1WYKA

Sindbis virus capsid protein (114-264)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
152
structure length
152
Chain Sequence
MRLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTYTSEHPEGFYNWHHGAVQYSGGRFTIPRGVGGRGDSGRPIMDNSGRVVAIVLGGADEGTRTALSVVTWNSKGKTIKTTPEGTEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein, hydrolase
molecule keywords SINDBIS VIRUS CAPSID PROTEIN
publication title Probing the potential glycoprotein binding site of sindbis virus capsid protein with dioxane and model building.
pubmed doi rcsb
source organism Sindbis virus
total genus 30
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1998-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wykA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wykA01
3KQDA 3ZVFA 3TK6A 2ODPA 2ZDKA 1AWHB 2ZTZA 1MBMA 3PYHA 1G9IE 3DFLA 4Y8YA 4B71A 3LPRA 1AY6H 1CGIE 4HZHA 1ZLRA 3UWIA 3Q3KA 1BMMH 3FP6E 7GCHF 1Z8IB 2RCEA 5PTPA 2AMDA 4X8UH 3RLYH 3MI4A 1HB0B 2BLWA 5C5NA 2BX3A 2W7UA 5K7RA 4AG1A 1VR1H 2AEIH 4OS6A 1C1WH 4ZROA 3P6ZB 3HATH 3TH4H 3M7UA 2ZCHP 1S5SA 4B75A 1C1NA 1SVPA 1GHAF 1P09A 3QGNB 1J17T 1OXGA 3U98H 1VCPA 3M61U 5GCHG 4NCYA 1DT2A 3ZZDA 2IN2A 3RC5A 2OCVB 4YOGA 2BZ6H 3EA8A 4ABJA 1F5KU 3BEIB 2H6MA 4WMFA 2ZHFH 5EPYA 1GHYH 2WPMS 1PPHE 1OSSA 1HUTH 1MTWA 1OX1A 3FP7E 3RMLH 1C9PA 1D4PB 4NGAH 1V2PT 2OC1A 3PTNA 4AFUA 3ZZAA 2ZDVH 2VNTA 1GBAA 2Q6FA 1V2WT 4AG2A 1CHOF 5HM9A 1DX5M 4YLUA 4TY6A 1RTKA 4ABAA 3GCHC 1UTNA 8ESTE 2VIVA 1GBEA 3O8RA 3UIRA 1O5BB 1A3EH 3V12A 2Y7ZA 5E2PA 3GYMA 1P2KA 1ORFA 4K60A 2BD5A 3SV8A 1D3TB 2HOBA 3PM3A 2SFAA 1PPGE 1Y59T 1C5TA 4JCNA 5GWZA 4K3JA 1GI6A 4Q7ZA 1P02A 3AASA 1EZUC 4O9VA 3DA9B 2UUJB 1PPBH 3BTEE 2ZNKH 2VWNA 1C4U2 4K2YA 1LKAA 1F0SA 2ZWLH 5ESBA 1D6WA 5DP9A 3NK8A 1HAOH 2I6SA 3SUDA 4HFPB 1TPOA 1WQVH 1GI3A 1DS2E 2SGEE 1DANH 1ZOMA 4FVDA 1W11U 4X1QU 4THNH 4WMDA 1W13U 1RJXB 1O36A 2PFEA 3GYLB 1T4UH 2D2DA 4MNYA 4DW2U 2R0LA 2NU3E 3RMOH 2FDAA 4ISIH 1FUJA 1H1BA 3UR9A 4AGJA 3E90B 3SGQE 2NU4E 1EAWA 1CA0B 4K1EA 2SGDE 5CHAC 3KEEA 3RU4E 1DWDH 2XWAA 3K2UA 1OWDA 3HK3B 3K6ZA 3V3MA 1C1UH 3EA7A 4E06H 5FPTA 3URCA 3ZZCA 2STBE 1ZJDA 1YYY1 2UUYA 3RXSA 3PROA 1WTGH 5GJ4B 4NA9H 2PTNA 2EI8A 3KQCA 2C93B 2ZPRA 1V2ST 3T25A 1B0EA 2BYAX 5A8ZA 5L6NH 1THRH 1TPSA 1C1VH 1MTNB 5IDKA 1NU9A 2FX6A 4NWKA 4CBOA 1YP9A 5JBCS 3GY5A 4X1RU 1BQYA 4JZDH 4DG4A 3LC5A 1THSH 1W0ZU 1CA8B 4BAKB 4NG9H 1GBLA 3AAVA 2QXHA 3QTOH 2FWWA 6ESTA 4BOHA 2UWOA 1DUEA 2UUFB 2WINI 1P2JA 2ZP0H 1F5RA 1MU6B 1TGCA 1QJ7B 2DE8A 3LOXA 4NA8A 4U2WA 4DT7B 1C4Y2 2EA3A 1SG8B 1O31A 5AHGH 1VJAU 3B8JA 3VFEA 1V2MT 1VCWA 1V2JT 3U8OH 1TYNA 4GHTA 2J92A 1GGDB 5JYIA 3M5OA 2ZU3A 1YF4A 2ZGHA 4AYVB 1H8IH 3MO9A 5C3NA 4NIVA 1YC0A 1NU7B 3A87A 1UCYH 2FOBA 2FXRA 1AUJA 1JWTA 1MTVA 2AMQA 2F9UA 2ZGCA 5GCHF 5A09A 3F9EA 2Q6DA 2KAIA 5EQRA 3UNRA 1HJAB 1GJ7B 2BVSH 4X8SH 3GY8A 1BMAA 3EYDA 3SU6A 2PHBA 2A4GA 2IJOB 3RXIA 1W8BH 1NESE 3ZVDA 1PPEE 2VH0A 3BTWE 2ANYA 5EW1H 3GCTF 1G3CA 1ID5H 1O2LA 3FVFB 2C8WB 3PWBA 4O97A 2LPRA 1XX9A 1T7CA 1DE7H 3HKJB 4ZXXH 1DXWA 4OS1A 1EZSC 1TOMH 2Z9GA 2ZZUH 2SNVA 1LHCH 2YNAA 4WH8A 2Y5FA 2TGTA 1TE0A 4IBLH 1QHRB 2VWLA 4WXVA 3RXCA 1GJAB 4I8KA 3M7QA 2ZDLA 2C90B 1K1JA 4B2CA 1V2UT 4ISLA 4DCDA 1NC6A 4A1TA 2FOGA 1NRNH 4KKDA 3TK9A 3PO1B 2OLGA 4Z0KA 2KAIB 3A7WA 4I8HA 4I8JA 1YPGH 2ILNA 2QAAA 4ZAEA 1AQ7A 2NU2E 3TGJE 1SBWA 1BBRE 1TALA 1SLWB 3T28A 1TX6A 1TIOA 1TNIA 1S85A 4OGXA 4BAMB 3Q3XA 4FUFA 2FOMB 1AVWA 3HK6B 1EZXC 3TNTA 2EI6A 2BY9X 1FPCH 2WV5A 3E0PB 4X6NA 1JIRA 1O5FH 2G81E 1UCYK 2BY8X 6GCHF 1IQHA 1W0YH 4YLQH 1C5LH 5A8XA 3OYPA 4M7GA 1MQ6A 3MNXA 1B0FA 2PR3A 1WTHD 1QL7A 1GL1A 3M35A 1DXPA 1ELBA 4IGDA 1P3CA 2R9PA 3GY3A 4NIYA 4JYUH 4XDEA 1Z8GA 3BTME 1FAXA 1K9OE 1IAUA 1GJCB 3SV6A 1AN1E 4I7YH 1P9UA 1UK3A 1B7XB 2QCYA 4CRFA 2A4RA 5F8XA 3V7TA 3ZVGA 1HPGA 3BV9B 4LXBH 2P8OC 3SNBA 1GI7B 1UHBB 1EP5A 4AYYB 2H1UA 3RXFA 1RD3B 1ZSLA 2A5IA 3KF2A 3BIUH 1ZTJA 3A85A 5DP3A 2G00A 1XMNB 2FMJA 3VGCC 1S83A 2VWOA 3SGAE 2GTBA 1V2TT 2ZF0H 1O3HA 2H5CA 4AGKA 4JMYA 1TABE 1WOFA 3WY8A 1QURH 2ANMH 2ZU1A 1ESBA 2VVCA 3RMMH 1UK4A 5GDSH 1TONA 1GMCF 1FY5A 1TNLA 2A7JA 3U8RH 1NFWA 1ELCA 1IQFA 3RM0H 1WBGB 1XUFA 1DFPA 1OS8A 4WF8A 4XFQA 2C8XB 3QZQA 5GIBA 1C1RA 1YPLH 2BDIA 1EPTC 4JYTA 1T31A 1QGFA 1K1LA 3LJOA 1AB9B 1P12E 1U6QA 2BD9A 2OTVA 1BA8B 2PSXA 1BJVA 2BD3A 4JZIA 1EB1H 1GDNA 3GDSA 1TGSZ 1BTZA 3VXEH 1V2OT 1YCPK 1BTUA 1V2NT 1ESAA 3RXLA 4GCHF 1RRKA 3UNSA 5K0HA 1BHXF 4BTIB 2GZ8A 1BOQA 1DOJA 1C2FA 4I31A 3SU0A 3ZZ7A 3VB3A 2ZHQH 2A2QH 1GCTC 2FTMA 1L2EA 1S0RA 2PSYA 2BQ7B 2FM2A 3E6PH 3LGVA 1F0UA 3SU1A 1O3AA 3QN7A 2OBOA 5HYOA 4FUCA 2Y5GA 2H2ZA 1Z8JB 2WV4A 3TGKE 2OP9A 1AVGH 1TPAE 1VZQH 4ABFA 1W7GH 3UPEA 7KMEH 2FS9A 1K1IA 2QXJA 3VB4A 3GDVA 2PKSC 1ARCA 1A7SA 3KQEA 2ZFTA 4IC5A 1EAXA 5TJXA 1PQ7A 2B9LA 5I25A 1PPFE 1YCPM 5DP4A 3RXPA 2XC0A 1O2RA 1MZDA 5HM2A 2ZGBH 1C5PA 4YESB 4O03A 2HLCA 1P10A 3D49H 2OC7A 5TCCA 4H6SB 2ZPSA 3LC3A 5AF9H 1VITG 3T5FH 1UVPA 1H9IE 1GMHG 2XNIA 2D26C 3F9HA 2IOTA 1C2GA 3I29A 1FZZA 1TGNA 2BOHB 3RDZA 1H8DH 3TVJB 1O34A 2V3OH 2DE9A 4INLA 1HJ9A 2OC0A 1UJ1A 3RXTA 1P05A 4TWWA 2O8WA 3SJIA 1HYLA 1UTQA 1CGJE 2AYWA 3RC4A 1O3MA 5J4QA 1DPOA 1BTWA 1ELTA 1AHTH 1AFEH 1GI1A 2BD4A 5JPMH 4XE4A 1Y3XA 3PMHB 1O3FA 1QL8A 1GJBB 2GMTC 4K69A 2VVUA 1UTPA 4MNWA 7LPRA 1ANCA 4ZKRU 1AMHA 2XWBI 1AZZA 1N8OC 3D65E 1NFXA 5EGMA 1GHBG 1PQAA 2BD2A 3RUOA 3PLKA 3SJ8A 1TGTA 2XYAA 2BVRH 1NRRH 1Y5AT 2GDEH 1O5EH 3A8AA 2ZHDA 5EOKA 3SV2H 3GOVB 2F9OA 2AH4X 1JMOH 1ZPZA 1ZRKA 2Y80A 3RXKA 2ZECA 2BTCE 1CVWH 3E8LA 1VITH 1FI8A 3NUMA 4ZHLU 1J14A 3RXUA 5FCRA 1FONA 1K21H 2WUCA 3CS7A 3LH3A 1CBWB 1GJ6A 1OYTH 2FS8A 3LONA 1RXPA 1TBZH 3SUEA 3TH2H 1ELDE 1C1PA 3R0FA 3TK5A 1ZZZA 3LU9B 2VIPA 1GVLA 8GCHF 1C2DA 3Q3YA 3P8FA 1IQLA 2C4FH 3TJOA 3VB6A 3I78A 2ZQ2A 1FAKH 1TQ0B 4BAOB 3H5CB 1GI4A 3OU0A 1MU8B 3JZ1B 1G2MA 3IITA 5B6OA 4YT6H 1QRXA 1JRSA 5FPSA 1O5GH 5AFZH 3ZV9A 1G3BA 1MAXA 4X1PU 1OYQA 1SGCA 2BLQA 1PYTC 2Z9LA 3MNCA 4GAWA 4CBNA 3LGWA 1B5GH 4TWYA 2W3IA 1HGTH 1A5HA 2TBSA 1W10U 5EG4A 5A0AE 1NT1A 4AX9H 1D3QB 4KTSA 3SHAH 1QA0A 2EEKA 1ZGVA 3TIUA 3O8BA 1T4VH 4UFGH 2TGAA 2ZA5A 1KXBA 5ETXA 2R2WU 1YBWA 5JB9S 2QGRA 2Z9IA 4UE7H 2YNBA 1K28D 1QCPA 1RGQA 3BG4B 1GJDB 1S82A 3EQ0H 1ACBE 3ATLA 1PYTD 4MPUA 4RKOB 4FUDA 1HXFH 1ANDA 2G52A 3SJ9A 3PB1E 2FP7B 1BRBE 2G5VA 3GISB 2BXTH 2QXGA 1TNKA 3M3TA 1JRTA 3M5LA 3R3GB 1HAGE 4A92A 1O3OA 4AN7A 1MMJN 4CREA 1F7ZA 1DM4B 2PTCE 3RU4D 1P3EA 3U69H 3QX5H 3QO6A 1H9HE 2XC5A 3RM2H 4XBDA 1YPKH 2ZHEH 1GWAA 4MNVA 1VGCC 1HAIH 1DY9A 5E0JA 4ABIA 2GT8A 2ZC9H 2ZDMA 1LQDB 2NWNA 3FZZA 4B74A 3E91A 2CHAB 2R3YA 1BJUA 1OWHA 3MHWU 3OY5U 1MKXH 3DHKH 1G32B 1A4WH 1KXEA 1LHDH 1LKBA 2CF8H 1XM1A 3TNSA 1ELGA 1MQ5A 3T62A 4AFSA 2V0BA 1GDQA 2STAE 2O8MA 1EP6A 3MU4A 1D3PB 1BTYA 3SQEE 1ZPBA 3A80A 3F9FA 3ZZ6A 1OKXA 3H7TA 1ELAA 5ABWA 2C8ZB 5T6DA 2YOLA 3KIDU 1DITH 1KXFA 2FOFA 2Z94A 2QXIA 2VJ1A 1A61H 1HJ8A 1GI9B 3BF6H 1K1MA 1ZR0A 2BY6X 4D76A 1KXCA 1GBIA 1EJAA 2BDCA 2BY7X 2CGAA 3MWIU 1PPZA 2ZHWH 1QRZA 3E3TA 1FIZA 2FOHA 2FOCA 1O3BA 4DGJA 1QNJA 2AGIX 1QBOA 1EJNA 1CHGA 2BD8A 1MTUA 4X6PA 1RS0A 1WSSH 2BX4A 1K1PA 1OWJA 1KSNA 1W14U 2QC2A 3A82A 2ZGJA 4GVUA 1HCGA 1C2EA 1P2NA 3M5MA 4DURA 3QWCH 1C5UA 2FLBH 1GJ5H 2ZU2A 1YKTA 4X0WU 1P9SA 1MKWH 3ZYDA 1Y3WA 3M36A 1DLEA 2P3UB 1W2KH 2QY0B 9ESTA 4AORA 2GKVE 6LPRA 1D6RA 2A7CA 4ZXYH 2GCTB 2PLXA 3C27B 4NIWA 4ZHMU 1MUEB 2ESTE 3SO3A 1NFUA 1T32A 2BDYA 1LPGB 1NZQH 5C2ZA 2JETB 3UOUA 1GBDA 4A7IB 4FUGA 1C2KA 2FZZA 4U32A 1TWXB 5A8YA 2AIPA 1TA6A 2FODA 1ZSKA 4SGAE 3UWJH 2Y82A 2F9BH 1NRPH 2J95A 1IQIA 4NWLA 4MPWA 1FDPA 2BM2A 1DUAA 1LCYA 4FUBA 3HGNA 5LGOA 4ZHAA 1FN8A 3E0NB 3RXAA 2BB4A 1KLIH 3T27A 4CR9A 1SMFE 4OS7A 5FX6A 2DUCA 3SQHE 1QBNA 2RA0A 1H4WA 2TIOA 3U1JB 1FY1A 2TGPZ 4Y11E 2BDBA 3SJKA 1BTHH 5LPRA 1PQ5A 1SI5H 1BZXE 4H4FA 1LO6A 1TMBH 2A32A 3UQVA 1GI5A 1EPTA 1ZMJA 4OS4A 4D8NA 4D7FA 3M5NA 2FLRH 1SGYE 1G37A 3KNXA 1TB6H 5DPAA 1ANEA 1FJSA 1E34B 1O2NA 1XKAC 3LGIA 1DVAH 1O2HA 1L4ZA 1C2LA 4MNXA 4VGCB 1BTXA 1TOCB 1THPB 4CHAB 3TH3H 3TJNA 2VGCB 3ZZ9A 1UTOA 1O2ZA 2XW9A 4D9QA 1CA0C 5T3HA 1BT7A 1L1NA 1QB9A 3F6UH 2F9NA 1MKWK 5HGGA 3SV9A 1SFIA 5EU8A 3A7XA 2RA3A 1HIAA 1T8OA 4RN6A 1IQGA 1CU1A 1AKSA 4INHA 2ANKH 3SZNA 4MPVA 1O2XA 2FIRH 3UQOA 2I6QA 2CMYA 4DIHH 3ATKA 4CRGA 1AO5A 4RKJB 3LJJA 2M5TA 2D8WA 2HPPH 2XBWA 3MNBA 1BRCE 1LPKB 5L2YH 1EPTB 1MTNC 1DY8A 3BTFE 1QIXB 5EQQA 4XBCA 2XBYA 1BRUP 1ABJH 4YM9A 2F83A 3L3TA 2J34A 2PV9B 1O3EA 1G36A 1MCVA 2J9NA 3TU7H 1DWEH 1HFDA 4DOQA 1O0DH 1NROH 3NKKA 2P3FH 3VXFH 3TPIZ 1GBTA 4FVBA 1O2JA 4PROA 2W5EA 2W3KA 3LT3A 4NZLA 1TBRH 3SU5A 1C1MA 1EZQA 2HGTH 2OXSA 2ZFFH 3E16B 3GCOA 1C5ZB 1DWCH 4WJG2 1HIAB 1RIWB 3VPKA 5DK1A 4NFFA 3Q77A 4UD9H 4JZEH 3TLOA 1WU1A 1AKSB 4ZUHA 1AVXA 4MTBA 4IC6A 1UCYE 2B7DH 1C2IA 3OX7U 4NA7A 2BLVA 5DP7A 3LH1A 2ANWA 4TY7A 1BRAA 2ZO3H 3BTHE 4MVNA 5JBBS 1ETRH 2A45B 2ALVA 1GGDC 3A8CA 1SHYA 2WPKS 3SBKA 2P95A 4AOQA 1J8AA 2GCHG 4X2VA 3MYWA 2TPIZ 1UVTH 1GG6B 1FMGA 1TMUH 1O2YA 1J9CH 2ZU5A 1NFYA 3BG8A 2UUKB 1GBMA 1O37A 4DJZB 3MTYA 1YPHE 1NTPA 4U01A 5C5OA 1KLTA 2WUBA 2XTTB 1P01A 1HJAC 2EC9H 3DUXH 3SGBE 4F4OC 1KY9A 3LGUA 5TCAA 4XBBA 5FHTA 1WQSA 5DKMA 2ZDAH 4UFFH 3OSYA 1ZSJA 1GVZA 1ZTLA 5A2MH 1Z71A 1L4DA 3ZVBA 1LHFH 4B2BA 1C5WB 1C1OA 1M9UA 4NZQA 1NS3A 2H5DA 1HDTH 1HRTH 3MH6A 1J16A 3MU0A 4CRBA 4Y7AA 5E0HA 4J1YA 1XXDA 3K65B 1JBUH 4K8YA 3P8NA 3MFJA 1SGIB 5EXNA 1W12U 1ZHRA 3P92A 1SQTA 2VB0A 4ABBA 3ATIA 1QTFA 2AERH 4BTUB 6CHAB 2G5NA 3FP8E 3RXMA 2CN0H 3PLPA 1F2SE 1IHSH 3PO1C 4X6OA 2VIOA 1SHHB 2BLOA 2HWLB 1UTMA 3QK1A 4R0IA 2FOEA 4XSKU 1ZTKA 4ASHA 3ATMA 1O5AB 4NFEA 1Y3YA 3RXOA 5JB8S 3UFAA 2BY5X 4Y0ZE 4JYVH 1CT2E 1N8OB 2P3TB 1P03A 1A5IA 2JH5D 5F03A 3EDXB 3EAJA 1ZGIA 1F5LA 3SUGA 3O8CA 1PPCE 1BIOA 1V2RT 1GHAG 2G51A 1ZHPA 3MH7A 1A2CH 1P8VC 1QB1A 1OWEA 4YZUA 3RXJA 3UUZA 3BEUA 1Z1JA 2OBQA 1HAXB 2BQ6B 1S0QA 3MO3A 3QTVH 4JK6A 4WWYA 4E05H 1XUIA 4AB8A 4F49A 3DT0H 3SW2B 1C5MD 1C1SA 1V2KT 1A0JA 1O2PA 1PFXC 2BMGB 2A7HA 4I33A 2ZTYA 4BAQB 4CRAA 5EW2H 5FBEA 2A4OA 3STIA 1YLDA 5LPEA 5EXMA 2P93A 4Z6AH 1GBHA 2BD7A 4UEHH 1FPHH 2Y81A 3S0NA 3S9BA 1IHTH 3BEFB 3GY7A 1SGTA 3Q00A 1DSUA 1TX8A 2AS9A 3BTTE 1P57B 4KTUA 1QQUA 1GI8B 5H4IB 5JBTA 1AI8H 5FCKA 4Y79A 2GT7A 1C2HA 4UFDH 1TX7A 5E0GA 1C2JA 1ZRBA 1S6FA 3KGPA 4D9RA 3NCLA 2F91A 3P95A 2ODQA 2BQWB 2ZEBA 2BZAA 4XOJA 5IYTA 1UTJA 3AW0A 2FOAA 3A8BA 3L6PA 2ZTXA 3UNQA 4BXWA 1NRQH 2AMPA 3A84A 3S9AA 4FU7A 1A1RA 1ABIH 2HALA 3MMGA 1WAYB 1INCA 1L0ZA 1LQEA 3U8TH 4B2AA 2HNTC 4MLFB 3MH5A 5DP8A 4KGAA 4HGCA 1LHEH 1O2MA 3EGKH 3G01A 4TYDA 2R2MB 2AGEX 3VB7A 4X6MA 3RXGA 3M37A 2HPQH 4X2XA 3SUFA 7ESTE 1MD8A 1AFQC 4K1SA 3GCHB 5F6MA 3LGYA 1LVYA 2V35A 1CE5A 1O2UA 4Q80A 3S69A 1MTSA 5I46H 1YM0A 1Y5UT 1E0FD 3PMJA 4FUIA 2JKHA 1JIMA 2XC4A 3GY2A 1FN6A 3DFJA 4Q2KA 2W7SA 2FX4A 1BITA 1ZMNA 2ZCKP 1C9TA 4FUEA 3D62A 2AGGX 1S6HA 1O2OA 2BDAA 5AVDA 2P16A 1TRYA 4INKA 2C3SA 1C2MA 3RXHA 3V0XA 3NPSA 1C4V2 2OINA 1DLKB 4ABHA 4DIIH 5C1XA 3KQBA 5C67A 4LK4A 1C1TA 1AWFH 1P0SH 2CF9H 3RC6A 1KTTB 3P8OA 1O3DA 2GP9B 3ZVEA 3A7TA 2ODYB 2ZIQH 1DSTA 4I8GA 3GCNA 5T6FA 3QZRA 1GBCA 3M7TA 1LPZB 1HAZB 1SGDE 1SSXA 1A0HB 1O5DH 2Z3DA 1SB1H 1NO9H 1G3DA 4Q7XA 1GBFA 1SGQE 5CHAB 1O3NA 8KME2 5J4SA 1O3LA 5DP6A 2GD4B 1YPJH 1EAIA 2HNTE 4WY3A 3N7OA 3E1XB 5LH8A 2ALPA 2A2XH 2H9EH 4ESTE 3GY6A 2Z9KA 3MU1A 2HNTF 1HXEH 1GI2A 1GVKB 1G3EA 2Z3EA 1FY8E 3RXDA 5A0CA 3UR6A 2Q1JA 4E7RG 1P04A 3A88A 1O2IA 1OP2A 1O2SA 2CV3A 2ZGXH 3M3SA 4UFEH 1EKBB 3Q76A 2VIQA 2CJIA 3P17H 1KIGH 1EOLA 1Y3UA 2SGFE 1BDAA 3QLPH 2ZI2H 3C1KA 4IW4E 1OWIA 9LPRA 1W3CA 3GCTG 1IQMA 5ESTE 3RXBA 3NZIA 3U1IB 1LVBA 1HBTH 2PGBB 1IQJA 3GY4A 1JOUB 4JK5A 3ITIA 1LDTT 1SLVB 1P06A 1K22H 4RSPA 1KLJH 1BCUH 1XUKA 1E35B 2V6NA 5JBAS 2ZFQH 4K5ZA 2Q6GA 3RLWH 3T2NA 2A4QA 3O8DA 1VITF 1TAWA 1EASA 1FY3A 2GVFA 2O8TA 4MPXA 1TMTH 2OQUA 1FNIA 5SGAE 3D23A 1GMHF 2GV6A 1HNEE 1FIWA 1TRNA 2ZG0H 2ZPQA 3K9XB 1E37B 1ELEE 4K1TA 3TGIE 1LHGH 3HGPA 1TBQH 1TNHA 3LKWA 3UTUH 1CBWC 2P94A 4X1SU 4QT8C 4DY7B 1FY4A 2QIQA 4WXIA 2ZQ1A 1PJPA 2FEQH 2B5TB 1TQ7B 1O3CA 3IWMA 1GPZA 2THFB 3RXEA 3SU3A 2QYIA 2PGQB 1Q2WA 1GBBA 1CSOE 3HPTB 1SL3A 3PMAB 1QQ4A 4BXSA 1UVOA 1O30A 4FUJA 1Y3VA 3GICB 1SOZA 4FU8A 1ETSH 1O2KA 1RTLA 2K1QA 4KP0A 4X8TH 1HAYB 3EA9A 2J4IA 2Z6BD 5DGJA 1P2QA 5EPNA 1J15A 1HLTH 1GHZA 1GMDG 4O3UA 2UWLA 1XUGA 2IPHA 2LNCA 2Z7FE 3UOPA 1BMNH 1D3DB 6GCHG 4R8TB 1GHBF 1O35A 1MBQA 1S81A 4HTCH 3FANA 2BVXH 3ZZ3A 2VU8E 2FI5E 1AD8H 3RMNH 2SNWA 3UY9A 1QL9A 3A86A 2PKAA 1UVSH 1Z6JH 2O8UA 1O2VA 4HI3A 1O33A 2XCNA 3K6YA 1EQ9A 1YPMH 1EB2A 4NIXA 2G8TA 1W7XH 4ISOA 1P2IA 5EXLA 2HRVA 3BG4C 4TPIZ 4LZ1H 2FTLE 3T26A 4CRCA 2ZCLP 1SGEE 3PV4A 1UTLM 2BDGA 4OGYA 1KXAA 1WUNH 2PUQH 4BANB 3ATWA 1ZJKA 1O3GA 1LVMA 4Y6DA 3QUMP 2UWPA 4ISHH 5FBIA 1BUIA 2A0QB 3NXPA 1OWKA 3DD2H 3AW1A 2Y6TA 1OPHB 1Q3XA 2A31A 3QDZB 1MKXK 1TPPA 4DVAU 1NN6A 2J94A 1GMCG 5DJ7A 3LIWA 1SQAA 3RP2A 1FV9A 2GGVB 2XCFA 1BBRH 2FPZA 2FI4E 2PKAB 1BHXB 5BPEA 3MU8A 2C8YB 1KTSB 1IQEA 5GPIB 2ZFRH 3ZVCA 3SU4A 1GJ8B 4A1VA 3V13A 1K1OA 5F8TA 3P8GA 2F3CE 1EJMA 2CHAC 2GZ7A 3EE0B 1IQNA 4IN2A 1AU8A 5CE1A 3SI3H 4CR5A 1JXPA 4ABGA 2Y5HA 2SGPE 1O32A 1HAPH 1GL0E 3SNDA 5A0BA 1C5QA 1XVOA 2P8OB 4GCHG 1EAUA 1S84A 1TRMA 1ZHMA 8LPRA 5C1YA 2F9VA 4CH8B 1ZYOA 3JZ2B 2FESH 1MD7A 3SJOA 3F68H 3VGCB 1HV7A 2RG3A 1Q31A 3KN2A 2XBVA 4A5TS 4AZ2B 4Y0YE 4ZKNU 1YPHC 1EUFA 4O3TA 4FUHA 1O3KA 1V3XA 3W95A 4JZFH 1MAYA 4OS2A 4E7NA 3S9CA 3HKIB 1OOKB 1C1QA 2Z9JA 3MU5A 5AFYH 2OD3B 3ZZBA 4B73A 4GPGA 2JH6D 3PMBB 4H6TA 4IMQA 1C5NH 1O39A 4A1XA 4YOJA 1XUHA 1TLDA 1CT0E 1C5XB 4SGBE 5E2OA 4LZ4B 2W26A 1GI0A 3S7KB 1YLCA 2XBXA 2G55A 2OQ5A 2O8LA 2QA9E 2GX4A 1CT4E 1VJ9U 1V2QT 3ZVAA 1A5GH 3AAUA 1EX3A 3A7ZA 2VINA 4X1NU 5HMAA 3NWUA 1DICA 1TA2A 1KYNA 1FLEE 3A81A 3UREA 1LMWB 2GZ9A 1SOTA 1BBRK 1IOEA 1MCTA 3L33A 2GCTC 1FXYA 1GHWH 1N1LA 4MG3A 1K1NA 3T29A 1ARBA 5EODA 2WPLS 2FYQA 2ZFPH 2TGDA 2JETC 5GXPA 2EI7A 1UHBA 1AUTC 1PQ8A 4IMZA 1TNGA 1OP0A 1YPEH 1T8NA 3RXVA 2O9QA 1GCTB 3SNAA 5FPYA 1YGCH 1N6YA 4YO9A 1GMDF 2F9PA 2BOKA 1HAVA 2OC8A 1O5CB 3QGJA 1MH0A 1XUJA 2NU0E 4Y76A 5DP5A 1QJ1B 1WYKA 1YCPH 2QF3A 1O2GH 1TGBA 2A5AA 1D9IA 1MZAA 1GCDA 2AFQB 1C5SA 5DG6A 4Y10E 1HAHH 2PKSB 2ZKSA 5BRRE 4I8LA 2BHGA 3STJA 1BTPA 1UVUH 1G30B 2XXLA 3CS0A 1QA7A 5T6GA 3OTJE 1Z1IA 1ESTA 1NM6A 3TJVA 2Y7XA 1E36B 2Z3CA 5FXLA 1KDQA 5EQSA 1TNJA 1LTOA 5L30H 2A1DB 3ODDA 4Y8XA 4J2YB 1RFNA 4JZ1A 3RU4T 1FQ3A 4VGCC 2VH6A 4CHAC 3BIVH 3W94A 1O2TA 2VGCC 3FFGA 2VVVA 3MNSA 4IN1A 4OS5A 2VWMA 2P59A 1N6XA 2WYJA 4UDWH 4KELA 4MQAA 3U9AH 1NY22 4H42U 4X2YA 3ZZ4A 2ULLA 4ABEA 5HXFA 1HAVB 1K2I1 2AIQA 3PLBA 3A7YA 4GHQA 3URDA 1QBVH 3FAOA 5JDUB 1SC8U 3I77A 3VEQB 4Y71A 4BAHB 1Y8TA 8GCHG 4LOYH 2QF0A 4IS5A 2H9HA 1UMAH 4CH2B 4X8VH 1L1JA 1QB6A 1CO7E 1EOJA 1KDQB 7GCHG 2V3HH 1C5OH 1ELVA 2GMTB 3RXQA 4B76A 2J2UA 2ZDNA 1BB0B 1GJ9B 1TFXA 1C5VA 2QN5T 2H9TH 1ZMLA 4GUXA 4YTAA 1OP8A 3H7OA 3CP7A 4D7GA 1AE5A 4AFQA 2ASUB 1AFQB 1SQOA 4ABDA 3S7HB 3P70B 4YT7H 4AB9A 1P2MA 1ELFA 3TJUA 1Y5BT 3AVZA 4GLYA 3ESTA 3CENA 3SORA 1SGFA 1T8LA 4I32A 3GDUA 3TITA 4CRDA 3FZDA 1A0LA 4BTTB 1UK2A 1ANBA 1RIWC 3LDXH 2XRCA 1WCZA 4A6LA 4UONA 1QFKH 1SLXB 2NU1E 2GV7A 4K8BA 4WVPE 2B8OH 1V2VT 4YOIA 5L2ZH 3IG6B 3A83A 2R3UA 3B23B 3BN9A 2BXUH 4X2WA 1EXFA 3ODFA 1Z8RA 1SR5C 2G4UA 2PUXB 3B9FH 1SPJA 3A8DA 5G4BA 2A5KA 4NSYA 1A46H 1G2LA 1XKBC 4ISNA 5E8EH 1CHOG 2PWXA 1Z7KA 1GG6C 3BTGE 2JH0D 3M3VA 3OY6U 4ZKOU 1SGNE 1UO6A 5C20A 2D1JA 1F92A 1L1GA 2VIWA 3VB5A 1DDJA 5FAHA 1SLUB 3BSQA 3SNCA 2WYGA 2TRMA 2G4TA 1F0TA 2FI3E 3MO6A 4Y7BA 2ZU4A 1O3JA 4FU9A 2GDDA 1XVMA 4Y8ZA 2J38A 1E38B 1AE8H 3SN8A 3PWCA 4Q7YA 3BTDE 4U30A 4ZKSU 2PW8H 1NRSH 2FYRA 3BTKE 3RXRA 1O2QA 1WV7H 4WH6A 2WPHS 1UTKA 3ZZ5A 2BDHA 2R0KA 1SGRE 1P2OA 3SU2A 4KTCA 3SV7A 1XXFA 2B0FA 5CMXH 1V2LT 3PTBA 1GDUA 5LPFA 2VIDA 1SGPE 1IQKA 1Z6EA 1VCQA 2HVXA 4WMEA 2SGQE 1AIXH 1AB9C 1P11E 6CHAC 1QJ6B 3ELAH 3SNEA 3MH4A 1LVOA 1SGFG 3F1SB 1O3PB 2GCHF 5C1UA 2WPIS 1C5YB 3A7VA 1ZPCA 1EATA 5FX5A 4TPYA 1CQQA 1O3IA 1GBJA 3BTQE 1T8MA 1AZ8A 1H9LB 3KL6A 3F9GA 1BMLA 1RTFB 3LGTA 1DWBH 1ETTH 4ZH8A 1KXDA 3ENSB 4BNRA 2SGAA 4B1TA 1CGHA 4AFZA 3ZZ8A 2QV1A 3KHVA 1X7AC 5DO4H 3ZV8A 1GHVH 4MDSA 1C5RA 2ZFSA 4GSOA 1O2WA 3A89A 1GBKA 1VGCB 1QY6A 2OUAA 3SI4H 2FO9A 3KCGH 4NSVA 4ZMAH 2RDLA 1GHXH 1NPMA 1V6DA 4FXGH 1O38A 1QRWA 1GJ4H 3SHCH 2CXVA 1QR3E 3ZYEA 5F8ZA 1AGJA 2WPJS 1F0RA 3SOSA 3MOCA 1SFQB 1A3BH
chains in the Genus database with same CATH superfamily
3KQDA 3ZVFA 3TK6A 2ODPA 2ZDKA 1AWHB 2ZTZA 1MBMA 3PYHA 1G9IE 3DFLA 4Y8YA 4B71A 2XOKD 3LPRA 1AY6H 1CGIE 4HZHA 1ZLRA 3OE7D 3UWIA 3Q3KA 1BMMH 3FP6E 7GCHF 1Z8IB 2RCEA 5PTPA 2AMDA 4X8UH 3UB0A 4F55A 3RLYH 2HLDD 3MI4A 1HB0B 2BLWA 5C5NA 2BX3A 2W7UA 5K7RA 4AG1A 3SZEA 2PP6A 1VR1H 2AEIH 4OS6A 1C1WH 4ZROA 3P6ZB 3HATH 3TH4H 3M7UA 2ZCHP 1QZ8A 1S5SA 4B75A 1C1NA 1SVPA 1GHAF 1P09A 3QGNB 1J17T 1OXGA 3U98H 1VCPA 3M61U 5GCHG 4NCYA 1DT2A 3ZZDA 2IN2A 3RC5A 2OCVB 4YOGA 2BZ6H 3EA8A 4ABJA 1F5KU 3BEIB 2H6MA 4WMFA 2ZHFH 5EPYA 1GHYH 2WPMS 1PPHE 1OSSA 4I86A 1HUTH 1MTWA 1OX1A 3FP7E 3RMLH 1C9PA 1D4PB 4NGAH 1V2PT 2OC1A 3PTNA 4AFUA 3ZZAA 2ZDVH 2VNTA 1GBAA 2Q6FA 1V2WT 4AG2A 1CHOF 5HM9A 1DX5M 4YLUA 4TY6A 1RTKA 4ABAA 3GCHC 2JIZD 1UTNA 8ESTE 2VIVA 1GBEA 3O8RA 3UIRA 1O5BB 1A3EH 3V12A 5DSFA 2Y7ZA 5E2PA 3GYMA 1P2KA 1ORFA 4K60A 2BD5A 3SV8A 1D3TB 2HOBA 3PM3A 2SFAA 1PPGE 1Y59T 1C5TA 3FN8A 4JCNA 5GWZA 4K3JA 1GI6A 4Q7ZA 1P02A 3AASA 1EZUC 4O9VA 3DA9B 2UUJB 1PPBH 3BTEE 2ZNKH 2VWNA 1C4U2 4K2YA 1LKAA 1F0SA 2ZWLH 5ESBA 1D6WA 5DP9A 3NK8A 1HAOH 2I6SA 3SUDA 4HFPB 2L6OA 1TPOA 1WQVH 1GI3A 1DS2E 2SGEE 1DANH 1ZOMA 3PRDA 1W11U 4FVDA 4X1QU 4THNH 4WMDA 1W13U 1RJXB 1O36A 2PFEA 3GYLB 1T4UH 2D2DA 4MNYA 4DW2U 2R0LA 2NU3E 3RMOH 2FDAA 4ISIH 1FUJA 1H1BA 3UR9A 4AGJA 1NBMD 3E90B 3SGQE 2NU4E 1EAWA 1CA0B 2M2AA 4K1EA 2SGDE 5CHAC 3KEEA 3RU4E 1DWDH 2XWAA 3K2UA 1OWDA 3HK3B 3K6ZA 3V3MA 1C1UH 3EA7A 4E06H 5FPTA 3URCA 3ZZCA 2STBE 1ZJDA 1YYY1 2UUYA 3RXSA 3PROA 1YLNA 1WTGH 5GJ4B 4NA9H 2PTNA 2EI8A 3KQCA 2C93B 2ZPRA 1V2ST 3T25A 3N99A 1B0EA 2BYAX 5A8ZA 5L6NH 1THRH 1TPSA 1C1VH 2CK3D 1MTNB 3GS9A 5IDKA 1NU9A 2FX6A 4NWKA 4CBOA 1YP9A 5JBCS 5CDFE 3GY5A 4X1RU 1BQYA 4JZDH 4DG4A 3LC5A 1THSH 1W0ZU 1CA8B 3OFND 4BAKB 4NG9H 1GBLA 3AAVA 2QXHA 1NBME 3QTOH 2FWWA 3UAIC 6ESTA 4BOHA 2UWOA 1DUEA 2UUFB 2WINI 1P2JA 2ZP0H 1F5RA 1MU6B 1TGCA 1QJ7B 2DE8A 2KM0A 3LOXA 4NA8A 4U2WA 2QF5A 4DT7B 1C4Y2 2EA3A 1SG8B 1O31A 5AHGH 1VJAU 3B8JA 3VFEA 1V2MT 3OEHD 1VCWA 1V2JT 3U8OH 1TYNA 4GHTA 2J92A 1GGDB 5JYIA 3M5OA 2ZU3A 1YF4A 2ZGHA 4AYVB 1H8IH 3MO9A 5C3NA 4NIVA 1YC0A 1NU7B 3A87A 1UCYH 2FOBA 2FXRA 1E1QD 1AUJA 1JWTA 1MTVA 2AMQA 2F9UA 2ZGCA 5GCHF 4M9FA 5A09A 3F9EA 2Q6DA 2KAIA 3DSPA 5EQRA 3UNRA 1HJAB 1GJ7B 2BVSH 4X8SH 3GY8A 1BMAA 3EYDA 3SU6A 2PHBA 2A4GA 2IJOB 3H09A 1W8BH 3RXIA 1NESE 3ZVDA 1PPEE 2VH0A 3BTWE 2ANYA 5EW1H 3GCTF 1G3CA 1ID5H 1O2LA 3FVFB 2C8WB 3PWBA 3DCLA 2LPRA 1XX9A 1T7CA 4O97A 1DE7H 2HVYB 3HKJB 4ZXXH 3KYGA 1DXWA 4OS1A 1EZSC 1TOMH 2Z9GA 2ZZUH 2SNVA 1LHCH 2YNAA 5HIZA 4WH8A 2Y5FA 2TGTA 1TE0A 4IBLH 1QHRB 2J97A 2VWLA 4WXVA 3RXCA 1GJAB 4I8KA 3M7QA 2ZDLA 2C90B 4DT4A 1K1JA 4B2CA 1V2UT 4ISLA 4AC9A 4DCDA 1NC6A 4A1TA 2FOGA 1NRNH 4KKDA 3TK9A 3PO1B 2OLGA 4Z0KA 2KAIB 3A7WA 4I8HA 4I8JA 1YPGH 2ILNA 2QAAA 4ZAEA 1AQ7A 2NU2E 3TGJE 1SBWA 1BBRE 1TALA 2WSSD 1SLWB 3T28A 1TX6A 1TIOA 1TNIA 1S85A 4OGXA 4BAMB 3Q3XA 4FUFA 2FOMB 1AVWA 3HK6B 1EZXC 3TNTA 2EI6A 2BY9X 1FPCH 2WV5A 3E0PB 4X6NA 1JIRA 1E1RD 3DSOA 1O5FH 2G81E 1UCYK 2BY8X 6GCHF 1IQHA 1W0YH 4YLQH 1C5LH 5A8XA 3OYPA 4M7GA 1MQ6A 3MNXA 5C94A 1B0FA 2PR3A 1WTHD 4ACAA 1QL7A 1GL1A 3M35A 1DXPA 1ELBA 4IGDA 1P3CA 2R9PA 3GY3A 4NIYA 4JYUH 2WZQA 1Z8GA 4XDEA 3BTME 1FAXA 1K9OE 1IAUA 1GJCB 3SV6A 1AN1E 4I7YH 1P9UA 1UK3A 1B7XB 2QCYA 4CRFA 4RT1A 2A4RA 5F8XA 3V7TA 3ZVGA 1HPGA 3BV9B 4LXBH 2P8OC 3SNBA 1GI7B 1UHBB 2W6ID 1EP5A 4FOUC 4AYYB 2H1UA 3RXFA 1RD3B 1ZSLA 2A5IA 3KF2A 3BIUH 1ZTJA 3OEED 3A85A 5DP3A 2G00A 1XMNB 2FMJA 3VGCC 1S83A 2VWOA 3SGAE 2GTBA 1V2TT 2ZF0H 1O3HA 2H5CA 4AGKA 3FOAA 4JMYA 1TABE 1WOFA 3WY8A 1QURH 2ANMH 2ZU1A 1ESBA 2VVCA 3RMMH 1UK4A 5GDSH 1TONA 1GMCF 1FY5A 1TNLA 2A7JA 3U8RH 1NFWA 1ELCA 1IQFA 3RM0H 1WBGB 2GJGA 1XUFA 1DFPA 1OS8A 4WF8A 4XFQA 2C8XB 3QZQA 5GIBA 1C1RA 1YPLH 2BDIA 1EPTC 4JYTA 1T31A 1QGFA 1K1LA 3LJOA 1AB9B 1P12E 1U6QA 2BD9A 2OTVA 1BA8B 2PSXA 3W1EA 1BJVA 2BD3A 4JZIA 1EB1H 1GDNA 3GDSA 1TGSZ 1BTZA 3VXEH 1V2OT 1YCPK 1BTUA 1V2NT 1ESAA 3RXLA 4GCHF 1RRKA 3UNSA 5K0HA 1BHXF 4BTIB 2GZ8A 1BOQA 1DOJA 1C2FA 4I31A 3SU0A 3ZZ7A 3VB3A 2ZHQH 2A2QH 1GCTC 2FTMA 1L2EA 1S0RA 2PSYA 2BQ7B 2FM2A 2KCPA 3E6PH 3LGVA 1F0UA 3SU1A 1O3AA 3QN7A 2OBOA 5HYOA 4FUCA 2Y5GA 2H2ZA 1Z8JB 2WV4A 3TGKE 2OP9A 4TSFD 1AVGH 1TPAE 2F43B 1VZQH 1SKYE 1W7GH 4ABFA 3WW7A 3UPEA 4RI0A 7KMEH 2FS9A 1K1IA 2QXJA 3VB4A 2JDID 2PKSC 3GDVA 1ARCA 1A7SA 3KQEA 2ZFTA 2WPDD 4IC5A 1EAXA 5TJXA 1PQ7A 2B9LA 1WXRA 5I25A 1PPFE 1YCPM 5DP4A 3RXPA 2XC0A 1O2RA 1MZDA 5HM2A 2ZGBH 1C5PA 4YESB 1KMHB 4O03A 2HLCA 1P10A 3D49H 2OC7A 5TCCA 4H6SB 2WV9A 2ZPSA 3LC3A 5AF9H 1VITG 3T5FH 1UVPA 1H9IE 1GMHG 2XNIA 2D26C 3F9HA 2IOTA 3WWBA 1C2GA 3I29A 2KR7A 1FZZA 1TGNA 2BOHB 3RDZA 1H8DH 3TVJB 2K0QA 1O34A 2V3OH 4XRNA 2DE9A 4INLA 1HJ9A 2OC0A 1UJ1A 3RXTA 1P05A 4TWWA 2O8WA 3SJIA 1HYLA 1UTQA 1CGJE 2AYWA 3RC4A 1O3MA 5J4QA 1DPOA 1BTWA 1ELTA 1AHTH 1AFEH 3F2HA 1GI1A 2AHME 2BD4A 5JPMH 4XE4A 1Y3XA 3PMHB 1O3FA 1QL8A 1GJBB 2GMTC 4K69A 2VVUA 1UTPA 4MNWA 7LPRA 1ANCA 4ZKRU 1AMHA 1YWUA 2J98A 2XWBI 1AZZA 2L74A 1N8OC 3D65E 1NFXA 5EGMA 1GHBG 1PQAA 4RT0A 2BD2A 3RUOA 3PLKA 3SJ8A 1TGTA 2XYAA 2BVRH 1VKYA 1NRRH 1Y5AT 4B6EA 2GDEH 1O5EH 3A8AA 2ZHDA 5EOKA 3SV2H 3GOVB 2F9OA 2AH4X 1JMOH 1ZPZA 1ZRKA 2Y80A 3RXKA 2ZECA 2BTCE 1CVWH 3E8LA 1VITH 1FI8A 2RDEA 3NUMA 4ZHLU 1J14A 3RXUA 5FCRA 1FONA 1K21H 2WUCA 3CS7A 3LH3A 1CBWB 1GJ6A 1OYTH 2FS8A 4ASUD 3LONA 1RXPA 1TBZH 3F2FA 3SUEA 3TH2H 1ELDE 1C1PA 3R0FA 3TK5A 1ZZZA 3LU9B 5EJ1A 2VIPA 1GVLA 8GCHF 1C2DA 3Q3YA 3P8FA 1IQLA 2C4FH 3TJOA 3VB6A 3I78A 2ZQ2A 1FAKH 1TQ0B 2J98B 4BAOB 3H5CB 1GI4A 3OU0A 1MU8B 3JZ1B 1G2MA 3IITA 5B6OA 4YT6H 1QRXA 1JRSA 5FPSA 1O5GH 2YMSC 5AFZH 3ZV9A 1G3BA 1MAXA 4X1PU 1OYQA 1SGCA 2BLQA 1PYTC 2Z9LA 3MNCA 4GAWA 4CBNA 3LGWA 1B5GH 4TWYA 2W3IA 1HGTH 1A5HA 2TBSA 1W10U 5EG4A 5A0AE 1NT1A 4AX9H 1D3QB 4KTSA 3SHAH 1QA0A 2EEKA 1ZGVA 3TIUA 3O8BA 1T4VH 4UFGH 2TGAA 2ZA5A 1KXBA 5ETXA 2R2WU 1YBWA 5JB9S 2YMSD 2QGRA 2Z9IA 4UE7H 2YNBA 3F0PA 3VG8A 1K28D 1QCPA 1RGQA 3BG4B 1GJDB 1S82A 3EQ0H 1ACBE 3ATLA 1PYTD 4MPUA 4RKOB 4FUDA 1HXFH 1ANDA 2G52A 3SJ9A 3PB1E 2FP7B 1BRBE 2G5VA 3GISB 2BXTH 2QXGA 1TNKA 3M3TA 1JRTA 3M5LA 3R3GB 1HAGE 5DN6D 4A92A 1O3OA 1YY3A 1MMJN 4AN7A 4CREA 1F7ZA 1DM4B 2PTCE 3RU4D 1P3EA 3U69H 3QX5H 3QO6A 1H9HE 2XC5A 3RM2H 4XBDA 1YPKH 2ZHEH 1GWAA 4MNVA 1VGCC 1HAIH 1DY9A 5E0JA 4ABIA 2GT8A 2ZC9H 2ZDMA 1LQDB 2NWNA 3FZZA 4FETA 4B74A 3E91A 2CHAB 1FX0B 2R3YA 1BJUA 1OWHA 5KECA 3MHWU 3OY5U 1MKXH 3DHKH 1G32B 1A4WH 1KXEA 1LHDH 1LKBA 2W6JD 2CF8H 1XM1A 3TNSA 1ELGA 1MQ5A 3T62A 4AFSA 2V0BA 1GDQA 2STAE 5F53A 2O8MA 1EP6A 3MU4A 1D3PB 1BTYA 3SQEE 1ZPBA 3A80A 3F9FA 3ZZ6A 1E79D 1OKXA 3H7TA 1ELAA 5ABWA 2C8ZB 3PV2A 5T6DA 2YOLA 3KIDU 5EJZA 1DITH 1KXFA 2FOFA 2Z94A 2QXIA 2VJ1A 1A61H 1HJ8A 1GI9B 3BF6H 1K1MA 1ZR0A 2BY6X 4D76A 1KXCA 1GBIA 1EJAA 2BDCA 2BY7X 2CGAA 3MWIU 1PPZA 2ZHWH 1QRZA 3E3TA 1FIZA 2FOHA 2FOCA 1O3BA 4DGJA 1QNJA 2AGIX 1QBOA 1EJNA 1CHGA 2BD8A 1MTUA 4X6PA 1RS0A 1WSSH 2BX4A 1K1PA 1OWJA 1KSNA 1W14U 2QC2A 3A82A 2ZGJA 4GVUA 1HCGA 1C2EA 1P2NA 3M5MA 4DURA 3QWCH 1C5UA 4TT3D 2FLBH 1GJ5H 2ZU2A 1YKTA 4X0WU 1P9SA 1MKWH 3ZYDA 1Y3WA 3M36A 1DLEA 2P3UB 2XNDD 1W2KH 2QY0B 9ESTA 4AORA 2GKVE 6LPRA 1D6RA 2A7CA 4ZXYH 2GCTB 2PLXA 3PV5A 3C27B 4NIWA 4ZHMU 1MUEB 2ESTE 3SO3A 1NFUA 1T32A 2BDYA 1LPGB 1NZQH 5C2ZA 2JETB 3UOUA 1GBDA 4A7IB 4FUGA 1C2KA 2EY4C 2FZZA 4U32A 1TWXB 5A8YA 2AIPA 1TA6A 2FODA 1ZSKA 4SGAE 3UWJH 2Y82A 2F9BH 1NRPH 2J95A 1IQIA 4NWLA 4MPWA 5C0UA 1FDPA 2BM2A 1DUAA 1LCYA 4FUBA 3HGNA 5LGOA 4ZHAA 1FN8A 3E0NB 3RXAA 2BB4A 1KLIH 3T27A 4CR9A 4Q4LA 1SMFE 4OS7A 5FX6A 2DUCA 3SQHE 1QBNA 4ZCNA 2RA0A 1H4WA 2TIOA 3U1JB 1FY1A 2TGPZ 4Y11E 2OK5A 2BDBA 3SJKA 1BTHH 5LPRA 1PQ5A 3F2GA 1SI5H 2VBCA 1BZXE 4H4FA 1LO6A 1TMBH 2A32A 3UQVA 1GI5A 1EPTA 1ZMJA 4OS4A 4D8NA 4D7FA 3M5NA 2FLRH 1SGYE 1G37A 3KNXA 1TB6H 5DPAA 1ANEA 1FJSA 1E34B 1O2NA 1XKAC 3LGIA 1DVAH 1O2HA 3FO8D 1L4ZA 1C2LA 4MNXA 4VGCB 3MQKC 1BTXA 1TOCB 1THPB 4CHAB 3TH3H 3TJNA 2VGCB 3ZZ9A 1UTOA 1O2ZA 2XW9A 4D9QA 1CA0C 5T3HA 1BT7A 1L1NA 1QB9A 3F6UH 2F9NA 1MKWK 5HGGA 3SV9A 1SFIA 5EU8A 3A7XA 2RA3A 1HIAA 1T8OA 4RN6A 1IQGA 1CU1A 1AKSA 4INHA 2ANKH 3SZNA 4MPVA 1O2XA 2FIRH 3UQOA 2I6QA 2CMYA 4DIHH 3ATKA 4CRGA 1AO5A 4RKJB 1K0HA 3LJJA 2M5TA 2D8WA 2HPPH 2XBWA 3MNBA 1BRCE 1LPKB 5L2YH 1EPTB 1MTNC 1DY8A 3BTFE 1QIXB 5EQQA 4XBCA 2XBYA 1BRUP 1ABJH 4YM9A 2F83A 3L3TA 2J34A 2PV9B 1O3EA 1G36A 5C17A 1MCVA 2J9NA 3TU7H 1DWEH 1HFDA 4DOQA 1O0DH 1NROH 3NKKA 2P3FH 3VXFH 3TPIZ 1GBTA 4FVBA 1O2JA 4PROA 2W5EA 2W3KA 3LT3A 4NZLA 1TBRH 3SU5A 1C1MA 1EZQA 2HGTH 2OXSA 2ZFFH 3E16B 3GCOA 1C5ZB 1DWCH 4WJG2 1HIAB 1RIWB 3VPKA 5DK1A 4NFFA 3Q77A 4UD9H 4JZEH 3TLOA 1WU1A 1AKSB 4ZUHA 1AVXA 4MTBA 4IC6A 1UCYE 2B7DH 1C2IA 3OX7U 4NA7A 2BLVA 5DP7A 4Z1MD 3LH1A 2ANWA 4TY7A 1BRAA 2ZO3H 3BTHE 4MVNA 5JBBS 1ETRH 2A45B 2ALVA 1GGDC 3A8CA 1SHYA 2WPKS 3SBKA 2P95A 4AOQA 1J8AA 2GCHG 4X2VA 3MYWA 2TPIZ 1UVTH 2KCAA 1GG6B 1FMGA 1TMUH 1O2YA 1J9CH 2ZU5A 1NFYA 3BG8A 2UUKB 1GBMA 1O37A 4DJZB 3MTYA 1YPHE 1NTPA 4U01A 5C5OA 1KLTA 2WUBA 2XTTB 1P01A 1HJAC 2EC9H 3DUXH 3SGBE 4F4OC 1KY9A 3LGUA 5TCAA 5EJLA 4XBBA 5FHTA 1WQSA 5DKMA 2ZDAH 4UFFH 3OSYA 1ZSJA 1GVZA 1ZTLA 5A2MH 1Z71A 1L4DA 3ZVBA 1LHFH 4B2BA 1C5WB 1C1OA 4P02A 1M9UA 4NZQA 1NS3A 2H5DA 1HDTH 1HRTH 3MH6A 1J16A 3MU0A 4CRBA 4Y7AA 5E0HA 4J1YA 1XXDA 3K65B 1JBUH 4K8YA 3P8NA 3CNRA 3MFJA 1SGIB 5EXNA 1W12U 1ZHRA 3P92A 1SQTA 2VB0A 1MABB 4ABBA 3ATIA 1QTFA 2AERH 4BTUB 6CHAB 2G5NA 3FP8E 3RXMA 2CN0H 3PLPA 1F2SE 1IHSH 3PO1C 4X6OA 2VIOA 1SHHB 2BLOA 2HWLB 1UTMA 3QK1A 4R0IA 2FOEA 4XSKU 1ZTKA 4ASHA 3ATMA 1O5AB 4NFEA 1Y3YA 3RXOA 3ZIAD 3UFAA 5JB8S 2BY5X 4Y0ZE 4JYVH 1CT2E 1N8OB 2P3TB 1P03A 1A5IA 2JH5D 5F03A 3EDXB 3EAJA 1ZGIA 1F5LA 3SUGA 3O8CA 1PPCE 1COWD 1BIOA 5T1VA 1V2RT 1GHAG 2G51A 1ZHPA 3F3BA 3MH7A 1A2CH 1P8VC 1QB1A 1OWEA 4YZUA 3RXJA 3UUZA 3BEUA 1Z1JA 2OBQA 1HAXB 2BQ6B 1S0QA 3MO3A 3QTVH 4JK6A 4WWYA 4E05H 1XUIA 4AB8A 4F49A 3DT0H 3F0OA 3SW2B 3AK5A 1C5MD 1C1SA 1V2KT 1A0JA 1O2PA 1PFXC 1SQRA 2BMGB 2A7HA 4I33A 2ZTYA 4BAQB 4CRAA 5EW2H 5FBEA 2A4OA 3STIA 1YLDA 5LPEA 5EXMA 2P93A 4Z6AH 1GBHA 2BD7A 4UEHH 1FPHH 2Y81A 3S0NA 3N7DA 3S9BA 1IHTH 3BEFB 2J5UA 3GY7A 4OM9A 1SGTA 3Q00A 1DSUA 1TX8A 2AS9A 3BTTE 1P57B 4KTUA 1QQUA 1GI8B 5H4IB 5JBTA 1AI8H 5FCKA 4Y79A 2GT7A 1C2HA 4UFDH 1TX7A 2YMSB 5E0GA 1C2JA 1ZRBA 1S6FA 3KGPA 3PRBA 4D9RA 3NCLA 2F91A 3P95A 2ODQA 2BQWB 2ZEBA 2BZAA 4XOJA 5IYTA 1UTJA 3AW0A 2FOAA 3A8BA 3L6PA 2ZTXA 3UNQA 4BXWA 1NRQH 2AMPA 3A84A 2V7QD 3S9AA 4FU7A 1A1RA 1ABIH 2HALA 3MMGA 1WAYB 1INCA 1L0ZA 1LQEA 3U8TH 4B2AA 2HNTC 4MLFB 3MH5A 3NRLA 4KGAA 5DP8A 4HGCA 1LHEH 1O2MA 5FL7D 3EGKH 3G01A 4TYDA 2R2MB 2AGEX 3VB7A 4X6MA 3RXGA 3M37A 2HPQH 4X2XA 3SUFA 7ESTE 1UW7A 1MD8A 3FKSD 1AFQC 4K1SA 3GCHB 5F6MA 3LGYA 1LVYA 2V35A 1CE5A 1O2UA 4Q80A 3S69A 1MTSA 5I46H 2KZ4A 1YM0A 1Y5UT 1E0FD 3PMJA 4FUIA 2JKHA 1JIMA 2XC4A 3GY2A 1FN6A 3DFJA 4Q2KA 2W7SA 2FX4A 1BITA 1ZMNA 2ZCKP 1C9TA 4FUEA 3D62A 2AGGX 1S6HA 3U28C 1O2OA 2BDAA 5AVDA 2P16A 1TRYA 4INKA 2C3SA 1C2MA 3RXHA 3V0XA 3NPSA 1C4V2 2OINA 1DLKB 4ABHA 4DIIH 5C1XA 3KQBA 5C67A 4LK4A 1C1TA 1AWFH 1P0SH 2CF9H 3RC6A 1KTTB 1S6LA 3P8OA 1O3DA 2GP9B 3ZVEA 3A7TA 2ODYB 2ZIQH 1DSTA 4I8GA 3GCNA 5T6FA 3QZRA 1GBCA 3M7TA 1LPZB 1HAZB 1SGDE 1SSXA 1A0HB 1O5DH 2Z3DA 1SB1H 1NO9H 2JJ2D 1G3DA 1GBFA 4Q7XA 1SGQE 5CHAB 1O3NA 8KME2 5J4SA 1O3LA 5DP6A 2GD4B 3OAAD 1YPJH 1EAIA 2HNTE 4WY3A 3N7OA 3E1XB 5LH8A 2ALPA 2A2XH 2H9EH 4ESTE 3GY6A 2Z9KA 3MU1A 2HNTF 1HXEH 1GI2A 1GVKB 1G3EA 2Z3EA 1FY8E 3RXDA 5A0CA 3UR6A 2Q1JA 4E7RG 1P04A 3A88A 1O2IA 1OP2A 1O2SA 2CV3A 2ZGXH 3M3SA 4UFEH 1EKBB 3Q76A 2VIQA 2CJIA 3P17H 1KIGH 1EOLA 1Y3UA 2SGFE 1BDAA 3QLPH 2ZI2H 3C1KA 4IW4E 1OWIA 9LPRA 1W3CA 3GCTG 1IQMA 5ESTE 3RXBA 3NZIA 3U1IB 1LVBA 1HBTH 2PGBB 1IQJA 3GY4A 1JOUB 4JK5A 3ITIA 1LDTT 1SLVB 1P06A 1K22H 4RSPA 1KLJH 1BCUH 1XUKA 1E35B 2V6NA 5JBAS 2ZFQH 4K5ZA 2Q6GA 3RLWH 3T2NA 2A4QA 3KQ5A 3O8DA 1VITF 1TAWA 1EASA 1FY3A 2GVFA 2O8TA 4MPXA 1TMTH 2OQUA 1FNIA 5SGAE 3D23A 1GMHF 2GV6A 1HNEE 1FIWA 2KX4A 1TRNA 2ZG0H 2ZPQA 3K9XB 1E37B 1ELEE 4K1TA 3TGIE 1LHGH 3HGPA 5B6LA 1TBQH 1TNHA 3LKWA 3UTUH 1CBWC 2P94A 4X1SU 4QT8C 4DY7B 1FY4A 1H8HD 2QIQA 4WXIA 2ZQ1A 2WHXA 1PJPA 2FEQH 2B5TB 1TQ7B 1O3CA 3IWMA 1GPZA 2THFB 3RXEA 3SU3A 2QYIA 2PGQB 1Q2WA 1GBBA 1CSOE 4Q63A 3HPTB 1SL3A 3PMAB 1QQ4A 4BXSA 1UVOA 1O30A 4FUJA 1Y3VA 3GICB 1SOZA 4FU8A 1ETSH 1O2KA 1RTLA 2K1QA 4KP0A 4X8TH 1HAYB 3EA9A 2J4IA 2Z6BD 5DGJA 1P2QA 4HG6A 5EPNA 1J15A 2LELA 1HLTH 1GHZA 1GMDG 4O3UA 2UWLA 1XUGA 2IPHA 2LNCA 2Z7FE 3UOPA 1BMNH 1D3DB 6GCHG 4R8TB 1GHBF 1O35A 1MBQA 1S81A 4HTCH 3FANA 2BVXH 1BMFD 2VU8E 3ZZ3A 2FI5E 1AD8H 3RMNH 2SNWA 3UY9A 1H8ED 1QL9A 3A86A 2IPQX 1W0JD 2PKAA 1UVSH 1Z6JH 2O8UA 5KEDA 1O2VA 3EE7A 4HI3A 1O33A 2XCNA 3K6YA 1EQ9A 5HIYA 1YPMH 1EB2A 4NIXA 2G8TA 1W7XH 4ISOA 1P2IA 5EXLA 2HRVA 3BG4C 4TPIZ 4LZ1H 2FTLE 3T26A 4CRCA 2ZCLP 1SGEE 3PV4A 1UTLM 2BDGA 4OGYA 1KXAA 1WUNH 2PUQH 4BANB 3ATWA 1ZJKA 1O3GA 1LVMA 4Y6DA 3QUMP 2UWPA 4ISHH 5FBIA 1BUIA 2A0QB 3NXPA 1OWKA 3DD2H 3AW1A 2Y6TA 1OPHB 1Q3XA 2A31A 3QDZB 1MKXK 1TPPA 4DVAU 1NN6A 2J94A 1GMCG 5DJ7A 3LIWA 1SQAA 3RP2A 1FV9A 2GGVB 2XCFA 1BBRH 2FPZA 2FI4E 2PKAB 1BHXB 5BPEA 3MU8A 2C8YB 1KTSB 1IQEA 5GPIB 2ZFRH 3ZVCA 3SU4A 1GJ8B 4A1VA 3V13A 1K1OA 5F8TA 2V3MA 3P8GA 2F3CE 1EJMA 4B6FA 2CHAC 2GZ7A 4F48B 5GNDA 3EE0B 1IQNA 3N7EA 4IN2A 1AU8A 5CE1A 3SI3H 4CR5A 1JXPA 4ABGA 2Y5HA 2SGPE 1O32A 1HAPH 1GL0E 3SNDA 5A0BA 1C5QA 1XVOA 2P8OB 4GCHG 1EAUA 1S84A 4XD7D 1TRMA 1ZHMA 8LPRA 5C1YA 2JJ1D 2F9VA 4CH8B 1ZYOA 3JZ2B 2FESH 1MD7A 3SJOA 3F68H 3VGCB 5EIYA 1HV7A 2RG3A 1Q31A 3KN2A 2XBVA 4A5TS 4AZ2B 4Y0YE 4ZKNU 1YPHC 1EUFA 4O3TA 4FUHA 1O3KA 1V3XA 3OTPA 3W95A 4JZFH 1MAYA 4OS2A 4E7NA 3S9CA 3HKIB 1OOKB 1C1QA 2Z9JA 3MU5A 5AFYH 2OD3B 3ZZBA 2F4LA 4B73A 4GPGA 2JH6D 3PMBB 4H6TA 4IMQA 1C5NH 1O39A 4A1XA 4YOJA 1XUHA 1TLDA 1CT0E 1C5XB 4SGBE 5E2OA 4LZ4B 2W26A 1GI0A 3S7KB 1YLCA 2XBXA 2G55A 2QF4A 2OQ5A 2O8LA 2QA9E 2GX4A 1CT4E 1VJ9U 1V2QT 3KYFA 3ZVAA 1A5GH 3AAUA 1EX3A 3A7ZA 2VINA 4X1NU 5HMAA 3NWUA 1DICA 1TA2A 1KYNA 3DSGA 1FLEE 3A81A 5HKKD 3UREA 1LMWB 2GZ9A 1SOTA 1BBRK 1IOEA 1MCTA 3L33A 2GCTC 1FXYA 1GHWH 1N1LA 4MG3A 1K1NA 3T29A 2KCYA 1ARBA 5EODA 2WPLS 2FYQA 2ZFPH 2TGDA 2JETC 5GXPA 1W0KD 2EI7A 1UHBA 1AUTC 1PQ8A 4IMZA 1TNGA 1OP0A 1YPEH 1T8NA 3RXVA 2O9QA 1GCTB 3SNAA 5FPYA 1YGCH 1N6YA 4YO9A 1GMDF 2F9PA 2BOKA 1HAVA 2OC8A 1O5CB 3QGJA 1MH0A 1XUJA 2NU0E 4Y76A 5DP5A 1QJ1B 1WYKA 1YCPH 2QF3A 1O2GH 1TGBA 2A5AA 1D9IA 1MZAA 1GCDA 2AFQB 1C5SA 5DG6A 4Y10E 1HAHH 2PKSB 2ZKSA 5BRRE 4I8LA 2BHGA 3STJA 1BTPA 1UVUH 1G30B 2XXLA 3CS0A 1QA7A 5T6GA 3OTJE 1Z1IA 1ESTA 1NM6A 3TJVA 2Y7XA 1E36B 2Z3CA 5FXLA 1KDQA 5EQSA 1TNJA 1LTOA 5L30H 2A1DB 3ODDA 4Y8XA 4ACBA 4J2YB 1RFNA 4JZ1A 3RU4T 1FQ3A 4VGCC 2VH6A 4CHAC 3BIVH 2IJD1 3W94A 2RFKC 1O2TA 2VGCC 3FFGA 2VVVA 3MNSA 4IN1A 4OS5A 2VWMA 2P59A 1N6XA 2WYJA 4UDWH 4KELA 4MQAA 3U9AH 1NY22 4H42U 4X2YA 3ZZ4A 2ULLA 4ABEA 5HXFA 1HAVB 1K2I1 2AIQA 3PLBA 3A7YA 4GHQA 3URDA 1QBVH 5C0TA 3FAOA 5JDUB 1SC8U 3I77A 3VEQB 4Y71A 4BAHB 1Y8TA 8GCHG 4LOYH 2QF0A 4IS5A 2H9HA 1UMAH 4CH2B 1EFRD 4X8VH 1L1JA 1QB6A 2EQNA 1CO7E 1EOJA 1KDQB 7GCHG 2V3HH 1C5OH 1ELVA 2GMTB 3RXQA 4B76A 2J2UA 2ZDNA 1BB0B 1GJ9B 1TFXA 1C5VA 2QN5T 2H9TH 1ZMLA 4GUXA 4YTAA 1OP8A 3H7OA 3CP7A 4D7GA 1AE5A 4AFQA 2ASUB 1AFQB 1SQOA 4ABDA 3S7HB 2KFWA 3P70B 4YT7H 4AB9A 1P2MA 1ELFA 3TJUA 1Y5BT 3AVZA 4GLYA 3ESTA 3CENA 3SORA 1SGFA 1T8LA 4I32A 3GDUA 3TITA 4CRDA 3FZDA 1A0LA 4BTTB 1UK2A 1ANBA 1RIWC 3LDXH 2XRCA 1WCZA 4A6LA 4UONA 1QFKH 1SLXB 2NU1E 2GV7A 4K8BA 4WVPE 2B8OH 1V2VT 4YOIA 5L2ZH 3IG6B 3A83A 2R3UA 3B23B 3BN9A 2BXUH 4X2WA 1EXFA 3ODFA 1Z8RA 1SR5C 2G4UA 2PUXB 3B9FH 1SPJA 3A8DA 5G4BA 2A5KA 4NSYA 1A46H 1G2LA 4P00A 1XKBC 4ISNA 5E8EH 1CHOG 3WWFA 2QE7D 2PWXA 1Z7KA 1GG6C 3BTGE 2JH0D 3M3VA 3OY6U 5KGOA 4ZKOU 1SGNE 1UO6A 5C20A 2D1JA 1F92A 5CHBA 1L1GA 2VIWA 3VB5A 1DDJA 5FAHA 1SLUB 3BSQA 3SNCA 2WYGA 3SYJA 2TRMA 2G4TA 1F0TA 2FI3E 2K8IA 3MO6A 4Y7BA 2ZU4A 1O3JA 4FU9A 2GDDA 1XVMA 4Y8ZA 2J38A 1E38B 1AE8H 3SN8A 3PWCA 4Q7YA 3BTDE 4U30A 4ZKSU 2PW8H 1NRSH 2FYRA 3BTKE 3RXRA 1O2QA 1WV7H 4WH6A 2WPHS 1UTKA 3ZZ5A 2KCOA 2BDHA 2R0KA 1SGRE 1P2OA 3SU2A 1OHHD 4KTCA 3SV7A 1XXFA 2B0FA 5CMXH 1V2LT 3PTBA 1GDUA 5LPFA 2VIDA 1WDIA 1SGPE 4YXWD 1IQKA 1Z6EA 1VCQA 2HVXA 4WMEA 2SGQE 1AIXH 1AB9C 1P11E 6CHAC 1QJ6B 3ELAH 3SNEA 3MH4A 1LVOA 1SGFG 3F1SB 1O3PB 2GCHF 5C1UA 2WPIS 1C5YB 3A7VA 2LP6A 1ZPCA 1EATA 5FX5A 4TPYA 1CQQA 1O3IA 1GBJA 3BTQE 1T8MA 1AZ8A 1H9LB 3KL6A 5IK2D 3F9GA 1BMLA 1RTFB 3LGTA 1DWBH 1ETTH 4ZH8A 1KXDA 3ENSB 4BNRA 2SGAA 4B1TA 1CGHA 4AFZA 3ZZ8A 2QV1A 3KHVA 1X7AC 5DO4H 3ZV8A 1GHVH 4MDSA 1C5RA 2ZFSA 4GSOA 1O2WA 3A89A 1GBKA 1VGCB 1QY6A 2OUAA 3SI4H 2FO9A 3KCGH 4NSVA 4ZMAH 2RDLA 1GHXH 1NPMA 1V6DA 4FXGH 1O38A 1QRWA 1GJ4H 3SHCH 2CXVA 1QR3E 3ZYEA 5F8ZA 1AGJA 2WPJS 1F0RA 3SOSA 3MOCA 1SFQB 1A3BH
chains in the Genus database with same CATH topology
3KQDA 3ZVFA 3TK6A 2ODPA 2ZDKA 1AWHB 2ZTZA 1MBMA 3PYHA 1G9IE 3DFLA 4Y8YA 4B71A 3LPRA 1AY6H 1CGIE 4HZHA 1ZLRA 3UWIA 3Q3KA 1BMMH 3FP6E 7GCHF 1Z8IB 2RCEA 5PTPA 2AMDA 4X8UH 3RLYH 3MI4A 1HB0B 2BLWA 5C5NA 2BX3A 2W7UA 5K7RA 4AG1A 1VR1H 2AEIH 4OS6A 1C1WH 4ZROA 3P6ZB 3HATH 3TH4H 3M7UA 2ZCHP 1S5SA 4B75A 1C1NA 1SVPA 1GHAF 1P09A 3QGNB 1J17T 1OXGA 3U98H 1VCPA 3M61U 5GCHG 4NCYA 1DT2A 3ZZDA 2IN2A 3RC5A 2OCVB 4YOGA 2BZ6H 3EA8A 4ABJA 1F5KU 3BEIB 2H6MA 4WMFA 2ZHFH 5EPYA 1GHYH 2WPMS 1PPHE 1OSSA 1HUTH 1MTWA 1OX1A 3FP7E 3RMLH 1C9PA 1D4PB 4NGAH 1V2PT 2OC1A 3PTNA 4AFUA 3ZZAA 2ZDVH 2VNTA 1GBAA 2Q6FA 1V2WT 4AG2A 1CHOF 5HM9A 1DX5M 4YLUA 4TY6A 1RTKA 4ABAA 3GCHC 1UTNA 8ESTE 2VIVA 1GBEA 3O8RA 3UIRA 1O5BB 1A3EH 3V12A 2Y7ZA 5E2PA 3GYMA 1P2KA 1ORFA 4K60A 2BD5A 3SV8A 1D3TB 2HOBA 3PM3A 2SFAA 1PPGE 1Y59T 1C5TA 4JCNA 5GWZA 4K3JA 1GI6A 4Q7ZA 1P02A 3AASA 1EZUC 4O9VA 3DA9B 2UUJB 1PPBH 3BTEE 2ZNKH 2VWNA 1C4U2 4K2YA 1LKAA 1F0SA 2ZWLH 5ESBA 1D6WA 5DP9A 3NK8A 1HAOH 2I6SA 3SUDA 4HFPB 1TPOA 1WQVH 1GI3A 1DS2E 2SGEE 1DANH 1ZOMA 4FVDA 1W11U 4X1QU 4THNH 4WMDA 1W13U 1RJXB 1O36A 2PFEA 3GYLB 1T4UH 2D2DA 4MNYA 4DW2U 2R0LA 2NU3E 3RMOH 2FDAA 4ISIH 1FUJA 1H1BA 3UR9A 4AGJA 3E90B 3SGQE 2NU4E 1EAWA 1CA0B 4K1EA 2SGDE 5CHAC 3KEEA 3RU4E 1DWDH 2XWAA 3K2UA 1OWDA 3HK3B 3K6ZA 3V3MA 1C1UH 3EA7A 4E06H 5FPTA 3URCA 3ZZCA 2STBE 1ZJDA 1YYY1 2UUYA 3RXSA 3PROA 1WTGH 5GJ4B 4NA9H 2PTNA 2EI8A 3KQCA 2C93B 2ZPRA 1V2ST 3T25A 1B0EA 2BYAX 5A8ZA 5L6NH 1THRH 1TPSA 1C1VH 1MTNB 5IDKA 1NU9A 2FX6A 4NWKA 4CBOA 1YP9A 5JBCS 3GY5A 4X1RU 1BQYA 4JZDH 4DG4A 3LC5A 1THSH 1W0ZU 1CA8B 4BAKB 4NG9H 1GBLA 3AAVA 2QXHA 3QTOH 2FWWA 6ESTA 4BOHA 2UWOA 1DUEA 2UUFB 2WINI 1P2JA 2ZP0H 1F5RA 1MU6B 1TGCA 1QJ7B 2DE8A 3LOXA 4NA8A 4U2WA 4DT7B 1C4Y2 2EA3A 1SG8B 1O31A 5AHGH 1VJAU 3B8JA 3VFEA 1V2MT 1VCWA 1V2JT 3U8OH 1TYNA 4GHTA 2J92A 1GGDB 5JYIA 3M5OA 2ZU3A 1YF4A 2ZGHA 4AYVB 1H8IH 3MO9A 5C3NA 4NIVA 1YC0A 1NU7B 3A87A 1UCYH 2FOBA 2FXRA 1AUJA 1JWTA 1MTVA 2AMQA 2F9UA 2ZGCA 5GCHF 5A09A 3F9EA 2Q6DA 2KAIA 5EQRA 3UNRA 1HJAB 1GJ7B 2BVSH 4X8SH 3GY8A 1BMAA 3EYDA 3SU6A 2PHBA 2A4GA 2IJOB 3RXIA 1W8BH 1NESE 3ZVDA 1PPEE 2VH0A 3BTWE 2ANYA 5EW1H 3GCTF 1G3CA 1ID5H 1O2LA 3FVFB 2C8WB 3PWBA 4O97A 2LPRA 1XX9A 1T7CA 1DE7H 3HKJB 4ZXXH 1DXWA 4OS1A 1EZSC 1TOMH 2Z9GA 2ZZUH 2SNVA 1LHCH 2YNAA 4WH8A 2Y5FA 2TGTA 1TE0A 4IBLH 1QHRB 2VWLA 4WXVA 3RXCA 1GJAB 4I8KA 3M7QA 2ZDLA 2C90B 1K1JA 4B2CA 1V2UT 4ISLA 4DCDA 1NC6A 4A1TA 2FOGA 1NRNH 4KKDA 3TK9A 3PO1B 2OLGA 4Z0KA 2KAIB 3A7WA 4I8HA 4I8JA 1YPGH 2ILNA 2QAAA 4ZAEA 1AQ7A 2NU2E 3TGJE 1SBWA 1BBRE 1TALA 1SLWB 3T28A 1TX6A 1TIOA 1TNIA 1S85A 4OGXA 4BAMB 3Q3XA 4FUFA 2FOMB 1AVWA 3HK6B 1EZXC 3TNTA 2EI6A 2BY9X 1FPCH 2WV5A 3E0PB 4X6NA 1JIRA 1O5FH 2G81E 1UCYK 2BY8X 6GCHF 1IQHA 1W0YH 4YLQH 1C5LH 5A8XA 3OYPA 4M7GA 1MQ6A 3MNXA 1B0FA 2PR3A 1WTHD 1QL7A 1GL1A 3M35A 1DXPA 1ELBA 4IGDA 1P3CA 2R9PA 3GY3A 4NIYA 4JYUH 4XDEA 1Z8GA 3BTME 1FAXA 1K9OE 1IAUA 1GJCB 3SV6A 1AN1E 4I7YH 1P9UA 1UK3A 1B7XB 2QCYA 4CRFA 2A4RA 5F8XA 3V7TA 3ZVGA 1HPGA 3BV9B 4LXBH 2P8OC 3SNBA 1GI7B 1UHBB 1EP5A 4AYYB 2H1UA 3RXFA 1RD3B 1ZSLA 2A5IA 3KF2A 3BIUH 1ZTJA 3A85A 5DP3A 2G00A 1XMNB 2FMJA 3VGCC 1S83A 2VWOA 3SGAE 2GTBA 1V2TT 2ZF0H 1O3HA 2H5CA 4AGKA 4JMYA 1TABE 1WOFA 3WY8A 1QURH 2ANMH 2ZU1A 1ESBA 2VVCA 3RMMH 1UK4A 5GDSH 1TONA 1GMCF 1FY5A 1TNLA 2A7JA 3U8RH 1NFWA 1ELCA 1IQFA 3RM0H 1WBGB 1XUFA 1DFPA 1OS8A 4WF8A 4XFQA 2C8XB 3QZQA 5GIBA 1C1RA 1YPLH 2BDIA 1EPTC 4JYTA 1T31A 1QGFA 1K1LA 3LJOA 1AB9B 1P12E 1U6QA 2BD9A 2OTVA 1BA8B 2PSXA 1BJVA 2BD3A 4JZIA 1EB1H 1GDNA 3GDSA 1TGSZ 1BTZA 3VXEH 1V2OT 1YCPK 1BTUA 1V2NT 1ESAA 3RXLA 4GCHF 1RRKA 3UNSA 5K0HA 1BHXF 4BTIB 2GZ8A 1BOQA 1DOJA 1C2FA 4I31A 3SU0A 3ZZ7A 3VB3A 2ZHQH 2A2QH 1GCTC 2FTMA 1L2EA 1S0RA 2PSYA 2BQ7B 2FM2A 3E6PH 3LGVA 1F0UA 3SU1A 1O3AA 3QN7A 2OBOA 5HYOA 4FUCA 2Y5GA 2H2ZA 1Z8JB 2WV4A 3TGKE 2OP9A 1AVGH 1TPAE 1VZQH 4ABFA 1W7GH 3UPEA 7KMEH 2FS9A 1K1IA 2QXJA 3VB4A 3GDVA 2PKSC 1ARCA 1A7SA 3KQEA 2ZFTA 4IC5A 1EAXA 5TJXA 1PQ7A 2B9LA 5I25A 1PPFE 1YCPM 5DP4A 3RXPA 2XC0A 1O2RA 1MZDA 5HM2A 2ZGBH 1C5PA 4YESB 4O03A 2HLCA 1P10A 3D49H 2OC7A 5TCCA 4H6SB 2ZPSA 3LC3A 5AF9H 1VITG 3T5FH 1UVPA 1H9IE 1GMHG 2XNIA 2D26C 3F9HA 2IOTA 1C2GA 3I29A 1FZZA 1TGNA 2BOHB 3RDZA 1H8DH 3TVJB 1O34A 2V3OH 2DE9A 4INLA 1HJ9A 2OC0A 1UJ1A 3RXTA 1P05A 4TWWA 2O8WA 3SJIA 1HYLA 1UTQA 1CGJE 2AYWA 3RC4A 1O3MA 5J4QA 1DPOA 1BTWA 1ELTA 1AHTH 1AFEH 1GI1A 2BD4A 5JPMH 4XE4A 1Y3XA 3PMHB 1O3FA 1QL8A 1GJBB 2GMTC 4K69A 2VVUA 1UTPA 4MNWA 7LPRA 1ANCA 4ZKRU 1AMHA 2XWBI 1AZZA 1N8OC 3D65E 1NFXA 5EGMA 1GHBG 1PQAA 2BD2A 3RUOA 3PLKA 3SJ8A 1TGTA 2XYAA 2BVRH 1NRRH 1Y5AT 2GDEH 1O5EH 3A8AA 2ZHDA 5EOKA 3SV2H 3GOVB 2F9OA 2AH4X 1JMOH 1ZPZA 1ZRKA 2Y80A 3RXKA 2ZECA 2BTCE 1CVWH 3E8LA 1VITH 1FI8A 3NUMA 4ZHLU 1J14A 3RXUA 5FCRA 1FONA 1K21H 2WUCA 3CS7A 3LH3A 1CBWB 1GJ6A 1OYTH 2FS8A 3LONA 1RXPA 1TBZH 3SUEA 3TH2H 1ELDE 1C1PA 3R0FA 3TK5A 1ZZZA 3LU9B 2VIPA 1GVLA 8GCHF 1C2DA 3Q3YA 3P8FA 1IQLA 2C4FH 3TJOA 3VB6A 3I78A 2ZQ2A 1FAKH 1TQ0B 4BAOB 3H5CB 1GI4A 3OU0A 1MU8B 3JZ1B 1G2MA 3IITA 5B6OA 4YT6H 1QRXA 1JRSA 5FPSA 1O5GH 5AFZH 3ZV9A 1G3BA 1MAXA 4X1PU 1OYQA 1SGCA 2BLQA 1PYTC 2Z9LA 3MNCA 4GAWA 4CBNA 3LGWA 1B5GH 4TWYA 2W3IA 1HGTH 1A5HA 2TBSA 1W10U 5EG4A 5A0AE 1NT1A 4AX9H 1D3QB 4KTSA 3SHAH 1QA0A 2EEKA 1ZGVA 3TIUA 3O8BA 1T4VH 4UFGH 2TGAA 2ZA5A 1KXBA 5ETXA 2R2WU 1YBWA 5JB9S 2QGRA 2Z9IA 4UE7H 2YNBA 1K28D 1QCPA 1RGQA 3BG4B 1GJDB 1S82A 3EQ0H 1ACBE 3ATLA 1PYTD 4MPUA 4RKOB 4FUDA 1HXFH 1ANDA 2G52A 3SJ9A 3PB1E 2FP7B 1BRBE 2G5VA 3GISB 2BXTH 2QXGA 1TNKA 3M3TA 1JRTA 3M5LA 3R3GB 1HAGE 4A92A 1O3OA 4AN7A 1MMJN 4CREA 1F7ZA 1DM4B 2PTCE 3RU4D 1P3EA 3U69H 3QX5H 3QO6A 1H9HE 2XC5A 3RM2H 4XBDA 1YPKH 2ZHEH 1GWAA 4MNVA 1VGCC 1HAIH 1DY9A 5E0JA 4ABIA 2GT8A 2ZC9H 2ZDMA 1LQDB 2NWNA 3FZZA 4B74A 3E91A 2CHAB 2R3YA 1BJUA 1OWHA 3MHWU 3OY5U 1MKXH 3DHKH 1G32B 1A4WH 1KXEA 1LHDH 1LKBA 2CF8H 1XM1A 3TNSA 1ELGA 1MQ5A 3T62A 4AFSA 2V0BA 1GDQA 2STAE 2O8MA 1EP6A 3MU4A 1D3PB 1BTYA 3SQEE 1ZPBA 3A80A 3F9FA 3ZZ6A 1OKXA 3H7TA 1ELAA 5ABWA 2C8ZB 5T6DA 2YOLA 3KIDU 1DITH 1KXFA 2FOFA 2Z94A 2QXIA 2VJ1A 1A61H 1HJ8A 1GI9B 3BF6H 1K1MA 1ZR0A 2BY6X 4D76A 1KXCA 1GBIA 1EJAA 2BDCA 2BY7X 2CGAA 3MWIU 1PPZA 2ZHWH 1QRZA 3E3TA 1FIZA 2FOHA 2FOCA 1O3BA 4DGJA 1QNJA 2AGIX 1QBOA 1EJNA 1CHGA 2BD8A 1MTUA 4X6PA 1RS0A 1WSSH 2BX4A 1K1PA 1OWJA 1KSNA 1W14U 2QC2A 3A82A 2ZGJA 4GVUA 1HCGA 1C2EA 1P2NA 3M5MA 4DURA 3QWCH 1C5UA 2FLBH 1GJ5H 2ZU2A 1YKTA 4X0WU 1P9SA 1MKWH 3ZYDA 1Y3WA 3M36A 1DLEA 2P3UB 1W2KH 2QY0B 9ESTA 4AORA 2GKVE 6LPRA 1D6RA 2A7CA 4ZXYH 2GCTB 2PLXA 3C27B 4NIWA 4ZHMU 1MUEB 2ESTE 3SO3A 1NFUA 1T32A 2BDYA 1LPGB 1NZQH 5C2ZA 2JETB 3UOUA 1GBDA 4A7IB 4FUGA 1C2KA 2FZZA 4U32A 1TWXB 5A8YA 2AIPA 1TA6A 2FODA 1ZSKA 4SGAE 3UWJH 2Y82A 2F9BH 1NRPH 2J95A 1IQIA 4NWLA 4MPWA 1FDPA 2BM2A 1DUAA 1LCYA 4FUBA 3HGNA 5LGOA 4ZHAA 1FN8A 3E0NB 3RXAA 2BB4A 1KLIH 3T27A 4CR9A 1SMFE 4OS7A 5FX6A 2DUCA 3SQHE 1QBNA 2RA0A 1H4WA 2TIOA 3U1JB 1FY1A 2TGPZ 4Y11E 2BDBA 3SJKA 1BTHH 5LPRA 1PQ5A 1SI5H 1BZXE 4H4FA 1LO6A 1TMBH 2A32A 3UQVA 1GI5A 1EPTA 1ZMJA 4OS4A 4D8NA 4D7FA 3M5NA 2FLRH 1SGYE 1G37A 3KNXA 1TB6H 5DPAA 1ANEA 1FJSA 1E34B 1O2NA 1XKAC 3LGIA 1DVAH 1O2HA 1L4ZA 1C2LA 4MNXA 4VGCB 1BTXA 1TOCB 1THPB 4CHAB 3TH3H 3TJNA 2VGCB 3ZZ9A 1UTOA 1O2ZA 2XW9A 4D9QA 1CA0C 5T3HA 1BT7A 1L1NA 1QB9A 3F6UH 2F9NA 1MKWK 5HGGA 3SV9A 1SFIA 5EU8A 3A7XA 2RA3A 1HIAA 1T8OA 4RN6A 1IQGA 1CU1A 1AKSA 4INHA 2ANKH 3SZNA 4MPVA 1O2XA 2FIRH 3UQOA 2I6QA 2CMYA 4DIHH 3ATKA 4CRGA 1AO5A 4RKJB 3LJJA 2M5TA 2D8WA 2HPPH 2XBWA 3MNBA 1BRCE 1LPKB 5L2YH 1EPTB 1MTNC 1DY8A 3BTFE 1QIXB 5EQQA 4XBCA 2XBYA 1BRUP 1ABJH 4YM9A 2F83A 3L3TA 2J34A 2PV9B 1O3EA 1G36A 1MCVA 2J9NA 3TU7H 1DWEH 1HFDA 4DOQA 1O0DH 1NROH 3NKKA 2P3FH 3VXFH 3TPIZ 1GBTA 4FVBA 1O2JA 4PROA 2W5EA 2W3KA 3LT3A 4NZLA 1TBRH 3SU5A 1C1MA 1EZQA 2HGTH 2OXSA 2ZFFH 3E16B 3GCOA 1C5ZB 1DWCH 4WJG2 1HIAB 1RIWB 3VPKA 5DK1A 4NFFA 3Q77A 4UD9H 4JZEH 3TLOA 1WU1A 1AKSB 4ZUHA 1AVXA 4MTBA 4IC6A 1UCYE