NRRH 2XYAA 4FUFA 1FAXA 1P2JA 4FU8A 1TA2A 1XMNB 1Y5BT 1O3BA 3EAJA 1IQLA 4WMDA 2AERH 1NPMA 3MO6A 2R2WU 1O3IA 1K28D 1FDPA 1EJMA 4AYVB 2RA3A 3V7TA 3BIUH 5JYIA 3BTME 3RXSA 1O2YA 2BD9A 5DP9A 3SNCA 4CRAA 1QB6A 3SU4A 1HAHH 4K2YA 5IDKA 1GHVH 2Z94A 2QC2A 4XFQA 2AEIH 3QWCH 4H42U 1NN6A 3UFAA 5E0JA 3GY3A 3SW2B 1LVMA 3U8RH 2WINI 2G81E 4IC6A 3U1JB 1AB9B 5FHTA 1ETSH 2AFQB 1LKBA 2R2MB 1PFXC 1V2QT 1K1PA 3SN8A 2GGVB 2G00A 1FY5A 2F9UA 2XW9A 1Q31A 3DFLA 3AW0A 3PMJA 2GD4B 3SQEE 2V3HH 1SPJA 1WBGB 2STAE 4FUHA 1RS0A 1EQ9A 5E0GA 1C5PA 1K1LA 1SSXA 3VB4A 2J94A 4JYTA 3T5FH 1O5AB 4FUBA 3RM0H 1QJ6B 4IMQA 1IQMA 2P16A 5AHGH 1BTZA 1IQNA 1LVBA 1MH0A 4X8VH 4YTAA 3MMGA 1CVWH 2JETC 1VZQH 5C20A 3E3TA 1PPCE 4SGBE 1YCPM 1C5NH 2UWPA 1XXDA 3MNSA 1DDJA 4IN2A 2RDLA 1VCPA 2VINA 2ZHQH 3LU9B 3P6ZB 2G4TA 4BAHB 4KELA 4THNH 1O37A 1SB1H 2WPLS 1C4V2 4XBDA 1SG8B 1DLKB 1BBRK 3QTOH 3HKIB 3E16B 2ZDVH 3PMBB 1O3MA 1GI8B 1ZRKA 1DXPA 5T6FA 2GT8A 1ZOMA 4KTUA 1NRPH 3CS0A 1P2OA 3P8NA 3H5CB 4HGCA 1WAYB 1AZZA 3NCLA 3P70B 3TH3H 2P95A 1CGIE 1K1OA 3HK3B 3PWCA 1AZ8A 1OP8A 1ANBA 1JXPA 1W2KH 2ZQ1A 1LMWB 1TIOA 2ZCLP 5J4SA 3SGAE 2ZGXH 5EOKA 1SBWA 1HNEE 1MZAA 2B5TB 1QB9A 4NZLA 1Y3WA 2CF8H 3KEEA 3Q3XA 4KP0A 3A7XA 3OX7U 1AHTH 4R0IA 3SUGA 3F68H 2A2XH 2OC7A 2W3KA 1C1UH 1FZZA 2Y5HA 1F7ZA 3MH6A 3TIUA 3MU0A 5PTPA 3KQEA 1YBWA 4NCYA 2FI5E 5C1XA 3RU4T 4DGJA 1SQAA 3A86A 1O2WA 4A1TA 1CT4E 1VGCB 3BTWE 1EPTA 3D49H 4X2VA 2ZU2A 2ZO3H 1A46H 3A8DA 1ZTLA 4X2XA 1TONA 1FN8A 1DWBH 1UTJA 1DE7H 3SUFA 1B0FA 1O3PB 5C1YA 4WH6A 1Z7KA 1D3QB 4ESTE 1P05A 3RXTA 4YESB 5LH8A 3U69H 5J4QA 3H7OA 2OQUA 3SZNA 1F0TA 3MH7A 1TNLA 1MAXA 3BTTE 1P0SH 1IAUA 4XOJA 1K22H 1QBOA 1C1RA 3EA8A 4FUGA 1T7CA 1SLXB 2ILNA 4OS6A 3TJOA 3ELAH 1O36A 1A3BH 3A7TA 4CRBA 4IS5A 1GGDB 5B6OA 1GBEA 3D23A 1BRAA 8LPRA 3EGKH 3T28A 1SFIA 2NU2E 1ELEE 3RXBA 2C93B 2SGEE 2PWXA 3PLKA 2HALA 4WXIA 4ZKRU 3T27A 4I8LA 1GWAA 1FI8A 3SV8A 4BTUB 1O5FH 2RCEA 1Z8JB 5FXLA 4CRDA 1ELCA 3L3TA 1LQEA 4K60A 4IN1A 3SORA 1E34B 3M61U 1LKAA 1BMLA 2H5CA 4NA9H 3KF2A 1DY9A 1EJNA 3P17H 4WXVA 4FU9A 1V2ST 3VGCB 1IQGA 3MNXA 4HI3A 2BDYA 3E90B 2BVXH 4JYVH 1C1SA 3F9HA 1EAWA 2VH6A 1O2XA 3MU4A 2IPHA 2WPHS 1XVMA 1HYLA 1N6XA 1CSOE 2QXHA 4FXGH 4OGYA 2BMGB 2ZTXA 3QUMP 4BAOB 4CRCA 1P10A 3A89A 4Y8ZA 1NO9H 4Y10E 1P03A 3UNQA 1SC8U 2J38A 1GJ8B 1OX1A 1T4UH 2QIQA 4CR5A 1AGJA 2A5AA 4BANB 1LHGH 1Y5UT 1BJVA 1O30A 5JB8S 1GJCB 1IHTH 1TBZH 1J9CH 4D7GA 1HJAB 1MQ6A 2SGAA 1GJ5H 1SGRE 2W7SA 5T3HA 4O9VA 3SUDA 2GT7A 1LHCH 2WPIS