2TPIZ

On the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
220
structure length
220
Chain Sequence
GYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSINOGEN
publication title On the Disordered Activation Domain in Trypsinogen. Chemical Labelling and Low-Temperature Crystallography
pubmed rcsb
total genus 51
structure length 220
sequence length 220
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1981-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tpiZ01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tpiZ02
4YESB 1KDQA 3PMJA 1GMDG 1ELEE 3RC6A 1ACBE 2GV6A 1O31A 2BZAA 4IW4E 1HUTH 1Z6EA 4XFQA 1LDTT 4A1XA 1O3GA 2ZU4A 3PV4A 1DDJA 1C2IA 2GV7A 5EXNA 1PPGE 4MLFB 3UREA 4B75A 5FX6A 1YPGH 1HYLA 3OY6U 3SHAH 1SHYA 2BDGA 2KAIA 1V2OT 3UNRA 1TPAE 5EODA 2FO9A 4FVDA 2CV3A 4D7FA 1GVKB 1PPHE 1MU6B 3LGWA 2HRVA 4OS2A 1GJ5H 1GBFA 1MTNB 1ELFA 3UWJH 4JZFH 4Y6DA 3PB1E 1HV7A 1ZRKA 1P06A 1FJSA 2ANWA 4NFEA 1PFXC 1AI8H 1F92A 5A8ZA 3A88A 2ZG0H 1O3AA 3LDXH 4ABEA 3NWUA 1V6DA 1WSSH 1XVMA 3E1XB 4NWLA 3LONA 1BBRE 5DPAA 2EI7A 3KIDU 4WF8A 1GCTC 2OC1A 1EZSC 4MPUA 1F0TA 1OYTH 4OGXA 3V13A 1OWKA 1W13U 1EQ9A 3A80A 8LPRA 2ZCHP 2Z9LA 4X8VH 1VITH 2ANMH 2BDCA 1MZDA 2Z6BD 4MNYA 3BF6H 1ABIH 2VVVA 4MNVA 1A0LA 3O8DA 3JZ1B 1MBQA 2ALVA 3VPKA 2F9BH 3EDXB 4B1TA 1O5CB 3RU4E 1O3KA 1BZXE 4TPIZ 1YPLH 1ZHPA 1BITA 2BDAA 1AD8H 4Y8YA 3F6UH 2GGVB 1LHEH 3G01A 4BTTB 1QA7A 4NG9H 2P16A 1V2VT 4ABHA 1SGNE 1V2TT 4AFQA 6ESTA 1A0HB 4MVNA 1GJ8B 1IQFA 1GCTB 3HK6B 3ZVBA 1Q3XA 1PYTD 3U8OH 1Y59T 5GCHF 3RXVA 3VEQB 2BLWA 2BZ6H 4ABIA 1TBZH 4Y8ZA 4X2YA 1OWJA 5F8XA 3ZZ3A 4WMEA 1FY4A 1OOKB 1ANBA 5EXLA 2AS9A 3MI4A 3LIWA 3ZVEA 4F4OC 3PYHA 1BB0B 1QHRB 4KTSA 2ZFPH 2A4QA 1H1BA 1SGYE 2H9HA 4MDSA 1O2UA 2HPPH 1BT7A 2WV4A 3F68H 1CE5A 1O2SA 1KTSB 1ZGIA 2FODA 2G5NA 5JBTA 1DT2A 1OYQA 1ZPZA 3QWCH 2FTLE 2VWLA 3TIUA 1W14U 3BG4C 1K1MA 3UY9A 1GI6A 3BN9A 1F0RA 1O2MA 2WPMS 2O9QA 3SNDA 1O2ZA 1GDNA 3NK8A 1AB9B 1TNGA 4QT8C 1RJXB 1W0ZU 4AFSA 1K9OE 5E8EH 5GCHG 3AVZA 1SVPA 4ZAEA 1TLDA 4GSOA 1HXFH 1SGDE 4FUCA 1AU8A 1C4Y2 1VITG 4K1EA 1QBOA 2FOHA 1ZYOA 1TBRH 4U2WA 1V2LT 3ZYEA 2VGCB 2P3TB 4ZKOU 3ZVGA 1SPJA 1ESTA 3GCHB 5DP9A 1MTWA 2FOBA 2GT7A 1LPKB 1DICA 2Z3EA 1Y3YA 2ZKSA 4U01A 1NPMA 5F8TA 3VXFH 1KXEA 2QF3A 3FP8E 1LMWB 1G3BA 1T32A 1T4VH 3LH3A 2P95A 3E0PB 1GJCB 2VIPA 3K6YA 1OWDA 1EAUA 1UK4A 2XXLA 3B23B 1O37A 1ID5H 2WYGA 3VGCB 1ARCA 3A86A 4WVPE 1TNKA 2AIPA 3MNBA 1TABE 1O3PB 2CHAB 4CR9A 1OP2A 1GI7B 2XTTB 2FS9A 3STIA 3A81A 2P3UB 5HXFA 1F5RA 2QCYA 3ODFA 3OX7U 4XBCA 3SU5A 3UIRA 2SGPE 2AIQA 3E91A 1RIWC 2OINA 4ISOA 4DIHH 3CENA 2QXGA 3QK1A 1EP6A 1TNJA 1B5GH 2H6MA 3NPSA 1MZAA 4XBDA 3S0NA 3ZVCA 1NESE 2F83A 1TQ0B 2A4RA 3MFJA 4B2BA 4ISNA 1NN6A 1A0JA 2BHGA 3AAVA 1SGQE 1EAIA 5C5OA 1MQ5A 1C1QA 3LC3A 1GI1A 3A7WA 2QIQA 4ZUHA 1EAXA 2OD3B 4JK5A 3RXAA 5L6NH 2BD4A 3L33A 1TOCB 2D8WA 2GX4A 4OS6A 1QRZA 2G00A 1F0UA 5K0HA 2DE9A 2SGAA 5J4SA 2UWLA 1O32A 1L4ZA 2ANKH 4NFFA 1RIWB 4Y11E 3AASA 1ETSH 5DO4H 1O3CA 3A8BA 2ZDLA 2Z9IA 2BVSH 1VCQA 1YPKH 2VNTA 2RA3A 1BTPA 4A6LA 1BJVA 3VB6A 1C2JA 2GMTB 2ZU1A 4JYUH 1JOUB 2GCHF 1CBWC 5EOKA 2GP9B 2W3KA 3RM2H 4SGAE 3SGAE 1EOJA 5CHAC 1BA8B 1XX9A 1CA0C 1FNIA 3SO3A 1UTJA 1HBTH 5A09A 2BLOA 3H5CB 1C1UH 2HNTE 2BVRH 1UTQA 1JIMA 1S81A 1AVXA 3UQVA 1IQMA 5EW1H 1DUAA 1Z7KA 3W94A 2ZDKA 3O8BA 1HAYB 3BTWE 5DP3A 5EPNA 2PV9B 1QB9A 1LHFH 4INKA 1HAHH 2Y80A 1YP9A 2JETC 1G2LA 1UJ1A 4KP0A 1AWFH 3SNAA 1JWTA 1Y3WA 3QLPH 1O2GH 2Z9JA 1T7CA 4DJZB 1YPHC 1EJMA 3ZZ7A 5E0HA 1PPBH 1BTXA 1QB1A 4Y7BA 2GCTC 1BHXF 3V3MA 4Y76A 4Y79A 5DJ7A 1SLVB 2P94A 3RXLA 3A85A 4ZH8A 1UVSH 2YOLA 1B0EA 1YLCA 1HAGE 1W2KH 3SJ8A 4FUEA 3W95A 4UFFH 1SGEE 1O3FA 4BOHA 1DX5M 1Y5UT 4FUGA 1GJDB 5CMXH 3U1JB 1O2LA 2BD3A 1V2MT 3HGPA 3ZZBA 3SJKA 1QJ1B 2HVXA 2STAE 1JMOH 2WPJS 1K1PA 3RU4D 1M9UA 1MAYA 2TGAA 3P8OA 2JETB 3VB5A 3TNSA 1AE8H 1C1PA 1BRCE 3UR6A 3RXMA 2TGDA 1GBHA 2CN0H 3PM3A 3VB3A 2BTCE 2ZDNA 3SV6A 3EYDA 2ZU2A 3E90B 1YGCH 2FYQA 5J4QA 3SGBE 3TH3H 5FHTA 2V35A 3KL6A 3MMGA 1AFQC 4ZKSU 1L4DA 4IC5A 1FUJA 2OC7A 1TX7A 2XCNA 2RCEA 1NRSH 5JYIA 4BTIB 1LHGH 2Z9KA 4MQAA 1FN8A 4WXVA 1P03A 4R0IA 2VH6A 1ETRH 2AMQA 4AN7A 2GDEH 5DP5A 1ZJDA 1SFIA 2C8XB 1IQGA 1RTFB 2O8LA 1ELDE 3A8AA 5L30H 1H9HE 1Y3VA 1O2IA 4ZXYH 1O36A 3SQEE 1AZ8A 1UHBB 4X6OA 4R8TB 4XE4A 5EG4A 5C20A 5TJXA 1C1NA 2J94A 1WQVH 1Y5AT 1VR1H 1O3IA 2WPKS 2OP9A 3CS0A 3M3VA 2SGEE 3QN7A 1AFQB 1RS0A 4UFDH 1YBWA 3SW2B 5H4IB 3TITA 2UUJB 1SLWB 3LJOA 1GI5A 1TRYA 1ORFA 1PPEE 1D6WA 2H2ZA 2J4IA 4AFUA 4IGDA 3UOPA 2QAAA 2UWPA 2FTMA 2H5CA 3WY8A 3GY3A 2GVFA 4CREA 1TRMA 1ZPCA 4K60A 1MUEB 5HGGA 3D49H 1N8OC 4IMQA 1C1OA 3M37A 3M5NA 1FY5A 3SV7A 4D9RA 1HNEE 5EXMA 1UTPA 3TJNA 3KN2A 2ALPA 1O3HA 3ENSB 1AWHB 1DWCH 2GDDA 4TY7A 3D65E 4TY6A 2IJOB 3EA8A 1UTKA 1WBGB 1GDUA 3GY2A 2BD2A 1CHGA 1MBMA 1RTKA 1TNLA 3A87A 1GJAB 2ZFQH 2J95A 8GCHF 2W26A 3SUEA 1ZLRA 1TMUH 1GG6C 4DY7B 1CSOE 1C2HA 1C2MA 4AB8A 2SNWA 3CS7A 1EZXC 1ZTJA 2OCVB 4A7IB 1K1NA 1QA0A 2VU8E 1S84A 1V2UT 4IN2A 1XUFA 1A46H 1BQYA 1UVOA 2PKSC 3V0XA 2HPQH 1N8OB 1TGCA 5JBCS 1H4WA 1DLEA 1AZZA 1QRWA 1CVWH 1GWAA 1S6FA 2BQ7B 1Z1IA 4H6TA 3M7TA 4WWYA 2VWOA 2FIRH 1GMDF 2G52A 1G2MA 4X6PA 4NA9H 5BRRE 3KNXA 3PTBA 4XBBA 7KMEH 4ZHLU 4OS4A 1T31A 4K8BA 4DIIH 2GT8A 1HAPH 1C1VH 2P8OC 1SGRE 2G51A 3RXDA 3MO9A 5JDUB 1GI0A 1HLTH 1FIZA 1GBKA 2AGIX 3BTEE 1CGIE 2A31A 4B71A 2XC0A 4CBOA 4Y71A 4NWKA 3CP7A 4YTAA 1C1SA 1GBBA 1GJ9B 2ZO3H 4NGAH 1BIOA 2VVCA 2B0FA 2QYIA 3A83A 3U9AH 1NS3A 1O0DH 1LQEA 2Q1JA 2V3HH 1FLEE 4JYTA 1OP8A 3SI3H 1SQAA 2R2MB 3QDZB 1SGPE 1NFUA 2DE8A 2F9OA 3DHKH 4I8HA 2CF8H 4WH8A 1J8AA 3A7YA 3HPTB 1A61H 2FMJA 5A2MH 4UDWH 2PUQH 2F9VA 3GISB 3RXFA 1HJAC 2FOAA 4H6SB 1GMHF 1L1NA 1W7GH 3R3GB 4X0WU 1AUTC 1TIOA 3T26A 5GXPA 3RXUA 3TK9A 2FI5E 1L0ZA 1LHDH 1LTOA 1BJUA 1KLTA 1XUKA 2I6SA 1FY3A 3BTQE 4YLUA 1NFWA 2TGTA 1EZQA 3IWMA 1P04A 1GHWH 2EA3A 3OSYA 1YCPM 2A2QH 3SV8A 1AKSB 1ANEA 4FUJA 1O33A 1WU1A 3GCTG 3SV9A 2Q6GA 2GD4B 4A1VA 4E7RG 3TJUA 3RXOA 2VH0A 7LPRA 2GTBA 1V2PT 3Q3YA 1EZUC 2ZFRH 1BTUA 2SNVA 2BOKA 3H7OA 3PMAB 1IQLA 1S0QA 4Z0KA 1HJAB 5ABWA 1B0FA 3TH4H 1LVYA 3MNXA 3ZZ8A 5F8ZA 1GHYH 2XBYA 3I78A 1J15A 5HM2A 1ZOMA 1QGFA 4CRFA 4X2WA 1IQJA 1ZTKA 1GMHG 2YNAA 3UFAA 1J17T 1TONA 1O3EA 1ZPBA 1Z1JA 1O5EH 3K9XB 1D3TB 2TGPZ 3A8DA 3GY8A 3MYWA 5FPTA 4O9VA 3SZNA 2ZECA 1PJPA 1V2QT 1O35A 1GBJA 3RMNH 1UTOA 2ANYA 4K5ZA 4WY3A 3ZZAA 2QXHA 3B8JA 3R0FA 3IG6B 4XOJA 5F6MA 1ZHMA 1TX8A 2Y5HA 2UUKB 2IOTA 1MTUA 1KYNA 2Q6FA 3DFLA 3Q3KA 1YKTA 3ZZ9A 4B74A 1V2NT 2CMYA 2QXJA 1GJ4H 1GJ7B 2FX6A 1RXPA 1HAVA 2FM2A 3U98H 5I46H 3E0NB 4YM9A 4LXBH 2C4FH 3M7UA 4X8TH 3Q76A 5T6GA 1P2MA 2TBSA 1GI9B 2R2WU 3A84A 1K1LA 1ESBA 4E05H 5T3HA 1NRQH 2ZC9H 1GJBB 4WMFA 1HJ9A 5LH8A 1GI8B 3M3SA 5GDSH 3PO1C 2BYAX 1EOLA 3BEIB 4UONA 1QL8A 4TWWA 1O2VA 2GKVE 2P93A 1WOFA 2XWAA 2Y81A 3SNEA 1O38A 2PHBA 2ZTXA 3GOVB 3PWBA 4NIWA 1ANDA 4A92A 1VITF 1HB0B 3ZVDA 1BMLA 3M7QA 4HZHA 2FOCA 1MU8B 1SG8B 4ABJA 2FYRA 1Z6JH 1QRXA 3PTNA 1AO5A 1ANCA 4ABGA 1UK2A 2D1JA 2H5DA 1P3EA 1G37A 1UVPA 3P8FA 3QTOH 4HFPB 4RSPA 4CBNA 5C1YA 1SLXB 1KXAA 2ZHQH 2HNTC 1Y5BT 2AFQB 2C90B 1V2KT 2PW8H 1KTTB 2UUFB 1IQHA 4ZROA 1NU9A 1IHTH 3ZVAA 1P10A 2ZHFH 1AQ7A 4Y10E 1AVGH 4TWYA 2ZCKP 4WMDA 3ZZ6A 5C1XA 1AY6H 2B7DH 3BIUH 1QJ7B 3FZDA 1C5RA 1D4PB 1O5DH 1P12E 1SB1H 1GCDA 1DSUA 4NZQA 4NIVA 3BV9B 5IYTA 1V2RT 1DM4B 3RU4T 1BRBE 2ZFSA 2Z7FE 3ZZ4A 3EA7A 3RXEA 1E36B 3SU0A 2J2UA 2PTNA 1QFKH 1KDQB 1C9TA 3SI4H 3MO3A 3URCA 1WAYB 1CGHA 2XCFA 1RGQA 3BG4B 3KHVA 1W10U 2XC4A 1C1WH 4D8NA 1EPTA 1DWDH 1O2YA 1GHZA 4NIXA 5EPYA 5JB8S 1HDTH 2A7HA 1TGBA 3KEEA 4KGAA 4X1SU 4B2CA 2KAIB 4JZEH 1AVWA 1C1RA 2PKAA 3NCLA 3GDUA 3FFGA 4WJG2 3QGJA 1QTFA 2ZDVH 2ZNKH 1ELBA 1IOEA 1THPB 1EX3A 3TH2H 3P17H 4Y8XA 4KKDA 1DY9A 1ELCA 1EUFA 1DXPA 1TYNA 1QJ6B 1O5BB 2XWBI 4WH6A 1NROH 2A7JA 1MKXH 3GCNA 2FESH 4I8KA 1E34B 4YZUA 3LKWA 3OU0A 4CRCA 4LZ4B 4UFEH 4A1TA 1CT4E 1UTNA 1C1MA 1WTGH 2Z3CA 1IQKA 1V2JT 1D3PB 3SBKA 2FZZA 1MTSA 4Y0YE 2FLRH 2QV1A 3ZZCA 4UEHH 3TGKE 4NA7A 1K21H 4DT7B 1T4UH 1LPZB 1TNHA 1E0FD 1C1TA 4IBLH 1ARBA 3KCGH 1OPHB 5CE1A 2BVXH 1CHOG 1TALA 1MH0A 2FS8A 1LKAA 5HM9A 1O30A 3BTDE 4ABFA 1ELGA 1P57B 1EJNA 3RXCA 4WXIA 4FU8A 1QB6A 1QCPA 2JH6D 1EJAA 2FOMB 2R0LA 1ZSKA 2A2XH 2ODQA 1VJ9U 2J34A 3RXBA 3GYLB 2OBQA 3TGIE 1PPCE 1LVBA 1H9LB 1SGCA 1C4V2 5SGAE 1FQ3A 4X6NA 4H42U 1ABJH 1Z8IB 4AYVB 2BLVA 2BD8A 2ZDAH 3RXIA 1UCYH 1XVOA 3HKIB 3BIVH 3UNQA 2BD9A 6LPRA 4ABBA 1XXFA 1MKWH 1TQ7B 1AFEH 3QGNB 3F1SB 4YLQH 2TPIZ 1PPFE 3Q77A 2H1UA 3TNTA 4MNXA 3LGUA 1UO6A 3D62A 4I8GA 3MNSA 1W0YH 1ZRBA 3TPIZ 3U1IB 1C5QA 1KIGH 3MH5A 5GWZA 3RP2A 3GY5A 4I33A 3HGNA 9ESTA 1L1JA 4KELA 2V0BA 3SGQE 3OY5U 1QIXB 1SGFG 1A7SA 1P3CA 3S7HB 1X7AC 2A32A 3KGPA 1ELTA 1O3MA 2OXSA 3P92A 1XUJA 2QC2A 3K2UA 1VGCC 2FDAA 4K1SA 4HI3A 1EPTC 1PQ7A 1AUJA 5TCCA 1UTMA 1CBWB 2BQ6B 3I77A 3O8CA 5CHAB 4GPGA 4Z6AH 1IQEA 2WPLS 1SMFE 1CA0B 2W3IA 2C8WB 1EKBB 1WQSA 1C4U2 3RXSA 3ATIA 1AE5A 2W7UA 1O3BA 3LOXA 4OGYA 2OTVA 1T8MA 1EP5A 2QGRA 4GAWA 2R3YA 1OS8A 4CRDA 2PTCE 1LVOA 1N6XA 3QZRA 5E0JA 5A0BA 3RXQA 1MD8A 4NIYA 1ZSJA 1QURH 1NU7B 1OWIA 1O2WA 3MU8A 1GBTA 5FXLA 1K2I1 1GJ6A 2Y6TA 1IAUA 1FAKH 3LGYA 4ZKNU 5T6FA 1XMNB 1ZTLA 2ZDMA 2NU2E 1P9SA 2BB4A 4IMZA 1OKXA 1JRSA 1L1GA 5E0GA 1SQOA 2AERH 2GCTB 2GZ9A 5DKMA 1TA2A 4X1PU 3LH1A 4JYVH 1O2XA 3LGVA 6GCHG 1DE7H 3RMOH 1GVZA 4J2YB 1P2JA 4B73A 2FEQH 4JZIA 3DUXH 1XXDA 2BLQA 3LJJA 3URDA 1GBIA 3ELAH 1J16A 5A8YA 1XM1A 3NXPA 4YT7H 1CT2E 4O3UA 3RXHA 3RLYH 5ETXA 3ZVFA 4K69A 3RXJA 2HOBA 2A7CA 1SFQB 3MWIU 5FCKA 1DWBH 1H8DH 1P2OA 1ZHRA 3S9BA 1XUHA 1QY6A 1NO9H 1TMTH 2YNBA 2B5TB 2C93B 3HATH 1C2KA 1Q2WA 1FZZA 1K28D 2V6NA 4BAQB 3ZZ5A 3FP6E 1THRH 4X2VA 3BEFB 3TK5A 1KXFA 1IQNA 2CJIA 3LT3A 1RD3B 2ZFTA 1S0RA 5B6OA 4X8SH 2AMPA 5C67A 1ZJKA 2H9EH 4TYDA 2BDYA 3O8RA 1P2IA 2V3OH 4YOIA 2F9NA 4MPXA 4X2XA 1SOZA 4A5TS 1A3EH 3PWCA 7GCHF 2FLBH 3PLBA 4IN1A 3U8RH 1P8VC 3LC5A 1A2CH 3GY7A 1ZMJA 3PROA 1EB2A 4ASHA 1EXFA 1GDQA 1GHBF 4MNWA 1F2SE 1HCGA 4ZKRU 1W11U 1A5HA 4OS5A 1YC0A 3RLWH 4E7NA 1C5YB 3MU1A 1ZMNA 2O8UA 3ATWA 3MU4A 1UCYK 2Y5FA 7ESTE 1QBVH 1C2LA 1HJ8A 3ODDA 1C5NH 5BPEA 3UQOA 4BAOB 3RM0H 1MKWK 3DA9B 5JB9S 1YYY1 2P59A 1SGTA 4SGBE 4LZ1H 2WUCA 1FV9A 4AX9H 3KQCA 1WV7H 2VWMA 5ESTE 1SR5C 1QNJA 5A0CA 1QR3E 3DD2H 1O2QA 2ZQ1A 5FAHA 4I8LA 2XW9A 1PQAA 3KF2A 5E2PA 1C5OH 3P6ZB 1E38B 3E16B 3RDZA 1FDPA 4BXSA 3T28A 1O3NA 1F0SA 1ZSLA 2XNIA 2ZEBA 3SU2A 3UWIA 1TNIA 3A89A 1G32B 1DUEA 1FXYA 2BY6X 2XRCA 4INLA 7GCHG 3RXGA 1FONA 2ZTZA 2ZHDA 1TBQH 1BMMH 2ZA5A 3AW1A 3P95A 1GHBG 2AGGX 1MQ6A 4UE7H 4NSYA 3MO6A 1XUGA 4LOYH 2ZU3A 5AFZH 2PGBB 1P11E 1T8OA 2B9LA 3UR9A 1JXPA 1BCUH 2PSXA 3M5MA 1MTVA 2A0QB 2F9PA 1GG6B 2QF0A 4MPWA 2VIDA 5FX5A 3LU9B 3B9FH 1SGIB 5T6DA 5L2ZH 4K8YA 3GCTF 2O8TA 4CRGA 2PKSB 1UTLM 2PUXB 1DANH 3ITIA 3QTVH 1CU1A 1K1JA 1C5ZB 3BTTE 3RMLH 2JKHA 5AF9H 4ABDA 1PQ5A 1VCPA 1C5LH 4XDEA 4RKOB 3C1KA 4Q80A 1Y8TA 3AAUA 1GI3A 3A7VA 4I7YH 2Y7XA 4NSVA 3M3TA 4CHAC 1G3EA 3S9CA 3MU5A 4AORA 2XBVA 1MMJN 3M61U 1O2HA 4B76A 3M36A 5EGMA 1AGJA 3EA9A 1NTPA 3RC5A 2BOHB 2P8OB 4GVUA 2Z9GA 2BDBA 2D2DA 4Y7AA 1H8IH 3D23A 2WYJA 1FPHH 5FBIA 3BTGE 3HK3B 1MTNC 5C1UA 3TLOA 5C2ZA 1CO7E 1D6RA 1NT1A 3UUZA 1C2FA 1TB6H 4ESTE 3RUOA 2VWNA 4UD9H 2PLXA 1FAXA 2A1DB 1GBLA 1UK3A 1SBWA 3QO6A 2G5VA 1HAOH 4KTUA 1Z8RA 1KLIH 1Y3UA 1EASA 1NM6A 2BMGB 3L3TA 1GHAF 1KY9A 1O2OA 1HAZB 1KLJH 4E06H 5DK1A 4CHAB 2J92A 2STBE 4JMYA 1GGDC 3H7TA 1BTWA 2VB0A 1J14A 1S6HA 3STJA 2C3SA 1BMNH 4X1NU 2SGQE 3PMHB 2HWLB 1CQQA 3A7XA 1BHXB 2ZQ2A 5GIBA 3QZQA 4JZDH 3RC4A 3F9EA 5FPYA 1BRAA 2FI3E 3RXRA 2LNCA 1Z71A 5DGJA 1A1RA 1WCZA 3A82A 2ZPRA 2ZZUH 3U8TH 4CR5A 3UOUA 4VGCC 3UPEA 5PTPA 8KME2 1DSTA 4ISHH 4ZHAA 4Q7XA 1QQ4A 1UVUH 4AGKA 5EQSA 1TAWA 1TE0A 3FP7E 2VVUA 5LGOA 2A45B 1GGDB 1U6QA 4CRAA 4Q7YA 1W7XH 1QL7A 1BUIA 4FUDA 2G4TA 1GHAG 1SQTA 3K65B 4K1TA 2OC8A 1AN1E 1WTHD 1GVLA 4NZLA 1KXCA 5LPFA 4X6MA 5DG6A 4BXWA 3P70B 3JZ2B 2OUAA 1O5AB 4O3TA 1C5TA 1N1LA 1HIAA 1O5GH 2JH5D 1GI4A 8ESTE 1TPPA 1DXWA 1F7ZA 4ZMAH 3NZIA 2A5IA 1C2DA 3NUMA 1FPCH 2Q6DA 4VGCB 3SN8A 4U30A 4K3JA 9LPRA 2ZI2H 4B2AA 4HTCH 2XC5A 4J1YA 3KQEA 5DP6A 3EQ0H 5EQRA 1BTHH 4IC6A 3U69H 1FY1A 1Q31A 2J38A 1TOMH 1AB9C 2FPZA 1P2QA 1TPSA 2O8MA 2ODPA 1C5SA 1SHHB 2R0KA 1O2TA 1FMGA 2EEKA 1G36A 2C8ZB 1NZQH 1CA8B 3PMBB 1F5LA 3PO1B 1D3DB 3GY4A 1W3CA 1FIWA 5LPRA 1VCWA 4F49A 4YOJA 2VGCC 5AFYH 2ZU5A 4D7GA 2LPRA 3MNCA 1LCYA 2C8YB 2RG3A 3ATLA 3MTYA 3ZV9A 4DCDA 1HGTH 3GCHC 1HRTH 1J9CH 3QX5H 4RN6A 1P05A 1TWXB 2JH0D 4BAKB 3PLPA 4FU9A 2ZCLP 2NU3E 4ABAA 3LGTA 4INHA 4ISLA 1QQUA 1MAXA 4AYYB 1NY22 4FXGH 5G4BA 1V2ST 2PSYA 5JPMH 1UCYE 1YM0A 4FU7A 3GDVA 1FN6A 1YPJH 1NFYA 3E8LA 3VGCC 3EE0B 1D9IA 4AGJA 2IPHA 1BBRH 2WPHS 3S69A 3BTKE 1C2GA 1TMBH 1GBEA 2CHAC 4IS5A 2IN2A 2B8OH 1T8LA 2CGAA 1RFNA 2ESTE 5K7RA 3P8NA 4MPVA 4OS7A 1G9IE 3N7OA 4GCHF 4LK4A 1THSH 3UNSA 1JIRA 2K1QA 4CH2B 5JBBS 3GICB 4MG3A 1A5GH 2VINA 1BRUP 1GHXH 1NRPH 2FOGA 5I25A 2HGTH 5L2YH 3P8GA 1ELVA 2FWWA 1CHOF 1INCA 4HGCA 2D26C 5DP4A 4THNH 2ZPQA 3SORA 1MD7A 1C5UA 5GJ4B 2AYWA 3TJVA 2G55A 4GUXA 3ATMA 2ILNA 2G81E 3F9HA 4Y0ZE 1WYKA 3VXEH 4Q7ZA 1EB1H 3Q00A 2AGEX 1UMAH 4BANB 3VB4A 2EC9H 1Y3XA 1S5SA 1PYTC 1KSNA 2O8WA 1LO6A 2BXUH 4Q2KA 1S85A 4U32A 2ZPSA 6CHAC 1O3OA 3MHWU 4DVAU 1P9UA 2SFAA 2VIQA 3RXTA 2SGDE 3ZYDA 1P0SH 1DLKB 1UHBA 3EAJA 5A0AE 2UWOA 3KQBA 4GCHG 3A8CA 3MH6A 4I8JA 2Y82A 1MCTA 3MH4A 3PLKA 2WINI 3T62A 2A5KA 1PPZA 2ZIQH 1DVAH 3SV2H 1S82A 3T27A 4JZ1A 1HAVB 2F9UA 2GMTC 2EI8A 1GL1A 3M5LA 5AHGH 2BDHA 3SNCA 1DITH 4FUFA 1GMCF 3OTJE 1S83A 4YOGA 3TJOA 2QXIA 1ZMLA 1HIAB 1HAXB 1YCPH 6CHAB 2ZGXH 3TVJB 1ZR0A 3BTME 4OS1A 4GLYA 2J9NA 3TGJE 5C5NA 1OWEA 1C5MD 2BXTH 1YF4A 2Y5GA 4BNRA 2ZGCA 1GBMA 5GPIB 2AH4X 5EU8A 1O3LA 1GBDA 5E2OA 1SLUB 3SUDA 2PFEA 2QY0B 2VJ1A 1ETTH 1D3QB 1IQIA 3SJOA 3MH7A 3SU6A 1NRNH 2BY5X 1HAIH 2BY7X 4FUHA 3DT0H 1DWEH 2Z3DA 1NC6A 3GDSA 1AMHA 1BOQA 3E3TA 3RXKA 2RDLA 5JBAS 3K6ZA 4DW2U 3ZZDA 4CRBA 3BSQA 1ELAA 1GHVH 1L2EA 1P01A 1O3DA 2FX4A 3V7TA 1V3XA 4JCNA 4M7GA 1C9PA 4D9QA 5DP7A 6GCHF 1GMCG 1DFPA 3LPRA 4CH8B 1C5PA 3BEUA 1PQ8A 3S7KB 1N6YA 2Z94A 3FVFB 1XKBC 1XUIA 1DS2E 3KQDA 5A8XA 1BDAA 4JK6A 4MTBA 3I29A 1ZZZA 1P02A 5FPSA 1RRKA 2ZHWH 1TGTA 1QBNA 1SC8U 2BX4A 1KXDA 1C2EA 1BBRK 1SGFA 1BMAA 1SI5H 1SOTA 1OP0A 2OQ5A 1T8NA 4DG4A 2XBXA 2VIVA 3E6PH 3SHCH 5ESBA 3SNBA 4XSKU 2XYAA 1FY8E 3M5OA 1P2KA 1TPOA 3NKKA 2GCHG 4YO9A 2AMDA 1OWHA 1VGCB 3FAOA 1TX6A 4D76A 1HFDA 1A4WH 1ZGVA 1EPTB 2OLGA 4DOQA 1EATA 1GPZA 3AW0A 3OYPA 4AB9A 2W5EA 2CXVA 2A5AA 1EAWA 2PKAB 1HXEH 4O03A 4BAMB 2BY8X 1LKBA 1O2PA 3C27B 4BAHB 3HKJB 4RKJB 1AIXH 1MKXK 1ESAA 3T5FH 2TRMA 1O5FH 1OX1A 1W8BH 4KTCA 1O34A 5LPEA 2WV5A 5HYOA 2ZFFH 1GBCA 2EI6A 4TPYA 3RXPA 2H9TH 2DUCA 2P3FH 4X1RU 1O3JA 1BTZA 3SUFA 2NU0E 1GI2A 1JBUH 4AG2A 2QA9E 1NRRH 1F5KU 4K2YA 1O2NA 3SOSA 2BQWB 1MCVA 1JRTA 1K1OA 2BY9X 5TCAA 2FP7B 1C5VA 2THFB 2OQUA 3VB7A 1AKSA 3MU0A 2PR3A 2PGQB 1OSSA 2PWXA 1Z8GA 3T2NA 1TA6A 3TK6A 1K1IA 2AEIH 3V12A 1AHTH 1DOJA 1LPGB 4X8UH 2QN5T 1CT0E 5EQQA 3SQHE 3FZZA 4FUBA 4NCYA 5EW2H 2G4UA 2ZGBH 3L6PA 1YCPK 1TFXA 3QUMP 2R3UA 2GZ7A 2ZF0H 2WUBA 1UVTH 1E37B 2NWNA 1GBAA 1TRNA 1A3BH 1GL0E 1RTLA 3VFEA 3GYMA 3SUGA 1C5XB 2RA0A 2SGFE 4AFZA 2HALA 2NU1E 4FUIA 5AVDA 4O97A 2F91A 4I31A 2VIWA 1P09A 2ZGJA 2ZGHA 1O2JA 4AZ2B 2F3CE 2BD5A 3BTHE 3RMMH 3F9FA 3ZV8A 1V2WT 3A7ZA 1G30B 2ZP0H 1OXGA 2ULLA 2UUYA 2HNTF 2BM2A 2A4OA 1YPMH 3ATKA 5FCRA 1VJAU 1XKAC 1TGSZ 2FOFA 2FOEA 2VIOA 2W7SA 4AG1A 1A5IA 5F03A 3EGKH 1LHCH 1C5WB 3SU4A 2FXRA 1NFXA 5C3NA 1VZQH 1YPHE 2ZHEH 2XBWA 4ZHMU 3SJIA 4X1QU 1WUNH 1G3CA 2OC0A 2R9PA 4DGJA 2M5TA 3GCOA 4PROA 2HLCA 3LGIA 1O2KA 2ZTYA 1P2NA 3S9AA 1H9IE 3F9GA 5IDKA 1W12U 5FBEA 1O39A 4NA8A 1HPGA 4GHQA 1SL3A 4I32A 3SU1A 2WPIS 1LQDB 1KXBA 4DURA 2ODYB 3BTFE 1YPEH 1K22H 3TU7H 2BD7A 2ZWLH 3ESTA 4UFGH 3M35A 1Z8JB 3SJ9A 1CGJE 1LVMA 2BX3A 3A7TA 2FI4E 2I6QA 4H4FA 1DY8A 3T25A 4AOQA 3FANA 2A4GA 3UTUH 4YT6H 1FI8A 3SU3A 8GCHG 1B7XB 1DPOA 2BDIA 3DFJA 1O2RA 1QL9A 1YLDA 5HMAA 1G3DA 3GY6A 2NU4E 5DP8A 2G8TA 4FVBA 1IHSH 2OBOA 1SSXA 4GHTA 2ASUB 4BTUB 2CF9H 1E35B 3BG8A 2TIOA 3IITA 2GZ8A 3MOCA 3T29A 4ZXXH 1BTYA 1TGNA 3Q3XA 4ISIH 2Y7ZA
chains in the Genus database with same CATH superfamily
4YESB 1KDQA 2YMSD 3PMJA 1GMDG 1ELEE 3RC6A 1ACBE 2GV6A 1O31A 2BZAA 4IW4E 1HUTH 1Z6EA 4XFQA 1LDTT 5HIYA 4A1XA 1O3GA 1NBMD 2ZU4A 3PV4A 1DDJA 1C2IA 2GV7A 5EXNA 1PPGE 4MLFB 3UREA 4B75A 5FX6A 1YPGH 1HYLA 3OY6U 3SHAH 1SHYA 2BDGA 2KAIA 1V2OT 3UNRA 1TPAE 5EODA 2FO9A 4FVDA 2CV3A 4D7FA 1GVKB 1PPHE 1MU6B 3LGWA 2HRVA 4OS2A 1GJ5H 1GBFA 2XNDD 1MTNB 1ELFA 3UWJH 4JZFH 4Y6DA 3PB1E 1HV7A 1ZRKA 1P06A 1FJSA 2ANWA 4NFEA 1PFXC 1AI8H 1F92A 5A8ZA 3A88A 2ZG0H 1O3AA 3LDXH 4ABEA 3NWUA 1V6DA 1WSSH 1XVMA 3E1XB 4NWLA 3LONA 1BBRE 5DPAA 1COWD 2EI7A 3KIDU 4WF8A 1GCTC 2OC1A 1EZSC 4MPUA 1F0TA 1OYTH 4OGXA 3V13A 1OWKA 1W13U 1EQ9A 3A80A 8LPRA 2ZCHP 2Z9LA 4X8VH 1VITH 2ANMH 2BDCA 1MZDA 2Z6BD 4MNYA 3BF6H 1ABIH 2VVVA 4MNVA 1A0LA 3O8DA 1OHHD 3JZ1B 1MBQA 2ALVA 3VPKA 2F9BH 3EDXB 3WWFA 4B1TA 1O5CB 3RU4E 1O3KA 1BZXE 4TPIZ 1YPLH 1ZHPA 1BITA 2BDAA 1AD8H 4Y8YA 3F6UH 2GGVB 1LHEH 3G01A 4BTTB 1QA7A 4NG9H 2P16A 1V2VT 2QE7D 4ABHA 3PRDA 1SGNE 1V2TT 4AFQA 6ESTA 1A0HB 4MVNA 1GJ8B 1IQFA 1GCTB 3HK6B 3ZVBA 1E79D 1Q3XA 1PYTD 3U8OH 1Y59T 5GCHF 3RXVA 3VEQB 2BLWA 2BZ6H 4ABIA 1TBZH 2YMSC 4Y8ZA 4X2YA 1OWJA 5F8XA 3ZZ3A 3KYFA 4WMEA 1FY4A 1OOKB 1ANBA 5EXLA 2AS9A 3MI4A 3LIWA 3ZVEA 4F4OC 3F2HA 3PYHA 1BB0B 1QHRB 4KTSA 2ZFPH 2A4QA 1H1BA 2RDEA 1SGYE 2H9HA 4MDSA 1O2UA 2HPPH 1BT7A 2WV4A 3F68H 1CE5A 1O2SA 1KTSB 1ZGIA 2FODA 2G5NA 5JBTA 1DT2A 1OYQA 1ZPZA 3QWCH 2FTLE 2HLDD 2VWLA 3TIUA 1W14U 3BG4C 5CDFE 1K1MA 3UY9A 1GI6A 3BN9A 1F0RA 1O2MA 2WPMS 2O9QA 3PV2A 3SNDA 1O2ZA 1GDNA 3NK8A 1AB9B 1TNGA 2YMSB 4QT8C 1RJXB 1W0ZU 4AFSA 1K9OE 5E8EH 5GCHG 3AVZA 1SVPA 4ZAEA 1TLDA 4GSOA 3UB0A 1HXFH 1SGDE 4FUCA 1AU8A 1C4Y2 1VITG 4K1EA 1QBOA 2FOHA 1ZYOA 1TBRH 4U2WA 1V2LT 3ZYEA 2VGCB 2P3TB 4ZKOU 3ZVGA 1SPJA 1ESTA 3GCHB 5DP9A 1MTWA 2FOBA 2GT7A 1LPKB 1DICA 2Z3EA 1Y3YA 2ZKSA 4U01A 1NPMA 3WW7A 5F8TA 3VXFH 1KXEA 2QF3A 3FP8E 1LMWB 1G3BA 1T32A 1T4VH 3LH3A 2P95A 3E0PB 1GJCB 2VIPA 3K6YA 1OWDA 1EAUA 1UK4A 2XXLA 3B23B 1O37A 1ID5H 2WYGA 3VGCB 1ARCA 3A86A 4WVPE 1TNKA 2AIPA 3MNBA 4HG6A 1TABE 1O3PB 2CHAB 4CR9A 1OP2A 1GI7B 2XTTB 2FS9A 3STIA 2JJ2D 3A81A 2AHME 2P3UB 5HXFA 1F5RA 2KR7A 2QCYA 3ODFA 3OX7U 4XBCA 3SU5A 3UIRA 5C0UA 2SGPE 2AIQA 3E91A 1RIWC 2OINA 4ISOA 4DIHH 3CENA 2QXGA 3QK1A 1EP6A 1TNJA 2EY4C 2M2AA 1B5GH 2H6MA 3NPSA 1MZAA 4XBDA 3S0NA 3ZVCA 1NESE 2F83A 1TQ0B 3PRBA 2A4RA 3MFJA 4B2BA 4ISNA 1NN6A 1A0JA 2BHGA 3AAVA 1SGQE 1EAIA 5C5OA 1MQ5A 1C1QA 3LC3A 1GI1A 3A7WA 2QIQA 4ZUHA 1EAXA 2OD3B 4JK5A 3RXAA 5L6NH 2BD4A 3L33A 1TOCB 2D8WA 2GX4A 4OS6A 1QRZA 2G00A 1F0UA 5K0HA 2DE9A 2SGAA 5J4SA 2UWLA 1O32A 1L4ZA 2ANKH 4NFFA 1RIWB 4Y11E 3AASA 1ETSH 5DO4H 1O3CA 3A8BA 2ZDLA 2Z9IA 2BVSH 1VCQA 1YPKH 2VNTA 2RA3A 3F3BA 1BTPA 4A6LA 1BJVA 3VB6A 1C2JA 2GMTB 2ZU1A 4JYUH 1JOUB 2GCHF 1CBWC 5EOKA 2GP9B 2W3KA 3RM2H 4SGAE 3SGAE 1EOJA 5CHAC 1BA8B 1XX9A 1CA0C 1FNIA 3SO3A 1UTJA 1HBTH 5A09A 2BLOA 3H5CB 1C1UH 2HNTE 2BVRH 1UTQA 1JIMA 1S81A 3F0PA 1AVXA 3UQVA 1IQMA 5EW1H 1DUAA 5HIZA 1Z7KA 3W94A 5EJ1A 2ZDKA 3O8BA 1HAYB 3BTWE 5DP3A 5EPNA 2PV9B 1QB9A 1LHFH 4INKA 1HAHH 2Y80A 1YP9A 2JETC 1G2LA 1UJ1A 4KP0A 1AWFH 3SNAA 1JWTA 1Y3WA 3QLPH 1O2GH 2Z9JA 1T7CA 4DJZB 1YPHC 1EJMA 3ZZ7A 5E0HA 1PPBH 2K8IA 1BTXA 1QB1A 4Y7BA 2GCTC 1BHXF 3V3MA 4Y76A 4Y79A 5DJ7A 1SLVB 2P94A 3RXLA 3A85A 4ZH8A 3OFND 1UVSH 2YOLA 1B0EA 1YLCA 1HAGE 1W2KH 3SJ8A 4FUEA 3W95A 4UFFH 1SGEE 1O3FA 4BOHA 1DX5M 1Y5UT 4FUGA 1GJDB 5CMXH 3U1JB 1O2LA 2BD3A 1V2MT 3HGPA 3ZZBA 3SJKA 1QJ1B 2HVXA 2STAE 1JMOH 2WPJS 1K1PA 3RU4D 1M9UA 1MAYA 2TGAA 3P8OA 2JETB 3VB5A 3TNSA 1EFRD 1AE8H 1C1PA 1BRCE 3UR6A 3RXMA 2TGDA 1GBHA 2CN0H 3PM3A 3VB3A 2BTCE 2ZDNA 3SV6A 3EYDA 2ZU2A 3E90B 1YGCH 2FYQA 5J4QA 3SGBE 3TH3H 5FHTA 2V35A 3KL6A 3MMGA 1AFQC 4ZKSU 1L4DA 4ZCNA 4IC5A 1FUJA 1YWUA 1TX7A 2OC7A 2XCNA 2RCEA 1NRSH 5JYIA 4BTIB 1LHGH 2Z9KA 4MQAA 1FN8A 4WXVA 1P03A 4R0IA 2VH6A 1ETRH 2AMQA 4AN7A 2GDEH 5DP5A 1ZJDA 1SFIA 2C8XB 1IQGA 5KGOA 1RTFB 1E1RD 2O8LA 1ELDE 3A8AA 5L30H 1H9HE 1Y3VA 1O2IA 4ZXYH 1O36A 3SQEE 1AZ8A 1UHBB 4X6OA 4R8TB 4XE4A 5EG4A 5C20A 5TJXA 1C1NA 2J94A 1WQVH 1Y5AT 1VR1H 1O3IA 2WPKS 2OP9A 3CS0A 3M3VA 2SGEE 3QN7A 1AFQB 1RS0A 4UFDH 1YBWA 3SW2B 5H4IB 3TITA 2UUJB 1SLWB 3LJOA 1GI5A 1TRYA 1ORFA 1PPEE 1D6WA 4P02A 2H2ZA 2J4IA 4AFUA 4IGDA 3UOPA 2QAAA 2UWPA 2FTMA 2H5CA 3WY8A 3GY3A 2GVFA 4CREA 1TRMA 1ZPCA 4K60A 1MUEB 5EIYA 5HGGA 3D49H 1N8OC 4IMQA 1C1OA 3M37A 3M5NA 1FY5A 3SV7A 4D9RA 1HNEE 5EXMA 1UTPA 3TJNA 3KN2A 2ALPA 1O3HA 3ENSB 1AWHB 1DWCH 2GDDA 4TY7A 3D65E 4TY6A 2IJOB 3EA8A 1UTKA 1WBGB 3OEHD 1GDUA 3GY2A 2BD2A 1CHGA 1MBMA 1RTKA 1TNLA 3A87A 1GJAB 3DSOA 2ZFQH 2J95A 8GCHF 2W26A 3SUEA 1ZLRA 1TMUH 1GG6C 4DY7B 1CSOE 1C2HA 1C2MA 4AB8A 2SNWA 3CS7A 1EZXC 1ZTJA 2J5UA 2OCVB 4A7IB 1K1NA 1QA0A 2VU8E 1S84A 1V2UT 4IN2A 1XUFA 1A46H 1BQYA 1UVOA 2PKSC 3V0XA 2HPQH 1N8OB 1TGCA 3OEED 5JBCS 1H4WA 1DLEA 1VKYA 1AZZA 1QRWA 1CVWH 1GWAA 1S6FA 2BQ7B 1Z1IA 4H6TA 3M7TA 4WWYA 2VWOA 2FIRH 1GMDF 2G52A 1G2MA 4X6PA 4NA9H 5BRRE 3KNXA 3PTBA 4XBBA 7KMEH 4ZHLU 4OS4A 1T31A 2W6JD 4K8BA 4DIIH 2GT8A 1HAPH 1C1VH 2P8OC 1SGRE 2G51A 3RXDA 3MO9A 5JDUB 1GI0A 1HLTH 1FIZA 5F53A 1GBKA 2AGIX 3BTEE 2PP6A 1CGIE 2A31A 4B71A 2XC0A 4CBOA 4Y71A 4NWKA 3CP7A 4YTAA 1SQRA 1C1SA 1GBBA 1GJ9B 2ZO3H 4NGAH 1BIOA 2VVCA 2B0FA 2QYIA 3A83A 5DN6D 3U9AH 1NS3A 1O0DH 1LQEA 2Q1JA 2V3HH 1FLEE 4JYTA 1OP8A 3SI3H 1SQAA 2R2MB 3QDZB 1SGPE 1NFUA 2DE8A 2F9OA 3DHKH 4I8HA 2CF8H 4WH8A 1J8AA 4FETA 3A7YA 3HPTB 1A61H 2FMJA 5A2MH 4UDWH 2PUQH 2F9VA 3GISB 3RXFA 1HJAC 2FOAA 4H6SB 1GMHF 1L1NA 1W7GH 3R3GB 4X0WU 1AUTC 1TIOA 3T26A 5GXPA 3RXUA 3TK9A 2FI5E 1L0ZA 1LHDH 1LTOA 1BJUA 1KLTA 1XUKA 2I6SA 1FY3A 3BTQE 4YLUA 1NFWA 2TGTA 1EZQA 3IWMA 1P04A 1GHWH 2EA3A 2KFWA 1YCPM 3OSYA 5HKKD 2A2QH 3SV8A 1AKSB 1ANEA 4FUJA 1O33A 1WU1A 3GCTG 3SV9A 2Q6GA 2GD4B 4A1VA 1H8ED 4E7RG 3TJUA 3RXOA 2VH0A 7LPRA 2GTBA 1V2PT 3Q3YA 1EZUC 2ZFRH 2J97A 1BTUA 2SNVA 2BOKA 3H7OA 4M9FA 3PMAB 1IQLA 1S0QA 4Z0KA 1HJAB 5ABWA 1B0FA 3TH4H 1LVYA 3MNXA 3ZZ8A 5F8ZA 1GHYH 2XBYA 3I78A 1J15A 5HM2A 1ZOMA 5EJLA 1QGFA 4CRFA 4X2WA 1IQJA 1ZTKA 1GMHG 2YNAA 3UFAA 1J17T 1TONA 1O3EA 1ZPBA 1Z1JA 1O5EH 3K9XB 1D3TB 2TGPZ 3FO8D 3A8DA 3GY8A 3MYWA 5FPTA 4O9VA 3SZNA 2ZECA 1PJPA 1V2QT 1WXRA 1O35A 1GBJA 3RMNH 1UTOA 2ANYA 4K5ZA 4WY3A 3ZZAA 2QXHA 3B8JA 3R0FA 3IG6B 4XOJA 5F6MA 1ZHMA 1TX8A 2Y5HA 2UUKB 2IOTA 1MTUA 1KYNA 2Q6FA 3DFLA 3Q3KA 1YKTA 3ZZ9A 4B74A 4ACBA 1V2NT 2CMYA 2QXJA 2KX4A 1GJ4H 1GJ7B 2FX6A 1RXPA 1HAVA 2FM2A 3U98H 5I46H 3E0NB 4YM9A 1S6LA 4LXBH 2C4FH 3M7UA 4X8TH 3Q76A 5T6GA 1P2MA 2TBSA 1GI9B 2R2WU 3A84A 1K1LA 1ESBA 4E05H 5T3HA 1NRQH 2ZC9H 1GJBB 4WMFA 1HJ9A 3MQKC 5LH8A 1GI8B 3M3SA 5GDSH 3PO1C 2BYAX 1EOLA 3BEIB 4UONA 1QL8A 4TWWA 1O2VA 2GKVE 2P93A 1WOFA 2XWAA 2Y81A 3SNEA 1O38A 2PHBA 2ZTXA 3GOVB 3PWBA 4NIWA 1ANDA 4A92A 1VITF 1HB0B 3ZVDA 1BMLA 3M7QA 4HZHA 2FOCA 1MU8B 1SG8B 4ABJA 2FYRA 5KEDA 1Z6JH 1QRXA 3PTNA 1AO5A 1ANCA 4ABGA 1UK2A 2D1JA 2H5DA 1P3EA 4FOUC 3H09A 1G37A 1UVPA 3P8FA 3QTOH 4HFPB 4RSPA 3UAIC 4CBNA 5C1YA 1SLXB 1KXAA 2ZHQH 2HNTC 1Y5BT 2AFQB 2C90B 1V2KT 2PW8H 1KTTB 2UUFB 4Q4LA 1IQHA 4ZROA 1NU9A 2GJGA 3SYJA 1IHTH 3F2FA 3ZVAA 1P10A 4AC9A 2ZHFH 1AQ7A 4Y10E 1AVGH 4TWYA 2ZCKP 4WMDA 3ZZ6A 1SKYE 5C1XA 1AY6H 2B7DH 3BIUH 1QJ7B 3FZDA 1C5RA 1D4PB 1O5DH 1P12E 1SB1H 1GCDA 1DSUA 4NZQA 4NIVA 3BV9B 5IYTA 1V2RT 3FN8A 1DM4B 3RU4T 1BRBE 2ZFSA 2Z7FE 3ZZ4A 3EA7A 3RXEA 1E36B 3SU0A 2OK5A 2CK3D 2J2UA 2F43B 2PTNA 1QFKH 1KDQB 1C9TA 3SI4H 3MO3A 3URCA 1WAYB 1CGHA 2XCFA 1RGQA 3BG4B 3KHVA 1W10U 2XC4A 1C1WH 4D8NA 1EPTA 1DWDH 1O2YA 1GHZA 4NIXA 5EPYA 5JB8S 1HDTH 2A7HA 1TGBA 3KEEA 4KGAA 4X1SU 4B2CA 2KAIB 2IPQX 4JZEH 1AVWA 1C1RA 2PKAA 5KECA 3NCLA 3GDUA 3FFGA 4WJG2 3QGJA 1QTFA 3GS9A 2ZDVH 2ZNKH 1ELBA 1IOEA 1THPB 1EX3A 3TH2H 3P17H 4Y8XA 4KKDA 1DY9A 1ELCA 1EUFA 1DXPA 1TYNA 1QJ6B 1O5BB 2XWBI 4WH6A 1NROH 2A7JA 1MKXH 3GCNA 2FESH 4I8KA 1E34B 4YZUA 3LKWA 3OU0A 4CRCA 4LZ4B 4UFEH 2J98A 4A1TA 1CT4E 1UTNA 1C1MA 1WTGH 2Z3CA 1IQKA 1V2JT 1D3PB 3SBKA 2FZZA 1MTSA 4Y0YE 2FLRH 2QV1A 4RT1A 3ZZCA 4UEHH 3TGKE 4NA7A 1K21H 4DT7B 1T4UH 1LPZB 1TNHA 1E0FD 1C1TA 4IBLH 1ARBA 3KCGH 1OPHB 5CE1A 2BVXH 3FOAA 1CHOG 1TALA 1MH0A 2FS8A 1LKAA 5HM9A 1O30A 3BTDE 4ABFA 1ELGA 1P57B 3DCLA 1EJNA 3RXCA 4WXIA 4FU8A 1QB6A 1QCPA 2JH6D 1EJAA 2FOMB 2R0LA 1ZSKA 2A2XH 2ODQA 1VJ9U 2J34A 3RXBA 3GYLB 2OBQA 3TGIE 1PPCE 1LVBA 1H9LB 1SGCA 1C4V2 5SGAE 1FQ3A 4X6NA 4H42U 1ABJH 1Z8IB 4AYVB 2BLVA 3KYGA 2BD8A 2ZDAH 3RXIA 1UCYH 1XVOA 3HKIB 3BIVH 3UNQA 2BD9A 2XOKD 6LPRA 4ABBA 1XXFA 1MKWH 1TQ7B 1AFEH 3QGNB 3F1SB 4YLQH 2TPIZ 1PPFE 3Q77A 2H1UA 3TNTA 4MNXA 4XRNA 3LGUA 1UO6A 3D62A 4I8GA 3MNSA 1W0YH 1ZRBA 3TPIZ 3U1IB 1C5QA 1KIGH 3MH5A 5GWZA 3RP2A 3GY5A 4I33A 3HGNA 9ESTA 1L1JA 4KELA 2V0BA 3SGQE 3OY5U 1QIXB 1SGFG 1A7SA 1P3CA 5C0TA 3S7HB 1X7AC 2A32A 3KGPA 1ELTA 1O3MA 2OXSA 3P92A 1XUJA 2QC2A 3K2UA 1VGCC 2FDAA 4K1SA 4HI3A 1EPTC 1PQ7A 1BMFD 4F48B 1AUJA 5TCCA 1UTMA 1CBWB 2BQ6B 3I77A 3O8CA 5CHAB 4GPGA 4Z6AH 1IQEA 2WPLS 1SMFE 1CA0B 2W3IA 2C8WB 3ZIAD 1EKBB 1WQSA 1C4U2 3RXSA 3ATIA 1AE5A 2W7UA 1O3BA 3LOXA 4OGYA 2OTVA 5FL7D 1T8MA 1EP5A 2QGRA 4GAWA 2R3YA 1OS8A 4CRDA 2PTCE 1LVOA 1N6XA 3QZRA 5E0JA 5A0BA 3RXQA 1MD8A 4NIYA 1ZSJA 1QURH 1NU7B 1OWIA 1O2WA 3MU8A 1GBTA 5FXLA 1K2I1 1GJ6A 2Y6TA 1IAUA 1FAKH 3LGYA 4ZKNU 5T6FA 1XMNB 1ZTLA 2ZDMA 2NU2E 1P9SA 2BB4A 2IJD1 2KM0A 2HVYB 4IMZA 1OKXA 1JRSA 1L1GA 5E0GA 1SQOA 2AERH 2GCTB 2GZ9A 5DKMA 1TA2A 5GNDA 4X1PU 3LH1A 4JYVH 1O2XA 3LGVA 6GCHG 1DE7H 3RMOH 1GVZA 4J2YB 1P2JA 4B73A 2WPDD 2FEQH 4JZIA 3DUXH 1XXDA 2BLQA 3LJJA 3URDA 1GBIA 3ELAH 1J16A 5A8YA 1XM1A 3NXPA 4YT7H 1CT2E 2K0QA 4O3UA 3RXHA 3RLYH 5ETXA 3ZVFA 4K69A 3RXJA 2HOBA 2A7CA 1SFQB 3MWIU 5FCKA 1DWBH 1H8DH 1P2OA 1ZHRA 3S9BA 2L74A 1XUHA 1QY6A 1NO9H 1TMTH 2YNBA 2B5TB 2C93B 3HATH 1C2KA 1Q2WA 1UW7A 1FZZA 1K28D 2V6NA 4BAQB 3ZZ5A 3FP6E 1THRH 4X2VA 3BEFB 3TK5A 1KXFA 1IQNA 2CJIA 3LT3A 1RD3B 2ZFTA 1S0RA 5B6OA 4X8SH 2AMPA 5C67A 1ZJKA 2KCPA 2H9EH 4TYDA 2BDYA 3O8RA 1P2IA 2V3OH 4YOIA 2F9NA 4MPXA 4X2XA 1SOZA 3OAAD 5DSFA 4A5TS 1A3EH 3PWCA 7GCHF 2FLBH 3PLBA 3PV5A 2VBCA 4IN1A 2KCOA 3U8RH 1P8VC 3LC5A 1A2CH 3GY7A 1ZMJA 1MABB 1EB2A 3PROA 4ASHA 1EXFA 1GDQA 1GHBF 4MNWA 1F2SE 2JJ1D 1HCGA 4ZKRU 1W11U 1A5HA 4OS5A 1YC0A 3RLWH 4E7NA 1C5YB 3MU1A 1ZMNA 2O8UA 3ATWA 3MU4A 1UCYK 2Y5FA 7ESTE 1QBVH 1C2LA 1HJ8A 3ODDA 1C5NH 5BPEA 3UQOA 4BAOB 3RM0H 1MKWK 3DA9B 5JB9S 1YYY1 2P59A 1SGTA 4SGBE 4LZ1H 2WUCA 1FV9A 4AX9H 3KQCA 1WV7H 2VWMA 5ESTE 1SR5C 1QNJA 5A0CA 1QR3E 3DD2H 1O2QA 2ZQ1A 5FAHA 4I8LA 2XW9A 1PQAA 3KF2A 5E2PA 1C5OH 3P6ZB 4Q63A 1E38B 3E16B 3RDZA 3DSPA 1FDPA 4BXSA 3T28A 1O3NA 1F0SA 1ZSLA 2XNIA 2ZEBA 3SU2A 5T1VA 3UWIA 1TNIA 3A89A 1G32B 1DUEA 1FXYA 2V7QD 2BY6X 2XRCA 4INLA 4OM9A 7GCHG 2L6OA 3RXGA 1FONA 2ZTZA 2ZHDA 1TBQH 1BMMH 2ZA5A 3AW1A 3P95A 1GHBG 2AGGX 1MQ6A 4UE7H 3U28C 4NSYA 3MO6A 1XUGA 4LOYH 2ZU3A 5AFZH 2PGBB 1P11E 1T8OA 2B9LA 3UR9A 1JXPA 1BCUH 2PSXA 3M5MA 1MTVA 2A0QB 2F9PA 1GG6B 2QF0A 4MPWA 4I86A 2VIDA 5FX5A 3LU9B 3B9FH 1SGIB 5T6DA 5L2ZH 4K8YA 3GCTF 2O8TA 4CRGA 2PKSB 1UTLM 2PUXB 1DANH 3ITIA 3QTVH 1CU1A 1K1JA 1C5ZB 3BTTE 3OE7D 3RMLH 2JKHA 5AF9H 4ABDA 1PQ5A 1VCPA 1C5LH 4XDEA 4RKOB 3C1KA 4Q80A 1Y8TA 3AAUA 1K0HA 1GI3A 3A7VA 4I7YH 2Y7XA 4NSVA 3M3TA 4CHAC 1G3EA 3S9CA 3MU5A 4AORA 3EE7A 2XBVA 1MMJN 2F4LA 3M61U 1O2HA 4B76A 3M36A 5EGMA 1AGJA 3EA9A 1NTPA 3RC5A 3CNRA 2BOHB 2P8OB 4GVUA 2Z9GA 2BDBA 2D2DA 4Y7AA 1H8IH 3D23A 2WYJA 1FPHH 5FBIA 2LELA 3BTGE 3HK3B 1MTNC 5C1UA 3TLOA 5C2ZA 1CO7E 1D6RA 1NT1A 3UUZA 1E1QD 1C2FA 1TB6H 4ESTE 3RUOA 3N99A 2VWNA 4UD9H 2PLXA 1FAXA 4ASUD 2A1DB 1GBLA 1UK3A 1SBWA 3QO6A 2G5VA 1HAOH 4KTUA 1Z8RA 1KLIH 1Y3UA 1EASA 1NM6A 2BMGB 3L3TA 1GHAF 1KY9A 1O2OA 1HAZB 1KLJH 4E06H 5DK1A 4CHAB 2J92A 2STBE 4JMYA 2QF5A 2WZQA 1GGDC 3H7TA 1BTWA 2VB0A 1J14A 1S6HA 3STJA 2C3SA 1BMNH 4X1NU 2SGQE 3PMHB 2HWLB 1CQQA 3A7XA 1BHXB 2ZQ2A 5GIBA 3QZQA 4JZDH 3RC4A 3F9EA 5FPYA 1BRAA 2FI3E 3RXRA 2LNCA 1Z71A 5DGJA 1A1RA 1WCZA 3A82A 2ZPRA 4Z1MD 2ZZUH 3U8TH 2WV9A 4CR5A 3UOUA 4VGCC 3UPEA 2KZ4A 5PTPA 8KME2 1DSTA 4ISHH 2EQNA 4ZHAA 4Q7XA 1QQ4A 1UVUH 4AGKA 3WWBA 5EQSA 5IK2D 1TAWA 1TE0A 3FP7E 2VVUA 5LGOA 2A45B 1GGDB 1U6QA 4CRAA 4Q7YA 1W7XH 1QL7A 1BUIA 4FUDA 2G4TA 1GHAG 1SQTA 3K65B 4K1TA 2OC8A 1AN1E 1WTHD 1GVLA 4NZLA 1KXCA 5LPFA 4X6MA 5DG6A 4BXWA 3P70B 3JZ2B 2OUAA 1O5AB 4O3TA 1C5TA 1N1LA 1HIAA 1W0JD 1O5GH 2JH5D 1GI4A 8ESTE 1TPPA 1DXWA 1F7ZA 4ZMAH 3NZIA 2A5IA 1C2DA 3NUMA 1FPCH 4P00A 2Q6DA 4VGCB 3SN8A 4U30A 4K3JA 9LPRA 2ZI2H 4B2AA 4HTCH 2XC5A 4J1YA 3KQEA 5DP6A 3EQ0H 3F0OA 2WSSD 5EQRA 1BTHH 4IC6A 3U69H 1FY1A 1Q31A 2J38A 1TOMH 1AB9C 2FPZA 1P2QA 1TPSA 2O8MA 2ODPA 1C5SA 1SHHB 2R0KA 1O2TA 1FMGA 2EEKA 1G36A 2C8ZB 1NZQH 1CA8B 3PMBB 1F5LA 3PO1B 1D3DB 3GY4A 1W3CA 1FIWA 5LPRA 3SZEA 1KMHB 1VCWA 4F49A 4YOJA 2VGCC 5AFYH 2ZU5A 4D7GA 2LPRA 3MNCA 1LCYA 2C8YB 2RG3A 3ATLA 3MTYA 3ZV9A 4DCDA 1HGTH 3GCHC 1HRTH 1J9CH 3QX5H 4RN6A 2KCAA 1P05A 1TWXB 2JH0D 4BAKB 3PLPA 4FU9A 2ZCLP 2NU3E 4ABAA 3LGTA 4INHA 3KQ5A 4ISLA 1QQUA 1MAXA 4AYYB 1YLNA 1H8HD 1NY22 4FXGH 5C94A 5G4BA 1V2ST 2PSYA 5JPMH 2RFKC 1UCYE 1YM0A 4FU7A 3GDVA 1FN6A 1YPJH 1NFYA 3E8LA 3VGCC 3EE0B 1D9IA 4AGJA 2IPHA 1BBRH 2WPHS 3S69A 3BTKE 1C2GA 1TMBH 1GBEA 2CHAC 4IS5A 2IN2A 2B8OH 1T8LA 2CGAA 1RFNA 2ESTE 5K7RA 3P8NA 4MPVA 4OS7A 1G9IE 3N7OA 4GCHF 4LK4A 1THSH 3UNSA 1JIRA 2K1QA 4CH2B 5JBBS 3GICB 4MG3A 1A5GH 2VINA 1BRUP 4TT3D 1GHXH 1NRPH 2FOGA 5I25A 2HGTH 5L2YH 3P8GA 1ELVA 2FWWA 1CHOF 1INCA 4HGCA 2D26C 5DP4A 4THNH 2ZPQA 3SORA 4ACAA 1MD7A 1C5UA 5GJ4B 2AYWA 3TJVA 2G55A 4GUXA 3ATMA 2ILNA 2G81E 3F9HA 4Y0ZE 1WYKA 3VXEH 4Q7ZA 1EB1H 3Q00A 2AGEX 3N7DA 1UMAH 3DSGA 4BANB 3VB4A 2EC9H 1Y3XA 4RI0A 1S5SA 1PYTC 1KSNA 2O8WA 1LO6A 2BXUH 4Q2KA 1S85A 4U32A 2ZPSA 6CHAC 1O3OA 4F55A 3MHWU 4DVAU 1P9UA 2SFAA 2VIQA 3RXTA 2SGDE 4YXWD 3ZYDA 1P0SH 1DLKB 1UHBA 2V3MA 3EAJA 5A0AE 2UWOA 3KQBA 4GCHG 2LP6A 3A8CA 3MH6A 4I8JA 2Y82A 1MCTA 3MH4A 3PLKA 2WINI 2JIZD 3T62A 2A5KA 1PPZA 2ZIQH 1DVAH 3SV2H 1S82A 3T27A 4JZ1A 1HAVB 2F9UA 2GMTC 2WHXA 5B6LA 2EI8A 1GL1A 3M5LA 5AHGH 2BDHA 3SNCA 1DITH 4FUFA 1GMCF 3OTJE 1S83A 4YOGA 3TJOA 2QXIA 1ZMLA 1HIAB 1HAXB 1YCPH 6CHAB 2ZGXH 3TVJB 1ZR0A 3BTME 4OS1A 4GLYA 2J9NA 3TGJE 5C5NA 1OWEA 1C5MD 2BXTH 1YF4A 2Y5GA 4BNRA 2ZGCA 1GBMA 2KCYA 5GPIB 2AH4X 5EU8A 1O3LA 1GBDA 5E2OA 1SLUB 3SUDA 2PFEA 2QY0B 2VJ1A 1ETTH 1D3QB 1IQIA 1YY3A 3SJOA 3FKSD 3MH7A 3SU6A 1NRNH 1NBME 2BY5X 1HAIH 2BY7X 4FUHA 3DT0H 1DWEH 2Z3DA 1NC6A 3GDSA 1QZ8A 1AMHA 1BOQA 3E3TA 3RXKA 4TSFD 2RDLA 5JBAS 3K6ZA 4DW2U 3ZZDA 4CRBA 3BSQA 1ELAA 1GHVH 1L2EA 1P01A 1O3DA 1WDIA 2FX4A 3V7TA 1V3XA 4JCNA 4M7GA 1C9PA 4D9QA 5DP7A 6GCHF 1GMCG 1DFPA 3LPRA 3N7EA 4CH8B 1C5PA 3BEUA 1PQ8A 3S7KB 1N6YA 2Z94A 3FVFB 1XKBC 1XUIA 1DS2E 3KQDA 5A8XA 1BDAA 4JK6A 4MTBA 3I29A 1ZZZA 2W6ID 1P02A 5FPSA 1RRKA 2ZHWH 1TGTA 1QBNA 1SC8U 2BX4A 1KXDA 4RT0A 1C2EA 1BBRK 1SGFA 5EJZA 1BMAA 1SI5H 1SOTA 2JDID 1OP0A 2OQ5A 1T8NA 4DG4A 2XBXA 2VIVA 3E6PH 3SHCH 5ESBA 3SNBA 4XSKU 2XYAA 1FY8E 3M5OA 1P2KA 1TPOA 3NKKA 2GCHG 4YO9A 2AMDA 1OWHA 1VGCB 3FAOA 1TX6A 4D76A 1HFDA 1A4WH 1ZGVA 1EPTB 2OLGA 4DOQA 1EATA 1GPZA 3AW0A 3OYPA 4AB9A 2W5EA 2CXVA 2A5AA 1EAWA 2PKAB 1HXEH 4O03A 4BAMB 2BY8X 1LKBA 1O2PA 3C27B 4BAHB 3HKJB 4RKJB 1AIXH 1MKXK 1ESAA 3T5FH 5C17A 2TRMA 1O5FH 1OX1A 1W8BH 4KTCA 1O34A 5LPEA 3F2GA 2WV5A 5HYOA 2ZFFH 1GBCA 2EI6A 4TPYA 3RXPA 2H9TH 2DUCA 2P3FH 4X1RU 1O3JA 1BTZA 3SUFA 2NU0E 1GI2A 1JBUH 4AG2A 2QA9E 1NRRH 1F5KU 4K2YA 1O2NA 3SOSA 2BQWB 1MCVA 1JRTA 1K1OA 2BY9X 5TCAA 2FP7B 2J98B 1C5VA 2THFB 2OQUA 3VB7A 1AKSA 3MU0A 2PR3A 2PGQB 1OSSA 2PWXA 1Z8GA 3T2NA 1TA6A 3TK6A 1K1IA 2AEIH 3W1EA 3V12A 1AHTH 1DOJA 1W0KD 1LPGB 4X8UH 2QN5T 1CT0E 5EQQA 3SQHE 3FZZA 4FUBA 4NCYA 5EW2H 2G4UA 2ZGBH 3L6PA 1YCPK 1TFXA 3QUMP 2R3UA 2GZ7A 2ZF0H 2WUBA 1UVTH 1E37B 2NWNA 1GBAA 1TRNA 2QF4A 1A3BH 1GL0E 3NRLA 1RTLA 3VFEA 3GYMA 3SUGA 1C5XB 2RA0A 2SGFE 4AFZA 2HALA 2NU1E 4FUIA 5AVDA 4O97A 2F91A 4B6EA 4I31A 2VIWA 1P09A 2ZGJA 2ZGHA 1O2JA 4AZ2B 2F3CE 5CHBA 2BD5A 3BTHE 3RMMH 3F9FA 3ZV8A 1V2WT 3A7ZA 1G30B 2ZP0H 1OXGA 2ULLA 2UUYA 2HNTF 2BM2A 2A4OA 1YPMH 3ATKA 5FCRA 1VJAU 1XKAC 1TGSZ 2FOFA 2FOEA 2VIOA 2W7SA 4AG1A 1A5IA 5F03A 3EGKH 1LHCH 1C5WB 3SU4A 2FXRA 1NFXA 5C3NA 1VZQH 1YPHE 2ZHEH 2XBWA 4ZHMU 3SJIA 4X1QU 1WUNH 1G3CA 2OC0A 2R9PA 4DGJA 2M5TA 3GCOA 4PROA 1FX0B 2HLCA 3LGIA 1O2KA 2ZTYA 1P2NA 3S9AA 1H9IE 4XD7D 3F9GA 5IDKA 1W12U 5FBEA 4DT4A 1O39A 4NA8A 1HPGA 4GHQA 1SL3A 4I32A 3SU1A 2WPIS 1LQDB 1KXBA 4DURA 3OTPA 2ODYB 3BTFE 1YPEH 1K22H 3TU7H 2BD7A 4B6FA 2ZWLH 3ESTA 4UFGH 3M35A 1Z8JB 3SJ9A 1CGJE 1LVMA 2BX3A 3A7TA 2FI4E 2I6QA 4H4FA 1DY8A 3VG8A 3T25A 4AOQA 3FANA 2A4GA 3UTUH 4YT6H 1FI8A 3SU3A 8GCHG 1B7XB 1DPOA 2BDIA 3DFJA 1O2RA 1QL9A 1YLDA 5HMAA 1G3DA 3GY6A 2NU4E 5DP8A 2G8TA 4FVBA 1IHSH 2OBOA 1SSXA 4GHTA 2ASUB 4BTUB 2CF9H 1E35B 3BG8A 2TIOA 3IITA 2GZ8A 3MOCA 3T29A 4ZXXH 1BTYA 1TGNA 3Q3XA 3AK5A 4ISIH 2Y7ZA
chains in the Genus database with same CATH topology
4YESB 1KDQA 3PMJA 1GMDG 1ELEE 3RC6A 1ACBE 2GV6A 1O31A 2BZAA 4IW4E 1HUTH 1Z6EA 4XFQA 1LDTT 4A1XA 1O3GA 2ZU4A 3PV4A 1DDJA 1C2IA 2GV7A 5EXNA 1PPGE 4MLFB 3UREA 4B75A 5FX6A 1YPGH 1HYLA 3OY6U 3SHAH 1SHYA 2BDGA 2KAIA 1V2OT 3UNRA 1TPAE 5EODA 2FO9A 4FVDA 2CV3A 4D7FA 1GVKB 1PPHE 1MU6B 3LGWA 2HRVA 4OS2A 1GJ5H 1GBFA 1MTNB 1ELFA 3UWJH 4JZFH 4Y6DA 3PB1E 1HV7A 1ZRKA 1P06A 1FJSA 2ANWA 4NFEA 1PFXC 1AI8H 1F92A 5A8ZA 3A88A 2ZG0H 1O3AA 3LDXH 4ABEA 3NWUA 1V6DA 1WSSH 1XVMA 3E1XB 4NWLA 3LONA 1BBRE 5DPAA 2EI7A 3KIDU 4WF8A 1GCTC 2OC1A 1EZSC 4MPUA 1F0TA 1OYTH 4OGXA 3V13A 1OWKA 1W13U 1EQ9A 3A80A 8LPRA 2ZCHP 2Z9LA 4X8VH 1VITH 2ANMH 2BDCA 1MZDA 2Z6BD 4MNYA 3BF6H 1ABIH 2VVVA 4MNVA 1A0LA 3O8DA 3JZ1B 1MBQA 2ALVA 3VPKA 2F9BH 3EDXB 4B1TA 1O5CB 3RU4E 1O3KA 1BZXE 4TPIZ 1YPLH 1ZHPA 1BITA 2BDAA 1AD8H 4Y8YA 3F6UH 2GGVB 1LHEH 3G01A 4BTTB 1QA7A 4NG9H 2P16A 1V2VT 4ABHA 1SGNE 1V2TT 4AFQA 6ESTA 1A0HB 4MVNA 1GJ8B 1IQFA 1GCTB 3HK6B 3ZVBA 1Q3XA 1PYTD 3U8OH 1Y59T 5GCHF 3RXVA 3VEQB 2BLWA 2BZ6H 4ABIA 1TBZH 4Y8ZA 4X2YA 1OWJA 5F8XA 3ZZ3A 4WMEA 1FY4A 1OOKB 1ANBA 5EXLA 2AS9A 3MI4A 3LIWA 3ZVEA 4F4OC 3PYHA 1BB0B 1QHRB 4KTSA 2ZFPH 2A4QA 1H1BA 1SGYE 2H9HA 4MDSA 1O2UA 2HPPH 1BT7A 2WV4A 3F68H 1CE5A 1O2SA 1KTSB 1ZGIA 2FODA 2G5NA 5JBTA 1DT2A 1OYQA 1ZPZA 3QWCH 2FTLE 2VWLA 3TIUA 1W14U 3BG4C 1K1MA 3UY9A 1GI6A 3BN9A 1F0RA 1O2MA 2WPMS 2O9QA 3SNDA 1O2ZA 1GDNA 3NK8A 1AB9B 1TNGA 4QT8C 1RJXB 1W0ZU 4AFSA 1K9OE 5E8EH 5GCHG 3AVZA 1SVPA 4ZAEA 1TLDA 4GSOA 1HXFH 1SGDE 4FUCA 1AU8A 1C4Y2 1VITG 4K1EA 1QBOA 2FOHA 1ZYOA 1TBRH 4U2WA 1V2LT 3ZYEA 2VGCB 2P3TB 4ZKOU 3ZVGA 1SPJA 1ESTA 3GCHB 5DP9A 1MTWA 2FOBA 2GT7A 1LPKB 1DICA 2Z3EA 1Y3YA 2ZKSA 4U01A 1NPMA 5F8TA 3VXFH 1KXEA 2QF3A 3FP8E 1LMWB 1G3BA 1T32A 1T4VH 3LH3A 2P95A 3E0PB 1GJCB 2VIPA 3K6YA 1OWDA 1EAUA 1UK4A 2XXLA 3B23B 1O37A 1ID5H 2WYGA 3VGCB 1ARCA 3A86A 4WVPE 1TNKA 2AIPA 3MNBA 1TABE 1O3PB 2CHAB 4CR9A 1OP2A 1GI7B 2XTTB 2FS9A 3STIA 3A81A 2P3UB 5HXFA 1F5RA 2QCYA 3ODFA 3OX7U 4XBCA 3SU5A 3UIRA 2SGPE 2AIQA 3E91A 1RIWC 2OINA 4ISOA 4DIHH 3CENA 2QXGA 3QK1A 1EP6A 1TNJA 1B5GH 2H6MA 3NPSA 1MZAA 4XBDA 3S0NA 3ZVCA 1NESE 2F83A 1TQ0B 2A4RA 3MFJA 4B2BA 4ISNA 1NN6A 1A0JA 2BHGA 3AAVA 1SGQE 1EAIA 5C5OA 1MQ5A 1C1QA 3LC3A 1GI1A 3A7WA 2QIQA 4ZUHA 1EAXA 2OD3B 4JK5A 3RXAA 5L6NH 2BD4A 3L33A 1TOCB 2D8WA 2GX4A 4OS6A 1QRZA 2G00A 1F0UA 5K0HA 2DE9A 2SGAA 5J4SA 2UWLA 1O32A 1L4ZA 2ANKH 4NFFA 1RIWB 4Y11E 3AASA 1ETSH 5DO4H 1O3CA 3A8BA 2ZDLA 2Z9IA 2BVSH 1VCQA 1YPKH 2VNTA 2RA3A 1BTPA 4A6LA 1BJVA 3VB6A 1C2JA 2GMTB 2ZU1A 4JYUH 1JOUB 2GCHF 1CBWC 5EOKA 2GP9B 2W3KA 3RM2H 4SGAE 3SGAE 1EOJA 5CHAC 1BA8B 1XX9A 1CA0C 1FNIA 3SO3A 1UTJA 1HBTH 5A09A 2BLOA 3H5CB 1C1UH 2HNTE 2BVRH 1UTQA 1JIMA 1S81A 1AVXA 3UQVA 1IQMA 5EW1H 1DUAA 1Z7KA 3W94A 2ZDKA 3O8BA 1HAYB 3BTWE 5DP3A 5EPNA 2PV9B 1QB9A 1LHFH 4INKA 1HAHH 2Y80A 1YP9A 2JETC 1G2LA 1UJ1A 4KP0A 1AWFH 3SNAA 1JWTA 1Y3WA 3QLPH 1O2GH 2Z9JA 1T7CA 4DJZB 1YPHC 1EJMA 3ZZ7A 5E0HA 1PPBH 1BTXA 1QB1A 4Y7BA 2GCTC 1BHXF 3V3MA 4Y76A 4Y79A 5DJ7A 1SLVB 2P94A 3RXLA 3A85A 4ZH8A 1UVSH 2YOLA 1B0EA 1YLCA 1HAGE 1W2KH 3SJ8A 4FUEA 3W95A 4UFFH 1SGEE 1O3FA 4BOHA 1DX5M 1Y5UT 4FUGA 1GJDB 5CMXH 3U1JB 1O2LA 2BD3A 1V2MT 3HGPA 3ZZBA 3SJKA 1QJ1B 2HVXA 2STAE 1JMOH 2WPJS 1K1PA 3RU4D 1M9UA 1MAYA 2TGAA 3P8OA 2JETB 3VB5A 3TNSA 1AE8H 1C1PA 1BRCE 3UR6A 3RXMA 2TGDA 1GBHA 2CN0H 3PM3A 3VB3A 2BTCE 2ZDNA 3SV6A 3EYDA 2ZU2A 3E90B 1YGCH 2FYQA 5J4QA 3SGBE 3TH3H 5FHTA 2V35A 3KL6A 3MMGA 1AFQC 4ZKSU 1L4DA 4IC5A 1FUJA 2OC7A 1TX7A 2XCNA 2RCEA 1NRSH 5JYIA 4BTIB 1LHGH 2Z9KA 4MQAA 1FN8A 4WXVA 1P03A 4R0IA 2VH6A 1ETRH 2AMQA 4AN7A 2GDEH 5DP5A 1ZJDA 1SFIA 2C8XB 1IQGA 1RTFB 2O8LA 1ELDE 3A8AA 5L30H 1H9HE 1Y3VA 1O2IA 4ZXYH 1O36A 3SQEE 1AZ8A 1UHBB 4X6OA 4R8TB 4XE4A 5EG4A 5C20A 5TJXA 1C1NA 2J94A 1WQVH 1Y5AT 1VR1H 1O3IA 2WPKS 2OP9A 3CS0A 3M3VA 2SGEE 3QN7A 1AFQB 1RS0A 4UFDH 1YBWA 3SW2B 5H4IB 3TITA 2UUJB 1SLWB 3LJOA 1GI5A 1TRYA 1ORFA 1PPEE 1D6WA 2H2ZA 2J4IA 4AFUA 4IGDA 3UOPA 2QAAA 2UWPA 2FTMA 2H5CA 3WY8A 3GY3A 2GVFA 4CREA 1TRMA 1ZPCA 4K60A 1MUEB 5HGGA 3D49H 1N8OC 4IMQA 1C1OA 3M37A 3M5NA 1FY5A 3SV7A 4D9RA 1HNEE 5EXMA 1UTPA 3TJNA 3KN2A 2ALPA 1O3HA 3ENSB 1AWHB 1DWCH 2GDDA 4TY7A 3D65E 4TY6A 2IJOB 3EA8A 1UTKA 1WBGB 1GDUA 3GY2A 2BD2A 1CHGA 1MBMA 1RTKA 1TNLA 3A87A 1GJAB 2ZFQH 2J95A 8GCHF 2W26A 3SUEA 1ZLRA 1TMUH 1GG6C 4DY7B 1CSOE 1C2HA 1C2MA 4AB8A 2SNWA 3CS7A 1EZXC 1ZTJA 2OCVB 4A7IB 1K1NA 1QA0A 2VU8E 1S84A 1V2UT 4IN2A 1XUFA 1A46H 1BQYA 1UVOA 2PKSC 3V0XA 2HPQH 1N8OB 1TGCA 5JBCS 1H4WA 1DLEA 1AZZA 1QRWA 1CVWH 1GWAA 1S6FA 2BQ7B 1Z1IA 4H6TA 3M7TA 4WWYA 2VWOA 2FIRH 1GMDF 2G52A 1G2MA 4X6PA 4NA9H 5BRRE 3KNXA 3PTBA 4XBBA 7KMEH 4ZHLU 4OS4A 1T31A 4K8BA 4DIIH 2GT8A 1HAPH 1C1VH 2P8OC 1SGRE 2G51A 3RXDA 3MO9A 5JDUB 1GI0A 1HLTH 1FIZA 1GBKA 2AGIX 3BTEE 1CGIE 2A31A 4B71A 2XC0A 4CBOA 4Y71A 4NWKA 3CP7A 4YTAA 1C1SA 1GBBA 1GJ9B 2ZO3H 4NGAH 1BIOA 2VVCA 2B0FA 2QYIA 3A83A 3U9AH 1NS3A 1O0DH 1LQEA 2Q1JA 2V3HH 1FLEE 4JYTA 1OP8A 3SI3H 1SQAA 2R2MB 3QDZB 1SGPE 1NFUA 2DE8A 2F9OA 3DHKH 4I8HA 2CF8H 4WH8A 1J8AA 3A7YA 3HPTB 1A61H 2FMJA 5A2MH 4UDWH 2PUQH 2F9VA 3GISB 3RXFA 1HJAC 2FOAA 4H6SB 1GMHF 1L1NA 1W7GH 3R3GB 4X0WU 1AUTC 1TIOA 3T26A 5GXPA 3RXUA 3TK9A 2FI5E 1L0ZA 1LHDH 1LTOA 1BJUA 1KLTA 1XUKA 2I6SA 1FY3A 3BTQE 4YLUA 1NFWA 2TGTA 1EZQA 3IWMA 1P04A 1GHWH 2EA3A 3OSYA 1YCPM 2A2QH 3SV8A 1AKSB 1ANEA 4FUJA 1O33A 1WU1A 3GCTG 3SV9A 2Q6GA 2GD4B 4A1VA 4E7RG 3TJUA 3RXOA 2VH0A 7LPRA 2GTBA 1V2PT 3Q3YA 1EZUC 2ZFRH 1BTUA 2SNVA 2BOKA 3H7OA 3PMAB 1IQLA 1S0QA 4Z0KA 1HJAB 5ABWA 1B0FA 3TH4H 1LVYA 3MNXA 3ZZ8A 5F8ZA 1GHYH 2XBYA 3I78A 1J15A 5HM2A 1ZOMA 1QGFA 4CRFA 4X2WA 1IQJA 1ZTKA 1GMHG 2YNAA 3UFAA 1J17T 1TONA 1O3EA 1ZPBA 1Z1JA 1O5EH 3K9XB 1D3TB 2TGPZ 3A8DA 3GY8A 3MYWA 5FPTA 4O9VA 3SZNA 2ZECA 1PJPA 1V2QT 1O35A 1GBJA 3RMNH 1UTOA 2ANYA 4K5ZA 4WY3A 3ZZAA 2QXHA 3B8JA 3R0FA 3IG6B 4XOJA 5F6MA 1ZHMA 1TX8A 2Y5HA 2UUKB 2IOTA 1MTUA 1KYNA 2Q6FA 3DFLA 3Q3KA 1YKTA 3ZZ9A 4B74A 1V2NT 2CMYA 2QXJA 1GJ4H 1GJ7B 2FX6A 1RXPA 1HAVA 2FM2A 3U98H 5I46H 3E0NB 4YM9A 4LXBH 2C4FH 3M7UA 4X8TH 3Q76A 5T6GA 1P2MA 2TBSA 1GI9B 2R2WU 3A84A 1K1LA 1ESBA 4E05H 5T3HA 1NRQH 2ZC9H 1GJBB 4WMFA 1HJ9A 5LH8A 1GI8B 3M3SA 5GDSH 3PO1C 2BYAX 1EOLA 3BEIB 4UONA 1QL8A 4TWWA 1O2VA 2GKVE 2P93A 1WOFA 2XWAA 2Y81A 3SNEA 1O38A 2PHBA 2ZTXA 3GOVB 3PWBA 4NIWA 1ANDA 4A92A 1VITF 1HB0B 3ZVDA 1BMLA 3M7QA 4HZHA 2FOCA 1MU8B 1SG8B 4ABJA 2FYRA 1Z6JH 1QRXA 3PTNA 1AO5A 1ANCA 4ABGA 1UK2A 2D1JA 2H5DA 1P3EA 1G37A 1UVPA 3P8FA 3QTOH 4HFPB 4RSPA 4CBNA 5C1YA 1SLXB 1KXAA 2ZHQH 2HNTC 1Y5BT 2AFQB 2C90B 1V2KT 2PW8H 1KTTB 2UUFB 1IQHA 4ZROA 1NU9A 1IHTH 3ZVAA 1P10A 2ZHFH 1AQ7A 4Y10E 1AVGH 4TWYA 2ZCKP 4WMDA 3ZZ6A 5C1XA 1AY6H 2B7DH 3BIUH 1QJ7B 3FZDA 1C5RA 1D4PB 1O5DH 1P12E 1SB1H 1GCDA 1DSUA 4NZQA 4NIVA 3BV9B 5IYTA 1V2RT 1DM4B 3RU4T 1BRBE 2ZFSA 2Z7FE 3ZZ4A 3EA7A 3RXEA 1E36B 3SU0A 2J2UA 2PTNA 1QFKH 1KDQB 1C9TA 3SI4H 3MO3A 3URCA 1WAYB 1CGHA 2XCFA 1RGQA 3BG4B 3KHVA 1W10U 2XC4A 1C1WH 4D8NA 1EPTA 1DWDH 1O2YA 1GHZA 4NIXA 5EPYA 5JB8S 1HDTH 2A7HA 1TGBA 3KEEA 4KGAA 4X1SU 4B2CA 2KAIB 4JZEH 1AVWA 1C1RA 2PKAA 3NCLA 3GDUA 3FFGA 4WJG2 3QGJA 1QTFA 2ZDVH 2ZNKH 1ELBA 1IOEA 1THPB 1EX3A 3TH2H 3P17H 4Y8XA 4KKDA 1DY9A 1ELCA 1EUFA 1DXPA 1TYNA 1QJ6B 1O5BB 2XWBI 4WH6A 1NROH 2A7JA 1MKXH 3GCNA 2FESH 4I8KA 1E34B 4YZUA 3LKWA 3OU0A 4CRCA 4LZ4B 4UFEH 4A1TA 1CT4E 1UTNA 1C1MA 1WTGH 2Z3CA 1IQKA 1V2JT 1D3PB 3SBKA 2FZZA 1MTSA 4Y0YE 2FLRH 2QV1A 3ZZCA 4UEHH 3TGKE 4NA7A 1K21H 4DT7B 1T4UH 1LPZB 1TNHA 1E0FD 1C1TA 4IBLH 1ARBA 3KCGH 1OPHB 5CE1A 2BVXH 1CHOG 1TALA 1MH0A 2FS8A 1LKAA 5HM9A 1O30A 3BTDE 4ABFA 1ELGA 1P57B 1EJNA 3RXCA 4WXIA 4FU8A 1QB6A 1QCPA 2JH6D 1EJAA 2FOMB 2R0LA 1ZSKA 2A2XH 2ODQA 1VJ9U 2J34A 3RXBA 3GYLB 2OBQA 3TGIE 1PPCE 1LVBA 1H9LB 1SGCA 1C4V2 5SGAE 1FQ3A 4X6NA 4H42U 1ABJH 1Z8IB 4AYVB 2BLVA 2BD8A 2ZDAH 3RXIA 1UCYH 1XVOA 3HKIB 3BIVH 3UNQA 2BD9A 6LPRA 4ABBA 1XXFA 1MKWH 1TQ7B 1AFEH 3QGNB 3F1SB 4YLQH 2TPIZ 1PPFE 3Q77A 2H1UA 3TNTA 4MNXA 3LGUA 1UO6A 3D62A 4I8GA