2TPIZ

On the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
220
structure length
220
Chain Sequence
GYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title On the Disordered Activation Domain in Trypsinogen. Chemical Labelling and Low-Temperature Crystallography
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 220
sequence length 220
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1981-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tpiZ01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tpiZ02
3SUGA 3ODFA 4JMYA 1P8VC 1RS0A 2OINA 1O2YA 1FY5A 2ZFRH 3AASA 1UCYK 3S9AA 1QBNA 1YKTA 1O2TA 1TABE 4LXBH 1BBRE 5A0CA 2HGTH 4JYUH 1JRTA 6ESTA 2ZDVH 9ESTA 2ODYB 1YLCA 2V3HH 3ZYEA 2Z9GA 3BEUA 3W95A 1TPPA 5T6GA 3ZZAA 1Z7KA 2XBYA 3M3SA 1AWFH 4MNYA 5LPFA 1H8DH 4FUDA 2FPZA 1P2QA 2LPRA 1O3JA 3ELAH 2HNTC 1MKXK 3PTNA 1XX9A 2ZCHP 3A8BA 2R9PA 1KDQB 1V3XA 2Y7XA 3F9EA 1QGFA 1BBRK 2QF3A 3OYPA 3KHVA 1EKBB 2BD8A 1G2MA 2V0BA 1ID5H 1WU1A 4BANB 1T8NA 3FP8E 2P59A 2Q6FA 2ZA5A 2JETC 4ZKNU 4AYYB 4DURA 2F9UA 3SNDA 2SGEE 3UWIA 1D3PB 4WMDA 3Q3XA 4OS7A 3VGCC 2PW8H 4X6MA 1TX8A 2AEIH 2ZDAH 3RMMH 2VWLA 4GLYA 5B6OA 1UJ1A 3QTVH 4K1EA 1K1JA 1L2EA 1LVMA 3GDUA 1VGCB 3DFJA 1H4WA 1KY9A 3FP6E 1TBQH 1EP6A 3QGJA 1FY1A 1MZDA 2VVCA 2PWXA 4HZHA 1FY3A 4OS5A 1ZHRA 1A0LA 1TGSZ 3ATWA 3ZZ7A 2UUJB 1S82A 1SPJA 1SI5H 2H5CA 4H6SB 4PROA 5L2YH 5HMAA 1ZHMA 3SI4H 1G32B 2O8MA 1GG6B 3HGPA 4FUFA 1ANDA 1U6QA 2CXVA 3A84A 1QRXA 2FIRH 3A8DA 3OU0A 3RP2A 2CHAC 1C1TA 3C1KA 1C5SA 1W13U 4ABDA 1YPHE 4D7GA 1NM6A 7ESTE 3H7OA 1BMNH 2ULLA 1C1NA 1HV7A 3K6ZA 4NWLA 1DANH 2VIVA 1QL7A 1O3CA 1T4UH 4NFFA 3ZV9A 1ORFA 2RG3A 1C2MA 3M37A 3S0NA 1S81A 3BIUH 3M5NA 4H6TA 4NIYA 2V35A 1SHYA 1THRH 3A7TA 4ZUHA 2CMYA 3GCOA 1G3EA 3CS0A 4NSYA 3ZVCA 1SFIA 1Z6EA 4HGCA 3I29A 4ABIA 2GZ9A 1CHOG 3URCA 1ZMJA 2B7DH 2OP9A 1J14A 1ETTH 2ZDNA 3L6PA 4J2YB 1WV7H 1F5LA 2ZWLH 4VGCC 1CT4E 1YF4A 2XWAA 1YCPM 2FXRA 2PHBA 1O2NA 1UTKA 1A3BH 3LT3A 4KTUA 1GI6A 2SGQE 2Z94A 1C2FA 1JMOH 7KMEH 3BEFB 5DP4A 3RXQA 1V2JT 3ATMA 2XXLA 4O97A 1OWKA 5H4IB 4TY7A 4D76A 1P12E 2BDGA 1TPSA 3TJOA 4O3TA 1L4ZA 3T28A 3LH1A 1LHFH 4CR9A 1O3EA 1BT7A 5GDSH 3SI3H 2OC7A 2FS9A 1UMAH 1P03A 7LPRA 4QT8C 2B8OH 3V7TA 1O34A 2R0KA 4YO9A 2JH5D 1D9IA 3GY2A 1C5QA 3MO9A 5SGAE 2ZHEH 3LKWA 2QA9E 3B23B 2PV9B 2Z6BD 1H9HE 1E37B 4H42U 3T62A 1C5OH 1TA2A 4AGJA 5LPEA 5CHAB 2VGCB 4X1NU 4YOJA 4MNVA 3M7QA 2ZHQH 2FS8A 3LONA 1P2MA 1XXDA 4KKDA 4YT6H 2G4UA 3FP7E 3MFJA 1LCYA 2ZQ1A 1HAVA 3TVJB 1GI2A 4NIWA 2BB4A 4FUEA 1YPGH 2P95A 1FDPA 2F91A 2ZC9H 4FVBA 2EEKA 4B1TA 2FOBA 1NRRH 1JOUB 2ALPA 1SQTA 3LGWA 2STBE 4CREA 2XC0A 1HXEH 1L1GA 4U30A 5IDKA 1YCPK 4YT7H 2EI7A 1C5YB 2HRVA 1UCYH 2WYJA 4WF8A 4JZFH 3TH3H 1L1JA 1YPJH 3P8OA 1BRUP 1QFKH 1TGNA 3URDA 3HK3B 4OS4A 3FANA 1GJDB 4X1RU 2RA3A 1AVWA 1VJ9U 5A8ZA 3O8BA 1EOLA 1GBFA 1SGCA 2PKSB 5DKMA 2P3UB 4B2AA 1O2KA 2GV6A 3LC5A 4I8KA 3T26A 5C20A 1QBOA 1UK3A 1HXFH 5DO4H 2PGBB 1MKXH 3A7YA 2WPJS 3GY3A 2AIQA 4GHTA 4B71A 1O2RA 4R8TB 4ZAEA 1E38B 2Y81A 4IGDA 1BBRH 3ZVBA 1GI4A 2IJOB 1YYY1 5BPEA 1N6XA 1QTFA 1HJAB 3SHCH 5DK1A 3A80A 2ZNKH 1EP5A 1GI3A 1ABJH 4X6OA 1VGCC 3MWIU 1O36A 2YOLA 6CHAC 1IQGA 1V2VT 3U98H 1UK4A 3T2NA 4UD9H 1P9SA 1EOJA 2ZU3A 2QGRA 4K60A 3GCTG 5EODA 2JH6D 2VU8E 1HLTH 1SGNE 2BHGA 1J17T 4M7GA 1QQ4A 3TLOA 1GG6C 1C2EA 3FVFB 5ESTE 3UOPA 2BLWA 4BTUB 4U01A 4HFPB 2UWLA 5PTPA 2VIOA 1AY6H 4ESTE 2P16A 1HCGA 5A2MH 1ELVA 3LPRA 4YOIA 4D7FA 1GI9B 3TIUA 1J15A 5AHGH 4GCHF 4MG3A 1GHZA 1P2IA 2B0FA 4KTSA 1O3GA 4KP0A 1BDAA 2VWMA 1QBVH 5LGOA 1O2QA 1NFUA 2XBXA 1TGTA 5JBCS 2BOHB 3KGPA 3P8FA 2SNVA 3IWMA 4RN6A 1SR5C 4YZUA 2ZDLA 4ZHMU 2NU2E 2A7HA 3MNCA 5EXLA 2BDAA 3SUFA 4ISHH 2ZCLP 1WUNH 3KQCA 1MCVA 2GD4B 5JB9S 3U8RH 1C1UH 3RXHA 3LIWA 3GYMA 1TNLA 3QZQA 3PYHA 1GBKA 1CA0B 2ZFSA 2V6NA 2ZDKA 4DVAU 2VJ1A 2ZU2A 1MMJN 1TMBH 3RC4A 4I8JA 1IQKA 1SLUB 1GHBG 2PSXA 1K1MA 1Y3YA 2NU3E 3SGQE 1MD7A 2H1UA 2AMDA 2Y5HA 1D6RA 2GDDA 5E8EH 2VIDA 1KXBA 4ZH8A 1GBCA 4Y7AA 1AO5A 3GY6A 1O2LA 2ZKSA 4ABBA 2VINA 1O5GH 1YGCH 1DWCH 3T27A 1HAOH 1GJ6A 3ATKA 3SNBA 1GBDA 1BITA 1P57B 1RD3B 3KIDU 3PMJA 5I46H 4IMQA 1GVKB 1O5CB 4Y0YE 1RTKA 1TNHA 1YPLH 1GMDG 1A1RA 2CGAA 1HAPH 2G5VA 1Z6JH 3AVZA 5CHAC 1GL1A 3S9CA 1CO7E 1ELFA 2OQ5A 1RGQA 2HNTE 1BTUA 1GBJA 4DW2U 1TNJA 2QXJA 1FXYA 1MBQA 3B9FH 1MTWA 1VITF 4CRGA 1H1BA 4Y0ZE 3PLBA 1TQ0B 4DT7B 1LKBA 1RTLA 1TOMH 2SGAA 3RM0H 3LH3A 1S0RA 2PSYA 1MH0A 1ZPZA 2WUBA 1GI0A 1GBLA 4AB8A 3SUDA 2B5TB 2BD5A 1YM0A 3GYLB 1HBTH 1S5SA 5J4SA 1DLKB 2QY0B 1BTZA 4JK5A 1LKAA 3RXJA 1CE5A 1HAIH 2DE8A 3M35A 1DITH 2R2WU 4YOGA 3SU5A 1VR1H 3P8GA 3GDSA 1O0DH 3E1XB 5J4QA 2PTCE 1AWHB 1PPEE 2P3FH 5EW1H 4FU9A 1ZSJA 1Z1JA 3DD2H 1O2OA 2D8WA 4UDWH 4WVPE 6GCHG 2ZQ2A 3BTTE 2PKSC 2GT8A 2XC5A 1WTGH 2GZ8A 1H8IH 1GHYH 5HM9A 1RTFB 3M7UA 1OSSA 2BX4A 1TRMA 4XDEA 4BAQB 3BN9A 3OY5U 4NGAH 2XRCA 1SGIB 3S7KB 1BTPA 1D3TB 1W12U 1AB9B 1AN1E 1HJAC 2QN5T 3VPKA 4INLA 2F9PA 3KEEA 2BLQA 1LHCH 4J1YA 1FQ3A 2TRMA 5HGGA 3TJVA 1KSNA 2BOKA 1FZZA 1GMCG 3QO6A 4I32A 1BUIA 1GVLA 2WV5A 2A31A 4BTTB 3RXSA 1F0UA 2FWWA 1EAXA 2BLVA 1W14U 1UVTH 2ZFFH 5A0AE 1LVOA 1AVGH 4DG4A 1Y8TA 1HGTH 1BHXF 2M5TA 2PGQB 1GBHA 3LGYA 3SUEA 2C8WB 3SW2B 4NIVA 1KTSB 2ZFTA 4CBNA 2D2DA 5ABWA 2PKAA 1C1VH 4IBLH 3UNRA 2ZHDA 1ZYOA 1LVBA 2ZTXA 1O3KA 3TGKE 5JDUB 5EQRA 2P3TB 1QA7A 1TOCB 2BTCE 1ZZZA 1GPZA 1TWXB 3F9HA 2OTVA 2G00A 2D26C 5FXLA 4OS2A 5HM2A 2ZPRA 4CH8B 3EGKH 2O8UA 1TRYA 1DUEA 1BOQA 1ELDE 2H2ZA 2QXGA 1SGDE 2XYAA 1HAGE 4F49A 1HAYB 4WH6A 2R0LA 1KIGH 4X6PA 3SV2H 4MPVA 1K1LA 3A7WA 1P11E 5JBBS 4I7YH 4X8TH 2EI6A 2ZPQA 4X0WU 3RU4T 2DUCA 1CA0C 2Y80A 1DS2E 3QGNB 1HJ9A 3MTYA 5C1XA 4B74A 1BHXB 2W26A 1G30B 3DHKH 3TITA 1H9IE 3SV7A 3R3GB 2FI4E 3PWCA 1UTOA 4XSKU 3UR9A 8GCHF 4IMZA 1GJ8B 1UK2A 3SJ8A 3GCNA 2Z3EA 1D4PB 1FONA 1CGJE 5F8TA 2NWNA 5DP9A 1SLWB 4WXVA 1XVOA 4K8BA 5FX5A 1HAHH 1O3BA 1O5EH 2FX4A 2NU4E 5EQQA 3SNAA 1ZSKA 2G52A 3MNXA 1S6FA 3SQEE 4X2XA 1F92A 1IQIA 2EC9H 4CRFA 5FBEA 3GCHB 4YTAA 3QN7A 1TGCA 1DUAA 1TPOA 1LVYA 1NZQH 5E2OA 1TIOA 1P2NA 4OS1A 1XUHA 2FTMA 2G81E 1NRQH 2Z3DA 1HAVB 1PQ7A 4BXSA 2HPQH 5L6NH 3SU3A 1O37A 4ABFA 1EPTA 1C2IA 4JZDH 4K69A 1GMDF 2FMJA 1C4U2 1BRAA 1UTQA 3QUMP 1IQNA 1SB1H 1LPGB 2WPMS 2BDBA 4B2BA 1BIOA 3NUMA 2PFEA 2CN0H 2I6QA 1IQMA 1Z8JB 4X2VA 8LPRA 2GV7A 2H9TH 3SV6A 1Z8GA 1C5WB 2UUYA 1QIXB 3MH4A 2Z9KA 2BXTH 5AFZH 1XUGA 1UVSH 4ISOA 4Y7BA 2BLOA 1CGIE 2ASUB 2WPKS 2XNIA 1P02A 1ZJKA 2H9HA 1IQFA 1V2KT 1K1NA 1DSTA 1NU9A 1NC6A 3A88A 1GDQA 2ZIQH 8KME2 1DXPA 2BDCA 1V2ST 3SJ9A 2GT7A 1B0EA 1SVPA 2G55A 2IOTA 1GHAF 1GBMA 1PJPA 1MU6B 3RMOH 3ZVAA 3SU0A 3HGNA 3SU6A 2FYRA 1W11U 1CHGA 2IPHA 3MU0A 4ZKSU 1Y3WA 1EX3A 5K0HA 1O33A 1AB9C 2O9QA 1G3BA 1K2I1 5IYTA 1K21H 1UVOA 2ANWA 1E34B 1FV9A 2WUCA 2Z9IA 1GI8B 2ZGHA 3EQ0H 2ANYA 4IW4E 2ZO3H 3RXEA 2C93B 1FPHH 1MKWK 3PB1E 4BAOB 1OKXA 3DT0H 5K7RA 4Q7YA 1YPEH 1AI8H 1CGHA 3PV4A 1ZJDA 3BTDE 3SU1A 1K9OE 4I8HA 1TGBA 2TPIZ 4TWYA 3M3VA 3DUXH 1GMCF 1OS8A 4K2YA 1BTWA 2AYWA 4BTIB 1TA6A 4Z6AH 1GBIA 2BQ6B 3UNSA 1ARCA 2C3SA 4WJG2 1FMGA 2FLRH 2W3IA 1HRTH 1LTOA 1V2MT 2O8LA 3DA9B 3GICB 1O5DH 3E0NB 3P92A 3KL6A 1FNIA 3PLPA 2R2MB 1P2KA 4Z0KA 4Q80A 1ARBA 1LMWB 2NU0E 1SLVB 2D1JA 1EQ9A 2CF9H 1DOJA 1VJAU 1ZSLA 4MPWA 1B7XB 4OS6A 3UIRA 2Y6TA 1OYQA 1O3LA 2BDIA 5FPTA 2A2XH 1HYLA 3ZYDA 3ITIA 2QYIA 1GMHG 1NT1A 3TNTA 1K28D 2FOHA 3QDZB 3MU4A 3M61U 1XUIA 3OTJE 1PYTD 1Y3UA 1F5KU 1XKAC 3STJA 2FOMB 2IN2A 2G4TA 3ODDA 3C27B 3Q00A 1Q2WA 2PUQH 2FOFA 1LPKB 2TGPZ 2F9BH 2AGIX 4GVUA 3T5FH 2ZZUH 1VCWA 3SOSA 2R3UA 4FVDA 2THFB 1O2GH 2F9NA 1BTHH 3F9FA 1TONA 2OC0A 1IOEA 1XUKA 3V3MA 4D9QA 4ABGA 1VCQA 2PR3A 1E36B 1O39A 1TMUH 2VIQA 3VB7A 3HKJB 2FOGA 4NFEA 3M36A 1RRKA 5EPYA 3GCHC 1BJVA 3RXVA 1THSH 3E91A 2ZHWH 1OWDA 4XFQA 1WAYB 4NCYA 4TPYA 1T8MA 1A4WH 1W0ZU 4DIIH 2A4OA 1QA0A 5L30H 3CS7A 4JYVH 1IQEA 1TNKA 3Q3YA 1BTXA 3QK1A 5EXMA 1CT0E 1HJ8A 4NA9H 4LZ1H 1WQVH 5CE1A 1QL8A 3A8CA 1XMNB 1TE0A 5T6FA 1GHWH 5F6MA 2B9LA 3AW1A 5BRRE 1NROH 1SLXB 3JZ2B 1TNIA 1ELEE 1C1OA 2XCFA 2XTTB 3RXKA 1SGQE 4ZXXH 1ANEA 3EDXB 1EZXC 1BMAA 1LHEH 4D8NA 4AG1A 3G01A 3MH6A 2P93A 1QQUA 1SGFG 2BDYA 2FX6A 1DLEA 1GJ9B 4FUIA 5FHTA 3TH2H 2Q1JA 4AB9A 2QIQA 3RXAA 2OUAA 3RXIA 1CBWB 2ZGJA 1ZOMA 3EA9A 2FYQA 4HI3A 2BY5X 3SU4A 4Y10E 1EAWA 3ZZBA 2GCTB 1QR3E 1EZUC 3TH4H 2Z9LA 4B75A 1GJ7B 2A1DB 5JYIA 2BY8X 1X7AC 1A5HA 4GUXA 3ZVFA 3K9XB 3RXFA 4ABAA 1J8AA 1O2UA 2HPPH 1TRNA 2FI5E 4FU8A 1CU1A 1WTHD 3NPSA 2QF0A 4NIXA 1MTSA 1WCZA 1DPOA 3UWJH 1WSSH 3BSQA 3U1IB 3RUOA 5T6DA 4ZROA 1DSUA 3TK9A 5HXFA 5C1UA 1BB0B 4E05H 4BAKB 2QXIA 3WY8A 1NU7B 3V13A 2A7CA 1CT2E 1BRCE 1PQ8A 4UFDH 1AGJA 1O2IA 1KXCA 2NU1E 5C5OA 4GHQA 1SQOA 2GP9B 1EXFA 3OY6U 1MKWH 1A7SA 1QJ6B 1JIMA 1NFYA 2ZECA 1TQ7B 3D65E 1TX6A 1ZGIA 3VEQB 1ELAA 1ESBA 1O3IA 4E7NA 2PKAB 1F5RA 2A2QH 3M5OA 1OP2A 3SGAE 3AAUA 3VB3A 1XKBC 1CHOF 1UTPA 1TB6H 1MD8A 2ODQA 4MDSA 1C1RA 1XUFA 4JCNA 5EG4A 3FZZA 4O03A 1ZRBA 3CP7A 3HK6B 4LOYH 3ATLA 5C5NA 1FIZA 1GJBB 4MPXA 4R0IA 4CBOA 1YP9A 2C4FH 4A7IB 1P06A 1SFQB 2A0QB 3MNBA 1E35B 2C8ZB 4LK4A 1SBWA 1GDUA 3NKKA 2KAIA 3SZNA 1FI8A 1CA8B 4X2WA 1LHGH 1Z1IA 1C5MD 1IAUA 4TYDA 4DIHH 2F9VA 2VGCC 1A46H 4UFGH 5C3NA 2AIPA 4JYTA 2QC2A 1QHRB 3P8NA 1FN6A 1GL0E 1V2TT 5EU8A 3EAJA 4MPUA 4DCDA 5GCHG 1NO9H 4RKOB 2ZFQH 1YPKH 1IQHA 1Y3XA 1Z71A 3OSYA 4Y79A 3RXPA 5I25A 3NK8A 1P09A 1RXPA 3TGJE 4K3JA 4YLQH 1ACBE 1LO6A 3ZZ8A 3VB6A 1V2UT 2HVXA 3RXBA 4BAHB 1AD8H 1DWBH 1HAXB 4I8LA 1FY8E 2VVUA 4FXGH 3F1SB 1GGDB 1N6YA 7GCHG 2BD7A 1MBMA 3LGVA 3BG4B 1MZAA 3FAOA 1YCPH 2G5NA 3TJUA 2ILNA 1EAUA 1SGTA 2HALA 1EB1H 3P70B 1D3QB 3D49H 1HIAA 3KQDA 1C5NH 3QLPH 3MYWA 2AMQA 3P17H 1O3PB 2XBVA 1W3CA 4Y6DA 5LPRA 1EPTB 3PMBB 3RC5A 1T32A 3PMHB 4X8VH 1NFXA 3M3TA 1JRSA 1C2HA 1BTYA 1V2OT 3A87A 1GVZA 3E90B 1SGPE 4MTBA 4XE4A 1GCTB 3PROA 5C1YA 2FI3E 3SHAH 1V2QT 1H9LB 3FFGA 1WBGB 2FLBH 1FN8A 3SQHE 4NSVA 2ZG0H 3RU4D 2ZGBH 1PPCE 3E3TA 3H7TA 1SMFE 1BRBE 2BY6X 4E06H 1IQJA 3S9BA 1UTLM 2CHAB 2UUFB 5F03A 3ZZDA 1KYNA 3ZZ4A 3MHWU 1C5LH 1NRSH 3UUZA 3M7TA 1EATA 1V2WT 2ANKH 2EA3A 3SNCA 1Z8RA 1OWHA 2A32A 2SFAA 1TLDA 2FODA 3UTUH 4NG9H 1JXPA 3A81A 1CBWC 2DE9A 2PUXB 1W0YH 1ETRH 1DDJA 4CH2B 2AERH 1QL9A 5E0HA 1YBWA 3RXCA 3E8LA 2ALVA 3SO3A 2QV1A 2H9EH 2GCTC 1RFNA 1T7CA 3STIA 4HTCH 2OQUA 3MNSA 4KGAA 4TY6A 4NZLA 2ZTYA 3GCTF 3RXOA 1C1MA 2VIWA 1AFEH 1MAYA 5DP7A 2CF8H 2J34A 4DGJA 4CRCA 3RM2H 2BQ7B 4BXWA 3BTGE 2ZP0H 2GDEH 3E0PB 4KELA 3A7ZA 2RCEA 2ZU5A 2QXHA 2VVVA 2AS9A 1HNEE 3GISB 2C8YB 1PPZA 1ABIH 1A3EH 1D6WA 2ZU1A 2BY7X 1ANCA 4NA8A 4UE7H 1C9PA 1TNGA 4X1QU 4Y8ZA 1DY8A 3SU2A 5A8XA 2C90B 2ZGXH 3VB4A 1NRPH 4XBCA 3VXEH 1GJ4H 2OLGA 2PLXA 2XWBI 2RA0A 1DE7H 3P95A 1GBAA 2ZU4A 2TGTA 4B73A 1G3DA 1AZZA 1GI5A 1ZPCA 4ABJA 1HFDA 1TFXA 4AORA 1QCPA 3SN8A 3IITA 2OXSA 4WH8A 2XW9A 1ELCA 1P10A 2A5KA 2O8WA 4K8YA 5DP5A 1Y5UT 1F0TA 1O2WA 2QAAA 1YPMH 1AFQB 2BMGB 5FBIA 4JZIA 4IC5A 3RXLA 1C5TA 1DVAH 2SGDE 1DXWA 1LQEA 1O3FA 4ZXYH 1CVWH 1OP0A 1LDTT 1G2LA 1O2JA 1O32A 1SOZA 2STAE 5E0GA 2UWPA 1NN6A 3DFLA 1WQSA 2BY9X 1UTMA 1GI1A 1GHBF 2W5EA 1ZR0A 1DX5M 1PPHE 2GCHG 3A89A 3TPIZ 4E7RG 1QB6A 4YLUA 3UNQA 1O38A 2CJIA 2FOCA 3CENA 4A1XA 5ETXA 1AKSA 5L2ZH 2OD3B 5A8YA 4DJZB 1ZPBA 1GJCB 3GY4A 1T8OA 2HWLB 4ABEA 4GAWA 3KN2A 2A7JA 1PQ5A 2SGPE 2BYAX 2GTBA 1EJAA 1UVUH 4ZMAH 5GPIB 1C2KA 1QB9A 1BMLA 1S0QA 3RXUA 3T29A 2Y5GA 1C1WH 4U2WA 1EZQA 2GVFA 1Z8IB 2FEQH 5EPNA 3N7OA 1INCA 3I77A 2BD3A 1FPCH 4X8SH 2Z9JA 3LGIA 3A7VA 1JIRA 1GGDC 4Y71A 1OWIA 3BG4C 9LPRA 3Q3KA 2V3OH 3BTHE 5GCHF 4O9VA 3K2UA 2ZEBA 1NFWA 1O3NA 1UHBA 4DOQA 2P94A 1BJUA 4WXIA 3QTOH 4AGKA 1TMTH 4BOHA 3BTME 4MQAA 1FJSA 3ZVDA 3NXPA 1EPTC 2BZAA 3JZ1B 3MOCA 1IHTH 4IN1A 1KXDA 3L3TA 4ZKRU 4K5ZA 4WY3A 4FUBA 2AMPA 7GCHF 1DM4B 3UQVA 1O30A 2BDHA 3BTEE 2CV3A 1P0SH 1Q31A 3KCGH 6CHAB 3M5MA 1GCTC 1GJ5H 2Z7FE 1C5UA 2AGEX 1AHTH 3PO1B 4ABHA 1A5GH 4GCHG 1OWJA 4WMEA 2BVSH 1L1NA 1OXGA 3ESTA 6GCHF 1NESE 1ZTKA 2FOEA 1ETSH 1BMMH 1QRWA 1P2OA 4Q2KA 2WV4A 5EQSA 4UFEH 4A1VA 5EXNA 1A2CH 3U69H 1P3EA 4INKA 1P05A 1T8LA 1C5RA 3SV8A 4AFZA 3SNEA 3LU9B 3LJOA 3K65B 3U8OH 1GWAA 2WPLS 4ZHAA 1K1OA 1DICA 2GGVB 3F68H 1SGEE 1ANBA 1MTNB 1AZ8A 4AG2A 5DPAA 1SSXA 4UEHH 2A4GA 4ISIH 3MMGA 1S83A 2G51A 4AFUA 1K1IA 3UQOA 3ZVEA 1A61H 2FDAA 2BZ6H 2SGFE 1GBEA 1VITH 3BTFE 1EJMA 1O3OA 3A86A 2O8TA 1FIWA 1V2NT 1O5FH 5AFYH 3A7XA 2UUKB 4JZEH 4NWKA 3BIVH 1SHHB 1VCPA 3SJIA 4CRBA 4CRDA 4UFFH 3V0XA 4ZHLU 3ZZ3A 1SGFA 3LDXH 5FPSA 1WOFA 3SORA 1O2XA 4H4FA 2ZI2H 3NCLA 1Y5AT 3U1JB 1LHDH 1JWTA 1D3DB 1G36A 2F3CE 2GZ7A 2BQWB 1V2RT 3M5LA 2BX3A 5A0BA 2J2UA 2BM2A 4CHAB 2I6SA 4ISLA 2Q6GA 2VH0A 3QZRA 1IHSH 3ZV8A 1L0ZA 1NRNH 1B5GH 1O3DA 4FUHA 1VITG 2Z3CA 1V6DA 1O2PA 1QJ7B 3TU7H 3MH5A 1HB0B 1LPZB 3GY8A 1ELTA 2W3KA 1AFQC 4Q7ZA 2JH0D 2J9NA 1W7GH 3ZVGA 3BTWE 3UOUA 2AFQB 2KAIB 1Q3XA 2VH6A 1C2JA 5JBTA 5FCKA 3GY7A 1L4DA 1S6HA 1PFXC 1PPBH 2P8OB 3A85A 1AVXA 1AUTC 1SGRE 1EZSC 1GI7B 1O5BB 1KDQA 1QB1A 1VZQH 1C2LA 4ZKOU 1SGYE 4X2YA 3O8DA 2ZHFH 3ZZ6A 2OC8A 3ATIA 3RXGA 3MI4A 3A8AA 5JPMH 1RIWB 1MCTA 3E16B 3KNXA 4Y8YA 5FPYA 3PMAB 5JBAS 1E0FD 1UVPA 5EOKA 1C1SA 2Y7ZA 4FU7A 1XVMA 2GCHF 2J4IA 3SJKA 3PWBA 1KXFA 1LQDB 3GY5A 3KQEA 1SOTA 4AX9H 2WPHS 5TCAA 1P2JA 1DWDH 1W7XH 3RLYH 4RKJB 4JZ1A 3LC3A 2ZTZA 1JBUH 2A5AA 1DT2A 1ZTLA 5F8XA 1NY22 2F83A 1YLDA 3RXMA 5T3HA 1G9IE 5G4BA 1HIAB 2GMTB 2BVXH 3IG6B 2AH4X 3UR6A 1ZRKA 2VB0A 1THPB 2ZPSA 2W7SA 1YC0A 1ZTJA 1S84A 2GX4A 1F0RA 1FUJA 1C4Y2 1QRZA 3ZZ5A 1GJAB 1C5VA 1C5XB 4Q7XA 2PTNA 1EASA 2ZGCA 3LOXA 5E0JA 1F7ZA 4X8UH 3F9GA 4FUJA 1HUTH 1N8OB 1GBTA 1A5IA 3PO1C 4DY7B 1NS3A 1P01A 1AMHA 3NZIA 4Y76A 3KF2A 3MO3A 4SGBE 1IQLA 4IC6A 1TBRH 1SQAA 2ZDMA 1EJNA 4ASHA 1O2MA 2XC4A 3LJJA 2BD4A 2G8TA 2BXUH 3MU1A 5CMXH 1OX1A 3PTBA 3V12A 1YPHC 1W10U 2HOBA 3BF6H 3GOVB 1QNJA 1OOKB 4I33A 5TCCA 3TK6A 3EA8A 2FTLE 2OC1A 1AE5A 2J38A 1TX7A 3RLWH 4TPIZ 1CQQA 4BAMB 2ESTE 4Y11E 3MU5A 4NA7A 1OPHB 2WYGA 1GCDA 4IS5A 1OYTH 1MTNC 1ZMNA 2VWOA 2JKHA 1DY9A 1ESTA 1AE8H 1SG8B 4AFSA 2A45B 1XXFA 1P3CA 3UY9A 2ZFPH 4TWWA 2GKVE 1V2LT 2HLCA 2A5IA 2HNTF 4ISNA 1SC8U 5DP6A 1O3AA 4MLFB 4FUGA 4K1SA 4UONA 8GCHG 2C8XB 1FLEE 4X1SU 1ELBA 1XUJA 3EYDA 1A0HB 2BVRH 3Q77A 3SGBE 3TK5A 4X6NA 3SJOA 1G37A 1Y5BT 5FX6A 2TIOA 3Q76A 4YM9A 2UWOA 2ODPA 1O3HA 1SL3A 3SBKA 3ZZ9A 4O3UA 1RJXB 4A1TA 3RXRA 5AVDA 1NPMA 2ZF0H 4I31A 1O5AB 2AGGX 4MVNA 4SGAE 3HATH 1GDNA 2TGDA 1UTJA 1TYNA 2FP7B 3UFAA 1ZMLA 1O2HA 2EI8A 5E2PA 1O31A 3U9AH 4AN7A 2BD9A 1F2SE 1PQAA 3HKIB 4CHAC 4A92A 2OCVB 2FZZA 3AAVA 1KXAA 3I78A 4WMFA 3UPEA 3TJNA 4XOJA 2LNCA 2FM2A 2Y82A 1PPFE 1TBZH 1FY4A 1C2DA 1ELGA 1C9TA 3L33A 4XBBA 4CRAA 5A09A 4X1PU 2F9OA 1GMHF 3BEIB 4AOQA 2R3YA 1UTNA 5DJ7A 2VNTA 3MO6A 3S7HB 1C5PA 3RXDA 1HDTH 1MUEB 1W2KH 3S69A 1KTTB 1OWEA 2BD2A 5DP8A 3VXFH 5GXPA 5DGJA 1AIXH 3VFEA 1HAZB 3LGUA 1OP8A 2YNAA 3ENSB 3A83A 2P8OC 1N1LA 2XBWA 4WWYA 2A4QA 1AKSB 4MNWA 1A0JA 1GHVH 2JETB 1F0SA 1TALA 4U32A 3LGTA 3VGCB 2H6MA 1QURH 1MTVA 3RXTA 4A5TS 3TNSA 4BNRA 2Y5FA 1UO6A 1RIWC 1ZHPA 1GHAG 1QY6A 3RDZA 1MTUA 3A82A 1ZLRA 3BV9B 4RSPA 4Y8XA 4KTCA 3U8TH 2FO9A 3H5CB 3QX5H 2J95A 3D62A 5LH8A 1WYKA 1BQYA 5GWZA 1FAKH 1EUFA 1O2ZA 3HPTB 1AUJA 2K1QA 2J94A 5C67A 3D23A 1BCUH 1O2SA 5F8ZA 3MU8A 1UHBB 2XCNA 1Y3VA 2FOAA 2GMTC 2RDLA 1GBBA 3E6PH 3FZDA 2VWNA 1XM1A 1O3MA 8ESTE 1DFPA 1C1QA 2WPIS 5GIBA 1ZGVA 1P04A 1MQ5A 2QCYA 3EE0B 3F6UH 5DP3A 3TGIE 1C1PA 2W7UA 1MQ6A 1FAXA 1CSOE 3T25A 1B0FA 3EA7A 4GSOA 1C4V2 5GJ4B 4AZ2B 3O8CA 1AU8A 1BZXE 2J92A 3RC6A 4B2CA 3O8RA 2FESH 3BG8A 3K6YA 4A6LA 4THNH 1N8OC 1EAIA 3AW0A 3VB5A 1HPGA 2SNWA 4OGYA 1P9UA 1O2VA 4VGCB 4OGXA 4YESB 4AFQA 2VIPA 4GPGA 3W94A 2WINI 5C2ZA 1TAWA 1PYTC 4K1TA 3NWUA 2A4RA 1AQ7A 3P6ZB 3ZZCA 2TBSA 3OX7U 1J16A 1TPAE 2OBQA 3QWCH 1Y59T 4MNXA 1ESAA 4LZ4B 3PLKA 4NZQA 1PPGE 2Q6DA 4FUCA 2TGAA 4F4OC 4D9RA 4B76A 4XBDA 5EGMA 4JK6A 4IN2A 1EB2A 4AYVB 5TJXA 5HYOA 5AF9H 1BA8B 1S85A 5EW2H 1W8BH 1NTPA 2YNBA 1T31A 1C5ZB 4INHA 1MAXA 3B8JA 3BTKE 2H5DA 3BTQE 1K1PA 6LPRA 3MH7A 1MU8B 1V2PT 2ZCKP 1O35A 1T4VH 3R0FA 4I8GA 5FAHA 1UCYE 3PM3A 1KLIH 3UREA 1M9UA 1C2GA 2OBOA 1QJ1B 3SV9A 3RMNH 1KLTA 4CR5A 1J9CH 3GDVA 3KQBA 1KXEA 1G3CA 5DG6A 5ESBA 3RMLH 1DWEH 5JB8S 1GHXH 1K22H 3RU4E 1KLJH 2ANMH 5FCRA
chains in the Genus database with same CATH superfamily
3SUGA 3ODFA 4JMYA 1P8VC 1RS0A 2OINA 1O2YA 1FY5A 2ZFRH 3AASA 1UCYK 3S9AA 1QBNA 1YKTA 1O2TA 1TABE 4LXBH 1BBRE 5A0CA 2QE7D 2HGTH 4JYUH 1JRTA 2EQNA 6ESTA 3WWBA 2ZDVH 9ESTA 2ODYB 1YLCA 2V3HH 3ZYEA 2Z9GA 3BEUA 3W95A 1TPPA 5T6GA 3ZZAA 1Z7KA 2XBYA 3M3SA 1AWFH 4MNYA 5LPFA 1H8DH 4FUDA 2FPZA 2AHME 1P2QA 2LPRA 1O3JA 3ELAH 2HNTC 3PRDA 1MKXK 3PTNA 1XX9A 2JJ1D 2ZCHP 3A8BA 2R9PA 1KDQB 1V3XA 2Y7XA 3F9EA 1QGFA 1BBRK 2QF3A 4B6FA 3OYPA 3KHVA 1EKBB 2BD8A 1G2MA 2V0BA 1ID5H 1WU1A 4BANB 1T8NA 3FP8E 2P59A 2Q6FA 2ZA5A 2JETC 4ZKNU 4AYYB 4DURA 2F9UA 3SNDA 2SGEE 3UWIA 1D3PB 4WMDA 3Q3XA 4OS7A 3VGCC 2PW8H 4X6MA 1TX8A 2AEIH 2QF4A 2ZDAH 3RMMH 2VWLA 4GLYA 5B6OA 1UJ1A 3QTVH 4K1EA 1K1JA 1L2EA 1LVMA 3GDUA 1VGCB 3DFJA 1H4WA 1KY9A 3FP6E 1TBQH 1EP6A 3QGJA 1FY1A 1MZDA 2VVCA 2PWXA 4HZHA 4YXWD 1FY3A 4OS5A 1ZHRA 1A0LA 1TGSZ 3ATWA 3ZZ7A 2UUJB 3KYGA 1S82A 1SPJA 1SI5H 2H5CA 2GJGA 4H6SB 4PROA 5HMAA 1ZHMA 3SI4H 5L2YH 1G32B 2O8MA 1GG6B 3HGPA 3OAAD 1ANDA 4FUFA 1U6QA 2CXVA 3A84A 1QRXA 2FIRH 3A8DA 3OU0A 3RP2A 2CHAC 1C1TA 3C1KA 1C5SA 1W13U 4ABDA 1YPHE 4D7GA 1NM6A 7ESTE 4FETA 3H7OA 1BMNH 2ULLA 1C1NA 1HV7A 3K6ZA 4NWLA 1DANH 2VIVA 2LELA 1QL7A 1O3CA 1T4UH 4NFFA 3ZV9A 1ORFA 2RG3A 1C2MA 3M37A 3S0NA 1S81A 3BIUH 3M5NA 4H6TA 4NIYA 2V35A 1SHYA 1THRH 1SQRA 3A7TA 4ZUHA 2CMYA 3GCOA 1G3EA 2KCAA 3CS0A 4NSYA 3ZVCA 1SFIA 1Z6EA 4HGCA 3I29A 4ABIA 2GZ9A 1CHOG 4P00A 3URCA 1ZMJA 2B7DH 2OP9A 1J14A 1ETTH 2RFKC 2ZDNA 3L6PA 4J2YB 1WV7H 1F5LA 2ZWLH 4VGCC 1CT4E 1YF4A 2XWAA 1YCPM 2FXRA 2PHBA 1O2NA 1UTKA 1A3BH 3LT3A 4KTUA 1GI6A 2SGQE 2Z94A 1C2FA 1JMOH 7KMEH 3BEFB 5DP4A 3RXQA 1V2JT 3ATMA 2XXLA 4O97A 1OWKA 5H4IB 4TY7A 4D76A 1P12E 2BDGA 1TPSA 3TJOA 4O3TA 1L4ZA 3T28A 3LH1A 1LHFH 4CR9A 1O3EA 1BT7A 5GDSH 3SI3H 2OC7A 2FS9A 1UMAH 1P03A 7LPRA 4QT8C 2B8OH 3V7TA 1O34A 2R0KA 4YO9A 2JH5D 1D9IA 3GY2A 1C5QA 3MO9A 5SGAE 2ZHEH 3LKWA 2QA9E 3B23B 2PV9B 2Z6BD 1H9HE 1E37B 4H42U 3T62A 1C5OH 1TA2A 4AGJA 5LPEA 5CHAB 2VGCB 4X1NU 4YOJA 4MNVA 3M7QA 2ZHQH 2FS8A 3LONA 1P2MA 1XXDA 4KKDA 4YT6H 2G4UA 3FP7E 3MFJA 1LCYA 4I86A 2ZQ1A 1HAVA 3TVJB 1GI2A 2XNDD 4NIWA 2BB4A 4FUEA 1YPGH 2P95A 1FDPA 2F91A 2ZC9H 4FVBA 5KECA 1K0HA 2EEKA 4B1TA 2FOBA 1NRRH 1JOUB 2ALPA 1SQTA 3FO8D 3LGWA 2STBE 4CREA 2XC0A 1HXEH 1L1GA 4U30A 5IDKA 1YCPK 4YT7H 2EI7A 1C5YB 2HRVA 1UCYH 2WYJA 4WF8A 4JZFH 3TH3H 1L1JA 1YPJH 3P8OA 1BRUP 1QFKH 1TGNA 3URDA 3HK3B 4OS4A 3FANA 1GJDB 4X1RU 2RA3A 1AVWA 1VJ9U 5A8ZA 3O8BA 1EOLA 1GBFA 1SGCA 3PV2A 2PKSB 5DKMA 2P3UB 4B2AA 1O2KA 2GV6A 3LC5A 4I8KA 3T26A 5C20A 1QBOA 1UK3A 1HXFH 5DO4H 2PGBB 1MKXH 3A7YA 2WPJS 3GY3A 2AIQA 4GHTA 4B71A 1O2RA 4R8TB 4ZAEA 1E38B 2Y81A 4IGDA 1BBRH 3ZVBA 1GI4A 2IJOB 1YYY1 5BPEA 2HVYB 1N6XA 1QTFA 1HJAB 3SHCH 5DK1A 3A80A 2ZNKH 1EP5A 1GI3A 1ABJH 4X6OA 1VGCC 3MWIU 1O36A 2YOLA 6CHAC 1IQGA 1V2VT 3U98H 1UK4A 3T2NA 4UD9H 1P9SA 1EOJA 2ZU3A 2QGRA 4K60A 3GCTG 5EODA 2JH6D 2VU8E 1HLTH 1SGNE 2BHGA 1J17T 4M7GA 1QQ4A 3TLOA 1GG6C 1C2EA 3FVFB 5ESTE 3UOPA 2BLWA 4BTUB 4U01A 4HFPB 2UWLA 4RI0A 5PTPA 2VIOA 1AY6H 4ESTE 2P16A 1HCGA 5A2MH 1ELVA 3LPRA 4YOIA 4D7FA 1GI9B 2IJD1 3TIUA 1J15A 5AHGH 3FKSD 4GCHF 4MG3A 1GHZA 1P2IA 2B0FA 4KTSA 1O3GA 4KP0A 1BDAA 2VWMA 1QBVH 5LGOA 1O2QA 1NFUA 2XBXA 1TGTA 5JBCS 2BOHB 3KGPA 3P8FA 1YWUA 5IK2D 2SNVA 3IWMA 4OM9A 4RN6A 1SR5C 4YZUA 2ZDLA 4ZHMU 2NU2E 2A7HA 3MNCA 5EXLA 2W6ID 2BDAA 3SUFA 4ISHH 2ZCLP 1WUNH 3KQCA 1MCVA 2GD4B 5JB9S 3U8RH 1C1UH 3RXHA 3LIWA 3GYMA 1TNLA 3QZQA 3PYHA 1H8HD 1GBKA 1CA0B 2ZFSA 2V6NA 2ZDKA 4DVAU 2VJ1A 2ZU2A 1MMJN 2CK3D 2YMSB 1TMBH 3F2FA 3RC4A 4I8JA 1IQKA 1SLUB 1GHBG 2PSXA 1K1MA 1Y3YA 2NU3E 3SGQE 1MD7A 2H1UA 2AMDA 2Y5HA 1D6RA 2GDDA 5E8EH 2VIDA 1KXBA 1WDIA 4ZH8A 1GBCA 4Y7AA 1AO5A 3GY6A 1O2LA 2ZKSA 4ABBA 2VINA 1O5GH 1YGCH 1DWCH 3T27A 1FX0B 1GJ6A 3ATKA 1HAOH 3SNBA 1GBDA 1BITA 1P57B 1RD3B 3KIDU 3PMJA 5I46H 4IMQA 1GVKB 1O5CB 4Y0YE 1RTKA 1TNHA 1YPLH 4AC9A 1GMDG 1A1RA 2CGAA 1HAPH 2G5VA 1Z6JH 3AVZA 5CHAC 1GL1A 3S9CA 1CO7E 1ELFA 2IPQX 2OQ5A 1RGQA 2HNTE 1BTUA 1GBJA 2V3MA 1W0JD 4DW2U 5FL7D 1TNJA 2QXJA 1FXYA 1MBQA 3B9FH 1MTWA 1VITF 4CRGA 1H1BA 4Y0ZE 3PLBA 1TQ0B 2HLDD 1LKBA 1RTLA 1TOMH 2SGAA 3RM0H 3LH3A 4DT7B 3F2GA 1S0RA 2PSYA 1MH0A 1ZPZA 2WUBA 1GI0A 1GBLA 4AB8A 3SUDA 2B5TB 2BD5A 1YM0A 3GYLB 1HBTH 1S5SA 5J4SA 1DLKB 2QY0B 1BTZA 4JK5A 1LKAA 3RXJA 1CE5A 1HAIH 2DE8A 3M35A 1DITH 2R2WU 4YOGA 3SU5A 1VR1H 3P8GA 3GDSA 1O0DH 3E1XB 5J4QA 2PTCE 1AWHB 1PPEE 2P3FH 5EW1H 4FU9A 1ZSJA 1Z1JA 3DD2H 1O2OA 2D8WA 4UDWH 4WVPE 6GCHG 2ZQ2A 3BTTE 2PKSC 4TSFD 2GT8A 2XC5A 1WTGH 5F53A 2GZ8A 1H8IH 1GHYH 5HM9A 1RTFB 3M7UA 1OSSA 2BX4A 1TRMA 4XDEA 4BAQB 3BN9A 3OY5U 4NGAH 2XRCA 1SGIB 3S7KB 1BTPA 3GS9A 1D3TB 1W12U 1AB9B 1AN1E 1HJAC 2QN5T 3VPKA 4XD7D 4INLA 2F9PA 3KEEA 2BLQA 1LHCH 4J1YA 1FQ3A 2TRMA 5HGGA 3TJVA 1KSNA 2BOKA 1FZZA 1GMCG 3QO6A 4I32A 1BUIA 1GVLA 2WV5A 2A31A 4BTTB 3RXSA 1F0UA 2FWWA 1EAXA 2BLVA 1W14U 1UVTH 2ZFFH 5A0AE 1LVOA 1AVGH 3OEED 4DG4A 1Y8TA 1HGTH 1BHXF 2M5TA 2PGQB 1GBHA 3LGYA 3SUEA 2C8WB 4F48B 3SW2B 4NIVA 1KTSB 2ZFTA 4CBNA 2D2DA 4XRNA 5ABWA 2PKAA 1C1VH 4IBLH 3UNRA 2ZHDA 1ZYOA 1LVBA 2ZTXA 1O3KA 3TGKE 5JDUB 5EQRA 2P3TB 1QA7A 1TOCB 2BTCE 1ZZZA 1GPZA 1TWXB 3F9HA 2OTVA 2G00A 2D26C 5FXLA 4OS2A 5HM2A 2ZPRA 4CH8B 3EGKH 2O8UA 1TRYA 1DUEA 1BOQA 1ELDE 2H2ZA 2QXGA 1SGDE 2XYAA 3F0OA 1HAGE 4F49A 1HAYB 4WH6A 2R0LA 1KIGH 4X6PA 3SV2H 4MPVA 2KZ4A 1K1LA 3A7WA 1P11E 5JBBS 4I7YH 5DSFA 4X8TH 2EI6A 2ZPQA 4X0WU 3RU4T 2DUCA 1E1RD 1CA0C 2Y80A 1DS2E 3QGNB 1HJ9A 3MTYA 5C1XA 4B74A 1BHXB 2YMSC 2W26A 1G30B 3DHKH 3TITA 1H9IE 3SV7A 3R3GB 2FI4E 3PWCA 1UTOA 4XSKU 3UR9A 8GCHF 4IMZA 1GJ8B 1UK2A 3SJ8A 3GCNA 2Z3EA 1D4PB 1FONA 1CGJE 5F8TA 2NWNA 5DP9A 1SLWB 4WXVA 5CHBA 1XVOA 4K8BA 5FX5A 1HAHH 1O3BA 1O5EH 2FX4A 2NU4E 5EQQA 3SNAA 1ZSKA 2G52A 3MNXA 1S6FA 3SQEE 1H8ED 4X2XA 1F92A 1IQIA 2EC9H 4CRFA 2RDEA 5FBEA 3GCHB 4YTAA 3QN7A 1TGCA 1DUAA 1TPOA 1LVYA 1NZQH 5E2OA 1TIOA 1P2NA 4OS1A 1XUHA 2FTMA 2G81E 1NRQH 2Z3DA 1HAVB 1PQ7A 4BXSA 2HPQH 1BMFD 1E1QD 3SU3A 5L6NH 1O37A 4ABFA 1EPTA 1C2IA 4JZDH 4K69A 1GMDF 2FMJA 1C4U2 1BRAA 1UTQA 3QUMP 2WZQA 1IQNA 1SB1H 1LPGB 2WPMS 2BDBA 4B2BA 1BIOA 3NUMA 2PFEA 2CN0H 2I6QA 1IQMA 1Z8JB 3OEHD 4X2VA 8LPRA 2GV7A 2H9TH 1S6LA 3SV6A 1Z8GA 1C5WB 2UUYA 1QIXB 3MH4A 2Z9KA 2BXTH 5AFZH 1XUGA 1UVSH 4ISOA 4Y7BA 2BLOA 1CGIE 2ASUB 2WPKS 2XNIA 1P02A 1ZJKA 2H9HA 1IQFA 1V2KT 1K1NA 1DSTA 1NU9A 1NC6A 3A88A 1GDQA 2ZIQH 8KME2 1DXPA 2BDCA 1V2ST 3SJ9A 2GT7A 1B0EA 1SVPA 2G55A 2IOTA 1GHAF 3H09A 1GBMA 1PJPA 3N99A 1MU6B 3RMOH 3ZVAA 3SU0A 3HGNA 3UB0A 3SU6A 2FYRA 1W11U 3F2HA 1CHGA 2KM0A 3F3BA 5EJLA 2IPHA 3MU0A 4ZKSU 1Y3WA 1EX3A 5K0HA 1O33A 1AB9C 2O9QA 4FOUC 1G3BA 1K2I1 5IYTA 1K21H 1UVOA 2ANWA 1E34B 1FV9A 2WUCA 2Z9IA 1GI8B 2ZGHA 3EQ0H 2ANYA 4IW4E 2ZO3H 3RXEA 2C93B 1FPHH 4RT1A 1MKWK 3PB1E 4BAOB 1OKXA 3DT0H 5K7RA 4Q7YA 1YPEH 1AI8H 1CGHA 3PV4A 1ZJDA 3BTDE 3SU1A 1K9OE 4I8HA 1TGBA 2TPIZ 4TWYA 3M3VA 3DUXH 1GMCF 1OS8A 4K2YA 4ACBA 1BTWA 2AYWA 4BTIB 1TA6A 4Z6AH 1NBMD 1GBIA 2BQ6B 3UNSA 1ARCA 2C3SA 4WJG2 1FMGA 2FLRH 2W3IA 1HRTH 5EJ1A 1LTOA 1V2MT 2O8LA 3DA9B 3GICB 1O5DH 3E0NB 3P92A 3FOAA 3KL6A 1FNIA 3PLPA 2R2MB 1P2KA 4Z0KA 4Q80A 1ARBA 1LMWB 2NU0E 1SLVB 2D1JA 1EQ9A 2CF9H 1DOJA 1VJAU 1ZSLA 4MPWA 1B7XB 4OS6A 3UIRA 2Y6TA 1OYQA 1O3LA 2BDIA 5FPTA 2A2XH 1HYLA 3ZYDA 3ITIA 2QYIA 1GMHG 1NT1A 1YY3A 3TNTA 1K28D 2FOHA 3QDZB 5C17A 3MU4A 3M61U 1XUIA 3OTJE 1PYTD 1Y3UA 1F5KU 1XKAC 3STJA 2FOMB 2IN2A 2G4TA 3ODDA 3C27B 3Q00A 1Q2WA 2PUQH 2FOFA 1LPKB 2TGPZ 2F9BH 2AGIX 4GVUA 3T5FH 2ZZUH 1VCWA 1COWD 3SOSA 2R3UA 1W0KD 4FVDA 2THFB 1O2GH 2F9NA 1BTHH 3F9FA 1TONA 2OC0A 1IOEA 1XUKA 3V3MA 4D9QA 4ABGA 1VCQA 2PR3A 1E36B 1O39A 1TMUH 2VIQA 3VB7A 3HKJB 2FOGA 4NFEA 3M36A 1RRKA 5EPYA 3GCHC 1BJVA 3RXVA 1THSH 3E91A 2ZHWH 1OWDA 4XFQA 1WAYB 4NCYA 4TPYA 1T8MA 1A4WH 1W0ZU 4DIIH 2A4OA 1QA0A 5L30H 3CS7A 4JYVH 1IQEA 1TNKA 3Q3YA 1BTXA 3CNRA 3QK1A 5EXMA 1CT0E 1HJ8A 4NA9H 4LZ1H 4F55A 1WQVH 5CE1A 1QL8A 3A8CA 1XMNB 1TE0A 2QF5A 5T6FA 2OK5A 1GHWH 5F6MA 2B9LA 3AW1A 5BRRE 1NROH 1SLXB 2XOKD 3JZ2B 1TNIA 1ELEE 1C1OA 2XCFA 2XTTB 3RXKA 1SGQE 4ZXXH 1ANEA 3EDXB 1EZXC 1BMAA 1LHEH 4D8NA 4AG1A 4Q63A 3G01A 3MH6A 1QQUA 1SGFG 2BDYA 2FX6A 2P93A 1DLEA 1GJ9B 4FUIA 5FHTA 3TH2H 2Q1JA 4AB9A 2QIQA 3RXAA 2OUAA 3RXIA 1CBWB 3DCLA 2ZGJA 1ZOMA 3EA9A 2FYQA 4HI3A 2BY5X 3SU4A 4Y10E 1EAWA 3ZZBA 2GCTB 1QR3E 1EZUC 3TH4H 2Z9LA 4B75A 1GJ7B 2A1DB 5JYIA 2BY8X 1X7AC 1A5HA 4GUXA 3ZVFA 3K9XB 3RXFA 4ABAA 1J8AA 1O2UA 2HPPH 5T1VA 1TRNA 2FI5E 4FU8A 1CU1A 1WTHD 3NPSA 2QF0A 4NIXA 1MTSA 1WCZA 1DPOA 2M2AA 1WSSH 3UWJH 3BSQA 3U1IB 3RUOA 3KQ5A 4ZROA 1DSUA 5T6DA 3TK9A 5HXFA 5C1UA 1BB0B 2KCYA 4E05H 5C0TA 4BAKB 2QXIA 3WY8A 1NU7B 3V13A 2A7CA 1CT2E 1BRCE 1PQ8A 4UFDH 1AGJA 1O2IA 1KXCA 2NU1E 5C5OA 4GHQA 1SQOA 2GP9B 1EXFA 3OY6U 3U28C 1MKWH 1A7SA 1QJ6B 1JIMA 1E79D 1NFYA 1TQ7B 2ZECA 3D65E 1TX6A 1ZGIA 3VEQB 1ELAA 1ESBA 1O3IA 4E7NA 2PKAB 1F5RA 2A2QH 3M5OA 1OP2A 3SGAE 1MABB 3AAUA 3VB3A 1XKBC 1CHOF 1UTPA 1TB6H 1MD8A 2ODQA 4MDSA 1C1RA 1XUFA 4JCNA 5EG4A 5HKKD 3FZZA 4O03A 1ZRBA 3CP7A 3HK6B 4LOYH 3ATLA 5C5NA 1FIZA 1GJBB 2K0QA 4MPXA 4R0IA 4CBOA 1YP9A 2C4FH 3SZEA 4A7IB 1VKYA 1P06A 1SFQB 2A0QB 3MNBA 1E35B 2C8ZB 4LK4A 1SBWA 1GDUA 3NKKA 2KAIA 3SZNA 1EFRD 1FI8A 1CA8B 4X2WA 1LHGH 1Z1IA 1C5MD 1IAUA 2L6OA 4TYDA 4DIHH 2F9VA 2VGCC 1A46H 4UFGH 5EIYA 5C3NA 2AIPA 4JYTA 2QC2A 1QHRB 3P8NA 3NRLA 1FN6A 1GL0E 1V2TT 5EU8A 3EAJA 4MPUA 4DCDA 5GCHG 1NO9H 4RKOB 2ZFQH 1YPKH 1IQHA 1Y3XA 1Z71A 3OSYA 4Y79A 3RXPA 5I25A 3NK8A 1P09A 1RXPA 2JIZD 3TGJE 2WV9A 4K3JA 4YLQH 1ACBE 1LO6A 3ZZ8A 2KR7A 1V2UT 2HVXA 3RXBA 3VB6A 1AD8H 1DWBH 1HAXB 4I8LA 1FY8E 2WSSD 2KFWA 2VVUA 3F1SB 4FXGH 1GGDB 1N6YA 7GCHG 2BD7A 1MBMA 3LGVA 3BG4B 1MZAA 3FAOA 1YCPH 2G5NA 3TJUA 2ILNA 1EAUA 1SGTA 2HALA 1EB1H 3P70B 1D3QB 3D49H 1HIAA 3KQDA 1C5NH 3QLPH 3MYWA 2AMQA 3P17H 1O3PB 2XBVA 4Z1MD 1W3CA 4Y6DA 5KEDA 5LPRA 1EPTB 3PMBB 3RC5A 1T32A 3PMHB 4X8VH 1NFXA 3M3TA 1JRSA 1C2HA 1BTYA 1V2OT 3A87A 1GVZA 3E90B 1SGPE 4MTBA 4XE4A 3FN8A 1GCTB 3PROA 5C1YA 2FI3E 3SHAH 1V2QT 1H9LB 3FFGA 3PV5A 1WBGB 2FLBH 1FN8A 3SQHE 4NSVA 2ZG0H 3RU4D 2ZGBH 3N7EA 1PPCE 3E3TA 4B6EA 3H7TA 1SMFE 1BRBE 2BY6X 4E06H 1IQJA 3S9BA 1UTLM 2CHAB 2UUFB 5F03A 3ZZDA 1KYNA 3ZZ4A 3MHWU 1C5LH 1NRSH 3UUZA 3M7TA 1EATA 1V2WT 2ANKH 2EA3A 3SNCA 1Z8RA 1OWHA 2A32A 2SFAA 1TLDA 2FODA 3UTUH 4NG9H 1JXPA 3A81A 1CBWC 2DE9A 2PUXB 1W0YH 1ETRH 1DDJA 4CH2B 2AERH 1QL9A 5E0HA 1YBWA 3RXCA 3E8LA 2ALVA 3SO3A 2QV1A 2H9EH 2GCTC 1RFNA 1T7CA 3STIA 4HTCH 2OQUA 3MNSA 4KGAA 4TY6A 4NZLA 2ZTYA 4HG6A 3GCTF 3RXOA 1C1MA 2VIWA 1AFEH 1MAYA 5DP7A 2CF8H 2J34A 4DGJA 4CRCA 3RM2H 2BQ7B 4BXWA 3BTGE 2ZP0H 2GDEH 3E0PB 4KELA 3A7ZA 2RCEA 2ZU5A 2QXHA 1QZ8A 2VVVA 3DSGA 2AS9A 1HNEE 3GISB 2C8YB 1PPZA 1ABIH 1A3EH 1D6WA 2ZU1A 2BY7X 1ANCA 4NA8A 3MQKC 5CDFE 4UE7H 1C9PA 1TNGA 4X1QU 4Y8ZA 1DY8A 3SU2A 5A8XA 2C90B 2ZGXH 3VB4A 1NRPH 4XBCA 3VXEH 1GJ4H 2JDID 1YLNA 2OLGA 2PLXA 2XWBI 2RA0A 1DE7H 3P95A 1GBAA 2ZU4A 2TGTA 4B73A 1G3DA 1AZZA 1GI5A 1ZPCA 4ABJA 1HFDA 1TFXA 4AORA 1QCPA 3SN8A 3IITA 2OXSA 4WH8A 2XW9A 1ELCA 4ZCNA 1P10A 2A5KA 2O8WA 4K8YA 5DP5A 1Y5UT 1F0TA 1O2WA 2KX4A 2QAAA 1YPMH 4BAHB 1AFQB 2BMGB 5FBIA 4JZIA 4IC5A 3RXLA 1C5TA 1DVAH 2SGDE 1DXWA 1LQEA 1O3FA 4ZXYH 1CVWH 1OP0A 1LDTT 1G2LA 1O2JA 1O32A 1SOZA 2STAE 5E0GA 2UWPA 1NN6A 3DFLA 1WQSA 2BY9X 1UTMA 1GI1A 1GHBF 2W5EA 1ZR0A 1DX5M 1PPHE 2GCHG 3A89A 3TPIZ 4E7RG 1QB6A 4YLUA 3UNQA 1O38A 5EJZA 2CJIA 2FOCA 3CENA 4A1XA 5ETXA 1AKSA 5L2ZH 2OD3B 5A8YA 4DJZB 1ZPBA 1GJCB 3GY4A 1T8OA 2HWLB 4ABEA 4GAWA 3KN2A 2A7JA 1PQ5A 2SGPE 2BYAX 2GTBA 1EJAA 1UVUH 4ZMAH 5GPIB 2J98A 1C2KA 1QB9A 1BMLA 1S0QA 3RXUA 3T29A 2Y5GA 1C1WH 4U2WA 1EZQA 2GVFA 1Z8IB 2FEQH 5EPNA 3N7OA 1INCA 3I77A 2BD3A 1FPCH 2J5UA 4X8SH 2Z9JA 3LGIA 3A7VA 1JIRA 1GGDC 4Y71A 1OWIA 3BG4C 9LPRA 3Q3KA 2V3OH 3BTHE 5GCHF 4O9VA 3SYJA 3W1EA 3K2UA 2ZEBA 1NFWA 1O3NA 1UHBA 4DOQA 2P94A 1BJUA 4WXIA 3QTOH 4AGKA 1TMTH 4BOHA 3BTME 4MQAA 1FJSA 3ZVDA 3NXPA 1EPTC 2BZAA 3JZ1B 3MOCA 1IHTH 4IN1A 1KXDA 3L3TA 4ZKRU 4K5ZA 4WY3A 4FUBA 2AMPA 7GCHF 1DM4B 3UQVA 1O30A 2BDHA 3BTEE 2CV3A 1P0SH 1Q31A 3KCGH 6CHAB 3M5MA 1GCTC 1GJ5H 2Z7FE 1C5UA 2AGEX 1AHTH 3PO1B 4ABHA 1A5GH 4GCHG 1OWJA 4WMEA 2BVSH 1L1NA 1OXGA 3ESTA 6GCHF 1NESE 1ZTKA 2FOEA 1WXRA 1ETSH 1BMMH 1QRWA 1P2OA 4Q2KA 2WV4A 5EQSA 4UFEH 4A1VA 5EXNA 1A2CH 3U69H 2J97A 1P3EA 4INKA 1P05A 1T8LA 1C5RA 3SV8A 4AFZA 3SNEA 3LU9B 3LJOA 3K65B 3U8OH 1GWAA 2WPLS 4ZHAA 1K1OA 1DICA 2GGVB 3F68H 1SGEE 1ANBA 1MTNB 1AZ8A 4AG2A 5DPAA 1SSXA 4UEHH 2A4GA 4ISIH 3MMGA 1S83A 2G51A 4AFUA 1K1IA 3UQOA 3ZVEA 1A61H 2FDAA 2BZ6H 2SGFE 1GBEA 1VITH 3BTFE 2EY4C 1EJMA 1O3OA 3A86A 2O8TA 1FIWA 1V2NT 1O5FH 5AFYH 3A7XA 2UUKB 4JZEH 5HIYA 4NWKA 3BIVH 1SHHB 5B6LA 1VCPA 3SJIA 4CRBA 4CRDA 4UFFH 3V0XA 4ZHLU 3WW7A 1SGFA 3ZZ3A 2KCPA 3LDXH 5FPSA 1WOFA 3SORA 1O2XA 4H4FA 2ZI2H 3NCLA 1Y5AT 3U1JB 1LHDH 1JWTA 1D3DB 1G36A 2F3CE 2GZ7A 2BQWB 1V2RT 3M5LA 2BX3A 5A0BA 2K8IA 2J2UA 2BM2A 4CHAB 2I6SA 4ISLA 2Q6GA 2VH0A 3QZRA 1IHSH 3ZV8A 1L0ZA 1NRNH 2V7QD 1B5GH 1O3DA 4FUHA 1VITG 2Z3CA 1V6DA 1O2PA 1QJ7B 3TU7H 3MH5A 1HB0B 1LPZB 3GY8A 1ELTA 2W3KA 1AFQC 4Q7ZA 2JH0D 2J9NA 1W7GH 3ZVGA 3BTWE 4P02A 3UOUA 2AFQB 2KAIB 1Q3XA 2VH6A 1C2JA 5JBTA 5FCKA 3GY7A 1L4DA 1S6HA 4ACAA 1PFXC 1PPBH 2P8OB 3A85A 1AVXA 1AUTC 1SGRE 1EZSC 1GI7B 1O5BB 1KDQA 1QB1A 1VZQH 1C2LA 4ZKOU 1SGYE 4X2YA 3O8DA 2ZHFH 3ZZ6A 2OC8A 3ATIA 3RXGA 3MI4A 3A8AA 5JPMH 1RIWB 1MCTA 2L74A 3E16B 3KNXA 4Y8YA 5FPYA 3PMAB 5JBAS 1E0FD 1UVPA 5EOKA 1C1SA 2Y7ZA 4FU7A 1XVMA 2F4LA 2WPDD 2GCHF 2J4IA 3SJKA 3PWBA 1KXFA 2YMSD 1LQDB 3GY5A 3KQEA 1SOTA 2F43B 4AX9H 2WPHS 5TCAA 1P2JA 1DWDH 1W7XH 4Q4LA 3RLYH 4RKJB 4JZ1A 3LC3A 2ZTZA 1JBUH 2A5AA 1DT2A 1ZTLA 5F8XA 1NY22 2F83A 1YLDA 3RXMA 5T3HA 1NBME 1G9IE 5C0UA 5G4BA 1HIAB 2GMTB 2BVXH 3IG6B 2AH4X 3UR6A 1ZRKA 2VB0A 3UAIC 1THPB 2ZPSA 2W7SA 1YC0A 1ZTJA 1S84A 2GX4A 1F0RA 1FUJA 1C4Y2 1QRZA 3ZZ5A 1GJAB 1C5VA 1C5XB 4Q7XA 2PTNA 1EASA 2ZGCA 3LOXA 5E0JA 1F7ZA 4X8UH 3F9GA 4FUJA 1HUTH 1N8OB 1GBTA 1A5IA 3PO1C 4DY7B 1NS3A 1P01A 1AMHA 3NZIA 4Y76A 3KF2A 3MO3A 3KYFA 4SGBE 1IQLA 4IC6A 1TBRH 1SQAA 2ZDMA 1EJNA 4ASHA 1O2MA 2XC4A 3LJJA 2BD4A 2G8TA 5HIZA 2BXUH 3MU1A 5CMXH 1OX1A 3PTBA 3V12A 1YPHC 1W10U 2HOBA 3BF6H 3GOVB 1QNJA 1OOKB 4I33A 5TCCA 3TK6A 3EA8A 2FTLE 2OC1A 1AE5A 2J38A 1TX7A 1SKYE 3RLWH 4TPIZ 1CQQA 4BAMB 2ESTE 2JJ2D 4Y11E 3MU5A 4NA7A 1OPHB 2WYGA 1GCDA 4IS5A 1OYTH 1MTNC 1ZMNA 2VWOA 3AK5A 2JKHA 1DY9A 1ESTA 1AE8H 2KCOA 1SG8B 2LP6A 3VG8A 4AFSA 2A45B 1XXFA 1P3CA 3UY9A 2ZFPH 4TWWA 2GKVE 1V2LT 2PP6A 2HLCA 2A5IA 2HNTF 4ISNA 1SC8U 5DP6A 1O3AA 3EE7A 4MLFB 4FUGA 4K1SA 4UONA 8GCHG 2C8XB 1FLEE 4X1SU 1ELBA 1XUJA 3EYDA 1A0HB 2BVRH 3Q77A 3SGBE 3TK5A 4X6NA 3SJOA 1G37A 1Y5BT 5FX6A 2TIOA 3Q76A 4YM9A 2UWOA 2ODPA 1O3HA 1SL3A 3SBKA 3ZZ9A 4O3UA 1RJXB 4A1TA 3RXRA 5AVDA 1NPMA 2ZF0H 4I31A 1O5AB 2AGGX 4MVNA 4SGAE 3HATH 1GDNA 2TGDA 1UTJA 1TYNA 2FP7B 3UFAA 1ZMLA 1O2HA 2EI8A 5E2PA 4DT4A 1O31A 3U9AH 4AN7A 2BD9A 1F2SE 1PQAA 3HKIB 4CHAC 4A92A 2OCVB 2FZZA 3AAVA 1KXAA 3I78A 4WMFA 3UPEA 3TJNA 4RT0A 4XOJA 2LNCA 2FM2A 2Y82A 1PPFE 1TBZH 1FY4A 1C2DA 1ELGA 1C9TA 3L33A 4XBBA 4CRAA 5A09A 4X1PU 2F9OA 1GMHF 3PRBA 3BEIB 4AOQA 2R3YA 1UTNA 5DJ7A 2VNTA 2WHXA 3MO6A 3S7HB 1C5PA 3RXDA 1HDTH 1KMHB 1MUEB 1W2KH 3S69A 1KTTB 1OWEA 2BD2A 5DP8A 5C94A 3VXFH 5GXPA 5DGJA 1AIXH 3VFEA 1HAZB 3LGUA 1OP8A 3OE7D 2YNAA 3ENSB 3A83A 2P8OC 1N1LA 2XBWA 4WWYA 2A4QA 1AKSB 4MNWA 1A0JA 1GHVH 2JETB 1F0SA 1TALA 4U32A 3LGTA 5GNDA 3VGCB 2H6MA 1QURH 1MTVA 3RXTA 4A5TS 3TNSA 4BNRA 2Y5FA 2J98B 1UO6A 1RIWC 1ZHPA 3F0PA 1GHAG 1QY6A 3RDZA 1MTUA 3A82A 1ZLRA 3BV9B 4RSPA 4Y8XA 4KTCA 3U8TH 2FO9A 3H5CB 3QX5H 2J95A 3D62A 5LH8A 1WYKA 1BQYA 5GWZA 1FAKH 1EUFA 1O2ZA 3HPTB 1AUJA 2K1QA 2J94A 5C67A 3D23A 1BCUH 1O2SA 5F8ZA 3MU8A 1UHBB 2XCNA 1Y3VA 2FOAA 2GMTC 2RDLA 1GBBA 3E6PH 3FZDA 2VWNA 3N7DA 1XM1A 1O3MA 1OHHD 8ESTE 1DFPA 1C1QA 2WPIS 5GIBA 1ZGVA 1P04A 1MQ5A 2QCYA 3EE0B 3F6UH 5DP3A 3TGIE 2W6JD 1C1PA 2W7UA 1MQ6A 1FAXA 1CSOE 3T25A 1B0FA 3EA7A 4GSOA 1C4V2 5GJ4B 4AZ2B 3O8CA 1AU8A 1BZXE 2J92A 3RC6A 4B2CA 3O8RA 2FESH 3BG8A 3K6YA 4A6LA 3OTPA 4THNH 1N8OC 1EAIA 3WWFA 3AW0A 3VB5A 1HPGA 2SNWA 4OGYA 1P9UA 1O2VA 4M9FA 4VGCB 4OGXA 4YESB 4AFQA 2VIPA 4GPGA 3W94A 2WINI 5C2ZA 1TAWA 1PYTC 4K1TA 3NWUA 2A4RA 1AQ7A 3P6ZB 3ZZCA 2TBSA 3OX7U 1J16A 1TPAE 2OBQA 3QWCH 1Y59T 3OFND 4MNXA 1ESAA 4LZ4B 3PLKA 4NZQA 1PPGE 2Q6DA 4FUCA 2TGAA 4F4OC 4D9RA 4B76A 4XBDA 5EGMA 4JK6A 4IN2A 1EB2A 3DSPA 2VBCA 4AYVB 5TJXA 5HYOA 5AF9H 1BA8B 1S85A 5EW2H 1W8BH 4ASUD 1NTPA 2YNBA 5KGOA 1T31A 1C5ZB 4INHA 1MAXA 3B8JA 3BTKE 2H5DA 3BTQE 1K1PA 6LPRA 3MH7A 1MU8B 1UW7A 1V2PT 1O35A 1T4VH 2ZCKP 3R0FA 5DN6D 4I8GA 5FAHA 1UCYE 3PM3A 1KLIH 3UREA 1M9UA 1C2GA 3ZIAD 2OBOA 1QJ1B 3SV9A 3RMNH 1KLTA 4CR5A 1J9CH 3GDVA 3KQBA 1KXEA 1G3CA 5DG6A 5ESBA 3RMLH 1DWEH 5JB8S 3DSOA 1GHXH 1K22H 3RU4E 4TT3D 1KLJH 2ANMH 5FCRA
chains in the Genus database with same CATH topology
3SUGA 3ODFA 4JMYA 1P8VC 1RS0A 2OINA 1O2YA 1FY5A 2ZFRH 3AASA 1UCYK 3S9AA 1QBNA 1YKTA 1O2TA 1TABE 4LXBH 1BBRE 5A0CA 2HGTH 4JYUH 1JRTA 6ESTA 2ZDVH 9ESTA 2ODYB 1YLCA 2V3HH 3ZYEA 2Z9GA 3BEUA 3W95A 1TPPA 5T6GA 3ZZAA 1Z7KA 2XBYA 3M3SA 1AWFH 4MNYA 5LPFA 1H8DH 4FUDA 2FPZA 1P2QA 2LPRA 1O3JA 3ELAH 2HNTC 1MKXK 3PTNA 1XX9A 2ZCHP 3A8BA 2R9PA 1KDQB 1V3XA 2Y7XA 3F9EA 1QGFA 1BBRK 2QF3A 3OYPA 3KHVA 1EKBB 2BD8A 1G2MA 2V0BA 1ID5H 1WU1A 4BANB 1T8NA 3FP8E 2P59A 2Q6FA 2ZA5A 2JETC 4ZKNU 4AYYB 4DURA 2F9UA 3SNDA 2SGEE 3UWIA 1D3PB 4WMDA 3Q3XA 4OS7A 3VGCC 2PW8H 4X6MA 1TX8A 2AEIH 2ZDAH 3RMMH 2VWLA 4GLYA 5B6OA 1UJ1A 3QTVH 4K1EA 1K1JA 1L2EA 1LVMA 3GDUA 1VGCB 3DFJA 1H4WA 1KY9A 3FP6E 1TBQH 1EP6A 3QGJA 1FY1A 1MZDA 2VVCA 2PWXA 4HZHA 1FY3A 4OS5A 1ZHRA 1A0LA 1TGSZ 3ATWA 3ZZ7A 2UUJB 1S82A 1SPJA 1SI5H 2H5CA 4H6SB 4PROA 5L2YH 5HMAA 1ZHMA 3SI4H 1G32B 2O8MA 1GG6B 3HGPA 4FUFA 1ANDA 1U6QA 2CXVA 3A84A 1QRXA 2FIRH 3A8DA 3OU0A 3RP2A 2CHAC 1C1TA 3C1KA 1C5SA 1W13U 4ABDA 1YPHE 4D7GA 1NM6A 7ESTE 3H7OA 1BMNH 2ULLA 1C1NA 1HV7A 3K6ZA 4NWLA 1DANH 2VIVA 1QL7A 1O3CA 1T4UH 4NFFA 3ZV9A 1ORFA 2RG3A 1C2MA 3M37A 3S0NA 1S81A 3BIUH 3M5NA 4H6TA 4NIYA 2V35A 1SHYA 1THRH 3A7TA 4ZUHA 2CMYA 3GCOA 1G3EA 3CS0A 4NSYA 3ZVCA 1SFIA 1Z6EA 4HGCA 3I29A 4ABIA 2GZ9A 1CHOG 3URCA 1ZMJA 2B7DH 2OP9A 1J14A 1ETTH 2ZDNA 3L6PA 4J2YB 1WV7H 1F5LA 2ZWLH 4VGCC 1CT4E 1YF4A 2XWAA 1YCPM 2FXRA 2PHBA 1O2NA 1UTKA 1A3BH 3LT3A 4KTUA 1GI6A 2SGQE 2Z94A 1C2FA 1JMOH 7KMEH 3BEFB 5DP4A 3RXQA 1V2JT 3ATMA 2XXLA 4O97A 1OWKA 5H4IB 4TY7A 4D76A 1P12E 2BDGA 1TPSA 3TJOA 4O3TA 1L4ZA 3T28A 3LH1A 1LHFH 4CR9A 1O3EA 1BT7A 5GDSH 3SI3H 2OC7A 2FS9A 1UMAH 1P03A 7LPRA 4QT8C 2B8OH 3V7TA 1O34A 2R0KA 4YO9A 2JH5D 1D9IA 3GY2A 1C5QA 3MO9A 5SGAE 2ZHEH 3LKWA 2QA9E 3B23B 2PV9B 2Z6BD 1H9HE 1E37B 4H42U 3T62A 1C5OH 1TA2A 4AGJA 5LPEA 5CHAB 2VGCB 4X1NU 4YOJA 4MNVA 3M7QA 2ZHQH 2FS8A 3LONA 1P2MA 1XXDA 4KKDA 4YT6H 2G4UA 3FP7E 3MFJA 1LCYA 2ZQ1A 1HAVA 3TVJB 1GI2A 4NIWA 2BB4A 4FUEA 1YPGH 2P95A 1FDPA 2F91A 2ZC9H 4FVBA 2EEKA 4B1TA 2FOBA 1NRRH 1JOUB 2ALPA 1SQTA 3LGWA 2STBE 4CREA 2XC0A 1HXEH 1L1GA 4U30A 5IDKA 1YCPK 4YT7H 2EI7A 1C5YB 2HRVA 1UCYH 2WYJA 4WF8A 4JZFH 3TH3H 1L1JA 1YPJH 3P8OA 1BRUP 1QFKH 1TGNA 3URDA 3HK3B 4OS4A 3FANA 1GJDB 4X1RU 2RA3A 1AVWA 1VJ9U 5A8ZA 3O8BA 1EOLA 1GBFA 1SGCA 2PKSB 5DKMA 2P3UB 4B2AA 1O2KA 2GV6A 3LC5A 4I8KA 3T26A 5C20A 1QBOA 1UK3A 1HXFH 5DO4H 2PGBB 1MKXH 3A7YA 2WPJS 3GY3A 2AIQA 4GHTA 4B71A 1O2RA 4R8TB 4ZAEA 1E38B 2Y81A 4IGDA 1BBRH 3ZVBA 1GI4A 2IJOB 1YYY1 5BPEA 1N6XA 1QTFA 1HJAB 3SHCH 5DK1A 3A80A 2ZNKH 1EP5A 1GI3A 1ABJH 4X6OA 1VGCC 3MWIU 1O36A 2YOLA 6CHAC 1IQGA 1V2VT 3U98H 1UK4A 3T2NA 4UD9H 1P9SA 1EOJA 2ZU3A 2QGRA 4K60A 3GCTG 5EODA 2JH6D 2VU8E 1HLTH 1SGNE 2BHGA 1J17T 4M7GA 1QQ4A 3TLOA 1GG6C 1C2EA 3FVFB 5ESTE 3UOPA 2BLWA 4BTUB 4U01A 4HFPB 2UWLA 5PTPA 2VIOA 1AY6H 4ESTE 2P16A 1HCGA 5A2MH 1ELVA 3LPRA 4YOIA 4D7FA 1GI9B 3TIUA 1J15A 5AHGH 4GCHF 4MG3A 1GHZA 1P2IA 2B0FA 4KTSA 1O3GA 4KP0A 1BDAA 2VWMA 1QBVH 5LGOA 1O2QA 1NFUA 2XBXA 1TGTA 5JBCS 2BOHB 3KGPA 3P8FA 2SNVA 3IWMA 4RN6A 1SR5C 4YZUA 2ZDLA 4ZHMU 2NU2E 2A7HA 3MNCA 5EXLA 2BDAA 3SUFA 4ISHH 2ZCLP 1WUNH 3KQCA 1MCVA 2GD4B 5JB9S 3U8RH 1C1UH 3RXHA 3LIWA 3GYMA 1TNLA 3QZQA 3PYHA 1GBKA 1CA0B 2ZFSA 2V6NA 2ZDKA 4DVAU 2VJ1A 2ZU2A 1MMJN 1TMBH 3RC4A 4I8JA 1IQKA 1SLUB 1GHBG 2PSXA 1K1MA 1Y3YA 2NU3E 3SGQE 1MD7A 2H1UA 2AMDA 2Y5HA 1D6RA 2GDDA 5E8EH 2VIDA 1KXBA 4ZH8A 1GBCA 4Y7AA 1AO5A 3GY6A 1O2LA 2ZKSA 4ABBA 2VINA 1O5GH 1YGCH 1DWCH 3T27A 1HAOH 1GJ6A 3ATKA 3SNBA 1GBDA 1BITA 1P57B 1RD3B 3KIDU 3PMJA 5I46H 4IMQA 1GVKB 1O5CB 4Y0YE 1RTKA 1TNHA 1YPLH 1GMDG 1A1RA 2CGAA 1HAPH 2G5VA 1Z6JH 3AVZA 5CHAC 1GL1A 3S9CA 1CO7E 1ELFA 2OQ5A 1RGQA 2HNTE 1BTUA 1GBJA 4DW2U 1TNJA 2QXJA 1FXYA 1MBQA 3B9FH 1MTWA 1VITF 4CRGA 1H1BA 4Y0ZE 3PLBA 1TQ0B 4DT7B 1LKBA 1RTLA 1TOMH 2SGAA 3RM0H 3LH3A 1S0RA 2PSYA 1MH0A 1ZPZA 2WUBA 1GI0A 1GBLA 4AB8A 3SUDA 2B5TB 2BD5A 1YM0A 3GYLB 1HBTH 1S5SA 5J4SA 1DLKB 2QY0B 1BTZA 4JK5A 1LKAA 3RXJA 1CE5A 1HAIH 2DE8A 3M35A 1DITH 2R2WU 4YOGA 3SU5A 1VR1H 3P8GA 3GDSA 1O0DH 3E1XB 5J4QA 2PTCE 1AWHB 1PPEE 2P3FH 5EW1H 4FU9A 1ZSJA 1Z1JA 3DD2H 1O2OA 2D8WA 4UDWH 4WVPE 6GCHG 2ZQ2A 3BTTE 2PKSC 2GT8A 2XC5A 1WTGH 2GZ8A 1H8IH 1GHYH 5HM9A 1RTFB 3M7UA 1OSSA 2BX4A 1TRMA 4XDEA 4BAQB 3BN9A 3OY5U 4NGAH 2XRCA 1SGIB 3S7KB 1BTPA 1D3TB 1W12U 1AB9B 1AN1E 1HJAC 2QN5T 3VPKA 4INLA 2F9PA 3KEEA 2BLQA 1LHCH 4J1YA 1FQ3A 2TRMA 5HGGA 3TJVA 1KSNA 2BOKA 1FZZA 1GMCG 3QO6A 4I32A 1BUIA 1GVLA 2WV5A 2A31A 4BTTB 3RXSA 1F0UA 2FWWA 1EAXA 2BLVA 1W14U 1UVTH 2ZFFH 5A0AE 1LVOA 1AVGH 4DG4A 1Y8TA 1HGTH 1BHXF 2M5TA 2PGQB 1GBHA 3LGYA 3SUEA 2C8WB 3SW2B 4NIVA 1KTSB 2ZFTA 4CBNA 2D2DA 5ABWA 2PKAA 1C1VH 4IBLH 3UNRA 2ZHDA 1ZYOA 1LVBA 2ZTXA 1O3KA 3TGKE 5JDUB 5EQRA 2P3TB 1QA7A 1TOCB 2BTCE 1ZZZA 1GPZA 1TWXB 3F9HA 2OTVA 2G00A 2D26C 5FXLA 4OS2A 5HM2A 2ZPRA 4CH8B 3EGKH 2O8UA 1TRYA 1DUEA 1BOQA 1ELDE 2H2ZA 2QXGA 1SGDE 2XYAA 1HAGE 4F49A 1HAYB 4WH6A 2R0LA 1KIGH 4X6PA 3SV2H 4MPVA 1K1LA 3A7WA 1P11E 5JBBS 4I7YH 4X8TH 2EI6A 2ZPQA 4X0WU 3RU4T 2DUCA 1CA0C 2Y80A 1DS2E 3QGNB 1HJ9A 3MTYA 5C1XA 4B74A 1BHXB 2W26A 1G30B 3DHKH 3TITA 1H9IE 3SV7A 3R3GB 2FI4E 3PWCA 1UTOA 4XSKU 3UR9A 8GCHF 4IMZA 1GJ8B 1UK2A 3SJ8A 3GCNA 2Z3EA 1D4PB 1FONA 1CGJE 5F8TA 2NWNA 5DP9A 1SLWB 4WXVA 1XVOA 4K8BA 5FX5A 1HAHH 1O3BA 1O5EH 2FX4A 2NU4E 5EQQA 3SNAA 1ZSKA 2G52A 3MNXA 1S6FA 3SQEE 4X2XA 1F92A 1IQIA 2EC9H 4CRFA 5FBEA 3GCHB 4YTAA 3QN7A 1TGCA 1DUAA 1TPOA 1LVYA 1NZQH 5E2OA 1TIOA 1P2NA 4OS1A 1XUHA 2FTMA 2G81E 1NRQH 2Z3DA 1HAVB 1PQ7A 4BXSA 2HPQH 5L6NH 3SU3A 1O37A 4ABFA 1EPTA 1C2IA 4JZDH 4K69A 1GMDF 2FMJA 1C4U2 1BRAA 1UTQA 3QUMP 1IQNA 1SB1H 1LPGB 2WPMS 2BDBA 4B2BA 1BIOA 3NUMA 2PFEA 2CN0H 2I6QA 1IQMA 1Z8JB 4X2VA 8LPRA 2GV7A 2H9TH 3SV6A 1Z8GA 1C5WB 2UUYA 1QIXB 3MH4A 2Z9KA 2BXTH 5AFZH 1XUGA 1UVSH 4ISOA 4Y7BA 2BLOA 1CGIE 2ASUB 2WPKS 2XNIA 1P02A 1ZJKA 2H9HA 1IQFA 1V2KT 1K1NA 1DSTA 1NU9A 1NC6A 3A88A 1GDQA 2ZIQH 8KME2 1DXPA 2BDCA 1V2ST 3SJ9A 2GT7A 1B0EA 1SVPA 2G55A 2IOTA 1GHAF 1GBMA 1PJPA 1MU6B 3RMOH 3ZVAA 3SU0A 3HGNA 3SU6A 2FYRA 1W11U 1CHGA 2IPHA 3MU0A 4ZKSU 1Y3WA 1EX3A 5K0HA 1O33A 1AB9C 2O9QA 1G3BA 1K2I1 5IYTA 1K21H 1UVOA 2ANWA 1E34B 1FV9A 2WUCA 2Z9IA 1GI8B 2ZGHA 3EQ0H 2ANYA 4IW4E 2ZO3H 3RXEA 2C93B 1FPHH 1MKWK 3PB1E 4BAOB 1OKXA 3DT0H 5K7RA 4Q7YA 1YPEH 1AI8H 1CGHA 3PV4A 1ZJDA 3BTDE 3SU1A 1K9OE 4I8HA 1TGBA 2TPIZ 4TWYA 3M3VA 3DUXH 1GMCF 1OS8A 4K2YA 1BTWA 2AYWA 4BTIB 1TA6A 4Z6AH 1GBIA 2BQ6B 3UNSA 1ARCA 2C3SA 4WJG2 1FMGA 2FLRH 2W3IA 1HRTH 1LTOA 1V2MT 2O8LA 3DA9B 3GICB 1O5DH 3E0NB 3P92A 3KL6A 1FNIA 3PLPA 2R2MB 1P2KA 4Z0KA 4Q80A 1ARBA 1LMWB 2NU0E 1SLVB 2D1JA 1EQ9A 2CF9H 1DOJA 1VJAU 1ZSLA 4MPWA 1B7XB 4OS6A 3UIRA 2Y6TA 1OYQA 1O3LA 2BDIA 5FPTA 2A2XH 1HYLA 3ZYDA 3ITIA 2QYIA 1GMHG 1NT1A 3TNTA 1K28D 2FOHA 3QDZB 3MU4A 3M61U 1XUIA 3OTJE 1PYTD 1Y3UA 1F5KU 1XKAC 3STJA 2FOMB 2IN2A 2G4TA 3ODDA 3C27B 3Q00A 1Q2WA 2PUQH 2FOFA 1LPKB 2TGPZ 2F9BH 2AGIX 4GVUA 3T5FH 2ZZUH 1VCWA 3SOSA 2R3UA 4FVDA 2THFB 1O2GH 2F9NA 1BTHH 3F9FA 1TONA 2OC0A 1IOEA 1XUKA 3V3MA 4D9QA 4ABGA 1VCQA 2PR3A 1E36B 1O39A 1TMUH 2VIQA 3VB7A 3HKJB 2FOGA 4NFEA 3M36A 1RRKA 5EPYA 3GCHC 1BJVA 3RXVA 1THSH 3E91A 2ZHWH 1OWDA 4XFQA 1WAYB 4NCYA 4TPYA 1T8MA 1A4WH 1W0ZU 4DIIH 2A4OA 1QA0A 5L30H 3CS7A 4JYVH 1IQEA 1TNKA 3Q3YA 1BTXA 3QK1A 5EXMA 1CT0E 1HJ8A 4NA9H 4LZ1H 1WQVH 5CE1A 1QL8A 3A8CA 1XMNB 1TE0A 5T6FA 1GHWH 5F6MA 2B9LA 3AW1A 5BRRE 1NROH 1SLXB 3JZ2B 1TNIA 1ELEE 1C1OA 2XCFA 2XTTB 3RXKA 1SGQE 4ZXXH 1ANEA 3EDXB 1EZXC 1BMAA 1LHEH 4D8NA 4AG1A 3G01A 3MH6A 2P93A 1QQUA 1SGFG 2BDYA 2FX6A 1DLEA 1GJ9B 4FUIA 5FHTA 3TH2H 2Q1JA 4AB9A 2QIQA 3RXAA 2OUAA 3RXIA 1CBWB 2ZGJA 1ZOMA 3EA9A 2FYQA 4HI3A 2BY5X 3SU4A 4Y10E 1EAWA 3ZZBA 2GCTB 1QR3E 1EZUC 3TH4H 2Z9LA 4B75A 1GJ7B 2A1DB 5JYIA 2BY8X 1X7AC 1A5HA 4GUXA 3ZVFA 3K9XB 3RXFA 4ABAA 1J8AA 1O2UA 2HPPH 1TRNA 2FI5E 4FU8A 1CU1A 1WTHD 3NPSA 2QF0A 4NIXA 1MTSA 1WCZA 1DPOA 3UWJH 1WSSH 3BSQA 3U1IB 3RUOA 5T6DA 4ZROA 1DSUA 3TK9A 5HXFA 5C1UA 1BB0B