1WYKA

Sindbis virus capsid protein (114-264)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
152
structure length
152
Chain Sequence
MRLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTYTSEHPEGFYNWHHGAVQYSGGRFTIPRGVGGRGDSGRPIMDNSGRVVAIVLGGADEGTRTALSVVTWNSKGKTIKTTPEGTEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SINDBIS VIRUS CAPSID PROTEIN
publication title Probing the potential glycoprotein binding site of sindbis virus capsid protein with dioxane and model building.
pubmed doi rcsb
source organism Sindbis virus
molecule tags Viral protein, hydrolase
total genus 30
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1998-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wykA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wykA01
1XUGA 2Y6TA 2ILNA 1DY9A 3M37A 1KTSB 5AF9H 2G55A 1O2RA 4K69A 1BJUA 1O2IA 2UUYA 1A5IA 1O2LA 1ZPCA 4O3TA 1OWJA 1YPHC 1OYQA 4X8UH 1GHBG 2ZQ2A 3A7ZA 2HWLB 5J4SA 4YT7H 1IQMA 1ESAA 4DT7B 2OC0A 1G3EA 4GPGA 1SOTA 3ELAH 4Y0YE 1UCYK 1HAIH 2BX3A 1B7XB 1P09A 3ZV9A 2V35A 1QTFA 1A61H 1MBQA 1KXEA 3W94A 1PYTC 2GCTB 2BY9X 1BIOA 2JETC 2ZPRA 4ZKSU 1UTJA 4B71A 1P12E 1SGNE 3U8TH 1GL0E 1MMJN 3QWCH 2VIOA 1V2PT 3ZZ3A 1HLTH 3A86A 1DWBH 4K1TA 4RSPA 4AOQA 2ESTE 4H6SB 1EAUA 1GCDA 1TOCB 1GG6B 3Q3XA 2HOBA 2PHBA 1WUNH 1UK4A 1E38B 3U8OH 2YNAA 3VGCC 5DP6A 4GLYA 2SFAA 1A4WH 1GMDF 1QBNA 1GMHG 1C9PA 2H1UA 1SGEE 5C1YA 5JB8S 4FUIA 1Z1IA 3E1XB 5JBBS 5A09A 2FESH 4NSYA 1NRNH 3UR6A 3OYPA 4XBDA 2ZDLA 3CP7A 3A7YA 5EPNA 2A1DB 2P8OB 7GCHF 3EAJA 2GV7A 1GHAG 3UOUA 2F9OA 2WPLS 4CH2B 3T2NA 3QUMP 2C93B 1YCPK 2W3IA 5BRRE 4K8YA 1ZSJA 3QZQA 3QGJA 4JYUH 3DFLA 4I8JA 2FM2A 3BTWE 3GY5A 1YPGH 1V2RT 3CENA 2V3HH 5ESBA 4BAQB 2BOKA 4OS4A 2G4UA 1Q3XA 1P2MA 3SV8A 3P6ZB 3SU5A 1TFXA 1G3DA 1XKBC 1O3OA 1TNGA 2BD2A 2CF8H 4IGDA 1ZOMA 1GDNA 2P3UB 1O3BA 3VXFH 2QF3A 4X2XA 1MD8A 1TPAE 1H4WA 1UCYE 1C1OA 2ZHFH 1TPSA 1TPPA 1T8NA 2BZ6H 4U30A 4I7YH 9LPRA 1PJPA 5DO4H 2PKAA 3LGVA 1ZMJA 5JBAS 1XVOA 2F9UA 3GICB 5T3HA 4ZHAA 1YGCH 3F9GA 2XBWA 3HK6B 4B76A 1SFIA 1SGFA 5E0HA 2ZU2A 1KSNA 1SGFG 3SV9A 4DJZB 2GDEH 3RDZA 1HCGA 2A7CA 4WXIA 2GD4B 1TAWA 1O2OA 1O3PB 1MCVA 1Z6JH 1HJAC 4O9VA 3C27B 3ESTA 1F7ZA 4WY3A 3MU8A 4YT6H 2GCHG 3TU7H 1ANBA 1XMNB 1TQ0B 3SGAE 3F1SB 5ETXA 4WH8A 1A5GH 1OWHA 5EG4A 4JK5A 1ELVA 1OWDA 1WCZA 4HGCA 2HNTC 3LGYA 3DUXH 3TK5A 1AY6H 1TGTA 1AQ7A 1DVAH 1J9CH 1S0QA 3S9CA 2Z9IA 2QV1A 1C1MA 1HNEE 5DP9A 2VVUA 3PLBA 1TMTH 4JZIA 8ESTE 1Z8JB 9ESTA 1DE7H 6CHAC 1W0ZU 1AWFH 1V2LT 5DK1A 1WAYB 1KY9A 1S6FA 1ESTA 1G3CA 3UWJH 4U32A 2WUCA 3A8AA 3UPEA 3DD2H 2TGAA 1XUHA 1QIXB 2Z9KA 3ZZ5A 1L2EA 1P3EA 1QJ1B 1H9LB 8KME2 1J15A 3SUFA 5L6NH 1LQDB 1D3QB 1K1JA 4Y76A 3TJOA 2ZO3H 3K6YA 1NT1A 2K1QA 1A0JA 1O31A 1EATA 2XW9A 1EJAA 1O2ZA 3STJA 2ZDNA 1FN8A 1QBOA 4RKJB 4GVUA 1O30A 3OY5U 1LCYA 5DP8A 3TIUA 1BMLA 2ANMH 2PKAB 2UWLA 1GI3A 1FIWA 1O3HA 1OWIA 8LPRA 5C5OA 3KIDU 3GDUA 4BAHB 3TNSA 1FNIA 1AFEH 2AGIX 1OYTH 4LK4A 3ODFA 2NU1E 2BYAX 1W11U 4FU8A 1A46H 5B6OA 1NN6A 4NA9H 3MH5A 1QHRB 1ZZZA 2ZHQH 3SJIA 4ABEA 3BIVH 2R0KA 3NCLA 1YP9A 3KGPA 1L1GA 5H4IB 2B7DH 2A31A 1UVUH 2A32A 3KQBA 1GI4A 3NK8A 3RU4E 1EJMA 1C4V2 2GGVB 4OS7A 3RC6A 2TIOA 1QB6A 3KQEA 1HJ9A 2GCTC 3RXSA 1QQ4A 3BEIB 1CHGA 1PPFE 4JCNA 2ANYA 3RXEA 3TLOA 1GI6A 4AFQA 1S82A 3KL6A 2ZFFH 1T7CA 2ZTXA 3QTOH 1FZZA 2QAAA 3SZNA 2BD4A 1GJ4H 2VIQA 2RG3A 1B0EA 8GCHF 2ZWLH 2DE9A 4ISIH 4K1SA 1K22H 2F9BH 1P0SH 1IQHA 1P03A 1V6DA 2GZ7A 2NU2E 1AUJA 4WMFA 5A0AE 3SJ9A 1XUJA 1DSUA 5EXLA 3T27A 3RXMA 3NPSA 2QXHA 5FHTA 1QQUA 1KXBA 1X7AC 1UTNA 4ABIA 1SQAA 3BTDE 1UVTH 1OOKB 2VVVA 2H9TH 3FP7E 2O8WA 1O3AA 3IWMA 4GSOA 1JBUH 2ZNKH 1AUTC 1TWXB 4D76A 1LTOA 1BZXE 5ESTE 1MZAA 1LPKB 1NFUA 4B74A 3ENSB 1AHTH 2ODQA 1J17T 1MKXH 2FP7B 2VJ1A 1C1TA 1YPKH 2Y81A 3RMLH 1K1LA 1P10A 1C2KA 2G5NA 1O5GH 3SU2A 3MH6A 4YZUA 2Q6DA 1TRNA 2BZAA 4MQAA 1GHVH 3LH1A 3LGTA 1MAXA 1J14A 3F9HA 1CHOF 4Q2KA 2STAE 1NY22 5C20A 3S9AA 1LKAA 2BB4A 2ZG0H 3LONA 1JXPA 4FVBA 3ZZCA 4OS2A 1FJSA 1KYNA 2FS8A 1A0HB 1C9TA 2QY0B 2G81E 1DSTA 5FBIA 1N8OB 4MNWA 2ODPA 2XNIA 2SGAA 3F68H 1NRRH 1VITG 1C1SA 4GUXA 2BDYA 5EW2H 3RXDA 3SORA 4ZHMU 1RTKA 2TBSA 1ANCA 4O03A 4UFFH 2J94A 1OXGA 2A2XH 2PSXA 4UD9H 4Q80A 2FI3E 2WINI 4NIWA 3ZZ8A 2BQ6B 4CREA 1LVOA 4NIXA 3FP6E 3ZV8A 2BVSH 1S6HA 3AAUA 1GWAA 1B0FA 2VB0A 1P2QA 3M5LA 4I8HA 1AFQC 3S0NA 3TITA 2QN5T 2Y7XA 1DOJA 2AS9A 5FXLA 3TH3H 1FONA 1GL1A 3KEEA 4J1YA 1UCYH 3EA8A 1GPZA 3K65B 1GMCG 1IQGA 1RXPA 1WTGH 2VGCC 4RN6A 4LZ4B 1AB9B 1F2SE 5GDSH 3FFGA 2VNTA 5EU8A 4CRAA 2IOTA 3EGKH 4MPWA 5EPYA 1SFQB 4ZHLU 2ZFQH 1AGJA 1O2UA 4MVNA 2QXGA 1EP6A 2AIPA 2XC4A 3M5MA 2IN2A 4ISOA 3AW1A 3ZVEA 3TGKE 1T8LA 1SR5C 1UJ1A 3ATWA 4ZKRU 2UUKB 3U98H 2OINA 1HXEH 1ESBA 2CN0H 2C8WB 1YBWA 2DE8A 1QJ7B 2BVRH 4MPXA 3IG6B 2ZIQH 4UE7H 4O3UA 2Z94A 1F5LA 1H8IH 1GBTA 5T6DA 1HAOH 1EPTA 1G2LA 5GCHG 1GHBF 4ABAA 5F8XA 3GOVB 4AGJA 1PYTD 3STIA 1A3EH 4OGXA 1BMAA 3BV9B 3ZVCA 1OP2A 1O38A 1T32A 3E0NB 1TE0A 3RXUA 1IQKA 1PPGE 2UWOA 4WH6A 1W13U 4U2WA 1O32A 1ZJKA 3BG4C 2BM2A 3U1JB 1AE5A 2P3FH 2HLCA 1B5GH 1YLCA 2PUQH 4I8LA 4A5TS 2KAIA 1K9OE 1AO5A 3A7XA 1HRTH 1S5SA 1UMAH 1ZR0A 2EEKA 1O5CB 4ZKNU 1SGTA 3MH7A 2GP9B 3A87A 5E0JA 1C5OH 1HAPH 2C8YB 2SGQE 3SW2B 3PLKA 2P93A 3P8OA 4K5ZA 1SGRE 1FI8A 3AW0A 3PMAB 1FPCH 1W7XH 1UTLM 1G32B 2QA9E 1O2WA 3F9EA 3PMBB 1E36B 5LH8A 1MTNC 2JH5D 1O3NA 2ANKH 5EOKA 3Q00A 1YCPM 1DS2E 1Z8RA 1SB1H 1TYNA 3PMHB 3LIWA 3QX5H 4UONA 2VH6A 1GMHF 1OWEA 1S83A 3EA9A 3SNCA 1F0UA 1TNHA 1D4PB 1BTPA 3GISB 1ELAA 1FIZA 3MYWA 1Z1JA 4JYVH 3SQEE 2WUBA 1SGIB 3B9FH 2PTCE 1KXAA 2ZHDA 1C4U2 2ZU5A 4NSVA 4AB8A 3MHWU 5A8ZA 1GHAF 1PPBH 2CF9H 1C2DA 1FPHH 1RRKA 3SV7A 4X6MA 1GBFA 1UTQA 3EE0B 3GCOA 3S9BA 2BLOA 3P95A 4NWLA 4ZROA 1DICA 4A1TA 4FXGH 3KCGH 1TONA 5LPRA 1P2JA 2O9QA 1P01A 3SNDA 1C5RA 1EPTB 1L4ZA 2ZECA 1MD7A 1GI5A 1JRSA 1TA6A 1NC6A 1W0YH 3H7OA 2FMJA 1YLDA 1SGCA 4WXVA 2J2UA 1V2TT 2P94A 1JIMA 2BHGA 2ZP0H 1HYLA 2BQWB 1YKTA 2CHAC 1GBKA 3BEFB 2BY7X 1W3CA 3MH4A 3GYMA 1NROH 2FX4A 5L2ZH 4D7GA 5E8EH 1C2LA 3MWIU 2KAIB 2ALPA 3PYHA 2BDIA 4DCDA 1YPJH 3DT0H 1RD3B 2A4OA 1BRCE 2FI4E 3D49H 1QNJA 2J34A 1C5SA 2F83A 1YYY1 2M5TA 1BOQA 1EOLA 3BTGE 3LDXH 2CJIA 1EZUC 1BTZA 1N8OC 3RXBA 5C2ZA 1GJ7B 4IBLH 3MU1A 4X1SU 3UQOA 1EX3A 2FDAA 1BTYA 1EKBB 2WV4A 2BD8A 1F5KU 2WPKS 2HPQH 1IQJA 4ASHA 4B1TA 1NPMA 1O3JA 2QF0A 2GCHF 5JDUB 2BY6X 1OSSA 1RJXB 3VB3A 4CHAC 1O2VA 3ATMA 1C5ZB 1O5EH 4A1XA 1W8BH 2OQUA 1NU9A 4MNXA 4ESTE 4UFDH 1EZQA 1KIGH 2C4FH 4FUHA 3Q3KA 1CA0B 2THFB 3UWIA 4K2YA 2Z7FE 5FAHA 1QRWA 1SG8B 7LPRA 1FUJA 1GJ6A 1GI2A 1ARCA 1O2SA 2A45B 3PO1B 1OP8A 1VITH 1O0DH 2FOHA 1DUAA 1G30B 2V3OH 1S0RA 1FAXA 1O39A 2VH0A 3AASA 4ABFA 1O3KA 4LZ1H 1F0SA 4NIVA 4NWKA 4MNYA 2CGAA 1GHWH 3MO3A 2BLWA 2GMTC 2JKHA 1HDTH 4CBOA 3DHKH 2ZDAH 1SGDE 2A5IA 1LO6A 3MTYA 1P06A 1Y3VA 1BTXA 3A89A 3F6UH 1DFPA 1DLKB 4NZLA 2ODYB 1JMOH 1K1OA 1KTTB 3MI4A 1F0TA 1ZYOA 1WTHD 1JIRA 1AIXH 1O3DA 4GCHG 4I31A 3D62A 1Y59T 2ZC9H 1EB1H 1MU8B 1GHZA 2PR3A 1MCTA 1JOUB 1IQNA 5EQSA 2V0BA 1NO9H 4I8KA 1ORFA 5JYIA 1QBVH 1DWEH 2ZGCA 3NKKA 4NGAH 3SJKA 3I78A 2Y7ZA 4HTCH 3PV4A 3F9FA 3E90B 2FPZA 1QB9A 3VB5A 1TX7A 2BXUH 4IW4E 1V2KT 2NU4E 3LGUA 3M3TA 3M35A 2EC9H 1MTUA 4YESB 5EXNA 1QURH 4D9RA 4UEHH 3A8BA 2AEIH 1SLVB 1YPLH 4Y6DA 5JBCS 3KHVA 3QLPH 1THPB 4JZEH 1FY3A 1LKBA 4GHQA 1MTSA 4CR9A 1BITA 1U6QA 1AMHA 1THSH 1TMUH 4NFEA 2OUAA 2NU3E 2WV5A 1MAYA 1O5FH 3UY9A 4ZUHA 1QR3E 2R2MB 1BBRK 2RA0A 4YM9A 1IHSH 2ZGBH 1ZRKA 3NUMA 3E3TA 4FU9A 1D6RA 1H1BA 1TGNA 4KTSA 2FTLE 4B2BA 1DDJA 1P05A 1ZSLA 1HAVA 3FAOA 1NFXA 3RXPA 4WVPE 3SO3A 2G5VA 1BRAA 4HFPB 2FOEA 1TNKA 2Y80A 2ZCHP 4JMYA 3GCHC 1AVGH 1MU6B 2O8UA 2HPPH 2ZGHA 1GJ9B 1CBWC 1ELEE 1XM1A 1VR1H 3QDZB 2W7SA 3UUZA 7ESTE 2FWWA 5GIBA 1XUFA 1C5UA 3VXEH 3VB4A 1SGPE 1GJCB 4LOYH 2QXIA 4THNH 4FUFA 4RKOB 1RIWC 1AU8A 4X2WA 1TQ7B 4TYDA 2GKVE 4AFZA 3V0XA 3MNXA 3SV2H 2SNWA 1TX8A 4DIHH 5AHGH 2VWOA 3E91A 1EPTC 3SUDA 3M5NA 3JZ1B 5GJ4B 1TB6H 4VGCB 2W26A 1GI7B 1ETSH 4M7GA 2R2WU 3U9AH 3E16B 2QYIA 3MO6A 1TGSZ 4FUDA 2LNCA 4AFUA 3A85A 1PPCE 1EZSC 3RMMH 1DX5M 3RXVA 3TPIZ 4J2YB 1V2MT 3GCTG 1BBRE 1A0LA 3AAVA 3EQ0H 4AG2A 3BTTE 1XUKA 5GPIB 1O33A 3MNCA 4GAWA 1K1IA 3IITA 4XE4A 3RM0H 1C1RA 2HGTH 2CXVA 2TRMA 1HAVB 3P92A 4X6PA 1L1NA 5HGGA 3ZZ4A 3Q77A 1ZGIA 2OC8A 3A81A 1YPHE 5DP3A 1M9UA 5HYOA 2R3YA 1NESE 5HMAA 3SU0A 3RXRA 3HK3B 3O8DA 2BLQA 1GI0A 1GMCF 1CA0C 2F9VA 2WPMS 3SU3A 4R8TB 4YOJA 1NFYA 4NFFA 4BAOB 4CRFA 4Y0ZE 2G8TA 1GG6C 2PFEA 1P57B 4JK6A 1DLEA 1MUEB 4INHA 3T29A 1VZQH 1TMBH 2BDGA 1Y5UT 1OP0A 2ZGXH 3U8RH 1MTWA 1HAGE 2FLRH 3E6PH 4ZH8A 5AVDA 1VCWA 3P8NA 4AYVB 5ABWA 3KQCA 4ZKOU 1FDPA 1HAYB 4JZFH 2H2ZA 4DW2U 1TNIA 3TJVA 1E35B 2A7JA 2P8OC 4YOGA 1G37A 2GDDA 3RXTA 1C5NH 5GCHF 2Y5FA 3UFAA 3QTVH 4AYYB 3SI4H 2BMGB 3BEUA 4KTUA 4D9QA 1TABE 2OBOA 2RDLA 1L0ZA 2SGDE 3SJOA 4X1PU 2ZF0H 2OQ5A 1LHGH 1O5AB 2PKSB 2ZCKP 3RUOA 1YM0A 2ZFTA 2A5AA 3QGNB 2BQ7B 1NM6A 3URDA 2O8MA 2IJOB 4MDSA 3BG8A 3BTME 1P9SA 2TGDA 5EW1H 1G2MA 2SGFE 3SU1A 1VGCB 2UWPA 2BD9A 3C1KA 2H5CA 1CT4E 1C5QA 3TK9A 3ZZBA 4A1VA 5GWZA 1SHHB 4IC6A 4K60A 1GHYH 3RMNH 1P2IA 1BHXB 2GT7A 1C2FA 1E0FD 1V3XA 2STBE 5FPYA 3H7TA 1ETTH 2AERH 3K6ZA 3RXIA 4TPIZ 4QT8C 3ZZ6A 3M3SA 3ZZAA 3TGIE 3T28A 1SGQE 2ZPSA 1HIAA 1C2EA 1Z71A 1SHYA 2LPRA 2TGPZ 2FOGA 3TNTA 3RXQA 1C1UH 1DWCH 3SNBA 3M5OA 2PW8H 4X2VA 4A92A 4KTCA 4CR5A 5F6MA 1G9IE 2Z3DA 4XFQA 3OSYA 1XX9A 1W7GH 3S69A 2BY8X 5CMXH 1F92A 3MU5A 1CT0E 4FUCA 2CMYA 3PTNA 1V2UT 1AD8H 1V2OT 1GI8B 5I46H 5DP4A 2QXJA 4Y71A 3RC5A 5C3NA 3MFJA 1P02A 1TBRH 4FU7A 4Y10E 1GJBB 3DA9B 1LHCH 2W5EA 1C1NA 3RM2H 1DANH 1ELDE 3R0FA 2P95A 1WU1A 4SGAE 5C67A 3QZRA 5EQRA 3FP8E 3UIRA 1ZHRA 5I25A 1UHBA 5A8XA 2HNTE 3A8CA 1CSOE 3VGCB 4CRBA 1YPEH 5IDKA 2GV6A 3LC3A 2ZHWH 3PLPA 3RXOA 1T8MA 4JZDH 1C5LH 3SBKA 2ZDKA 3S7KB 1C4Y2 3GY7A 2QIQA 3RXAA 5DPAA 1AZZA 1BB0B 3D65E 1QY6A 1XXFA 3FZZA 4OS6A 1BMNH 3RC4A 2VIWA 1Y3XA 1HB0B 2Z9JA 1G3BA 3B8JA 3NXPA 3ITIA 4XOJA 1O3LA 3BN9A 3TK6A 2I6SA 1GBEA 3WY8A 2G4TA 2VWMA 1C2MA 1E34B 1BJVA 4ZXYH 4AORA 2BXTH 3R3GB 2FX6A 4UDWH 1HXFH 1HIAB 1EOJA 3SUEA 5TCAA 6LPRA 2ZFSA 3SN8A 2FS9A 1KXFA 1O2NA 1WBGB 1ELFA 1GBBA 1ZHPA 2F9NA 3QO6A 2RCEA 1ZTJA 3A8DA 4BTUB 2F3CE 2B0FA 5DP5A 4INLA 1VJAU 1VCQA 1HUTH 1HFDA 4AFSA 1NRQH 1UTPA 3PMJA 4Y79A 1C1VH 1ZTKA 3NWUA 1WQSA 6GCHG 1CHOG 1QCPA 3M7TA 5E0GA 3O8BA 2GVFA 1PQAA 3I77A 4X6OA 1ABIH 4X1QU 1IHTH 4PROA 2FI5E 4I32A 3AVZA 1QA7A 4CRCA 2A4RA 1SC8U 1QL7A 2UUJB 1ETRH 2BY5X 4AN7A 1BBRH 1OKXA 4TY6A 4NA7A 3KF2A 1HJAB 4IMQA 1FLEE 1UHBB 1GJ8B 1KXDA 1KLIH 3QN7A 4GCHF 4DY7B 3RMOH 1AE8H 1ID5H 1KXCA 1TLDA 4X6NA 4BTIB 2BTCE 1GJDB 1ZHMA 5L30H 1DXWA 2H9HA 1HGTH 3O8RA 1XVMA 2BD7A 4WMDA 2HALA 2XBXA 1Y3YA 1AN1E 5SGAE 2Z3EA 1EP5A 1O3GA 2BOHB 4MTBA 1IQEA 1UTMA 3LC5A 5FBEA 1LHFH 3P8GA 3VEQB 2Q6FA 1C5PA 2ZI2H 6CHAB 4MPVA 1C2JA 1SLUB 3LGIA 4CH8B 1HJ8A 2B5TB 1TALA 3W95A 1IQIA 4AZ2B 3PROA 2VIVA 1WOFA 1S81A 2PKSC 1K28D 3M36A 2FOFA 1K2I1 3ATLA 3VFEA 4FUBA 3TVJB 3ZYDA 1CU1A 2OCVB 1WV7H 1UVSH 1HPGA 1EQ9A 4ISLA 4Y11E 1CT2E 1P3CA 1BTHH 1QFKH 2FOAA 3I29A 2PV9B 1MBMA 3LU9B 1D3PB 2BD5A 1TBQH 3M7QA 3UR9A 1V2ST 4CBNA 4BTTB 3ZVBA 1P2KA 2ZCLP 1P2OA 1E37B 1FY5A 5BPEA 1O36A 4AG1A 2OD3B 4ZAEA 1GHXH 1NS3A 4SGBE 4E7RG 3GY2A 1SBWA 3SJ8A 2FEQH 1D6WA 1FMGA 5JB9S 1BRUP 3RLYH 3N7OA 5DGJA 3TJUA 1PFXC 1MH0A 1TNJA 2D8WA 3SU6A 3BTFE 4I8GA 1O3IA 1PPEE 3FANA 2BDBA 3RXKA 1W2KH 3JZ2B 1DPOA 2GZ8A 1T31A 4Y7AA 2TGTA 2EI6A 2NWNA 4H42U 1HAXB 4BXSA 1HBTH 4A6LA 2XBYA 5LPEA 4LXBH 1HAZB 1S84A 3HATH 2ANWA 2OBQA 2ZEBA 1AB9C 4XBCA 2FZZA 3NZIA 1ZLRA 4MG3A 5C5NA 1RFNA 2BVXH 4AX9H 2R0LA 1XXDA 4ABDA 2FYQA 2J4IA 4NIYA 2BDAA 4TY7A 2AMDA 4B2CA 4MLFB 3OX7U 1KLJH 1BUIA 1VCPA 5T6FA 3FZDA 1P04A 1ABJH 3MNSA 1O2YA 1GJ5H 1ANDA 4ZXXH 5K7RA 1EAWA 1GBMA 1DM4B 1BDAA 2H9EH 1OWKA 1BQYA 1FV9A 1Z7KA 3A84A 4AB9A 2PLXA 3L3TA 4X1RU 3O8CA 1OPHB 1T8OA 3LPRA 4X8VH 1C1PA 2OC7A 5E2PA 1O34A 1O3MA 3GCTF 3ODDA 3SHAH 1SI5H 2ZDMA 1DITH 2ZFPH 3A7VA 3OTJE 1MQ6A 3UTUH 3V13A 1LPZB 1RTLA 4DURA 3ZVFA 2H6MA 3T5FH 5A0BA 2WYJA 5TCCA 1Q31A 1PQ5A 1SGYE 2FOCA 1GDUA 2ZU4A 1A7SA 1O3CA 1ZRBA 1TNLA 4DG4A 1ACBE 1O2GH 1BHXF 1TX6A 1BCUH 1O2JA 1QB1A 5AFYH 5K0HA 1C1WH 1ELCA 2AYWA 3LKWA 3T25A 1IAUA 3SI3H 1UTKA 3FVFB 3PTBA 3ZZDA 5A2MH 1F5RA 4Q7YA 1ELTA 1UK3A 2Q6GA 2W7UA 2JH0D 4D8NA 3TGJE 3UQVA 5AFZH 2FOMB 3UOPA 3EYDA 5F8ZA 2ZA5A 4OS5A 1D3DB 2P16A 3SOSA 1A2CH 4BNRA 4E05H 1CE5A 1GGDB 3TH4H 4NZQA 1CVWH 5LPFA 1SSXA 4BOHA 1N1LA 4X1NU 2ZU3A 4NA8A 4R0IA 2VIDA 1EZXC 3CS0A 2OTVA 3A7TA 1TIOA 1IOEA 3RXHA 1TPOA 2XCFA 1MZDA 1EAIA 1AFQB 2ZFRH 5F8TA 1ZMLA 3LJOA 3TH2H 1C2HA 5CHAB 3ZYEA 3MO9A 1GBDA 2C90B 3GY3A 1EASA 3E0PB 3GY8A 2WPIS 2HVXA 3PWBA 3HKIB 1RTFB 2FTMA 2VGCB 4DGJA 1N6XA 1A3BH 1MKWH 2AFQB 1XUIA 2ZU1A 1FAKH 4ABHA 2FODA 4X8SH 4A7IB 4B73A 1NRPH 1K1PA 1BTWA 4B2AA 4WWYA 3BF6H 1JWTA 4ABBA 2BD3A 2B9LA 1GMDG 1SLWB 3UNSA 4K1EA 3MOCA 5FCRA 3MNBA 4YLQH 1PPHE 5T6GA 3M3VA 2FIRH 2NU0E 3B23B 3Q3YA 3RP2A 1LQEA 4F49A 3MU0A 5CE1A 1O5BB 1JRTA 1VITF 1TA2A 1O2KA 4ABJA 1FN6A 2FXRA 2VU8E 7GCHG 2A2QH 3VB6A 1ZGVA 2SNVA 2XWAA 2VWNA 2BDHA 1AVWA 1LVBA 4Z0KA 4BXWA 3UREA 1GI1A 2AMPA 1C2GA 2ZGJA 4DIIH 3BTHE 3SHCH 4OS1A 4Q7ZA 1Y3UA 1UK2A 4BAKB 2GZ9A 4INKA 2XRCA 1PQ8A 1CGHA 4YO9A 4IN2A 1V2JT 2GTBA 3BG4B 5EQQA 3PB1E 3KQDA 1T4UH 2WPJS 2AGGX 5C1UA 3V7TA 2C8ZB 1LHDH 1IQLA 1QA0A 2Y82A 3T26A 3VPKA 1EXFA 2AMQA 4GHTA 3OU0A 1FQ3A 2QGRA 1C5VA 1QRZA 1DWDH 1KDQA 3MMGA 2WYGA 2XBVA 5DJ7A 1GBLA 1H8DH 2HRVA 3PO1C 5TJXA 3SUGA 1OX1A 2Q1JA 5F03A 1C5WB 4HZHA 1ELBA 2EI7A 2VIPA 3SGQE 3V3MA 3GDVA 3DFJA 4BAMB 4JYTA 3TJNA 4O97A 2P3TB 1PQ7A 1INCA 1QL8A 4UFEH 1AVXA 2D2DA 1MTNB 2SGPE 1TRMA 4IN1A 2A4QA 5A8YA 4FUGA 2I6QA 3GY4A 1ZPBA 3ZZ9A 4U01A 5JPMH 1TBZH 1O2MA 2GX4A 3A82A 2FO9A 1P9UA 1GVZA 2XXLA 1SQTA 4K8BA 2FLBH 1GI9B 2ZTZA 1G36A 2HNTF 3A7WA 2QCYA 1LVYA 2XC0A 5EXMA 2ULLA 3SQHE 1CGJE 2PGQB 2PSYA 2R3UA 3ZZ7A 2VVCA 4TWYA 2CV3A 1LMWB 4KP0A 1C5YB 1DT2A 1ZMNA 4UFGH 5GXPA 4XDEA 2P59A 4Y8ZA 3PWCA 3QK1A 1WSSH 1NRSH 4ISNA 3ATKA 5E2OA 5L2YH 2PUXB 4X8TH 5J4QA 1HAHH 4DOQA 3U69H 2ZPQA 4Y8YA 2QC2A 2XYAA 1O2XA 1P2NA 2A4GA 4D7FA 2ZKSA 1FY4A 2ZDVH 3SGBE 3BTQE 1GCTB 2A7HA 2R9PA 4FUEA 5IYTA 3T62A 1NTPA 4WJG2 3URCA 2CHAB 1IQFA 1F0RA 1SPJA 1P8VC 1C5TA 1ARBA 1MQ5A 2J92A 1V2NT 1PPZA 1GJAB 3PM3A 2O8LA 3ATIA 5FCKA 1CA8B 2ZHEH 1V2VT 1A1RA 1Q2WA 1D3TB 6GCHF 3RXJA 4CRDA 1KDQB 2SGEE 3Q76A 2G00A 5JBTA 3RU4T 1LPGB 1D9IA 4YTAA 1TOMH 1CO7E 2OXSA 2UUFB 3OY6U 1SQOA 4ISHH 3SNEA 2PGBB 4MNVA 1UTOA 2ZTYA 4ABGA 4H6TA 4FUJA 3SV6A 3SU4A 2Z3CA 1O35A 4XBBA 5HXFA 1MKWK 1YPMH 1GGDC 3SNAA 2EA3A 4CHAB 1UVOA 1O37A 2JETB 5A0CA 2V6NA 3BTEE 5HM2A 2PWXA 1YC0A 1YF4A 4KGAA 2H5DA 2DUCA 1BT7A 2WPHS 3L33A 3HKJB 5PTPA 3ZVDA 5G4BA 4Z6AH 2GT8A 4X0WU 1CGIE 2OP9A 4I33A 2XWBI 5CHAC 2Y5HA 3RXFA 1GVKB 3P8FA 1L1JA 2AIQA 1FY1A 3A80A 2EI8A 1K1NA 1SVPA 2Z9LA 4K3JA 1DXPA 3E8LA 3UNRA 5DP7A 4ZMAH 1RS0A 4MPUA 3HGPA 1C2IA 1O5DH 2ALVA 3BIUH 1GBCA 1Z8IB 4HI3A 2AH4X 1BTUA 1KLTA 2GMTB 1THRH 3RXCA 4VGCC 8GCHG 1Z8GA 1S85A 1GDQA 4NG9H 1ZPZA 2BX4A 3RU4D 1P11E 1GBJA 1N6YA 2O8TA 3GY6A 1GBHA 4FVDA 4TWWA 4E06H 7KMEH 4Y8XA 1EB2A 3HGNA 1QJ6B 3UNQA 1LHEH 1SLXB 1UVPA 3LJJA 4Y7BA 4YLUA 3P17H 5HM9A 2J95A 4TPYA 1O2QA 4IC5A 1O3EA 3CS7A 2F91A 2J38A 3LOXA 4IS5A 2D26C 3K2UA 4XSKU 1FY8E 4WF8A 6ESTA 1GBIA 3VB7A 1O2PA 4E7NA 4WMEA 3KNXA 3ZVGA 1MTVA 4B75A 3V12A 3GDSA 1ZTLA 1UO6A 1TGCA 2JH6D 3LH3A 1O3FA 2A5KA 2YOLA 1AKSA 1FXYA 3BTKE 1SMFE 1AZ8A 1W12U 1W14U 4Q7XA 2B8OH 1V2QT 3D23A 2VINA 1EJNA 5FPSA 2A0QB 1O2HA 2ZQ1A 1NFWA 1O2TA 2PTNA 1YCPH 3ZVAA 3LT3A 4BANB 1LDTT 2FYRA 1QL9A 2Z6BD 3M61U 2BDCA 3LGWA 1SOZA 5FPTA 2Z9GA 1K21H 1T4VH 4DVAU 5LGOA 4NCYA 1ANEA 1BRBE 1NZQH 3MU4A 3BSQA 1W10U 1TRYA 4AGKA 3U1IB 3KN2A 4KELA 3EA7A 4IMZA 1K1MA 1C5XB 3RXGA 2C8XB 2OC1A 4KKDA 1TGBA 2TPIZ 1NU7B 4F4OC 4H4FA 1CQQA 2Y5GA 1AWHB 3GYLB 3RXLA 2J9NA 5EGMA 1GVLA 2C3SA 1L4DA 3A88A 5DKMA 3RLWH 1LVMA 3GCHB 1J16A 5C1XA 3HPTB 2XCNA 3P70B 1DUEA 1Y5BT 1CBWB 2RA3A 2YNBA 5FX6A 1BMMH 2F9PA 2D1JA 1H9IE 3A83A 2FOBA 1SL3A 1MKXK 1J8AA 2AGEX 1QGFA 5EODA 1Z6EA 5FX5A 1A5HA 4X2YA 4YOIA 3EDXB 1Y5AT 1OS8A 1H9HE 1RIWB 4JZ1A 3S7HB 1WQVH 3GCNA 3M7UA 2VWLA 2BLVA 5DG6A 1Y3WA 2G51A 2IPHA 1AI8H 1RGQA 1XKAC 3G01A 3H5CB 4OGYA 2W3KA 3L6PA 1DY8A 4CRGA 2OLGA 2XC5A 2ASUB 1AKSB 1V2WT 1QRXA 1VJ9U 1GCTC 1EUFA 1BA8B 3K9XB 1C5MD 2ZZUH 2XTTB 1VGCC 1GBAA 1HV7A 1Y8TA 1ZSKA 2G52A 1ELGA 1C1QA 1ZJDA 1EAXA 1WYKA
chains in the Genus database with same CATH superfamily
1XUGA 2Y6TA 2ILNA 1DY9A 3M37A 1KTSB 4OM9A 5AF9H 2G55A 1O2RA 4K69A 1BJUA 1O2IA 2UUYA 1A5IA 1O2LA 1ZPCA 4O3TA 1OWJA 1YPHC 2LP6A 1MABB 1OYQA 4X8UH 1GHBG 2ZQ2A 3A7ZA 2HWLB 5J4SA 4YT7H 1IQMA 1ESAA 4DT7B 2OC0A 1G3EA 4GPGA 1SOTA 3ELAH 4Y0YE 1UCYK 1HAIH 2BX3A 4B6FA 1B7XB 1P09A 3ZV9A 2V35A 1QTFA 1A61H 1MBQA 1KXEA 3W94A 1PYTC 2GCTB 5EJ1A 2BY9X 1BIOA 2JETC 2ZPRA 4ZKSU 1UTJA 5KGOA 4B71A 1WXRA 1P12E 1SGNE 3U8TH 1GL0E 1MMJN 3QWCH 2VIOA 1V2PT 3ZZ3A 1HLTH 3A86A 1DWBH 4K1TA 4RSPA 4AOQA 2ESTE 4H6SB 1EAUA 1GCDA 1TOCB 1GG6B 3Q3XA 2QF5A 2HOBA 2PHBA 1WUNH 1UK4A 1E38B 3U8OH 2YNAA 3VGCC 1VKYA 5DP6A 4GLYA 2SFAA 1A4WH 1GMDF 1QBNA 1GMHG 1C9PA 2H1UA 1SGEE 5C1YA 5JB8S 4FUIA 1Z1IA 3E1XB 5JBBS 5A09A 2FESH 4NSYA 1NRNH 3UR6A 3OYPA 4XBDA 2QE7D 2ZDLA 3CP7A 3A7YA 5EPNA 2A1DB 2P8OB 7GCHF 3EAJA 2GV7A 1GHAG 3UOUA 2F9OA 2XNDD 2WPLS 4CH2B 3T2NA 3QUMP 3WWFA 2C93B 1YCPK 2W3IA 5BRRE 4K8YA 1ZSJA 3QZQA 3UAIC 3QGJA 4JYUH 3DFLA 4I8JA 2FM2A 4FOUC 3BTWE 3GY5A 1YPGH 1V2RT 3CENA 2V3HH 3KYGA 2WV9A 5ESBA 4BAQB 2BOKA 4OS4A 2G4UA 1Q3XA 1P2MA 3SV8A 3P6ZB 3SU5A 1TFXA 1YY3A 3PV5A 1G3DA 1XKBC 1O3OA 2CF8H 1TNGA 2BD2A 4IGDA 1ZOMA 1GDNA 2P3UB 1O3BA 3VXFH 2QF3A 4X2XA 1MD8A 1TPAE 1H4WA 1UCYE 2HVYB 1C1OA 2ZHFH 1TPSA 1TPPA 1T8NA 2BZ6H 4U30A 4I7YH 4P00A 9LPRA 1PJPA 5DO4H 2PKAA 3LGVA 1ZMJA 5JBAS 3NRLA 1XVOA 2F9UA 1SQRA 3GICB 5T3HA 4ZHAA 1YGCH 3F9GA 2XBWA 3HK6B 4B76A 1SFIA 1SGFA 5E0HA 2ZU2A 1KSNA 1SGFG 3SV9A 4DJZB 2GDEH 3RDZA 1HCGA 2A7CA 4WXIA 2GD4B 1TAWA 2KR7A 1O2OA 1O3PB 1MCVA 1Z6JH 1KMHB 1HJAC 2W6ID 2EQNA 4O9VA 3C27B 3ESTA 5CDFE 1F7ZA 4WY3A 3MU8A 4YT6H 2GCHG 3TU7H 1ANBA 1XMNB 1TQ0B 3SGAE 3F1SB 5ETXA 4WH8A 1A5GH 1OWHA 5EG4A 1WDIA 4JK5A 1ELVA 1OWDA 1WCZA 4HGCA 2HNTC 3LGYA 3DUXH 3TK5A 1AY6H 1TGTA 1AQ7A 1DVAH 1J9CH 1S0QA 3S9CA 2Z9IA 2QV1A 1C1MA 1HNEE 5DP9A 2VVUA 3PLBA 1TMTH 4JZIA 8ESTE 1Z8JB 3VG8A 9ESTA 1DE7H 6CHAC 1W0ZU 3W1EA 1AWFH 1V2LT 5DK1A 1WAYB 1KY9A 1S6FA 1ESTA 1G3CA 3UWJH 4U32A 2WUCA 3A8AA 3UPEA 3DD2H 2TGAA 1XUHA 1QIXB 2Z9KA 3ZZ5A 1L2EA 1P3EA 1QJ1B 1H9LB 3WWBA 1J15A 8KME2 3SUFA 5L6NH 1LQDB 3DSOA 1D3QB 1K1JA 4Y76A 3TJOA 2ZO3H 3K6YA 1NT1A 2L74A 2K1QA 1A0JA 1O31A 1EATA 2XW9A 1EJAA 1O2ZA 3STJA 2ZDNA 1FN8A 1QBOA 4RKJB 4GVUA 1O30A 3OY5U 1LCYA 5DP8A 3TIUA 1BMLA 2ANMH 2PKAB 2UWLA 1GI3A 1FIWA 1O3HA 1OWIA 8LPRA 5C5OA 3KIDU 3GDUA 4BAHB 3FO8D 3TNSA 1FNIA 1AFEH 4ASUD 2AGIX 1OYTH 4LK4A 3ODFA 2NU1E 2BYAX 1W11U 4FU8A 1A46H 5B6OA 1NN6A 4NA9H 3MH5A 1SKYE 3U28C 1QHRB 1ZZZA 2ZHQH 3SJIA 4ABEA 2WSSD 3BIVH 2R0KA 3NCLA 1YP9A 3KGPA 1L1GA 5H4IB 2B7DH 2A31A 1UVUH 2A32A 3KQBA 1GI4A 3NK8A 3RU4E 1EJMA 1C4V2 2GGVB 4OS7A 3RC6A 2TIOA 1QB6A 3KQEA 1HJ9A 2GCTC 3RXSA 1QQ4A 3BEIB 1CHGA 1PPFE 2J5UA 4JCNA 2ANYA 3RXEA 3TLOA 1GI6A 4AFQA 1S82A 3KL6A 2ZFFH 1T7CA 2ZTXA 3QTOH 1FZZA 2QAAA 3SZNA 2BD4A 1GJ4H 5DSFA 2VIQA 2RG3A 1B0EA 8GCHF 2ZWLH 2DE9A 3FOAA 4ISIH 4K1SA 1K22H 2F9BH 1P0SH 1IQHA 1P03A 1V6DA 2V3MA 2GZ7A 2NU2E 1AUJA 4WMFA 5A0AE 3SJ9A 1XUJA 1DSUA 5EXLA 3T27A 3RXMA 3NPSA 2QXHA 5FHTA 1QQUA 1KXBA 1X7AC 1UTNA 4ABIA 1SQAA 3BTDE 1UVTH 1OOKB 2VVVA 2H9TH 3FP7E 2O8WA 1O3AA 3IWMA 4GSOA 1JBUH 2ZNKH 1AUTC 1TWXB 4D76A 1LTOA 1BZXE 5ESTE 1MZAA 1LPKB 1NBME 1NFUA 4B74A 3ENSB 1AHTH 2ODQA 1J17T 1MKXH 2FP7B 2VJ1A 1C1TA 1YPKH 2Y81A 5KECA 3RMLH 1K1LA 1P10A 1C2KA 2G5NA 5EIYA 1O5GH 3SU2A 3MH6A 4YZUA 2Q6DA 1TRNA 2BZAA 4MQAA 1GHVH 3LH1A 3LGTA 1MAXA 1J14A 3F9HA 1CHOF 4Q2KA 2STAE 1NY22 5IK2D 3OAAD 5C20A 4M9FA 1LKAA 2BB4A 2ZG0H 3S9AA 3LONA 1JXPA 4FVBA 5EJLA 3ZZCA 4OS2A 1FJSA 1KYNA 2FS8A 1A0HB 1C9TA 2QY0B 2G81E 1DSTA 5FBIA 1N8OB 4MNWA 2ODPA 2XNIA 2SGAA 3F68H 1NRRH 1VITG 1C1SA 4GUXA 2BDYA 5EW2H 3RXDA 3SORA 4ZHMU 1RTKA 2TBSA 1ANCA 4O03A 4UFFH 2J94A 1OXGA 2A2XH 2KFWA 2PSXA 4UD9H 4Q80A 2FI3E 2WINI 4NIWA 4RT1A 3ZZ8A 2BQ6B 4CREA 1LVOA 4NIXA 3FP6E 3ZV8A 2BVSH 1S6HA 3AAUA 1GWAA 1B0FA 2VB0A 1P2QA 3M5LA 3N7DA 4I8HA 1AFQC 3S0NA 3TITA 2QN5T 2Y7XA 1DOJA 2AS9A 5FXLA 3TH3H 1FONA 1GL1A 3KEEA 5T1VA 4J1YA 1UCYH 3FKSD 3EA8A 1GPZA 3K65B 1GMCG 1IQGA 1RXPA 1WTGH 2VGCC 4RN6A 4LZ4B 1AB9B 1F2SE 5GDSH 3FFGA 2VNTA 5EU8A 4CRAA 2IOTA 3EGKH 4MPWA 5EPYA 1SFQB 4ZHLU 2ZFQH 1AGJA 1O2UA 4MVNA 2QXGA 1EP6A 3UB0A 2AIPA 2XC4A 3M5MA 2IN2A 4ISOA 3F3BA 3AW1A 3ZVEA 3TGKE 1T8LA 1SR5C 1UJ1A 3ATWA 4ZKRU 2UUKB 3U98H 2OINA 1HXEH 1ESBA 2CN0H 2C8WB 1YBWA 2XOKD 2DE8A 1QJ7B 2BVRH 4MPXA 3IG6B 2ZIQH 4UE7H 4O3UA 2Z94A 1F5LA 1H8IH 1GBTA 5T6DA 1HAOH 4F48B 1EPTA 1G2LA 5GCHG 1GHBF 4ABAA 5F8XA 3GOVB 4AGJA 1PYTD 3STIA 1A3EH 3DSPA 4OGXA 5HIYA 1BMAA 3BV9B 3ZVCA 1OP2A 1O38A 1T32A 3E0NB 1TE0A 3RXUA 1IQKA 1PPGE 2UWOA 4WH6A 1W13U 4U2WA 1O32A 1ZJKA 3BG4C 2BM2A 3U1JB 1AE5A 2P3FH 2HLCA 1B5GH 1YLCA 2PUQH 4I8LA 4A5TS 3H09A 2KAIA 1K9OE 1AO5A 3A7XA 1HRTH 1S5SA 1UMAH 1ZR0A 2EEKA 1O5CB 4ZKNU 1SGTA 3MH7A 2GP9B 3A87A 5E0JA 1C5OH 1HAPH 2C8YB 2SGQE 3SW2B 3PLKA 2P93A 3P8OA 4K5ZA 1SGRE 1FI8A 3AW0A 3PMAB 1FPCH 1W7XH 1UTLM 1G32B 2QA9E 1O2WA 3F9EA 3PMBB 1E36B 5LH8A 1YWUA 1MTNC 2JH5D 1O3NA 2ANKH 5EOKA 3Q00A 1UW7A 1YCPM 1DS2E 1Z8RA 1SB1H 1TYNA 3PMHB 3LIWA 3QX5H 4UONA 2VH6A 1GMHF 1OWEA 1S83A 3EA9A 3SNCA 1F0UA 1TNHA 1D4PB 1BTPA 3GISB 1ELAA 1FIZA 2J98A 3MYWA 1Z1JA 4JYVH 3SQEE 2WUBA 1SGIB 3B9FH 2PTCE 1KXAA 2ZHDA 1C4U2 2ZU5A 4NSVA 1E79D 1BMFD 4AB8A 3MHWU 5A8ZA 1GHAF 1E1RD 4TSFD 1PPBH 2CF9H 1C2DA 1FPHH 1RRKA 3SV7A 4X6MA 1GBFA 1UTQA 5DN6D 3EE0B 3GCOA 3S9BA 2BLOA 3P95A 4NWLA 4ZROA 1DICA 4A1TA 4FXGH 3KCGH 1TONA 5LPRA 2EY4C 1P2JA 2O9QA 1P01A 3SNDA 1C5RA 1EPTB 1L4ZA 2ZECA 1MD7A 1GI5A 1JRSA 1TA6A 1NC6A 1W0YH 3H7OA 2FMJA 1YLDA 1SGCA 4WXVA 2J2UA 2K8IA 1V2TT 2P94A 2YMSC 1JIMA 2BHGA 2ZP0H 1HYLA 2BQWB 1YKTA 2CHAC 1GBKA 3BEFB 2BY7X 3PRDA 2PP6A 1W3CA 3MH4A 3GYMA 1NROH 2FX4A 5L2ZH 4D7GA 5E8EH 3SYJA 4RT0A 1C2LA 3MWIU 2KAIB 2ALPA 3PYHA 2BDIA 4DCDA 1YPJH 3DT0H 1RD3B 2A4OA 1BRCE 2FI4E 3D49H 1QNJA 2J34A 1C5SA 2F83A 1YYY1 4HG6A 2M5TA 1BOQA 1EOLA 3BTGE 3LDXH 2CJIA 1EZUC 1BTZA 1N8OC 3RXBA 5C2ZA 1GJ7B 4IBLH 3MU1A 4X1SU 3UQOA 1EX3A 2FDAA 1BTYA 1EKBB 2WV4A 2BD8A 1F5KU 2WPKS 2HPQH 1IQJA 4ASHA 4YXWD 1W0JD 4B1TA 1NPMA 1O3JA 2QF0A 5C0UA 2GCHF 5JDUB 2BY6X 1OSSA 1RJXB 3VB3A 4CHAC 1O2VA 3ATMA 1C5ZB 1O5EH 4A1XA 1W8BH 2OQUA 1NU9A 4MNXA 4ESTE 4UFDH 1EZQA 1KIGH 2C4FH 2J98B 4FUHA 3Q3KA 1CA0B 2THFB 3UWIA 4K2YA 2Z7FE 5FAHA 1QRWA 1SG8B 7LPRA 2KCOA 1FUJA 4I86A 1GJ6A 1GI2A 1ARCA 1O2SA 2A45B 3PO1B 1OP8A 1VITH 1O0DH 2FOHA 1DUAA 1G30B 2V3OH 1S0RA 1FAXA 1O39A 3F2FA 2VH0A 3AASA 4ABFA 1O3KA 4LZ1H 1F0SA 4NIVA 4NWKA 4MNYA 2CGAA 1GHWH 3MO3A 2BLWA 2GMTC 2JKHA 1HDTH 4CBOA 3DHKH 2ZDAH 1SGDE 2A5IA 1LO6A 3MTYA 1P06A 1Y3VA 1BTXA 3A89A 3F6UH 1DFPA 1DLKB 4NZLA 2ODYB 1JMOH 1K1OA 1KTTB 3MI4A 1F0TA 1ZYOA 1WTHD 1JIRA 1AIXH 1O3DA 4GCHG 4I31A 3D62A 1Y59T 2ZC9H 1EB1H 1MU8B 1GHZA 2PR3A 1MCTA 1JOUB 1IQNA 5EQSA 2V0BA 1NO9H 4I8KA 1ORFA 5JYIA 1QBVH 1DWEH 2ZGCA 3NKKA 4NGAH 3SJKA 3I78A 2Y7ZA 4HTCH 3PV4A 4RI0A 3F9FA 3E90B 2FPZA 1QB9A 3VB5A 1TX7A 2BXUH 4IW4E 1V2KT 2NU4E 3LGUA 3M3TA 3M35A 2EC9H 1MTUA 4YESB 5EXNA 1QURH 4D9RA 4UEHH 3A8BA 2AEIH 1SLVB 1YPLH 4Y6DA 5JBCS 3KHVA 3QLPH 1THPB 4JZEH 1FY3A 1LKBA 4GHQA 1MTSA 4CR9A 1BITA 1U6QA 1AMHA 1THSH 1TMUH 4NFEA 2OUAA 2NU3E 2WV5A 1MAYA 1O5FH 3UY9A 4ZUHA 1QR3E 2R2MB 1BBRK 2RA0A 4YM9A 1IHSH 2ZGBH 1ZRKA 3NUMA 3E3TA 4FU9A 1D6RA 1H1BA 1TGNA 4KTSA 2FTLE 4B2BA 1DDJA 1P05A 1ZSLA 1HAVA 3FAOA 1NFXA 3RXPA 4WVPE 3SO3A 4Z1MD 2G5VA 1BRAA 2WZQA 4HFPB 2FOEA 1TNKA 2Y80A 2ZCHP 4JMYA 3GCHC 4ZCNA 1AVGH 1MU6B 2O8UA 2HPPH 2ZGHA 1GJ9B 1CBWC 1ELEE 1XM1A 1VR1H 3QDZB 2W7SA 3UUZA 7ESTE 2FWWA 5GIBA 5C17A 1XUFA 5F53A 1C5UA 3VXEH 3VB4A 1SGPE 1GJCB 4LOYH 2QXIA 4THNH 4FUFA 4RKOB 1RIWC 1AU8A 4X2WA 1TQ7B 4TYDA 4P02A 2GKVE 4AFZA 3V0XA 3OEHD 3MNXA 3SV2H 2SNWA 1TX8A 4DIHH 5AHGH 2VWOA 3E91A 1EPTC 3SUDA 3M5NA 3JZ1B 5GJ4B 3OE7D 1TB6H 4VGCB 2W26A 1GI7B 1H8ED 1ETSH 4M7GA 2R2WU 3U9AH 3E16B 2QYIA 3MO6A 1TGSZ 3KQ5A 4FUDA 2LNCA 4AFUA 3A85A 2KX4A 1PPCE 1EZSC 3RMMH 1DX5M 3RXVA 3TPIZ 4J2YB 1V2MT 5B6LA 3GCTG 1BBRE 1A0LA 3AAVA 3EQ0H 2VBCA 3BTTE 4AG2A 1XUKA 5GPIB 1O33A 3MNCA 4GAWA 1K1IA 3IITA 4XE4A 3RM0H 2WHXA 1C1RA 2HGTH 2CXVA 2TRMA 1HAVB 3P92A 4X6PA 1L1NA 5HGGA 3ZZ4A 3Q77A 1ZGIA 2OC8A 3A81A 1YPHE 5DP3A 1M9UA 5HYOA 2R3YA 1NESE 3PV2A 5HMAA 3SU0A 3RXRA 3HK3B 3O8DA 2BLQA 2OK5A 1GI0A 1GMCF 1CA0C 2F9VA 2WPMS 3SU3A 4R8TB 4YOJA 1NFYA 4NFFA 4BAOB 4CRFA 4Y0ZE 2HLDD 2G8TA 1GG6C 2PFEA 1P57B 4JK6A 1DLEA 1MUEB 4XRNA 4INHA 3T29A 1VZQH 1TMBH 2BDGA 1Y5UT 1OP0A 2ZGXH 3U8RH 1MTWA 1HAGE 2FLRH 3E6PH 4ZH8A 2AHME 5AVDA 1VCWA 3P8NA 4AYVB 5ABWA 3KYFA 3KQCA 4ZKOU 1FDPA 1HAYB 4JZFH 2H2ZA 4DW2U 1TNIA 3TJVA 1E35B 2A7JA 2P8OC 4YOGA 1G37A 2GDDA 3RXTA 1C5NH 2WPDD 5GCHF 2Y5FA 3UFAA 3QTVH 4AYYB 3SI4H 2BMGB 3BEUA 4KTUA 4D9QA 1TABE 2OBOA 2RDLA 1L0ZA 2SGDE 3SJOA 4X1PU 2ZF0H 2OQ5A 1LHGH 1O5AB 2PKSB 2ZCKP 3RUOA 1YM0A 2ZFTA 2A5AA 3QGNB 2BQ7B 1NM6A 3URDA 2O8MA 2IJOB 4MDSA 3PRBA 3BG8A 3BTME 1P9SA 2TGDA 5EW1H 1G2MA 2SGFE 3SU1A 1VGCB 2UWPA 2BD9A 3C1KA 2H5CA 1CT4E 1C5QA 3TK9A 3ZZBA 4A1VA 5GWZA 1SHHB 4IC6A 4K60A 1GHYH 3RMNH 1P2IA 1K0HA 1BHXB 2GT7A 1C2FA 1E0FD 1V3XA 2STBE 5FPYA 1S6LA 3H7TA 1ETTH 2AERH 3K6ZA 3RXIA 4TPIZ 4QT8C 3ZZ6A 1H8HD 3M3SA 3N7EA 3ZZAA 4B6EA 3TGIE 3T28A 1SGQE 2ZPSA 1HIAA 1C2EA 1Z71A 1SHYA 2LPRA 2TGPZ 2FOGA 3TNTA 3RXQA 4ACBA 1C1UH 1DWCH 3SNBA 3M5OA 2PW8H 4X2VA 4A92A 4KTCA 4CR5A 5F6MA 1G9IE 2KCPA 2Z3DA 4XFQA 3OSYA 1XX9A 1W7GH 3S69A 2BY8X 5CMXH 1F92A 3MU5A 1CT0E 4FUCA 2CMYA 3PTNA 1V2UT 1AD8H 1V2OT 1GI8B 5I46H 5DP4A 2QXJA 4Y71A 3RC5A 5C3NA 2YMSD 3MFJA 1P02A 1TBRH 2CK3D 4FU7A 4Y10E 1GJBB 3DA9B 1LHCH 2W5EA 1C1NA 3RM2H 2L6OA 1DANH 1ELDE 3R0FA 2P95A 1WU1A 4SGAE 5C67A 3QZRA 5EQRA 2W6JD 3FP8E 3UIRA 1ZHRA 5I25A 1UHBA 5A8XA 2HNTE 3A8CA 1CSOE 3VGCB 4XD7D 4CRBA 1YPEH 5IDKA 2GV6A 3LC3A 2ZHWH 3PLPA 3RXOA 1T8MA 4JZDH 1C5LH 3SBKA 2ZDKA 3S7KB 1C4Y2 2K0QA 3GY7A 2QIQA 3RXAA 5DPAA 1AZZA 1BB0B 3D65E 1QY6A 1XXFA 3FZZA 4OS6A 1BMNH 3RC4A 2VIWA 1Y3XA 1HB0B 2Z9JA 1G3BA 3EE7A 3B8JA 3NXPA 3ITIA 4XOJA 1OHHD 1O3LA 3BN9A 3TK6A 2I6SA 1GBEA 3WY8A 2G4TA 2VWMA 1C2MA 1E34B 1BJVA 4ZXYH 4AORA 2BXTH 3R3GB 2FX6A 4UDWH 1HXFH 1HIAB 1EOJA 3SUEA 5TCAA 6LPRA 2ZFSA 3SN8A 2FS9A 1KXFA 1O2NA 1WBGB 1ELFA 2IJD1 1GBBA 1ZHPA 2F9NA 3QO6A 5HIZA 2RCEA 4AC9A 1ZTJA 3A8DA 4BTUB 2F3CE 2B0FA 5DP5A 4INLA 1VJAU 1VCQA 1HUTH 1HFDA 4AFSA 1NRQH 1UTPA 3PMJA 4Y79A 1C1VH 1ZTKA 3NWUA 1WQSA 6GCHG 1CHOG 1QCPA 3M7TA 5E0GA 3O8BA 2GVFA 1PQAA 3I77A 4X6OA 1ABIH 4X1QU 1IHTH 4PROA 2FI5E 4I32A 3AVZA 1QA7A 4CRCA 2A4RA 1SC8U 1QL7A 1W0KD 1YLNA 2UUJB 1ETRH 2BY5X 4AN7A 1BBRH 1OKXA 4TY6A 4NA7A 3KF2A 1HJAB 4IMQA 3OFND 1FLEE 1UHBB 1GJ8B 1KXDA 1KLIH 3QN7A 4GCHF 4DY7B 3RMOH 1AE8H 1ID5H 1KXCA 4Q63A 1TLDA 4X6NA 4BTIB 2BTCE 1GJDB 1ZHMA 5L30H 1DXWA 2H9HA 1HGTH 3O8RA 1XVMA 2BD7A 4WMDA 2HALA 2XBXA 1Y3YA 1AN1E 5SGAE 2Z3EA 1EP5A 1O3GA 2BOHB 4MTBA 1IQEA 1UTMA 3LC5A 5FBEA 5HKKD 1LHFH 3P8GA 3VEQB 2Q6FA 1C5PA 2ZI2H 6CHAB 4MPVA 1C2JA 1SLUB 3LGIA 4CH8B 1HJ8A 2B5TB 1TALA 3W95A 1IQIA 4AZ2B 5FL7D 3PROA 2VIVA 1WOFA 1S81A 2PKSC 1K28D 3M36A 2FOFA 1K2I1 2KCYA 3ATLA 3VFEA 4FUBA 3TVJB 3ZYDA 1CU1A 2OCVB 1WV7H 3GS9A 1UVSH 1HPGA 1EFRD 1EQ9A 4ISLA 4Y11E 1CT2E 1P3CA 1BTHH 1QFKH 2FOAA 3I29A 2PV9B 1MBMA 3LU9B 1D3PB 2BD5A 1TBQH 3M7QA 3UR9A 1V2ST 4CBNA 4BTTB 3ZVBA 1P2KA 2ZCLP 1P2OA 1E37B 1FY5A 5BPEA 1O36A 3F0PA 4AG1A 2OD3B 4ZAEA 1GHXH 1NS3A 4SGBE 4E7RG 3GY2A 1SBWA 3SJ8A 2FEQH 1D6WA 1FMGA 5JB9S 1BRUP 3RLYH 3N7OA 5DGJA 3TJUA 1PFXC 1MH0A 1TNJA 3DCLA 3SZEA 2D8WA 3SU6A 3BTFE 4I8GA 1O3IA 1PPEE 3FANA 2BDBA 3RXKA 1W2KH 3JZ2B 1DPOA 2GZ8A 2KCAA 1T31A 4Y7AA 2TGTA 2EI6A 2NWNA 4H42U 1HAXB 2LELA 4BXSA 1HBTH 4A6LA 2XBYA 5LPEA 4LXBH 1HAZB 1S84A 2IPQX 3HATH 2ANWA 2OBQA 2ZEBA 1AB9C 4XBCA 2FZZA 3NZIA 1ZLRA 4MG3A 5C5NA 1RFNA 2BVXH 4AX9H 2R0LA 1XXDA 4ABDA 2FYQA 2J4IA 4NIYA 2BDAA 4TY7A 2AMDA 4B2CA 4MLFB 3OX7U 1KLJH 1BUIA 1VCPA 5T6FA 3FZDA 2RDEA 1P04A 3OTPA 1ABJH 2F4LA 1O2YA 1GJ5H 1ANDA 3MNSA 4ZXXH 5K7RA 1EAWA 1GBMA 1DM4B 1BDAA 2V7QD 2H9EH 1OWKA 1BQYA 1FV9A 1Z7KA 3A84A 4AB9A 2PLXA 3L3TA 4X1RU 3O8CA 1OPHB 1T8OA 3LPRA 4X8VH 1C1PA 2OC7A 5E2PA 1COWD 1O34A 1O3MA 3GCTF 3ODDA 3SHAH 1SI5H 2ZDMA 1DITH 2ZFPH 3A7VA 3OTJE 1MQ6A 3UTUH 3V13A 1LPZB 1RTLA 4DURA 3ZVFA 2H6MA 3T5FH 5A0BA 2WYJA 5TCCA 1Q31A 3F2GA 1PQ5A 1SGYE 2FOCA 1GDUA 2ZU4A 1A7SA 1O3CA 1ZRBA 1TNLA 2JJ1D 1ACBE 4DG4A 1O2GH 1BHXF 1TX6A 1BCUH 1O2JA 1QB1A 4ACAA 5AFYH 2GJGA 5K0HA 1C1WH 1ELCA 2AYWA 3LKWA 3T25A 1IAUA 3SI3H 1UTKA 3FVFB 3PTBA 3ZZDA 5A2MH 5EJZA 1F5RA 4Q7YA 1ELTA 1UK3A 2Q6GA 2W7UA 2JH0D 4D8NA 3TGJE 3UQVA 5AFZH 2FOMB 3UOPA 3EYDA 5F8ZA 2ZA5A 4OS5A 1D3DB 2P16A 3SOSA 1A2CH 4BNRA 4E05H 1CE5A 1GGDB 3TH4H 4NZQA 1CVWH 5LPFA 1SSXA 4BOHA 2JIZD 1N1LA 4X1NU 3FN8A 2ZU3A 4NA8A 4R0IA 2VIDA 1EZXC 3CS0A 2OTVA 3A7TA 1TIOA 1IOEA 3RXHA 1TPOA 2XCFA 1MZDA 1EAIA 1AFQB 2ZFRH 5F8TA 1ZMLA 3LJOA 3TH2H 1C2HA 5CHAB 3ZYEA 3MO9A 1GBDA 2C90B 3GY3A 1EASA 3E0PB 3GY8A 2WPIS 2HVXA 3PWBA 3HKIB 1RTFB 2FTMA 2VGCB 4DGJA 1N6XA 1A3BH 1MKWH 2AFQB 3ZIAD 1XUIA 2ZU1A 1FAKH 4ABHA 2FODA 4X8SH 4A7IB 4B73A 1NRPH 1K1PA 1BTWA 4B2AA 4WWYA 3BF6H 1JWTA 2F43B 4ABBA 2BD3A 2B9LA 1GMDG 1SLWB 3UNSA 4K1EA 3MOCA 5FCRA 3MNBA 4YLQH 1PPHE 5T6GA 3M3VA 2FIRH 2NU0E 3B23B 3Q3YA 3RP2A 1LQEA 4F49A 3MU0A 3N99A 5CE1A 1O5BB 1JRTA 1FX0B 1VITF 1TA2A 1O2KA 4ABJA 1FN6A 2FXRA 2VU8E 7GCHG 2A2QH 3VB6A 1ZGVA 2SNVA 2XWAA 2VWNA 2BDHA 1AVWA 1LVBA 4Z0KA 4BXWA 3UREA 4Q4LA 1GI1A 2AMPA 1C2GA 2ZGJA 4DIIH 3BTHE 3SHCH 4OS1A 4Q7ZA 1Y3UA 1UK2A 4BAKB 2GZ9A 4INKA 2XRCA 1PQ8A 1CGHA 4YO9A 4IN2A 1V2JT 2GTBA 3BG4B 5EQQA 3PB1E 3KQDA 1T4UH 2WPJS 2AGGX 5C1UA 3V7TA 2C8ZB 1LHDH 1IQLA 1QA0A 2Y82A 3T26A 3VPKA 1EXFA 2AMQA 4GHTA 3OU0A 1FQ3A 1E1QD 2QGRA 1C5VA 1QRZA 1DWDH 1KDQA 3MMGA 2WYGA 2XBVA 5DJ7A 1GBLA 1H8DH 2HRVA 3PO1C 5TJXA 3SUGA 1OX1A 2Q1JA 5F03A 1C5WB 3CNRA 4HZHA 1ELBA 2EI7A 2VIPA 3SGQE 3V3MA 3GDVA 3DFJA 4BAMB 4JYTA 4FETA 3TJNA 4O97A 2P3TB 1PQ7A 1INCA 1QL8A 4UFEH 1AVXA 2D2DA 1MTNB 2SGPE 1TRMA 4IN1A 2A4QA 5A8YA 4FUGA 2I6QA 3GY4A 1ZPBA 2JDID 3ZZ9A 5C0TA 4U01A 5JPMH 3AK5A 1TBZH 1O2MA 2GX4A 3A82A 2FO9A 1P9UA 1GVZA 2XXLA 1SQTA 4K8BA 2FLBH 1GI9B 2ZTZA 1G36A 2HNTF 3A7WA 2QCYA 1LVYA 2XC0A 5EXMA 2ULLA 5GNDA 3SQHE 1CGJE 2PGQB 2PSYA 2R3UA 3ZZ7A 2VVCA 4TWYA 2CV3A 1LMWB 4KP0A 1C5YB 1DT2A 1ZMNA 4UFGH 1QZ8A 5GXPA 4XDEA 2P59A 4Y8ZA 5CHBA 3PWCA 3QK1A 1WSSH 1NRSH 4ISNA 3ATKA 5E2OA 5L2YH 2PUXB 2J97A 4X8TH 5J4QA 1HAHH 4DOQA 3U69H 2ZPQA 4Y8YA 2QC2A 4TT3D 2XYAA 1O2XA 1P2NA 2A4GA 4D7FA 2ZKSA 1FY4A 2ZDVH 3SGBE 3BTQE 1GCTB 2A7HA 2R9PA 4FUEA 5IYTA 3T62A 2RFKC 2YMSB 1NTPA 4WJG2 3URCA 2CHAB 1IQFA 1F0RA 1SPJA 1P8VC 1C5TA 1ARBA 1MQ5A 2J92A 1V2NT 1PPZA 1GJAB 3PM3A 2O8LA 3ATIA 5FCKA 1CA8B 2ZHEH 1V2VT 1A1RA 1Q2WA 2QF4A 1D3TB 6GCHF 3RXJA 4CRDA 1KDQB 2SGEE 3Q76A 2G00A 5JBTA 3RU4T 1LPGB 1D9IA 4YTAA 1TOMH 1CO7E 2OXSA 2UUFB 3OY6U 1SQOA 4ISHH 3SNEA 2PGBB 4MNVA 1UTOA 2ZTYA 4ABGA 4H6TA 4FUJA 3SV6A 3SU4A 2Z3CA 1O35A 4XBBA 5HXFA 1MKWK 1YPMH 1GGDC 3DSGA 3SNAA 2EA3A 4CHAB 1UVOA 1O37A 2JETB 5A0CA 2KM0A 2V6NA 3BTEE 5HM2A 2PWXA 1YC0A 1YF4A 4KGAA 2H5DA 2DUCA 1BT7A 2WPHS 3L33A 3HKJB 5C94A 5PTPA 3ZVDA 5G4BA 4Z6AH 2GT8A 4X0WU 1CGIE 2OP9A 4I33A 2XWBI 5CHAC 2Y5HA 3RXFA 1GVKB 3P8FA 1L1JA 2AIQA 1FY1A 3A80A 2EI8A 1K1NA 1SVPA 2Z9LA 4K3JA 1DXPA 3E8LA 3UNRA 5DP7A 4ZMAH 1RS0A 4MPUA 3HGPA 1C2IA 1O5DH 2ALVA 3BIUH 1GBCA 1Z8IB 4HI3A 2AH4X 1BTUA 1KLTA 2GMTB 1THRH 3RXCA 4VGCC 8GCHG 1Z8GA 1S85A 1GDQA 4NG9H 1ZPZA 2BX4A 3RU4D 3MQKC 1P11E 1GBJA 1N6YA 2O8TA 3GY6A 1GBHA 4FVDA 4TWWA 4E06H 7KMEH 4Y8XA 1EB2A 3HGNA 1QJ6B 3UNQA 1LHEH 1SLXB 1UVPA 3LJJA 4Y7BA 4YLUA 2M2AA 3P17H 5HM9A 2J95A 4TPYA 1O2QA 5KEDA 4IC5A 1O3EA 3CS7A 2F91A 2J38A 3LOXA 4IS5A 2D26C 3K2UA 4XSKU 1FY8E 4WF8A 6ESTA 1GBIA 3VB7A 1O2PA 4E7NA 4WMEA 3KNXA 3ZVGA 1MTVA 4B75A 3V12A 3GDSA 3WW7A 1ZTLA 4DT4A 1UO6A 1TGCA 2JH6D 3LH3A 1O3FA 2A5KA 2YOLA 1AKSA 1FXYA 3BTKE 1SMFE 1AZ8A 1W12U 1W14U 4Q7XA 2B8OH 1V2QT 3D23A 2VINA 1EJNA 5FPSA 2A0QB 1O2HA 2ZQ1A 1NFWA 1O2TA 2PTNA 1YCPH 3ZVAA 3LT3A 4BANB 1LDTT 2FYRA 1QL9A 2Z6BD 3M61U 2BDCA 3LGWA 1SOZA 5FPTA 2Z9GA 1K21H 1T4VH 4DVAU 5LGOA 4NCYA 1ANEA 1BRBE 1NZQH 3MU4A 3BSQA 1W10U 1TRYA 4AGKA 3U1IB 3KN2A 1NBMD 4KELA 3EA7A 4IMZA 1K1MA 1C5XB 3RXGA 2C8XB 2OC1A 4KKDA 1TGBA 2TPIZ 1NU7B 4F4OC 4H4FA 1CQQA 2Y5GA 1AWHB 3GYLB 3RXLA 2J9NA 5EGMA 1GVLA 2C3SA 1L4DA 3A88A 5DKMA 4F55A 3RLWH 1LVMA 3GCHB 1J16A 2JJ2D 5C1XA 3HPTB 2XCNA 3P70B 1DUEA 1Y5BT 1CBWB 2RA3A 2YNBA 5FX6A 1BMMH 2F9PA 2D1JA 3F0OA 3OEED 1H9IE 2KZ4A 3A83A 2FOBA 1SL3A 1MKXK 1J8AA 2AGEX 1QGFA 5EODA 1Z6EA 5FX5A 1A5HA 3F2HA 4X2YA 4YOIA 3EDXB 1Y5AT 1OS8A 1H9HE 1RIWB 4JZ1A 3S7HB 1WQVH 3GCNA 3M7UA 2VWLA 2BLVA 5DG6A 1Y3WA 2G51A 2IPHA 1AI8H 1RGQA 1XKAC 3G01A 3H5CB 4OGYA 2W3KA 3L6PA 1DY8A 4CRGA 2OLGA 2XC5A 2ASUB 1AKSB 1V2WT 1QRXA 1VJ9U 1GCTC 1EUFA 1BA8B 3K9XB 1C5MD 2ZZUH 2XTTB 1VGCC 1GBAA 1HV7A 1Y8TA 1ZSKA 2G52A 1ELGA 1C1QA 1ZJDA 1EAXA 1WYKA
chains in the Genus database with same CATH topology
1XUGA 2Y6TA 2ILNA 1DY9A 3M37A 1KTSB 5AF9H 2G55A 1O2RA 4K69A 1BJUA 1O2IA 2UUYA 1A5IA 1O2LA 1ZPCA 4O3TA 1OWJA 1YPHC 1OYQA 4X8UH 1GHBG 2ZQ2A 3A7ZA 2HWLB 5J4SA 4YT7H 1IQMA 1ESAA 4DT7B 2OC0A 1G3EA 4GPGA 1SOTA 3ELAH 4Y0YE 1UCYK 1HAIH 2BX3A 1B7XB 1P09A 3ZV9A 2V35A 1QTFA 1A61H 1MBQA 1KXEA 3W94A 1PYTC 2GCTB 2BY9X 1BIOA 2JETC 2ZPRA 4ZKSU 1UTJA 4B71A 1P12E 1SGNE 3U8TH 1GL0E 1MMJN 3QWCH 2VIOA 1V2PT 3ZZ3A 1HLTH 3A86A 1DWBH 4K1TA 4RSPA 4AOQA 2ESTE 4H6SB 1EAUA 1GCDA 1TOCB 1GG6B 3Q3XA 2HOBA 2PHBA 1WUNH 1UK4A 1E38B 3U8OH 2YNAA 3VGCC 5DP6A 4GLYA 2SFAA 1A4WH 1GMDF 1QBNA 1GMHG 1C9PA 2H1UA 1SGEE 5C1YA 5JB8S 4FUIA 1Z1IA 3E1XB 5JBBS 5A09A 2FESH 4NSYA 1NRNH 3UR6A 3OYPA 4XBDA 2ZDLA 3CP7A 3A7YA 5EPNA 2A1DB 2P8OB 7GCHF 3EAJA 2GV7A 1GHAG 3UOUA 2F9OA 2WPLS 4CH2B 3T2NA 3QUMP 2C93B 1YCPK 2W3IA 5BRRE 4K8YA 1ZSJA 3QZQA 3QGJA 4JYUH 3DFLA 4I8JA 2FM2A 3BTWE 3GY5A 1YPGH 1V2RT 3CENA 2V3HH 5ESBA 4BAQB 2BOKA 4OS4A 2G4UA 1Q3XA 1P2MA 3SV8A 3P6ZB 3SU5A 1TFXA 1G3DA 1XKBC 1O3OA 1TNGA 2BD2A 2CF8H 4IGDA 1ZOMA 1GDNA 2P3UB 1O3BA 3VXFH 2QF3A 4X2XA 1MD8A 1TPAE 1H4WA 1UCYE 1C1OA 2ZHFH 1TPSA 1TPPA 1T8NA 2BZ6H 4U30A 4I7YH 9LPRA 1PJPA 5DO4H 2PKAA 3LGVA 1ZMJA 5JBAS 1XVOA 2F9UA 3GICB 5T3HA 4ZHAA 1YGCH 3F9GA 2XBWA 3HK6B 4B76A 1SFIA 1SGFA 5E0HA 2ZU2A 1KSNA 1SGFG 3SV9A 4DJZB 2GDEH 3RDZA 1HCGA 2A7CA 4WXIA 2GD4B 1TAWA 1O2OA 1O3PB 1MCVA 1Z6JH 1HJAC 4O9VA 3C27B 3ESTA 1F7ZA 4WY3A 3MU8A 4YT6H 2GCHG 3TU7H 1ANBA 1XMNB 1TQ0B 3SGAE 3F1SB 5ETXA 4WH8A 1A5GH 1OWHA 5EG4A 4JK5A 1ELVA 1OWDA 1WCZA 4HGCA 2HNTC 3LGYA 3DUXH 3TK5A 1AY6H 1TGTA 1AQ7A 1DVAH 1J9CH 1S0QA 3S9CA 2Z9IA 2QV1A 1C1MA 1HNEE 5DP9A 2VVUA 3PLBA 1TMTH 4JZIA 8ESTE 1Z8JB 9ESTA 1DE7H 6CHAC 1W0ZU 1AWFH 1V2LT 5DK1A 1WAYB 1KY9A 1S6FA 1ESTA 1G3CA 3UWJH 4U32A 2WUCA 3A8AA 3UPEA 3DD2H 2TGAA 1XUHA 1QIXB 2Z9KA 3ZZ5A 1L2EA 1P3EA 1QJ1B 1H9LB 8KME2 1J15A 3SUFA 5L6NH 1LQDB 1D3QB 1K1JA 4Y76A 3TJOA 2ZO3H 3K6YA 1NT1A 2K1QA 1A0JA 1O31A 1EATA 2XW9A 1EJAA 1O2ZA 3STJA 2ZDNA 1FN8A 1QBOA 4RKJB 4GVUA 1O30A 3OY5U 1LCYA 5DP8A 3TIUA 1BMLA 2ANMH 2PKAB 2UWLA 1GI3A 1FIWA 1O3HA 1OWIA 8LPRA 5C5OA 3KIDU 3GDUA 4BAHB 3TNSA 1FNIA 1AFEH 2AGIX 1OYTH 4LK4A 3ODFA 2NU1E 2BYAX 1W11U 4FU8A 1A46H 5B6OA 1NN6A 4NA9H 3MH5A 1QHRB 1ZZZA 2ZHQH 3SJIA 4ABEA 3BIVH 2R0KA 3NCLA 1YP9A 3KGPA 1L1GA 5H4IB 2B7DH 2A31A 1UVUH 2A32A 3KQBA 1GI4A 3NK8A 3RU4E 1EJMA 1C4V2 2GGVB 4OS7A 3RC6A 2TIOA 1QB6A 3KQEA 1HJ9A 2GCTC 3RXSA 1QQ4A 3BEIB 1CHGA 1PPFE 4JCNA 2ANYA 3RXEA 3TLOA 1GI6A 4AFQA 1S82A 3KL6A 2ZFFH 1T7CA 2ZTXA 3QTOH 1FZZA 2QAAA 3SZNA 2BD4A 1GJ4H 2VIQA 2RG3A 1B0EA 8GCHF 2ZWLH 2DE9A 4ISIH 4K1SA 1K22H 2F9BH 1P0SH 1IQHA 1P03A 1V6DA 2GZ7A 2NU2E 1AUJA 4WMFA 5A0AE 3SJ9A 1XUJA 1DSUA 5EXLA 3T27A 3RXMA 3NPSA 2QXHA 5FHTA 1QQUA 1KXBA 1X7AC 1UTNA 4ABIA 1SQAA 3BTDE 1UVTH 1OOKB 2VVVA 2H9TH 3FP7E 2O8WA 1O3AA 3IWMA 4GSOA 1JBUH 2ZNKH 1AUTC 1TWXB 4D76A 1LTOA 1BZXE 5ESTE 1MZAA 1LPKB 1NFUA 4B74A 3ENSB 1AHTH 2ODQA 1J17T 1MKXH 2FP7B 2VJ1A 1C1TA 1YPKH 2Y81A 3RMLH 1K1LA 1P10A 1C2KA 2G5NA 1O5GH 3SU2A 3MH6A 4YZUA 2Q6DA 1TRNA 2BZAA 4MQAA 1GHVH 3LH1A 3LGTA 1MAXA 1J14A 3F9HA 1CHOF 4Q2KA 2STAE 1NY22 5C20A 3S9AA 1LKAA 2BB4A 2ZG0H 3LONA 1JXPA 4FVBA 3ZZCA 4OS2A 1FJSA 1KYNA 2FS8A 1A0HB 1C9TA 2QY0B 2G81E 1DSTA 5FBIA 1N8OB 4MNWA 2ODPA 2XNIA 2SGAA 3F68H 1NRRH 1VITG 1C1SA 4GUXA 2BDYA 5EW2H 3RXDA 3SORA 4ZHMU 1RTKA 2TBSA 1ANCA 4O03A 4UFFH 2J94A 1OXGA 2A2XH 2PSXA 4UD9H 4Q80A 2FI3E 2WINI 4NIWA 3ZZ8A 2BQ6B 4CREA 1LVOA 4NIXA 3FP6E 3ZV8A 2BVSH 1S6HA 3AAUA 1GWAA 1B0FA 2VB0A 1P2QA 3M5LA 4I8HA 1AFQC 3S0NA 3TITA 2QN5T 2Y7XA 1DOJA 2AS9A 5FXLA 3TH3H 1FONA 1GL1A 3KEEA 4J1YA 1UCYH 3EA8A 1GPZA 3K65B 1GMCG 1IQGA 1RXPA 1WTGH 2VGCC 4RN6A 4LZ4B 1AB9B 1F2SE 5GDSH 3FFGA 2VNTA 5EU8A 4CRAA 2IOTA 3EGKH 4MPWA 5EPYA 1SFQB 4ZHLU 2ZFQH 1AGJA 1O2UA 4MVNA 2QXGA 1EP6A 2AIPA 2XC4A 3M5MA 2IN2A 4ISOA 3AW1A 3ZVEA 3TGKE 1T8LA 1SR5C 1UJ1A 3ATWA 4ZKRU 2UUKB 3U98H 2OINA 1HXEH 1ESBA 2CN0H 2C8WB 1YBWA 2DE8A 1QJ7B 2BVRH 4MPXA 3IG6B 2ZIQH 4UE7H 4O3UA 2Z94A 1F5LA 1H8IH 1GBTA 5T6DA 1HAOH 1EPTA 1G2LA 5GCHG 1GHBF 4ABAA 5F8XA 3GOVB 4AGJA 1PYTD 3STIA 1A3EH 4OGXA 1BMAA 3BV9B 3ZVCA 1OP2A 1O38A 1T32A 3E0NB 1TE0A 3RXUA 1IQKA 1PPGE 2UWOA 4WH6A 1W13U 4U2WA 1O32A 1ZJKA 3BG4C 2BM2A 3U1JB 1AE5A 2P3FH 2HLCA 1B5GH 1YLCA 2PUQH 4I8LA 4A5TS 2KAIA 1K9OE 1AO5A 3A7XA 1HRTH 1S5SA 1UMAH 1ZR0A 2EEKA 1O5CB 4ZKNU 1SGTA 3MH7A 2GP9B 3A87A 5E0JA 1C5OH 1HAPH 2C8YB 2SGQE 3SW2B 3PLKA 2P93A 3P8OA 4K5ZA 1SGRE 1FI8A 3AW0A 3PMAB 1FPCH 1W7XH 1UTLM 1G32B 2QA9E 1O2WA 3F9EA 3PMBB 1E36B 5LH8A 1MTNC 2JH5D 1O3NA 2ANKH 5EOKA 3Q00A 1YCPM 1DS2E 1Z8RA 1SB1H 1TYNA 3PMHB 3LIWA 3QX5H 4UONA 2VH6A 1GMHF 1OWEA 1S83A 3EA9A 3SNCA 1F0UA 1TNHA 1D4PB 1BTPA 3GISB 1ELAA 1FIZA 3MYWA 1Z1JA 4JYVH 3SQEE 2WUBA 1SGIB 3B9FH 2PTCE 1KXAA 2ZHDA 1C4U2 2ZU5A 4NSVA 4AB8A 3MHWU 5A8ZA 1GHAF 1PPBH 2CF9H 1C2DA 1FPHH 1RRKA 3SV7A 4X6MA 1GBFA 1UTQA 3EE0B 3GCOA 3S9BA 2BLOA 3P95A 4NWLA 4ZROA 1DICA 4A1TA 4FXGH 3KCGH 1TONA 5LPRA 1P2JA 2O9QA 1P01A 3SNDA 1C5RA 1EPTB 1L4ZA 2ZECA 1MD7A 1GI5A 1JRSA 1TA6A 1NC6A 1W0YH 3H7OA 2FMJA 1YLDA 1SGCA 4WXVA 2J2UA 1V2TT 2P94A 1JIMA 2BHGA 2ZP0H 1HYLA 2BQWB 1YKTA 2CHAC 1GBKA 3BEFB 2BY7X 1W3CA 3MH4A 3GYMA 1NROH 2FX4A 5L2ZH 4D7GA 5E8EH 1C2LA 3MWIU 2KAIB 2ALPA 3PYHA 2BDIA 4DCDA 1YPJH 3DT0H 1RD3B 2A4OA 1BRCE 2FI4E 3D49H 1QNJA 2J34A 1C5SA 2F83A 1YYY1 2M5TA 1BOQA 1EOLA 3BTGE 3LDXH 2CJIA 1EZUC 1BTZA 1N8OC 3RXBA 5C2ZA 1GJ7B 4IBLH 3MU1A 4X1SU 3UQOA 1EX3A 2FDAA 1BTYA 1EKBB 2WV4A 2BD8A 1F5KU 2WPKS 2HPQH 1IQJA 4ASHA 4B1TA 1NPMA 1O3JA 2QF0A 2GCHF 5JDUB 2BY6X 1OSSA 1RJXB 3VB3A 4CHAC 1O2VA 3ATMA 1C5ZB 1O5EH 4A1XA 1W8BH 2OQUA 1NU9A 4MNXA 4ESTE 4UFDH 1EZQA 1KIGH 2C4FH 4FUHA 3Q3KA 1CA0B 2THFB 3UWIA 4K2YA 2Z7FE 5FAHA 1QRWA 1SG8B 7LPRA 1FUJA 1GJ6A 1GI2A 1ARCA 1O2SA 2A45B 3PO1B 1OP8A 1VITH 1O0DH 2FOHA 1DUAA 1G30B 2V3OH 1S0RA 1FAXA 1O39A 2VH0A 3AASA 4ABFA 1O3KA 4LZ1H 1F0SA 4NIVA 4NWKA 4MNYA 2CGAA 1GHWH 3MO3A 2BLWA 2GMTC 2JKHA 1HDTH 4CBOA 3DHKH 2ZDAH 1SGDE 2A5IA 1LO6A 3MTYA 1P06A 1Y3VA 1BTXA 3A89A 3F6UH 1DFPA 1DLKB 4NZLA 2ODYB 1JMOH 1K1OA 1KTTB 3MI4A 1F0TA 1ZYOA 1WTHD 1JIRA 1AIXH 1O3DA 4GCHG 4I31A 3D62A 1Y59T 2ZC9H 1EB1H 1MU8B 1GHZA 2PR3A 1MCTA 1JOUB 1IQNA 5EQSA 2V0BA 1NO9H 4I8KA 1ORFA 5JYIA 1QBVH 1DWEH 2ZGCA 3NKKA 4NGAH 3SJKA 3I78A 2Y7ZA 4HTCH 3PV4A 3F9FA 3E90B 2FPZA 1QB9A 3VB5A 1TX7A 2BXUH 4IW4E 1V2KT 2NU4E 3LGUA 3M3TA 3M35A 2EC9H 1MTUA 4YESB 5EXNA 1QURH 4D9RA 4UEHH 3A8BA 2AEIH 1SLVB 1YPLH 4Y6DA 5JBCS 3KHVA 3QLPH 1THPB 4JZEH 1FY3A 1LKBA 4GHQA 1MTSA 4CR9A 1BITA 1U6QA 1AMHA 1THSH 1TMUH 4NFEA 2OUAA 2NU3E 2WV5A 1MAYA 1O5FH 3UY9A 4ZUHA 1QR3E 2R2MB 1BBRK 2RA0A 4YM9A 1IHSH 2ZGBH 1ZRKA 3NUMA 3E3TA 4FU9A 1D6RA 1H1BA 1TGNA 4KTSA 2FTLE 4B2BA 1DDJA 1P05A 1ZSLA 1HAVA 3FAOA 1NFXA 3RXPA 4WVPE 3SO3A 2G5VA 1BRAA 4HFPB 2FOEA 1TNKA 2Y80A 2ZCHP 4JMYA 3GCHC 1AVGH 1MU6B 2O8UA 2HPPH 2ZGHA 1GJ9B 1CBWC 1ELEE 1XM1A 1VR1H 3QDZB 2W7SA 3UUZA 7ESTE 2FWWA 5GIBA 1XUFA 1C5UA 3VXEH 3VB4A 1SGPE 1GJCB 4LOYH 2QXIA 4THNH 4FUFA 4RKOB 1RIWC 1AU8A 4X2WA 1TQ7B 4TYDA 2GKVE 4AFZA 3V0XA 3MNXA 3SV2H 2SNWA 1TX8A 4DIHH 5AHGH 2VWOA 3E91A 1EPTC 3SUDA 3M5NA 3JZ1B 5GJ4B 1TB6H 4VGCB 2W26A 1GI7B 1ETSH 4M7GA 2R2WU 3U9AH 3E16B 2QYIA 3MO6A 1TGSZ 4FUDA 2LNCA 4AFUA 3A85A 1PPCE 1EZSC 3RMMH 1DX5M 3RXVA 3TPIZ 4J2YB 1V2MT 3GCTG 1BBRE 1A0LA 3AAVA 3EQ0H 4AG2A 3BTTE 1XUKA 5GPIB 1O33A 3MNCA 4GAWA 1K1IA 3IITA 4XE4A 3RM0H 1C1RA 2HGTH 2CXVA 2TRMA 1HAVB 3P92A 4X6PA 1L1NA 5HGGA 3ZZ4A 3Q77A 1ZGIA 2OC8A 3A81A 1YPHE 5DP3A 1M9UA 5HYOA 2R3YA 1NESE 5HMAA 3SU0A 3RXRA 3HK3B 3O8DA 2BLQA 1GI0A 1GMCF 1CA0C 2F9VA 2WPMS 3SU3A 4R8TB 4YOJA 1NFYA 4NFFA 4BAOB 4CRFA 4Y0ZE 2G8TA 1GG6C 2PFEA 1P57B 4JK6A 1DLEA 1MUEB 4INHA 3T29A 1VZQH 1TMBH 2BDGA 1Y5UT 1OP0A 2ZGXH 3U8RH 1MTWA 1HAGE 2FLRH 3E6PH 4ZH8A 5AVDA 1VCWA 3P8NA 4AYVB 5ABWA 3KQCA 4ZKOU 1FDPA 1HAYB 4JZFH 2H2ZA 4DW2U 1TNIA 3TJVA 1E35B 2A7JA 2P8OC 4YOGA 1G37A 2GDDA 3RXTA 1C5NH 5GCHF 2Y5FA 3UFAA 3QTVH 4AYYB 3SI4H 2BMGB 3BEUA 4KTUA