1C1RA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1rA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1rA02
1DVAH 4LXBH 1ZTJA 1A2CH 1ZPZA 2C93B 4JZIA 2Y5FA 1VR1H 3MHWU 1BZXE 3ZZ5A 3GCNA 3RXIA 1SGCA 3L3TA 2BOKA 1UHBA 4E05H 1GG6C 1NU9A 2Y80A 1AKSA 4X6NA 1BTYA 1XUFA 1LHGH 2PLXA 1Y3VA 2G4UA 4TWWA 2GP9B 1BBRH 2ZU4A 2J38A 2A4OA 3RXQA 1YPGH 5FCRA 1FIWA 5TJXA 2Z9JA 4I7YH 3BTDE 3V13A 1MTWA 2Y6TA 3ATWA 1DOJA 4TY7A 4K3JA 2EI6A 1IQJA 3RXGA 1O3MA 2OUAA 4ZKRU 3TJUA 1TRMA 1HJAB 4I32A 2HWLB 1KXFA 4K60A 1CA0C 3VB7A 1A0HB 4HZHA 3BTEE 1HYLA 1V2UT 1HAPH 3OY6U 4ISLA 5AVDA 1A0LA 5EQSA 1C2HA 1MH0A 1UTKA 2BQ7B 2XC4A 4MNWA 4BAKB 3PO1B 2ZTXA 1O5EH 1XX9A 3H5CB 1BT7A 2CXVA 1LHCH 3TIUA 1JOUB 5IYTA 2HNTE 4JK6A 5DP7A 1GMCG 2Z3DA 1O3PB 1P02A 1DFPA 1V2TT 1LPGB 1V2PT 1YPHC 4RKJB 3STIA 3PM3A 4OGXA 5T6FA 1ZHRA 2VIPA 1FZZA 1ARBA 1F7ZA 3P92A 3LPRA 1O3LA 4YOGA 2QF3A 5K7RA 1GBBA 4OS4A 4IN1A 2P8OC 4IS5A 1ZSKA 3V12A 5AF9H 2BY5X 3SJOA 3VB5A 4FVDA 1EZQA 3ZV8A 2CF9H 2OP9A 4K69A 1SGYE 2NU3E 1W0YH 3PO1C 1WBGB 1GMDF 1THRH 3EAJA 3P6ZB 2FS9A 2A7CA 1O2NA 2A4RA 2XCFA 2OD3B 1V2WT 3N7OA 1FY3A 3RC6A 4CBOA 2VVUA 5DO4H 5C5OA 1NFYA 1HJAC 3ZZ4A 5EXMA 1TMUH 3QZQA 2A5AA 2G5NA 4IBLH 4MNYA 1A61H 1VZQH 1P3CA 2ANKH 1NT1A 1UTMA 4LOYH 4Y79A 1BTZA 1F0SA 3TVJB 5E0HA 1TGNA 5T6DA 2BYAX 1C1QA 1LMWB 1MZAA 1DX5M 3RXRA 3P8GA 2C8YB 1XVMA 1GG6B 2Y81A 5GIBA 3KL6A 1JWTA 1GBJA 1OYQA 3A86A 3T27A 1KDQA 4JCNA 2W7SA 2VH6A 4NWKA 1ESBA 1UCYK 4ISOA 1O3JA 2LNCA 4XOJA 1HAGE 1OWJA 3ODFA 3GDVA 1KYNA 5E2PA 4FU7A 2FP7B 1GBIA 3LH1A 2RA3A 1GHZA 1KXAA 2PGBB 3T26A 2J95A 1L4ZA 1P2KA 2P95A 1GVLA 3GYLB 1CHOF 1EASA 1EP6A 1ELAA 3BG4C 1GHXH 1J16A 1MUEB 1FPCH 2OCVB 1O5BB 5A8YA 2BB4A 3A83A 2I6SA 4X1SU 4DIIH 1RJXB 1TALA 2HALA 2V0BA 4KTSA 3SGBE 1V2OT 1ACBE 1L1GA 1S0QA 1Z8RA 4MNXA 4UDWH 1KY9A 1TLDA 4D76A 1BMMH 1RRKA 1QL9A 1O2MA 3M5OA 3UR6A 4OS2A 1SQAA 1P11E 4CRDA 3EGKH 4OGYA 3K2UA 1BRAA 4YT7H 1ETRH 1XUKA 4A6LA 1XVOA 4BTUB 1MTSA 3F9EA 1W10U 2QCYA 4U01A 4AB8A 2I6QA 2ZIQH 3M7QA 2UUJB 2ZCKP 1YCPM 4CR5A 1ZMLA 2ZEBA 2J2UA 3B8JA 3ESTA 3W94A 5K0HA 2PKSC 2FO9A 1DWCH 3URDA 5I46H 4DGJA 1UTLM 2BVSH 2EEKA 3A7WA 3SNEA 1N8OC 2O8LA 3RXKA 2PTCE 1PQ5A 3RDZA 5FHTA 5HM9A 1QCPA 4MG3A 5FPSA 4MPVA 2A32A 1SGRE 4ZHAA 1AGJA 3K65B 1W11U 1O5FH 2ALPA 3HGNA 1RTLA 1TNGA 3G01A 2Z94A 3I78A 4AGKA 4O3UA 3P17H 3E90B 4OS5A 2NU2E 3LT3A 2R0KA 6GCHF 3M5NA 3DT0H 1DITH 3T29A 1XKBC 5ABWA 3S9CA 1FAXA 1QB9A 3GCHB 4DY7B 2SGFE 1A3EH 2C4FH 4BANB 2BOHB 1C1SA 1QIXB 2TBSA 4GCHF 3A89A 1EPTB 2GDEH 8LPRA 1TA2A 1GHWH 1E37B 5GXPA 1LKBA 4LZ4B 4Z0KA 1J17T 1GHAF 4DJZB 2J94A 2BY9X 4BTIB 4JK5A 2HPQH 4F49A 1O3AA 3RXMA 1AUTC 1HGTH 1UVSH 2BZAA 1K1LA 1KLJH 2BDAA 1KTSB 2GVFA 5J4QA 3BEUA 2BD5A 1T4VH 1DY9A 1YP9A 3SNDA 1SGEE 4I8LA 2ZFSA 2BDCA 4Y76A 3GISB 2ZHEH 2Y7XA 1O2VA 1HAYB 1O35A 1N6XA 5L6NH 4Q7YA 4GVUA 4D9RA 3TH3H 3AAVA 4JMYA 1EOLA 1P57B 2G52A 1TNKA 2FLBH 4Q7ZA 2AIPA 1O3IA 3A80A 1BMLA 3O8RA 1O3EA 2BVXH 2ZDLA 2OBOA 4GHQA 1G3EA 3GY4A 3MMGA 2ZO3H 4GUXA 2ZG0H 2IOTA 2CF8H 3ZZ8A 1XUHA 1VCPA 2ZFFH 1GGDC 1UK4A 1W13U 5F6MA 2R3YA 1A0JA 1GGDB 4FUFA 4BAHB 5EQQA 4ZKNU 1DICA 2UWOA 2OC0A 5FPYA 1S5SA 2FIRH 1AB9C 1QBNA 4WXIA 1Y3YA 2A5IA 1V2MT 2SGDE 3H7OA 2OC8A 1ZPBA 4FUBA 1Q3XA 3M3SA 5JB9S 2Z9GA 1MAYA 1TNJA 2P93A 5T6GA 3HK3B 1QA7A 1VITF 1EAUA 2XCNA 3AVZA 3ZZ6A 2V6NA 4GCHG 3H7TA 4B2CA 9ESTA 2TRMA 3D23A 4ABJA 1XXFA 3GDUA 2AH4X 3MOCA 3GY2A 3PWBA 4B2AA 3SUGA 1NTPA 3FZZA 1P0SH 3RXSA 1NU7B 1ANCA 4SGAE 1TQ7B 1A4WH 1Z8GA 1FY8E 3OTJE 1HXFH 1AZ8A 1EATA 3SNCA 1Y3XA 3UWIA 3ATIA 3PROA 5FBIA 2QN5T 5A0CA 1AFQC 1GBKA 3RU4E 2WPMS 4K8YA 3LIWA 4FUEA 1CT2E 4X2XA 1F92A 1P03A 1ESTA 3DA9B 3DFJA 1G3CA 1EPTC 1MD8A 2VJ1A 1VCWA 4WWYA 1O30A 1PPFE 2BD7A 1W0ZU 1GJ6A 1TX8A 1QTFA 1AFEH 5C20A 3RXUA 2FLRH 2W26A 1O2XA 3LGTA 4NFFA 1CGIE 3K6ZA 2YNAA 2FTMA 3BTKE 4E7NA 1C5WB 3LJJA 2JETC 4X2VA 4BAMB 2FOFA 1NRRH 2P3TB 1TNIA 2GMTB 1WSSH 3UOUA 2WPHS 3A7XA 4JZDH 4X2WA 1O3NA 1O5GH 3A8DA 1BOQA 5EQRA 1QB1A 2BD4A 1ELFA 1GHYH 1B7XB 1DY8A 3ENSB 5CE1A 3E8LA 1D3QB 4E06H 1ID5H 3RXLA 4NGAH 2H9HA 2BDYA 1SLUB 4OS1A 3EDXB 1Y3UA 1ANDA 2ZDAH 1ABJH 4NFEA 5GCHG 3A81A 2F3CE 1GCTC 2OBQA 2BLQA 3MNXA 1Y8TA 8ESTE 2BX4A 1BA8B 4BAQB 2ZC9H 1GJBB 1FNIA 1GI7B 2FI4E 2BY6X 5CHAC 3KN2A 1BRBE 1RTKA 3S69A 2J92A 1SMFE 2ZU2A 1O2HA 1K1NA 1CGJE 3GYMA 3BEIB 4A5TS 2YNBA 2BY7X 1C9TA 3BG4B 1BMAA 5DJ7A 1RTFB 3ZZCA 1HCGA 3TJVA 1AY6H 1FI8A 8GCHG 2P16A 1F2SE 1O2RA 2FWWA 1PPEE 1GJ9B 1PPZA 1P2QA 1QQ4A 1GMHG 1HAIH 3CS7A 3UOPA 2PTNA 5F8ZA 1GHVH 1K9OE 3CP7A 3KHVA 1HJ8A 2SGQE 2F9VA 3PMBB 3F1SB 2ANYA 2XBXA 1BHXF 3UUZA 4MNVA 2FXRA 1TE0A 3O8DA 4FXGH 1ZYOA 4YZUA 2B8OH 1L0ZA 3TNSA 1KDQB 1TX7A 1PQ7A 2CJIA 1YPEH 1GVZA 3PMAB 2Q1JA 1L1JA 2EI8A 2SNWA 3MNCA 3SHCH 7GCHG 2ZI2H 7GCHF 1MBQA 2ANWA 2PUXB 2WPIS 2BHGA 1EZUC 1LQEA 5DK1A 1OWIA 3ZVGA 2RA0A 4I8GA 5LPRA 2QXIA 2B0FA 2WUCA 1O3GA 2ZCHP 4WJG2 5FCKA 1YF4A 1Z1JA 1O2PA 7ESTE 4RSPA 5EPYA 5AFZH 3S9AA 4B1TA 1P01A 2BQ6B 6LPRA 1XKAC 1LO6A 1LPZB 1C2IA 4X6MA 1ZJKA 4X6OA 4J1YA 3S9BA 1OP8A 3KCGH 2QXGA 3BTTE 3FFGA 3BEFB 4TPIZ 2PUQH 1TRYA 4WMDA 3D65E 1U6QA 1EQ9A 2P8OB 3LU9B 4XFQA 3RXTA 1V2VT 4ABHA 1S6HA 3GY7A 4UE7H 1PJPA 2PKAB 2CHAC 2ZA5A 4AOQA 4WVPE 5LPFA 2XC0A 1FY1A 1IQNA 1RIWB 4CH2B 1C2KA 5E2OA 1MTNC 1SGFG 3SORA 3I29A 2FM2A 2YOLA 3MH4A 1J14A 1TGTA 1GI9B 1TOMH 2ZPSA 1Z6JH 1EAWA 3JZ1B 4Y8XA 4IC6A 1GJ7B 2F9PA 1CE5A 2KAIB 5H4IB 1H4WA 1JRSA 2RCEA 3KNXA 4H6SB 1YPHE 1ZSLA 4B71A 1FV9A 1BHXB 2WPLS 1P3EA 1CA0B 2XBWA 3TITA 2A7JA 2H5CA 3SJKA 3IG6B 4CH8B 1MCVA 3LGIA 3Q76A 3V3MA 2C3SA 4FU9A 1G36A 4IGDA 2HLCA 5EODA 1ELTA 4ZROA 1HAVB 6ESTA 1ETSH 1L4DA 2UWLA 1GMCF 1WCZA 4UFEH 1QJ1B 4U32A 2BY8X 1QFKH 4R0IA 3ZVEA 3RMLH 3ZZ7A 1C4Y2 4XDEA 3E16B 4YT6H 1S0RA 3Q3KA 4R8TB 3NPSA 3T25A 3ZVFA 1AVGH 1SOTA 1V6DA 2G51A 3PV4A 1IQMA 2B5TB 1D6RA 1C2FA 1KSNA 1ANEA 1GMHF 2G8TA 4FU8A 2QA9E 3HPTB 4XBDA 4ZMAH 1LVOA 2QF0A 2O8MA 3D62A 1SFQB 1D9IA 1NFWA 4J2YB 2G00A 1O3KA 1WTHD 2H1UA 1HAZB 1P04A 2OLGA 1DPOA 1BTWA 2Z3CA 4ZKOU 1DM4B 1F0RA 2F83A 2XW9A 2AGIX 4KTCA 2FOEA 1TABE 2ESTE 2XBYA 1G3BA 1CBWB 1THSH 3FP6E 1AE5A 2ZDVH 4KELA 2Y7ZA 2ZHFH 3U8OH 4XE4A 1BTUA 2UUYA 1CU1A 5T3HA 1XUGA 1QHRB 1IQHA 1OS8A 3ATKA 1HNEE 1C2MA 3ZVAA 1NROH 1V2LT 1GI3A 2XWBI 1N6YA 1Z8IB 3M61U 1IAUA 1OP0A 2BD2A 4H4FA 1GBLA 2PV9B 1O37A 1H8IH 2AS9A 2H9EH 3UNSA 3UNQA 1DWBH 1KLIH 3BIVH 4NIXA 1AI8H 2FESH 3SNAA 2GGVB 2FEQH 2CMYA 1Y3WA 3T62A 3M36A 4M7GA 1F5KU 1J15A 1AZZA 3PLBA 1THPB 1SLWB 1TPAE 3TU7H 3ZYEA 1EPTA 1TRNA 1BBRE 2FOAA 1GI5A 3SUEA 3S7HB 3M37A 3MU0A 1T8LA 3IITA 4AGJA 2NU1E 1Y59T 1LTOA 4X6PA 1QB6A 7LPRA 3AAUA 4JYUH 4ABEA 2FZZA 1SG8B 2F9OA 2VVVA 1TPSA 1O34A 2BD8A 5JBAS 4H6TA 1HUTH 3HKIB 3LJOA 1ZRBA 2BLWA 2HGTH 2QXJA 1C2DA 1P05A 3ZVDA 2STBE 1OPHB 4CRFA 1AMHA 3VXEH 1ZZZA 1SC8U 1GJDB 1TBZH 1ANBA 2FPZA 2Z3EA 1LKAA 4YLQH 2FDAA 2WYJA 4ASHA 1KXCA 4RN6A 4ZAEA 4DIHH 1HLTH 1GHBG 2AYWA 1P10A 4ISNA 1XMNB 3TLOA 1AO5A 1S84A 1BRCE 1G37A 4X8VH 1FAKH 4VGCC 3F9GA 5FPTA 3Q3XA 2VWNA 4Y0YE 2D26C 3K6YA 3PLPA 4AYVB 2BDHA 3BTGE 4NCYA 1RXPA 1UK3A 1CQQA 4ABFA 2CGAA 1SB1H 7KMEH 4NA9H 1AVXA 1HBTH 3QDZB 1GPZA 2GZ9A 2GDDA 4THNH 3A8BA 2OQ5A 4X2YA 1FN8A 3SW2B 1OX1A 3VGCB 4WMEA 1BTXA 2SNVA 4DVAU 1W2KH 3A7YA 4FUIA 3A85A 3GCTG 1O2OA 1YYY1 3SV7A 2ASUB 2GX4A 2PFEA 2PW8H 2ZECA 1RS0A 1PYTD 1PPHE 2FOMB 1SQOA 1BQYA 3SU0A 4AFQA 4GPGA 3MTYA 4GLYA 1NRQH 1W14U 2FS8A 2ZGXH 4CRAA 3PMJA 1BRUP 2FX6A 1WYKA 1C1PA 1DDJA 1D6WA 2FI3E 1LVYA 1P8VC 1Z71A 2HOBA 4X0WU 5F8XA 3GOVB 5C2ZA 1K28D 3SOSA 1K21H 2HPPH 3SQHE 5A09A 3FVFB 4ABGA 1C5VA 3PYHA 1CO7E 4ABBA 2VGCC 1NRSH 3MI4A 2VWMA 1T32A 3HKJB 5C1XA 1GL1A 3QTOH 4HI3A 1BDAA 1EP5A 4Y6DA 5F8TA 4FUCA 1C1NA 5C5NA 1AIXH 2SGAA 1QR3E 2V3HH 5C1UA 1M9UA 1MMJN 2XRCA 2G4TA 3DHKH 2ZP0H 1QURH 4NA7A 5GJ4B 4YLUA 1O3CA 3ZYDA 1C5PA 1A5GH 1X7AC 3S7KB 1F5LA 1SLXB 4GHTA 5ETXA 2HNTF 3LC5A 1NZQH 1C5QA 5EXLA 1D3PB 1C1MA 3V0XA 3QGNB 4K8BA 1Y5AT 3QUMP 1QL7A 2ODQA 1FMGA 4PROA 3K9XB 5E8EH 1EZSC 2B9LA 3T28A 1BUIA 3ZZ9A 4ZHLU 4XBCA 3SU3A 1O32A 2R2MB 2VIDA 1E34B 2A2XH 1C5UA 3BF6H 1MKWK 1O2UA 4Y8YA 1H9IE 3SBKA 2Z9LA 1YKTA 2FTLE 3MH6A 1HB0B 1TMBH 4K1SA 3RXHA 1O3DA 1TYNA 5EXNA 1GJAB 1P2MA 1C5YB 1MTUA 1W12U 5AFYH 5BRRE 1DE7H 3MO9A 5B6OA 1GBMA 3RXDA 1ESAA 5C1YA 1NS3A 5DPAA 4UFDH 3RU4T 2AGEX 3TH4H 3O8CA 4K2YA 1EB2A 4DG4A 2XTTB 1K22H 4X8UH 3ZZBA 2K1QA 3UQOA 1JMOH 1AWFH 2ZTZA 1C2EA 2G55A 4I31A 3RM2H 2EI7A 3U8TH 4AB9A 1UO6A 4YOJA 4HGCA 1ARCA 4I8HA 1GHAG 3KF2A 4FUDA 4LZ1H 4CHAB 1C5OH 4YTAA 3RP2A 3PMHB 2FI5E 1GJCB 5DP6A 2R2WU 1ZJDA 3RXFA 1INCA 1SGDE 1XM1A 4D8NA 2GT7A 3LH3A 1PPGE 2G81E 1HAXB 1WTGH 3SJ8A 2XNIA 5DGJA 1O3HA 3EA8A 3TNTA 4B76A 3SU5A 4Z6AH 3F9HA 2Y5GA 1D4PB 3A7TA 1ELBA 1GBTA 1SFIA 1EAXA 1S85A 1T31A 2ZDNA 4QT8C 3SV6A 1YGCH 1UVOA 6CHAB 2R3UA 4MTBA 1K1OA 2QXHA 1O5DH 1TNHA 2FOBA 4ZHMU 1LVMA 3AW1A 1E35B 4X1RU 1S81A 3QK1A 1DT2A 3GY6A 3GICB 1KLTA 1F0TA 4NIWA 1OWHA 1WQVH 2AERH 3UTUH 1GBHA 2PSXA 2P94A 1QY6A 3KGPA 1GDNA 1O2SA 2SGEE 1UK2A 5JDUB 3L6PA 2AIQA 1O2LA 3URCA 1SL3A 1GI4A 3MU8A 5L2ZH 1TBRH 1WUNH 1FY4A 1W7GH 3UPEA 1UCYH 5ESTE 3MO3A 3QZRA 2ZFTA 3BTFE 1HDTH 1EJNA 3GDSA 5JBBS 3QN7A 4INKA 4NG9H 3NWUA 1O5AB 3SQEE 1T4UH 2NU4E 1TOCB 1ELDE 1O3OA 3EYDA 3KQDA 1LQDB 1MTNB 2GV7A 3F6UH 3KIDU 4F4OC 3VB3A 3RC4A 2XXLA 2ALVA 1O5CB 3EA9A 4CRCA 1G32B 1ZLRA 3SZNA 1GBAA 1H9HE 5DG6A 1DANH 3TPIZ 2UUFB 3VXFH 3NCLA 3L33A 2GV6A 1BB0B 2JKHA 4BTTB 5LPEA 1IHSH 1DSTA 3P70B 4I33A 3E1XB 1IQGA 2QAAA 2ZHWH 3BIUH 4WH8A 3RXPA 1GBDA 1SPJA 2VB0A 1MQ5A 1PFXC 4ABIA 2GCTB 4YOIA 4NWLA 1GJ4H 2R9PA 3LC3A 2G5VA 3MU4A 4FVBA 1S82A 4B75A 4INHA 1S6FA 1BMNH 1O38A 1HPGA 1ZHMA 1GVKB 2ZFRH 1CA8B 1ORFA 2XBVA 4FUHA 1SSXA 4AFUA 3MYWA 4MDSA 2WPKS 1SGTA 1IQIA 1TA6A 2AGGX 3VGCC 2GTBA 3OSYA 1EX3A 1L2EA 1YLDA 1NM6A 5HMAA 5EPNA 1OP2A 2W3IA 4WXVA 2A5KA 3ITIA 4HFPB 4OS7A 1LDTT 3E6PH 1MU6B 4DCDA 2Q6DA 1GBCA 3SU2A 4LK4A 2HNTC 4YESB 1TMTH 1EAIA 2O9QA 1QRWA 1O2YA 2A4GA 1NC6A 3AASA 3U69H 2XYAA 3E0NB 2WINI 3M7UA 5GWZA 1DLKB 4WF8A 3OX7U 3SUDA 1GBEA 5F03A 1QRXA 3S0NA 1E0FD 3CS0A 4NSYA 1QJ7B 1HFDA 1C1TA 4UEHH 1YPLH 1CHGA 1CT4E 4D9QA 4CRGA 2ZCLP 1NPMA 1BIOA 3PTNA 1FONA 3VB4A 1H8DH 3ZZDA 2RG3A 1ELEE 3M5LA 1L1NA 1PPCE 1GCDA 2D1JA 3ZZAA 1MKXH 4B74A 3SV9A 3RUOA 1ETTH 1V3XA 2BD9A 3MO6A 1G3DA 1VJ9U 1QA0A 1XUIA 3TGIE 1WV7H 1SHYA 1BBRK 1P2JA 1Q31A 3BG8A 5I25A 1OWDA 1HAVA 3KQEA 1H9LB 4ZUHA 1C1OA 3QO6A 5ESBA 2A4QA 2ZU1A 3CENA 4CHAC 1C2GA 3SU6A 2XC5A 2TGPZ 1EKBB 2BXTH 3UR9A 5PTPA 2WUBA 1P2NA 2AFQB 1YLCA 3RMNH 3RXEA 1J8AA 1EJAA 3RLYH 1C4V2 5FAHA 1YM0A 1W3CA 1YBWA 1C5XB 2BQWB 2J4IA 2VVCA 3GCTF 1W7XH 1UTNA 1A3BH 4NA8A 1YCPK 8KME2 1LHEH 2OC7A 1DXPA 2ZF0H 1BITA 3UWJH 3RXBA 2ZGCA 1TGCA 1ZSJA 1Z1IA 3SI4H 1Z7KA 1CSOE 2DUCA 2FMJA 1TPOA 3M3VA 2HVXA 1AWHB 5GCHF 1IQLA 1OOKB 4DT7B 1O3BA 3RLWH 4UFGH 1SI5H 3DFLA 3SUFA 2SGPE 2BTCE 1O0DH 1NFXA 4Q7XA 3TGJE 2ZQ2A 3QLPH 4D7FA 3OYPA 2JH0D 1C5NH 2ZHQH 2W7UA 1QJ6B 2W5EA 5LGOA 2ZDKA 4NSVA 2J9NA 2AMDA 3QX5H 1HAHH 3MNBA 1OKXA 1TQ0B 1E38B 2QYIA 3UNRA 2SFAA 3LDXH 4GAWA 5E0JA 1AFQB 5GPIB 4A1XA 5HGGA 1QQUA 2C8ZB 3FP8E 2ZDMA 1F0UA 3GY8A 4Y8ZA 3UQVA 4WY3A 1TONA 3STJA 2BX3A 1T8MA 4D7GA 5JBTA 5C3NA 1DLEA 1H1BA 3LGWA 3M7TA 4A7IB 2O8UA 1LCYA 3FANA 1VCQA 1CGHA 2H2ZA 2VWLA 1C5ZB 2FODA 3PLKA 3TK9A 1YPJH 4AX9H 1SQTA 1HRTH 2O8TA 1MKXK 1GI6A 3TGKE 3E0PB 3U9AH 1GI1A 1TPPA 4NIYA 4ZKSU 4Y71A 2BM2A 1O2JA 2A0QB 4BNRA 1MQ6A 4TY6A 2KAIA 1YPMH 2UUKB 4Y10E 1SVPA 1WU1A 1WOFA 1UHBB 1QL8A 1KIGH 1FJSA 4INLA 2Z7FE 1ZTLA 2FOGA 3U98H 3PWCA 1EOJA 3RMOH 2OC1A 1G9IE 3WY8A 1JBUH 1HAOH 3Q77A 4MPUA 3TK5A 1J9CH 3SNBA 1FDPA 4Y7AA 3QWCH 1B5GH 4ISIH 1MAXA 2A7HA 1XXDA 4YM9A 1MZDA 2BD3A 2D8WA 4CRBA 3LGYA 2ODPA 1IHTH 1UTJA 3HGPA 2ZGBH 4JZ1A 4DURA 1VJAU 1Z8JB 3OY5U 4X1QU 2GCTC 4KKDA 5JB8S 2WV4A 4BXWA 1YCPH 3EE0B 3LONA 2P59A 1PYTC 1VITH 2BZ6H 3A82A 1DWDH 3EA7A 4FUGA 1PPBH 2H6MA 1ELVA 3TK6A 2FOHA 4UFFH 4WMFA 2PGQB 5JPMH 2TGDA 1JRTA 1A46H 1O31A 3QGJA 5FX6A 2ZNKH 1FLEE 1BJVA 3RXJA 9LPRA 5DP9A 1MU8B 1K1PA 1AHTH 3UREA 3ELAH 4NZLA 2WPJS 4Q2KA 2BXUH 4IN2A 1ABIH 3P8OA 2ZGHA 5JYIA 1GJ8B 4O03A 1HXEH 4JYTA 1T8NA 1GDQA 5HYOA 4TYDA 3BTWE 2VIOA 3UFAA 3GCHC 1C5TA 2ZPRA 4AG1A 1F5RA 1Q2WA 4IC5A 5HM2A 3TJOA 3SV2H 5EU8A 1KXBA 4K1TA 1P06A 2F9UA 1B0EA 2VIWA 2ZTYA 5FXLA 1YPKH 3NKKA 4RKOB 3C27B 1O2GH 2Q6FA 4GSOA 1S83A 1AUJA 1HJ9A 1CVWH 2A2QH 2GZ8A 3ZZ3A 1FN6A 2JH5D 3RXCA 1N8OB 2PHBA 1ELGA 3NZIA 3VPKA 2GD4B 4DW2U 6CHAC 5DP3A 1RFNA 2PKSB 3B23B 2ZKSA 5JBCS 1D3DB 1G2LA 1EJMA 2OTVA 3FZDA 3JZ2B 5A0AE 4AZ2B 1O36A 1PQ8A 2AEIH 2ODYB 3KEEA 2VU8E 2QIQA 1SHHB 3F68H 1RD3B 1V2NT 3A7VA 1ZPCA 2OINA 1SGFA 4UD9H 1GJ5H 1NRPH 5EG4A 3BV9B 4TPYA 3QTVH 3MNSA 2GCHG 5CHAB 4IMZA 4NIVA 1K1JA 1KXEA 3AW0A 4AORA 5J4SA 1TWXB 1C9PA 3MH7A 1HV7A 3SGQE 1GCTB 4MVNA 3U8RH 2GCHF 1QGFA 5FBEA 5DP8A 2DE8A 3T2NA 4WH6A 1FIZA 1O2WA 1OYTH 1ZOMA 1CBWC 3DUXH 4BXSA 4X1PU 3GY3A 1TX6A 1V2ST 2IJOB 1MKWH 1A1RA 1SLVB 1O3FA 1C4U2 4CREA 3RC5A 1K1MA 5GDSH 1GL0E 3ATMA 5CMXH 3BTQE 1O39A 1P9UA 1UCYE 1WAYB 2ZPQA 2XWAA 3A8CA 1T8OA 3RXAA 3W95A 1WQSA 2THFB 2PR3A 1LHDH 4Q80A 1AQ7A 1P2IA 3MWIU 1FXYA 3KQBA 2ANMH 1DS2E 2ILNA 1TNLA 2JETB 2Z9IA 4NZQA 1FQ3A 2QC2A 4A1VA 3A88A 1O2QA 1UTQA 2GZ7A 3VFEA 3HATH 1JIRA 2VINA 2M5TA 2UWPA 1SGPE 4MPXA 4UONA 4YO9A 4MPWA 1UTPA 1LVBA 1OXGA 1NFUA 4JYVH 4JZFH 1EUFA 2TGAA 2JH6D 2F91A 2J34A 1CHOG 3IWMA 3SO3A 1G2MA 1TGBA 1ZHPA 3A87A 1Z6EA 4O97A 3SJIA 1E36B 2Z6BD 2NWNA 1DUEA 3LGUA 5G4BA 2TIOA 1O2KA 3C1KA 2AMQA 2IPHA 1SGIB 1NY22 2H9TH 3MFJA 1AU8A 1ZMNA 4Y7BA 2OQUA 3M5MA 3RXOA 2R0LA 2FYRA 3SGAE 3PTBA 2V3OH 5E0GA 5A0BA 1GI8B 1K1IA 1AE8H 3E3TA 1C5LH 3TH2H 3A7ZA 4X8SH 3RM0H 2BDBA 3ZV9A 3F9FA 2STAE 5DP5A 4ZH8A 4TWYA 3NXPA 1GBFA 1MD7A 3NUMA 3ODDA 3SV8A 3SJ9A 3B9FH 2C90B 4BAOB 1TGSZ 3EQ0H 4A1TA 2ZU5A 1HIAB 3P95A 2Q6GA 1FY5A 3SI3H 2BMGB 2CV3A 2D2DA 8GCHF 2BVRH 1TAWA 2WYGA 1FPHH 1EB1H 1MTVA 1NESE 1P09A 3P8NA 5LH8A 1LHFH 2VGCB 1C1VH 5HXFA 3KQCA 1KTTB 1O2IA 1G30B 3T5FH 1OWKA 1RIWC 1NO9H 4ISHH 3U1IB 3SHAH 1C2JA 2BDGA 3BTHE 2ULLA 1B0FA 1TBQH 1V2JT 2CHAB 2GKVE 2VIVA 1EZXC 1AB9B 2PKAA 1GDUA 5A2MH 4KTUA 1JXPA 1Y5UT 2TGTA 2ZGJA 4I8JA 2FX4A 5TCAA 1C5SA 1GMDG 3RU4D 4AYYB 1P9SA 2F9BH 1BCUH 4O9VA 1UJ1A 5A8ZA 5SGAE 4DOQA 2DE9A 3Q00A 1ZMJA 1T7CA 2BLOA 4ZXYH 3TJNA 1SBWA 1BTPA 2V35A 1P2OA 1SGQE 1SR5C 1ZGIA 3A8AA 4O3TA 4I8KA 4AFSA 1OSSA 3MH5A 1DSUA 2PWXA 1TB6H 2A31A 4IMQA 1PQAA 1ZR0A 1RGQA 5A8XA 3VEQB 5IDKA 1V2KT 2O8WA 4AFZA 2HRVA 2AMPA 3GCOA 1DUAA 1C5RA 3ATLA 3LGVA 1BJUA 2VH0A 1C2LA 4K1EA 2W3KA 1O2ZA 2BLVA 1UVTH 3GY5A 1UTOA 3FP7E 1AKSB 1ELCA 3M35A 4SGBE 2IN2A 3D49H 4A92A 3SN8A 3VB6A 2Y82A 3BN9A 2B7DH 1QBVH 1D3TB 4KP0A 4U2WA 4HTCH 4VGCB 3HK6B 4Y11E 4ABAA 4B2BA 1W8BH 3LOXA 1IOEA 1A5IA 1GI2A 1Y5BT 1FUJA 1MBMA 4MQAA 3ZVCA 3U1JB 2VIQA 5AHGH 4H42U 5EW1H 1CT0E 2ZQ1A 3R3GB 1GI0A 4IW4E 4CBNA 3Q3YA 2OXSA 2ZFQH 3SU1A 2CN0H 1V2QT 4Y0ZE 2P3FH 2ZFPH 4FUJA 1YC0A 1OWEA 1C5MD 2QV1A 5BPEA 1V2RT 2P3UB 2A45B 1VITG 1QBOA 4AN7A 2TPIZ 2F9NA 4MLFB 5EGMA 2BDIA 3SU4A 2C8WB 1VGCB 3FAOA 3A84A 1DWEH 3MU1A 2NU0E 3NK8A 1ZTKA 3UY9A 1IQKA 2VWOA 1JIMA 1HIAA 1SGNE 2ZWLH 3LKWA 5EW2H 5DP4A 1UVUH 3DD2H 6GCHG 3PB1E 1UMAH 1A5HA 1C1WH 4U30A 5FX5A 1SOZA 1K2I1 2A1DB 3E91A 3O8BA 5C67A 2PSYA 1NN6A 1TIOA 4ABDA 2FOCA 3V7TA 2ZU3A 1O2TA 4ESTE 3P8FA 1GHBF 3OU0A 2QGRA 1ZGVA 3UIRA 1GWAA 2ZHDA 2ZZUH 3M3TA 4B73A 2FYQA 1C1UH 4OS6A 1N1LA 1AD8H 4XBBA 3RXVA 2EA3A 1MCTA 4E7RG 3BSQA 1AN1E 2QY0B 3MU5A 3RMMH 5L30H 1IQEA 2GMTC 3ZVBA 1VGCC 4AG2A 2Z9KA 5DKMA 1O33A 2WV5A 1NRNH 2C8XB 3BTME 4JZEH 2LPRA 1C1RA 2Y5HA 4K5ZA 2EC9H 1QNJA 4XSKU 1LPKB 1DXWA 1P12E 4X1NU 5TCCA 1XUJA 4BOHA 1QRZA 1TFXA 3I77A 1BTHH 3R0FA 2RDLA 1A7SA 5L2YH 2H5DA 1UVPA 1KXDA 1ZRKA 2VNTA 5EOKA 2GT8A 4CR9A 1AVWA 4KGAA 4ZXXH 1EXFA 4X8TH 1IQFA
chains in the Genus database with same CATH superfamily
1DVAH 4LXBH 1ZTJA 1A2CH 1ZPZA 2C93B 4JZIA 2Y5FA 1VR1H 3MHWU 1BZXE 3ZZ5A 3GCNA 3RXIA 2YMSD 1SGCA 5EJLA 3L3TA 2BOKA 5CDFE 1UHBA 4E05H 1GG6C 1NU9A 2M2AA 2Y80A 1AKSA 4X6NA 1BTYA 1XUFA 1LHGH 2PLXA 1Y3VA 2G4UA 3FKSD 4TWWA 4B6EA 2GP9B 1BBRH 2ZU4A 2J38A 2A4OA 3RXQA 1YPGH 5FCRA 1FIWA 5TJXA 2Z9JA 4I7YH 3BTDE 3V13A 1MTWA 2Y6TA 3ATWA 1DOJA 4TY7A 4K3JA 2EI6A 1IQJA 3RXGA 1O3MA 2OUAA 4ZKRU 3TJUA 1TRMA 1HJAB 4I32A 2HWLB 1KXFA 4K60A 1CA0C 3VB7A 1A0HB 4HZHA 3BTEE 1HYLA 1V2UT 1HAPH 3OY6U 2YMSC 4ISLA 5AVDA 5DSFA 1A0LA 5EQSA 1C2HA 1MH0A 1UTKA 2BQ7B 2XC4A 4MNWA 4BAKB 3PO1B 2ZTXA 1O5EH 1XX9A 3H5CB 1BT7A 2CXVA 1LHCH 5HIYA 3TIUA 1JOUB 5IYTA 2HNTE 4JK6A 5DP7A 1GMCG 2Z3DA 1O3PB 1P02A 1DFPA 1V2TT 1LPGB 1V2PT 1YPHC 4RKJB 3STIA 3NRLA 3PM3A 4OGXA 5T6FA 3DSPA 1ZHRA 2VIPA 1FZZA 1ARBA 4XRNA 1F7ZA 3P92A 3LPRA 1O3LA 4YOGA 2QF3A 5K7RA 1GBBA 4OS4A 4IN1A 2P8OC 4IS5A 1ZSKA 3V12A 5AF9H 2BY5X 3SJOA 3VB5A 4FVDA 1EZQA 3CNRA 3ZV8A 2CF9H 2OP9A 4K69A 1SGYE 2NU3E 1W0YH 3PO1C 1WBGB 1GMDF 1THRH 3EAJA 3P6ZB 2FS9A 2A7CA 1O2NA 2A4RA 2XCFA 2OD3B 1V2WT 3N7OA 1FY3A 3RC6A 4CBOA 2VVUA 5DO4H 5C5OA 1NFYA 1HJAC 2K0QA 3ZZ4A 5EXMA 1TMUH 3QZQA 2A5AA 2W6ID 2G5NA 4IBLH 4MNYA 1A61H 1VZQH 1P3CA 2ANKH 1NT1A 1UTMA 4LOYH 4Y79A 1BTZA 3WWFA 1F0SA 3TVJB 5E0HA 1TGNA 5T6DA 2BYAX 1C1QA 1LMWB 1MZAA 1DX5M 3RXRA 3P8GA 2C8YB 1XVMA 1GG6B 2Y81A 5GIBA 3KL6A 1JWTA 1GBJA 1OYQA 3A86A 3T27A 1KDQA 4JCNA 2W7SA 2VH6A 3F2FA 4NWKA 1ESBA 1UCYK 4ISOA 1O3JA 2LNCA 4XOJA 1HAGE 1OWJA 3ODFA 3GDVA 1KYNA 5E2PA 4FU7A 2FP7B 1GBIA 3LH1A 2RA3A 1GHZA 1KXAA 2PGBB 3T26A 2J95A 1L4ZA 1P2KA 2P95A 1GVLA 3GYLB 2VBCA 1CHOF 1EASA 1EP6A 1ELAA 3BG4C 3DCLA 1GHXH 1J16A 1MUEB 1FPCH 2OCVB 1O5BB 5A8YA 2BB4A 3A83A 2I6SA 5DN6D 4X1SU 4DIIH 1RJXB 1TALA 2HALA 2V0BA 4KTSA 3SGBE 1V2OT 1ACBE 1L1GA 1S0QA 1Z8RA 4MNXA 4UDWH 1KY9A 1TLDA 4D76A 1BMMH 1RRKA 1QL9A 1O2MA 3M5OA 3UR6A 4OS2A 1SQAA 1P11E 4CRDA 3EGKH 4OGYA 3K2UA 4P02A 1BRAA 4YT7H 1ETRH 1XUKA 4A6LA 1XVOA 4BTUB 1MTSA 3F9EA 1W10U 2QCYA 4U01A 4AB8A 2I6QA 2ZIQH 3M7QA 2UUJB 2ZCKP 1YCPM 4CR5A 1ZMLA 2ZEBA 2J2UA 3B8JA 3ESTA 3W94A 5K0HA 3F0OA 2PKSC 2FO9A 1DWCH 3OEHD 3URDA 5I46H 4DGJA 1UTLM 2BVSH 4B6FA 2EEKA 3A7WA 3SNEA 1N8OC 2O8LA 3RXKA 2PTCE 1PQ5A 3UAIC 3RDZA 5FHTA 5HM9A 1QCPA 4MG3A 5FPSA 4MPVA 2A32A 1SGRE 4ZHAA 1AGJA 3K65B 1W11U 1O5FH 2ALPA 3HGNA 1RTLA 1TNGA 3G01A 2Z94A 3I78A 4AGKA 4O3UA 3P17H 2XOKD 3E90B 4OS5A 2NU2E 3LT3A 2R0KA 4OM9A 6GCHF 3M5NA 3DT0H 1DITH 2J97A 3T29A 1XKBC 5ABWA 3S9CA 4Z1MD 1FAXA 1QB9A 3GCHB 4DY7B 2SGFE 1A3EH 2C4FH 4BANB 2BOHB 1C1SA 1QIXB 2TBSA 4GCHF 3A89A 1EPTB 2GDEH 8LPRA 1TA2A 1GHWH 3SYJA 1E37B 4RT1A 5GXPA 1LKBA 4LZ4B 4Z0KA 1J17T 1GHAF 4DJZB 2J94A 2BY9X 4BTIB 4JK5A 2HPQH 4F49A 1O3AA 3RXMA 1AUTC 1UVSH 1HGTH 2BZAA 1FX0B 1K1LA 1KLJH 2BDAA 1KTSB 2GVFA 5J4QA 3BEUA 2BD5A 1T4VH 1DY9A 1YP9A 3SNDA 1SGEE 4I8LA 2ZFSA 2BDCA 4Y76A 3GISB 2ZHEH 2Y7XA 1O2VA 1HAYB 1O35A 1N6XA 5L6NH 4Q7YA 4GVUA 4D9RA 3TH3H 3AAVA 4JMYA 1EOLA 1P57B 2G52A 1S6LA 1TNKA 2FLBH 2AIPA 4Q7ZA 5C94A 1O3IA 3A80A 1BMLA 3O8RA 1O3EA 2BVXH 2ZDLA 2OBOA 4GHQA 1G3EA 3GY4A 3MMGA 2ZO3H 4GUXA 2ZG0H 2IOTA 2CF8H 3ZZ8A 1XUHA 1VCPA 2ZFFH 1GGDC 1UK4A 1W13U 5F6MA 2R3YA 1A0JA 1GGDB 4FUFA 4BAHB 4TT3D 5EQQA 4ZKNU 1DICA 2UWOA 3F2GA 2OC0A 5FPYA 1S5SA 2FIRH 1AB9C 1QBNA 4WXIA 1Y3YA 2A5IA 1V2MT 2SGDE 3H7OA 2OC8A 1ZPBA 4FUBA 1Q3XA 3M3SA 4YXWD 5JB9S 2Z9GA 1MAYA 1TNJA 2P93A 2WSSD 3HK3B 5T6GA 1QA7A 1VITF 1EAUA 2XCNA 2EY4C 3AVZA 3ZZ6A 2V6NA 4GCHG 3H7TA 4B2CA 9ESTA 2TRMA 3D23A 4ABJA 1XXFA 3GDUA 2AH4X 3MOCA 3GY2A 3PWBA 4B2AA 3SUGA 1NTPA 3FZZA 1P0SH 3RXSA 1NU7B 1ANCA 4SGAE 1TQ7B 1A4WH 1Z8GA 1FY8E 3ZIAD 3OTJE 1HXFH 1AZ8A 1EATA 3SNCA 1Y3XA 3UWIA 3ATIA 3PROA 5FBIA 2QN5T 5A0CA 1AFQC 1GBKA 4Q4LA 3RU4E 4F55A 2WPMS 4K8YA 3LIWA 4FUEA 1CT2E 4X2XA 1F92A 1P03A 1ESTA 3DA9B 3DFJA 3PRBA 1G3CA 1EPTC 1MD8A 2VJ1A 1VCWA 4WWYA 1O30A 1PPFE 2BD7A 1W0ZU 1GJ6A 1TX8A 1QTFA 1AFEH 5C20A 3RXUA 2FLRH 2W26A 1O2XA 3LGTA 4NFFA 1CGIE 3K6ZA 2YNAA 2FTMA 3BTKE 4E7NA 4FETA 1C5WB 1YY3A 3LJJA 2JETC 4X2VA 4BAMB 2FOFA 1NRRH 2P3TB 1TNIA 2GMTB 1WSSH 3UOUA 2WPHS 3A7XA 5EJ1A 3FO8D 4JZDH 4X2WA 1O3NA 1O5GH 3A8DA 1BOQA 1WDIA 5EQRA 1QB1A 2BD4A 1ELFA 1GHYH 1B7XB 1DY8A 3ENSB 5CE1A 3E8LA 1D3QB 4E06H 1ID5H 3RXLA 4NGAH 2H9HA 2BDYA 1SLUB 4OS1A 3EDXB 1Y3UA 1ANDA 2ZDAH 1ABJH 3MQKC 4NFEA 5GCHG 3A81A 2F3CE 1GCTC 2OBQA 2BLQA 3MNXA 1Y8TA 8ESTE 3N7DA 2BX4A 1BA8B 4BAQB 2ZC9H 1GJBB 1FNIA 1GI7B 2FI4E 2BY6X 5CHAC 3KN2A 1BRBE 1RTKA 3S69A 2J92A 1SMFE 1W0JD 2ZU2A 1O2HA 1K1NA 1CGJE 3GYMA 2AHME 3BEIB 4A5TS 2YNBA 2BY7X 1C9TA 3BG4B 1BMAA 5DJ7A 3EE7A 1RTFB 3ZZCA 1HCGA 3TJVA 1AY6H 1FI8A 8GCHG 2P16A 1F2SE 1O2RA 2FWWA 1PPEE 1GJ9B 1PPZA 1P2QA 4XD7D 1QQ4A 1GMHG 1HAIH 3CS7A 3UOPA 2PTNA 3DSOA 5F8ZA 1GHVH 1K9OE 3CP7A 5IK2D 3KHVA 1HJ8A 2SGQE 2F9VA 3PMBB 3F1SB 2ANYA 3OFND 2XBXA 1BHXF 3UUZA 4MNVA 2FXRA 1TE0A 3O8DA 4FXGH 1ZYOA 4YZUA 2L6OA 2B8OH 1L0ZA 3TNSA 1KDQB 1TX7A 1PQ7A 3N7EA 2CJIA 1YPEH 1GVZA 3PMAB 2Q1JA 1L1JA 2EI8A 2SNWA 3MNCA 3SHCH 7GCHG 1SQRA 2ZI2H 7GCHF 1MBQA 2ANWA 2PUXB 2WPIS 2BHGA 1EZUC 2JIZD 1LQEA 5DK1A 1OWIA 3ZVGA 2RA0A 4I8GA 5LPRA 2QXIA 2B0FA 2WUCA 1O3GA 2JJ2D 2ZCHP 4WJG2 5FCKA 1YF4A 1Z1JA 1O2PA 7ESTE 4RSPA 5EPYA 5AFZH 3S9AA 4B1TA 1P01A 2BQ6B 6LPRA 1XKAC 1LO6A 1LPZB 1C2IA 4X6MA 1ZJKA 4X6OA 4J1YA 3S9BA 1OP8A 3KCGH 2QXGA 3BTTE 3FFGA 3BEFB 4TPIZ 2PUQH 1TRYA 4WMDA 5EIYA 3D65E 1U6QA 1EQ9A 5C17A 2P8OB 3LU9B 4XFQA 3RXTA 1V2VT 4ABHA 1S6HA 3GY7A 4UE7H 1PJPA 2PKAB 2CHAC 2V7QD 2ZA5A 4AOQA 4WVPE 5LPFA 2XC0A 1FY1A 1IQNA 1RIWB 1KMHB 4CH2B 1C2KA 5E2OA 1MTNC 1SGFG 3SORA 3I29A 2FM2A 2YOLA 2KFWA 3MH4A 5FL7D 1J14A 1TGTA 1GI9B 1TOMH 2ZPSA 4ACAA 1Z6JH 1EAWA 3JZ1B 4Y8XA 4IC6A 1GJ7B 2F9PA 1CE5A 2KAIB 5H4IB 1H4WA 1JRSA 2RCEA 3KNXA 4H6SB 1YPHE 1ZSLA 4HG6A 4B71A 1FV9A 1BHXB 2WPLS 1P3EA 1CA0B 1BMFD 2XBWA 3TITA 2A7JA 2H5CA 3SJKA 3IG6B 4CH8B 1MCVA 3LGIA 3Q76A 3AK5A 3WW7A 3V3MA 2C3SA 4FU9A 1G36A 4IGDA 2HLCA 5EODA 1ELTA 4ZROA 1HAVB 6ESTA 1ETSH 1L4DA 2UWLA 1GMCF 1H8ED 1WCZA 4UFEH 1QJ1B 4U32A 2BY8X 1QFKH 4R0IA 3ZVEA 3RMLH 3ZZ7A 1C4Y2 4XDEA 3E16B 4YT6H 1S0RA 3Q3KA 4R8TB 3NPSA 3T25A 3ZVFA 1AVGH 2W6JD 1SOTA 1V6DA 2G51A 3PV4A 2IJD1 1IQMA 2B5TB 1D6RA 2QE7D 1C2FA 1KSNA 1ANEA 1GMHF 2G8TA 4FU8A 2QA9E 3HPTB 4XBDA 4ZMAH 1LVOA 2QF0A 2O8MA 3D62A 1SFQB 1D9IA 1NFWA 4J2YB 2G00A 1O3KA 1WTHD 2H1UA 1HAZB 1P04A 2OLGA 1DPOA 1BTWA 2Z3CA 4ZKOU 3VG8A 1DM4B 1F0RA 2F83A 2XW9A 2AGIX 4KTCA 5KECA 2FOEA 1TABE 2ESTE 2XBYA 1G3BA 5GNDA 1CBWB 1THSH 3FP6E 1AE5A 2ZDVH 4KELA 2Y7ZA 2ZHFH 3U8OH 4XE4A 1BTUA 2UUYA 1CU1A 5T3HA 1XUGA 1QHRB 1IQHA 1OS8A 3ATKA 1HNEE 1C2MA 3ZVAA 1NROH 1V2LT 1GI3A 2XWBI 1N6YA 1Z8IB 3M61U 1IAUA 1OP0A 2BD2A 4H4FA 1GBLA 2PV9B 1O37A 1H8IH 2AS9A 1NBMD 2H9EH 3UNSA 3UNQA 1DWBH 1KLIH 3BIVH 4NIXA 1AI8H 2FESH 3SNAA 2GGVB 2FEQH 2CMYA 2WZQA 1Y3WA 3T62A 3M36A 4M7GA 1F5KU 1W0KD 1J15A 1AZZA 3PLBA 1THPB 1SLWB 1TPAE 3TU7H 5HKKD 3ZYEA 1EPTA 1TRNA 1BBRE 2FOAA 1GI5A 3SUEA 3S7HB 3M37A 3MU0A 2RDEA 1T8LA 3IITA 4AGJA 2NU1E 1Y59T 1LTOA 4X6PA 1QB6A 7LPRA 3AAUA 4JYUH 4ABEA 2FZZA 1SG8B 2F9OA 2VVVA 1TPSA 1O34A 2BD8A 5JBAS 4H6TA 1HUTH 3HKIB 3LJOA 1ZRBA 2BLWA 2HGTH 2QXJA 1C2DA 1P05A 3ZVDA 2STBE 1OPHB 4CRFA 1AMHA 3VXEH 1ZZZA 1SC8U 1GJDB 1TBZH 1ANBA 2FPZA 2Z3EA 1LKAA 3GS9A 4YLQH 2FDAA 2WYJA 4ASHA 1KXCA 4RN6A 4ZAEA 4DIHH 1HLTH 1GHBG 2AYWA 1P10A 4ISNA 1XMNB 3TLOA 1AO5A 1S84A 1BRCE 1G37A 4X8VH 1FAKH 4VGCC 3F9GA 5FPTA 3Q3XA 2VWNA 4Y0YE 2D26C 3K6YA 3PLPA 4AYVB 2BDHA 3BTGE 4NCYA 1RXPA 1UK3A 1CQQA 4ABFA 2CGAA 1SB1H 7KMEH 4NA9H 1AVXA 1HBTH 3QDZB 1GPZA 2GZ9A 2GDDA 4THNH 3A8BA 2OQ5A 4X2YA 1FN8A 3SW2B 1OX1A 3VGCB 4WMEA 1BTXA 2SNVA 4DVAU 1W2KH 3A7YA 4FUIA 3A85A 3GCTG 1O2OA 1YYY1 3SV7A 2ASUB 2GX4A 2PFEA 2PW8H 2ZECA 1RS0A 1PYTD 1PPHE 2FOMB 1SQOA 1BQYA 3SU0A 4AFQA 4GPGA 3MTYA 4GLYA 1NRQH 1W14U 2FS8A 2ZGXH 4CRAA 3PMJA 1BRUP 2FX6A 1WYKA 1C1PA 1DDJA 1D6WA 2FI3E 1LVYA 2WHXA 1P8VC 1Z71A 2HOBA 4X0WU 5F8XA 3GOVB 5C2ZA 1K28D 3SOSA 1K21H 2HPPH 3SQHE 5A09A 3FVFB 4ABGA 1C5VA 3PYHA 1CO7E 1E1RD 4ABBA 3OAAD 2J98B 1E79D 2VGCC 1NRSH 3MI4A 2VWMA 1T32A 3HKJB 5C1XA 1GL1A 3QTOH 4HI3A 1BDAA 1EP5A 4Y6DA 5F8TA 4FUCA 1C1NA 5C5NA 1AIXH 2SGAA 1QR3E 1H8HD 2V3HH 5C1UA 1M9UA 1MMJN 3PV2A 2XRCA 2J98A 2G4TA 3DHKH 2ZP0H 1QURH 4NA7A 5GJ4B 4YLUA 1O3CA 3ZYDA 1C5PA 1A5GH 1X7AC 3S7KB 1F5LA 1SLXB 4GHTA 4FOUC 2HNTF 5ETXA 3LC5A 1NZQH 1C5QA 5EXLA 1D3PB 1C1MA 3V0XA 3QGNB 4K8BA 1Y5AT 3QUMP 1QL7A 2ODQA 1FMGA 4PROA 3K9XB 5E8EH 1EZSC 2B9LA 3T28A 1BUIA 3ZZ9A 4ZHLU 4XBCA 3SU3A 1O32A 2R2MB 3FOAA 2VIDA 1E34B 2A2XH 1C5UA 3BF6H 1MKWK 1O2UA 4Y8YA 1H9IE 3KYFA 3SBKA 2Z9LA 1YKTA 2FTLE 3MH6A 1HB0B 1TMBH 2JJ1D 4K1SA 3RXHA 1O3DA 1TYNA 5EXNA 1GJAB 1P2MA 1C5YB 1MTUA 4I86A 1W12U 1COWD 5AFYH 5BRRE 1DE7H 3MO9A 5B6OA 1GBMA 5KEDA 3RXDA 1ESAA 5C1YA 1NS3A 5DPAA 4UFDH 3RU4T 2AGEX 3TH4H 2HVYB 3O8CA 4K2YA 1EB2A 4DG4A 2XTTB 1K22H 4X8UH 3ZZBA 2K1QA 5EJZA 3UQOA 4ACBA 1JMOH 1AWFH 2ZTZA 1C2EA 2G55A 4I31A 3RM2H 2EI7A 3U8TH 4AB9A 1UO6A 4YOJA 4HGCA 1ARCA 4I8HA 1GHAG 3KF2A 4FUDA 4LZ1H 4CHAB 1C5OH 4YTAA 3RP2A 3PMHB 2FI5E 1GJCB 5DP6A 2R2WU 1ZJDA 3RXFA 1INCA 1SGDE 1XM1A 4D8NA 2GT7A 3LH3A 1PPGE 2G81E 1HAXB 1WTGH 3SJ8A 2XNIA 5DGJA 4TSFD 1O3HA 3EA8A 3TNTA 3N99A 4B76A 3SU5A 4Z6AH 3F9HA 2Y5GA 1D4PB 3A7TA 3KYGA 1ELBA 1GBTA 1SFIA 1EAXA 1S85A 1T31A 2ZDNA 4QT8C 3SV6A 1YGCH 1UVOA 6CHAB 2R3UA 5KGOA 4MTBA 1K1OA 2QXHA 1O5DH 1TNHA 2FOBA 4ZHMU 1LVMA 3AW1A 1E35B 4X1RU 1S81A 3QK1A 1DT2A 3GY6A 3GICB 1KLTA 1F0TA 4NIWA 1OWHA 1WQVH 2AERH 3UTUH 1GBHA 2PSXA 2P94A 1QY6A 3KGPA 1GDNA 1O2SA 1E1QD 2SGEE 1UK2A 2EQNA 5JDUB 3L6PA 2AIQA 4RI0A 1O2LA 3URCA 1SL3A 1GI4A 3MU8A 5L2ZH 2WPDD 1TBRH 1WUNH 1FY4A 1W7GH 3UPEA 1UCYH 5ESTE 3MO3A 3QZRA 2ZFTA 3BTFE 1HDTH 1EJNA 3GDSA 5JBBS 3QN7A 4INKA 4NG9H 3NWUA 1O5AB 3SQEE 1T4UH 2NU4E 1TOCB 4Q63A 1ELDE 1O3OA 3EYDA 3KQDA 1LQDB 1MTNB 2GV7A 2LP6A 2QF5A 3F6UH 3KIDU 4F4OC 4ZCNA 2GJGA 3RC4A 3VB3A 1WXRA 2XXLA 2ALVA 1O5CB 3EA9A 4CRCA 1G32B 1ZLRA 3H09A 3SZNA 1GBAA 1H9HE 5DG6A 1DANH 3TPIZ 2UUFB 3VXFH 3NCLA 3L33A 2GV6A 1BB0B 2JKHA 4BTTB 5LPEA 1IHSH 1DSTA 1YLNA 3P70B 4I33A 3E1XB 1IQGA 2QAAA 2ZHWH 3BIUH 4WH8A 5HIZA 3RXPA 1GBDA 1SPJA 2VB0A 1MQ5A 1PFXC 4ABIA 2GCTB 4YOIA 2IPQX 4NWLA 1GJ4H 2R9PA 3LC3A 2G5VA 3MU4A 4FVBA 1S82A 3OEED 4B75A 4INHA 1S6FA 1BMNH 1O38A 1HPGA 1ZHMA 1GVKB 2ZFRH 1CA8B 1ORFA 2XBVA 4FUHA 1SSXA 4AFUA 3MYWA 4MDSA 2WPKS 1SGTA 1IQIA 1TA6A 2AGGX 3VGCC 2GTBA 3OSYA 1EX3A 1L2EA 1YLDA 1NM6A 5HMAA 5EPNA 1OP2A 2W3IA 4WXVA 2A5KA 3ITIA 4HFPB 3OTPA 4OS7A 1LDTT 3E6PH 1MU6B 4DCDA 2Q6DA 1GBCA 3SU2A 4LK4A 2HNTC 4YESB 3FN8A 1TMTH 1EAIA 2O9QA 1QRWA 2QF4A 1O2YA 2A4GA 1NC6A 3AASA 3U69H 2XYAA 3E0NB 2WINI 3M7UA 5GWZA 1DLKB 4WF8A 3OX7U 3SUDA 1GBEA 5F03A 1QRXA 3S0NA 1E0FD 3CS0A 4NSYA 1QJ7B 1HFDA 1C1TA 4UEHH 1YPLH 1CHGA 1CT4E 4D9QA 4CRGA 2ZCLP 1NPMA 3F3BA 1BIOA 3PTNA 1FONA 3VB4A 1H8DH 3ZZDA 2RG3A 1ELEE 3M5LA 1L1NA 1PPCE 1GCDA 2D1JA 3ZZAA 1MKXH 5C0TA 4B74A 3SV9A 3RUOA 1ETTH 1V3XA 2BD9A 3MO6A 1G3DA 1VJ9U 1QA0A 1XUIA 3TGIE 1WV7H 1SHYA 5CHBA 4P00A 1BBRK 1P2JA 1Q31A 3BG8A 5I25A 1OWDA 1HAVA 3KQEA 1H9LB 4ZUHA 1C1OA 3QO6A 5ESBA 2A4QA 2ZU1A 3CENA 4CHAC 1C2GA 3SU6A 2XC5A 2TGPZ 1EKBB 2BXTH 3UR9A 5PTPA 2WUBA 1P2NA 2AFQB 1YLCA 3RMNH 3RXEA 1J8AA 1EJAA 3RLYH 1C4V2 5FAHA 1YM0A 1W3CA 1YBWA 1C5XB 2BQWB 2J4IA 2VVCA 2K8IA 3GCTF 1W7XH 1UTNA 1A3BH 4NA8A 1YCPK 8KME2 1LHEH 2OC7A 2KCOA 1DXPA 2ZF0H 1BITA 3UWJH 3DSGA 3RXBA 2ZGCA 1TGCA 1ZSJA 1Z1IA 3SI4H 1Z7KA 2F43B 3UB0A 1CSOE 2DUCA 2FMJA 1TPOA 3M3VA 2HVXA 1AWHB 5GCHF 1IQLA 1OOKB 4DT7B 1O3BA 3RLWH 4UFGH 1SI5H 3DFLA 2V3MA 3SUFA 2SGPE 2BTCE 1O0DH 1NFXA 4Q7XA 3TGJE 2ZQ2A 3QLPH 4D7FA 3OYPA 1YWUA 2JH0D 1C5NH 2ZHQH 2W7UA 1QJ6B 2W5EA 5LGOA 2ZDKA 4NSVA 2HLDD 2J9NA 3W1EA 2AMDA 3QX5H 1HAHH 3MNBA 1OKXA 1TQ0B 1E38B 2QYIA 3UNRA 2SFAA 3LDXH 4GAWA 5E0JA 1AFQB 5GPIB 4A1XA 5HGGA 1QQUA 2C8ZB 3FP8E 2ZDMA 1F0UA 3GY8A 4Y8ZA 3UQVA 3OE7D 4WY3A 1TONA 3STJA 2BX3A 1T8MA 4D7GA 5JBTA 2KCAA 5C3NA 1DLEA 1H1BA 3LGWA 3M7TA 4A7IB 2O8UA 1LCYA 3FANA 1VCQA 1CGHA 2H2ZA 2VWLA 1C5ZB 2FODA 3PLKA 3TK9A 1YPJH 4AX9H 1SQTA 1HRTH 2O8TA 1MKXK 1GI6A 3TGKE 3E0PB 3U9AH 1GI1A 1TPPA 4NIYA 4ZKSU 1QZ8A 2BM2A 4Y71A 1O2JA 2A0QB 4BNRA 1MQ6A 4TY6A 2KAIA 1YPMH 2UUKB 4Y10E 1SVPA 1WU1A 1WOFA 1UHBB 1QL8A 1KIGH 1FJSA 4INLA 2Z7FE 1ZTLA 2FOGA 2KM0A 3U98H 3PWCA 1EOJA 3RMOH 2J5UA 2OC1A 1G9IE 3WY8A 1SKYE 1JBUH 1HAOH 3Q77A 1UW7A 4MPUA 3TK5A 1OHHD 1J9CH 3SNBA 1FDPA 4Y7AA 3QWCH 1B5GH 4ISIH 1MAXA 2A7HA 1XXDA 4YM9A 1MZDA 2BD3A 2D8WA 4CRBA 3LGYA 2ODPA 1IHTH 1UTJA 3HGPA 2ZGBH 4JZ1A 4DURA 1VJAU 1Z8JB 3OY5U 4X1QU 2GCTC 4KKDA 5JB8S 2WV4A 3WWBA 4BXWA 1YCPH 3EE0B 3LONA 2P59A 1PYTC 1VITH 2BZ6H 3A82A 1DWDH 3EA7A 4FUGA 1PPBH 2H6MA 1ELVA 3TK6A 2FOHA 4DT4A 4UFFH 4WMFA 2PGQB 5JPMH 2TGDA 1JRTA 1A46H 1O31A 3QGJA 5FX6A 2ZNKH 1NBME 1FLEE 1BJVA 3RXJA 9LPRA 5DP9A 1MU8B 1K1PA 1AHTH 3UREA 3ELAH 4NZLA 2WPJS 4Q2KA 2BXUH 4IN2A 1ABIH 3P8OA 2ZGHA 5JYIA 1GJ8B 4O03A 1HXEH 4JYTA 1T8NA 1GDQA 5HYOA 3KQ5A 4TYDA 3BTWE 2VIOA 3UFAA 3GCHC 1C5TA 2ZPRA 4AG1A 1F5RA 1Q2WA 4IC5A 5HM2A 3TJOA 2KZ4A 3SV2H 5EU8A 1KXBA 4K1TA 1P06A 2F9UA 1B0EA 2VIWA 2ZTYA 5FXLA 1YPKH 3NKKA 4RKOB 3C27B 1O2GH 2Q6FA 4GSOA 1S83A 1AUJA 1HJ9A 1CVWH 2A2QH 2GZ8A 3ZZ3A 1FN6A 2JH5D 3RXCA 1N8OB 2PHBA 1ELGA 3NZIA 3VPKA 2GD4B 4DW2U 6CHAC 5DP3A 1RFNA 2PKSB 3B23B 2ZKSA 5JBCS 1D3DB 1G2LA 1EJMA 2OTVA 3FZDA 3JZ2B 5A0AE 4AZ2B 1O36A 1PQ8A 2AEIH 2ODYB 3KEEA 2VU8E 2QIQA 1SHHB 3F68H 1RD3B 1V2NT 3A7VA 1ZPCA 2OINA 1SGFA 4UD9H 1GJ5H 1VKYA 1NRPH 5EG4A 3BV9B 4TPYA 3QTVH 2LELA 3MNSA 2GCHG 5CHAB 2F4LA 4IMZA 4NIVA 1K1JA 1KXEA 3AW0A 4AORA 5J4SA 1TWXB 1C9PA 3MH7A 1HV7A 3SGQE 1GCTB 4MVNA 3U8RH 2GCHF 1QGFA 5FBEA 5DP8A 2DE8A 3T2NA 4WH6A 1FIZA 1O2WA 1OYTH 1ZOMA 1CBWC 3DUXH 4BXSA 4X1PU 3GY3A 1TX6A 1V2ST 2IJOB 1MKWH 1A1RA 1SLVB 1O3FA 1C4U2 4CREA 3RC5A 1K1MA 5GDSH 1GL0E 3ATMA 3PRDA 5CMXH 3BTQE 1O39A 1P9UA 1UCYE 1WAYB 2ZPQA 2XWAA 3A8CA 1T8OA 3RXAA 3W95A 1WQSA 2THFB 2PR3A 1LHDH 4Q80A 1AQ7A 1P2IA 3MWIU 1FXYA 3KQBA 2ANMH 1DS2E 2ILNA 1TNLA 2JETB 2Z9IA 4NZQA 1FQ3A 2QC2A 4A1VA 3A88A 1O2QA 1UTQA 2GZ7A 3VFEA 3HATH 1JIRA 2VINA 2CK3D 2M5TA 2UWPA 1SGPE 4MPXA 4UONA 4YO9A 4MPWA 1UTPA 1LVBA 1OXGA 1NFUA 4JYVH 4JZFH 1EUFA 2TGAA 2JH6D 2F91A 2J34A 1CHOG 3IWMA 3SO3A 1G2MA 1TGBA 1ZHPA 3A87A 1Z6EA 4O97A 3SJIA 5F53A 1E36B 2Z6BD 2NWNA 1DUEA 3LGUA 5G4BA 2TIOA 1O2KA 3C1KA 2AMQA 2IPHA 1SGIB 1NY22 2H9TH 3MFJA 1EFRD 1AU8A 1ZMNA 4Y7BA 2OQUA 3M5MA 3RXOA 2KCYA 5B6LA 2R0LA 2FYRA 3SGAE 3PTBA 2V3OH 5E0GA 5A0BA 1GI8B 1K1IA 1AE8H 3E3TA 1C5LH 3TH2H 3A7ZA 4X8SH 3RM0H 2BDBA 3ZV9A 3F9FA 2STAE 5DP5A 4ZH8A 4TWYA 3NXPA 1GBFA 1MD7A 3NUMA 3ODDA 3SV8A 3SJ9A 3B9FH 2C90B 4BAOB 1TGSZ 3EQ0H 4A1TA 2ZU5A 1HIAB 3P95A 2Q6GA 1FY5A 3SI3H 2BMGB 2CV3A 2D2DA 8GCHF 2BVRH 1TAWA 2WYGA 1FPHH 1EB1H 1MTVA 1NESE 1P09A 3P8NA 4AC9A 1LHFH 1C1VH 2VGCB 5HXFA 5LH8A 3KQCA 1KTTB 1O2IA 1G30B 3T5FH 4RT0A 2OK5A 1OWKA 1RIWC 1NO9H 4ISHH 3U1IB 3SHAH 1C2JA 2BDGA 3BTHE 2ULLA 1B0FA 1TBQH 1V2JT 2CHAB 2GKVE 2VIVA 1EZXC 1AB9B 2PKAA 1GDUA 5A2MH 4KTUA 1JXPA 1Y5UT 2TGTA 2RFKC 2ZGJA 4I8JA 2FX4A 5TCAA 1C5SA 2KX4A 1GMDG 3RU4D 4AYYB 1P9SA 2KR7A 2F9BH 1BCUH 4O9VA 1UJ1A 5A8ZA 5SGAE 4DOQA 2DE9A 3Q00A 1ZMJA 1T7CA 2YMSB 2BLOA 4ZXYH 3TJNA 1SBWA 1BTPA 2V35A 1P2OA 1SGQE 1SR5C 1ZGIA 3A8AA 4O3TA 4I8KA 2L74A 4AFSA 1OSSA 3MH5A 1DSUA 2PWXA 1TB6H 2A31A 4IMQA 1PQAA 1ZR0A 1RGQA 5A8XA 3VEQB 5IDKA 1V2KT 2O8WA 4AFZA 2HRVA 2AMPA 3GCOA 1DUAA 1C5RA 4ASUD 3ATLA 3LGVA 1BJUA 2VH0A 1C2LA 4K1EA 2W3KA 1O2ZA 2BLVA 1UVTH 3GY5A 1UTOA 3FP7E 1AKSB 1ELCA 3M35A 4SGBE 2IN2A 3SZEA 3D49H 4A92A 3SN8A 2PP6A 3VB6A 2Y82A 4F48B 3BN9A 2B7DH 1QBVH 1D3TB 4KP0A 4U2WA 4HTCH 4VGCB 2JDID 3HK6B 4Y11E 4ABAA 4B2BA 1W8BH 3LOXA 1K0HA 1IOEA 1A5IA 1GI2A 1Y5BT 1FUJA 1MBMA 4MQAA 3ZVCA 3U1JB 3PV5A 2VIQA 5AHGH 4H42U 5EW1H 1CT0E 2ZQ1A 3R3GB 1GI0A 4IW4E 4CBNA 3Q3YA 2OXSA 2ZFQH 3SU1A 2CN0H 1V2QT 4Y0ZE 2P3FH 2ZFPH 4FUJA 1YC0A 1OWEA 1C5MD 2QV1A 5BPEA 1V2RT 2P3UB 2A45B 1VITG 1QBOA 4AN7A 3F2HA 2TPIZ 2F9NA 4MLFB 5EGMA 2BDIA 3SU4A 2C8WB 1VGCB 3FAOA 3A84A 1DWEH 3MU1A 2NU0E 3NK8A 1ZTKA 3UY9A 1IQKA 2VWOA 1JIMA 1HIAA 1SGNE 2ZWLH 3LKWA 5EW2H 5DP4A 1UVUH 5T1VA 3DD2H 6GCHG 3PB1E 1UMAH 1A5HA 1C1WH 4U30A 5FX5A 1SOZA 1K2I1 2A1DB 3E91A 3O8BA 5C67A 2PSYA 1NN6A 1TIOA 2WV9A 4ABDA 2FOCA 3V7TA 2ZU3A 1O2TA 4ESTE 3P8FA 1GHBF 3OU0A 2QGRA 1ZGVA 3UIRA 1GWAA 2ZHDA 2ZZUH 3M3TA 4B73A 5C0UA 2FYQA 1C1UH 4OS6A 1N1LA 1AD8H 4XBBA 3RXVA 2EA3A 1MCTA 4E7RG 3BSQA 2XNDD 1AN1E 2QY0B 3MU5A 3RMMH 4M9FA 5L30H 1IQEA 2GMTC 3ZVBA 1VGCC 4AG2A 2Z9KA 5DKMA 1O33A 2WV5A 1NRNH 2C8XB 3BTME 4JZEH 2LPRA 1C1RA 2Y5HA 4K5ZA 2EC9H 3F0PA 1QNJA 4XSKU 1LPKB 1DXWA 1P12E 4X1NU 5TCCA 1XUJA 3U28C 1QRZA 4BOHA 1TFXA 3I77A 1BTHH 3R0FA 2RDLA 1A7SA 5L2YH 2H5DA 1UVPA 1MABB 1KXDA 1ZRKA 2VNTA 5EOKA 2GT8A 4CR9A 1AVWA 4KGAA 4ZXXH 1EXFA 4X8TH 2KCPA 1IQFA
chains in the Genus database with same CATH topology
1DVAH 4LXBH 1ZTJA 1A2CH 1ZPZA 2C93B 4JZIA 2Y5FA 1VR1H 3MHWU 1BZXE 3ZZ5A 3GCNA 3RXIA 1SGCA 3L3TA 2BOKA 1UHBA 4E05H 1GG6C 1NU9A 2Y80A 1AKSA 4X6NA 1BTYA 1XUFA 1LHGH 2PLXA 1Y3VA 2G4UA 4TWWA 2GP9B 1BBRH 2ZU4A 2J38A 2A4OA 3RXQA 1YPGH 5FCRA 1FIWA 5TJXA 2Z9JA 4I7YH 3BTDE 3V13A 1MTWA 2Y6TA 3ATWA 1DOJA 4TY7A 4K3JA 2EI6A 1IQJA 3RXGA 1O3MA 2OUAA 4ZKRU 3TJUA 1TRMA 1HJAB 4I32A 2HWLB 1KXFA 4K60A 1CA0C 3VB7A 1A0HB 4HZHA 3BTEE 1HYLA 1V2UT 1HAPH 3OY6U 4ISLA 5AVDA 1A0LA 5EQSA 1C2HA 1MH0A 1UTKA 2BQ7B 2XC4A 4MNWA 4BAKB 3PO1B 2ZTXA 1O5EH 1XX9A 3H5CB 1BT7A 2CXVA 1LHCH 3TIUA 1JOUB 5IYTA 2HNTE 4JK6A 5DP7A 1GMCG 2Z3DA 1O3PB 1P02A 1DFPA 1V2TT 1LPGB 1V2PT 1YPHC 4RKJB 3STIA 3PM3A 4OGXA 5T6FA 1ZHRA 2VIPA 1FZZA 1ARBA 1F7ZA 3P92A 3LPRA 1O3LA 4YOGA 2QF3A 5K7RA 1GBBA 4OS4A 4IN1A 2P8OC 4IS5A 1ZSKA 3V12A 5AF9H 2BY5X 3SJOA 3VB5A 4FVDA 1EZQA 3ZV8A 2CF9H 2OP9A 4K69A 1SGYE 2NU3E 1W0YH 3PO1C 1WBGB 1GMDF 1THRH 3EAJA 3P6ZB 2FS9A 2A7CA 1O2NA 2A4RA 2XCFA 2OD3B 1V2WT 3N7OA 1FY3A 3RC6A 4CBOA 2VVUA 5DO4H 5C5OA 1NFYA 1HJAC 3ZZ4A 5EXMA 1TMUH 3QZQA 2A5AA 2G5NA 4IBLH 4MNYA 1A61H 1VZQH 1P3CA 2ANKH 1NT1A 1UTMA 4LOYH 4Y79A 1BTZA 1F0SA 3TVJB 5E0HA 1TGNA 5T6DA 2BYAX 1C1QA 1LMWB 1MZAA 1DX5M 3RXRA 3P8GA 2C8YB 1XVMA 1GG6B 2Y81A 5GIBA 3KL6A 1JWTA 1GBJA 1OYQA 3A86A 3T27A 1KDQA 4JCNA 2W7SA 2VH6A 4NWKA 1ESBA 1UCYK 4ISOA 1O3JA 2LNCA 4XOJA 1HAGE 1OWJA 3ODFA 3GDVA 1KYNA 5E2PA 4FU7A 2FP7B 1GBIA 3LH1A 2RA3A 1GHZA 1KXAA 2PGBB 3T26A 2J95A 1L4ZA 1P2KA 2P95A 1GVLA 3GYLB 1CHOF 1EASA 1EP6A 1ELAA 3BG4C 1GHXH 1J16A 1MUEB 1FPCH 2OCVB 1O5BB 5A8YA 2BB4A 3A83A 2I6SA 4X1SU 4DIIH 1RJXB 1TALA 2HALA 2V0BA 4KTSA 3SGBE 1V2OT 1ACBE 1L1GA 1S0QA 1Z8RA 4MNXA 4UDWH 1KY9A 1TLDA 4D76A 1BMMH 1RRKA 1QL9A 1O2MA 3M5OA 3UR6A 4OS2A 1SQAA 1P11E 4CRDA 3EGKH 4OGYA 3K2UA 1BRAA 4YT7H 1ETRH 1XUKA 4A6LA 1XVOA 4BTUB 1MTSA 3F9EA 1W10U 2QCYA 4U01A 4AB8A 2I6QA 2ZIQH 3M7QA 2UUJB 2ZCKP 1YCPM 4CR5A 1ZMLA 2ZEBA 2J2UA 3B8JA 3ESTA 3W94A 5K0HA 2PKSC 2FO9A 1DWCH 3URDA 5I46H 4DGJA 1UTLM 2BVSH 2EEKA 3A7WA 3SNEA 1N8OC 2O8LA 3RXKA 2PTCE 1PQ5A 3RDZA 5FHTA 5HM9A 1QCPA 4MG3A 5FPSA 4MPVA 2A32A 1SGRE 4ZHAA 1AGJA 3K65B 1W11U 1O5FH 2ALPA 3HGNA 1RTLA 1TNGA 3G01A 2Z94A 3I78A 4AGKA 4O3UA 3P17H 3E90B 4OS5A 2NU2E 3LT3A 2R0KA 6GCHF 3M5NA 3DT0H 1DITH 3T29A 1XKBC 5ABWA 3S9CA 1FAXA 1QB9A 3GCHB 4DY7B 2SGFE 1A3EH 2C4FH 4BANB 2BOHB 1C1SA 1QIXB 2TBSA 4GCHF 3A89A 1EPTB 2GDEH 8LPRA 1TA2A 1GHWH 1E37B 5GXPA 1LKBA 4LZ4B 4Z0KA 1J17T 1GHAF 4DJZB 2J94A 2BY9X 4BTIB 4JK5A 2HPQH 4F49A 1O3AA 3RXMA 1AUTC 1HGTH 1UVSH 2BZAA 1K1LA 1KLJH 2BDAA 1KTSB 2GVFA 5J4QA 3BEUA 2BD5A 1T4VH 1DY9A 1YP9A 3SNDA 1SGEE 4I8LA 2ZFSA 2BDCA 4Y76A 3GISB 2ZHEH 2Y7XA 1O2VA 1HAYB 1O35A 1N6XA 5L6NH 4Q7YA 4GVUA 4D9RA 3TH3H 3AAVA 4JMYA 1EOLA 1P57B 2G52A 1TNKA 2FLBH 4Q7ZA 2AIPA 1O3IA 3A80A 1BMLA 3O8RA 1O3EA 2BVXH 2ZDLA 2OBOA 4GHQA 1G3EA 3GY4A 3MMGA 2ZO3H 4GUXA 2ZG0H 2IOTA 2CF8H 3ZZ8A 1XUHA 1VCPA 2ZFFH 1GGDC 1UK4A 1W13U 5F6MA 2R3YA 1A0JA 1GGDB 4FUFA 4BAHB 5EQQA 4ZKNU 1DICA 2UWOA 2OC0A 5FPYA 1S5SA 2FIRH 1AB9C 1QBNA 4WXIA 1Y3YA 2A5IA 1V2MT 2SGDE 3H7OA 2OC8A 1ZPBA 4FUBA 1Q3XA 3M3SA 5JB9S 2Z9GA 1MAYA 1TNJA 2P93A 5T6GA 3HK3B 1QA7A 1VITF 1EAUA 2XCNA 3AVZA 3ZZ6A 2V6NA 4GCHG 3H7TA 4B2CA 9ESTA 2TRMA 3D23A 4ABJA 1XXFA 3GDUA 2AH4X 3MOCA 3GY2A 3PWBA 4B2AA 3SUGA 1NTPA 3FZZA 1P0SH 3RXSA 1NU7B 1ANCA 4SGAE 1TQ7B 1A4WH 1Z8GA 1FY8E 3OTJE 1HXFH 1AZ8A 1EATA 3SNCA 1Y3XA 3UWIA 3ATIA 3PROA 5FBIA 2QN5T 5A0CA 1AFQC 1GBKA 3RU4E 2WPMS 4K8YA 3LIWA 4FUEA 1CT2E 4X2XA 1F92A 1P03A 1ESTA 3DA9B 3DFJA 1G3CA 1EPTC 1MD8A 2VJ1A 1VCWA 4WWYA 1O30A 1PPFE 2BD7A 1W0ZU 1GJ6A 1TX8A 1QTFA 1AFEH 5C20A 3RXUA 2FLRH 2W26A 1O2XA 3LGTA 4NFFA 1CGIE 3K6ZA 2YNAA 2FTMA 3BTKE 4E7NA 1C5WB 3LJJA 2JETC 4X2VA 4BAMB 2FOFA 1NRRH 2P3TB 1TNIA 2GMTB 1WSSH 3UOUA 2WPHS 3A7XA 4JZDH 4X2WA 1O3NA 1O5GH 3A8DA 1BOQA 5EQRA 1QB1A 2BD4A 1ELFA 1GHYH 1B7XB 1DY8A 3ENSB 5CE1A 3E8LA 1D3QB 4E06H 1ID5H 3RXLA 4NGAH 2H9HA 2BDYA 1SLUB 4OS1A 3EDXB 1Y3UA 1ANDA 2ZDAH 1ABJH 4NFEA 5GCHG 3A81A 2F3CE 1GCTC 2OBQA 2BLQA 3MNXA 1Y8TA 8ESTE 2BX4A 1BA8B 4BAQB 2ZC9H 1GJBB 1FNIA 1GI7B 2FI4E 2BY6X 5CHAC 3KN2A 1BRBE 1RTKA 3S69A 2J92A 1SMFE 2ZU2A 1O2HA 1K1NA 1CGJE 3GYMA 3BEIB 4A5TS 2YNBA 2BY7X 1C9TA 3BG4B 1BMAA 5DJ7A 1RTFB 3ZZCA 1HCGA 3TJVA 1AY6H 1FI8A 8GCHG 2P16A 1F2SE 1O2RA 2FWWA 1PPEE 1GJ9B 1PPZA 1P2QA 1QQ4A 1GMHG 1HAIH 3CS7A 3UOPA 2PTNA 5F8ZA 1GHVH 1K9OE 3CP7A 3KHVA 1HJ8A 2SGQE 2F9VA 3PMBB 3F1SB 2ANYA 2XBXA 1BHXF 3UUZA 4MNVA 2FXRA 1TE0A 3O8DA 4FXGH 1ZYOA 4YZUA 2B8OH 1L0ZA 3TNSA 1KDQB 1TX7A 1PQ7A 2CJIA 1YPEH 1GVZA 3PMAB 2Q1JA 1L1JA 2EI8A 2SNWA 3MNCA 3SHCH 7GCHG 2ZI2H 7GCHF 1MBQA 2ANWA 2PUXB 2WPIS 2BHGA 1EZUC 1LQEA 5DK1A 1OWIA 3ZVGA 2RA0A 4I8GA 5LPRA 2QXIA 2B0FA 2WUCA 1O3GA 2ZCHP 4WJG2 5FCKA 1YF4A 1Z1JA 1O2PA 7ESTE 4RSPA 5EPYA 5AFZH 3S9AA 4B1TA 1P01A 2BQ6B 6LPRA 1XKAC 1LO6A 1LPZB 1C2IA 4X6MA 1ZJKA 4X6OA 4J1YA 3S9BA 1OP8A 3KCGH 2QXGA 3BTTE 3FFGA 3BEFB 4TPIZ 2PUQH 1TRYA 4WMDA 3D65E 1U6QA 1EQ9A 2P8OB 3LU9B 4XFQA 3RXTA 1V2VT 4ABHA 1S6HA 3GY7A 4UE7H 1PJPA 2PKAB 2CHAC 2ZA5A 4AOQA 4WVPE 5LPFA 2XC0A 1FY1A 1IQNA 1RIWB 4CH2B 1C2KA 5E2OA 1MTNC 1SGFG 3SORA 3I29A 2FM2A 2YOLA 3MH4A 1J14A 1TGTA 1GI9B 1TOMH 2ZPSA 1Z6JH 1EAWA 3JZ1B 4Y8XA 4IC6A 1GJ7B 2F9PA 1CE5A 2KAIB 5H4IB 1H4WA 1JRSA 2RCEA 3KNXA 4H6SB 1YPHE 1ZSLA 4B71A 1FV9A 1BHXB 2WPLS 1P3EA 1CA0B 2XBWA 3TITA 2A7JA 2H5CA 3SJKA 3IG6B 4CH8B 1MCVA 3LGIA 3Q76A 3V3MA 2C3SA 4FU9A 1G36A 4IGDA 2HLCA 5EODA 1ELTA 4ZROA 1HAVB 6ESTA 1ETSH 1L4DA 2UWLA 1GMCF 1WCZA 4UFEH 1QJ1B 4U32A 2BY8X 1QFKH 4R0IA 3ZVEA 3RMLH 3ZZ7A 1C4Y2 4XDEA 3E16B 4YT6H 1S0RA 3Q3KA 4R8TB 3NPSA 3T25A 3ZVFA 1AVGH 1SOTA 1V6DA 2G51A 3PV4A 1IQMA 2B5TB 1D6RA 1C2FA 1KSNA 1ANEA 1GMHF 2G8TA 4FU8A 2QA9E 3HPTB 4XBDA 4ZMAH 1LVOA 2QF0A 2O8MA 3D62A 1SFQB 1D9IA 1NFWA 4J2YB 2G00A 1O3KA 1WTHD 2H1UA 1HAZB 1P04A 2OLGA 1DPOA 1BTWA 2Z3CA 4ZKOU 1DM4B 1F0RA 2F83A 2XW9A 2AGIX 4KTCA 2FOEA 1TABE 2ESTE 2XBYA 1G3BA 1CBWB 1THSH 3FP6E 1AE5A 2ZDVH 4KELA 2Y7ZA 2ZHFH 3U8OH 4XE4A 1BTUA 2UUYA 1CU1A 5T3HA 1XUGA 1QHRB 1IQHA 1OS8A 3ATKA 1HNEE 1C2MA 3ZVAA 1NROH 1V2LT 1GI3A 2XWBI 1N6YA 1Z8IB 3M61U 1IAUA 1OP0A 2BD2A 4H4FA 1GBLA 2PV9B 1O37A 1H8IH 2AS9A 2H9EH 3UNSA 3UNQA 1DWBH 1KLIH 3BIVH 4NIXA 1AI8H 2FESH 3SNAA 2GGVB 2FEQH 2CMYA 1Y3WA 3T62A 3M36A 4M7GA 1F5KU 1J15A 1AZZA 3PLBA 1THPB 1SLWB 1TPAE 3TU7H 3ZYEA 1EPTA 1TRNA 1BBRE 2FOAA 1GI5A 3SUEA 3S7HB 3M37A 3MU0A 1T8LA 3IITA 4AGJA 2NU1E 1Y59T 1LTOA 4X6PA 1QB6A 7LPRA 3AAUA 4JYUH 4ABEA 2FZZA 1SG8B 2F9OA 2VVVA 1TPSA 1O34A 2BD8A 5JBAS 4H6TA 1HUTH 3HKIB 3LJOA 1ZRBA 2BLWA 2HGTH 2QXJA 1C2DA 1P05A 3ZVDA 2STBE 1OPHB 4CRFA 1AMHA 3VXEH 1ZZZA 1SC8U 1GJDB 1TBZH 1ANBA 2FPZA 2Z3EA 1LKAA 4YLQH 2FDAA 2WYJA 4ASHA 1KXCA 4RN6A 4ZAEA 4DIHH 1HLTH 1GHBG 2AYWA 1P10A 4ISNA 1XMNB 3TLOA 1AO5A 1S84A 1BRCE 1G37A 4X8VH 1FAKH 4VGCC 3F9GA 5FPTA 3Q3XA 2VWNA 4Y0YE 2D26C 3K6YA 3PLPA 4AYVB 2BDHA 3BTGE 4NCYA 1RXPA 1UK3A 1CQQA 4ABFA 2CGAA 1SB1H 7KMEH 4NA9H 1AVXA 1HBTH 3QDZB 1GPZA 2GZ9A 2GDDA 4THNH 3A8BA 2OQ5A 4X2YA 1FN8A 3SW2B 1OX1A 3VGCB 4WMEA 1BTXA 2SNVA 4DVAU 1W2KH 3A7YA 4FUIA 3A85A 3GCTG 1O2OA 1YYY1 3SV7A 2ASUB 2GX4A 2PFEA 2PW8H 2ZECA 1RS0A 1PYTD 1PPHE 2FOMB 1SQOA 1BQYA 3SU0A 4AFQA 4GPGA 3MTYA 4GLYA 1NRQH 1W14U 2FS8A 2ZGXH 4CRAA 3PMJA 1BRUP 2FX6A 1WYKA 1C1PA 1DDJA 1D6WA 2FI3E 1LVYA 1P8VC 1Z71A 2HOBA 4X0WU 5F8XA 3GOVB 5C2ZA 1K28D 3SOSA 1K21H 2HPPH 3SQHE 5A09A 3FVFB 4ABGA 1C5VA 3PYHA 1CO7E 4ABBA 2VGCC 1NRSH 3MI4A 2VWMA 1T32A 3HKJB 5C1XA 1GL1A 3QTOH 4HI3A 1BDAA 1EP5A 4Y6DA 5F8TA 4FUCA 1C1NA 5C5NA 1AIXH 2SGAA 1QR3E 2V3HH 5C1UA 1M9UA 1MMJN 2XRCA 2G4TA 3DHKH 2ZP0H 1QURH 4NA7A 5GJ4B 4YLUA 1O3CA 3ZYDA 1C5PA 1A5GH 1X7AC 3S7KB 1F5LA 1SLXB 4GHTA 5ETXA 2HNTF 3LC5A 1NZQH 1C5QA 5EXLA 1D3PB 1C1MA 3V0XA 3QGNB 4K8BA 1Y5AT 3QUMP 1QL7A 2ODQA 1FMGA 4PROA 3K9XB 5E8EH 1EZSC 2B9LA 3T28A 1BUIA 3ZZ9A 4ZHLU 4XBCA 3SU3A 1O32A 2R2MB 2VIDA 1E34B 2A2XH 1C5UA 3BF6H 1MKWK 1O2UA 4Y8YA 1H9IE 3SBKA 2Z9LA 1YKTA 2FTLE 3MH6A