2TPIZ

On the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
220
structure length
220
Chain Sequence
b'GYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title On the Disordered Activation Domain in Trypsinogen. Chemical Labelling and Low-Temperature Crystallography
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 220
sequence length 220
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1981-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tpiZ01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tpiZ02
4PROA 3S9CA 1DANH 1O2IA 1CHOG 5HM9A 4JZIA 2A7HA 4D76A 4AZ2B 4K3JA 2ZDKA 5SGAE 3KNXA 2FPZA 1HAZB 1FY3A 5JPMH 2EI8A 2CGAA 2A4RA 1C5ZB 1ZMNA 1QB6A 3ZVCA 2A5AA 2P3TB 3SV8A 4GCHF 6LPRA 2QC2A 2ZU2A 1EJAA 2THFB 4NIXA 2FOEA 1SGFG 1FLEE 1C1RA 3T27A 2ZU4A 5A09A 1YPEH 1O5AB 1QBOA 1V2OT 4GHTA 4H4FA 1SQOA 1C1SA 3DHKH 1QR3E 1ESAA 2OBQA 4O03A 4Q80A 1GJ4H 6CHAC 5JB8S 1TOMH 1GGDB 1XVOA 1FONA 3ATKA 4IC5A 3RXKA 2XW9A 3NKKA 1LHFH 3MI4A 4ABDA 1DS2E 2FI5E 1ANBA 4WVPE 4JYUH 4I33A 2ZEBA 3DFLA 4A92A 2RG3A 1PPZA 2G5NA 2FI4E 4BAOB 2WPLS 1C1MA 1WYKA 2VIWA 3MNXA 1UCYK 1DT2A 2SGDE 4ISIH 5E8EH 1ABJH 1H9HE 4BANB 3ZZ4A 2BD7A 3SUEA 5DP5A 5GWZA 4FUHA 1V2RT 4KP0A 1FIWA 1C5XB 2ZHFH 1XUIA 4NA8A 1GBEA 1QJ7B 1DM4B 3GCOA 1RFNA 2AGIX 3QK1A 1YP9A 3UNQA 1W3CA 2ZHQH 1C1VH 1ETRH 1AU8A 4B71A 2RA3A 1EOJA 1IQKA 1MMJN 3MH7A 1AKSB 1O0DH 1O3KA 2J38A 4BXSA 2JH0D 1AVWA 3RC5A 1H9LB 1P06A 4FVBA 4YLUA 1ZGVA 2STAE 1VCQA 2OC0A 1Y5AT 2ZP0H 1O2QA 1C5UA 2O8LA 3UNRA 1TNIA 1ZMLA 3ATWA 4INHA 1WTGH 4K1TA 3TVJB 1F7ZA 3A86A 2FTMA 2HOBA 3BG4C 1O31A 1C2GA 4U30A 8ESTE 1JIRA 1UTOA 2GT8A 1JRTA 1KDQB 1NZQH 4X6OA 2BXUH 1P2NA 2OTVA 3H5CB 2G51A 3QDZB 3M7QA 3UWIA 2A31A 2R3YA 3LGVA 4CRDA 3PMJA 3GY8A 4I8LA 1H9IE 1AZ8A 1QA7A 1C5OH 2GV6A 1SGEE 2ZU3A 1P9UA 1LVYA 1GHXH 1F92A 1LPZB 1W7GH 3TPIZ 1K1IA 1O5EH 1V2NT 1ZHRA 3E8LA 1PJPA 3SU1A 3IG6B 1N6YA 4LOYH 1ZYOA 4YOGA 1O30A 1KIGH 1DWEH 1IAUA 4D7GA 1GI5A 2WINI 4ABHA 1O2XA 2BMGB 3QN7A 3HK6B 1GBMA 1CE5A 2FX6A 3EYDA 3AASA 4Y8YA 5DPAA 1ABIH 1NRQH 4MG3A 1BTWA 1Y8TA 4NGAH 1P11E 1P2OA 1EPTA 1QGFA 4XBBA 4Q7ZA 1ZJDA 3ATLA 4JK5A 1TX8A 2F9OA 2GKVE 3RMOH 2GZ9A 2XBVA 2Z9JA 1O2PA 1C1QA 1SHYA 3SU4A 3RM2H 4WMDA 3QO6A 2JKHA 1QQ4A 2FDAA 1Z8JB 1ETTH 4D8NA 2BTCE 1SOZA 1OYTH 1P57B 4X8UH 2WPHS 4DIHH 1MKWK 1DDJA 3QZRA 1HCGA 1DE7H 1BRAA 1T8OA 1B0EA 4AGKA 5JB9S 3SGQE 3UQVA 1SGDE 4AB8A 4XBDA 1TABE 1D6RA 2ZO3H 4BAKB 4ZMAH 1WQSA 1TQ0B 2OQUA 1VCWA 4KTUA 4WH6A 1EP5A 5DP6A 2HWLB 2P8OC 1MTWA 2TIOA 4MNVA 1SI5H 4JZEH 1EXFA 1MTUA 1EAXA 4I8JA 1TRMA 2GVFA 4UDWH 4ISOA 2ZFRH 4GUXA 1G3CA 2BLWA 4J2YB 5F8TA 1O2UA 1OOKB 1HAOH 3QGJA 2Y7XA 1FXYA 1QIXB 1THRH 1U6QA 3LH1A 2XYAA 1C9TA 2AEIH 2G5VA 3MO3A 3ZV8A 1CVWH 1TPSA 1QRWA 2QF0A 1H8IH 3SHAH 3SJOA 3URDA 3A87A 2W3IA 5C3NA 1BB0B 1MTVA 2SGEE 1GCDA 1YPHE 2FXRA 1G30B 1MQ5A 4ZHLU 1SVPA 1HXFH 1WAYB 3PMHB 1LHDH 1TPPA 3TJVA 2BXTH 3S9BA 1GJ5H 1A3EH 1O3DA 2PKSB 1BA8B 4ABJA 1Z8RA 2SNWA 4HGCA 4FUDA 1AE8H 4IN1A 3PMAB 4X2VA 3SUGA 5LPFA 3BG8A 4KKDA 3U8TH 2PKAB 5CMXH 5AF9H 3K2UA 3GYLB 3AAUA 2WYJA 4CBOA 2BX3A 3FP6E 5F03A 1SFIA 1V2QT 3TNTA 1MTNC 4Y10E 3MU0A 4X1NU 1IQFA 5C1XA 1K1MA 4B75A 3SJ8A 4YTAA 3LGIA 3M5LA 1C2IA 1QJ6B 3UREA 1P12E 2BQ7B 5DP9A 3ZZCA 3MH5A 1NM6A 1BUIA 1D3TB 1C2KA 1C2LA 4E7RG 4X1QU 1HJ9A 1J14A 2W3KA 3PMBB 3F9GA 4BTIB 2BZ6H 3RU4T 2OCVB 1EJNA 3MH4A 3GDSA 1UTQA 1BTYA 1UJ1A 4ESTE 1ZRBA 3GCHC 2PFEA 1ELVA 2KAIA 4A7IB 1GHVH 2P3UB 4ISHH 3UR6A 4B2CA 3MU4A 1VGCC 4IMZA 1DICA 4JYVH 4Y76A 3RC6A 4FU8A 1SGFA 4GVUA 4GCHG 2ANYA 2UUJB 1AIXH 2JETB 1AB9C 1S6HA 2ZCLP 3M61U 2ZHWH 2W7SA 2A45B 4DCDA 1KXBA 1C5TA 1VJ9U 1T4UH 1C5SA 2HRVA 3RXVA 1HJAC 5AFYH 5FBEA 1O5BB 3SW2B 2VU8E 1ANDA 1SBWA 3ODFA 1O3IA 1OXGA 3T28A 1C1PA 4IGDA 4BTTB 1ZHMA 2GTBA 1SL3A 4RN6A 4B73A 4MNXA 3PB1E 1TBQH 3SJKA 3ODDA 3QTOH 3TK6A 3TJUA 3LC5A 1J17T 1DVAH 1Z1IA 3R3GB 1LVOA 1FZZA 4CRFA 1AUJA 3SU6A 3A89A 1O35A 5EPNA 4VGCC 3C27B 1O3NA 1YPJH 1EAWA 1OSSA 4MPUA 5EODA 3UTUH 1MCTA 3LH3A 5HM2A 2F9NA 1EJMA 2Y80A 1C1TA 2Z6BD 1HAXB 2OP9A 3PROA 5DP4A 2ZFSA 3LPRA 1AHTH 4THNH 1P2KA 5H4IB 1O36A 1OS8A 2AIPA 3LDXH 1SGCA 2CJIA 1DUAA 5FHTA 3ATIA 1DY8A 3D62A 3Q77A 3PO1B 4I31A 2JH6D 1O2TA 2WUBA 2XC4A 2BLOA 1BTUA 2QN5T 1GJCB 3E90B 3GY5A 5JBAS 1PFXC 3E1XB 2R3UA 4YZUA 1Z8IB 3SV9A 3RDZA 4MLFB 1V2VT 2FYRA 1LHCH 2Z9IA 1Y3UA 2QXIA 4ZAEA 4XSKU 3RXHA 3ZVGA 1BTZA 1UCYE 4MNYA 2UUFB 1F2SE 5C2ZA 2J95A 1NC6A 2XC0A 1KYNA 1AI8H 2TGPZ 2BD5A 4OS4A 4UFEH 1C5LH 3KN2A 5DP8A 1G3BA 2CMYA 4AGJA 4LK4A 2A32A 2IJOB 2WV5A 3SJ9A 2AFQB 2BOHB 1EOLA 1A0LA 5LH8A 1GMDF 1T8MA 4NWLA 2Z3EA 3RXUA 3G01A 1GMCF 5HMAA 1OP2A 1HJAB 1QL9A 3RXOA 2ODYB 4A5TS 4MTBA 1CU1A 5E0JA 3LKWA 1QY6A 2OQ5A 1THSH 3A84A 1V2LT 1DWBH 4MPVA 1IQGA 3P8GA 3PWCA 1YM0A 1TX6A 3ZYEA 1HB0B 2EEKA 3A8DA 2NU4E 2NU3E 1HAHH 5IYTA 4LZ4B 1LTOA 1EZUC 2VIPA 4YO9A 4GHQA 3WY8A 3RP2A 1O2YA 1Y3WA 2CN0H 3STIA 1KXDA 5FPSA 1O3JA 3EDXB 3RXDA 1BOQA 3UUZA 5FX5A 1FPHH 3T2NA 1FQ3A 3TGIE 4Y71A 1HUTH 1IQLA 1Z6EA 2WPKS 5L2ZH 3S69A 3KL6A 3TH4H 4CRBA 1C5NH 2K1QA 1NFYA 2AMDA 1GBJA 1K1JA 2GCHF 1Y3YA 2C3SA 2GGVB 3M3SA 1V2MT 1ZGIA 1K21H 1O3CA 2V6NA 1W12U 3A7XA 1BRCE 1QB1A 5C5OA 2C8WB 1P0SH 2TPIZ 3ZVFA 1FMGA 1TNJA 2BD8A 2TGDA 5JYIA 3SU2A 4TYDA 3CENA 1K9OE 2AYWA 1Q31A 3V7TA 1O33A 2WUCA 3T5FH 4NZQA 3LGYA 3RMLH 4ABAA 1K1PA 3EA7A 3S9AA 4Q7YA 5EXLA 2ZFTA 1TNLA 3ZZ8A 5I25A 4FXGH 1P02A 1UVTH 3VPKA 1CBWB 4J1YA 5FCRA 1GGDC 2VJ1A 3PLKA 1IQHA 1BQYA 2FOGA 1SGNE 4K69A 3GY7A 5DP7A 2ILNA 3E0NB 1NO9H 1TPAE 2VWNA 4GLYA 3CS0A 4R8TB 3BTME 2BD2A 2PUQH 1PQ5A 4A1TA 4IMQA 2NWNA 4HZHA 1PQAA 2C90B 1VCPA 2A0QB 1ZHPA 1Z1JA 3A8AA 1UHBA 2O8MA 1C2JA 1TGSZ 1VITF 3KQCA 1O5GH 2ZKSA 1PPGE 4FUBA 1ANCA 5T6DA 2FOFA 4X0WU 3BTTE 1A0JA 4JMYA 1SGPE 2TBSA 1BTXA 4TWYA 3FAOA 1GDUA 2ANKH 3T62A 1TWXB 1N8OB 2QAAA 2A7JA 1MD7A 2G4UA 3QUMP 4KELA 5HGGA 3A7YA 3SU5A 1TLDA 1JXPA 1EB2A 1JOUB 3Q3YA 3QGNB 4HTCH 1SGRE 1GJBB 1YCPK 1O3FA 4ZROA 2DE9A 2ZF0H 1HNEE 3SGBE 1A61H 1N1LA 5C20A 3E0PB 2D26C 4NFFA 3SI3H 5TCAA 1NFUA 1YPMH 2W5EA 1S81A 5L2YH 1FPCH 1BRBE 1K22H 3SI4H 4YLQH 2HALA 3MO9A 4E7NA 4D7FA 1GJ8B 1TE0A 3B9FH 3LIWA 1AO5A 3OTJE 1YBWA 1TOCB 3HGNA 1TMUH 3KQBA 1O3OA 1EKBB 3AW0A 5EPYA 2FOBA 2UUYA 4FUCA 2XTTB 1BRUP 1GJDB 3BTKE 3D65E 3S0NA 2J34A 3M5MA 1IHTH 3U8RH 2BDYA 1C1OA 2BOKA 5EW2H 4JCNA 2PGBB 4M7GA 2QIQA 3F68H 1NESE 3BTQE 3M3VA 3RXRA 4XOJA 1GI4A 2ZPSA 1NS3A 1T8LA 3LGWA 1A0HB 4D9RA 4MVNA 2BD9A 2BY8X 3RUOA 2F9UA 3FANA 3GCTF 1G3EA 1IQJA 2ZFQH 1C2EA 4E05H 1CA0B 1MTSA 1HAYB 2G8TA 3F9EA 3U1JB 3SUFA 3HPTB 2BY9X 4OS5A 1A2CH 2H1UA 1NRRH 1WQVH 4AN7A 1OWEA 1D6WA 2XC5A 1XKBC 3KIDU 1MCVA 5GJ4B 5CE1A 4X2XA 4I8HA 1ELBA 3QZQA 5ESBA 3EA9A 2H9HA 3SNCA 2PWXA 2LNCA 4X6NA 4AFQA 3PYHA 4FUIA 4K1EA 1LQDB 5F6MA 4YOJA 2AIQA 2GT7A 1VJAU 4TWWA 1QRXA 1SQTA 5JBBS 1SGQE 1LKAA 3HKJB 4IC6A 1BMAA 2Q6DA 3SU0A 3NUMA 2A4GA 3A8BA 4FUFA 1QBVH 3A8CA 1AQ7A 3ENSB 4HI3A 2F9PA 1GBCA 5E2PA 4Y8ZA 2HVXA 1OWIA 4RSPA 2A5KA 2ZIQH 1HDTH 1RJXB 1IQIA 4NA9H 1KXEA 1HIAA 1NTPA 1DWDH 1WV7H 1A1RA 2BY5X 4OS7A 4OS6A 3RXEA 4I32A 5C67A 2BDBA 2BHGA 4ZKRU 2PGQB 1ORFA 2OXSA 3QLPH 1G2MA 2F9BH 3LU9B 1GMHF 1O3BA 1F0SA 1YPKH 1CGJE 2YNAA 1EP6A 1LO6A 2PW8H 3UPEA 1PYTC 1LHEH 3FVFB 4X1SU 3RLYH 3T25A 2XRCA 1QFKH 3S7HB 1NPMA 1NRSH 1MZAA 1SQAA 3HK3B 1BTPA 1DXWA 1C4U2 1GCTB 2ESTE 1KLTA 4RKOB 2PSYA 1AD8H 4UFGH 2FOMB 1O38A 2ZGCA 3A80A 3I78A 4WF8A 4YESB 5T6FA 5JDUB 5DKMA 1HJ8A 2BD3A 4CR9A 2PKSC 4NSYA 3K6YA 3SZNA 2SNVA 5ETXA 1P09A 1GG6C 3ZYDA 3BIVH 1XM1A 3VXFH 3VB6A 1GI7B 1TA6A 1GMDG 4O3TA 1QNJA 3LONA 3ZZ6A 2CXVA 1FI8A 2R0KA 2IPHA 3NWUA 4FU7A 3SV2H 3UOUA 1BMMH 1GMCG 1TPOA 3EE0B 4Q7XA 4I8GA 1AMHA 5HYOA 1P2MA 1GI1A 1LDTT 2ZWLH 3S7KB 3VB3A 5DGJA 1CSOE 1UCYH 4AORA 4Y79A 1P2IA 4AYYB 1GHAG 1DX5M 5HXFA 4MNWA 2IN2A 7LPRA 2VH6A 1FY4A 5EW1H 1XUKA 1L4DA 1XUHA 2G00A 1TQ7B 1SSXA 3TH2H 2FS8A 3Q76A 1C1NA 3KHVA 2C4FH 5TCCA 1W10U 1ACBE 3DA9B 1TBZH 2ZPQA 1ZSLA 2Z9GA 2BVSH 1KXAA 4MDSA 1QCPA 4CREA 4BTUB 4Z6AH 1WOFA 1G3DA 1BDAA 3P70B 2KAIB 1B0FA 1WU1A 4WMEA 2BDCA 3SV6A 1S84A 2AMQA 4FUGA 1C2HA 1D3QB 3GY6A 3A81A 4BOHA 2PSXA 5K0HA 3RXIA 1AE5A 2EI7A 4ZKNU 2B9LA 1O3GA 4AB9A 1ZSKA 2JETC 2ZHDA 4OS1A 3RM0H 3BTFE 1UVOA 1YGCH 2SFAA 9ESTA 1H1BA 2D2DA 4JK6A 2A7CA 4JYTA 1EAUA 1W13U 3SNBA 2PV9B 2FTLE 3V13A 1MBQA 4GAWA 2Y81A 2A2QH 3RMMH 2FMJA 1TRNA 1W8BH 3U98H 1GG6B 1O3PB 3SNDA 1V2KT 1CO7E 1UK3A 4X8TH 4UE7H 4CBNA 1C5PA 3AAVA 4TY6A 3Q00A 3IITA 5L30H 1AN1E 1LVMA 3FFGA 4K2YA 3UY9A 4K5ZA 8LPRA 2AH4X 1GI9B 5K7RA 4AG2A 1VITH 1K1OA 2ZCHP 4AG1A 2Q6GA 4Y0YE 3F1SB 1P03A 1TONA 4K8YA 1XUJA 2BB4A 1BBRK 1VITG 1XKAC 3BSQA 4Y8XA 2FWWA 1M9UA 1Y5UT 4X1RU 4A1XA 4TPIZ 1WCZA 2AERH 1O3HA 3AW1A 4AOQA 2H2ZA 3ZZ3A 3RXAA 2A2XH 2BDIA 5BPEA 3PO1C 4YOIA 4BNRA 1P04A 1UTNA 1UTJA 4KTCA 4Y7AA 1NU9A 1YYY1 2GZ7A 1GBHA 1NRPH 1BZXE 4ZKOU 1O3EA 2VWLA 1TFXA 2Z7FE 1JWTA 3P6ZB 2Z9LA 4TPYA 2EC9H 2FS9A 4D9QA 2Y5FA 3RLWH 3K65B 1QBNA 2OC1A 3MU5A 1OX1A 3KEEA 2VVVA 5A0AE 3D49H 1NFXA 1TIOA 1O3LA 1MKWH 1UVSH 1RD3B 5EOKA 2ZI2H 3P8OA 2ALPA 1CA8B 2XBXA 1DLEA 2D8WA 1EASA 2HNTC 1OWDA 5C5NA 2UWLA 2RCEA 2IOTA 3FZDA 2Z3DA 3OU0A 8GCHF 2CF9H 1WTHD 1ZMJA 1QL8A 4U01A 1BHXB 3RC4A 1WUNH 3BTDE 1HAPH 4NA7A 1PPEE 1FN6A 2NU1E 1EB1H 1BCUH 1ARBA 5IDKA 1GJAB 1V2WT 1FDPA 1AFQB 2NU2E 2ANMH 1D3DB 2M5TA 1GBDA 1T7CA 1IQMA 1GVKB 2UWOA 3MTYA 4IS5A 5TJXA 1L4ZA 4XFQA 4IN2A 3TGKE 2R2WU 3MWIU 3P8NA 3F6UH 3M5OA 1QHRB 1HAVB 2BD4A 2GMTB 3NXPA 4AYVB 4CR5A 6GCHF 1G9IE 1EZQA 3BTWE 2FESH 3PLPA 2VGCB 1GHZA 1NFWA 2ZGHA 1Y3XA 3DD2H 2QCYA 2CHAB 3H7TA 1MU6B 4A6LA 2F91A 2DE8A 1P8VC 3SU3A 1W2KH 1FY1A 1K1LA 1AY6H 1FN8A 1Z7KA 2STBE 3GICB 4H6TA 2XWAA 2GX4A 2Y5GA 3RXQA 4FUJA 1EUFA 2VIQA 3E91A 4WXVA 1N6XA 2GP9B 4Z0KA 5B6OA 1GHYH 2ZDVH 1YKTA 4XE4A 3V12A 4UD9H 3ZZBA 2PTNA 3A82A 3BTGE 2OC8A 1A5IA 1BBRH 1NN6A 3TGJE 2VIOA 4I7YH 1CBWC 1L0ZA 1HBTH 4K8BA 2V35A 1K2I1 1O2ZA 5JBCS 1TNHA 4JZDH 3A83A 3LGUA 3ZZDA 2H5CA 3VGCB 1OP8A 1XUGA 1PYTD 1SFQB 2CV3A 3PLBA 1SGTA 3BF6H 3VB7A 3GISB 3MOCA 3V0XA 5ABWA 2TGAA 4ABGA 1L1NA 1SPJA 1O32A 1E37B 1UHBB 5EQSA 2I6QA 1J16A 1ZPCA 3ZZ9A 2Y7ZA 1A4WH 1WBGB 3R0FA 5A8ZA 4WXIA 1GMHG 2ZG0H 1FAKH 2FI3E 1SGYE 1NROH 1O2VA 3TJOA 4Y11E 2PTCE 1A46H 1K1NA 4ISLA 1C5MD 1PPCE 3JZ2B 1AWHB 1V6DA 2ODQA 2GCTB 1P3CA 1N8OC 3ZVEA 5LPEA 4K60A 4X8SH 3PV4A 1UVUH 3ITIA 3DUXH 2ZECA 1MD8A 2ZTXA 2ZFPH 2WPJS 1SLWB 2QYIA 3ZV9A 2Q6FA 1LPGB 3GDVA 1HXEH 3DT0H 1BITA 1OWJA 3LC3A 1NU7B 3RXPA 2HNTF 3SV7A 1ELFA 3U9AH 3HKIB 1THPB 3OY5U 1GBLA 2HPPH 4DIIH 3SNEA 1TX7A 2QGRA 7GCHG 2CF8H 3VEQB 3GY4A 2ZHEH 4ISNA 2ZTZA 3MU1A 3W95A 1UVPA 5BRRE 4Y7BA 3OSYA 1UTMA 4NSVA 1C2DA 4YT7H 2VVCA 1B7XB 1RIWB 1GBBA 4I8KA 1PQ8A 3RXTA 1P01A 1ZSJA 1J8AA 1KXCA 1AFEH 3UWJH 3L3TA 2H9TH 4LXBH 1F0RA 3MNSA 2O8TA 3L33A 2BZAA 1YC0A 3TLOA 1ANEA 1CA0C 3OY6U 1FNIA 2JH5D 2VWMA 3KCGH 1CQQA 4Y6DA 2OD3B 3NPSA 3RXBA 3A88A 2GD4B 1Y59T 3ZZ5A 1UTKA 3BV9B 4NWKA 2XNIA 1O3MA 2D1JA 1ELDE 3A7ZA 2Y5HA 2J2UA 3KGPA 2ZDMA 5EQRA 5T6GA 5G4BA 2ZQ2A 2WV4A 4INLA 5FBIA 3N7OA 4NIWA 4FVDA 3B23B 2P3FH 1SMFE 1MAYA 1RGQA 3M3TA 2DUCA 1O34A 2Y82A 5CHAC 1NT1A 2R2MB 1MUEB 3IWMA 6ESTA 1O39A 1LVBA 2SGAA 2XWBI 4BAHB 2GDEH 3SQEE 2FZZA 1GJ9B 3BIUH 4A1VA 1OPHB 4OS2A 1LHGH 1ELAA 1T32A 2F83A 7KMEH 2BM2A 4K1SA 1E36B 2FOAA 2G81E 1TGTA 1HIAB 1TBRH 2BYAX 3ZZ7A 1ZPBA 2Q1JA 3SNAA 3OX7U 2F9VA 2UUKB 3PTBA 3K9XB 1GHWH 1INCA 2EI6A 1FY5A 2FP7B 2QXHA 3MYWA 1BMNH 1GJ7B 1BIOA 4MPXA 2ZTYA 5DG6A 1DUEA 1FY8E 2ALVA 1XXFA 1GVZA 3HATH 1YF4A 2GDDA 2V3OH 1XXDA 1ID5H 1LKBA 1CT0E 3EA8A 2OLGA 2ZDAH 1C5YB 1GCTC 3ZZAA 3ZVDA 2F3CE 1C1WH 1W0YH 1C9PA 5FAHA 4CH8B 1BBRE 3K6ZA 1EPTB 3U69H 3QWCH 2OINA 5EG4A 4CHAB 4NZLA 4Y0ZE 4JZ1A 3RXCA 4B2AA 4NIYA 1DSTA 3KQEA 5C1YA 1T4VH 1B5GH 1E34B 1VR1H 1FIZA 5F8XA 1KXFA 1YPGH 2J94A 1O5FH 1D4PB 5A0BA 3A7TA 4OGXA 2ZDLA 1IHSH 1QTFA 4B2BA 4X8VH 4B74A 8GCHG 4KGAA 1O2HA 1X7AC 4GSOA 1GI0A 2ZNKH 3SGAE 3FP7E 2H9EH 4SGBE 1MAXA 5CHAB 1TMBH 1RS0A 1OYQA 3E3TA 1L1JA 3A7WA 1O2WA 3NCLA 2OC7A 4ZXYH 4O3UA 1C5WB 1F0TA 2G52A 1D9IA 1O37A 2J9NA 1O5DH 3UFAA 1O2MA 1YCPM 3NZIA 3W94A 1GI6A 3RXFA 1DOJA 2FOHA 1BT7A 1F5LA 5GXPA 1J9CH 4GPGA 1ZLRA 1ZTJA 1CT4E 2BY7X 2FM2A 4ABEA 3GDUA 6GCHG 3MNBA 4ZHMU 1YCPH 1P2QA 3LGTA 1EZSC 3RXGA 2PUXB 2BVXH 1AVXA 5FPTA 2ZGJA 1FUJA 3TNSA 4YM9A 2BQ6B 1MZDA 3BTEE 3KF2A 2VB0A 2ZZUH 3M5NA 1KLJH 2PHBA 2HGTH 3ESTA 4CRAA 3RU4E 1GVLA 6CHAB 3BEUA 2BDHA 3I77A 3VB5A 2SGFE 2Z94A 4AFZA 2QF3A 4IBLH 2FO9A 3P92A 4H6SB 1O2JA 1W7XH 2ASUB 1YPHC 4NIVA 3MFJA 2YNBA 3EAJA 1AZZA 3QX5H 5DJ7A 2H6MA 1G37A 2P59A 2AS9A 1H4WA 1V2PT 1RXPA 3SN8A 2BQWB 4DGJA 1GBTA 2OBOA 1C5RA 1DPOA 3VXEH 3KQDA 2XBWA 5AFZH 2QV1A 1RTLA 4YT6H 2RDLA 2RA0A 3M7TA 5GCHF 1GHBF 1A3BH 3B8JA 1MQ6A 4BXWA 3BTHE 2VWOA 1O5CB 3BN9A 7GCHF 1HFDA 2VVUA 3MH6A 3CP7A 2BLQA 2BX4A 1L2EA 4INKA 1OP0A 1S83A 2P94A 3OYPA 4UFFH 5DP3A 3P95A 2FEQH 4R0IA 1AKSA 1C4Y2 1V3XA 4XBCA 1UMAH 2O8WA 2W26A 1HLTH 2J92A 5PTPA 3U1IB 1ZJKA 4X2YA 1ZPZA 1DFPA 3RXMA 1EAIA 1GWAA 4AX9H 5F8ZA 1A5HA 4WY3A 2P95A 4O97A 3FZZA 3TH3H 4DY7B 4UONA 1T8NA 3GY3A 4ABFA 3SOSA 1K28D 4BAQB 1XUFA 3BG4B 4XDEA 1HPGA 3Q3XA 2VINA 2GCHG 1KLIH 3VB4A 1KDQA 1TYNA 4DG4A 2VIDA 2WYGA 1EX3A 1JBUH 1DSUA 3SQHE 4DURA 3T29A 3SORA 1TGBA 2V0BA 3L6PA 3M36A 1HYLA 2ZC9H 1TAWA 2O9QA 4DJZB 3LJOA 2B7DH 4E06H 5JBTA 2VH0A 1QL7A 3U8OH 1A5GH 3T26A 3LT3A 3GCNA 1KTTB 1F0UA 1G2LA 1JIMA 3M37A 4B76A 3EGKH 3C1KA 2UWPA 1AFQC 4ABBA 1TNGA 1CHOF 2BDGA 5GPIB 1S85A 1W14U 2WPMS 1NRNH 3M35A 3PM3A 1UK2A 1MKXK 4UFDH 5J4SA 1GBIA 1SLVB 3ATMA 2BLVA 2GMTC 1XX9A 1EATA 1T31A 4CRCA 1P05A 1Y5BT 1E0FD 2FYQA 1TALA 1HAIH 2VGCC 5C1UA 3H7OA 5FXLA 2C8XB 1ZRKA 2CHAC 4ZHAA 4Q2KA 4IW4E 3O8CA 3D23A 1E38B 1TMTH 1PQ7A 2ZFFH 1P2JA 1GJ6A 2C8ZB 1OWHA 1GDQA 1SG8B 1TA2A 2SGQE 1LMWB 1CT2E 5DK1A 3TJNA 2VNTA 4AFUA 3RMNH 5EQQA 4NCYA 1GBKA 2VIVA 5FX6A 2QA9E 2QXGA 1O2KA 5FPYA 1BMLA 1AUTC 3NK8A 5AVDA 1HGTH 2P8OB 2ZU1A 3F9HA 3DFJA 3TIUA 4KTSA 3RU4D 2R0LA 1FJSA 5FCKA 4DVAU 5EGMA 1HRTH 2XBYA 1A7SA 5GDSH 3VGCC 4FUEA 5L6NH 4QT8C 1ELCA 3E16B 5A8YA 1SC8U 1Q3XA 2ULLA 2TGTA 1QQUA 5E0GA 2P93A 4LZ1H 1O2GH 1LCYA 1QB9A 1S6FA 1O2SA 1PPHE 3RXSA 2ZA5A 3SJIA 1ETSH 1S0QA 1ZZZA 4H42U 2AGGX 1ELGA 2A4OA 1S5SA 2OUAA 5GIBA 4CRGA 3A7VA 1FV9A 7ESTE 1S0RA 1Z6JH 1BTHH 2XCFA 1DXPA 2ZDNA 2GCTC 3E6PH 5A2MH 2AMPA 1AWFH 1ESTA 3MO6A 3GCTG 5EXNA 3GYMA 1C4V2 1V2ST 4UEHH 4ZH8A 1TGNA 2A4QA 1XMNB 2Y6TA 1SB1H 4DW2U 1RTKA 4ZXXH 1GL1A 2PKAA 3O8RA 3ZVAA 1ARCA 3ELAH 5A8XA 2ZPRA 3PTNA 2R9PA 1P3EA 1MTNB 3MU8A 2O8UA 2C8YB 2G4TA 1TNKA 2C93B 1O3AA 1BHXF 2Z3CA 1G32B 3LJJA 1C5VA 3M7UA 5EXMA 1W11U 4SGAE 1SR5C 1MKXH 2P16A 3STJA 1D3PB 2W7UA 4AFSA 1HV7A 3A85A 3Q3KA 1ESBA 1TRYA 2GZ8A 2FOCA 1DY9A 2XCNA 1LQEA 1O2LA 3UQOA 3VFEA 3HGPA 2NU0E 3QTVH 2HLCA 5I46H 2LPRA 1MU8B 2I6SA 5DO4H 3UOPA 1CGHA 1RIWC 1OWKA 1AGJA 4NG9H 4TY7A 3GCHB 3AVZA 4MPWA 5J4QA 3RXLA 1Q2WA 1S82A 3RXJA 4WMFA 2H5DA 2FIRH 3JZ1B 4B1TA 1GL0E 4ABIA 3GY2A 1P9SA 1TB6H 1VGCB 3TK5A 1VZQH 1QURH 1SOTA 1QA0A 2HNTE 3UNSA 4O9VA 1GPZA 1AB9B 1OKXA 2BVRH 9LPRA 4FU9A 4U32A 1RRKA 5T3HA 1SLXB 2V3HH 1BJVA 1MH0A 4BAMB 1YLCA 1ELEE 1O2NA 1QJ1B 1GBAA 4X6MA 2ZQ1A 3LOXA 1PPBH 2FODA 1GHAF 4MQAA 2ZU5A 3SBKA 1GI2A 1IQEA 4NFEA 1MBMA 4RKJB 3P17H 1UTPA 2QY0B 1ZOMA 1KSNA 3SO3A 1C2FA 2B5TB 1XVMA 4JZFH 4VGCB 1G36A 1L1GA 1BJUA 1DITH 2ANWA 4ZKSU 4WJG2 2XXLA 1GDNA 1HAVA 1NY22 3P8FA 3SUDA 4X1PU 1KTSB 1H8DH 1DWCH 2PR3A 1RTFB 3MNCA 5A0CA 1O2OA 2HPQH 3SHCH 3O8BA 2J4IA 5GCHG 2B0FA 1GHBG 3BEIB 1DLKB 3F9FA 1V2TT 4CH2B 4WWYA 1O2RA 1IOEA 1GI3A 2EA3A 5E2OA 2ZGBH 3EQ0H 1C1UH 1YLDA 1AVGH 5ESTE 1Z71A 1JMOH 1F5RA 1CHGA 1SGIB 2A1DB 1JRSA 4X2WA 3V3MA 1GI8B 1Y3VA 1C5QA 4U2WA 3CS7A 1UTLM 1E35B 3TU7H 1V2JT 1ZTKA 1ELTA 2SGPE 1PPFE 8KME2 3ZVBA 1YPLH 2YOLA 3PWBA 3TITA 1QRZA 2WPIS 4F4OC 1IQNA 3UR9A 5EU8A 4OGYA 4ASHA 1SHHB 2B8OH 2A5IA 1WSSH 4DT7B 2AGEX 4F49A 3BEFB 1UO6A 2TRMA 2BY6X 1GBFA 4WH8A 1UK4A 2FX4A 3UIRA 1EZXC 1HAGE 1V2UT 1EQ9A 3GOVB 1F5KU 2GV7A 2ZCKP 1J15A 4ZUHA 5LGOA 1KY9A 1TGCA 2G55A 1EPTC 1LPKB 1Z8GA 4CHAC 1ZTLA 4X6PA 3FP8E 5LPRA 3MMGA 3O8DA 1W0ZU 4DOQA 2Z9KA 1SLUB 1P10A 5E0HA 2ODPA 3TK9A 1C2MA 1ZR0A 2BDAA 2PLXA 2FLRH 1CGIE 4HFPB 3MHWU 2QXJA 1FAXA 2ZGXH 3I29A 3URCA 2FLBH 5AHGH
chains in the Genus database with same CATH superfamily
1UW7A 4PROA 3S9CA 1DANH 1O2IA 3H09A 1CHOG 5HM9A 4JZIA 2A7HA 4D76A 5KECA 4AZ2B 4K3JA 2ZDKA 5SGAE 3KNXA 2FPZA 1HAZB 1FY3A 5JPMH 2EI8A 2CGAA 2A4RA 1C5ZB 1ZMNA 1QB6A 2JDID 3ZVCA 2A5AA 2P3TB 3SV8A 4GCHF 6LPRA 2QC2A 4RT0A 2ZU2A 1EJAA 2THFB 4NIXA 2FOEA 1SGFG 1FLEE 1C1RA 5CHBA 3T27A 4RI0A 2ZU4A 5A09A 1YPEH 4M9FA 1O5AB 1QBOA 1V2OT 4GHTA 4H4FA 1SQOA 1C1SA 3DHKH 1QR3E 1ESAA 2OBQA 4O03A 4Q80A 1GJ4H 6CHAC 5JB8S 1TOMH 1GGDB 1XVOA 1FONA 3ATKA 4IC5A 3RXKA 2XW9A 3NKKA 1LHFH 3MI4A 4ABDA 3F2FA 1DS2E 2FI5E 1ANBA 4WVPE 4JYUH 4I33A 2ZEBA 3DFLA 4A92A 2RG3A 1PPZA 2G5NA 2FI4E 4BAOB 2WPLS 1C1MA 1WYKA 2VIWA 3MNXA 1UCYK 1DT2A 2SGDE 4ISIH 5E8EH 1ABJH 1H9HE 4BANB 3ZZ4A 2BD7A 3SUEA 5DP5A 5GWZA 4FUHA 1V2RT 4KP0A 1FIWA 1C5XB 2ZHFH 1XUIA 4NA8A 1GBEA 1QJ7B 1DM4B 5FL7D 3GCOA 1RFNA 2AGIX 3QK1A 1YP9A 3UNQA 1W3CA 2L6OA 2ZHQH 1C1VH 1ETRH 1AU8A 4B71A 2RA3A 1EOJA 1IQKA 1MMJN 2J97A 3MH7A 1AKSB 1O0DH 1O3KA 2J38A 3GS9A 4BXSA 2JH0D 1AVWA 4TT3D 1H9LB 3RC5A 1P06A 4FVBA 4YLUA 1ZGVA 2STAE 1VCQA 2OC0A 1Y5AT 2ZP0H 1O2QA 1C5UA 2O8LA 3UNRA 2YMSD 1TNIA 1ZMLA 3ATWA 4INHA 1WTGH 4K1TA 3TVJB 1F7ZA 3A86A 2FTMA 2HOBA 3BG4C 5EJLA 1O31A 1C2GA 4U30A 8ESTE 1JIRA 1UTOA 2GT8A 1JRTA 1KDQB 1NZQH 4X6OA 2BXUH 1P2NA 2OTVA 3H5CB 2G51A 3QDZB 3M7QA 3UWIA 2A31A 2R3YA 3LGVA 1FX0B 4CRDA 3PMJA 2LELA 3GY8A 4I8LA 1H9IE 1AZ8A 1QA7A 1C5OH 2GV6A 1SGEE 2ZU3A 1P9UA 1LVYA 1GHXH 1F92A 1LPZB 1W7GH 3TPIZ 1K1IA 1O5EH 1V2NT 1ZHRA 3E8LA 1PJPA 3SU1A 3IG6B 1N6YA 4LOYH 1ZYOA 4YOGA 1O30A 1KIGH 1DWEH 1IAUA 4D7GA 1GI5A 2WINI 4ABHA 1O2XA 2BMGB 3QN7A 3HK6B 4Q4LA 1GBMA 1CE5A 2FX6A 3EYDA 3AASA 4Y8YA 5DPAA 1ABIH 1NRQH 4MG3A 1BTWA 1Y8TA 4NGAH 1P11E 1P2OA 1EPTA 1QGFA 4XBBA 4Q7ZA 1ZJDA 3ATLA 4JK5A 1TX8A 2F9OA 2GKVE 3RMOH 2GZ9A 2XBVA 2Z9JA 1O2PA 3KQ5A 1C1QA 1SHYA 3SU4A 3RM2H 4WMDA 3QO6A 2JKHA 1QQ4A 2FDAA 4HG6A 1Z8JB 1ETTH 4D8NA 2BTCE 1SOZA 1OYTH 2RFKC 1P57B 4X8UH 2WPHS 4DIHH 1MKWK 1DDJA 3QZRA 1HCGA 1DE7H 1BRAA 1T8OA 1B0EA 4AGKA 3WWFA 5JB9S 3SGQE 3UQVA 1SGDE 4AB8A 2JIZD 4XBDA 1TABE 1D6RA 2ZO3H 4BAKB 4ZMAH 1WQSA 1TQ0B 2OQUA 1VCWA 4KTUA 4WH6A 1EP5A 5DP6A 2HWLB 2P8OC 1MTWA 2TIOA 4MNVA 1SI5H 4JZEH 4OM9A 1EXFA 1MTUA 1EAXA 4I8JA 1TRMA 2GVFA 4UDWH 4ISOA 2ZFRH 5C0UA 4GUXA 1G3CA 2BLWA 4J2YB 5F8TA 1O2UA 1OOKB 1HAOH 3QGJA 2Y7XA 1FXYA 1QIXB 1THRH 1U6QA 3LH1A 2XYAA 1C9TA 2AEIH 2G5VA 3MO3A 4AC9A 3ZV8A 1CVWH 1TPSA 1QRWA 2QF0A 1H8IH 3SHAH 3SJOA 3URDA 3A87A 2W3IA 5C3NA 1BB0B 1MTVA 2SGEE 1GCDA 1YPHE 2FXRA 1G30B 1MQ5A 4ZHLU 1SVPA 3WWBA 1HXFH 1WAYB 3PMHB 1LHDH 1TPPA 3TJVA 2BXTH 3S9BA 1GJ5H 1A3EH 2KFWA 1O3DA 2PKSB 1BA8B 4ABJA 4ZCNA 1Z8RA 2SNWA 4HGCA 5KGOA 4FUDA 1AE8H 4IN1A 3PMAB 4X2VA 3SUGA 5LPFA 3BG8A 4KKDA 3U8TH 2PKAB 5CMXH 5AF9H 3K2UA 3GYLB 3AAUA 2WYJA 4CBOA 2BX3A 3FP6E 5F03A 1SFIA 1V2QT 3TNTA 1MTNC 4Y10E 3MU0A 4X1NU 1IQFA 5C1XA 1K1MA 4B6EA 4B75A 3SJ8A 4YTAA 3LGIA 3M5LA 2KM0A 1C2IA 1QJ6B 3UREA 1P12E 2BQ7B 5DP9A 1H8HD 3ZZCA 3MH5A 1NM6A 3DCLA 1BUIA 1D3TB 1C2KA 1C2LA 4E7RG 4X1QU 1HJ9A 4ASUD 1J14A 2W3KA 3PMBB 3F9GA 4BTIB 2BZ6H 3RU4T 2OCVB 1EJNA 3MH4A 3GDSA 1UTQA 1BTYA 1UJ1A 4ESTE 1ZRBA 3GCHC 2PFEA 1ELVA 2KAIA 4A7IB 1GHVH 2P3UB 4ISHH 3UR6A 2WHXA 2AHME 4B2CA 3MU4A 1VGCC 3FN8A 4IMZA 1DICA 4JYVH 4Y76A 3RC6A 4FU8A 1SGFA 4GVUA 4GCHG 2ANYA 2UUJB 1AIXH 2JETB 1AB9C 1S6HA 2ZCLP 3M61U 2ZHWH 2W7SA 4Z1MD 2A45B 4DCDA 1KXBA 1C5TA 1VJ9U 5C0TA 1T4UH 1C5SA 2HRVA 3RXVA 3PV5A 1HJAC 5AFYH 5FBEA 1O5BB 3SW2B 2VU8E 1ANDA 1SBWA 3ODFA 1O3IA 1OXGA 3T28A 1C1PA 4IGDA 4BTTB 1ZHMA 2GTBA 1SL3A 4RN6A 4B73A 4MNXA 3PB1E 1TBQH 3SJKA 3OEED 3ODDA 3QTOH 3TK6A 3TJUA 3LC5A 1J17T 1DVAH 1Z1IA 3R3GB 1LVOA 1FZZA 4CRFA 1AUJA 3SU6A 3A89A 1O35A 5EPNA 4VGCC 3C27B 2J98A 1O3NA 1YPJH 1EAWA 1OSSA 4MPUA 5EODA 4XD7D 3UTUH 4DT4A 1MCTA 1YLNA 3LH3A 5HM2A 2F9NA 1EJMA 2Y80A 3EE7A 1C1TA 2Z6BD 1HAXB 2OP9A 3PROA 5DP4A 2ZFSA 1H8ED 3LPRA 1AHTH 4THNH 1P2KA 5H4IB 3N99A 1O36A 1OS8A 2AIPA 3LDXH 1SGCA 2CJIA 1DUAA 5FHTA 2WPDD 3ATIA 1DY8A 3D62A 3Q77A 3PO1B 4I31A 2JH6D 1O2TA 2CK3D 2WUBA 2XC4A 2BLOA 1BTUA 2QN5T 1GJCB 3E90B 1QZ8A 3GY5A 5JBAS 1PFXC 3E1XB 2R3UA 1SKYE 4YZUA 1Z8IB 3SV9A 4YXWD 3RDZA 4MLFB 1V2VT 2FYRA 1LHCH 2Z9IA 1Y3UA 2QXIA 4ZAEA 4XSKU 3RXHA 3ZVGA 1BTZA 1UCYE 4MNYA 2UUFB 1F2SE 5C2ZA 2J95A 1NC6A 2XC0A 1KYNA 1AI8H 2TGPZ 2BD5A 4OS4A 4UFEH 1C5LH 3KN2A 5DP8A 1G3BA 2CMYA 1W0KD 4AGJA 4LK4A 2A32A 2IJOB 2WV5A 3SJ9A 3CNRA 2AFQB 2BOHB 1EOLA 1A0LA 5LH8A 1GMDF 1T8MA 4NWLA 2Z3EA 3RXUA 3G01A 1GMCF 5HMAA 4B6FA 5EJZA 1OP2A 1HJAB 1QL9A 3RXOA 2ODYB 4A5TS 4MTBA 1CU1A 5E0JA 3LKWA 1QY6A 1K0HA 2OQ5A 1THSH 3A84A 1V2LT 1DWBH 4MPVA 1IQGA 3F3BA 3P8GA 3PWCA 1YM0A 1TX6A 3ZYEA 1HB0B 2EEKA 3A8DA 2NU4E 2NU3E 1HAHH 5IYTA 4LZ4B 1LTOA 1EZUC 2VIPA 4YO9A 4GHQA 3WY8A 3RP2A 1O2YA 1Y3WA 2CN0H 3STIA 1KXDA 5FPSA 1O3JA 3EDXB 3RXDA 1BOQA 3UUZA 5FX5A 5B6LA 1FPHH 3T2NA 1FQ3A 3TGIE 4Y71A 1HUTH 1IQLA 1Z6EA 2WPKS 5L2ZH 1EFRD 3S69A 3KL6A 3TH4H 4CRBA 1C5NH 2K1QA 1NFYA 2AMDA 1GBJA 1K1JA 2GCHF 1Y3YA 2C3SA 2QE7D 2GGVB 3M3SA 1V2MT 1ZGIA 1K21H 1O3CA 2V6NA 1W12U 3A7XA 1BRCE 1QB1A 5C5OA 2C8WB 1P0SH 2TPIZ 3ZVFA 1FMGA 1TNJA 2BD8A 2TGDA 5JYIA 3SU2A 4TYDA 2YMSB 1K9OE 3CENA 2AYWA 1Q31A 3V7TA 1O33A 2WUCA 3T5FH 4NZQA 2HVYB 3LGYA 3RMLH 4ABAA 1K1PA 3EA7A 3S9AA 4Q7YA 5EXLA 2ZFTA 1TNLA 3ZZ8A 5I25A 4FXGH 5C17A 1P02A 1UVTH 3VPKA 1CBWB 4J1YA 5FCRA 1GGDC 2VJ1A 3PLKA 1IQHA 1BQYA 2FOGA 1SGNE 4K69A 2KCOA 3GY7A 5DP7A 2ILNA 3E0NB 1NO9H 1TPAE 2VWNA 4GLYA 3CS0A 4R8TB 3BTME 2BD2A 2PUQH 1PQ5A 4A1TA 4IMQA 5EIYA 2NWNA 4HZHA 1PQAA 2C90B 1VCPA 2A0QB 1ZHPA 1Z1JA 3A8AA 1UHBA 2O8MA 1C2JA 1TGSZ 1VITF 3KQCA 1O5GH 2ZKSA 1PPGE 4FUBA 1ANCA 3NRLA 5T6DA 2FOFA 4X0WU 3BTTE 1A0JA 4JMYA 1SGPE 2TBSA 1BTXA 4TWYA 3FAOA 1GDUA 2ANKH 3T62A 1TWXB 5GNDA 1N8OB 2QAAA 2A7JA 1MD7A 2G4UA 3QUMP 4KELA 5HGGA 3A7YA 3SU5A 1TLDA 1JXPA 1EB2A 1JOUB 3Q3YA 3QGNB 4HTCH 1SGRE 1GJBB 1YCPK 1O3FA 4ZROA 2DE9A 2ZF0H 3FOAA 1HNEE 1OHHD 3SGBE 1A61H 1N1LA 5C20A 3E0PB 2D26C 4NFFA 3SI3H 5TCAA 1NFUA 1YPMH 2W5EA 1S81A 5L2YH 1FPCH 1BRBE 1K22H 3SI4H 4YLQH 2KX4A 1COWD 2HALA 3MO9A 4E7NA 4D7FA 1GJ8B 1TE0A 3B9FH 3LIWA 1AO5A 3OTJE 1YBWA 1TOCB 3HGNA 1TMUH 3KQBA 1O3OA 1EKBB 3AW0A 5EPYA 2FOBA 2UUYA 4FUCA 2XTTB 1BRUP 1GJDB 3BTKE 3D65E 3S0NA 2J34A 3M5MA 3OFND 1IHTH 3U8RH 2BDYA 1C1OA 2BOKA 5EW2H 4JCNA 2PGBB 4M7GA 2QIQA 3F68H 1NESE 3BTQE 3M3VA 3RXRA 4XOJA 1GI4A 2QF4A 2ZPSA 1NS3A 1T8LA 3LGWA 1A0HB 4D9RA 4MVNA 2BD9A 2BY8X 3RUOA 2QF5A 2F9UA 3FANA 5C94A 3GCTF 1G3EA 1IQJA 2ZFQH 1C2EA 4E05H 1CA0B 1MTSA 1HAYB 2G8TA 3F9EA 3U1JB 3SUFA 3HPTB 2BY9X 4OS5A 1A2CH 2H1UA 1NRRH 1WQVH 4AN7A 1OWEA 1D6WA 2XC5A 1XKBC 3KIDU 1MCVA 5GJ4B 5CE1A 4X2XA 4I8HA 1ELBA 3QZQA 5ESBA 3EA9A 2H9HA 3SNCA 2PWXA 2LNCA 1VKYA 4X6NA 4AFQA 3N7DA 3PYHA 4FUIA 4K1EA 1LQDB 5F6MA 4YOJA 2AIQA 2GT7A 1VJAU 4TWWA 1QRXA 1SQTA 5JBBS 1SGQE 1LKAA 3HKJB 4IC6A 1BMAA 2Q6DA 3SU0A 3NUMA 2A4GA 3A8BA 4FUFA 1QBVH 3A8CA 1AQ7A 3ENSB 4HI3A 2F9PA 1GBCA 5E2PA 4Y8ZA 2HVXA 1OWIA 4RSPA 2A5KA 2ZIQH 1HDTH 1RJXB 1IQIA 4NA9H 1KXEA 1HIAA 1NTPA 1DWDH 1WV7H 1A1RA 2BY5X 4OS7A 4OS6A 3RXEA 4I32A 5C67A 2BDBA 2BHGA 4ZKRU 2PGQB 1ORFA 2OXSA 3QLPH 1G2MA 2F9BH 3LU9B 1GMHF 1O3BA 1F0SA 1YPKH 1CGJE 2YNAA 1EP6A 1LO6A 2PW8H 3UPEA 1PYTC 1LHEH 3FVFB 4X1SU 3RLYH 3T25A 2XRCA 1QFKH 3S7HB 1NPMA 1NRSH 1MZAA 1SQAA 3HK3B 1BTPA 1DXWA 1C4U2 1GCTB 2ESTE 1KLTA 4RKOB 2PSYA 1AD8H 4UFGH 2FOMB 1O38A 2ZGCA 3A80A 3I78A 3F2GA 4WF8A 4YESB 5T6FA 5JDUB 5DKMA 1HJ8A 2BD3A 4CR9A 2PKSC 4NSYA 3K6YA 3SZNA 2SNVA 5ETXA 1P09A 1GG6C 3ZYDA 3BIVH 1XM1A 3VXFH 3VB6A 1GI7B 1TA6A 1GMDG 4O3TA 1QNJA 3LONA 3ZZ6A 2CXVA 1FI8A 2R0KA 2IPHA 3NWUA 4FU7A 3SV2H 3UOUA 1BMMH 1GMCG 1TPOA 3EE0B 4Q7XA 4I8GA 1AMHA 5HYOA 1P2MA 1GI1A 1LDTT 2ZWLH 3S7KB 3VB3A 5DGJA 1CSOE 1UCYH 4AORA 4Y79A 1P2IA 4AYYB 1GHAG 1DX5M 5HXFA 4MNWA 2IN2A 7LPRA 2VH6A 1FY4A 5EW1H 1XUKA 1L4DA 1XUHA 2G00A 1TQ7B 1SSXA 3TH2H 2FS8A 3Q76A 1C1NA 3KHVA 2C4FH 5TCCA 1W10U 1ACBE 3DA9B 1TBZH 2ZPQA 1ZSLA 2Z9GA 4I86A 2BVSH 1KXAA 4MDSA 1QCPA 4CREA 4BTUB 4Z6AH 1WOFA 1G3DA 1BDAA 3P70B 4Q63A 2KAIB 1B0FA 1WU1A 4WMEA 2BDCA 3SV6A 1S84A 2AMQA 4FUGA 1C2HA 1D3QB 3GY6A 3OE7D 3A81A 4BOHA 2PSXA 5K0HA 3RXIA 1AE5A 2EI7A 4ZKNU 2B9LA 1O3GA 4AB9A 1ZSKA 2JETC 2ZHDA 4OS1A 3RM0H 3BTFE 1UVOA 1YGCH 2SFAA 9ESTA 1H1BA 2D2DA 4JK6A 2A7CA 4JYTA 1EAUA 1W13U 3F0OA 3SNBA 2PV9B 2FTLE 3V13A 1MBQA 1S6LA 1W0JD 4GAWA 2Y81A 2A2QH 3RMMH 2FMJA 1TRNA 1W8BH 3U98H 1GG6B 1O3PB 3SNDA 1V2KT 5HKKD 1CO7E 1UK3A 3PRBA 4X8TH 4UE7H 4CBNA 2KR7A 1C5PA 3AAVA 4TY6A 3Q00A 3IITA 5L30H 1AN1E 1LVMA 3FFGA 4K2YA 3UY9A 2J98B 4K5ZA 8LPRA 2LP6A 2AH4X 1GI9B 5K7RA 4AG2A 1VITH 1K1OA 2ZCHP 4AG1A 2Q6GA 4Y0YE 3F1SB 1P03A 1TONA 4K8YA 1XUJA 2BB4A 1BBRK 1VITG 1XKAC 3BSQA 4Y8XA 2FWWA 1M9UA 1Y5UT 2KZ4A 4X1RU 4A1XA 4TPIZ 1WCZA 2AERH 1O3HA 3AW1A 4AOQA 2H2ZA 3ZZ3A 3RXAA 2A2XH 2BDIA 5BPEA 3PO1C 4YOIA 4BNRA 1P04A 1UTNA 1UTJA 4KTCA 4Y7AA 1NU9A 1YYY1 2GZ7A 3N7EA 1GBHA 1NRPH 4FETA 1BZXE 4ZKOU 1WXRA 1O3EA 2VWLA 1TFXA 2Z7FE 1JWTA 3P6ZB 2Z9LA 4TPYA 2EC9H 2FS9A 4D9QA 2Y5FA 3RLWH 3K65B 1QBNA 2OC1A 3MU5A 1OX1A 3KEEA 2VVVA 5A0AE 3D49H 1NFXA 1TIOA 1O3LA 1MKWH 1UVSH 1RD3B 5EOKA 2ZI2H 3P8OA 2ALPA 1CA8B 2XBXA 1DLEA 2WV9A 2D8WA 1EASA 2HNTC 1OWDA 5C5NA 2UWLA 3KYGA 2RCEA 2IOTA 3FZDA 4F55A 2Z3DA 3OU0A 8GCHF 2CF9H 1WTHD 1ZMJA 1QL8A 4U01A 1BHXB 3RC4A 1WUNH 3BTDE 1HAPH 4NA7A 1PPEE 1FN6A 1BMFD 2NU1E 5CDFE 1EB1H 1BCUH 1ARBA 5IDKA 1GJAB 1V2WT 1FDPA 1AFQB 2NU2E 2ANMH 1D3DB 2M5TA 1GBDA 1T7CA 2WSSD 1IQMA 1GVKB 2UWOA 3MTYA 4IS5A 5TJXA 1L4ZA 4XFQA 4IN2A 3TGKE 2R2WU 3MWIU 3P8NA 3F6UH 3M5OA 1QHRB 1HAVB 2BD4A 2GMTB 3NXPA 4AYVB 4CR5A 6GCHF 1E1RD 1G9IE 1EZQA 3BTWE 2FESH 3PLPA 2VGCB 1GHZA 1NFWA 5HIYA 2ZGHA 1Y3XA 3UAIC 3DD2H 2XOKD 2QCYA 2CHAB 3H7TA 1MU6B 4A6LA 2F91A 2DE8A 1P8VC 3SU3A 1W2KH 1FY1A 1K1LA 1AY6H 1FN8A 1Z7KA 2STBE 3GICB 4H6TA 2XWAA 2GX4A 2Y5GA 3RXQA 4FUJA 1EUFA 2VIQA 3E91A 4WXVA 1N6XA 2GP9B 2IJD1 2F4LA 4Z0KA 5B6OA 2YMSC 1GHYH 2ZDVH 1YKTA 4XE4A 3V12A 4UD9H 3ZZBA 2PTNA 3A82A 4F48B 3BTGE 2F43B 2OC8A 1A5IA 1BBRH 1NN6A 3TGJE 2VIOA 4I7YH 1CBWC 1L0ZA 1HBTH 4K8BA 2V35A 1K2I1 1O2ZA 5JBCS 1TNHA 4JZDH 3A83A 3LGUA 3ZZDA 2H5CA 3VGCB 3DSPA 1OP8A 1XUGA 1PYTD 1SFQB 2CV3A 3PLBA 3SZEA 1SGTA 3BF6H 3VB7A 3GISB 3MOCA 3V0XA 5ABWA 2TGAA 4ABGA 1L1NA 1SPJA 1O32A 1E37B 1UHBB 5EQSA 2I6QA 1J16A 1ZPCA 3ZZ9A 2Y7ZA 1A4WH 3F0PA 1WBGB 3R0FA 5A8ZA 4WXIA 1GMHG 2ZG0H 1FAKH 2FI3E 1SGYE 1NROH 1O2VA 3TJOA 4Y11E 2PTCE 1A46H 1K1NA 1YWUA 1C5MD 1PPCE 4ISLA 3JZ2B 1AWHB 1V6DA 2ODQA 4ACBA 2GCTB 1P3CA 1N8OC 3ZVEA 5LPEA 3OAAD 4K60A 3PV4A 4X8SH 1UVUH 3ITIA 3DUXH 2ZECA 1MD8A 5EJ1A 3PV2A 2ZTXA 2ZFPH 2WPJS 1SLWB 2QYIA 3ZV9A 2Q6FA 1LPGB 3GDVA 1HXEH 3DT0H 1BITA 1OWJA 3LC3A 1NU7B 3RXPA 2HNTF 3SV7A 1ELFA 3U9AH 3HKIB 1THPB 3OY5U 1GBLA 2HPPH 3F2HA 4DIIH 3SNEA 3FKSD 2EQNA 5KEDA 2PP6A 1TX7A 2QGRA 7GCHG 2CF8H 3VEQB 3GY4A 2ZHEH 4ISNA 2ZTZA 3MU1A 3VG8A 3W95A 1UVPA 5BRRE 3DSOA 4Y7BA 3OSYA 1UTMA 2OK5A 4NSVA 1C2DA 4YT7H 2VVCA 1B7XB 1RIWB 1GBBA 4I8KA 1PQ8A 3RXTA 1P01A 1ZSJA 1J8AA 1KXCA 1AFEH 3UWJH 3L3TA 2JJ2D 2H9TH 4LXBH 1F0RA 3MNSA 2O8TA 3L33A 2BZAA 1YC0A 3TLOA 1ANEA 1CA0C 3OY6U 1FNIA 2JH5D 2VWMA 3KCGH 1CQQA 4Y6DA 2OD3B 3NPSA 3RXBA 3A88A 2GD4B 1Y59T 3ZZ5A 1UTKA 3BV9B 4NWKA 2XNIA 1O3MA 2KCPA 2D1JA 1ELDE 3A7ZA 2Y5HA 2J2UA 3KGPA 2ZDMA 5EQRA 5T6GA 5G4BA 2ZQ2A 2WV4A 4INLA 5FBIA 2RDEA 3N7OA 4NIWA 4FVDA 3B23B 2P3FH 1SMFE 1MAYA 1RGQA 3M3TA 2DUCA 1O34A 2Y82A 5CHAC 1NT1A 2R2MB 1MUEB 3IWMA 6ESTA 1O39A 1LVBA 2SGAA 2XWBI 3MQKC 4BAHB 2GDEH 2XNDD 3SQEE 2FZZA 1GJ9B 3BIUH 4A1VA 1OPHB 4OS2A 1LHGH 1ELAA 1T32A 2F83A 7KMEH 2BM2A 4K1SA 1E36B 2FOAA 2G81E 1TGTA 1HIAB 4P02A 1TBRH 2BYAX 5T1VA 3ZZ7A 1ZPBA 2Q1JA 5DSFA 3SNAA 3OX7U 2F9VA 2UUKB 3PTBA 3K9XB 1GHWH 1INCA 2EI6A 1FY5A 2FP7B 3OEHD 2QXHA 3MYWA 1BMNH 1GJ7B 1BIOA 4MPXA 2HLDD 2W6JD 2ZTYA 5DG6A 1DUEA 1FY8E 2ALVA 1XXFA 1GVZA 3HATH 1YF4A 1NBME 2GDDA 2V3OH 1XXDA 1ID5H 1LKBA 1CT0E 3EA8A 2OLGA 2ZDAH 1C5YB 1GCTC 3ZZAA 3ZVDA 2F3CE 1C1WH 1W0YH 1C9PA 5FAHA 2EY4C 4CH8B 3AK5A 1BBRE 3K6ZA 1EPTB 3U69H 3QWCH 2OINA 5EG4A 4CHAB 4NZLA 4Y0ZE 4JZ1A 3RXCA 4B2AA 4NIYA 1DSTA 3KQEA 5C1YA 1T4VH 1B5GH 1E34B 1VR1H 1FIZA 2GJGA 5F8XA 1KXFA 1YPGH 2J94A 1O5FH 1D4PB 5A0BA 3A7TA 4OGXA 2ZDLA 1IHSH 1QTFA 4B2BA 4X8VH 4B74A 8GCHG 4KGAA 1O2HA 1X7AC 4GSOA 1GI0A 2ZNKH 3SGAE 3FP7E 2H9EH 4SGBE 1MAXA 5CHAB 1TMBH 1RS0A 1OYQA 3E3TA 1L1JA 3A7WA 1O2WA 3NCLA 2OC7A 4ZXYH 4O3UA 1C5WB 1F0TA 2G52A 1D9IA 1O37A 2J9NA 1O5DH 3UFAA 1O2MA 1YCPM 3NZIA 3W94A 1GI6A 3RXFA 1DOJA 2FOHA 2J5UA 1BT7A 1F5LA 5GXPA 1J9CH 4GPGA 1ZLRA 1ZTJA 1CT4E 2BY7X 2FM2A 4ABEA 3GDUA 2V7QD 6GCHG 3MNBA 4ZHMU 1YCPH 1P2QA 3LGTA 2IPQX 1EZSC 3RXGA 2PUXB 2BVXH 1AVXA 5FPTA 2ZGJA 1FUJA 3TNSA 1MABB 4YM9A 2BQ6B 1MZDA 3BTEE 3KF2A 2VB0A 2ZZUH 3M5NA 1KLJH 2PHBA 2HGTH 3ESTA 2M2AA 4CRAA 3RU4E 1GVLA 6CHAB 3BEUA 2BDHA 3I77A 3VB5A 2SGFE 2Z94A 4AFZA 2QF3A 4IBLH 2FO9A 3P92A 4H6SB 1O2JA 1W7XH 2ASUB 1YPHC 4NIVA 3MFJA 4TSFD 2YNBA 3EAJA 1AZZA 3QX5H 5DJ7A 2H6MA 1G37A 2P59A 3U28C 2AS9A 1H4WA 1V2PT 1RXPA 3SN8A 2BQWB 4DGJA 1GBTA 2OBOA 1C5RA 1DPOA 3VXEH 3ZIAD 3KQDA 2XBWA 5AFZH 2QV1A 1RTLA 4YT6H 2RDLA 2RA0A 3M7TA 5GCHF 1GHBF 1A3BH 3B8JA 1MQ6A 4BXWA 3BTHE 2VWOA 1O5CB 3BN9A 7GCHF 1HFDA 2VVUA 3MH6A 3CP7A 2BLQA 2BX4A 1L2EA 4INKA 1OP0A 1S83A 2P94A 3OYPA 4UFFH 5DP3A 3P95A 2FEQH 4R0IA 1AKSA 1C4Y2 1V3XA 4XBCA 1UMAH 2O8WA 2W26A 1HLTH 2J92A 5PTPA 3U1IB 1ZJKA 4X2YA 1ZPZA 1DFPA 3RXMA 1EAIA 1GWAA 4AX9H 5F8ZA 1A5HA 4WY3A 2P95A 4O97A 2L74A 3FZZA 3TH3H 4DY7B 4UONA 1T8NA 3GY3A 4ABFA 3SOSA 1K28D 4BAQB 1XUFA 1E79D 3BG4B 4XDEA 1HPGA 3Q3XA 2VINA 2GCHG 1KLIH 3VB4A 1KDQA 1TYNA 4DG4A 1NBMD 2VIDA 2WYGA 3OTPA 1EX3A 1JBUH 1DSUA 3SQHE 1YY3A 4DURA 3FO8D 2VBCA 3T29A 3SORA 1TGBA 2V0BA 3L6PA 3M36A 2WZQA 1HYLA 2ZC9H 1TAWA 2O9QA 4DJZB 3LJOA 2B7DH 2JJ1D 4E06H 5JBTA 2VH0A 1QL7A 3U8OH 1A5GH 3T26A 3LT3A 3GCNA 1KTTB 1F0UA 1G2LA 1JIMA 3M37A 4B76A 3EGKH 3C1KA 2UWPA 1AFQC 4ABBA 1TNGA 1CHOF 2BDGA 5GPIB 1S85A 1W14U 2WPMS 1NRNH 3M35A 3PM3A 4XRNA 1UK2A 2KCAA 1MKXK 4UFDH 5J4SA 1GBIA 1SLVB 3ATMA 2BLVA 2GMTC 1XX9A 1EATA 1T31A 4CRCA 1P05A 1Y5BT 1E0FD 2FYQA 1TALA 1HAIH 2VGCC 5C1UA 3H7OA 5FXLA 2C8XB 1ZRKA 2CHAC 4ZHAA 4Q2KA 4IW4E 3O8CA 3D23A 1E38B 1TMTH 1PQ7A 2ZFFH 1P2JA 1GJ6A 2C8ZB 1OWHA 1GDQA 1SG8B 1TA2A 2SGQE 1LMWB 1CT2E 5DK1A 3TJNA 2VNTA 4AFUA 3RMNH 5EQQA 4NCYA 1GBKA 1SQRA 2VIVA 5FX6A 2QA9E 2QXGA 1O2KA 5FPYA 1BMLA 1AUTC 3NK8A 5AVDA 1HGTH 2P8OB 2ZU1A 2V3MA 3DFJA 3F9HA 4KTSA 3TIUA 3RU4D 2R0LA 1FJSA 5FCKA 4DVAU 5EGMA 1HRTH 2XBYA 1A7SA 5GDSH 3VGCC 4FUEA 5L6NH 4QT8C 1ELCA 3E16B 5A8YA 1SC8U 1Q3XA 2ULLA 2TGTA 1QQUA 5E0GA 2P93A 4LZ1H 3SYJA 1O2GH 1LCYA 1QB9A 1S6FA 1O2SA 1PPHE 3RXSA 2ZA5A 3SJIA 1ETSH 1S0QA 1ZZZA 4H42U 2AGGX 5HIZA 1ELGA 2A4OA 1S5SA 2OUAA 5GIBA 4CRGA 3A7VA 1FV9A 7ESTE 1S0RA 1Z6JH 1BTHH 2XCFA 1DXPA 2ZDNA 2GCTC 3E6PH 5A2MH 2AMPA 1AWFH 1ESTA 3MO6A 3GCTG 5EXNA 3GYMA 1C4V2 1V2ST 4UEHH 4ZH8A 1TGNA 2A4QA 1XMNB 2Y6TA 1SB1H 4DW2U 1RTKA 4ZXXH 3WW7A 1GL1A 2PKAA 3O8RA 3ZVAA 1ARCA 3ELAH 5A8XA 2ZPRA 3PTNA 4ACAA 2R9PA 1P3EA 1MTNB 3MU8A 2O8UA 2C8YB 2G4TA 2K0QA 1TNKA 2C93B 1O3AA 1BHXF 2Z3CA 1G32B 3LJJA 1C5VA 3M7UA 5EXMA 4FOUC 1W11U 4SGAE 4RT1A 1SR5C 1MKXH 2P16A 3STJA 1D3PB 2W7UA 4AFSA 1HV7A 3A85A 3Q3KA 1ESBA 1TRYA 2GZ8A 2FOCA 1DY9A 2XCNA 1LQEA 1O2LA 3UQOA 3VFEA 3HGPA 2NU0E 3QTVH 2HLCA 5I46H 2LPRA 1MU8B 2I6SA 5DO4H 3UOPA 1CGHA 1RIWC 1OWKA 1AGJA 3UB0A 3W1EA 4NG9H 4TY7A 3GCHB 3AVZA 4MPWA 5J4QA 3RXLA 1Q2WA 1S82A 3RXJA 4WMFA 2H5DA 2FIRH 3JZ1B 4B1TA 1GL0E 4ABIA 3GY2A 1P9SA 5F53A 1TB6H 1VGCB 3TK5A 1VZQH 1QURH 1SOTA 1QA0A 2HNTE 3PRDA 3UNSA 4O9VA 1GPZA 1AB9B 1OKXA 2BVRH 9LPRA 4FU9A 4U32A 1RRKA 5IK2D 5T3HA 1SLXB 2V3HH 1BJVA 1MH0A 4BAMB 1YLCA 1ELEE 1O2NA 1QJ1B 1GBAA 4X6MA 2ZQ1A 3LOXA 1PPBH 2FODA 1GHAF 4MQAA 2ZU5A 3SBKA 1GI2A 1IQEA 4NFEA 1MBMA 4RKJB 3P17H 1UTPA 2QY0B 1ZOMA 1KSNA 3SO3A 1C2FA 2B5TB 1XVMA 4JZFH 4VGCB 1G36A 1L1GA 1BJUA 1DITH 2ANWA 4ZKSU 4WJG2 2XXLA 1GDNA 1HAVA 1NY22 3P8FA 3SUDA 4X1PU 1KTSB 1H8DH 1DWCH 2PR3A 1RTFB 3KYFA 3MNCA 5A0CA 1O2OA 2HPQH 3SHCH 3O8BA 2J4IA 5GCHG 2B0FA 1GHBG 4P00A 2KCYA 3BEIB 1DLKB 3F9FA 1V2TT 4CH2B 4WWYA 1O2RA 1IOEA 1GI3A 2EA3A 5E2OA 2ZGBH 3EQ0H 1C1UH 1YLDA 1AVGH 1WDIA 5ESTE 1Z71A 1JMOH 1F5RA 1CHGA 1SGIB 2A1DB 1JRSA 4X2WA 3V3MA 1GI8B 1Y3VA 1C5QA 4U2WA 3CS7A 1UTLM 1E35B 3TU7H 1V2JT 1ZTKA 1ELTA 2SGPE 1PPFE 8KME2 3ZVBA 1YPLH 2YOLA 3PWBA 3TITA 1QRZA 2W6ID 2WPIS 4F4OC 1IQNA 2K8IA 3UR9A 1KMHB 5EU8A 4OGYA 4ASHA 1SHHB 2B8OH 2A5IA 1WSSH 4DT7B 2AGEX 4F49A 3BEFB 1UO6A 2TRMA 2BY6X 1GBFA 4WH8A 1UK4A 2FX4A 3UIRA 5DN6D 1EZXC 1HAGE 1V2UT 1EQ9A 3GOVB 1E1QD 1F5KU 2GV7A 2ZCKP 1J15A 4ZUHA 5LGOA 1KY9A 1TGCA 2G55A 1EPTC 1LPKB 1Z8GA 4CHAC 1ZTLA 4X6PA 3FP8E 5LPRA 3MMGA 3O8DA 1W0ZU 4DOQA 2Z9KA 1SLUB 1P10A 5E0HA 2ODPA 3TK9A 3DSGA 1C2MA 1ZR0A 2BDAA 2PLXA 2FLRH 1CGIE 4HFPB 3MHWU 2QXJA 1FAXA 2ZGXH 3I29A 3URCA 2FLBH 5AHGH
chains in the Genus database with same CATH topology
4PROA 3S9CA 1DANH 1O2IA 1CHOG 5HM9A 4JZIA 2A7HA 4D76A 4AZ2B 4K3JA 2ZDKA 5SGAE 3KNXA 2FPZA 1HAZB 1FY3A 5JPMH 2EI8A 2CGAA 2A4RA 1C5ZB 1ZMNA 1QB6A 3ZVCA 2A5AA 2P3TB 3SV8A 4GCHF 6LPRA 2QC2A 2ZU2A 1EJAA 2THFB 4NIXA 2FOEA 1SGFG 1FLEE 1C1RA 3T27A 2ZU4A 5A09A 1YPEH 1O5AB 1QBOA 1V2OT 4GHTA 4H4FA 1SQOA 1C1SA 3DHKH 1QR3E 1ESAA 2OBQA 4O03A 4Q80A 1GJ4H 6CHAC 5JB8S 1TOMH 1GGDB 1XVOA 1FONA 3ATKA 4IC5A 3RXKA 2XW9A 3NKKA 1LHFH 3MI4A 4ABDA 1DS2E 2FI5E 1ANBA 4WVPE 4JYUH 4I33A 2ZEBA 3DFLA 4A92A 2RG3A 1PPZA 2G5NA 2FI4E 4BAOB 2WPLS 1C1MA 1WYKA 2VIWA 3MNXA 1UCYK 1DT2A 2SGDE 4ISIH 5E8EH 1ABJH 1H9HE 4BANB 3ZZ4A 2BD7A 3SUEA 5DP5A 5GWZA 4FUHA 1V2RT 4KP0A 1FIWA 1C5XB 2ZHFH 1XUIA 4NA8A 1GBEA 1QJ7B 1DM4B 3GCOA 1RFNA 2AGIX 3QK1A 1YP9A 3UNQA 1W3CA 2ZHQH 1C1VH 1ETRH 1AU8A 4B71A 2RA3A 1EOJA 1IQKA 1MMJN 3MH7A 1AKSB 1O0DH 1O3KA 2J38A 4BXSA 2JH0D 1AVWA 3RC5A 1H9LB 1P06A 4FVBA 4YLUA 1ZGVA 2STAE 1VCQA 2OC0A 1Y5AT 2ZP0H 1O2QA 1C5UA 2O8LA 3UNRA 1TNIA 1ZMLA 3ATWA 4INHA 1WTGH 4K1TA 3TVJB 1F7ZA 3A86A 2FTMA 2HOBA 3BG4C 1O31A 1C2GA 4U30A 8ESTE 1JIRA 1UTOA 2GT8A 1JRTA 1KDQB 1NZQH 4X6OA 2BXUH 1P2NA 2OTVA 3H5CB 2G51A 3QDZB 3M7QA 3UWIA 2A31A 2R3YA 3LGVA 4CRDA 3PMJA 3GY8A 4I8LA 1H9IE 1AZ8A 1QA7A 1C5OH 2GV6A 1SGEE 2ZU3A 1P9UA 1LVYA 1GHXH 1F92A 1LPZB 1W7GH 3TPIZ 1K1IA 1O5EH 1V2NT 1ZHRA 3E8LA 1PJPA 3SU1A 3IG6B 1N6YA 4LOYH 1ZYOA 4YOGA 1O30A 1KIGH 1DWEH 1IAUA 4D7GA 1GI5A 2WINI 4ABHA 1O2XA 2BMGB 3QN7A 3HK6B 1GBMA 1CE5A 2FX6A 3EYDA 3AASA 4Y8YA 5DPAA 1ABIH 1NRQH 4MG3A 1BTWA 1Y8TA 4NGAH 1P11E 1P2OA 1EPTA 1QGFA 4XBBA 4Q7ZA 1ZJDA 3ATLA 4JK5A 1TX8A 2F9OA 2GKVE 3RMOH 2GZ9A 2XBVA 2Z9JA 1O2PA 1C1QA 1SHYA 3SU4A 3RM2H 4WMDA 3QO6A 2JKHA 1QQ4A 2FDAA 1Z8JB 1ETTH 4D8NA 2BTCE 1SOZA 1OYTH 1P57B 4X8UH 2WPHS 4DIHH 1MKWK 1DDJA 3QZRA 1HCGA 1DE7H 1BRAA 1T8OA 1B0EA 4AGKA 5JB9S 3SGQE 3UQVA 1SGDE 4AB8A 4XBDA 1TABE 1D6RA 2ZO3H 4BAKB 4ZMAH 1WQSA 1TQ0B 2OQUA 1VCWA 4KTUA 4WH6A 1EP5A 5DP6A 2HWLB 2P8OC 1MTWA 2TIOA 4MNVA 1SI5H 4JZEH 1EXFA 1MTUA 1EAXA 4I8JA 1TRMA 2GVFA 4UDWH 4ISOA 2ZFRH 4GUXA 1G3CA 2BLWA 4J2YB 5F8TA 1O2UA 1OOKB 1HAOH 3QGJA 2Y7XA 1FXYA 1QIXB 1THRH 1U6QA 3LH1A 2XYAA 1C9TA 2AEIH 2G5VA 3MO3A 3ZV8A 1CVWH 1TPSA 1QRWA 2QF0A 1H8IH 3SHAH 3SJOA 3URDA 3A87A 2W3IA 5C3NA 1BB0B 1MTVA 2SGEE 1GCDA 1YPHE 2FXRA 1G30B 1MQ5A 4ZHLU 1SVPA 1HXFH 1WAYB 3PMHB 1LHDH 1TPPA 3TJVA 2BXTH 3S9BA 1GJ5H 1A3EH 1O3DA 2PKSB 1BA8B 4ABJA 1Z8RA 2SNWA 4HGCA 4FUDA 1AE8H 4IN1A 3PMAB 4X2VA 3SUGA 5LPFA 3BG8A 4KKDA 3U8TH 2PKAB 5CMXH 5AF9H 3K2UA 3GYLB 3AAUA 2WYJA 4CBOA 2BX3A 3FP6E 5F03A 1SFIA 1V2QT 3TNTA 1MTNC 4Y10E 3MU0A 4X1NU 1IQFA 5C1XA 1K1MA 4B75A 3SJ8A 4YTAA 3LGIA 3M5LA 1C2IA 1QJ6B 3UREA 1P12E 2BQ7B 5DP9A 3ZZCA 3MH5A 1NM6A 1BUIA 1D3TB 1C2KA 1C2LA 4E7RG 4X1QU 1HJ9A 1J14A 2W3KA 3PMBB 3F9GA 4BTIB 2BZ6H 3RU4T 2OCVB 1EJNA 3MH4A 3GDSA 1UTQA 1BTYA 1UJ1A 4ESTE 1ZRBA 3GCHC 2PFEA 1ELVA 2KAIA 4A7IB 1GHVH 2P3UB 4ISHH 3UR6A 4B2CA 3MU4A 1VGCC 4IMZA 1DICA 4JYVH 4Y76A 3RC6A 4FU8A 1SGFA 4GVUA 4GCHG 2ANYA 2UUJB 1AIXH 2JETB 1AB9C 1S6HA 2ZCLP 3M61U 2ZHWH 2W7SA 2A45B 4DCDA 1KXBA 1C5TA 1VJ9U 1T4UH 1C5SA 2HRVA 3RXVA 1HJAC 5AFYH 5FBEA 1O5BB 3SW2B 2VU8E 1ANDA 1SBWA 3ODFA 1O3IA 1OXGA 3T28A 1C1PA 4IGDA 4BTTB 1ZHMA 2GTBA 1SL3A 4RN6A 4B73A 4MNXA 3PB1E 1TBQH 3SJKA 3ODDA 3QTOH 3TK6A 3TJUA 3LC5A 1J17T 1DVAH 1Z1IA 3R3GB 1LVOA 1FZZA 4CRFA 1AUJA 3SU6A 3A89A 1O35A 5EPNA 4VGCC 3C27B 1O3NA 1YPJH 1EAWA 1OSSA 4MPUA 5EODA 3UTUH 1MCTA 3LH3A 5HM2A 2F9NA 1EJMA 2Y80A 1C1TA 2Z6BD 1HAXB 2OP9A 3PROA 5DP4A 2ZFSA 3LPRA 1AHTH 4THNH 1P2KA 5H4IB 1O36A 1OS8A 2AIPA 3LDXH 1SGCA 2CJIA 1DUAA 5FHTA 3ATIA 1DY8A 3D62A 3Q77A 3PO1B 4I31A 2JH6D 1O2TA 2WUBA 2XC4A 2BLOA 1BTUA 2QN5T 1GJCB 3E90B 3GY5A 5JBAS 1PFXC 3E1XB 2R3UA 4YZUA 1Z8IB 3SV9A 3RDZA 4MLFB 1V2VT 2FYRA 1LHCH 2Z9IA 1Y3UA 2QXIA 4ZAEA 4XSKU 3RXHA 3ZVGA 1BTZA 1UCYE 4MNYA 2UUFB 1F2SE 5C2ZA 2J95A 1NC6A 2XC0A 1KYNA 1AI8H 2TGPZ 2BD5A 4OS4A 4UFEH 1C5LH 3KN2A 5DP8A 1G3BA 2CMYA 4AGJA 4LK4A 2A32A 2IJOB 2WV5A 3SJ9A 2AFQB 2BOHB 1EOLA 1A0LA 5LH8A 1GMDF 1T8MA 4NWLA 2Z3EA 3RXUA 3G01A 1GMCF 5HMAA 1OP2A 1HJAB 1QL9A 3RXOA 2ODYB 4A5TS 4MTBA 1CU1A 5E0JA 3LKWA 1QY6A 2OQ5A 1THSH 3A84A 1V2LT 1DWBH 4MPVA 1IQGA 3P8GA 3PWCA 1YM0A 1TX6A 3ZYEA 1HB0B 2EEKA 3A8DA 2NU4E 2NU3E 1HAHH 5IYTA 4LZ4B 1LTOA 1EZUC 2VIPA 4YO9A 4GHQA 3WY8A 3RP2A 1O2YA 1Y3WA 2CN0H 3STIA 1KXDA 5FPSA 1O3JA 3EDXB 3RXDA 1BOQA 3UUZA 5FX5A 1FPHH 3T2NA 1FQ3A 3TGIE 4Y71A 1HUTH 1IQLA 1Z6EA 2WPKS 5L2ZH 3S69A 3KL6A 3TH4H 4CRBA 1C5NH 2K1QA 1NFYA 2AMDA 1GBJA 1K1JA 2GCHF 1Y3YA 2C3SA 2GGVB 3M3SA 1V2MT 1ZGIA 1K21H 1O3CA 2V6NA 1W12U 3A7XA 1BRCE 1QB1A 5C5OA 2C8WB 1P0SH 2TPIZ 3ZVFA 1FMGA 1TNJA 2BD8A 2TGDA 5JYIA 3SU2A 4TYDA 3CENA 1K9OE 2AYWA 1Q31A 3V7TA 1O33A 2WUCA 3T5FH 4NZQA 3LGYA 3RMLH 4ABAA 1K1PA 3EA7A 3S9AA 4Q7YA 5EXLA 2ZFTA 1TNLA 3ZZ8A 5I25A 4FXGH 1P02A 1UVTH 3VPKA 1CBWB 4J1YA 5FCRA 1GGDC 2VJ1A 3PLKA 1IQHA 1BQYA 2FOGA 1SGNE 4K69A 3GY7A 5DP7A 2ILNA 3E0NB 1NO9H 1TPAE 2VWNA 4GLYA 3CS0A 4R8TB 3BTME 2BD2A 2PUQH 1PQ5A 4A1TA 4IMQA 2NWNA 4HZHA 1PQAA 2C90B 1VCPA 2A0QB 1ZHPA 1Z1JA 3A8AA 1UHBA 2O8MA 1C2JA 1TGSZ 1VITF 3KQCA 1O5GH 2ZKSA 1PPGE 4FUBA 1ANCA 5T6DA 2FOFA 4X0WU 3BTTE 1A0JA 4JMYA 1SGPE 2TBSA 1BTXA 4TWYA 3FAOA 1GDUA 2ANKH 3T62A 1TWXB 1N8OB 2QAAA 2A7JA 1MD7A 2G4UA 3QUMP 4KELA 5HGGA 3A7YA 3SU5A 1TLDA 1JXPA 1EB2A 1JOUB 3Q3YA 3QGNB 4HTCH 1SGRE 1GJBB 1YCPK 1O3FA 4ZROA 2DE9A 2ZF0H 1HNEE 3SGBE 1A61H 1N1LA 5C20A 3E0PB 2D26C 4NFFA 3SI3H 5TCAA 1NFUA 1YPMH 2W5EA 1S81A 5L2YH 1FPCH 1BRBE 1K22H 3SI4H 4YLQH 2HALA 3MO9A 4E7NA 4D7FA 1GJ8B 1TE0A 3B9FH 3LIWA 1AO5A 3OTJE 1YBWA 1TOCB 3HGNA 1TMUH 3KQBA 1O3OA 1EKBB 3AW0A 5EPYA 2FOBA 2UUYA 4FUCA 2XTTB 1BRUP 1GJDB 3BTKE 3D65E 3S0NA 2J34A 3M5MA 1IHTH 3U8RH 2BDYA 1C1OA 2BOKA 5EW2H 4JCNA 2PGBB 4M7GA 2QIQA 3F68H 1NESE 3BTQE 3M3VA 3RXRA 4XOJA 1GI4A 2ZPSA 1NS3A 1T8LA 3LGWA 1A0HB 4D9RA 4MVNA 2BD9A 2BY8X 3RUOA 2F9UA 3FANA 3GCTF 1G3EA 1IQJA 2ZFQH 1C2EA 4E05H 1CA0B 1MTSA 1HAYB 2G8TA 3F9EA 3U1JB 3SUFA 3HPTB 2BY9X 4OS5A 1A2CH 2H1UA 1NRRH 1WQVH 4AN7A 1OWEA 1D6WA 2XC5A 1XKBC 3KIDU 1MCVA 5GJ4B 5CE1A 4X2XA 4I8HA 1ELBA 3QZQA 5ESBA 3EA9A 2H9HA 3SNCA 2PWXA 2LNCA 4X6NA 4AFQA 3PYHA 4FUIA 4K1EA 1LQDB 5F6MA 4YOJA 2AIQA 2GT7A 1VJAU 4TWWA 1QRXA 1SQTA 5JBBS 1SGQE 1LKAA 3HKJB 4IC6A 1BMAA 2Q6DA 3SU0A 3NUMA 2A4GA 3A8BA 4FUFA 1QBVH 3A8CA 1AQ7A 3ENSB 4HI3A 2F9PA 1GBCA 5E2PA 4Y8ZA 2HVXA 1OWIA 4RSPA 2A5KA 2ZIQH 1HDTH 1RJXB 1IQIA 4NA9H 1KXEA 1HIAA 1NTPA 1DWDH 1WV7H 1A1RA 2BY5X 4OS7A 4OS6A 3RXEA 4I32A 5C67A 2BDBA 2BHGA 4ZKRU 2PGQB 1ORFA 2OXSA 3QLPH 1G2MA 2F9BH 3LU9B 1GMHF 1O3BA 1F0SA 1YPKH 1CGJE 2YNAA 1EP6A 1LO6A 2PW8H 3UPEA 1PYTC 1LHEH 3FVFB 4X1SU 3RLYH 3T25A 2XRCA 1QFKH 3S7HB 1NPMA 1NRSH 1MZAA 1SQAA 3HK3B 1BTPA 1DXWA 1C4U2 1GCTB 2ESTE 1KLTA 4RKOB 2PSYA 1AD8H 4UFGH 2FOMB 1O38A 2ZGCA 3A80A 3I78A 4WF8A 4YESB 5T6FA 5JDUB 5DKMA 1HJ8A 2BD3A 4CR9A 2PKSC 4NSYA 3K6YA 3SZNA 2SNVA 5ETXA 1P09A 1GG6C 3ZYDA 3BIVH 1XM1A 3VXFH 3VB6A 1GI7B 1TA6A 1GMDG 4O3TA 1QNJA 3LONA 3ZZ6A 2CXVA 1FI8A 2R0KA 2IPHA 3NWUA 4FU7A 3SV2H 3UOUA 1BMMH 1GMCG 1TPOA 3EE0B 4Q7XA 4I8GA 1AMHA 5HYOA 1P2MA 1GI1A 1LDTT 2ZWLH 3S7KB 3VB3A 5DGJA 1CSOE 1UCYH 4AORA 4Y79A 1P2IA 4AYYB 1GHAG 1DX5M 5HXFA 4MNWA 2IN2A 7LPRA 2VH6A 1FY4A 5EW1H 1XUKA 1L4DA 1XUHA 2G00A 1TQ7B 1SSXA 3TH2H 2FS8A 3Q76A 1C1NA 3KHVA 2C4FH 5TCCA 1W10U 1ACBE 3DA9B 1TBZH 2ZPQA 1ZSLA 2Z9GA 2BVSH 1KXAA 4MDSA 1QCPA 4CREA 4BTUB 4Z6AH 1WOFA 1G3DA 1BDAA 3P70B 2KAIB 1B0FA 1WU1A 4WMEA 2BDCA 3SV6A 1S84A 2AMQA 4FUGA 1C2HA 1D3QB 3GY6A 3A81A 4BOHA 2PSXA 5K0HA 3RXIA 1AE5A 2EI7A 4ZKNU 2B9LA 1O3GA 4AB9A 1ZSKA 2JETC 2ZHDA 4OS1A 3RM0H 3BTFE 1UVOA 1YGCH 2SFAA 9ESTA 1H1BA 2D2DA 4JK6A 2A7CA 4JYTA 1EAUA 1W13U 3SNBA 2PV9B 2FTLE 3V13A 1MBQA 4GAWA 2Y81A 2A2QH 3RMMH 2FMJA 1TRNA 1W8BH 3U98H 1GG6B 1O3PB 3SNDA 1V2KT 1CO7E 1UK3A 4X8TH 4UE7H 4CBNA 1C5PA 3AAVA 4TY6A 3Q00A 3IITA 5L30H 1AN1E 1LVMA 3FFGA 4K2YA 3UY9A 4K5ZA 8LPRA 2AH4X 1GI9B 5K7RA 4AG2A 1VITH 1K1OA 2ZCHP 4AG1A 2Q6GA 4Y0YE 3F1SB