1C1RA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1rA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1rA02
1H9HE 2CMYA 1V6DA 2Y81A 1IQEA 1QJ6B 1SGNE 1THRH 3S9CA 3ODFA 2NU1E 5EOKA 3RXGA 2WYGA 2QY0B 3RLYH 5DP9A 1DITH 1HAZB 4Y7BA 5F8ZA 1MU8B 4A1TA 2G5VA 5GPIB 5AF9H 2BD4A 4NFEA 1K22H 4NWKA 1GBBA 3BTDE 1ZSLA 1O3CA 3A8CA 2RG3A 2CF9H 2ZQ1A 4F49A 1YBWA 1BB0B 4HZHA 5I25A 4OGXA 3FVFB 2BD7A 4LXBH 1S6HA 4X6PA 2RA3A 2HGTH 3MNSA 1Q3XA 1Y3WA 2BD5A 4ZKRU 1GBLA 5EXNA 3SNAA 3HK3B 5C1XA 1TBZH 1AVWA 4INKA 3UTUH 3F1SB 3SV6A 1JRSA 1UTPA 5EQRA 4X6NA 1ID5H 1QTFA 1NZQH 5DP4A 1HV7A 1MKWH 3SU4A 3ATLA 2FTLE 3SGQE 3AW1A 1A46H 4D9RA 3KF2A 1SLWB 2QF0A 1QR3E 2I6SA 2ZTXA 3VB5A 1N8OC 2J34A 1SGTA 1V2TT 1BTYA 3A8AA 3PO1B 2BD9A 3O8CA 1UTQA 3TH2H 3TNTA 1Z1IA 4DGJA 2SGQE 4XSKU 5T3HA 1KXBA 5JBBS 5A09A 4JYVH 5E0JA 1EPTC 1NY22 4BANB 1C2MA 1C2EA 2A2XH 1VR1H 3BTGE 4K69A 3MU4A 2SGFE 1WQSA 2RA0A 1VGCC 1RRKA 3PROA 3ZZ8A 1FIZA 1SBWA 4OGYA 1DT2A 1HIAA 1Z8GA 4DW2U 1IQKA 2O8MA 3RMNH 1S6FA 3RXKA 2FZZA 2AIPA 4CRDA 1EATA 1P12E 2AS9A 1LTOA 2PWXA 2C8YB 2FOCA 4UFDH 2G8TA 4Y0YE 4FU7A 4FUIA 1GJDB 4B73A 1HJAB 1C5YB 2A7JA 2VIVA 2BX4A 3EAJA 1ZHRA 4MPVA 3EGKH 2OP9A 4WJG2 1J9CH 2UWOA 4UEHH 1J8AA 2J9NA 2JH6D 5EXLA 1KY9A 1C5LH 3VB6A 3UY9A 2VH0A 4WH8A 1HAVA 1P09A 1A0HB 1Z1JA 3BTTE 4Y6DA 1IQGA 1WTHD 4I8JA 3KL6A 1TIOA 3ZVGA 1P2KA 4B2AA 3M5OA 4M7GA 4X2XA 5BPEA 1BJUA 1QRZA 4FUJA 1YKTA 2FOGA 1BTPA 3B8JA 1J15A 4UFGH 4ABGA 1SG8B 3A89A 3MI4A 3SNCA 2ZCLP 2R3UA 5CMXH 4AB9A 2GV6A 1PPEE 1SB1H 4WWYA 4CBNA 5JBCS 3MU8A 1F5KU 2B0FA 3BN9A 3M3TA 4E06H 1V2LT 1K9OE 1Z6EA 1O2IA 4FUFA 1ZLRA 4ZUHA 1AO5A 1GHXH 4MNYA 4XOJA 4B74A 1P05A 3TJUA 3SW2B 1HFDA 2LPRA 1SGCA 1IAUA 1TNIA 2PUXB 4MNXA 2H9HA 1C4U2 3P17H 3W95A 3ZVDA 2DUCA 4XBDA 3QTVH 4DJZB 1MBMA 3PMHB 2JKHA 2WPKS 8KME2 3NPSA 4X8VH 2GX4A 3LJOA 1PPBH 1YF4A 2OINA 4GLYA 1ZGIA 3MU5A 5DP6A 8GCHG 1NFUA 3M7UA 5JBTA 1AE8H 1ZRBA 3SN8A 3KCGH 2FI3E 3LGIA 1C1TA 1UJ1A 1LMWB 1BOQA 2Z9LA 3I78A 2AH4X 3RXDA 1GI2A 2JETC 3MYWA 2XBYA 3SU0A 2G4TA 2BDGA 1ELEE 2B7DH 1XM1A 5T6GA 5A8YA 3H7TA 3VGCC 2OTVA 2A5IA 2BQ7B 2VIQA 1UCYK 2XCFA 1BTHH 4A6LA 4BXWA 1W12U 1MTNC 2HVXA 3MNBA 1KTTB 2G5NA 1MTUA 1ZGVA 1JIRA 4H6SB 3UREA 2ZKSA 2IN2A 4K5ZA 2ZF0H 1O3KA 1GI9B 1W7GH 3RC5A 3U8OH 2ALVA 3ZVBA 1T8NA 1C2LA 3SU5A 1GBKA 4DIIH 5T6FA 1SQOA 2FI4E 1FAKH 1UTMA 1W14U 2QIQA 1TBRH 1WV7H 5ABWA 1IQLA 3TK9A 1AY6H 4X1PU 1S5SA 5L2YH 1H9IE 1SGFG 5A0BA 2OXSA 1AKSB 4SGAE 1TALA 2AFQB 2O8WA 1G36A 1P3CA 1O2MA 2A1DB 1TRMA 2XC0A 1IHTH 1O3MA 2ZHEH 2P8OB 2OLGA 1JMOH 1EAXA 3OU0A 3M3VA 4FVDA 1Y3VA 1JOUB 1ELFA 1MKXH 1C2IA 1GJ5H 4K3JA 2FYRA 5EGMA 1A61H 1GJ4H 1BRBE 5F6MA 5C3NA 3M61U 4ABDA 1DPOA 2ZO3H 2FM2A 5A0CA 1RXPA 2TGAA 3ZZBA 1FQ3A 1H8IH 2RDLA 1TB6H 1SFIA 4YOIA 1FIWA 3RXTA 3RXRA 2ZU3A 1SQTA 1GBAA 1ZMNA 3SNEA 1Z8RA 4JZDH 4YLUA 1ABIH 1OWIA 1C5QA 1B5GH 2A4OA 2HNTF 2ESTE 1KDQA 1FLEE 3H7OA 1FUJA 2H9EH 2HPPH 2ZCKP 1D4PB 1AUJA 3F9HA 3GY8A 2NU2E 4CRBA 3SQEE 2PGQB 1MTWA 2V35A 2Z9JA 1A3EH 1O5BB 1FN6A 4I33A 4D7GA 1TOMH 4AB8A 1MZDA 2XWAA 1HNEE 1L4ZA 3QUMP 3ESTA 1A5HA 1Z7KA 3PV4A 3AASA 1LHDH 1HJAC 1OOKB 1W7XH 3MH5A 5JDUB 1C5VA 1T4VH 3TLOA 1TQ7B 1O2SA 3ZVCA 3SORA 1HYLA 1VCPA 1O2JA 1A5GH 1S85A 2AMPA 1GI4A 1CHOF 1EQ9A 1FZZA 1QJ1B 4ZKSU 4MPWA 1WTGH 1NRNH 1YM0A 4B76A 1C2JA 3MO3A 1C5OH 2ZPSA 1QY6A 4NIVA 2H5DA 1Q2WA 4BAQB 3GOVB 4NWLA 2Z7FE 3GY5A 2A32A 1GGDB 1V2RT 1GPZA 4XBBA 2P93A 3P95A 3N7OA 2VGCB 5EODA 2H1UA 3SV9A 2AYWA 3RC6A 1JRTA 1EKBB 1ETRH 1LHGH 4KTCA 3AAUA 3KNXA 3TGIE 3KN2A 1A7SA 1A4WH 3P92A 4WMDA 3B23B 3M3SA 1T31A 3UPEA 1SGEE 2VINA 3KQEA 3BIVH 3MO6A 3RDZA 1JIMA 3SQHE 1LHCH 2ZDVH 2FS8A 1AUTC 3U98H 1TLDA 2B9LA 2A2QH 1P9UA 2NU0E 1LKBA 4CBOA 3MH7A 2ZGJA 1L1JA 3LH1A 3A88A 1CA0B 1AKSA 5EPYA 1O2LA 2PTCE 3BTQE 6ESTA 4K1EA 1FXYA 2THFB 5CE1A 3DUXH 1O3HA 2CV3A 2EA3A 3RXCA 1C5ZB 4R8TB 1P9SA 1PFXC 1EASA 4AX9H 1DLEA 3PLKA 4B2CA 3PLBA 3MU1A 1BHXB 4CR5A 2XW9A 1C1OA 3T27A 1DXWA 2J2UA 1BZXE 1CGIE 1VJ9U 4FVBA 4DIHH 1P2QA 4A1VA 4I7YH 1UK3A 3U69H 1S0QA 1Z6JH 1YPKH 1GI0A 4YZUA 2ZU1A 3VB3A 3R0FA 4AORA 1VCWA 3SJ9A 4YT6H 1FMGA 1K1MA 1F0TA 3U1JB 2G4UA 4CH8B 3O8DA 1DWDH 1KLJH 1UHBB 3W94A 3TK5A 1P06A 2CHAB 1INCA 3Q76A 4NGAH 2J95A 3RMLH 2VWMA 2ZU4A 2ZFPH 3A7ZA 1IQIA 1DSTA 1QL9A 5DPAA 2SNVA 2BTCE 1SFQB 1UCYE 1UO6A 2BVRH 4YESB 4X0WU 3L33A 3RXLA 4RKJB 4MPXA 1E38B 1V2PT 1ARBA 1K1IA 1RTLA 2ZHFH 1O3JA 1O2VA 3KGPA 2PW8H 3SGAE 3SNDA 2W5EA 3GY2A 3GYLB 3CENA 2BDAA 1HUTH 2H2ZA 3BSQA 4AGKA 3SV7A 1VITF 3RUOA 3ZYEA 3MOCA 2BLQA 3EE0B 3DA9B 1YC0A 3M35A 2Y7XA 3MTYA 4MPUA 1BHXF 1SC8U 2FOAA 1SPJA 3A82A 1YCPH 1C1QA 1V2OT 1LQEA 2NU3E 1HAGE 1MZAA 1TX8A 1NM6A 4FUBA 5L30H 3SNBA 4D9QA 4FU8A 5AFZH 3OX7U 1CSOE 2Q6DA 4CRGA 1C5RA 1O5FH 4JYUH 1O38A 2QV1A 1HAPH 1O5DH 1GBDA 4X1NU 4QT8C 3QO6A 3EA7A 1W3CA 2HOBA 1ELAA 3JZ2B 5HGGA 3TIUA 3V7TA 3M5NA 1HBTH 1P0SH 4KTSA 1THPB 2GCTB 2BX3A 4NA7A 1C2KA 2QXHA 3A8BA 3BTME 1QB6A 1ORFA 1BRAA 1AI8H 3ATKA 5AHGH 2NU4E 5AFYH 3SHCH 5DKMA 4I32A 1T8OA 4ZKNU 4TYDA 2UUFB 1A1RA 1BT7A 3EDXB 1SOZA 4Y10E 3GISB 4GVUA 3MH6A 1QQUA 1WYKA 1V2KT 3M5LA 2FDAA 1DY9A 1G3DA 1LDTT 1XVMA 2HPQH 4Z6AH 6LPRA 3RM2H 1TAWA 1O5EH 5FCRA 2GD4B 5CHAC 1ZSKA 5E2PA 3BTKE 1UTNA 1FY3A 2BY8X 2HNTE 3OY6U 5GCHG 5T6DA 1B0FA 2AMQA 1EJMA 1GHYH 1GGDC 1SHHB 4UDWH 2PV9B 2BOHB 1BMNH 1CHOG 2QF3A 2A4RA 5DO4H 2C3SA 3UFAA 1O2WA 1SOTA 3QGNB 1C1PA 2Y5HA 1QFKH 3LGVA 4VGCB 1V2ST 4NIYA 2EC9H 1OP2A 5FX6A 2GMTB 2BY9X 2ZHDA 1AMHA 4FUHA 2ASUB 5EW1H 1XKAC 4RKOB 1W8BH 4X2WA 2ULLA 3URDA 1OP0A 2R9PA 4OS4A 3URCA 3BEFB 1ZTLA 1NFWA 4PROA 3SJIA 2Z3EA 3RLWH 2C8ZB 4I8KA 1LKAA 2H6MA 1FDPA 3LOXA 1ETSH 5LGOA 3BF6H 3ZZCA 1PPHE 3LONA 1SSXA 3TH4H 2Z9KA 2ZZUH 2R0KA 1P57B 2WV4A 4A92A 1IOEA 2OCVB 1D6RA 1NC6A 2JH0D 1LPZB 1SGFA 4AN7A 1ELBA 3M5MA 1PYTC 2A45B 1QA0A 2QGRA 1B7XB 1L1GA 1JWTA 1C5MD 2WPMS 4TPIZ 2ZCHP 1K2I1 1V2MT 1HJ8A 3RXSA 3A87A 1KTSB 1OS8A 2Y6TA 4NIWA 1O2ZA 2PKAA 3HATH 1BDAA 4YLQH 3M36A 4BTTB 2OC1A 1EOJA 4IW4E 1O32A 4E7RG 2CXVA 4KKDA 1WSSH 1PYTD 1TA2A 1OXGA 1QIXB 3A80A 2GCHF 2FX6A 2C93B 2D8WA 3OY5U 2AERH 1HAHH 2F9VA 2ZPRA 3SOSA 1TPOA 2XTTB 1DX5M 4THNH 1AN1E 1C5TA 2P3TB 1J14A 3BTFE 1SGQE 2GZ7A 1BCUH 2TIOA 4MLFB 1RTKA 1IQHA 2JH5D 3NKKA 2FOMB 3VB4A 3VFEA 1ESBA 2GP9B 2QXGA 4JZEH 1NESE 1O2RA 3T5FH 3UUZA 3KHVA 2WPHS 4LZ4B 1E37B 1QBOA 4K2YA 3SV8A 1O5CB 1LPGB 4JZ1A 2W26A 1XKBC 3GCOA 2G55A 1EZXC 2J94A 3ZYDA 1QB9A 1EB2A 2AGGX 1L2EA 1VJAU 4D7FA 1ZR0A 4Y8ZA 1T8MA 4AZ2B 1GL1A 1FONA 3EA9A 3LPRA 1LHEH 2FEQH 1T8LA 4SGBE 3HKJB 1ARCA 2HWLB 3SUFA 3SGBE 3SU2A 1O5GH 1C1WH 1GHBF 1K21H 3HKIB 1LHFH 1C2HA 1W0ZU 3RXJA 1B0EA 1OWHA 1O2QA 1PPGE 1HGTH 2BD2A 4OS1A 1O2YA 1EAUA 1S81A 2FWWA 2SGPE 6CHAB 3SI3H 2PGBB 5DG6A 2OBQA 1NRRH 3GDSA 1RS0A 1BMLA 1GCTB 4ZMAH 3TITA 4FUCA 1A0LA 4WF8A 1FY5A 1GBEA 3VB7A 3RXVA 1BA8B 4DVAU 2PR3A 2XC4A 4KGAA 1HCGA 1VITG 1GMDF 8ESTE 1DANH 2Z94A 3T26A 1PJPA 3T62A 1O2NA 1ANCA 2WINI 2WUBA 7GCHF 1GVKB 4BNRA 1ZJKA 1BRUP 3PMAB 3ZZ6A 1XMNB 4A5TS 5EU8A 2BYAX 2WUCA 3PTNA 2BVXH 1E34B 3FP6E 4ISIH 1YPJH 4BAHB 1C5SA 4Q7YA 2FYQA 1NROH 4XFQA 4ISOA 2BD8A 2BY7X 2F9BH 3GICB 1WCZA 1VZQH 2QA9E 1Y5AT 1ZPCA 2PLXA 2FOEA 3SZNA 3V12A 1FY8E 1PQ8A 4CHAB 1SLXB 2VWNA 3STJA 1MTSA 1K1LA 1N6XA 1MQ5A 1TPSA 1K1OA 1X7AC 1XUJA 4BTUB 5A8XA 3ENSB 1AFQB 4CRFA 4K8YA 4Y76A 2VH6A 4ASHA 3BG4B 2PFEA 3T28A 1DUAA 1Y8TA 2EI6A 2QN5T 2Q6GA 3TU7H 3P8OA 1V2QT 1CHGA 3QGJA 1HAOH 4TY6A 2EI8A 1TE0A 2BLVA 4ISNA 1WOFA 2O8UA 1GDNA 2UWLA 1ZSJA 3U8RH 1SLVB 1CGHA 2ZDNA 1QBVH 1CVWH 1NRPH 3TVJB 2FPZA 4AYVB 2SGAA 3A7VA 3GYMA 3EYDA 4YO9A 5LH8A 1YCPM 1GBJA 2ZFQH 5JB9S 2GMTC 2ZIQH 3K6ZA 6GCHF 1NO9H 1TNHA 1G3BA 1ZHMA 5EQSA 5GIBA 3BEUA 2BB4A 2FOFA 2BDBA 2FX4A 1OP8A 1F2SE 1TONA 3PO1C 3ZVAA 4Y11E 2OUAA 9LPRA 1QBNA 8LPRA 5EQQA 1EJNA 2IOTA 1GJ9B 1MUEB 4ZXYH 2RCEA 2A0QB 1PPZA 3ZVEA 1GHWH 1OWKA 1CBWB 1EJAA 1QCPA 3IITA 1XUGA 2FO9A 5DP5A 1SVPA 2H9TH 1GVZA 2OQUA 4WMFA 3RXUA 3SJOA 5A8ZA 2PSXA 1QL7A 2XXLA 3ZZ9A 3GCHB 1HB0B 1G32B 1AVGH 3ZZ3A 4ZROA 4OS2A 2Z9GA 2D26C 2VIWA 3RXOA 1RIWB 1TFXA 4U32A 1MKWK 1V3XA 3ZVFA 1TGSZ 4CRCA 1LCYA 3STIA 1E0FD 1CT4E 1BJVA 3AVZA 1YPMH 1P3EA 1TGTA 1QB1A 2CGAA 2PKSB 2WPJS 1W13U 1D9IA 3TPIZ 1O39A 2C8WB 4BOHA 2UUJB 1ELCA 2Q6FA 2XNIA 2YNBA 3E8LA 4X6OA 4INHA 5E8EH 2ZC9H 3HPTB 3E91A 2Y5GA 2F91A 3PTBA 5C2ZA 2ANYA 1Y3XA 2G81E 4AOQA 2BMGB 5SGAE 1AHTH 4AG1A 1AZ8A 5FXLA 4DG4A 3BTEE 4B1TA 5GXPA 1CQQA 1H9LB 2UWPA 2Y7ZA 3C27B 2G52A 4WVPE 2GCHG 2PHBA 4B71A 4A1XA 4KP0A 2ALPA 2BXTH 3T2NA 4O97A 3TGKE 4GHTA 1NS3A 2KAIB 4TY7A 3IG6B 2P3UB 2ZTZA 3KQCA 3MH4A 1JXPA 1W2KH 4O3TA 1WU1A 4WMEA 1BTXA 1KXFA 1TNGA 1Y3UA 1DWEH 5FAHA 5ESTE 1GI6A 3GY4A 1GHVH 2Z3CA 1V2UT 4FUGA 3BTWE 3CS7A 4OS5A 3A8DA 5C20A 6CHAC 3SI4H 1Z8IB 2PUQH 4BAKB 5L6NH 1TNKA 1C9PA 2A5AA 1F5LA 2VVCA 3HK6B 1CO7E 2V0BA 1YPHE 3A7TA 3QZQA 1C1UH 2WPIS 3SV2H 1GBCA 1OYTH 1HAYB 1UVTH 1BQYA 1GMHF 1OWJA 3DT0H 1ZMJA 1GDQA 1Y3YA 4Q2KA 1N8OB 3OTJE 3BTHE 2YOLA 1C5NH 1BTZA 1SI5H 1TWXB 5C5NA 3LGYA 3PMJA 4X1QU 5GDSH 1QGFA 5DP3A 4UFFH 2FI5E 1RFNA 1TOCB 1QRWA 1SMFE 5F8XA 1TABE 1EPTB 2ZNKH 2OBOA 1TBQH 1OWDA 1NPMA 3RU4E 3M7TA 2W7SA 1TX6A 1W11U 2ZHWH 3R3GB 5C67A 1SL3A 1VGCB 1GMDG 4Y7AA 1O2HA 4BAMB 5DK1A 2ZGCA 1H1BA 1O2PA 7GCHG 2HNTC 4TWWA 4BAOB 1TMTH 1TMBH 3UWIA 2M5TA 2AGEX 4U2WA 3GY6A 2BVSH 2XBWA 1GBIA 2FP7B 5FBEA 1F0RA 1IHSH 2ZG0H 2J4IA 3F68H 2GT7A 1AQ7A 3SHAH 3UWJH 1QL8A 2GZ9A 2VVVA 1DLKB 1AFQC 5B6OA 1QJ7B 2ZQ2A 2TGTA 2FIRH 1GJAB 3A83A 1C5XB 4XE4A 1C2DA 1O3IA 2GKVE 4MNVA 4HFPB 2Z6BD 3K6YA 1AE5A 2XBXA 1QRXA 3UIRA 5L2ZH 3L6PA 2SFAA 4WH6A 2ZPQA 1MTVA 5FPYA 4AFUA 1ANEA 2XC5A 3Q00A 4I8HA 1RJXB 3U1IB 1ESAA 2UUYA 2TPIZ 3F9FA 3L3TA 2TGPZ 2ZGBH 3NK8A 3ATMA 2P8OC 1AFEH 1O3LA 3TNSA 3I29A 1DWCH 3TJVA 1PPFE 4E7NA 5C1UA 1CE5A 2F9OA 1D3PB 1ZRKA 2R0LA 4UFEH 5E2OA 4JZIA 1LPKB 4RN6A 3TJOA 4FXGH 1EP5A 1ZJDA 1W0YH 2FOBA 2NWNA 2Z3DA 5FHTA 4IN2A 3F6UH 1G37A 2ZDKA 1LVBA 1QURH 4J1YA 1HIAB 1UCYH 1YLCA 1Z8JB 3AW0A 2AEIH 2XWBI 2QAAA 2XRCA 2Y5FA 3E0NB 4Y71A 2EI7A 2Y82A 3VEQB 6GCHG 1CT0E 1SQAA 1F92A 2ZP0H 3ZV9A 4GUXA 2F9NA 3B9FH 3MMGA 1O30A 1DS2E 2BLOA 1KXEA 3S0NA 3NXPA 5ETXA 4NG9H 3PWBA 1E35B 1GBFA 4A7IB 1MKXK 2ZFRH 3NCLA 2ANWA 2ZU5A 1CU1A 3E16B 2VNTA 2W3KA 2FOHA 3MHWU 1BIOA 1GL0E 1SHYA 1F0SA 1GI3A 1ELTA 1HAVB 2C8XB 3HGPA 4H42U 1YLDA 5G4BA 2P95A 1IQJA 1EZQA 4CR9A 1BITA 1XUFA 3FZDA 3VGCB 1C2FA 3F9GA 2ZGXH 3JZ1B 1GJBB 2Z9IA 3UR9A 1ZHPA 3TH3H 1MTNB 4ABAA 2AGIX 3PYHA 2VWOA 1GI7B 2HLCA 3Q77A 1SGRE 2GDEH 2O9QA 1AWFH 3RXEA 2BDYA 3ZZ7A 3ELAH 1AD8H 2BZ6H 4H6TA 4Q80A 1DE7H 3K2UA 1C4V2 3P70B 3NWUA 4GPGA 1FNIA 2ZDLA 1Q31A 1DDJA 5HM9A 1LVOA 3BV9B 2QCYA 3SJKA 2BDHA 2FTMA 2P59A 2VGCC 1MQ6A 3DFLA 4NSVA 4WY3A 4ABBA 1W10U 2ODYB 5BRRE 4I8LA 1UHBA 3DD2H 1GMCF 2K1QA 3GDVA 2V6NA 4ZHMU 4JCNA 1RD3B 5F8TA 2OC8A 1EAWA 3LIWA 3E3TA 3WY8A 1AZZA 1O37A 5JB8S 2CJIA 5TCCA 1DWBH 2TRMA 1ZYOA 1QA7A 4HI3A 3U8TH 3UNSA 1KXDA 1OX1A 1UK2A 3FFGA 2BY5X 3H5CB 3SU6A 3V13A 1WUNH 2BD3A 1SGYE 1V2WT 2FMJA 4IN1A 1UVOA 1BMAA 5LPEA 3VXFH 1FPCH 2F3CE 3G01A 1IQMA 2VB0A 1EB1H 4CH2B 1JBUH 1GBHA 3D65E 1CA0C 3FP7E 3SUEA 2VIDA 1KSNA 3PWCA 4TPYA 1G3CA 3LC5A 1OPHB 1TGNA 1ZPZA 5HMAA 1LVYA 1L0ZA 1DXPA 2Q1JA 1A2CH 1P2NA 1NU7B 1CT2E 1F0UA 1O3GA 1FY4A 1K28D 1TRYA 4NFFA 5FX5A 4ABJA 1GMHG 1YPGH 2ZFSA 1P2OA 3ATIA 3FZZA 4MVNA 1KLIH 2ZWLH 1GI5A 4RSPA 2HRVA 2BY6X 3RXHA 3UOPA 1C1RA 3T25A 2BQ6B 1DVAH 1GVLA 2BM2A 3QK1A 1GJCB 2VJ1A 1F5RA 1EUFA 1EOLA 1ESTA 1MD8A 4X8TH 5TCAA 2IJOB 3QWCH 5FPTA 1GBTA 4JMYA 1ACBE 1THSH 1O2KA 1J16A 2P3FH 4CRAA 5I46H 1O3FA 1P02A 2CHAC 3LJJA 4AG2A 4LZ1H 2YNAA 1EXFA 3ZZ4A 1O2UA 1UTOA 3BG8A 1EZSC 1ABJH 5J4QA 1TPAE 4IC5A 1O36A 1YPEH 1KLTA 3D23A 2BDCA 3V3MA 5JBAS 1NFXA 1T32A 1ZMLA 1MBQA 3E1XB 5EPNA 1DY8A 4Q7XA 4X1RU 3M37A 4K8BA 1G9IE 4X2VA 5HM2A 1KIGH 4GSOA 1NRSH 1XUKA 1L4DA 3QDZB 4JZFH 1NRQH 1C1SA 1S83A 1DFPA 4ZH8A 1XXFA 3PMBB 1S0RA 1K1JA 2BDIA 5E0GA 1C1MA 4ZXXH 1DUEA 2ZI2H 2A7CA 5DGJA 5JPMH 1P11E 1O2OA 1C1VH 1KDQB 4DY7B 1NU9A 4NZLA 1P8VC 5LPFA 1V2JT 2FLBH 2G00A 1KXCA 4ZHLU 1O2XA 3ZZAA 2B8OH 3IWMA 1XXDA 1PQ5A 1V2VT 3RC4A 1UTKA 4X1SU 3SUDA 1SLUB 2SGDE 2ZDAH 3EA8A 4UD9H 3RU4T 1ZTKA 1D3TB 1EZUC 1N6YA 1LQDB 4ABFA 1BTWA 1PQ7A 1SGPE 2FXRA 4ABHA 1D6WA 1TQ0B 2WYJA 1J17T 1O0DH 3QX5H 5DJ7A 4GAWA 7KMEH 1T7CA 2BQWB 1AB9B 1GDUA 4ABIA 1K1PA 5EXMA 3A81A 5HYOA 3FP8E 3TK6A 2BLWA 1P03A 4D76A 2Y80A 4E05H 1ETTH 1ZPBA 3E6PH 1O3NA 3A86A 3KIDU 1O35A 1BBRK 1MU6B 1OKXA 4IMZA 3LGUA 1NN6A 1P01A 3ZV8A 4R0IA 2GCTC 3UR6A 5H4IB 4GCHF 1HAIH 4MTBA 1G30B 2GDDA 4YOJA 1AGJA 1HRTH 2ZGHA 3PLPA 1O34A 3TGJE 1YCPK 1YPLH 2BXUH 1M9UA 4FUEA 2DE8A 1HAXB 2WPLS 3P8NA 3Q3YA 4YM9A 4AFQA 2G51A 3KEEA 5K7RA 2P94A 1QNJA 1TA6A 1GJ7B 1P2JA 5TJXA 1BRCE 1N1LA 1DICA 2TGDA 1TGBA 3QTOH 5IYTA 4AFSA 5ESBA 2W7UA 1C4Y2 2I6QA 1FV9A 1CGJE 4K60A 4XDEA 1YPHC 3OYPA 2VVUA 2DE9A 3LDXH 1Z71A 3ZZ5A 3P6ZB 3PM3A 3QZRA 1C1NA 2ZHQH 3CP7A 1C5UA 1SGDE 7LPRA 3K65B 4VGCC 1G2MA 3P8GA 2QYIA 3RXMA 2V3HH 1DM4B 1VITH 3LKWA 2FESH 3OSYA 1D3DB 1VCQA 3LC3A 1U6QA 2WV5A 4OS7A 1SR5C 4MQAA 1BMMH 1DSUA 3VPKA 1FY1A 3GCTF 1C2GA 1E36B 3LGTA 2CN0H 2GVFA 1FN8A 1UVSH 2ZEBA 4UE7H 1WQVH 4U30A 3DHKH 1GMCG 3GCNA 2UUKB 1GHAF 1AIXH 3LH3A 5IDKA 2VU8E 4IMQA 4NCYA 2O8TA 5PTPA 3RU4D 2ODPA 3MO9A 2SGEE 3A7YA 3MNCA 4Q7ZA 3RMOH 1HLTH 1GG6B 2R2MB 5JYIA 3MFJA 3S9BA 4KTUA 4X2YA 1ELGA 5F03A 1TRNA 1ELVA 3A7XA 1A5IA 4AYYB 2BOKA 1NT1A 2IPHA 4JYTA 1OSSA 4H4FA 2QXJA 2ILNA 2BHGA 1UTJA 1TPPA 3QN7A 1ANDA 3MU0A 4KELA 2QC2A 2QXIA 4NZQA 1EP6A 3C1KA 3M7QA 3SU3A 1WAYB 3MNXA 2R3YA 1YYY1 1O3EA 3RMMH 2FODA 4FU9A 3S7HB 3RXIA 2FLRH 1H4WA 1YP9A 2ZA5A 3TJNA 3O8RA 1MAXA 1XX9A 2FS9A 2GV7A 1A3BH 2ZFFH 3AAVA 4TWYA 2AMDA 1GWAA 4YOGA 5DP8A 1O3PB 5GCHF 1G2LA 3UNRA 1DOJA 4NSYA 4O9VA 1O5AB 1GJ6A 3D49H 1Y5BT 1PQAA 3E0PB 1P2IA 4F4OC 3NUMA 4HGCA 5CHAB 1ELDE 1SGIB 1GHZA 2XYAA 2W3IA 2A7HA 2OD3B 4ESTE 4I8GA 4O3UA 1FPHH 4BXSA 1O3BA 3RP2A 4IBLH 1P2MA 3D62A 1S84A 4K1TA 1G3EA 2F9UA 2H5CA 3SU1A 4X8SH 2J92A 2C4FH 5HXFA 7ESTE 3RM0H 2TBSA 1GBMA 2LNCA 2ZU2A 3S69A 3K9XB 1GCTC 1UVPA 2F83A 3KQDA 5FPSA 1GHBG 1K1NA 1UMAH 4LOYH 3RXFA 1O2TA 1V2NT 5A0AE 9ESTA 1TGCA 3A85A 5EG4A 2R2WU 1XVOA 2J38A 1MCVA 4DT7B 1P10A 4HTCH 3A7WA 4YTAA 1OWEA 4JK5A 3RXBA 3CS0A 1UTLM 2O8LA 1OYQA 2PTNA 2F9PA 1XUHA 5C5OA 1O31A 2ZTYA 1C9TA 2SNWA 4WXIA 4Y8XA 1D3QB 3GY7A 1AU8A 2ZFTA 3P8FA 3Q3KA 4MG3A 1AB9C 2V3OH 4MNWA 1Y59T 4Y8YA 1IQFA 1BUIA 3LGWA 1KYNA 3SO3A 3GY3A 4D8NA 2OQ5A 3S7KB 1MH0A 1T4UH 4ZKOU 1L1NA 5E0HA 1LO6A 2A31A 2ODQA 3ODDA 5A2MH 3SUGA 4NA9H 3U9AH 1GJ8B 3ITIA 3UNQA 4ISHH 4X8UH 5EW2H 1MAYA 3A84A 1QQ4A 2EEKA 4Y79A 5J4SA 1RGQA 1EX3A 4CHAC 2GGVB 2VIOA 4NIXA 4U01A 3HGNA 2STAE 2D2DA 1BBRE 1FJSA 2XBVA 4B2BA 3SJ8A 1H8DH 4GHQA 2D1JA 4CREA 2VIPA 4AFZA 1CA8B 1KXAA 4GCHG 1GI1A 3BG4C 4DCDA 1F7ZA 4UONA 1O33A 4X6MA 1LVMA 3S9AA 1PPCE 3F9EA 3RXAA 1TNJA 2C90B 1O3DA 1ZTJA 2GT8A 1IQNA 3RXPA 1HXFH 2HALA 3T29A 2AIQA 3I77A 3UQVA 1TNLA 4AGJA 2CF8H 2GTBA 5AVDA 1A0JA 1GCDA 2ANKH 4IS5A 3ZZDA 2BZAA 1GI8B 2OC7A 2P16A 4DURA 1C5PA 1HJ9A 1HPGA 3PB1E 5FBIA 3RXQA 4ZHAA 3EQ0H 2A4QA 1UVUH 3SBKA 5K0HA 1MD7A 4NA8A 1AWHB 2A4GA 3Q3XA 4XBCA 1BBRH 2KAIA 3UOUA 1ANBA 1TX7A 1YGCH 3BIUH 2XCNA 4K1SA 2A5KA 4YT7H 1EAIA 3BEIB 1TYNA 1AVXA 2PSYA 2PKAB 4I31A 4DOQA 8GCHF 1C5WB 4ZAEA 4J2YB 1O2GH 3LU9B 5GJ4B 1NFYA 4LK4A 1FAXA 1Y5UT 3DFJA 4Z0KA 2VWLA 4IC6A 1CBWC 5DP7A 1O3AA 3VXEH 1QHRB 4BTIB 1BTUA 3GCTG 1MCTA 3FANA 2ZECA 3NZIA 4Y0ZE 3QLPH 3UQOA 1FI8A 2ZDMA 1P04A 1HDTH 1ZOMA 3GCHC 1MMJN 1GHAG 1GG6C 1XUIA 1UK4A 3O8BA 4INLA 1RTFB 1ZZZA 2OC0A 5LPRA 1RIWC 1TMUH 4ISLA 3FAOA 3LT3A 1S82A 2ANMH 4ABEA 5GWZA 4WXVA 1NTPA 1O3OA 2GZ8A 4O03A 3KQBA 5FCKA 4MDSA 4OS6A 2STBE 5C1YA 2PKSC 2JETB 4B75A 3GDUA 3MWIU 3V0XA 3E90B 2B5TB 4FUDA 1EPTA 1HXEH 4JK6A 4IGDA 3ATWA 1WBGB
chains in the Genus database with same CATH superfamily
1H9HE 2CMYA 1V6DA 2Y81A 5KECA 1IQEA 1QJ6B 1SGNE 1THRH 3S9CA 3ODFA 2NU1E 5EOKA 3RXGA 2WYGA 2QY0B 3RLYH 5DP9A 1DITH 1HAZB 4Y7BA 5F8ZA 1MU8B 4A1TA 2G5VA 5GPIB 5AF9H 2BD4A 4NFEA 1K22H 4NWKA 1GBBA 3BTDE 1ZSLA 1O3CA 3A8CA 2RG3A 2CF9H 2ZQ1A 4F49A 1YBWA 1BB0B 4HZHA 5I25A 4OGXA 3FVFB 2BD7A 4LXBH 1S6HA 4X6PA 2RA3A 2HGTH 3MNSA 1Q3XA 5DN6D 1Y3WA 2BD5A 4ZKRU 1GBLA 5EXNA 3SNAA 3HK3B 5C1XA 1TBZH 1AVWA 4INKA 3UTUH 3F1SB 3SV6A 1JRSA 1UTPA 5EQRA 4X6NA 1ID5H 1QTFA 4FETA 1NZQH 5DP4A 1HV7A 1MKWH 3SU4A 3ATLA 2FTLE 3SGQE 3AW1A 1A46H 4D9RA 3KF2A 1SLWB 2QF0A 1QR3E 2I6SA 2ZTXA 3VB5A 1N8OC 2J34A 1SGTA 1V2TT 1BTYA 3A8AA 3PO1B 2BD9A 3O8CA 1UTQA 3TH2H 3TNTA 1Z1IA 4DGJA 2SGQE 4XSKU 2IPQX 5T3HA 1KXBA 5JBBS 5A09A 4JYVH 5E0JA 1EPTC 1NY22 4BANB 1C2MA 1C2EA 5CDFE 2A2XH 1VR1H 3BTGE 4K69A 3MU4A 2SGFE 1WQSA 2RA0A 1VGCC 1RRKA 3PROA 5FL7D 3ZZ8A 1FIZA 1SBWA 4OGYA 1DT2A 1HIAA 1Z8GA 4DW2U 1IQKA 2O8MA 3RMNH 1S6FA 3RXKA 2FZZA 2AIPA 4ASUD 1EATA 4CRDA 1BMFD 1P12E 2AS9A 1LTOA 2PWXA 2C8YB 2FOCA 4UFDH 2G8TA 4Y0YE 4FU7A 4FUIA 1GJDB 4B73A 1HJAB 1C5YB 2A7JA 2VIVA 2BX4A 1NBMD 3EAJA 1ZHRA 4MPVA 3EGKH 2OP9A 4WJG2 1J9CH 2UWOA 4FOUC 4UEHH 1E1RD 1J8AA 2J9NA 2JH6D 5EXLA 1H8HD 1KY9A 4OM9A 1C5LH 3VB6A 3UY9A 2VH0A 4WH8A 1HAVA 1P09A 2RDEA 1A0HB 3H09A 1Z1JA 3BTTE 4Y6DA 1IQGA 1WTHD 4I8JA 3KL6A 1TIOA 3ZVGA 1YLNA 1P2KA 5T1VA 4B2AA 3M5OA 4M7GA 4X2XA 5BPEA 1BJUA 1QRZA 4FUJA 1YKTA 2FOGA 1BTPA 3B8JA 1J15A 4UFGH 4ABGA 1SG8B 3A89A 3MI4A 3SNCA 2ZCLP 2R3UA 5CMXH 4AB9A 2GV6A 1PPEE 1SB1H 2KX4A 4WWYA 4CBNA 5JBCS 3MU8A 1F5KU 2B0FA 3BN9A 3M3TA 4E06H 1V2LT 1K9OE 1Z6EA 1O2IA 4FUFA 1ZLRA 4ZUHA 1AO5A 1GHXH 4MNYA 4XOJA 4B74A 1P05A 3TJUA 3SW2B 1HFDA 2LPRA 1SGCA 3F2GA 1IAUA 1TNIA 2PUXB 4MNXA 1OHHD 2H9HA 3PRBA 1C4U2 3P17H 3W95A 3ZVDA 2DUCA 4XBDA 3QTVH 4DJZB 1MBMA 3PMHB 2JKHA 2WPKS 8KME2 3NPSA 4X8VH 2GX4A 3LJOA 1PPBH 1YF4A 2OINA 4GLYA 1ZGIA 3MU5A 5DP6A 8GCHG 1NFUA 3M7UA 5JBTA 1AE8H 1ZRBA 3SN8A 3KCGH 2FI3E 3LGIA 1C1TA 1UJ1A 1LMWB 1BOQA 2Z9LA 3I78A 2AH4X 3NRLA 3RXDA 1GI2A 2JETC 3MYWA 2XBYA 3SU0A 2G4TA 2BDGA 1ELEE 2B7DH 1XM1A 5T6GA 5A8YA 3H7TA 3VGCC 2OTVA 2A5IA 2BQ7B 2VIQA 1UCYK 2XCFA 1BTHH 4A6LA 4BXWA 1W12U 1MTNC 2HVXA 3MNBA 1KTTB 2G5NA 1MTUA 1ZGVA 1JIRA 4H6SB 3UREA 2ZKSA 2IN2A 4K5ZA 2ZF0H 1O3KA 1GI9B 1W7GH 1WDIA 3RC5A 3U8OH 2ALVA 3ZVBA 1T8NA 1C2LA 3SU5A 1GBKA 4DIIH 1YWUA 5T6FA 1SQOA 2FI4E 1FAKH 1UTMA 1W14U 2QIQA 1TBRH 1WV7H 5ABWA 1IQLA 3TK9A 4AC9A 1AY6H 4X1PU 1S5SA 5L2YH 1H9IE 1SGFG 5A0BA 2OXSA 1AKSB 4SGAE 2WZQA 1TALA 2AFQB 2O8WA 4Z1MD 1G36A 1P3CA 1O2MA 2A1DB 1TRMA 2XC0A 1IHTH 1O3MA 2ZHEH 2P8OB 2OLGA 1JMOH 1EAXA 3OU0A 3M3VA 4FVDA 1Y3VA 1JOUB 1ELFA 1MKXH 1C2IA 1GJ5H 4K3JA 2FYRA 5EGMA 1A61H 1GJ4H 1BRBE 5F6MA 5C3NA 3M61U 4ABDA 1DPOA 2ZO3H 2FM2A 5A0CA 1RXPA 2TGAA 3ZZBA 1FQ3A 1H8IH 2RDLA 1TB6H 1SFIA 4YOIA 1FIWA 3RXTA 3RXRA 2ZU3A 1SQTA 1GBAA 1ZMNA 3SNEA 1Z8RA 4JZDH 4YLUA 1ABIH 1OWIA 1C5QA 1B5GH 2A4OA 2HNTF 2ESTE 5DSFA 1KDQA 1FLEE 5EJLA 3H7OA 1FUJA 2H9EH 2HPPH 2ZCKP 1D4PB 1AUJA 3F9HA 3GY8A 2NU2E 4CRBA 3SQEE 2PGQB 1MTWA 2V35A 2Z9JA 1A3EH 1O5BB 1FN6A 4I33A 2KCYA 4D7GA 1TOMH 4AB8A 1MZDA 2XWAA 1HNEE 1L4ZA 3QUMP 3ESTA 3N7DA 1A5HA 1Z7KA 1KMHB 3PV4A 3AASA 1LHDH 1HJAC 1OOKB 1W7XH 3MH5A 5JDUB 1C5VA 1T4VH 3TLOA 1TQ7B 1O2SA 3ZVCA 3SORA 1HYLA 1VCPA 1O2JA 1A5GH 1S85A 2AMPA 1GI4A 1CHOF 2LELA 1EQ9A 1FZZA 1QJ1B 4ZKSU 4MPWA 1WTGH 1NRNH 1YM0A 4B76A 1C2JA 3MO3A 1C5OH 2ZPSA 1QY6A 4NIVA 2H5DA 1Q2WA 4BAQB 3GOVB 4NWLA 2Z7FE 3GY5A 2A32A 1GGDB 1V2RT 1GPZA 4XBBA 2P93A 3P95A 3N7OA 2VGCB 3F2FA 5EODA 2H1UA 3SV9A 2AYWA 3RC6A 1JRTA 4B6FA 1EKBB 1ETRH 1LHGH 4KTCA 3AAUA 3KNXA 3TGIE 3KN2A 1A7SA 1A4WH 3P92A 4WMDA 3B23B 3M3SA 1T31A 3UPEA 1SGEE 2VINA 3KQEA 3BIVH 3MO6A 3RDZA 1JIMA 3SQHE 1LHCH 2ZDVH 2FS8A 1AUTC 3U98H 1TLDA 4F48B 2B9LA 2A2QH 1P9UA 2NU0E 1LKBA 4CBOA 3MH7A 2ZGJA 1L1JA 3LH1A 3A88A 1CA0B 1AKSA 5EPYA 1O2LA 2PTCE 3BTQE 6ESTA 4K1EA 1FXYA 2THFB 5CE1A 3DUXH 1O3HA 2CV3A 2EA3A 3RXCA 1C5ZB 4R8TB 1P9SA 1PFXC 1EASA 4AX9H 1DLEA 3PLKA 4B2CA 3PLBA 3MU1A 1BHXB 4CR5A 2XW9A 1C1OA 3T27A 4ZCNA 1DXWA 5EJZA 2J2UA 1BZXE 1CGIE 1VJ9U 4FVBA 4DIHH 1P2QA 4A1VA 4I7YH 1UK3A 3U69H 1S0QA 1Z6JH 1YPKH 1GI0A 4YZUA 2ZU1A 3VB3A 3R0FA 4AORA 1VCWA 3GS9A 3UAIC 3SJ9A 4YT6H 1FMGA 1K1MA 1F0TA 3U1JB 2G4UA 4CH8B 3O8DA 1DWDH 1KLJH 1UHBB 3W94A 3TK5A 1P06A 2CHAB 1INCA 3Q76A 4NGAH 2J95A 3RMLH 2VWMA 2ZU4A 2ZFPH 3A7ZA 1IQIA 1COWD 1DSTA 1QL9A 5DPAA 2SNVA 2BTCE 1SFQB 1UCYE 1UO6A 2BVRH 4YESB 4X0WU 3L33A 1YY3A 3RXLA 2W6ID 4RKJB 4MPXA 1E38B 1V2PT 1ARBA 1K1IA 1RTLA 2ZHFH 1O3JA 1O2VA 3KGPA 2PW8H 3SGAE 3SNDA 2W5EA 3GY2A 3GYLB 3CENA 2BDAA 1HUTH 2H2ZA 3BSQA 2JJ2D 4AGKA 3SV7A 1VITF 3RUOA 3ZYEA 3MOCA 2BLQA 3EE0B 3DA9B 1YC0A 3M35A 2Y7XA 3MTYA 4MPUA 1BHXF 1SC8U 2FOAA 1SPJA 3A82A 1YCPH 1C1QA 2AHME 1V2OT 1E79D 1LQEA 2NU3E 1HAGE 1MZAA 1TX8A 1NM6A 4FUBA 5L30H 3SNBA 4D9QA 4FU8A 5AFZH 3OX7U 1CSOE 2Q6DA 4CRGA 1C5RA 1O5FH 4JYUH 1O38A 4RT0A 2QV1A 1HAPH 1O5DH 1GBDA 4X1NU 4QT8C 5CHBA 3QO6A 3EA7A 1W3CA 2HOBA 1ELAA 3JZ2B 5HGGA 3TIUA 3V7TA 2IJD1 3M5NA 1HBTH 1P0SH 4KTSA 1THPB 3KYFA 2GCTB 2BX3A 4NA7A 1C2KA 2QXHA 3A8BA 3BTME 1QB6A 1ORFA 1BRAA 1AI8H 3ATKA 5AHGH 2NU4E 5AFYH 3SHCH 5DKMA 4I32A 1T8OA 4ZKNU 4TYDA 1W0JD 2YMSC 5HIZA 2UUFB 1A1RA 1BT7A 3EDXB 2WPDD 1SOZA 4Y10E 3GISB 4GVUA 3MH6A 1QQUA 1WYKA 1V2KT 3M5LA 2FDAA 1DY9A 1G3DA 1LDTT 1XVMA 2HPQH 4Z6AH 6LPRA 2QE7D 3RM2H 1TAWA 1O5EH 5FCRA 2GD4B 5CHAC 1ZSKA 5E2PA 3BTKE 5C0TA 1UTNA 1FY3A 2BY8X 2HNTE 3OY6U 5GCHG 5T6DA 1B0FA 2AMQA 1EJMA 1GHYH 1GGDC 1SHHB 4UDWH 2PV9B 2BOHB 1BMNH 1CHOG 2QF3A 2A4RA 2YMSD 5DO4H 2C3SA 3UFAA 1O2WA 1SOTA 3WW7A 3QGNB 1C1PA 2Y5HA 1QFKH 3LGVA 2V3MA 4VGCB 1V2ST 4NIYA 2EC9H 1OP2A 3KYGA 5FX6A 2GMTB 2BY9X 2HLDD 1AMHA 2ZHDA 2ASUB 1E1QD 4FUHA 5EW1H 1XKAC 4RKOB 1W8BH 4X2WA 2ULLA 3URDA 1OP0A 2R9PA 4OS4A 3URCA 3BEFB 1ZTLA 1NFWA 4PROA 3SJIA 2Z3EA 3RLWH 2C8ZB 2KCPA 4I8KA 1LKAA 2H6MA 1FDPA 3LOXA 1ETSH 5LGOA 3BF6H 3ZZCA 1PPHE 3LONA 1SSXA 3TH4H 2Z9KA 2ZZUH 2R0KA 1P57B 2WV4A 4A92A 1IOEA 2OCVB 1D6RA 1NC6A 2JH0D 3OEED 1LPZB 1SGFA 4AN7A 1ELBA 3M5MA 1PYTC 2A45B 1QA0A 2QGRA 1B7XB 1L1GA 1JWTA 1C5MD 2WPMS 4TPIZ 2ZCHP 1K2I1 1V2MT 4Q4LA 1HJ8A 3RXSA 3A87A 1KTSB 1OS8A 2Y6TA 4NIWA 1O2ZA 2PKAA 3HATH 1BDAA 4YLQH 3M36A 4BTTB 2OC1A 1EOJA 4IW4E 1O32A 4E7RG 2CXVA 4KKDA 3SYJA 1WSSH 1PYTD 1TA2A 1OXGA 3PRDA 1QIXB 3A80A 2GCHF 2FX6A 2C93B 2D8WA 3OY5U 2AERH 1HAHH 2F9VA 2ZPRA 3SOSA 1TPOA 2XTTB 1DX5M 4THNH 1AN1E 1C5TA 2P3TB 1J14A 3BTFE 1SGQE 2GZ7A 1BCUH 2TIOA 4MLFB 1RTKA 1IQHA 2JH5D 3NKKA 2FOMB 3VB4A 3VFEA 3FN8A 1ESBA 2GP9B 2QXGA 4JZEH 3CNRA 1NESE 1O2RA 3T5FH 1FX0B 3KHVA 2WPHS 3UUZA 4LZ4B 1E37B 1QBOA 4K2YA 3SV8A 1O5CB 1LPGB 4JZ1A 2W26A 1XKBC 2J5UA 3GCOA 2G55A 1EZXC 2J94A 3ZYDA 1QB9A 1EB2A 2AGGX 1L2EA 1VJAU 4D7FA 1ZR0A 4Y8ZA 1T8MA 3EE7A 4AZ2B 3VG8A 1GL1A 1FONA 3EA9A 3LPRA 1LHEH 2FEQH 1T8LA 4SGBE 3HKJB 1ARCA 2HWLB 3U28C 4XD7D 3SGBE 3SU2A 1O5GH 3SUFA 1C1WH 1GHBF 1K21H 3HKIB 1LHFH 1C2HA 1W0ZU 3RXJA 1B0EA 1OWHA 1O2QA 1PPGE 1HGTH 2BD2A 4OS1A 1O2YA 1EAUA 1S81A 2FWWA 2SGPE 6CHAB 3SI3H 2PGBB 5DG6A 2OBQA 1NRRH 3GDSA 1RS0A 1BMLA 1SKYE 1GCTB 2OK5A 4ZMAH 3TITA 5C94A 4FUCA 1A0LA 4WF8A 1FY5A 1GBEA 3VB7A 3RXVA 1BA8B 1MABB 4DVAU 2PR3A 2XC4A 4KGAA 1HCGA 1VITG 1GMDF 8ESTE 1DANH 2Z94A 3T26A 1PJPA 3T62A 1O2NA 1ANCA 2WINI 2WUBA 7GCHF 1GVKB 4BNRA 1ZJKA 1BRUP 3PMAB 3ZZ6A 1XMNB 4A5TS 5EU8A 2BYAX 2WUCA 3PTNA 2BVXH 1E34B 3FP6E 4ISIH 1YPJH 4BAHB 1C5SA 4Q7YA 2FYQA 1NROH 4XFQA 4ISOA 2BD8A 2BY7X 2F9BH 3GICB 1WCZA 1VZQH 2QA9E 1Y5AT 1ZPCA 2PLXA 2FOEA 3SZNA 3V12A 1FY8E 1PQ8A 4CHAB 1SLXB 2VWNA 3STJA 2HVYB 1MTSA 1K1LA 1N6XA 5KEDA 1MQ5A 1TPSA 1K1OA 1X7AC 1XUJA 4BTUB 5A8XA 5F53A 3ENSB 1AFQB 4CRFA 4K8YA 4Y76A 2VH6A 4ASHA 3BG4B 2PFEA 3T28A 1DUAA 1Y8TA 2EI6A 2QN5T 2Q6GA 3TU7H 1W0KD 3P8OA 1V2QT 1CHGA 3QGJA 1HAOH 4TY6A 2EI8A 1TE0A 2BLVA 4ISNA 1WOFA 3WWBA 2O8UA 1GDNA 2UWLA 1ZSJA 2J98B 3U8RH 2XNDD 1SLVB 1CGHA 2ZDNA 1QBVH 1CVWH 1NRPH 3TVJB 2FPZA 4AYVB 2SGAA 3A7VA 3GYMA 3EYDA 4YO9A 5LH8A 1YCPM 1GBJA 2ZFQH 5JB9S 2GMTC 2ZIQH 3K6ZA 6GCHF 1NO9H 1TNHA 1G3BA 1ZHMA 5EQSA 5GIBA 3BEUA 2BB4A 2FOFA 2BDBA 2FX4A 1OP8A 1F2SE 1TONA 3PO1C 3ZVAA 4Y11E 2OUAA 9LPRA 1QBNA 8LPRA 5EQQA 1EJNA 2IOTA 1GJ9B 1MUEB 4ZXYH 2RCEA 2A0QB 1PPZA 3ZVEA 1GHWH 3OE7D 1OWKA 1CBWB 1EJAA 1QCPA 3IITA 5GNDA 1XUGA 2FO9A 5DP5A 1SVPA 2H9TH 1GVZA 2OQUA 4WMFA 3RXUA 3SJOA 5A8ZA 2PSXA 1QL7A 2XXLA 3ZZ9A 4B6EA 3GCHB 1HB0B 1G32B 1AVGH 3ZZ3A 4ZROA 4OS2A 2Z9GA 2D26C 2VIWA 3RXOA 1RIWB 1TFXA 4U32A 1MKWK 1V3XA 3ZVFA 1TGSZ 4CRCA 1LCYA 3STIA 1E0FD 1CT4E 1BJVA 3AVZA 1YPMH 2KZ4A 1P3EA 1TGTA 1QB1A 2CGAA 2VBCA 2PKSB 2WPJS 1W13U 1D9IA 3TPIZ 1O39A 2C8WB 4BOHA 2UUJB 1ELCA 2Q6FA 2XNIA 2YNBA 3E8LA 4X6OA 4INHA 5E8EH 2ZC9H 3HPTB 3E91A 2Y5GA 2F91A 3PTBA 5C2ZA 2ANYA 1Y3XA 2G81E 4AOQA 2BMGB 5SGAE 1AHTH 4AG1A 1AZ8A 2LP6A 2WV9A 5FXLA 4DG4A 3BTEE 4B1TA 5GXPA 1CQQA 1H9LB 2UWPA 2Y7ZA 3C27B 2G52A 4WVPE 2GCHG 2PHBA 4B71A 4A1XA 4KP0A 2ALPA 2BXTH 3T2NA 4O97A 3TGKE 4GHTA 1NS3A 2KAIB 4TY7A 3IG6B 4F55A 2P3UB 5B6LA 2KCAA 2ZTZA 3KQCA 3MH4A 1JXPA 1W2KH 4O3TA 1WU1A 4WMEA 1BTXA 1KXFA 1TNGA 2CK3D 1Y3UA 1DWEH 5FAHA 5ESTE 1GI6A 3GY4A 1GHVH 2Z3CA 1V2UT 4FUGA 3BTWE 3CS7A 4OS5A 3A8DA 5C20A 6CHAC 3SI4H 1Z8IB 2PUQH 4BAKB 4YXWD 5L6NH 1TNKA 1C9PA 2A5AA 2KFWA 1F5LA 2VVCA 3HK6B 1CO7E 2V0BA 1YPHE 3A7TA 3QZQA 1C1UH 2WPIS 3SV2H 1GBCA 1OYTH 1HAYB 1UVTH 1BQYA 1GMHF 1OWJA 3DT0H 4ACBA 1ZMJA 1GDQA 1Y3YA 4Q2KA 1N8OB 3OTJE 3BTHE 2YOLA 1C5NH 1BTZA 1SI5H 1TWXB 5C5NA 3LGYA 3PMJA 4X1QU 5GDSH 1QGFA 5DP3A 4UFFH 2FI5E 1RFNA 1TOCB 1QRWA 1SMFE 5F8XA 1TABE 1EPTB 2ZNKH 2OBOA 1TBQH 1OWDA 1NPMA 3RU4E 3M7TA 2W7SA 1TX6A 1W11U 2ZHWH 3R3GB 5C67A 1SL3A 1VGCB 1GMDG 4Y7AA 1O2HA 4BAMB 5DK1A 2ZGCA 1H1BA 1O2PA 7GCHG 2HNTC 4TWWA 4BAOB 1TMTH 1TMBH 3UWIA 2M5TA 2AGEX 4U2WA 3GY6A 2BVSH 2XBWA 1GBIA 2FP7B 5FBEA 1F0RA 1IHSH 2ZG0H 2J4IA 3F68H 5C0UA 4ACAA 2GT7A 1EFRD 3KQ5A 1AQ7A 4I86A 3SHAH 3UWJH 1QL8A 2GZ9A 2VVVA 1DLKB 1AFQC 5B6OA 1QJ7B 2ZQ2A 3WWFA 3OTPA 3OEHD 2TGTA 2FIRH 1GJAB 3A83A 1C5XB 4XE4A 1C2DA 1O3IA 2GKVE 4MNVA 4HFPB 2Z6BD 3K6YA 1AE5A 2XBXA 1QRXA 3UIRA 5L2ZH 3L6PA 2SFAA 4WH6A 2ZPQA 1MTVA 5FPYA 4AFUA 1ANEA 2XC5A 3Q00A 4I8HA 3DSGA 1RJXB 3U1IB 1ESAA 2UUYA 2TPIZ 3F9FA 3L3TA 2TGPZ 2ZGBH 3NK8A 3ATMA 2P8OC 1AFEH 1O3LA 3TNSA 3I29A 1DWCH 3TJVA 1PPFE 4E7NA 5C1UA 1CE5A 2F9OA 1D3PB 1ZRKA 2R0LA 2KM0A 4UFEH 5E2OA 4JZIA 1LPKB 4RN6A 3TJOA 4FXGH 1EP5A 1ZJDA 1W0YH 2FOBA 2NWNA 2Z3DA 5FHTA 4IN2A 3F6UH 1G37A 2ZDKA 1LVBA 1QURH 4J1YA 1HIAB 1UCYH 1YLCA 1Z8JB 3AW0A 2AEIH 2XWBI 2QAAA 2XRCA 2Y5FA 3E0NB 4Y71A 2EI7A 2Y82A 3VEQB 6GCHG 5EJ1A 1CT0E 1SQAA 1F92A 2ZP0H 3ZV9A 4GUXA 2F9NA 3B9FH 3MMGA 1O30A 1DS2E 2BLOA 1KXEA 3S0NA 3NXPA 5ETXA 4NG9H 3PWBA 1E35B 1GBFA 4A7IB 1MKXK 2ZFRH 3NCLA 2ANWA 2ZU5A 1CU1A 3E16B 2VNTA 2W3KA 2FOHA 3MHWU 1BIOA 1GL0E 1SHYA 1F0SA 1GI3A 1ELTA 1HAVB 2C8XB 3HGPA 4H42U 1YLDA 5G4BA 2P95A 1IQJA 1EZQA 4CR9A 1BITA 1XUFA 5HIYA 3FZDA 2QF4A 3VGCB 1C2FA 3F9GA 2ZGXH 3JZ1B 1GJBB 2Z9IA 3UR9A 1ZHPA 3TH3H 1MTNB 4ABAA 2AGIX 3PYHA 2VWOA 1GI7B 2HLCA 3Q77A 1SGRE 2GDEH 2O9QA 1AWFH 3RXEA 2BDYA 3ZZ7A 3ELAH 1AD8H 2BZ6H 4H6TA 4Q80A 1DE7H 3K2UA 1C4V2 3P70B 3NWUA 4GPGA 1FNIA 2ZDLA 1Q31A 1DDJA 5HM9A 1LVOA 1VKYA 3BV9B 2QCYA 3SJKA 2BDHA 2FTMA 2P59A 2VGCC 1MQ6A 3DFLA 4NSVA 4WY3A 4ABBA 1W10U 2ODYB 5BRRE 2RFKC 4I8LA 5C17A 1SQRA 1UHBA 3DD2H 1GMCF 2K1QA 3GDVA 2V6NA 4ZHMU 4JCNA 4P00A 1RD3B 5F8TA 2OC8A 3SZEA 1EAWA 3LIWA 3E3TA 3WY8A 1AZZA 1O37A 5JB8S 2CJIA 5TCCA 1DWBH 2TRMA 1ZYOA 1QA7A 4HI3A 3U8TH 3UNSA 1KXDA 1OX1A 1UK2A 3FFGA 2BY5X 3H5CB 3SU6A 3V13A 1WUNH 2BD3A 1SGYE 1V2WT 2FMJA 4IN1A 1UVOA 1BMAA 5LPEA 3VXFH 1FPCH 2F3CE 5KGOA 3G01A 1IQMA 2VB0A 1EB1H 4CH2B 1JBUH 1GBHA 3D65E 3FKSD 1CA0C 3FP7E 3SUEA 2VIDA 1KSNA 3PWCA 4TPYA 1G3CA 3LC5A 3W1EA 1OPHB 1TGNA 1ZPZA 5HMAA 1LVYA 1L0ZA 1DXPA 2Q1JA 3F0PA 1A2CH 1P2NA 3F3BA 3FO8D 1NU7B 1CT2E 1F0UA 1O3GA 1FY4A 2KR7A 1K28D 1TRYA 4NFFA 5FX5A 4ABJA 1GMHG 1YPGH 2ZFSA 1P2OA 3ATIA 3FZZA 4MVNA 1KLIH 2ZWLH 1GI5A 4RSPA 2HRVA 2BY6X 3RXHA 3UOPA 1C1RA 3PV2A 3T25A 2BQ6B 1DVAH 1GVLA 2BM2A 3QK1A 1GJCB 2VJ1A 1F5RA 1EUFA 1EOLA 1ESTA 1MD8A 4X8TH 5TCAA 2IJOB 3QWCH 5FPTA 1GBTA 4JMYA 1ACBE 1THSH 1O2KA 1J16A 3OFND 2P3FH 4CRAA 5I46H 1O3FA 1P02A 2CHAC 3LJJA 4AG2A 4LZ1H 2YNAA 1EXFA 3ZZ4A 1O2UA 1UTOA 3BG8A 1EZSC 1ABJH 5J4QA 1TPAE 4IC5A 1O36A 1YPEH 1KLTA 3D23A 2BDCA 3V3MA 2V7QD 5JBAS 1NFXA 1T32A 1ZMLA 1MBQA 3E1XB 5EPNA 1DY8A 4Q7XA 4X1RU 3M37A 4K8BA 1WXRA 1G9IE 5HKKD 4X2VA 5HM2A 3UB0A 1KIGH 4GSOA 1NRSH 1XUKA 1L4DA 3QDZB 3MQKC 4JZFH 1NRQH 1C1SA 1S83A 2KCOA 1DFPA 4ZH8A 1XXFA 3PMBB 1S0RA 1K1JA 2BDIA 5E0GA 1C1MA 4ZXXH 1DUEA 2ZI2H 2A7CA 5DGJA 5JPMH 1P11E 1O2OA 4RT1A 1C1VH 1KDQB 4DY7B 1NU9A 4NZLA 1P8VC 5LPFA 1V2JT 2FLBH 2G00A 1KXCA 4ZHLU 1O2XA 2JDID 3ZZAA 2B8OH 3IWMA 1XXDA 3F0OA 1PQ5A 1V2VT 3RC4A 1UTKA 4X1SU 3SUDA 1SLUB 2SGDE 2ZDAH 3EA8A 4UD9H 3RU4T 1ZTKA 1D3TB 1EZUC 1N6YA 1LQDB 4ABFA 1BTWA 1PQ7A 1SGPE 2FXRA 4ABHA 1D6WA 1TQ0B 2WYJA 1J17T 1O0DH 3QX5H 5DJ7A 2K8IA 4GAWA 7KMEH 1T7CA 2BQWB 1AB9B 1GDUA 4ABIA 1K1PA 5EXMA 3A81A 5HYOA 3FP8E 3TK6A 2BLWA 1P03A 4D76A 2Y80A 4E05H 1ETTH 1ZPBA 3E6PH 1O3NA 3A86A 3KIDU 1O35A 1BBRK 1MU6B 1OKXA 4IMZA 3LGUA 1NN6A 1P01A 3ZV8A 4R0IA 2GCTC 3UR6A 5H4IB 4GCHF 1HAIH 4MTBA 1G30B 2GDDA 4YOJA 1AGJA 1HRTH 2ZGHA 3PLPA 1O34A 3TGJE 1YCPK 1YPLH 2BXUH 1M9UA 4FUEA 2DE8A 1HAXB 2W6JD 2L6OA 2WPLS 2WSSD 3P8NA 3Q3YA 4AFQA 2G51A 3KEEA 4YM9A 5K7RA 2P94A 1QNJA 1TA6A 1GJ7B 1P2JA 5TJXA 1BRCE 1N1LA 1DICA 2TGDA 1TGBA 1NBME 3QTOH 5IYTA 4AFSA 5ESBA 2W7UA 1C4Y2 2I6QA 1FV9A 1CGJE 4K60A 4XDEA 1YPHC 3OYPA 2VVUA 2DE9A 3LDXH 1Z71A 3ZZ5A 3F2HA 2JIZD 1S6LA 3P6ZB 3PM3A 3QZRA 1C1NA 2ZHQH 3CP7A 1C5UA 1SGDE 7LPRA 3K65B 4VGCC 1G2MA 3P8GA 2QYIA 3RXMA 2V3HH 1DM4B 1VITH 3LKWA 2FESH 3OSYA 1D3DB 1VCQA 3LC3A 1U6QA 2WV5A 4OS7A 1SR5C 4MQAA 1BMMH 1DSUA 3VPKA 1FY1A 3GCTF 1C2GA 1E36B 3LGTA 2CN0H 2GVFA 1FN8A 1UVSH 2ZEBA 4UE7H 1WQVH 4U30A 3DHKH 1GMCG 3GCNA 2UUKB 1GHAF 2XOKD 1AIXH 3LH3A 5IDKA 2VU8E 4IMQA 4HG6A 4NCYA 3DCLA 2O8TA 2F4LA 5PTPA 3RU4D 2ODPA 2QF5A 3MO9A 2SGEE 3A7YA 3MNCA 4Q7ZA 3RMOH 1HLTH 1GG6B 2JJ1D 2R2MB 5JYIA 3MFJA 3S9BA 4KTUA 4X2YA 1ELGA 5F03A 1TRNA 1ELVA 3A7XA 1A5IA 4AYYB 2BOKA 1NT1A 3PV5A 2IPHA 4JYTA 1OSSA 4H4FA 4RI0A 2EQNA 2QXJA 2ILNA 2BHGA 1UTJA 1TPPA 3QN7A 5EIYA 1ANDA 3MU0A 4KELA 2QC2A 2QXIA 4NZQA 1EP6A 3C1KA 3M7QA 3SU3A 1WAYB 3MNXA 4P02A 2R3YA 1YYY1 1O3EA 3RMMH 2FODA 4FU9A 3S7HB 3RXIA 2FLRH 1H4WA 1YP9A 2ZA5A 3TJNA 3O8RA 1MAXA 1XX9A 2FS9A 2GV7A 1A3BH 2ZFFH 3AAVA 4TWYA 3FOAA 2AMDA 1GWAA 4YOGA 2YMSB 5DP8A 2EY4C 1O3PB 5GCHF 4TSFD 1G2LA 3UNRA 1DOJA 4NSYA 4O9VA 1O5AB 1GJ6A 1K0HA 3D49H 1Y5BT 1PQAA 3E0PB 1P2IA 4F4OC 3NUMA 4HGCA 5CHAB 1ELDE 1SGIB 3DSPA 1GHZA 2XYAA 2W3IA 2A7HA 2OD3B 4ESTE 4I8GA 4O3UA 1FPHH 4BXSA 1O3BA 3RP2A 4IBLH 3N99A 1P2MA 2L74A 3D62A 1QZ8A 1S84A 4K1TA 1G3EA 2F9UA 2H5CA 3SU1A 4X8SH 2J92A 2C4FH 5HXFA 7ESTE 1UW7A 3RM0H 2TBSA 1GBMA 2LNCA 2ZU2A 3S69A 3K9XB 1GCTC 1UVPA 2F83A 3KQDA 5FPSA 1GHBG 1K1NA 1UMAH 4LOYH 3RXFA 1H8ED 1O2TA 1V2NT 5A0AE 9ESTA 1TGCA 3A85A 5EG4A 2R2WU 1XVOA 2J38A 1MCVA 2J98A 4DT7B 1P10A 4HTCH 3A7WA 4YTAA 1OWEA 4JK5A 3RXBA 3CS0A 1UTLM 2O8LA 1OYQA 2PTNA 2F9PA 1XUHA 5C5OA 1O31A 2ZTYA 1C9TA 2SNWA 4WXIA 4Y8XA 1D3QB 3GY7A 1AU8A 2ZFTA 3P8FA 3Q3KA 4MG3A 1AB9C 2V3OH 2M2AA 4TT3D 4MNWA 1Y59T 4Y8YA 2J97A 2F43B 1IQFA 1BUIA 3LGWA 1KYNA 3SO3A 3GY3A 4D8NA 2OQ5A 5IK2D 3S7KB 1MH0A 1T4UH 4ZKOU 1L1NA 5E0HA 1LO6A 2A31A 2ODQA 3ODDA 5A2MH 3SUGA 4NA9H 2GJGA 3U9AH 1GJ8B 3ITIA 3UNQA 4ISHH 4X8UH 5EW2H 1MAYA 3A84A 1QQ4A 2EEKA 4XRNA 4Y79A 5J4SA 1RGQA 1EX3A 4CHAC 2GGVB 2VIOA 4NIXA 3AK5A 4U01A 3HGNA 2STAE 2D2DA 1BBRE 1FJSA 2XBVA 4B2BA 3SJ8A 1H8DH 4GHQA 2D1JA 4CREA 2VIPA 4AFZA 1CA8B 1KXAA 4GCHG 1GI1A 3BG4C 4DCDA 1F7ZA 4DT4A 4UONA 1O33A 4X6MA 1LVMA 3S9AA 1PPCE 3F9EA 3RXAA 1TNJA 2C90B 1O3DA 1ZTJA 2GT8A 1IQNA 3RXPA 1HXFH 2HALA 3T29A 2AIQA 3I77A 3UQVA 1TNLA 4AGJA 2CF8H 2GTBA 4M9FA 5AVDA 1A0JA 1GCDA 2ANKH 4IS5A 3ZZDA 4Q63A 2BZAA 1GI8B 2OC7A 2P16A 4DURA 1C5PA 1HJ9A 1HPGA 3PB1E 5FBIA 3RXQA 3ZIAD 4ZHAA 3EQ0H 2A4QA 1UVUH 3SBKA 5K0HA 1MD7A 4NA8A 1AWHB 2A4GA 3Q3XA 4XBCA 1BBRH 2KAIA 3UOUA 1ANBA 1TX7A 1YGCH 3BIUH 2XCNA 4K1SA 2A5KA 4YT7H 1EAIA 3BEIB 3DSOA 1TYNA 1AVXA 2PSYA 2PKAB 4I31A 4DOQA 8GCHF 1C5WB 4ZAEA 4J2YB 1O2GH 3LU9B 5GJ4B 1NFYA 4LK4A 1FAXA 1Y5UT 3DFJA 4Z0KA 2VWLA 4IC6A 1CBWC 5DP7A 1O3AA 3N7EA 3VXEH 1QHRB 4BTIB 1BTUA 3GCTG 1MCTA 3FANA 2ZECA 3NZIA 4Y0ZE 3QLPH 3UQOA 1FI8A 2ZDMA 1P04A 1HDTH 1ZOMA 3GCHC 1MMJN 1GHAG 1GG6C 1XUIA 1UK4A 3O8BA 3OAAD 4INLA 2WHXA 1RTFB 1ZZZA 2OC0A 5LPRA 1RIWC 1TMUH 4ISLA 3FAOA 3LT3A 1S82A 2ANMH 4ABEA 5GWZA 4WXVA 1NTPA 2K0QA 1O3OA 2GZ8A 4O03A 3KQBA 5FCKA 4MDSA 4OS6A 2STBE 5C1YA 2PKSC 2JETB 4B75A 3GDUA 3MWIU 3V0XA 3E90B 2B5TB 4FUDA 1EPTA 1HXEH 4JK6A 4IGDA 3ATWA 1WBGB 2PP6A
chains in the Genus database with same CATH topology
1H9HE 2CMYA 1V6DA 2Y81A 1IQEA 1QJ6B 1SGNE 1THRH 3S9CA 3ODFA 2NU1E 5EOKA 3RXGA 2WYGA 2QY0B 3RLYH 5DP9A 1DITH 1HAZB 4Y7BA 5F8ZA 1MU8B 4A1TA 2G5VA 5GPIB 5AF9H 2BD4A 4NFEA 1K22H 4NWKA 1GBBA 3BTDE 1ZSLA 1O3CA 3A8CA 2RG3A 2CF9H 2ZQ1A 4F49A 1YBWA 1BB0B 4HZHA 5I25A 4OGXA 3FVFB 2BD7A 4LXBH 1S6HA 4X6PA 2RA3A 2HGTH 3MNSA 1Q3XA 1Y3WA 2BD5A 4ZKRU 1GBLA 5EXNA 3SNAA 3HK3B 5C1XA 1TBZH 1AVWA 4INKA 3UTUH 3F1SB 3SV6A 1JRSA 1UTPA 5EQRA 4X6NA 1ID5H 1QTFA 1NZQH 5DP4A 1HV7A 1MKWH 3SU4A 3ATLA 2FTLE 3SGQE 3AW1A 1A46H 4D9RA 3KF2A 1SLWB 2QF0A 1QR3E 2I6SA 2ZTXA 3VB5A 1N8OC 2J34A 1SGTA 1V2TT 1BTYA 3A8AA 3PO1B 2BD9A 3O8CA 1UTQA 3TH2H 3TNTA 1Z1IA 4DGJA 2SGQE 4XSKU 5T3HA 1KXBA 5JBBS 5A09A 4JYVH 5E0JA 1EPTC 1NY22 4BANB 1C2MA 1C2EA 2A2XH 1VR1H 3BTGE 4K69A 3MU4A 2SGFE 1WQSA 2RA0A 1VGCC 1RRKA 3PROA 3ZZ8A 1FIZA 1SBWA 4OGYA 1DT2A 1HIAA 1Z8GA 4DW2U 1IQKA 2O8MA 3RMNH 1S6FA 3RXKA 2FZZA 2AIPA 4CRDA 1EATA 1P12E 2AS9A 1LTOA 2PWXA 2C8YB 2FOCA 4UFDH 2G8TA 4Y0YE 4FU7A 4FUIA 1GJDB 4B73A 1HJAB 1C5YB 2A7JA 2VIVA 2BX4A 3EAJA 1ZHRA 4MPVA 3EGKH 2OP9A 4WJG2 1J9CH 2UWOA 4UEHH 1J8AA 2J9NA 2JH6D 5EXLA 1KY9A 1C5LH 3VB6A 3UY9A 2VH0A 4WH8A 1HAVA 1P09A 1A0HB 1Z1JA 3BTTE 4Y6DA 1IQGA 1WTHD 4I8JA 3KL6A 1TIOA 3ZVGA 1P2KA 4B2AA 3M5OA 4M7GA 4X2XA 5BPEA 1BJUA 1QRZA 4FUJA 1YKTA 2FOGA 1BTPA 3B8JA 1J15A 4UFGH 4ABGA 1SG8B 3A89A 3MI4A 3SNCA 2ZCLP 2R3UA 5CMXH 4AB9A 2GV6A 1PPEE 1SB1H 4WWYA 4CBNA 5JBCS 3MU8A 1F5KU 2B0FA 3BN9A 3M3TA 4E06H 1V2LT 1K9OE 1Z6EA 1O2IA 4FUFA 1ZLRA 4ZUHA 1AO5A 1GHXH 4MNYA 4XOJA 4B74A 1P05A 3TJUA 3SW2B 1HFDA 2LPRA 1SGCA 1IAUA 1TNIA 2PUXB 4MNXA 2H9HA 1C4U2 3P17H 3W95A 3ZVDA 2DUCA 4XBDA 3QTVH 4DJZB 1MBMA 3PMHB 2JKHA 2WPKS 8KME2 3NPSA 4X8VH 2GX4A 3LJOA 1PPBH 1YF4A 2OINA 4GLYA 1ZGIA 3MU5A 5DP6A 8GCHG 1NFUA 3M7UA 5JBTA 1AE8H 1ZRBA 3SN8A 3KCGH 2FI3E 3LGIA 1C1TA 1UJ1A 1LMWB 1BOQA 2Z9LA 3I78A 2AH4X 3RXDA 1GI2A 2JETC 3MYWA 2XBYA 3SU0A 2G4TA 2BDGA 1ELEE 2B7DH 1XM1A 5T6GA 5A8YA 3H7TA 3VGCC 2OTVA 2A5IA 2BQ7B 2VIQA 1UCYK 2XCFA 1BTHH 4A6LA 4BXWA 1W12U 1MTNC 2HVXA 3MNBA 1KTTB 2G5NA 1MTUA 1ZGVA 1JIRA 4H6SB 3UREA 2ZKSA 2IN2A 4K5ZA 2ZF0H 1O3KA 1GI9B 1W7GH 3RC5A 3U8OH 2ALVA 3ZVBA 1T8NA 1C2LA 3SU5A 1GBKA 4DIIH 5T6FA 1SQOA 2FI4E 1FAKH 1UTMA 1W14U 2QIQA 1TBRH 1WV7H 5ABWA 1IQLA 3TK9A 1AY6H 4X1PU 1S5SA 5L2YH 1H9IE 1SGFG 5A0BA 2OXSA 1AKSB 4SGAE 1TALA 2AFQB 2O8WA 1G36A 1P3CA 1O2MA 2A1DB 1TRMA 2XC0A 1IHTH 1O3MA 2ZHEH 2P8OB 2OLGA 1JMOH 1EAXA 3OU0A 3M3VA 4FVDA 1Y3VA 1JOUB 1ELFA 1MKXH 1C2IA 1GJ5H 4K3JA 2FYRA 5EGMA 1A61H 1GJ4H 1BRBE 5F6MA 5C3NA 3M61U 4ABDA 1DPOA 2ZO3H 2FM2A 5A0CA 1RXPA 2TGAA 3ZZBA 1FQ3A 1H8IH 2RDLA 1TB6H 1SFIA 4YOIA 1FIWA 3RXTA 3RXRA 2ZU3A 1SQTA 1GBAA 1ZMNA 3SNEA 1Z8RA 4JZDH 4YLUA 1ABIH 1OWIA 1C5QA 1B5GH 2A4OA 2HNTF 2ESTE 1KDQA 1FLEE 3H7OA 1FUJA 2H9EH 2HPPH 2ZCKP 1D4PB 1AUJA 3F9HA 3GY8A 2NU2E 4CRBA 3SQEE 2PGQB 1MTWA 2V35A 2Z9JA 1A3EH 1O5BB 1FN6A 4I33A 4D7GA 1TOMH 4AB8A 1MZDA 2XWAA 1HNEE 1L4ZA 3QUMP 3ESTA 1A5HA 1Z7KA 3PV4A 3AASA 1LHDH 1HJAC 1OOKB 1W7XH 3MH5A 5JDUB 1C5VA 1T4VH 3TLOA 1TQ7B 1O2SA 3ZVCA 3SORA 1HYLA 1VCPA 1O2JA 1A5GH 1S85A 2AMPA 1GI4A 1CHOF 1EQ9A 1FZZA 1QJ1B 4ZKSU 4MPWA 1WTGH 1NRNH 1YM0A 4B76A 1C2JA 3MO3A 1C5OH 2ZPSA 1QY6A 4NIVA 2H5DA 1Q2WA 4BAQB 3GOVB 4NWLA 2Z7FE 3GY5A 2A32A 1GGDB 1V2RT 1GPZA 4XBBA 2P93A 3P95A 3N7OA 2VGCB 5EODA 2H1UA 3SV9A 2AYWA 3RC6A 1JRTA 1EKBB 1ETRH 1LHGH 4KTCA 3AAUA 3KNXA 3TGIE 3KN2A 1A7SA 1A4WH 3P92A 4WMDA 3B23B 3M3SA 1T31A 3UPEA 1SGEE 2VINA 3KQEA 3BIVH 3MO6A 3RDZA 1JIMA 3SQHE 1LHCH 2ZDVH 2FS8A 1AUTC 3U98H 1TLDA 2B9LA 2A2QH 1P9UA 2NU0E 1LKBA 4CBOA 3MH7A 2ZGJA 1L1JA 3LH1A 3A88A 1CA0B 1AKSA 5EPYA 1O2LA 2PTCE 3BTQE 6ESTA 4K1EA 1FXYA 2THFB 5CE1A 3DUXH 1O3HA 2CV3A 2EA3A 3RXCA 1C5ZB 4R8TB 1P9SA 1PFXC 1EASA 4AX9H 1DLEA 3PLKA 4B2CA 3PLBA 3MU1A 1BHXB 4CR5A 2XW9A 1C1OA 3T27A 1DXWA 2J2UA 1BZXE 1CGIE 1VJ9U 4FVBA 4DIHH 1P2QA 4A1VA 4I7YH 1UK3A 3U69H 1S0QA 1Z6JH 1YPKH 1GI0A 4YZUA 2ZU1A 3VB3A 3R0FA 4AORA 1VCWA 3SJ9A 4YT6H 1FMGA 1K1MA 1F0TA 3U1JB 2G4UA 4CH8B 3O8DA 1DWDH 1KLJH 1UHBB 3W94A 3TK5A 1P06A 2CHAB 1INCA 3Q76A 4NGAH 2J95A 3RMLH 2VWMA 2ZU4A 2ZFPH 3A7ZA 1IQIA 1DSTA 1QL9A 5DPAA 2SNVA 2BTCE 1SFQB 1UCYE 1UO6A 2BVRH 4YESB 4X0WU 3L33A 3RXLA 4RKJB 4MPXA 1E38B 1V2PT 1ARBA 1K1IA 1RTLA 2ZHFH 1O3JA 1O2VA 3KGPA 2PW8H 3SGAE 3SNDA 2W5EA 3GY2A 3GYLB 3CENA 2BDAA 1HUTH 2H2ZA 3BSQA 4AGKA 3SV7A 1VITF 3RUOA 3ZYEA 3MOCA 2BLQA 3EE0B 3DA9B 1YC0A 3M35A 2Y7XA 3MTYA 4MPUA 1BHXF 1SC8U 2FOAA 1SPJA 3A82A 1YCPH 1C1QA 1V2OT 1LQEA 2NU3E 1HAGE 1MZAA 1TX8A 1NM6A 4FUBA 5L30H 3SNBA 4D9QA 4FU8A 5AFZH 3OX7U 1CSOE 2Q6DA 4CRGA 1C5RA 1O5FH 4JYUH 1O38A 2QV1A 1HAPH 1O5DH 1GBDA 4X1NU 4QT8C 3QO6A 3EA7A 1W3CA 2HOBA 1ELAA 3JZ2B 5HGGA 3TIUA 3V7TA 3M5NA 1HBTH 1P0SH 4KTSA 1THPB 2GCTB 2BX3A 4NA7A 1C2KA 2QXHA 3A8BA 3BTME 1QB6A 1ORFA 1BRAA 1AI8H 3ATKA 5AHGH 2NU4E 5AFYH 3SHCH 5DKMA 4I32A 1T8OA 4ZKNU 4TYDA 2UUFB 1A1RA 1BT7A 3EDXB 1SOZA 4Y10E 3GISB 4GVUA 3MH6A 1QQUA 1WYKA 1V2KT 3M5LA 2FDAA 1DY9A 1G3DA 1LDTT 1XVMA 2HPQH 4Z6AH 6LPRA 3RM2H 1TAWA 1O5EH 5FCRA 2GD4B 5CHAC 1ZSKA 5E2PA 3BTKE 1UTNA 1FY3A 2BY8X 2HNTE 3OY6U 5GCHG 5T6DA 1B0FA 2AMQA 1EJMA 1GHYH 1GGDC 1SHHB 4UDWH 2PV9B 2BOHB 1BMNH 1CHOG 2QF3A 2A4RA 5DO4H 2C3SA 3UFAA 1O2WA 1SOTA 3QGNB 1C1PA 2Y5HA 1QFKH 3LGVA 4VGCB 1V2ST 4NIYA 2EC9H 1OP2A 5FX6A 2GMTB 2BY9X 2ZHDA 1AMHA 4FUHA 2ASUB 5EW1H 1XKAC 4RKOB 1W8BH 4X2WA 2ULLA 3URDA 1OP0A 2R9PA 4OS4A 3URCA 3BEFB 1ZTLA 1NFWA 4PROA 3SJIA 2Z3EA 3RLWH 2C8ZB 4I8KA 1LKAA 2H6MA 1FDPA 3LOXA 1ETSH 5LGOA 3BF6H 3ZZCA 1PPHE 3LONA 1SSXA 3TH4H 2Z9KA 2ZZUH 2R0KA 1P57B 2WV4A 4A92A 1IOEA 2OCVB 1D6RA 1NC6A 2JH0D 1LPZB 1SGFA 4AN7A 1ELBA 3M5MA 1PYTC 2A45B 1QA0A 2QGRA 1B7XB 1L1GA 1JWTA 1C5MD 2WPMS 4TPIZ 2ZCHP 1K2I1 1V2MT 1HJ8A 3RXSA 3A87A 1KTSB 1OS8A 2Y6TA 4NIWA 1O2ZA 2PKAA 3HATH 1BDAA 4YLQH 3M36A 4BTTB 2OC1A 1EOJA 4IW4E 1O32A 4E7RG 2CXVA 4KKDA 1WSSH 1PYTD 1TA2A 1OXGA 1QIXB 3A80A 2GCHF 2FX6A 2C93B 2D8WA 3OY5U 2AERH 1HAHH 2F9VA 2ZPRA 3SOSA 1TPOA 2XTTB 1DX5M 4THNH 1AN1E 1C5TA 2P3TB 1J14A 3BTFE 1SGQE 2GZ7A 1BCUH 2TIOA 4MLFB 1RTKA 1IQHA 2JH5D 3NKKA 2FOMB 3VB4A 3VFEA 1ESBA 2GP9B 2QXGA 4JZEH 1NESE 1O2RA 3T5FH 3UUZA 3KHVA 2WPHS 4LZ4B 1E37B 1QBOA 4K2YA 3SV8A 1O5CB 1LPGB 4JZ1A 2W26A 1XKBC 3GCOA 2G55A 1EZXC 2J94A 3ZYDA 1QB9A 1EB2A 2AGGX 1L2EA 1VJAU 4D7FA 1ZR0A 4Y8ZA 1T8MA 4AZ2B 1GL1A 1FONA 3EA9A 3LPRA 1LHEH 2FEQH 1T8LA 4SGBE 3HKJB 1ARCA 2HWLB 3SUFA 3SGBE 3SU2A 1O5GH 1C1WH 1GHBF 1K21H 3HKIB 1LHFH 1C2HA 1W0ZU 3RXJA 1B0EA 1OWHA 1O2QA 1PPGE 1HGTH 2BD2A 4OS1A 1O2YA 1EAUA 1S81A 2FWWA 2SGPE 6CHAB 3SI3H 2PGBB 5DG6A 2OBQA 1NRRH 3GDSA 1RS0A 1BMLA 1GCTB 4ZMAH 3TITA 4FUCA 1A0LA 4WF8A 1FY5A 1GBEA 3VB7A 3RXVA 1BA8B 4DVAU 2PR3A 2XC4A 4KGAA 1HCGA 1VITG 1GMDF 8ESTE 1DANH 2Z94A 3T26A 1PJPA 3T62A 1O2NA 1ANCA 2WINI 2WUBA 7GCHF 1GVKB 4BNRA 1ZJKA 1BRUP 3PMAB 3ZZ6A 1XMNB 4A5TS 5EU8A 2BYAX 2WUCA 3PTNA 2BVXH 1E34B 3FP6E 4ISIH 1YPJH 4BAHB 1C5SA 4Q7YA 2FYQA 1NROH 4XFQA 4ISOA 2BD8A 2BY7X 2F9BH 3GICB 1WCZA 1VZQH 2QA9E 1Y5AT 1ZPCA 2PLXA 2FOEA 3SZNA 3V12A 1FY8E 1PQ8A 4CHAB 1SLXB 2VWNA 3STJA 1MTSA 1K1LA 1N6XA 1MQ5A 1TPSA 1K1OA 1X7AC 1XUJA 4BTUB 5A8XA 3ENSB 1AFQB 4CRFA 4K8YA 4Y76A 2VH6A 4ASHA 3BG4B 2PFEA 3T28A 1DUAA 1Y8TA 2EI6A 2QN5T 2Q6GA 3TU7H 3P8OA 1V2QT 1CHGA 3QGJA 1HAOH 4TY6A 2EI8A 1TE0A 2BLVA 4ISNA 1WOFA 2O8UA 1GDNA 2UWLA 1ZSJA 3U8RH 1SLVB 1CGHA 2ZDNA 1QBVH 1CVWH 1NRPH 3TVJB 2FPZA 4AYVB 2SGAA 3A7VA 3GYMA 3EYDA 4YO9A 5LH8A 1YCPM 1GBJA 2ZFQH 5JB9S 2GMTC 2ZIQH 3K6ZA 6GCHF 1NO9H 1TNHA 1G3BA 1ZHMA 5EQSA 5GIBA 3BEUA 2BB4A 2FOFA 2BDBA 2FX4A 1OP8A 1F2SE 1TONA 3PO1C 3ZVAA 4Y11E 2OUAA 9LPRA 1QBNA 8LPRA 5EQQA 1EJNA 2IOTA 1GJ9B 1MUEB 4ZXYH 2RCEA 2A0QB 1PPZA 3ZVEA 1GHWH 1OWKA 1CBWB 1EJAA 1QCPA 3IITA 1XUGA 2FO9A 5DP5A 1SVPA 2H9TH 1GVZA 2OQUA 4WMFA 3RXUA 3SJOA 5A8ZA 2PSXA 1QL7A 2XXLA 3ZZ9A 3GCHB 1HB0B 1G32B 1AVGH 3ZZ3A 4ZROA 4OS2A 2Z9GA 2D26C 2VIWA 3RXOA 1RIWB 1TFXA 4U32A 1MKWK 1V3XA 3ZVFA 1TGSZ 4CRCA 1LCYA 3STIA 1E0FD 1CT4E 1BJVA 3AVZA 1YPMH