1C1RA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1rA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1rA02
1TAWA 1O2LA 3W95A 1FI8A 2ZECA 1C5RA 2WINI 1Q2WA 1AUTC 1W7XH 1HAVA 1HAIH 1QCPA 1P10A 3A88A 5E0HA 1LMWB 1TNHA 3SJOA 2BY6X 4JZFH 4K60A 4ZHAA 2Q1JA 1GI1A 3V7TA 4UD9H 1AKSA 3KQCA 2ZPQA 1ELAA 3I29A 5JYIA 1QIXB 2D26C 3RMNH 3D23A 2NU0E 2J4IA 4CRBA 5C1XA 2AFQB 1BOQA 1V2MT 1MMJN 1H9IE 1FIWA 1MTVA 2D8WA 1O3DA 4DIHH 2Z3CA 3Q3YA 1O2UA 3SNBA 3M7QA 1THRH 3MMGA 2ODPA 1C2DA 2GVFA 2P95A 1NTPA 3A7TA 1G2MA 3T28A 4HGCA 2OBOA 1T31A 3A7XA 4DCDA 1IQJA 1BHXB 1JOUB 1O5EH 3PLPA 2D1JA 4Q7XA 2FS8A 2OP9A 1TRNA 1QA0A 3KN2A 4ISOA 1HLTH 4JZIA 2WUBA 1V2KT 4U01A 2Y7XA 1MTNC 1P2NA 4A5TS 1GHBF 2GKVE 2FIRH 5GDSH 4KTCA 3ATIA 1SQTA 2Y81A 1C4Y2 1J14A 1GCTB 2B0FA 3PWCA 3ZZ4A 1GMHF 3KQEA 1TQ0B 6GCHF 3TJNA 3TIUA 1ESTA 2G81E 3M3SA 1HAHH 3FP8E 1K1OA 3TJUA 1B5GH 1LCYA 3SU4A 3ZZCA 1XVOA 2QAAA 4MQAA 1SOTA 3TH2H 1C1RA 1KIGH 1Z1IA 1TX8A 2EI8A 2FPZA 4WH8A 1XKAC 3GY5A 2VWMA 3ESTA 5AVDA 3AW0A 3P70B 3A86A 1BHXF 2PV9B 3SJ9A 1SLUB 1G9IE 3A89A 1AY6H 1P2JA 1EATA 2BDGA 1P2MA 3GCOA 5JBTA 3EA8A 2PUXB 2XBWA 1O0DH 4AYVB 1MQ6A 3PM3A 3EAJA 1W13U 5EG4A 1PPBH 4OS2A 1EASA 2FO9A 3LC3A 2NWNA 5GPIB 2BZ6H 1L1JA 2Y6TA 2QN5T 4D9QA 4AFQA 1YCPH 2O8WA 2YOLA 1SHYA 1ORFA 1NRPH 1N8OC 6CHAC 5F8ZA 4O97A 1CT0E 1LHEH 1C1VH 2F9UA 4IN2A 4MPUA 3D49H 2BVRH 1BT7A 1SGTA 4CHAC 1GVKB 1MTNB 1SI5H 4WMEA 2BDCA 2Q6FA 1AHTH 4H42U 1FNIA 4ABFA 1E35B 2XWBI 1DANH 3I77A 3BTQE 4MPXA 4I8GA 1WQSA 2Z94A 1YYY1 7GCHG 1AVWA 1C5UA 3ZZBA 3PMBB 5DKMA 2O8MA 3M5NA 3GY4A 1CA8B 2A2QH 2J34A 1EOJA 3P95A 1QJ7B 3LPRA 4CBOA 2HOBA 2TGPZ 2V3OH 4TYDA 3U1IB 2H9HA 4DW2U 2QA9E 3SV6A 2UWPA 2B7DH 4K2YA 3RXVA 4E7RG 5GCHF 4K5ZA 2ZDLA 1F0TA 4U30A 3TNSA 3LT3A 1KXDA 3SJ8A 3BIUH 1TNJA 4YOGA 1FLEE 2PGQB 1C5SA 1O2WA 2BD2A 1O34A 1EZSC 4NSVA 3EYDA 1CBWC 2PKAB 2TPIZ 2BXTH 1RTFB 3C27B 3D65E 1GBLA 2Q6GA 1D4PB 2B5TB 1O3LA 3MU0A 1RTKA 1SGCA 3BEUA 1C1MA 1YCPK 1QBVH 2BY7X 1NS3A 3RXBA 5GWZA 4TWYA 1C5WB 1T4UH 3MH5A 3SUEA 2IPHA 2ZTXA 1H1BA 3V0XA 1GJAB 1N8OB 3ELAH 4JZDH 2VIWA 6CHAB 3QLPH 1GHVH 1YC0A 1B7XB 1C5QA 1L4DA 1HGTH 1HXEH 2BLVA 2CHAC 4CHAB 3ZVAA 1NROH 1CU1A 1OX1A 3A87A 3HGNA 1GMDG 2FM2A 5EPNA 3VB5A 3MFJA 4WMDA 1Y3UA 2JH6D 1V2UT 2Y7ZA 2AIQA 3QGNB 2NU1E 1GBDA 2IJOB 3WY8A 3PTBA 2ZFTA 1Y59T 4D76A 4AX9H 3ZYEA 1OWEA 2NU4E 1CGJE 2STBE 2AIPA 1AVGH 1JRSA 1GL1A 1FPCH 1UK3A 1G3DA 1Y3YA 4O3UA 6ESTA 1LKBA 5G4BA 3M36A 2BLOA 4ASHA 1AMHA 1ZLRA 2GT8A 2SGPE 1Y5UT 2CF8H 1SGQE 1A3BH 3SJKA 3ZVDA 2PSYA 2Q6DA 4GHQA 1OWKA 4K1EA 2QY0B 4FUDA 3ZZAA 1PPCE 3A8DA 3RU4T 1CBWB 1O3FA 4NIWA 1C1SA 2R2WU 4RKOB 1HIAA 1N1LA 3ODFA 4YT6H 4NWLA 4LXBH 4NWKA 1SGDE 1OP0A 4JK6A 2AEIH 3TK9A 5DP4A 1BUIA 2CHAB 3MU1A 2A7JA 3GCHC 4TPYA 4GUXA 1V2JT 1CHGA 1O3AA 4NSYA 5J4SA 1L1GA 1BJUA 3VB4A 1FDPA 1NM6A 3RP2A 1Z6JH 4YM9A 4OS4A 4DIIH 5DG6A 2SGDE 4SGAE 1IHTH 1EAIA 1P3EA 1W3CA 1KXBA 2TRMA 2OCVB 1MAXA 2XC4A 1TMBH 1VITG 2P59A 3ENSB 3MU4A 4ISNA 4Y79A 5ESBA 1L2EA 2BB4A 1UJ1A 2RG3A 1P01A 1MAYA 1S6FA 3MNXA 4WWYA 1ZZZA 2R3UA 4YZUA 4YLUA 1AE5A 1PJPA 2PW8H 4GPGA 2PSXA 1MCVA 3LJJA 3UUZA 1TWXB 1AGJA 2P93A 4DT7B 3M3TA 2AERH 3BTTE 4ZKSU 3ZVGA 4AOQA 1HJ9A 1GJ7B 1TALA 2FTMA 3SJIA 1D3TB 1HFDA 4BNRA 1GJ4H 3LJOA 1IQKA 1ANDA 4TY7A 4B71A 4B2BA 1FMGA 1HAOH 3SV8A 1QHRB 1YF4A 4MPVA 3D62A 1TPOA 2FOHA 1E0FD 1AD8H 3RC4A 3GCHB 1ARBA 3W94A 1OPHB 3RLWH 3LONA 4GVUA 3LGVA 1S82A 4K8BA 1V2LT 2YNAA 1HAVB 3ZZ9A 3NK8A 4NGAH 1HRTH 1P2OA 1VJAU 2BVSH 2ZFSA 1UVTH 1QL8A 4TY6A 3ZYDA 2Z9JA 1DWCH 2H5CA 1K28D 4IS5A 2OTVA 1AWHB 8GCHG 2BM2A 1BA8B 1NU9A 2FDAA 1F0RA 3LC5A 4ISLA 1GJ8B 1C1TA 4AGKA 3TGKE 1O37A 1P57B 1A4WH 2FOGA 1MUEB 2GP9B 1TX7A 3TH4H 2NU2E 3SI3H 3UNRA 3LU9B 1GGDC 1E36B 5I25A 1QB1A 2OUAA 2F83A 1EUFA 2FI3E 1K1LA 2GCHG 1QGFA 1N6XA 1SGFA 2VINA 1DY8A 1O2VA 1VJ9U 2ZC9H 3QTOH 3GYLB 4CRGA 1DT2A 3NZIA 2UUJB 3P8GA 1V2ST 4FU7A 3RMLH 3RXQA 3URCA 3A8AA 2ZPRA 5LPEA 3O8BA 1UVSH 2Y82A 3ZVCA 3MNBA 2HNTC 2BD4A 2ODQA 3EE0B 1ZHPA 1DX5M 1PPZA 1ZOMA 1YPEH 1UVOA 1ANBA 1GJ5H 4NZLA 5CE1A 2HPQH 3QWCH 2C3SA 2ZCHP 1HAPH 2VIDA 2ZP0H 1UTJA 1GPZA 1KLJH 3AW1A 2BY9X 2ESTE 1DVAH 2G4UA 1UK2A 1T32A 2ZI2H 1NC6A 4FVDA 1QRZA 2ZFPH 1NN6A 3JZ2B 2BD7A 1XM1A 2ZGHA 1KSNA 1P12E 2WPIS 2A0QB 3BF6H 3L33A 1GMDF 3KEEA 1GHZA 4JZEH 3HGPA 2W7UA 1TFXA 1GDQA 1O38A 1GI2A 2A4GA 5FCRA 2SGAA 3S9AA 2ZHQH 3M5MA 1JIRA 3LGIA 2GD4B 2QXHA 1GGDB 4FU8A 5HGGA 3ZZ8A 5C5NA 1UTMA 1V3XA 2F9NA 4BOHA 1INCA 2VIPA 1ZMNA 3BTHE 1IHSH 1BITA 3EQ0H 2ZQ2A 4UFGH 1D9IA 2B9LA 1SLXB 3RXIA 1L4ZA 4D9RA 1OP8A 4B75A 1LVBA 2OD3B 3E8LA 4XBBA 3TK6A 3R3GB 3GCNA 2XBYA 3VXFH 2BZAA 2P16A 2W7SA 1O2IA 5FPSA 1A0JA 3GY8A 2FI4E 2FOEA 1BMMH 2D2DA 1AI8H 2QC2A 3K6YA 1C5PA 5A8ZA 2NU3E 1EZUC 1V2TT 1TGCA 1WBGB 2ZGCA 2OBQA 4ZKOU 4BXWA 2VB0A 1D6WA 1Q3XA 1HXFH 2JKHA 1SL3A 3C1KA 3GDSA 4FUBA 3M7TA 3IITA 2G52A 1J15A 4M7GA 3QTVH 4A7IB 1PFXC 1RTLA 1GMCF 1ZSJA 2XC0A 1Y8TA 1LVYA 1FXYA 2GTBA 4I33A 2EEKA 1FY8E 3MI4A 4WY3A 4PROA 3BTME 3A7WA 5AF9H 1A5GH 3A81A 3RXFA 5CHAB 3QK1A 3SORA 3K9XB 2HNTF 1SSXA 3UIRA 4BAQB 1C5MD 1GJ6A 4MPWA 2BD8A 2FODA 1V2QT 3GDVA 2ANWA 2FMJA 1UTPA 1SQOA 4X6OA 4INKA 1OWDA 2BDHA 1GI5A 1O3EA 2IOTA 2XWAA 1DOJA 1IQGA 4ABAA 3TGIE 3TK5A 2BDIA 1VCQA 1XVMA 3MO3A 1C2FA 2Z9KA 1THPB 1O36A 1FY4A 2FXRA 3LKWA 2A5IA 1OWJA 3U69H 4BAOB 4X1SU 4X1PU 1AIXH 2Y80A 2GMTC 1ELVA 5FHTA 1UVPA 1WUNH 2BOHB 1TRMA 1CQQA 2Y5FA 2ANYA 3A83A 5AFYH 5LGOA 1PQ7A 5HYOA 2XBVA 1FY1A 4JYVH 2WUCA 1ELBA 5K7RA 1GG6C 4NA7A 2CJIA 3B23B 3QO6A 1PPGE 2G00A 2PLXA 2V0BA 1TA2A 2IN2A 2A2XH 1F5KU 1AB9B 1YBWA 4CR5A 1MU6B 3P8NA 3STIA 5IDKA 4A1TA 1BRBE 1TNGA 3ZZ3A 4GHTA 1CVWH 3KF2A 1SGYE 1LQEA 1Z8IB 1O3PB 1O3KA 4B76A 5A8YA 4MNWA 1O3JA 3MYWA 4YTAA 1ZSKA 1AWFH 3T25A 3E1XB 4OS6A 5FAHA 4JZ1A 2LPRA 1SLVB 3HKIB 3F9FA 1ELCA 1NRRH 3ZVEA 3GY7A 1W0ZU 5ESTE 8GCHF 1EX3A 2ILNA 2FP7B 1V2VT 4QT8C 1MCTA 5I46H 1WCZA 1ZSLA 1LTOA 3SUGA 1QA7A 2GZ7A 1KDQB 1BTWA 2F91A 2GX4A 4ZXYH 1C2LA 3F68H 2PGBB 2ZEBA 3B8JA 2C8ZB 1H9LB 4I8JA 1D3QB 2GMTB 2GCHF 3MNSA 4K1TA 2VGCC 1C2JA 3KNXA 1IAUA 1A2CH 4RKJB 5C5OA 1O2SA 3SZNA 1GG6B 1ZPZA 2FOBA 1QBNA 1O5GH 4NA9H 1K21H 2Z3DA 2ODYB 1HAGE 4GCHG 4Y6DA 2C8WB 1VITH 3F9GA 2A1DB 3OTJE 3PMAB 1NPMA 1QJ1B 2FLRH 3EA7A 1YPHC 1ABJH 1K1PA 1GHAG 2R3YA 1HPGA 1Y5BT 2GGVB 2AMDA 1HJ8A 2JETC 3RXSA 2ZU4A 3S9CA 1GJ9B 2BYAX 1TBQH 1TABE 5EODA 1DLEA 3E0NB 1V6DA 1AUJA 2XCNA 4IC5A 4X6MA 1EP5A 2QYIA 1A61H 1IQNA 3S7KB 1Y3XA 5FPTA 5JDUB 1P02A 2BTCE 3RXEA 1A46H 3MO6A 4OS7A 4X8SH 1E38B 2RDLA 3FFGA 1EPTA 4DURA 1IQMA 2A45B 3VFEA 2ZDAH 4CRDA 1ETTH 2QV1A 2FOCA 3SV7A 1ZHMA 1ESBA 1QQ4A 4H6TA 3ITIA 1KLTA 4OS5A 2BQWB 1WOFA 3S69A 4I31A 1NESE 1NU7B 4FU9A 1QR3E 2GZ8A 2F3CE 3UREA 1VCWA 3RXPA 2OLGA 2ZGBH 1P03A 3FP7E 2VVCA 2PKSC 4A92A 2I6QA 1RJXB 1ZPBA 4AN7A 1MBMA 1SR5C 1TIOA 2J94A 2P3UB 2VGCB 4J1YA 1MZDA 5E8EH 1AVXA 3PV4A 3FP6E 1XUHA 1RD3B 1C2IA 1V2WT 5EQSA 1DXWA 1T7CA 2FEQH 1G3CA 1HJAC 6LPRA 1RRKA 1WAYB 3QZQA 1GBKA 2UUFB 2UWOA 3K2UA 3KIDU 1C5VA 4AZ2B 1EZQA 2H6MA 3UOUA 1IOEA 3MWIU 2BQ6B 3BG8A 1ELEE 1FN8A 2BLWA 3DD2H 4BTTB 2TIOA 2QXGA 2JETB 1BMAA 4FUGA 1O2PA 2PWXA 3A82A 3VB7A 3DT0H 5DGJA 2XCFA 1BIOA 1AN1E 4K69A 1WU1A 3QX5H 3M5OA 1WTGH 1DM4B 1FY5A 4DJZB 4WVPE 5BPEA 1ZMJA 4TWWA 3OU0A 4NZQA 2BHGA 1W8BH 1CHOG 1BQYA 1DLKB 4ABHA 1O2YA 1SGPE 2A32A 2P8OC 2XYAA 1HDTH 3VXEH 2J92A 2Z6BD 3BTEE 3KGPA 2H9EH 1GHXH 4Y7AA 4ESTE 4IC6A 1MZAA 1C2MA 1P2KA 1MKXH 2PKSB 3BG4C 1LVOA 2AS9A 5F8XA 4Z0KA 2BLQA 4FUJA 1JMOH 1C9PA 1TLDA 4FVBA 1SOZA 1W7GH 1B0FA 3FZZA 3ZVFA 4B1TA 4F4OC 3SNEA 5C3NA 3GY2A 4I32A 5DJ7A 1JWTA 1UHBB 5B6OA 3SQEE 1KXFA 1K1NA 1S85A 3BTDE 4YOIA 3RM0H 1HJAB 4HI3A 2AMQA 1HV7A 3DHKH 1TPSA 1GBFA 1BTPA 3ZZDA 1TPAE 2VVVA 2ZCKP 1FIZA 1D6RA 1FN6A 4NIYA 1FQ3A 3HATH 5AFZH 4K8YA 1CT2E 1XUKA 2Z9LA 1C9TA 1O2TA 2ZTYA 1RIWC 2LNCA 3LIWA 5IYTA 3UTUH 5H4IB 1IQEA 3R0FA 3NXPA 5HMAA 5TCAA 1EJMA 4U2WA 4X1QU 1C5LH 3RMMH 3URDA 1GBMA 1TE0A 2ZF0H 3SUDA 4E7NA 3E6PH 2KAIB 1QRXA 3RXRA 1ZRBA 1QB9A 1SVPA 1BCUH 1G30B 1LHDH 5T6GA 3BTGE 5F03A 4UFFH 3UWIA 1ESAA 2HLCA 1JXPA 1GJDB 2O8LA 1BTHH 2WPJS 2P8OB 5JB9S 2WPMS 1P09A 4NFEA 3P6ZB 2C90B 2EC9H 1C1NA 3MHWU 3PWBA 1L0ZA 2FLBH 3BG4B 1SMFE 1X7AC 2WV4A 1ACBE 1S5SA 1OP2A 5ABWA 1NRSH 1TGNA 5T3HA 3RXJA 5C1UA 2AYWA 2HRVA 1GI7B 2A4OA 4YESB 1PQAA 5L6NH 3SNAA 1F0SA 7ESTE 1O2NA 5BRRE 2A31A 4NFFA 1PYTC 3E91A 1THSH 1NZQH 5L2YH 2V3HH 2GZ9A 5EW2H 3RXHA 3CENA 1FUJA 5FPYA 3P17H 2OQUA 4ABIA 3RXTA 3O8RA 3P8OA 4XBDA 3SUFA 1BTYA 2VIOA 4UE7H 1WYKA 4U32A 1RIWB 2EI7A 2PUQH 3KQDA 4I8HA 4KTUA 1GBHA 2A7HA 2W5EA 2Z3EA 1H9HE 2BDBA 2AGEX 1A0LA 4ISHH 1DSTA 1EJNA 1H8IH 4XOJA 3T62A 5DP3A 1ELDE 1XXDA 1ZYOA 2XBXA 1K2I1 3RXDA 4GAWA 4GCHF 1MQ5A 3QGJA 1P9UA 1YPMH 4MVNA 1O3HA 3SU0A 2BDYA 4AB9A 4DG4A 1L1NA 2G8TA 4KGAA 5C2ZA 1AKSB 1GHAF 3GY3A 4AG2A 4R0IA 4B2CA 1KXCA 3QZRA 5F6MA 3GOVB 3NPSA 4B73A 1DUAA 1IQFA 1DFPA 4GSOA 1P06A 1KXEA 5DK1A 1V2NT 3SN8A 1QTFA 2PKAA 1W11U 4WJG2 1XX9A 3GCTG 6GCHG 1HAZB 1C1PA 1BBRE 4FUEA 4LOYH 7GCHF 2A7CA 3PTNA 3MH7A 1O33A 2QXJA 1QBOA 3GISB 1DWBH 1P2IA 1QURH 3SV2H 1C2HA 2QXIA 8ESTE 3VGCC 1OS8A 4DGJA 2SNWA 2BY8X 3DUXH 5A0AE 1HNEE 4AORA 4DOQA 4D7GA 2FX6A 3LDXH 5AHGH 1OWHA 4ZH8A 2VWOA 1ZRKA 2ZU5A 3VEQB 1QL7A 3K65B 1BTXA 5FX5A 1TB6H 3RC5A 2ZG0H 2GT7A 1EKBB 3BIVH 3VB6A 3TNTA 2VH0A 4HFPB 2Y5HA 1K1MA 2QIQA 3LH1A 1J9CH 1SB1H 5GJ4B 3UY9A 1ZJDA 1JRTA 4IN1A 1O5DH 4NA8A 2STAE 3ODDA 4X8VH 3LH3A 1FJSA 1YPGH 1WQVH 1C5TA 2V6NA 1GI4A 4ABGA 4HTCH 1NT1A 3U8RH 5EGMA 2P3FH 2CF9H 3JZ1B 4OGYA 1GI8B 1GBCA 2HVXA 1XMNB 5CHAC 3T26A 1KTSB 1JIMA 4INHA 4JYUH 1ELFA 1TRYA 1TA6A 1WV7H 3UR6A 4Q2KA 2VH6A 2HALA 1M9UA 5JPMH 1YP9A 5L30H 1SFIA 5GIBA 3Q3XA 1DS2E 3BTWE 1YLDA 3N7OA 1EAUA 3VGCB 5JBBS 1CHOF 4X1RU 1Y5AT 1FPHH 1Y3VA 4UONA 3PLBA 1QFKH 2OC1A 1UCYE 3KHVA 3TGJE 5GCHG 4CRAA 1K22H 3RXKA 3A7YA 1T8OA 4Y0ZE 2A4QA 2FOMB 4WF8A 1IQHA 1BTUA 2PHBA 2ZPSA 4UFEH 2ZHDA 1P05A 1ZPCA 1BTZA 2CMYA 4MNXA 4FUFA 4GLYA 1Z8RA 1F92A 1GBAA 5JBAS 2XW9A 1GI0A 3M35A 4ABJA 3V12A 3SNDA 1UTLM 4KKDA 4H6SB 1BMNH 3U9AH 2FI5E 1A5IA 2DE8A 2ZO3H 1SLWB 5FBEA 2FZZA 1Z8GA 2M5TA 1AO5A 2VIQA 3T29A 2GV6A 4FUIA 1TBRH 2WYGA 4AFUA 3TU7H 4D8NA 2H9TH 2ZKSA 4IW4E 1ZJKA 4ZMAH 1Y3WA 3SU3A 2PFEA 5EOKA 7KMEH 1AB9C 4Y8YA 3SNCA 5JB8S 5HM2A 2ZU3A 3F9EA 1Z7KA 1GHWH 3MNCA 5E2OA 2O8TA 3SQHE 1YM0A 1O3MA 3RXLA 3T27A 5A0BA 3RU4D 1A3EH 3ZZ5A 5LPRA 1EB1H 1PQ5A 1UMAH 1GBBA 3NUMA 1C2EA 3V13A 5EPYA 4X2YA 2V35A 1ZTJA 1ZTKA 3RMOH 1KTTB 2VU8E 2FTLE 3TJOA 1BZXE 1O5CB 3PROA 4ZKRU 5EXNA 3BV9B 4X6PA 2AMPA 1D3PB 3ZZ7A 2HPPH 3RXOA 9ESTA 1SGFG 3EA9A 3ZVBA 4ABBA 4MNVA 3STJA 4E05H 1VITF 1S81A 5E0GA 3MH6A 5DP9A 1VZQH 3AVZA 2ZDMA 1Z71A 1ZHRA 1EQ9A 1TOCB 4LZ1H 3UNQA 1KY9A 4MDSA 1C5XB 2WPLS 2XXLA 4ISIH 2ZGJA 2QCYA 3UWJH 3H7TA 1K1IA 4MG3A 2FYQA 3I78A 3SV9A 4AFSA 3T5FH 5DP8A 3IWMA 1O31A 1O3OA 1T8LA 3PO1C 1FZZA 2PTNA 2EA3A 1GWAA 1SGIB 1YGCH 3GDUA 2PTCE 1C4V2 2OINA 1TPPA 3RDZA 2SGFE 3A8CA 2SGQE 2ZHEH 1O3GA 3AAVA 3FANA 1BDAA 1LO6A 2W26A 1TMTH 8LPRA 5TJXA 3GICB 1C1QA 2GCTB 3EGKH 3MO9A 2FX4A 5C1YA 1O3IA 2ZHWH 3ATWA 1DE7H 3BEIB 1OYQA 1TX6A 4Q7YA 2FOFA 3H5CB 3QUMP 1FAXA 3H7OA 1LHGH 3E90B 1HIAB 4CRCA 2CGAA 1BRAA 2Z7FE 1C1WH 4Y76A 1EAXA 4WXIA 1YPLH 2TGDA 2A4RA 1C1UH 3K6ZA 4I8LA 1HCGA 3OYPA 5EQRA 1LHFH 2UUKB 1GBTA 4B2AA 5DP7A 2H1UA 3FZDA 3OY5U 1IQIA 3SGQE 3GY6A 1PPFE 2CXVA 1Q31A 2W3IA 1PQ8A 9LPRA 2VJ1A 3GCTF 5E0JA 4IMQA 3RUOA 4NIVA 1F5LA 3CP7A 2AH4X 4X8UH 4YT7H 5CMXH 1QNJA 1J16A 2R0KA 1FY3A 2Y5GA 1RFNA 2GV7A 1MH0A 3MU8A 4X8TH 1S83A 2WV5A 4Y7BA 1ZGVA 3G01A 3TH3H 2WPKS 1MBQA 1VR1H 2ZFQH 3PO1B 1LPKB 4IGDA 3SHAH 3LOXA 4AB8A 1EZXC 1ELTA 1G2LA 2ASUB 3SGBE 1O3CA 1Z1JA 1GDUA 1O2JA 1LVMA 4D7FA 1F0UA 1G37A 5E2PA 1O2ZA 1O35A 1SBWA 5LH8A 1OYTH 3LGUA 2R9PA 3B9FH 1O2HA 1J17T 2R2MB 3UR9A 4X2VA 1GBJA 3NKKA 4FXGH 1KYNA 3SHCH 4ABEA 2TBSA 4MNYA 1TGTA 3PMJA 1GI9B 3A80A 3DA9B 1GI6A 2H5DA 1GL0E 1TYNA 2CV3A 3SU1A 1HUTH 3MOCA 4WH6A 1DDJA 2ZCLP 1Z8JB 1AU8A 1WTHD 4VGCC 5DPAA 2ZU2A 1W0YH 1C5NH 1LKAA 1CA0C 2J95A 1SFQB 1DY9A 2BDAA 1YCPM 1RGQA 1G3BA 3BEFB 4BXSA 3SU5A 1OXGA 4WXVA 1VGCC 2QF0A 1E34B 3CS7A 3RXCA 1TGSZ 1G32B 5DP6A 2F9PA 1XKBC 4Q80A 1SPJA 3RM2H 4BAKB 5L2ZH 3A85A 1QY6A 1P0SH 3A84A 2A5KA 3SU2A 1RS0A 1S0RA 2TGAA 3E0PB 1SC8U 5FXLA 1ETSH 2XC5A 1GVZA 2ZDVH 2ANKH 7LPRA 4DY7B 3DFLA 4AFZA 4INLA 3QDZB 1TBZH 1NY22 2BMGB 2XTTB 1QB6A 4LK4A 3ZZ6A 2SNVA 5EXMA 1S0QA 1TGBA 2QF3A 1A5HA 1S84A 1UTQA 4YOJA 2ZWLH 2AGIX 2BY5X 1C2GA 2C4FH 3SOSA 1GHYH 1QRWA 2RA3A 1NO9H 1TMUH 4J2YB 3VB3A 3M7UA 1AE8H 1BMLA 1LDTT 1UTNA 1U6QA 4VGCB 4CBNA 1NFWA 1CGHA 1AFEH 1MKWH 1YPJH 3L6PA 4TPIZ 1DICA 1BRUP 1ELGA 3Q3KA 3M5LA 4B74A 1QL9A 1CA0B 1YPKH 2BOKA 3A7VA 1G3EA 1K1JA 5SGAE 2BD9A 1YLCA 2YNBA 1VGCB 1O5BB 1T8MA 2VWLA 1MTWA 2O9QA 1AZZA 3RU4E 1W2KH 1TNIA 4I7YH 3Q77A 4Y0YE 4O9VA 2B8OH 3M3VA 1CSOE 1XUIA 1UVUH 2HNTE 1P9SA 2ZZUH 1E37B 4XE4A 2W3KA 5FBIA 1K9OE 4KP0A 1A1RA 1DSUA 1BBRH 4Y10E 1TONA 1GJBB 2ZU1A 2HGTH 3RLYH 2XRCA 3ATLA 3O8CA 1GCDA 3UQVA 5T6DA 4OS1A 3FAOA 1FAKH 1TQ7B 2C93B 1BJVA 3BTKE 2R0LA 2ANMH 2AGGX 3Q76A 3IG6B 4H4FA 1GBIA 4JYTA 4MTBA 3LGTA 1B0EA 1ZMLA 1JBUH 3SGAE 1AFQC 3F9HA 3MTYA 1CGIE 2P3TB 3BSQA 4UDWH 2EI6A 3EDXB 4A1XA 1MTSA 2RCEA 4K3JA 4ZHMU 1MU8B 1DUEA 3PMHB 1QJ6B 1GMCG 1AZ8A 2OC0A 1FONA 1MKWK 1O2MA 2OC8A 1KDQA 1MD8A 2G51A 5C67A 2O8UA 4A1VA 4BAHB 3NCLA 2BXUH 1DWEH 3OY6U 3ZV9A 1MKXK 1PPEE 2ZIQH 3Q00A 3QN7A 3S9BA 1C1OA 3S0NA 3TPIZ 2H2ZA 5EQQA 1ETRH 1XUFA 4XSKU 1LHCH 1XXFA 3F6UH 2DUCA 3HK6B 4BTIB 2UWLA 5A2MH 2ZFFH 4YLQH 4Y8XA 5HXFA 5ETXA 1NFXA 1KLIH 2VIVA 1ZTLA 4X0WU 1O32A 3ATKA 1BBRK 2DE9A 2QGRA 3SBKA 2FWWA 5K0HA 4KTSA 5JBCS 3A7ZA 4AGJA 3GYMA 1J8AA 3RXUA 1HB0B 2ZTZA 3TITA 2OXSA 3UQOA 1EP6A 4XFQA 4I8KA 3UPEA 1DITH 4HZHA 3OSYA 1UCYH 1WSSH 2ZA5A 4BANB 1OOKB 1OSSA 2Z9IA 1KXAA 3LGWA 1C5ZB 4CH2B 3O8DA 2XNIA 4OGXA 4CR9A 1AFQB 3KL6A 3HKJB 5T6FA 3AAUA 4MLFB 2ZFRH 1A0HB 3S7HB 1F7ZA 3RXGA 4BAMB 4X1NU 4X2WA 1HBTH 2BQ7B 1T8NA 3KCGH 1GJCB 4E06H 5PTPA 2ZDNA 3OX7U 1BB0B 1T4VH 4CREA 1GHBG 1W12U 3U98H 4RN6A 4Y11E 5EXLA 5FCKA 4CH8B 1O2XA 3P92A 1C5OH 2BVXH 1NFUA 3E16B 1OWIA 1C4U2 2BX4A 4O3TA 2ALPA 3A8BA 1ID5H 2SFAA 1GMHG 4RSPA 3RC6A 2FYRA 4SGBE 3U8OH 2ZNKH 3VPKA 2I6SA 2TGTA 1UTKA 1O2GH 1XUGA 4JK5A 2FS9A 4IBLH 4ZKNU 1XUJA 2G5NA 2ZGXH 1G36A 3MH4A 3P8FA 4ZHLU 1GI3A 1VCPA 2UUYA 3CS0A 1C2KA 4WMFA 4NCYA 1SGNE 2FESH 5EW1H 2G4TA 3L3TA 1EB2A 1DWDH 2J9NA 3LGYA 4Y8ZA 1UCYK 1W10U 3AASA 4AYYB 1SG8B 4LZ4B 3TLOA 1EAWA 3KQBA 3UFAA 4KELA 4ZROA 4Q7ZA 2F9VA 3SI4H 4UEHH 1EPTC 3TJVA 1P8VC 2J38A 1AQ7A 1SGEE 5J4QA 5A8XA 5DP5A 3RXAA 3HPTB 4Y71A 1GVLA 2C8YB 2ZQ1A 4X6NA 4XBCA 2F9BH 1ANEA 1ABIH 1MD7A 5LPFA 4K1SA 1P04A 1HAXB 1MTUA 1CE5A 2HWLB 1F5RA 4Z6AH 3M61U 2ZDKA 1H8DH 8KME2 1FV9A 1PYTD 1OKXA 3PYHA 1RXPA 2SGEE 3TVJB 3ATMA 1UHBA 1LPZB 2GDEH 4FUCA 1ARCA 4ABDA 5A09A 3E3TA 1V2OT 5A0CA 1TNKA 2J2UA 3FVFB 2FOAA 1EJAA 2THFB 1N6YA 2RA0A 1NFYA 3RXMA 3SU6A 2VVUA 3ZV8A 1O5FH 2A5AA 4ZUHA 1ANCA 4IMZA 1NRQH 2ALVA 3BTFE 1EXFA 1V2PT 1F2SE 1O2QA 3V3MA 5F8TA 1UTOA 4ZXXH 4NG9H 4AG1A 3NWUA 1S6HA 4FUHA 4X2XA 4BTUB 3SW2B 4CRFA 4JCNA 4A6LA 4JMYA 2ULLA 1W14U 4UFDH 1O2OA 1ZGIA 1IQLA 2PR3A 2VWNA 1EPTB 2OC7A 1YPHE 2F9OA 2KAIA 1GDNA 1SHHB 1V2RT 5C20A 2C8XB 2CN0H 3PB1E 1P2QA 1TOMH 5EU8A 1O5AB 5FX6A 3U8TH 1A7SA 2K1QA 5TCCA 1Z6EA 2GDDA 2WYJA 3DFJA 1O30A 1O2RA 3UOPA 3MU5A 2GCTC 3M37A 2BD5A 3T2NA 1PPHE 1DXPA 4ZAEA 1LQDB 1DPOA 2P94A 2OQ5A 2WPHS 2BX3A 1O3NA 1UK4A 2JH0D 1UO6A 1NRNH 2JH5D 2ZHFH 1P11E 1EOLA 1CO7E 5HM9A 1D3DB 1O39A 4YO9A 5DO4H 1C5YB 1QQUA 3U1JB 4XDEA 2G5VA 4THNH 1LPGB 1BRCE 1TNLA 1YKTA 1HAYB 1P3CA 2VNTA 1HYLA 1SQAA 3PLKA 3BN9A 3UNSA 2G55A 4O03A 1GCTC 2Z9GA 4F49A 1H4WA 3HK3B 1ZR0A 1O2KA 1O3BA 1SGRE 4DVAU 1CT4E 2BD3A 4NIXA 1GBEA 3F1SB 3SO3A 4R8TB 5GXPA
chains in the Genus database with same CATH superfamily
2WHXA 1TAWA 1O2LA 3W95A 1FI8A 2ZECA 4YXWD 1C5RA 2WINI 1Q2WA 1AUTC 1W7XH 1HAVA 4B6FA 1HAIH 1QCPA 1P10A 3A88A 5E0HA 1LMWB 1TNHA 3SJOA 2BY6X 4JZFH 4K60A 4ZHAA 2Q1JA 1GI1A 3OEED 4UD9H 3V7TA 1AKSA 3KQCA 2ZPQA 1ELAA 3I29A 5JYIA 1QIXB 2D26C 3RMNH 3D23A 2NU0E 2J4IA 4CRBA 5C1XA 2AFQB 1BOQA 1V2MT 1MMJN 1H9IE 1FIWA 1MTVA 2D8WA 3AK5A 1O3DA 4DIHH 2Z3CA 3N7DA 1O2UA 3Q3YA 3SNBA 3M7QA 1THRH 3MMGA 2ODPA 1C2DA 2GVFA 2P95A 1NTPA 3A7TA 1G2MA 3T28A 4HGCA 2OBOA 1T31A 3UB0A 3A7XA 4DCDA 1IQJA 1BHXB 1JOUB 1FX0B 1O5EH 3PLPA 2D1JA 4Q7XA 2FS8A 2OP9A 1TRNA 1QA0A 3KN2A 4ISOA 1HLTH 4JZIA 2WUBA 1V2KT 4U01A 2Y7XA 1MTNC 1P2NA 4A5TS 1GHBF 2GKVE 2FIRH 5GDSH 4KTCA 3ATIA 1SQTA 2Y81A 1C4Y2 1J14A 3WWFA 1GCTB 2B0FA 3PWCA 3ZZ4A 1GMHF 3KQEA 1TQ0B 6GCHF 3TJNA 3TIUA 1ESTA 2G81E 3M3SA 1HAHH 3FP8E 1K1OA 3TJUA 1B5GH 1LCYA 3SU4A 3ZZCA 1XVOA 2QAAA 4MQAA 1SOTA 3TH2H 1C1RA 1KIGH 1Z1IA 1TX8A 2EI8A 5EJLA 2FPZA 4WH8A 1XKAC 3GY5A 2VWMA 2OK5A 3ESTA 5AVDA 3AW0A 3P70B 3A86A 1BHXF 2PV9B 3SJ9A 1SLUB 2AHME 1G9IE 3A89A 1AY6H 1P2JA 1EATA 2BDGA 1P2MA 3GCOA 5JBTA 3EA8A 2PUXB 2XBWA 1O0DH 4AYVB 1MQ6A 3PM3A 3EAJA 1W13U 5EG4A 1PPBH 4OS2A 1EASA 2FO9A 3LC3A 5B6LA 2QF5A 1E1RD 2NWNA 5GPIB 2BZ6H 1L1JA 2Y6TA 2KFWA 2QN5T 4D9QA 4AFQA 1YCPH 2O8WA 2YOLA 2WV9A 1SHYA 1ORFA 1NRPH 2KCPA 1N8OC 6CHAC 5F8ZA 4O97A 1CT0E 1LHEH 1C1VH 2F9UA 4IN2A 4MPUA 4Z1MD 3D49H 2BVRH 1BT7A 1SGTA 4CHAC 1KMHB 1GVKB 1MTNB 1SI5H 4WMEA 2BDCA 2VBCA 2Q6FA 1AHTH 4H42U 3KYGA 1FNIA 4ABFA 1E35B 2XWBI 1DANH 3I77A 3BTQE 4MPXA 4I8GA 1WQSA 2Z94A 1YYY1 7GCHG 1AVWA 4F48B 1C5UA 3ZZBA 3PMBB 5DKMA 2O8MA 3M5NA 3GY4A 1CA8B 2A2QH 3F2FA 2J34A 1EOJA 3P95A 1QJ7B 3LPRA 5C94A 2HOBA 2TGPZ 2V3OH 4CBOA 4TYDA 3U1IB 2H9HA 4DW2U 2QA9E 3SV6A 2UWPA 5C17A 2B7DH 4K2YA 3RXVA 4E7RG 5GCHF 4K5ZA 2ZDLA 1F0TA 4U30A 3TNSA 3LT3A 1KXDA 3SJ8A 3BIUH 1TNJA 4YOGA 1FLEE 2PGQB 1C5SA 1O2WA 2BD2A 1O34A 1EZSC 4NSVA 3EYDA 1CBWC 2PKAB 2TPIZ 2BXTH 1RTFB 3C27B 3D65E 1GBLA 2Q6GA 1D4PB 2B5TB 1O3LA 3MU0A 1RTKA 1SGCA 3BEUA 1C1MA 1YCPK 3F0PA 1QBVH 2BY7X 1NS3A 3RXBA 5GWZA 4TWYA 1C5WB 1T4UH 2PP6A 3MH5A 3SUEA 2IPHA 2ZTXA 1H1BA 3V0XA 3F0OA 1GJAB 1N8OB 3ELAH 4JZDH 2VIWA 6CHAB 3QLPH 1GHVH 1YC0A 1B7XB 1C5QA 1L4DA 1HGTH 1HXEH 2BLVA 2CHAC 4CHAB 3ZVAA 1NROH 1CU1A 1S6LA 1OX1A 3A87A 3HGNA 1GMDG 2FM2A 1NBME 5EPNA 3VB5A 3MFJA 4WMDA 1Y3UA 2JH6D 2W6ID 1V2UT 2Y7ZA 2AIQA 3QGNB 2NU1E 1GBDA 2IJOB 3WWBA 3WY8A 3PTBA 2ZFTA 1Y59T 4D76A 4AX9H 5HKKD 3ZYEA 1OWEA 2JJ1D 2NU4E 1CGJE 2STBE 2AIPA 1AVGH 1JRSA 1GL1A 1FPCH 1UK3A 1G3DA 5EIYA 1Y3YA 4O3UA 6ESTA 1LKBA 5G4BA 3M36A 2BLOA 4ASHA 1AMHA 1ZLRA 2GT8A 2SGPE 1Y5UT 2CF8H 1SGQE 1A3BH 3SJKA 3ZVDA 2PSYA 2Q6DA 4GHQA 1OWKA 4K1EA 2QY0B 4FUDA 3ZZAA 1PPCE 3A8DA 3RU4T 1CBWB 1O3FA 4NIWA 1C1SA 2R2WU 4RKOB 1HIAA 1N1LA 4M9FA 3ODFA 4YT6H 4NWLA 4LXBH 4NWKA 1SGDE 1OP0A 2XOKD 4JK6A 2AEIH 3TK9A 5DP4A 1BUIA 2CHAB 3MU1A 2A7JA 3GCHC 4TPYA 4GUXA 1V2JT 1CHGA 1O3AA 4NSYA 5J4SA 1L1GA 1BJUA 3VB4A 1FDPA 1NM6A 3RP2A 1Z6JH 3N7EA 4YM9A 4OS4A 4DIIH 5DG6A 2SGDE 4SGAE 1IHTH 1EAIA 1P3EA 1W3CA 1KXBA 2TRMA 2OCVB 1MAXA 2XC4A 1TMBH 1VITG 2P59A 3ENSB 3MU4A 4ISNA 4Y79A 5ESBA 1L2EA 2BB4A 1UJ1A 2RG3A 1P01A 1MAYA 1S6FA 3MNXA 4F55A 4WWYA 1ZZZA 2R3UA 4YZUA 4YLUA 1AE5A 1PJPA 2PW8H 4GPGA 2PSXA 1MCVA 3LJJA 3UUZA 1TWXB 1AGJA 2P93A 4DT7B 3M3TA 2AERH 3BTTE 4ZKSU 3ZVGA 4AOQA 1HJ9A 2F4LA 1GJ7B 1TALA 2FTMA 3SJIA 1D3TB 1HFDA 4BNRA 1GJ4H 3LJOA 1IQKA 1ANDA 4TY7A 2M2AA 4B71A 4B2BA 1FMGA 1HAOH 3SV8A 1QHRB 1YF4A 2KCYA 4MPVA 3D62A 1TPOA 2FOHA 1E0FD 1AD8H 3RC4A 3GCHB 1ARBA 3W94A 4TSFD 1OPHB 3RLWH 3LONA 4GVUA 3LGVA 1S82A 4K8BA 1V2LT 2YNAA 1HAVB 3ZZ9A 3NK8A 4NGAH 1HRTH 1P2OA 1VJAU 2BVSH 2EQNA 2ZFSA 1UVTH 1QL8A 4TY6A 3ZYDA 2GJGA 2Z9JA 1DWCH 2H5CA 5KEDA 1K28D 4IS5A 2OTVA 1AWHB 8GCHG 2BM2A 1BA8B 1NU9A 1YLNA 2FDAA 4DT4A 1F0RA 3LC5A 4ISLA 1GJ8B 1C1TA 4AGKA 3TGKE 1O37A 1P57B 1A4WH 2FOGA 1MUEB 2GP9B 1TX7A 3TH4H 2K0QA 2NU2E 3SI3H 3UNRA 3LU9B 1GGDC 1E36B 5I25A 1QB1A 2OUAA 2F83A 1EUFA 2FI3E 1K1LA 2GCHG 1QGFA 1N6XA 1SGFA 2VINA 1DY8A 1O2VA 1VJ9U 2ZC9H 3QTOH 3GYLB 4CRGA 1DT2A 3NZIA 2UUJB 3P8GA 1V2ST 4FU7A 3RMLH 3RXQA 3URCA 3A8AA 2ZPRA 5LPEA 3O8BA 1UVSH 2Y82A 3ZVCA 3MNBA 2HNTC 2BD4A 2ODQA 3EE0B 1ZHPA 1DX5M 1PPZA 1ZOMA 1YPEH 1UVOA 3FN8A 1ANBA 1GJ5H 3DSPA 4NZLA 5CE1A 2HPQH 3QWCH 2C3SA 2ZCHP 1HAPH 2VIDA 2ZP0H 1UTJA 1GPZA 1KLJH 3AW1A 2BY9X 2ESTE 1DVAH 2G4UA 1UK2A 1T32A 2ZI2H 1NC6A 4FVDA 1QRZA 2ZFPH 1NN6A 3JZ2B 2BD7A 1XM1A 2ZGHA 1KSNA 1P12E 2WPIS 2A0QB 3BF6H 3L33A 1GMDF 3KEEA 1GHZA 4JZEH 1UW7A 3HGPA 2W7UA 1TFXA 1GDQA 1O38A 1GI2A 2A4GA 5FCRA 2SGAA 3S9AA 2ZHQH 3M5MA 1JIRA 3LGIA 2GD4B 2QXHA 1GGDB 4FU8A 5HGGA 3ZZ8A 5C5NA 1UTMA 1V3XA 2F9NA 4BOHA 1INCA 2VIPA 1ZMNA 3BTHE 1IHSH 1BITA 3EQ0H 2ZQ2A 4UFGH 1D9IA 2B9LA 1SLXB 3RXIA 1L4ZA 4D9RA 1OP8A 4B75A 1LVBA 2OD3B 3E8LA 3PRDA 4XBBA 3TK6A 3R3GB 3GCNA 2XBYA 3VXFH 2BZAA 2P16A 2W7SA 1O2IA 5FPSA 1A0JA 3GY8A 2FI4E 2FOEA 1BMMH 2D2DA 1VKYA 1AI8H 2QC2A 3K6YA 1C5PA 5A8ZA 2NU3E 1EZUC 1V2TT 1TGCA 1WBGB 5C0TA 2HLDD 2ZGCA 5FL7D 2OBQA 4ZKOU 4BXWA 2VB0A 1D6WA 1Q3XA 1HXFH 2JKHA 1SL3A 3C1KA 3GDSA 4FUBA 2KZ4A 3M7TA 3IITA 2G52A 1J15A 3F2HA 4M7GA 4Q4LA 3QTVH 4A7IB 1PFXC 1RTLA 1H8ED 1GMCF 1ZSJA 2XC0A 1Y8TA 1LVYA 1FXYA 2GTBA 4I33A 2EEKA 1FY8E 3MI4A 3NRLA 1YY3A 4PROA 3BTME 4WY3A 3A7WA 5AF9H 1A5GH 3A81A 3RXFA 5CHAB 3QK1A 3SORA 3K9XB 2HNTF 1SSXA 3UIRA 4BAQB 1C5MD 1GJ6A 4MPWA 2BD8A 2FODA 1V2QT 3GDVA 2ANWA 2FMJA 1UTPA 4OM9A 1SQOA 4X6OA 4INKA 1OWDA 2BDHA 1GI5A 1O3EA 2IOTA 2XWAA 1DOJA 1IQGA 4ABAA 3TGIE 3TK5A 2KCAA 2BDIA 1VCQA 2KX4A 1XVMA 3MO3A 1C2FA 2Z9KA 3PRBA 1THPB 1O36A 1FY4A 2FXRA 3LKWA 2A5IA 1OWJA 3U69H 4BAOB 2KCOA 4X1SU 4X1PU 1AIXH 2Y80A 2GMTC 1ELVA 2YMSD 5FHTA 1UVPA 1WUNH 2BOHB 1TRMA 1CQQA 2Y5FA 2ANYA 2RDEA 3A83A 5AFYH 5LGOA 1PQ7A 5HYOA 2XBVA 1FY1A 5KGOA 4JYVH 2WUCA 1ELBA 5K7RA 1GG6C 4NA7A 2WSSD 2CJIA 3B23B 3QO6A 1PPGE 2G00A 2PLXA 3FO8D 2V0BA 3PV2A 2F43B 1TA2A 2IN2A 2A2XH 1F5KU 1AB9B 1YBWA 4CR5A 1MU6B 3P8NA 3STIA 3UAIC 3CNRA 5IDKA 4A1TA 1BRBE 1TNGA 3ZZ3A 4GHTA 1CVWH 3KF2A 1SGYE 1LQEA 2IPQX 1Z8IB 1O3PB 1O3KA 4B76A 5A8YA 4MNWA 1O3JA 3MYWA 4YTAA 1ZSKA 1AWFH 3T25A 3E1XB 4OS6A 5FAHA 4JZ1A 2LPRA 1SLVB 3HKIB 3F9FA 1ELCA 1NRRH 3ZVEA 3GY7A 1W0ZU 5ESTE 8GCHF 1EX3A 2ILNA 2FP7B 1V2VT 4QT8C 1MCTA 4XD7D 5I46H 1WCZA 1ZSLA 1LTOA 3SUGA 1QA7A 2GZ7A 1KDQB 1BTWA 2F91A 2GX4A 4ZXYH 1WXRA 1C2LA 4RT1A 3F68H 2PGBB 2ZEBA 3B8JA 2C8ZB 1H9LB 4I8JA 3W1EA 1D3QB 2GMTB 2GCHF 3MNSA 4K1TA 2VGCC 1C2JA 3KNXA 2KR7A 1IAUA 1A2CH 4RKJB 5C5OA 1O2SA 3SZNA 1GG6B 1ZPZA 2FOBA 1QBNA 1O5GH 4NA9H 1K21H 2Z3DA 2ODYB 1HAGE 4GCHG 4Y6DA 2C8WB 1VITH 3F9GA 2A1DB 3OTJE 3PMAB 2J98B 1NPMA 1QJ1B 2FLRH 3EA7A 1YPHC 1ABJH 1K1PA 1GHAG 2R3YA 1HPGA 1Y5BT 2GGVB 2AMDA 1HJ8A 2JETC 3RXSA 2ZU4A 3S9CA 1GJ9B 3N99A 2BYAX 1TBQH 1TABE 5EODA 1DLEA 3E0NB 1V6DA 1AUJA 2XCNA 4IC5A 4X6MA 1EP5A 2QYIA 1A61H 1IQNA 3S7KB 1Y3XA 5FPTA 5JDUB 2WPDD 1P02A 2BTCE 3RXEA 1A46H 3MO6A 4OS7A 4FOUC 4X8SH 1E38B 2RDLA 3FFGA 1EPTA 4DURA 1IQMA 2A45B 3VFEA 2ZDAH 4CRDA 1ETTH 2QV1A 2FOCA 3SV7A 1ZHMA 1ESBA 1QQ4A 4H6TA 3ITIA 1KLTA 4OS5A 2BQWB 1WOFA 3S69A 4I31A 1NESE 1NU7B 4FU9A 1QR3E 2GZ8A 2F3CE 2CK3D 2WZQA 3UREA 1VCWA 3RXPA 2OLGA 2ZGBH 1P03A 3FP7E 2VVCA 1COWD 2PKSC 5KECA 4A92A 2I6QA 1RJXB 1ZPBA 2JDID 4AN7A 1MBMA 1SR5C 1TIOA 2J94A 2P3UB 2VGCB 4J1YA 1MZDA 3KYFA 5E8EH 1AVXA 3PV4A 3FP6E 1XUHA 1RD3B 1C2IA 1V2WT 5EQSA 1DXWA 1T7CA 2FEQH 1G3CA 1HJAC 6LPRA 1RRKA 1WAYB 3QZQA 1GBKA 2UUFB 2UWOA 3K2UA 3KIDU 1C5VA 4AZ2B 1EZQA 2H6MA 3UOUA 1IOEA 3MWIU 2BQ6B 1H8HD 3BG8A 1ELEE 1FN8A 2BLWA 2QE7D 3DD2H 4BTTB 2TIOA 2QXGA 2JETB 1BMAA 4FUGA 5F53A 1SQRA 1O2PA 2PWXA 3A82A 3FOAA 3VB7A 2JJ2D 3DT0H 5DGJA 2XCFA 1BMFD 1BIOA 1AN1E 4K69A 1WU1A 3QX5H 3M5OA 1WTGH 1DM4B 1FY5A 4DJZB 4WVPE 5BPEA 1ZMJA 4TWWA 3OU0A 4NZQA 2BHGA 1W8BH 1CHOG 1BQYA 1DLKB 4ABHA 1O2YA 1SGPE 2A32A 2P8OC 2XYAA 1HDTH 3VXEH 2J92A 2Z6BD 3BTEE 3KGPA 2H9EH 1GHXH 4Y7AA 4ESTE 4IC6A 1MZAA 1C2MA 1P2KA 1MKXH 2PKSB 3BG4C 1LVOA 2AS9A 5F8XA 4Z0KA 2BLQA 4FUJA 5DSFA 1JMOH 1C9PA 1TLDA 4FVBA 1SOZA 1W7GH 1B0FA 3FZZA 3ZVFA 4B1TA 4F4OC 3SNEA 5C3NA 3GY2A 4I32A 5DJ7A 1JWTA 1UHBB 5B6OA 3SQEE 1KXFA 1K1NA 1S85A 3BTDE 4YOIA 3RM0H 1HJAB 4HI3A 2AMQA 1HV7A 3DHKH 1TPSA 1GBFA 1BTPA 3ZZDA 1TPAE 2VVVA 2ZCKP 1FIZA 1D6RA 1FN6A 4NIYA 1FQ3A 3HATH 5AFZH 4K8YA 1CT2E 1XUKA 2Z9LA 1C9TA 1O2TA 2ZTYA 1RIWC 2LNCA 3LIWA 5IYTA 3UTUH 5H4IB 1IQEA 3R0FA 3NXPA 5HMAA 5TCAA 1EJMA 4U2WA 4X1QU 1C5LH 3RMMH 3URDA 1GBMA 1TE0A 2ZF0H 3SUDA 4E7NA 5IK2D 3E6PH 2KAIB 1QRXA 3RXRA 1ZRBA 1QB9A 1SVPA 1BCUH 1G30B 1LHDH 5T6GA 3BTGE 5F03A 4UFFH 3UWIA 1ESAA 2HLCA 1JXPA 1GJDB 2O8LA 1BTHH 2WPJS 2P8OB 5JB9S 2WPMS 1P09A 4NFEA 3P6ZB 2C90B 2EC9H 1C1NA 3MHWU 3PWBA 1L0ZA 2FLBH 3BG4B 1SMFE 1X7AC 2WV4A 1ACBE 3SZEA 5EJ1A 1S5SA 1OP2A 5ABWA 1NRSH 1TGNA 5T3HA 3RXJA 5C1UA 2AYWA 2HRVA 1GI7B 2A4OA 4YESB 1PQAA 5L6NH 3SNAA 3ZIAD 1F0SA 7ESTE 1O2NA 5BRRE 2A31A 4NFFA 1PYTC 3E91A 1THSH 1NZQH 5L2YH 2V3HH 2GZ9A 5EW2H 3RXHA 3CENA 1FUJA 5FPYA 3P17H 2OQUA 4ABIA 3RXTA 2K8IA 3O8RA 3P8OA 1WDIA 4XBDA 3SUFA 1BTYA 2VIOA 3F2GA 4UE7H 1WYKA 4U32A 1RIWB 2EI7A 2PUQH 3KQDA 4I8HA 4KTUA 1GBHA 2A7HA 2W5EA 2Z3EA 1H9HE 2BDBA 2AGEX 1A0LA 4ISHH 1DSTA 1EJNA 1H8IH 4XOJA 3T62A 5DP3A 5CHBA 1ELDE 1XXDA 1ZYOA 2XBXA 1K2I1 3RXDA 4GAWA 4AC9A 4GCHF 1MQ5A 3QGJA 1P9UA 1YPMH 4MVNA 1O3HA 3SU0A 2BDYA 4AB9A 4DG4A 1L1NA 2G8TA 4KGAA 5C2ZA 1AKSB 1GHAF 3GY3A 4AG2A 4R0IA 4B2CA 1KXCA 3QZRA 3FKSD 4B6EA 3GOVB 4ZCNA 3NPSA 5F6MA 4B73A 1DUAA 1IQFA 1DFPA 4GSOA 1P06A 1KXEA 5DK1A 1V2NT 3SN8A 1QTFA 2PKAA 1W11U 4WJG2 1XX9A 3GCTG 6GCHG 3DSGA 1HAZB 1C1PA 1BBRE 4FUEA 4LOYH 7GCHF 2A7CA 3PTNA 3MH7A 1O33A 2QXJA 1QBOA 3GISB 1DWBH 1P2IA 1QURH 3SV2H 1C2HA 2QXIA 8ESTE 3VGCC 1OS8A 4DGJA 2SNWA 2BY8X 3DUXH 5A0AE 1HNEE 4AORA 4DOQA 4D7GA 2FX6A 3LDXH 4FETA 1OWHA 5AHGH 4ZH8A 2VWOA 1ZRKA 2ZU5A 3VEQB 1QL7A 2QF4A 3PV5A 3K65B 1BTXA 3GS9A 5FX5A 1TB6H 3RC5A 2ZG0H 2GT7A 1EKBB 3BIVH 3VB6A 3TNTA 2VH0A 4HFPB 2Y5HA 1K1MA 2V3MA 2QIQA 3LH1A 1J9CH 1SB1H 5GJ4B 3UY9A 1ZJDA 1JRTA 4IN1A 1O5DH 2LELA 4NA8A 4P00A 2STAE 3ODDA 2KM0A 4X8VH 3LH3A 1FJSA 1YPGH 1WQVH 1C5TA 2V6NA 1GI4A 4ABGA 4HTCH 1NT1A 3U8RH 5EGMA 2P3FH 2CF9H 3JZ1B 4OGYA 1GI8B 1GBCA 2HVXA 1XMNB 5CHAC 3T26A 1KTSB 1JIMA 4INHA 4JYUH 1ELFA 1TRYA 1TA6A 1WV7H 3UR6A 4Q2KA 2VH6A 2HALA 1M9UA 5JPMH 1YP9A 5L30H 1SFIA 5GIBA 3Q3XA 1DS2E 3BTWE 1YLDA 3N7OA 1EAUA 3VGCB 5JBBS 1CHOF 1SKYE 1Y5AT 1FPHH 1Y3VA 4X1RU 4UONA 3PLBA 1QFKH 2OC1A 1UCYE 3KHVA 4RI0A 3TGJE 5GCHG 1W0JD 4CRAA 1K22H 3RXKA 3A7YA 1E1QD 1T8OA 4Y0ZE 2A4QA 2FOMB 4WF8A 1IQHA 1BTUA 2PHBA 2ZPSA 4UFEH 2ZHDA 1P05A 1ZPCA 1BTZA 2CMYA 4MNXA 4FUFA 4GLYA 1Z8RA 1F92A 1GBAA 5JBAS 2XW9A 1GI0A 3M35A 4ABJA 3V12A 3SNDA 1UTLM 4KKDA 4H6SB 1BMNH 3EE7A 3U9AH 2FI5E 1A5IA 2DE8A 2ZO3H 1SLWB 4RT0A 5FBEA 2FZZA 1Z8GA 2M5TA 2LP6A 1AO5A 2VIQA 3T29A 2GV6A 4FUIA 1TBRH 2WYGA 4AFUA 3TU7H 4D8NA 2H9TH 2IJD1 2ZKSA 4IW4E 1ZJKA 4ZMAH 1Y3WA 3SU3A 2PFEA 5EOKA 7KMEH 1AB9C 4Y8YA 3SNCA 5JB8S 5HM2A 2ZU3A 3F9EA 1Z7KA 1GHWH 3MNCA 5E2OA 2O8TA 3SQHE 1YM0A 1O3MA 3RXLA 3T27A 5A0BA 3RU4D 1A3EH 3ZZ5A 5LPRA 1EB1H 1PQ5A 1UMAH 1GBBA 3NUMA 1C2EA 3V13A 5EPYA 3OTPA 2V35A 4X2YA 1ZTJA 1ZTKA 3RMOH 1KTTB 2VU8E 2FTLE 3TJOA 1BZXE 1O5CB 3PROA 4ZKRU 5EXNA 3BV9B 4X6PA 2AMPA 1D3PB 3ZZ7A 2HPPH 3RXOA 9ESTA 1SGFG 3EA9A 3ZVBA 5T1VA 4ABBA 4MNVA 3STJA 4E05H 1VITF 1S81A 5E0GA 3MH6A 1W0KD 5DP9A 4ACAA 1VZQH 3AVZA 2ZDMA 1Z71A 1ZHRA 1EQ9A 1TOCB 4LZ1H 3UNQA 1KY9A 4MDSA 1C5XB 2WPLS 2XXLA 3KQ5A 4ISIH 2ZGJA 2QCYA 3UWJH 3H7TA 1K1IA 4MG3A 1E79D 2FYQA 3I78A 3SV9A 4AFSA 3T5FH 4ACBA 5DP8A 3IWMA 1O31A 1O3OA 1T8LA 3PO1C 1FZZA 2PTNA 2EA3A 1GWAA 1SGIB 1YGCH 3GDUA 2PTCE 1C4V2 2OINA 1TPPA 3RDZA 2SGFE 3A8CA 2SGQE 2ZHEH 1O3GA 3AAVA 3FANA 1BDAA 1LO6A 2W26A 1TMTH 8LPRA 5TJXA 3GICB 1C1QA 2GCTB 3EGKH 3MO9A 2FX4A 5C1YA 1O3IA 2ZHWH 3ATWA 1DE7H 3BEIB 1OYQA 1TX6A 4Q7YA 2FOFA 3H5CB 3QUMP 1FAXA 3H7OA 1LHGH 3E90B 1HIAB 4CRCA 2CGAA 1BRAA 2Z7FE 1C1WH 4Y76A 1EAXA 4WXIA 1YPLH 2TGDA 2A4RA 1C1UH 3K6ZA 4I8LA 1HCGA 3MQKC 3OYPA 5EQRA 1LHFH 2UUKB 1GBTA 4B2AA 5DP7A 2H1UA 3FZDA 3OY5U 1IQIA 3SGQE 5GNDA 3GY6A 1PPFE 2CXVA 1Q31A 2L6OA 2W3IA 1PQ8A 9LPRA 2VJ1A 3GCTF 5E0JA 4IMQA 3RUOA 4NIVA 1F5LA 3CP7A 2AH4X 4X8UH 4YT7H 5CMXH 1QNJA 1J16A 2R0KA 1FY3A 2Y5GA 1RFNA 2GV7A 2J5UA 1MH0A 3MU8A 4X8TH 1S83A 2WV5A 4Y7BA 1ZGVA 3G01A 3TH3H 2WPKS 1MBQA 1VR1H 2ZFQH 3PO1B 1LPKB 4IGDA 3SHAH 3LOXA 4AB8A 1EZXC 1ELTA 1G2LA 2ASUB 3SGBE 4HG6A 1O3CA 1Z1JA 1GDUA 1O2JA 1LVMA 4D7FA 1F0UA 1G37A 3OEHD 5E2PA 1O2ZA 1O35A 1SBWA 3DSOA 5LH8A 1OYTH 3LGUA 2R9PA 3B9FH 1O2HA 1J17T 2R2MB 3UR9A 1OHHD 4X2VA 1GBJA 3NKKA 4FXGH 1KYNA 4TT3D 3SHCH 2L74A 4ABEA 2TBSA 4MNYA 1TGTA 3PMJA 1GI9B 3A80A 3DA9B 1GI6A 2H5DA 1GL0E 1TYNA 2CV3A 3SU1A 1HUTH 3MOCA 4WH6A 1DDJA 2ZCLP 1Z8JB 1AU8A 1WTHD 4VGCC 5DPAA 2ZU2A 1W0YH 1C5NH 3F3BA 1LKAA 1CA0C 2J95A 1SFQB 1DY9A 2BDAA 1YCPM 1RGQA 1G3BA 3BEFB 4BXSA 3SU5A 1OXGA 2W6JD 4WXVA 1VGCC 2QF0A 1E34B 3CS7A 1EFRD 3RXCA 1TGSZ 1G32B 5DP6A 2F9PA 1XKBC 4Q80A 3OE7D 1SPJA 3RM2H 4BAKB 5L2ZH 3A85A 1QY6A 1P0SH 3A84A 2A5KA 3SU2A 1RS0A 1S0RA 2TGAA 3E0PB 1SC8U 5FXLA 1ETSH 2XC5A 1GVZA 2ZDVH 2ANKH 7LPRA 3DCLA 3DFLA 4DY7B 4AFZA 4INLA 3QDZB 1TBZH 1NY22 2BMGB 2XTTB 1QB6A 4LK4A 3ZZ6A 2SNVA 5HIZA 5EXMA 1S0QA 1TGBA 2QF3A 1A5HA 4I86A 1S84A 1UTQA 4YOJA 2ZWLH 2AGIX 2BY5X 1C2GA 2C4FH 3SOSA 1GHYH 5HIYA 1QRWA 2RA3A 1NO9H 1TMUH 4J2YB 3VB3A 3M7UA 1AE8H 1BMLA 1LDTT 1UTNA 1U6QA 4VGCB 4CBNA 1NFWA 1CGHA 1AFEH 1MKWH 1YPJH 3L6PA 4TPIZ 1DICA 1BRUP 1ELGA 3Q3KA 3M5LA 4B74A 1QL9A 1CA0B 1YPKH 2BOKA 3A7VA 1G3EA 1K1JA 5SGAE 2BD9A 1YLCA 2YNBA 1VGCB 1O5BB 1T8MA 2VWLA 1MTWA 2O9QA 1AZZA 3RU4E 1W2KH 1TNIA 4I7YH 3Q77A 4Y0YE 4O9VA 2B8OH 3M3VA 1CSOE 1XUIA 1UVUH 2HNTE 1P9SA 3OAAD 2ZZUH 1E37B 4XE4A 2W3KA 5FBIA 1K9OE 3VG8A 4KP0A 1A1RA 1DSUA 1BBRH 4Y10E 1TONA 1GJBB 2ZU1A 2HGTH 3RLYH 2XRCA 2XNDD 3ATLA 3O8CA 1GCDA 3SYJA 3UQVA 5T6DA 3WW7A 4OS1A 3FAOA 1FAKH 1TQ7B 2C93B 1BJVA 3BTKE 2R0LA 2ANMH 2AGGX 3Q76A 3IG6B 4H4FA 1GBIA 4JYTA 4MTBA 3LGTA 1B0EA 1ZMLA 5CDFE 1JBUH 3SGAE 1AFQC 3F9HA 3MTYA 1CGIE 2P3TB 3BSQA 4UDWH 2EI6A 3EDXB 4A1XA 1MTSA 2RCEA 4K3JA 4ZHMU 1MU8B 1DUEA 3PMHB 1QJ6B 1GMCG 1AZ8A 2OC0A 1FONA 1MKWK 1O2MA 2OC8A 2JIZD 1KDQA 1MD8A 2G51A 5C67A 2O8UA 4A1VA 4BAHB 3NCLA 2BXUH 1DWEH 3OY6U 3ZV9A 1MKXK 1PPEE 2ZIQH 3Q00A 3QN7A 1MABB 3S9BA 1C1OA 3S0NA 3TPIZ 2H2ZA 5EQQA 1ETRH 2RFKC 1XUFA 4XSKU 1LHCH 1XXFA 3F6UH 2DUCA 1QZ8A 3HK6B 4BTIB 2UWLA 5A2MH 2V7QD 2ZFFH 4YLQH 4Y8XA 5HXFA 4ASUD 5ETXA 1NFXA 1KLIH 2VIVA 1ZTLA 4X0WU 1O32A 3ATKA 1BBRK 2DE9A 2QGRA 3SBKA 2FWWA 5K0HA 2J98A 4KTSA 5JBCS 3A7ZA 4AGJA 3GYMA 1J8AA 3RXUA 1HB0B 2ZTZA 3TITA 2OXSA 4Q63A 3UQOA 1EP6A 4XFQA 4I8KA 3UPEA 1DITH 4HZHA 3OSYA 1UCYH 3U28C 1WSSH 2ZA5A 4BANB 1OOKB 1OSSA 2Z9IA 1KXAA 3LGWA 1C5ZB 4CH2B 3O8DA 2XNIA 4OGXA 4CR9A 1AFQB 3KL6A 3HKJB 5T6FA 3AAUA 4MLFB 2ZFRH 1A0HB 3S7HB 1F7ZA 3RXGA 4BAMB 4X1NU 4X2WA 1HBTH 2BQ7B 1T8NA 3KCGH 1GJCB 4E06H 5PTPA 2ZDNA 5EJZA 3OX7U 1BB0B 1T4VH 4CREA 1GHBG 1W12U 3U98H 4RN6A 4Y11E 5EXLA 5FCKA 4CH8B 1O2XA 3P92A 1C5OH 2BVXH 1NFUA 3E16B 1OWIA 1C4U2 2BX4A 4O3TA 2ALPA 3A8BA 1ID5H 2SFAA 2HVYB 1GMHG 4RSPA 3RC6A 2FYRA 4SGBE 3U8OH 2ZNKH 2EY4C 3VPKA 2I6SA 2TGTA 5C0UA 1UTKA 1O2GH 1XUGA 4JK5A 2FS9A 4IBLH 4ZKNU 2J97A 1XUJA 2G5NA 2ZGXH 1G36A 3MH4A 3P8FA 4ZHLU 1GI3A 1VCPA 2UUYA 3CS0A 1C2KA 4WMFA 4NCYA 1SGNE 2FESH 5EW1H 2G4TA 3L3TA 1EB2A 1DWDH 2J9NA 3LGYA 4Y8ZA 1UCYK 1W10U 3AASA 4AYYB 1SG8B 4LZ4B 5DN6D 3TLOA 1EAWA 3KQBA 3UFAA 4KELA 4ZROA 4Q7ZA 2F9VA 3SI4H 4UEHH 1EPTC 3TJVA 1P8VC 2J38A 3OFND 1AQ7A 1SGEE 5J4QA 5A8XA 5DP5A 3RXAA 3HPTB 4Y71A 1GVLA 2C8YB 2ZQ1A 4X6NA 4XBCA 2F9BH 1ANEA 3H09A 1ABIH 1MD7A 5LPFA 4K1SA 1P04A 1HAXB 1MTUA 1CE5A 2HWLB 1F5RA 4Z6AH 3M61U 2ZDKA 1H8DH 8KME2 1FV9A 1PYTD 1OKXA 3PYHA 1K0HA 1RXPA 2SGEE 3TVJB 3ATMA 1UHBA 1LPZB 2GDEH 2YMSC 4FUCA 1ARCA 4ABDA 5A09A 3E3TA 1V2OT 5A0CA 1TNKA 1YWUA 2J2UA 3FVFB 2FOAA 1EJAA 2THFB 1N6YA 2RA0A 1NFYA 3RXMA 3SU6A 2VVUA 4P02A 3ZV8A 1O5FH 2A5AA 4ZUHA 1ANCA 4IMZA 1NRQH 2ALVA 4XRNA 3BTFE 1EXFA 1V2PT 1F2SE 1O2QA 3V3MA 5F8TA 1UTOA 4ZXXH 4NG9H 4AG1A 3NWUA 1S6HA 4FUHA 4X2XA 4BTUB 3SW2B 4CRFA 4JCNA 4A6LA 4JMYA 2ULLA 1W14U 4UFDH 1O2OA 1ZGIA 1IQLA 2PR3A 2VWNA 1EPTB 2OC7A 1YPHE 2F9OA 2KAIA 1GDNA 1SHHB 1V2RT 5C20A 2C8XB 2CN0H 3PB1E 1P2QA 1TOMH 5EU8A 1O5AB 5FX6A 3U8TH 1A7SA 2K1QA 5TCCA 1Z6EA 1NBMD 2GDDA 2WYJA 3DFJA 1O30A 1O2RA 3UOPA 3MU5A 2GCTC 3M37A 2BD5A 3T2NA 1PPHE 1DXPA 4ZAEA 1LQDB 1DPOA 2P94A 2OQ5A 2WPHS 2BX3A 1O3NA 1UK4A 2JH0D 1UO6A 1NRNH 2JH5D 2ZHFH 1P11E 1EOLA 1CO7E 5HM9A 1D3DB 2YMSB 1O39A 4YO9A 5DO4H 1C5YB 1QQUA 3U1JB 4XDEA 2G5VA 4THNH 1LPGB 1BRCE 1TNLA 1YKTA 1HAYB 1P3CA 2VNTA 1HYLA 1SQAA 3PLKA 3BN9A 3UNSA 2G55A 4O03A 1GCTC 2Z9GA 4F49A 1H4WA 3HK3B 1ZR0A 1O2KA 1O3BA 1SGRE 4DVAU 1CT4E 2BD3A 4NIXA 1GBEA 3F1SB 3SO3A 4R8TB 5GXPA
chains in the Genus database with same CATH topology
1TAWA 1O2LA 3W95A 1FI8A 2ZECA 1C5RA 2WINI 1Q2WA 1AUTC 1W7XH 1HAVA 1HAIH 1QCPA 1P10A 3A88A 5E0HA 1LMWB 1TNHA 3SJOA 2BY6X 4JZFH 4K60A 4ZHAA 2Q1JA 1GI1A 3V7TA 4UD9H 1AKSA 3KQCA 2ZPQA 1ELAA 3I29A 5JYIA 1QIXB 2D26C 3RMNH 3D23A 2NU0E 2J4IA 4CRBA 5C1XA 2AFQB 1BOQA 1V2MT 1MMJN 1H9IE 1FIWA 1MTVA 2D8WA 1O3DA 4DIHH 2Z3CA 3Q3YA 1O2UA 3SNBA 3M7QA 1THRH 3MMGA 2ODPA 1C2DA 2GVFA 2P95A 1NTPA 3A7TA 1G2MA 3T28A 4HGCA 2OBOA 1T31A 3A7XA 4DCDA 1IQJA 1BHXB 1JOUB 1O5EH 3PLPA 2D1JA 4Q7XA 2FS8A 2OP9A 1TRNA 1QA0A 3KN2A 4ISOA 1HLTH 4JZIA 2WUBA 1V2KT 4U01A 2Y7XA 1MTNC 1P2NA 4A5TS 1GHBF 2GKVE 2FIRH 5GDSH 4KTCA 3ATIA 1SQTA 2Y81A 1C4Y2 1J14A 1GCTB 2B0FA 3PWCA 3ZZ4A 1GMHF 3KQEA 1TQ0B 6GCHF 3TJNA 3TIUA 1ESTA 2G81E 3M3SA 1HAHH 3FP8E 1K1OA 3TJUA 1B5GH 1LCYA 3SU4A 3ZZCA 1XVOA 2QAAA 4MQAA 1SOTA 3TH2H 1C1RA 1KIGH 1Z1IA 1TX8A 2EI8A 2FPZA 4WH8A 1XKAC 3GY5A 2VWMA 3ESTA 5AVDA 3AW0A 3P70B 3A86A 1BHXF 2PV9B 3SJ9A 1SLUB 1G9IE 3A89A 1AY6H 1P2JA 1EATA 2BDGA 1P2MA 3GCOA 5JBTA 3EA8A 2PUXB 2XBWA 1O0DH 4AYVB 1MQ6A 3PM3A 3EAJA 1W13U 5EG4A 1PPBH 4OS2A 1EASA 2FO9A 3LC3A 2NWNA 5GPIB 2BZ6H 1L1JA 2Y6TA 2QN5T 4D9QA 4AFQA 1YCPH 2O8WA 2YOLA 1SHYA 1ORFA 1NRPH 1N8OC 6CHAC 5F8ZA 4O97A 1CT0E 1LHEH 1C1VH 2F9UA 4IN2A 4MPUA 3D49H 2BVRH 1BT7A 1SGTA 4CHAC 1GVKB 1MTNB 1SI5H 4WMEA 2BDCA 2Q6FA 1AHTH 4H42U 1FNIA 4ABFA 1E35B 2XWBI 1DANH 3I77A 3BTQE 4MPXA 4I8GA 1WQSA 2Z94A 1YYY1 7GCHG 1AVWA 1C5UA 3ZZBA 3PMBB 5DKMA 2O8MA 3M5NA 3GY4A 1CA8B 2A2QH 2J34A 1EOJA 3P95A 1QJ7B 3LPRA 4CBOA 2HOBA 2TGPZ 2V3OH 4TYDA 3U1IB 2H9HA 4DW2U 2QA9E 3SV6A 2UWPA 2B7DH 4K2YA 3RXVA 4E7RG 5GCHF 4K5ZA 2ZDLA 1F0TA 4U30A 3TNSA 3LT3A 1KXDA 3SJ8A 3BIUH 1TNJA 4YOGA 1FLEE 2PGQB 1C5SA 1O2WA 2BD2A 1O34A 1EZSC 4NSVA 3EYDA 1CBWC 2PKAB 2TPIZ 2BXTH 1RTFB 3C27B 3D65E 1GBLA 2Q6GA 1D4PB 2B5TB 1O3LA 3MU0A 1RTKA 1SGCA 3BEUA 1C1MA 1YCPK 1QBVH 2BY7X 1NS3A 3RXBA 5GWZA 4TWYA 1C5WB 1T4UH 3MH5A 3SUEA 2IPHA 2ZTXA 1H1BA 3V0XA 1GJAB 1N8OB 3ELAH 4JZDH 2VIWA 6CHAB 3QLPH 1GHVH 1YC0A 1B7XB 1C5QA 1L4DA 1HGTH 1HXEH 2BLVA 2CHAC 4CHAB 3ZVAA 1NROH 1CU1A 1OX1A 3A87A 3HGNA 1GMDG 2FM2A 5EPNA 3VB5A 3MFJA 4WMDA 1Y3UA 2JH6D 1V2UT 2Y7ZA 2AIQA 3QGNB 2NU1E 1GBDA 2IJOB 3WY8A 3PTBA 2ZFTA 1Y59T 4D76A 4AX9H 3ZYEA 1OWEA 2NU4E 1CGJE 2STBE 2AIPA 1AVGH 1JRSA 1GL1A 1FPCH 1UK3A 1G3DA 1Y3YA 4O3UA 6ESTA 1LKBA 5G4BA 3M36A 2BLOA 4ASHA 1AMHA 1ZLRA 2GT8A 2SGPE 1Y5UT 2CF8H 1SGQE 1A3BH 3SJKA 3ZVDA 2PSYA 2Q6DA 4GHQA 1OWKA 4K1EA 2QY0B 4FUDA 3ZZAA 1PPCE 3A8DA 3RU4T 1CBWB 1O3FA 4NIWA 1C1SA 2R2WU 4RKOB 1HIAA 1N1LA 3ODFA 4YT6H 4NWLA 4LXBH 4NWKA 1SGDE 1OP0A 4JK6A 2AEIH 3TK9A 5DP4A 1BUIA 2CHAB 3MU1A 2A7JA 3GCHC 4TPYA 4GUXA 1V2JT 1CHGA 1O3AA 4NSYA 5J4SA 1L1GA 1BJUA 3VB4A 1FDPA 1NM6A 3RP2A 1Z6JH 4YM9A 4OS4A 4DIIH 5DG6A 2SGDE 4SGAE 1IHTH 1EAIA 1P3EA 1W3CA 1KXBA 2TRMA 2OCVB 1MAXA 2XC4A 1TMBH 1VITG 2P59A 3ENSB 3MU4A 4ISNA 4Y79A 5ESBA 1L2EA 2BB4A 1UJ1A 2RG3A 1P01A 1MAYA 1S6FA 3MNXA 4WWYA 1ZZZA 2R3UA 4YZUA 4YLUA 1AE5A 1PJPA 2PW8H 4GPGA 2PSXA 1MCVA 3LJJA 3UUZA 1TWXB 1AGJA 2P93A 4DT7B 3M3TA 2AERH 3BTTE 4ZKSU 3ZVGA 4AOQA 1HJ9A 1GJ7B 1TALA 2FTMA 3SJIA 1D3TB 1HFDA 4BNRA 1GJ4H 3LJOA 1IQKA 1ANDA 4TY7A 4B71A 4B2BA 1FMGA 1HAOH 3SV8A 1QHRB 1YF4A 4MPVA 3D62A 1TPOA 2FOHA 1E0FD 1AD8H 3RC4A 3GCHB 1ARBA 3W94A 1OPHB 3RLWH 3LONA 4GVUA 3LGVA 1S82A 4K8BA 1V2LT 2YNAA 1HAVB 3ZZ9A 3NK8A 4NGAH 1HRTH 1P2OA 1VJAU 2BVSH 2ZFSA 1UVTH 1QL8A 4TY6A 3ZYDA 2Z9JA 1DWCH 2H5CA 1K28D 4IS5A 2OTVA 1AWHB 8GCHG 2BM2A 1BA8B 1NU9A 2FDAA 1F0RA 3LC5A 4ISLA 1GJ8B 1C1TA 4AGKA 3TGKE 1O37A 1P57B 1A4WH 2FOGA 1MUEB 2GP9B 1TX7A 3TH4H 2NU2E 3SI3H 3UNRA 3LU9B 1GGDC 1E36B 5I25A 1QB1A 2OUAA 2F83A 1EUFA 2FI3E 1K1LA 2GCHG 1QGFA 1N6XA 1SGFA 2VINA 1DY8A 1O2VA 1VJ9U 2ZC9H 3QTOH 3GYLB 4CRGA 1DT2A 3NZIA 2UUJB 3P8GA 1V2ST 4FU7A 3RMLH 3RXQA 3URCA 3A8AA 2ZPRA 5LPEA 3O8BA 1UVSH 2Y82A 3ZVCA 3MNBA 2HNTC 2BD4A 2ODQA 3EE0B 1ZHPA 1DX5M 1PPZA 1ZOMA 1YPEH 1UVOA 1ANBA 1GJ5H 4NZLA 5CE1A 2HPQH 3QWCH 2C3SA 2ZCHP 1HAPH 2VIDA 2ZP0H 1UTJA 1GPZA 1KLJH 3AW1A 2BY9X 2ESTE 1DVAH 2G4UA 1UK2A 1T32A 2ZI2H 1NC6A 4FVDA 1QRZA 2ZFPH 1NN6A 3JZ2B 2BD7A 1XM1A 2ZGHA 1KSNA 1P12E 2WPIS 2A0QB 3BF6H 3L33A 1GMDF 3KEEA 1GHZA 4JZEH 3HGPA 2W7UA 1TFXA 1GDQA 1O38A 1GI2A 2A4GA 5FCRA 2SGAA 3S9AA 2ZHQH 3M5MA 1JIRA 3LGIA 2GD4B 2QXHA 1GGDB 4FU8A 5HGGA 3ZZ8A 5C5NA 1UTMA 1V3XA 2F9NA 4BOHA 1INCA 2VIPA 1ZMNA 3BTHE 1IHSH 1BITA 3EQ0H 2ZQ2A 4UFGH 1D9IA 2B9LA 1SLXB 3RXIA 1L4ZA 4D9RA 1OP8A 4B75A 1LVBA 2OD3B 3E8LA 4XBBA 3TK6A 3R3GB 3GCNA 2XBYA 3VXFH 2BZAA 2P16A 2W7SA 1O2IA 5FPSA 1A0JA 3GY8A 2FI4E 2FOEA 1BMMH 2D2DA 1AI8H 2QC2A 3K6YA 1C5PA 5A8ZA 2NU3E 1EZUC 1V2TT 1TGCA 1WBGB 2ZGCA 2OBQA 4ZKOU 4BXWA 2VB0A 1D6WA 1Q3XA 1HXFH 2JKHA 1SL3A 3C1KA 3GDSA 4FUBA 3M7TA 3IITA 2G52A 1J15A 4M7GA 3QTVH 4A7IB 1PFXC 1RTLA 1GMCF 1ZSJA 2XC0A 1Y8TA 1LVYA 1FXYA 2GTBA 4I33A 2EEKA 1FY8E 3MI4A 4WY3A 4PROA 3BTME 3A7WA 5AF9H 1A5GH 3A81A 3RXFA 5CHAB 3QK1A 3SORA 3K9XB 2HNTF 1SSXA 3UIRA 4BAQB 1C5MD 1GJ6A 4MPWA 2BD8A 2FODA 1V2QT 3GDVA 2ANWA 2FMJA 1UTPA 1SQOA 4X6OA 4INKA 1OWDA 2BDHA 1GI5A 1O3EA 2IOTA 2XWAA 1DOJA 1IQGA 4ABAA 3TGIE 3TK5A 2BDIA 1VCQA 1XVMA 3MO3A 1C2FA 2Z9KA 1THPB 1O36A 1FY4A 2FXRA 3LKWA 2A5IA 1OWJA 3U69H 4BAOB 4X1SU 4X1PU 1AIXH 2Y80A 2GMTC 1ELVA 5FHTA 1UVPA 1WUNH 2BOHB 1TRMA 1CQQA 2Y5FA 2ANYA 3A83A 5AFYH 5LGOA 1PQ7A 5HYOA 2XBVA 1FY1A 4JYVH 2WUCA 1ELBA 5K7RA 1GG6C 4NA7A 2CJIA 3B23B 3QO6A 1PPGE 2G00A 2PLXA 2V0BA 1TA2A 2IN2A 2A2XH 1F5KU 1AB9B 1YBWA 4CR5A 1MU6B 3P8NA 3STIA 5IDKA 4A1TA 1BRBE 1TNGA 3ZZ3A 4GHTA 1CVWH 3KF2A 1SGYE 1LQEA 1Z8IB 1O3PB 1O3KA 4B76A 5A8YA 4MNWA 1O3JA 3MYWA 4YTAA 1ZSKA 1AWFH 3T25A 3E1XB 4OS6A 5FAHA 4JZ1A 2LPRA 1SLVB 3HKIB 3F9FA 1ELCA 1NRRH 3ZVEA 3GY7A 1W0ZU 5ESTE 8GCHF 1EX3A 2ILNA 2FP7B 1V2VT 4QT8C 1MCTA 5I46H 1WCZA 1ZSLA 1LTOA 3SUGA 1QA7A 2GZ7A 1KDQB 1BTWA 2F91A 2GX4A 4ZXYH 1C2LA 3F68H 2PGBB 2ZEBA 3B8JA 2C8ZB 1H9LB 4I8JA 1D3QB 2GMTB 2GCHF 3MNSA 4K1TA 2VGCC 1C2JA 3KNXA 1IAUA 1A2CH 4RKJB 5C5OA 1O2SA 3SZNA 1GG6B 1ZPZA 2FOBA 1QBNA 1O5GH 4NA9H 1K21H 2Z3DA 2ODYB 1HAGE 4GCHG 4Y6DA 2C8WB 1VITH 3F9GA 2A1DB 3OTJE 3PMAB 1NPMA 1QJ1B 2FLRH 3EA7A 1YPHC 1ABJH 1K1PA 1GHAG 2R3YA 1HPGA 1Y5BT 2GGVB 2AMDA 1HJ8A 2JETC 3RXSA 2ZU4A 3S9CA 1GJ9B 2BYAX 1TBQH 1TABE 5EODA 1DLEA 3E0NB 1V6DA 1AUJA 2XCNA 4IC5A 4X6MA 1EP5A 2QYIA 1A61H 1IQNA 3S7KB 1Y3XA 5FPTA 5JDUB 1P02A 2BTCE 3RXEA 1A46H 3MO6A 4OS7A 4X8SH 1E38B 2RDLA 3FFGA 1EPTA 4DURA 1IQMA 2A45B 3VFEA 2ZDAH 4CRDA 1ETTH 2QV1A 2FOCA 3SV7A 1ZHMA 1ESBA 1QQ4A 4H6TA 3ITIA 1KLTA 4OS5A 2BQWB 1WOFA 3S69A 4I31A 1NESE 1NU7B 4FU9A 1QR3E 2GZ8A 2F3CE 3UREA 1VCWA 3RXPA 2OLGA 2ZGBH 1P03A 3FP7E 2VVCA 2PKSC 4A92A 2I6QA 1RJXB 1ZPBA 4AN7A 1MBMA 1SR5C 1TIOA 2J94A 2P3UB 2VGCB 4J1YA 1MZDA 5E8EH 1AVXA 3PV4A 3FP6E 1XUHA 1RD3B 1C2IA 1V2WT 5EQSA 1DXWA 1T7CA 2FEQH 1G3CA 1HJAC 6LPRA 1RRKA 1WAYB 3QZQA 1GBKA 2UUFB 2UWOA 3K2UA 3KIDU 1C5VA 4AZ2B 1EZQA 2H6MA 3UOUA 1IOEA 3MWIU 2BQ6B 3BG8A 1ELEE 1FN8A 2BLWA 3DD2H 4BTTB 2TIOA 2QXGA 2JETB 1BMAA 4FUGA 1O2PA 2PWXA 3A82A 3VB7A 3DT0H 5DGJA 2XCFA 1BIOA 1AN1E 4K69A 1WU1A 3QX5H 3M5OA 1WTGH 1DM4B 1FY5A 4DJZB 4WVPE 5BPEA 1ZMJA 4TWWA 3OU0A 4NZQA 2BHGA 1W8BH 1CHOG 1BQYA 1DLKB 4ABHA 1O2YA 1SGPE 2A32A 2P8OC 2XYAA 1HDTH 3VXEH 2J92A 2Z6BD 3BTEE 3KGPA 2H9EH 1GHXH 4Y7AA 4ESTE 4IC6A 1MZAA 1C2MA 1P2KA 1MKXH 2PKSB 3BG4C 1LVOA 2AS9A 5F8XA 4Z0KA 2BLQA 4FUJA 1JMOH 1C9PA 1TLDA 4FVBA 1SOZA 1W7GH 1B0FA 3FZZA 3ZVFA 4B1TA 4F4OC 3SNEA 5C3NA 3GY2A 4I32A 5DJ7A 1JWTA 1UHBB 5B6OA 3SQEE 1KXFA 1K1NA 1S85A 3BTDE 4YOIA 3RM0H 1HJAB 4HI3A 2AMQA 1HV7A 3DHKH 1TPSA 1GBFA 1BTPA 3ZZDA 1TPAE 2VVVA 2ZCKP 1FIZA 1D6RA 1FN6A 4NIYA 1FQ3A 3HATH 5AFZH 4K8YA 1CT2E 1XUKA 2Z9LA 1C9TA 1O2TA 2ZTYA 1RIWC 2LNCA 3LIWA 5IYTA 3UTUH 5H4IB 1IQEA 3R0FA 3NXPA 5HMAA 5TCAA 1EJMA 4U2WA 4X1QU 1C5LH 3RMMH 3URDA 1GBMA 1TE0A 2ZF0H 3SUDA 4E7NA 3E6PH 2KAIB 1QRXA 3RXRA 1ZRBA 1QB9A 1SVPA 1BCUH 1G30B 1LHDH 5T6GA 3BTGE 5F03A 4UFFH 3UWIA 1ESAA 2HLCA 1JXPA 1GJDB 2O8LA 1BTHH 2WPJS 2P8OB 5JB9S 2WPMS 1P09A 4NFEA