2KAIA

Refined 2.5 angstroms x-ray crystal structure of the complex formed by porcine kallikrein a and the bovine pancreatic trypsin inhibitor. crystallization, patterson search, structure determination, refinement, structure and comparison with its components and with the bovine trypsin-pancreatic trypsin inhibitor complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
80
structure length
80
Chain Sequence
IIGGRECEKNSHPWQVAIYHYSSFQCGGVLVNPKWVLTAAHCKNDNYEVWLGRHNLFENENTAQFFGVTADFPHPGFNLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KALLIKREIN A
publication title Refined 2.5 A X-ray crystal structure of the complex formed by porcine kallikrein A and the bovine pancreatic trypsin inhibitor. Crystallization, Patterson search, structure determination, refinement, structure and comparison with its components and with the bovine trypsin-pancreatic trypsin inhibitor complex
pubmed doi rcsb
source organism Sus scrofa
molecule tags Complex (proteinase-inhibitor)
total genus 10
structure length 80
sequence length 80
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 1984-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2kaiA00
1EP5A 2TGDA 4RKJB 4AN7A 3CP7A 1GBAA 1KXCA 1GHAG 1K1IA 1T8MA 3BF6H 1AE8H 2FI5E 2BDGA 2ZFTA 3BEFB 3UFAA 1O3MA 2DE8A 2AYWA 1CHOG 2FTMA 5C2ZA 3Q3YA 2TIOA 1G3BA 4FVDA 1WOFA 4J2YB 5EGMA 2WPHS 3ZZ4A 1K1JA 2KAIB 2QF0A 1C2MA 4CHAB 1TX8A 1CA8B 2SGPE 3ODFA 3BEIB 3UPEA 4MPXA 1K1MA 2ZFQH 3KF2A 1GI8B 5DO4H 2HRVA 1ZHRA 1UK4A 5F8XA 4XOJA 1T8OA 3GCNA 2P95A 1ZMNA 1SGCA 2H1UA 3O8RA 1C5UA 1GI3A 3GCTF 4NIYA 2GMTB 1UHBB 5HM9A 1YPGH 1EKBB 2ANWA 3NUMA 1TX7A 1UCYH 1ZRKA 1O3CA 1HAGE 1IQIA 3A87A 3UQOA 1CBWC 2P8OC 3A7XA 3BTTE 1GJ5H 3RXTA 3SV9A 2AGIX 1NRRH 1O5GH 1IQGA 4YLQH 1O3HA 1A0HB 1N8OC 3BTKE 1F0TA 1MAYA 5A0BA 1AGJA 5PTPA 3Q00A 4DIIH 2ZU4A 1F5RA 1XUIA 6GCHF 2OD3B 2J2UA 4LOYH 4MQAA 4O97A 5BPEA 3RXFA 2BDYA 3UWJH 1O2XA 5I46H 3T62A 3TLOA 3M35A 1DFPA 2J4IA 1VCWA 1HJ9A 3A8DA 1OWKA 5GPIB 4ZKSU 1ZTJA 1UTLM 1MTNC 2I6QA 4YT7H 4HZHA 1VITH 3A8AA 2ANMH 7GCHG 1O2UA 2Q6DA 4IC6A 2GZ9A 6CHAB 2EI6A 1O5EH 2AGGX 4ESTE 1UJ1A 4NSVA 3PO1B 1K1OA 3UOPA 3TITA 3PM3A 4U32A 2QIQA 4Y7AA 1G2MA 4WJG2 4JYTA 1GBTA 1QBVH 1L0ZA 4E7RG 1BTXA 3RXEA 1CGHA 1PPEE 1OYTH 3Q3KA 4Y7BA 1Z8JB 2BDHA 2R0KA 2AMPA 2ULLA 1C1QA 1IQNA 5CHAC 3ZVBA 3M37A 1GHVH 3ZZ7A 1S0RA 2VWOA 3MU8A 4B71A 3MHWU 1UTMA 6ESTA 1TPPA 3BG4C 1SLWB 1SBWA 2HWLB 1ARCA 3TJOA 4Y6DA 1GGDB 2FX6A 1TMUH 3EA8A 1PPBH 1Z6JH 1P9UA 2ZF0H 1OWJA 4H42U 1P12E 1F5LA 1P3EA 5EQSA 1LVYA 2QXHA 3JZ2B 3DT0H 1CT2E 3CENA 2BHGA 2F9BH 4ZXXH 1LHFH 3QDZB 1P3CA 2QC2A 1B7XB 3SNDA 2BM2A 2H9HA 3PMJA 3U1JB 2ZHFH 1YP9A 2HOBA 1SGIB 2Y7ZA 3VB4A 4DOQA 2ZHEH 1Y3WA 3ZZ5A 1G37A 2PR3A 1D9IA 1W13U 2FOHA 3T5FH 5DP9A 4BTIB 1QL8A 1TBRH 1RRKA 1JRSA 1G3DA 3HGPA 4D8NA 4X6MA 2GX4A 1F5KU 1EOLA 3A89A 3SUDA 2SGAA 2STBE 2QAAA 2JH5D 4NCYA 2VVVA 5E8EH 4UE7H 1C2DA 1MZAA 5E0GA 5FAHA 2V3OH 2AIPA 4UFDH 1LHEH 1EUFA 1NPMA 2HPPH 2OUAA 3OSYA 4FUDA 1OX1A 2CXVA 2XTTB 3C27B 2A7CA 1O35A 1UO6A 4BXSA 3AASA 4MG3A 1HRTH 4Y71A 2XRCA 1PPGE 1GJ4H 1YCPM 1D6WA 2GCHG 1CHGA 2WPJS 5A0AE 1KLIH 1XKBC 1SFIA 1Y5BT 3JZ1B 3RP2A 5C5NA 3E1XB 1E37B 1YPEH 4A1VA 3ZZ3A 1GBMA 1GI2A 3SHAH 1CGJE 2PSXA 4AYVB 2R2WU 1B0FA 4DW2U 4ISOA 4BAKB 1AKSA 1O2HA 1O3EA 2ZG0H 2VGCC 5FX6A 2Z9IA 4FXGH 1J15A 3ESTA 3T28A 4JZDH 3SNAA 2AMQA 1EJAA 1GMCF 2W26A 2GTBA 2WPMS 1JWTA 1DE7H 2PGQB 5DK1A 4DT7B 5F03A 1DOJA 3TVJB 3ZVDA 1O3AA 1KXAA 5E0JA 4D9RA 1LVBA 4Q7YA 3NWUA 1GHXH 1TNIA 4H6SB 1YF4A 4MNWA 1NRQH 4K8YA 1BHXF 2BD3A 1IHTH 1O0DH 5T6DA 2BOKA 4YLUA 1LCYA 1PPZA 3NK8A 1CT0E 4CR9A 1DICA 4E05H 1G3EA 2AGEX 1EX3A 4AFSA 4X8SH 2PSYA 3M7TA 1GI5A 1AWFH 1DT2A 1K9OE 1BTYA 3WY8A 3DA9B 1J9CH 4BNRA 2EA3A 1H4WA 1SSXA 1O3IA 1QJ6B 1N8OB 4NIVA 1FLEE 3QTVH 3LH3A 5A0CA 1HCGA 4A5TS 2G52A 4I31A 1LHDH 4H6TA 4K1EA 4Z0KA 1EOJA 1O2QA 1UTPA 4NWLA 2FOFA 2Y5HA 1HFDA 2H2ZA 9LPRA 1ZTLA 1BBRK 2GDEH 2PHBA 1C1UH 1O3GA 2BX4A 2C3SA 1AFQC 4HTCH 3NKKA 3E6PH 1CO7E 3TJVA 2ZKSA 2J92A 4OS2A 4TPYA 1GMDF 1YKTA 1O3PB 5JPMH 4X1QU 4NIWA 1O2ZA 1V6DA 2ZTYA 1VJAU 4IMQA 4HFPB 1MD8A 1C2KA 1K21H 2HNTE 1K1LA 3URDA 1AIXH 1GI0A 2OBOA 4YTAA 2R0LA 3KEEA 2ZWLH 3DFLA 3F9GA 1SGEE 3Q77A 3KHVA 1H8IH 2ANKH 2QGRA 2ZC9H 2A7JA 1QJ7B 3GY7A 3SI4H 4ABFA 1QHRB 4B74A 2FESH 3F1SB 4X0WU 1MU8B 1ETTH 3RMNH 4TWYA 3SHCH 3VEQB 5T3HA 3E8LA 4MPUA 2TGAA 1A2CH 2BQWB 1BCUH 1SGNE 5CHAB 3R0FA 3BTWE 1P9SA 3B9FH 5C5OA 1ESTA 3PWCA 4ISLA 3FZZA 3ZZDA 2OC7A 2PKAA 1ORFA 1ZHMA 1MH0A 3GYLB 2FS8A 3VB7A 3ZYEA 2ZIQH 4UD9H 2TGPZ 4TPIZ 4UFEH 3A86A 4ZKOU 1P2QA 5L30H 1VITG 1YCPH 2ZQ2A 2XCFA 4RSPA 1FY4A 1E34B 3SV7A 1AB9C 2QXJA 1C1OA 1QA0A 5J4SA 3GYMA 1QRXA 1AQ7A 4K3JA 5A09A 1RGQA 1NFYA 3RXUA 3STIA 5FX5A 1ZMLA 1PYTD 1MKWH 2YNAA 3RXVA 1GHBG 1WTHD 3TGJE 1DXWA 3LGTA 1XX9A 1TGBA 2V0BA 4DURA 1QL9A 1TPSA 4GHTA 5IYTA 2C4FH 3PLKA 1EPTC 2XBVA 4JYUH 3TGIE 3MI4A 1ELFA 2BY7X 3EDXB 2Z6BD 1AFEH 5DP5A 2ZU2A 1V2ST 1UHBA 4ABEA 4ZMAH 1UVUH 5A8XA 1TB6H 3O8DA 1O2JA 1Z71A 4KTSA 3RXGA 1OWIA 1ZSJA 2ZGHA 2FM2A 4B73A 2IOTA 2BDBA 2HLCA 3HPTB 1Y8TA 3H7TA 4Y0ZE 1SVPA 1HXEH 2ZPSA 2J95A 2ESTE 1P57B 3RM2H 1ANEA 3FANA 3T26A 4BAOB 1KLJH 5GIBA 2ZPQA 5CE1A 4K5ZA 3VB5A 2Y6TA 1AMHA 4O3UA 3ZV9A 4ABAA 2VIOA 1ELCA 1O3KA 1MD7A 2BDIA 1DLEA 3UIRA 1DVAH 1W7GH 3K6ZA 1THSH 2V3HH 1FY8E 1C2JA 3VPKA 1O2NA 2ZDMA 4Y11E 1NESE 5FXLA 3SN8A 1RXPA 3MU1A 1CSOE 5H4IB 3A85A 4UFFH 1S81A 1VGCC 2FYRA 1BBRH 3ENSB 5HMAA 3RC5A 5ABWA 3ODDA 2C93B 1P03A 4JZ1A 5DP7A 1UCYK 2FLRH 1O5BB 1AVXA 1QCPA 2PV9B 2VGCB 4AG1A 1TGSZ 5A8ZA 1C5OH 1QIXB 8GCHG 4Y8ZA 3HGNA 1V2WT 1C2GA 3F9HA 4WMDA 3P6ZB 3E16B 3CS0A 5FBIA 1ZZZA 1FY3A 3U8TH 1ANDA 1HAXB 2PLXA 5C1XA 4I7YH 1A0JA 1SR5C 2P3FH 1TNLA 3ZZCA 3ZVFA 2ZFFH 3E0NB 1NU7B 3BTHE 4BTTB 5E2PA 4ABJA 2OQ5A 4UEHH 2GP9B 1BTPA 4JZIA 1A61H 1C9PA 3NZIA 3QWCH 1LVOA 2AEIH 3BG8A 3QK1A 1ZOMA 2ZQ1A 5F8TA 1C5SA 4AFQA 1HAYB 1RTKA 4OS6A 2HPQH 2BQ6B 1BTHH 1GI7B 2ZU3A 3SNEA 1EB1H 2PUXB 1PPCE 1SOTA 1E35B 2Z9GA 4X6OA 3VGCB 5EXNA 1C9TA 1WQSA 1FDPA 1MBQA 2A4QA 4NIXA 4A1TA 2BB4A 1GI6A 2UUFB 1GBJA 2Y81A 2ZHDA 1TBZH 2NU1E 3L33A 2UUYA 2CJIA 1ELEE 4I32A 3NXPA 1GJ9B 5TCAA 4Z6AH 1C4V2 1ZMJA 1GMHG 3LIWA 1QL7A 1L4DA 1HAOH 3RXJA 4BOHA 3NPSA 1LPGB 1WU1A 1UCYE 2ZFPH 1GDQA 2IJOB 3U8OH 5J4QA 1ZGVA 2PKSB 1C5ZB 1GJCB 3OYPA 1O3NA 2F9OA 3LT3A 1TONA 5A2MH 1O5FH 4FU8A 1FY1A 4CR5A 5EPYA 3EA9A 2ODYB 1Y3YA 1MTVA 3SGQE 1XXDA 2VWLA 1YPHE 4I33A 1D3TB 1PYTC 2EEKA 4U30A 4FUEA 2FTLE 1K2I1 3TK5A 3E91A 5GCHG 2PKAB 1EASA 1IHSH 3E90B 2Z7FE 1SG8B 5FPSA 1IAUA 1GCTB 3FFGA 4Y8YA 4XBCA 1Y5UT 1CE5A 4ASHA 4R8TB 1VCQA 3TPIZ 1L1NA 1A46H 4FU7A 4VGCB 1AUJA 4ABDA 4XDEA 1SL3A 1DDJA 5EQRA 5GXPA 3H5CB 2BTCE 1W0YH 5EODA 5JB9S 1JBUH 2Q1JA 1P02A 2ZCHP 1QB9A 3W95A 2FX4A 3BTDE 2F9UA 3LDXH 2OTVA 1NO9H 1NTPA 4CREA 3SUGA 2FOMB 1EB2A 1HIAB 1GHAF 2VB0A 4K69A 1P10A 2O9QA 3GOVB 3QGNB 1H9LB 4NA8A 3UTUH 2LPRA 2ZZUH 3UREA 1MCVA 1SPJA 2CV3A 3QO6A 1ZHPA 2Z3EA 1CHOF 3H7OA 2R2MB 3L3TA 3DD2H 5AF9H 1TQ7B 2ZHQH 1UVTH 3RXRA 5DJ7A 2PTNA 4WWYA 2F91A 1IQKA 5LGOA 3RXPA 3P95A 3A7WA 4Y79A 1KTSB 3MNBA 2H9TH 3OU0A 3S69A 1C1NA 2O8WA 1PFXC 1TE0A 4IS5A 3KL6A 1V2PT 2B7DH 1TAWA 4XBBA 1SOZA 4IC5A 5EU8A 1IOEA 4WH6A 3SJ8A 1P06A 3HATH 2JETC 1C2IA 1V2TT 3QX5H 1N6XA 5L6NH 4X1SU 3SUEA 1SQAA 1S84A 1QNJA 3V12A 3QLPH 3EAJA 2ZGBH 1T8NA 4B2BA 1ZPCA 3ATIA 3ATLA 1GI1A 1QBOA 2FDAA 1ABJH 2NU2E 3S9AA 3DHKH 4DVAU 2I6SA 1TNHA 1AU8A 2XBYA 4HGCA 1AN1E 4LK4A 2D8WA 4AFUA 2HGTH 2OC8A 4NFEA 3EGKH 2R3YA 4PROA 3ATKA 5E0HA 2VNTA 3ATWA 5FCKA 2ZDVH 2C8WB 4IN1A 1L2EA 2VIDA 1NRSH 1HNEE 1SGPE 4I8HA 1N6YA 3BTGE 2NU0E 1SHYA 1SFQB 3FZDA 1P2KA 4MTBA 4ZHMU 1KYNA 2IPHA 2PWXA 1XMNB 1K1NA 2VIVA 3BIVH 4GVUA 1TYNA 7GCHF 2A2XH 2G81E 5DP3A 1C1TA 3U9AH 1YLCA 2W3KA 2BD9A 2FODA 3EA7A 3RM0H 5T6FA 1S82A 4MNVA 2VIPA 1H8DH 1ESAA 1DM4B 3UY9A 3MOCA 1A5HA 2UWLA 2ANYA 1GCDA 2HNTF 4HI3A 1ELBA 1A0LA 1L4ZA 1W10U 2BD5A 4O03A 1HJAC 1C2HA 2VWNA 1C5LH 4D9QA 1DWEH 2C8ZB 1DXPA 5JYIA 2OP9A 3DUXH 2P94A 4CH2B 4ZUHA 3BIUH 3SU3A 4JZEH 4GLYA 1Y3VA 2BLVA 1WAYB 4KTCA 5EXLA 1A3BH 2SGEE 1O34A 1C2LA 1C2EA 3AAVA 1TPAE 3U1IB 4CRDA 3SNBA 2PUQH 2BY6X 2WUBA 1DY8A 3C1KA 1HXFH 1C2FA 4ZHAA 4JYVH 1GBLA 3MH5A 5C67A 3PROA 1TGTA 1O2WA 2FOAA 1BMNH 5C3NA 5HXFA 2FOBA 3SU5A 1EZXC 5ESTE 1P11E 1GBFA 1BTZA 2OLGA 4WMEA 3PTBA 2NU3E 2ALPA 2BDAA 2RCEA 1QB1A 2O8MA 4ISIH 4KELA 4ABBA 4BXWA 4YOJA 3RXQA 1SLUB 1YCPK 1Z8IB 1BB0B 1DANH 1BRUP 1JIMA 2Y82A 1O32A 1Z1JA 1KSNA 3EE0B 1ZYOA 1MQ5A 1GJBB 3A7ZA 1SQTA 1MTUA 1YPJH 3QZRA 1MKWK 1ZRBA 4YM9A 2QV1A 1P2IA 1LHCH 1OS8A 3B8JA 2Y5GA 2BD7A 1NN6A 1FQ3A 1LPZB 4WVPE 2A4OA 1JRTA 4BTUB 1Y59T 1Z1IA 1BT7A 1EJMA 2RA0A 4DIHH 2K1QA 3ZZBA 1HUTH 1QB6A 1SGRE 1ZJDA 1BITA 1PPHE 4K8BA 3GY4A 2A32A 1YPKH 1TIOA 4DCDA 1FV9A 1TNKA 2GCHF 2VVCA 1O2IA 3QTOH 1AWHB 4O3TA 3QZQA 5K7RA 3SV2H 3I29A 1UTJA 3RU4E 1WCZA 1NU9A 1TFXA 1PQAA 4IGDA 4AG2A 1GVLA 3S9BA 3PB1E 3RXIA 1AUTC 1VJ9U 4DY7B 4BANB 1O2RA 4CRFA 1KXEA 2ZTZA 2AH4X 1CBWB 2P8OB 4YT6H 1H1BA 3D62A 2ZTXA 1GVKB 5FPYA 1O3DA 5AVDA 1KLTA 2A2QH 1BJVA 4X2VA 5IDKA 2C8XB 2OQUA 3RUOA 4ZXYH 5C20A 1KDQB 1O2SA 1OXGA 5AHGH 1HAVB 4FUCA 4FUHA 4BAQB 4YO9A 2ZCKP 2PGBB 2QN5T 1GI9B 3A7YA 1T31A 2P3UB 2FOCA 2JETB 3RXAA 2JKHA 3A83A 1GG6C 1HAIH 2FS9A 1DWDH 4GAWA 1SLVB 2ZECA 1MTNB 4INKA 1V2LT 1TMBH 2G4UA 1T4UH 3MMGA 5DGJA 1XM1A 3RC4A 1S0QA 1LTOA 2CF8H 1SGDE 4F49A 3GDUA 2BLQA 3BSQA 3VFEA 1W3CA 2F83A 3MH4A 1C5NH 1NC6A 1NFWA 1Q3XA 3TH3H 4AORA 3FP6E 2WUCA 4CRAA 1ZSKA 3V0XA 3EQ0H 1XUGA 2XC0A 4Q7XA 1QRWA 3UNQA 1TRMA 1ETRH 3IITA 4E06H 3GISB 1J14A 1WUNH 1E38B 4A92A 3KGPA 2YOLA 1RIWC 1EXFA 1O3FA 1TNJA 5B6OA 2GZ7A 4GCHG 3GY6A 1ANBA 3MNXA 1DSTA 4RKOB 3VXFH 3ZZ8A 2ODPA 4K1TA 2BD8A 4X8VH 5FCRA 3BG4B 1DWBH 2BVSH 5A8YA 3T29A 1E36B 2Q6GA 1AZ8A 1FMGA 2Z9LA 1B5GH 1O2VA 4Y76A 1DITH 2ASUB 2GV7A 2F9PA 1TRNA 3HK3B 1XUHA 3KQDA 1BBRE 1O3BA 5DPAA 4AGJA 1LHGH 1GHWH 4UONA 2GV6A 1UMAH 1QBNA 2PTCE 1DUEA 1X7AC 3KQCA 1HJ8A 3LKWA 1NS3A 3M5OA 3NCLA 4JZFH 4E7NA 2BVXH 3S7HB 1SGYE 3FAOA 4R0IA 4CHAC 3PYHA 3MFJA 1Z7KA 4Y8XA 3SBKA 2FO9A 2Z9KA 1HIAA 2TBSA 1DY9A 2GGVB 3LPRA 1C5TA 2OC1A 1IQLA 1U6QA 3A8CA 4CRBA 1DX5M 1UTOA 5AFYH 2BOHB 5JBTA 2HVXA 4Y0YE 1GHZA 2D26C 3RMMH 3SU1A 1EPTA 4AB9A 3K6YA 4ISHH 4A1XA 2GMTC 5FBEA 2O8UA 1MCTA 4INHA 1AZZA 5EOKA 3GICB 1MTWA 1VITF 1OWHA 4CH8B 3M7QA 2ZP0H 4THNH 3BTME 4XSKU 1PJPA 1LPKB 3SJOA 1A3EH 1SLXB 5DKMA 1EJNA 3FP7E 1M9UA 2FXRA 3O8CA 4K60A 4FU9A 3M7UA 2ZFRH 1GHBF 2SFAA 1EATA 1OOKB 2O8LA 3LGIA 1V2JT 4FUBA 2GD4B 1J17T 1O3LA 1YBWA 3ATMA 3Q76A 3A7TA 4CBOA 3SU0A 3SQHE 2TGTA 3SQEE 3SJKA 2OXSA 1MQ6A 1A7SA 2BVRH 1W11U 1BOQA 1PPFE 2XWBI 2B9LA 1IQFA 1LDTT 1EP6A 3P17H 5L2YH 4OS7A 3O8BA 3RXLA 1BTWA 1HLTH 2AIQA 1A1RA 3UWIA 1V2NT 3BV9B 1YM0A 1HB0B 1BRBE 4OGYA 6CHAC 1UTKA 4OS4A 4AFZA 1XVOA 3PO1C 4NA9H 2WINI 4AZ2B 3SZNA 5ESBA 2VWMA 1UVOA 2FWWA 2A0QB 1NT1A 1FZZA 2XNIA 1TQ0B 2QXIA 3PTNA 1UVPA 1XUKA 4LXBH 3V13A 1AE5A 1WTGH 1K1PA 2H5DA 3M3SA 1TX6A 1MZDA 1O2KA 1MTSA 3LJJA 2QYIA 2EI8A 1B0EA 3A82A 2CHAC 3RC6A 3LJOA 1PQ8A 3SORA 3SU2A 4X1NU 1J8AA 3OY5U 2A5KA 1V2MT 1THPB 4INLA 2VJ1A 2HNTC 1D4PB 1MBMA 2VH0A 2F3CE 2UWPA 3KCGH 4OS5A 3M3VA 1UK3A 3B23B 1XUJA 4CRCA 1G9IE 1GGDC 1AI8H 2G55A 1C5VA 3RXOA 7KMEH 4H4FA 2GKVE 4Q80A 4MLFB 2C90B 3TK6A 3FVFB 5BRRE 2BLWA 1GBBA 8GCHF 3HK6B 3ZVCA 1P2JA 2AFQB 4NSYA 1V2KT 2WPLS 1ZSLA 4NZQA 2BY9X 3PV4A 4Q2KA 1O3OA 5T6GA 3UUZA 1FY5A 3SO3A 5JBCS 3LGVA 3BTQE 1AFQB 1P8VC 3BTFE 4CBNA 2DE9A 4MNYA 1KTTB 1TABE 2FEQH 2ZO3H 2D1JA 2W3IA 1CA0C 4KP0A 8ESTE 4MNXA 1HBTH 2CGAA 2BMGB 3D65E 2BXUH 1NFXA 2AS9A 5EQQA 1C1WH 1P09A 3FP8E 2A4RA 1ABIH 2BDCA 1F0UA 7ESTE 5CMXH 1EAWA 3HKIB 2M5TA 5GDSH 3U98H 2BD4A 1MKXH 1UTQA 2FPZA 2OBQA 1GMHF 1XXFA 2RA3A 3TNSA 4YOGA 1MMJN 3A84A 1DSUA 1TOCB 4IMZA 3MH6A 4Q7ZA 3SU4A 3UNRA 3LGWA 5HYOA 5F8ZA 3KQBA 2FI3E 5FHTA 5SGAE 3MO3A 1FIZA 3GCTG 3K65B 2SGDE 2GDDA 3KN2A 3URCA 1ESBA 1GJ6A 1ZJKA 1BQYA 1QQUA 5LH8A 2BYAX 4TY6A 3RMOH 1IQJA 1VZQH 2PW8H 1AB9B 1GBDA 3ZZ9A 1O5CB 3MU5A 2BZAA 1C5QA 4AOQA 1K28D 1P05A 1KY9A 3K2UA 4XBDA 2ZGXH 1XVMA 1FXYA 1MU6B 2EC9H 1PQ7A 4X2WA 4ABGA 5GCHF 1W2KH 1EPTB 2XXLA 1DPOA 6GCHG 1OSSA 2EI7A 2VVUA 3OY6U 1SQOA 2Y80A 3KIDU 1HAPH 3OTJE 1ZLRA 1RTFB 1T4VH 2BY8X 2A45B 3K9XB 4D76A 3L6PA 1MUEB 1ANCA 1P2NA 1SMFE 1G3CA 1RS0A 1F7ZA 3GY3A 1GJAB 4NG9H 1C5PA 1V2VT 4ZKRU 5FPTA 3MNCA 1KDQA 1ZPBA 3LGUA 3V3MA 4AYYB 4JK6A 2XBWA 2THFB 4FUGA 2B0FA 4I8KA 1HAVA 1FN6A 3LU9B 3G01A 1O3JA 3LONA 1YGCH 2WYJA 1FNIA 1O2GH 5L2ZH 1ARBA 4QT8C 1BRCE 3RLYH 1WSSH 2STAE 2P16A 2WV4A 1YPMH 2JH0D 3CS7A 3A7VA 4ABHA 2A4GA 3TJNA 4LZ4B 2A1DB 3IWMA 3MH7A 1EZUC 3BTEE 4KGAA 4B75A 1P04A 1EQ9A 3P8OA 3BEUA 5I25A 3MTYA 1C1PA 2QCYA 1C1RA 1VGCB 2W5EA 1Z8GA 2FZZA 1QQ4A 3SGAE 1OPHB 1QY6A 3M3TA 1CT4E 3A80A 5JBAS 4MPVA 1GBCA 1TOMH 1WYKA 3F9EA 2QXGA 1JOUB 2CF9H 2UUKB 1ZTKA 2ZU1A 4X2YA 1UK2A 2FOEA 4B2CA 3ZVAA 1C5MD 3P8GA 1GI4A 2G8TA 1ZPZA 1AD8H 1HAZB 4AB8A 1TBQH 2SGFE 4X8TH 4ZAEA 2WPKS 4RN6A 3VB6A 1SGFA 1MAXA 1LMWB 1TNGA 1GPZA 2YNBA 3TGKE 1GWAA 4JMYA 2TPIZ 1V2RT 5F6MA 5JDUB 2VIQA 1C1MA 2CHAB 3MWIU 1EAXA 1Y5AT 1N1LA 3SW2B 1GBIA 1Z6EA 2ZDKA 3SNCA 2PFEA 1FJSA 3E0PB 1BZXE 2GZ8A 4X6NA 3F6UH 2FI4E 3TH4H 2XC5A 2Y7XA 2FP7B 4OS1A 2RG3A 2A5IA 1TA6A 4NFFA 1D3DB 1VR1H 4WH8A 4K2YA 4M7GA 4A6LA 1V2OT 1JXPA 1YPHC 1O2PA 1YPLH 2XWAA 2JH6D 2CN0H 1ZGIA 1BA8B 1A5IA 3MYWA 4GSOA 1FUJA 1DS2E 2A5AA 4GPGA 1DLKB 3LC5A 3SI3H 3GDSA 3U8RH 4F4OC 1W12U 3PLPA 2V35A 2ODQA 5EPNA 4B2AA 2R9PA 1CA0B 1IQHA 2G00A 2Z3DA 3P8NA 4FVBA 2P59A 1ELAA 1GBHA 2GCTC 3SOSA 3D49H 1GJDB 5HM2A 4U2WA 8LPRA 1EAUA 4JCNA 1O2OA 4WF8A 1Q31A 1SB1H 3ZZ6A 1ELVA 3RMLH 3I77A 1QJ1B 2FMJA 1LKAA 3P8FA 1BIOA 3TJUA 1XKAC 2CMYA 1ELDE 1FPCH 3PLBA 3PWBA 3TIUA 1GMCG 1QFKH 2BD2A 2XCNA 1TGNA 1BMAA 2HALA 1P2MA 2QF3A 3PMAB 1JMOH 1G36A 5K0HA 3TU7H 5G4BA 1SGTA 2TRMA 1CVWH 1G2LA 5C1YA 4DG4A 1BRAA 3PMHB 1THRH 2ZDNA 2J34A 2W7UA 3UNSA 4WXIA 2SNVA 1Q2WA 1GDUA 1YLDA 3RU4D 1UTNA 3MNSA 4X2XA 3MU0A 1KIGH 4U01A 2C8YB 2XW9A 4GUXA 2AMDA 1F0RA 2Q6FA 2OINA 1T7CA 5EXMA 1BHXB 1O2LA 1ELTA 1FIWA 3GCHC 4TYDA 1LQDB 2GVFA 3ZVGA 3P92A 1O33A 5E2OA 3RDZA 1PQ5A 1OWDA 3AW0A 2XYAA 1S5SA 1C4U2 5LPRA 2P93A 2SNWA 3GY2A 1S85A 1F2SE 3RXMA 5EW2H 3TK9A 1NRPH 1OYQA 1A5GH 2ZA5A 1GMDG 1S6FA 1C5RA 1C5WB 1KXDA 4IW4E 2G5VA 2XBXA 2ZHWH 1W7XH 4I8LA 3TH2H 1LVMA 9ESTA 1W0ZU 1IQMA 2G4TA 3VGCC 1TA2A 4ZROA 1NY22 3SV6A 1IQEA 1L1GA 3RXHA 4BAHB 2ZDLA 4WXVA 5EG4A 1QA7A 2RDLA 1TWXB 1F0SA 4BAMB 3VXEH 4NA7A 1O39A 3M61U 4UFGH 1OKXA 4NGAH 1RTLA 4WY3A 1FAKH 4X6PA 5DG6A 1OP0A 1SGFG 2GT7A 3EYDA 2PKSC 4MDSA 2ZCLP 4ABIA 5LPEA 1AVGH 5TJXA 1AVWA 3STJA 3SU6A 3RXDA 4K1SA 5JBBS 6LPRA 1S6HA 4CRGA 1GHYH 4FUIA 1C4Y2 1SGQE 3E3TA 1V2QT 3F9FA 1D6RA 1VCPA 3S9CA 1QGFA 5TCCA 4ZH8A 1C1VH 1GL1A 1O38A 2FYQA 2WV5A 1AHTH 1H9HE 1E0FD 3SJIA 4I8JA 3A88A 1HGTH 2Z3CA 4ZKNU 1RFNA 1BUIA 4A7IB 1BTUA 1G30B 5C1UA 2O8TA 1BJUA 2BY5X 1GCTC 2R3UA 2G51A 1W8BH 5LPFA 4X8UH 3D23A 4MVNA 3MO6A 4VGCC 3ELAH 3ZVEA 3VB3A 3UR6A 4B1TA 2B8OH 2J9NA 1ZR0A 1HJAB 1FONA 1D3QB 4X1PU 3V7TA 4SGBE 1Y3UA 4GCHF 1OP2A 2F9NA 3S0NA 1EZQA 5JB8S 2Z9JA 1HYLA 4NWKA 3P70B 1K22H 2KAIA 4XE4A 1FN8A 4J1YA 2H6MA 5DP6A 4NZLA 3MO9A 1LQEA 1DWCH 3A81A 1W14U 1TMTH 1KXFA 4SGAE 1NROH 1NZQH 1SHHB 1Z8RA 1WQVH 2VINA 4AX9H 1O36A 3RXKA 1MKXK 5DP8A 4GHQA 2ZDAH 2FOGA 5ETXA 2FLBH 1JIRA 3QUMP 2QY0B 2ZU5A 4KKDA 5EW1H 2J94A 2F9VA 1QURH 3ZV8A 2ALVA 1HV7A 3F68H 2A7HA 2LNCA 4ZHLU 1QRZA 2ILNA 3M36A 4MPWA 1ELGA 2WYGA 2OCVB 2ZFSA 1GVZA 2FIRH 4FUJA 4WMFA 2D2DA 1SI5H 2W7SA 2GCTB 1L1JA 2H5CA 3S7KB 1AO5A 2BLOA 1O31A 3ZZAA 3I78A 1P2OA 3UR9A 4YZUA 2ZEBA 3N7OA 1NM6A 3TNTA 1S83A 4D7FA 4FUFA 1P0SH 1NRNH 2ZPRA 1F92A 1GBEA 1INCA 4UDWH 4IN2A 1GJ7B 1C5XB 8KME2 1YYY1 3T25A 4LZ1H 3T2NA 4X1RU 2V6NA 1HPGA 4I8GA 1UVSH 4OGXA 4DJZB 2H9EH 2IN2A 1YC0A 3U69H 4B76A 4TWWA 4O9VA 2BZ6H 3PMBB 1O2YA 3LH1A 3GCOA 4TY7A 2XC4A 3MU4A 3SV8A 1FPHH 2NWNA 1RD3B 2Y5FA 3KNXA 1O37A 1P01A 1SC8U 1OP8A 4YESB 1EAIA 1AKSB 1O2MA 3LC3A 4D7GA 2VIWA 1Y3XA 3GY8A 4KTUA 2B5TB 2ZGJA 3LGYA 1QR3E 5GJ4B 3RU4T 4XFQA 4ISNA 2ZGCA 3AW1A 3RXSA 3GY5A 3IG6B 3GCHB 4YOIA 3M5LA 2UUJB 1GDNA 4IBLH 1T32A 1AY6H 3AAUA 3GDVA 2AERH 1ACBE 2WPIS 1OWEA 3OX7U 1V2UT 3RLWH 3AVZA 3R3GB 5DP4A 1HAHH 1HDTH 3DFJA 3HKJB 2A31A 1J16A 1CU1A 1LKBA 1RJXB 1TLDA 1XUFA 3BN9A 2BXTH 1QTFA 1ETSH 1LO6A 1A4WH 1TGCA 1O30A 3A8BA 2Z94A 1FAXA 2OC0A 3UOUA 1CQQA 2NU4E 3M5NA 1O2TA 1BMMH 1D3PB 1WBGB 3W94A 4Y10E 4AGKA 1GG6B 2ZNKH 1KXBA 1BMLA 3LOXA 2J38A 3RXBA 3T27A 1DUAA 3QN7A 2ZI2H 3UQVA 1V3XA 1NFUA 5HGGA 1EZSC 1O5AB 1H9IE 7LPRA 1O5DH 3SGBE 2G5NA 2SGQE 2BX3A 1TALA 2VH6A 2UWOA 1WV7H 3ZYDA 1C1SA 1GBKA 2GT8A 4DGJA 1G32B 1GL0E 5AFZH 1T8LA 1FI8A 4JK5A 1ID5H 2BQ7B 3SJ9A 2P3TB 1C5YB 1TRYA 1RIWB 3M5MA 1CGIE 2QA9E 3SUFA 2DUCA 2VU8E 1GJ8B 3KQEA 1TPOA 3Q3XA 5GWZA 3ITIA 1BDAA 3RXCA 3QGJA
chains in the Genus database with same CATH superfamily
1EP5A 2TGDA 4RKJB 4AN7A 3CP7A 1GBAA 1KXCA 3F2GA 1GHAG 1K1IA 1T8MA 3BF6H 1AE8H 2FI5E 2BDGA 2ZFTA 3BEFB 3UFAA 1O3MA 2DE8A 2AYWA 1SKYE 1CHOG 2FTMA 5C2ZA 3Q3YA 2TIOA 1G3BA 4FVDA 1VKYA 1WOFA 4J2YB 5EGMA 3DSGA 2WPHS 3ZZ4A 1K1JA 2KAIB 2M2AA 5EIYA 2QF0A 1C2MA 4CHAB 1TX8A 1CA8B 2SGPE 3ODFA 3BEIB 3UPEA 4MPXA 5T1VA 1K1MA 2ZFQH 3KF2A 1GI8B 5DO4H 2HRVA 1ZHRA 1UK4A 5F8XA 4XOJA 1T8OA 3GCNA 2P95A 1ZMNA 1SGCA 2H1UA 3O8RA 1C5UA 1GI3A 3GCTF 4NIYA 2GMTB 1UHBB 5HM9A 1YPGH 1EKBB 2ANWA 3NUMA 1TX7A 1UCYH 3UAIC 1ZRKA 1O3CA 1HAGE 1IQIA 3A87A 3UQOA 1CBWC 2P8OC 3A7XA 4TSFD 3BTTE 1H8HD 1GJ5H 3RXTA 3SV9A 2AGIX 1NRRH 1O5GH 1IQGA 4YLQH 1O3HA 3W1EA 1A0HB 1N8OC 3BTKE 1F0TA 1MAYA 5A0BA 1AGJA 5PTPA 3Q00A 4DIIH 2ZU4A 1F5RA 1XUIA 6GCHF 2OD3B 2J2UA 2F43B 4LOYH 4MQAA 4O97A 5BPEA 3RXFA 2BDYA 3UWJH 1O2XA 5I46H 3T62A 3TLOA 3M35A 1DFPA 2J4IA 1VCWA 1HJ9A 3A8DA 1OWKA 5GPIB 4ZKSU 1ZTJA 1UTLM 5KEDA 1MTNC 2I6QA 4YT7H 4HZHA 1VITH 3A8AA 2ANMH 7GCHG 5C94A 1O2UA 2Q6DA 4IC6A 2GZ9A 2KR7A 6CHAB 2EI6A 1O5EH 2AGGX 4ESTE 1QZ8A 1UJ1A 4NSVA 3PO1B 1K1OA 3UOPA 3FOAA 3TITA 3PM3A 4U32A 2QIQA 4Y7AA 4B6EA 1G2MA 4WJG2 4JYTA 1GBTA 1QBVH 1L0ZA 4E7RG 5KECA 1BTXA 3RXEA 1CGHA 1PPEE 1OYTH 3Q3KA 4Y7BA 1Z8JB 2BDHA 2R0KA 2AMPA 2ULLA 1C1QA 1IQNA 5CHAC 3ZVBA 3M37A 1GHVH 3ZZ7A 1S0RA 2VWOA 3MU8A 4B71A 3MHWU 1UTMA 6ESTA 1TPPA 3BG4C 1SLWB 1SBWA 2HWLB 5GNDA 1ARCA 3TJOA 4Y6DA 1GGDB 2FX6A 1TMUH 3EA8A 1COWD 1PPBH 1Z6JH 2HVYB 1P9UA 2ZF0H 1OWJA 1W0KD 4H42U 1P12E 1F5LA 1P3EA 5EQSA 1LVYA 2QXHA 3JZ2B 3DT0H 1CT2E 3CENA 2BHGA 2F9BH 4ZXXH 1LHFH 3QDZB 1P3CA 2QC2A 1B7XB 3SNDA 2BM2A 2H9HA 3PMJA 3U1JB 2ZHFH 1YP9A 2HOBA 1SGIB 2Y7ZA 3VB4A 4DOQA 2ZHEH 1Y3WA 3ZZ5A 1G37A 2PR3A 1D9IA 1W13U 2FOHA 3T5FH 5DP9A 4BTIB 1QL8A 1TBRH 1RRKA 1JRSA 1G3DA 3HGPA 4D8NA 4X6MA 2GX4A 1F5KU 1EOLA 3A89A 3SUDA 2SGAA 2STBE 3OTPA 2QAAA 2JH5D 4NCYA 2VVVA 5E8EH 4UE7H 1C2DA 1MZAA 5E0GA 5FAHA 2K0QA 2V3OH 2AIPA 4UFDH 1LHEH 1EUFA 1NPMA 2HPPH 2OUAA 3OSYA 4FUDA 1OX1A 2CXVA 2XTTB 3C27B 2A7CA 1O35A 1UO6A 4BXSA 3AASA 4MG3A 1HRTH 4Y71A 2XRCA 1PPGE 3EE7A 1GJ4H 1YCPM 1D6WA 2GCHG 1CHGA 2WPJS 5A0AE 1KLIH 1XKBC 1SFIA 1Y5BT 3JZ1B 3RP2A 5C5NA 3E1XB 1E37B 1YPEH 4A1VA 3ZZ3A 1GBMA 1GI2A 2PP6A 3SHAH 1CGJE 2PSXA 4AYVB 2R2WU 1B0FA 4DW2U 4ISOA 4BAKB 1AKSA 1O2HA 1O3EA 2ZG0H 2VGCC 5FX6A 2Z9IA 4FXGH 1J15A 3ESTA 3T28A 4JZDH 3SNAA 2AMQA 1EJAA 1GMCF 2W26A 2GTBA 2WPMS 1JWTA 1DE7H 2PGQB 5DK1A 4DT7B 5F03A 1DOJA 3TVJB 3ZVDA 1O3AA 1KXAA 5E0JA 4D9RA 1LVBA 4Q7YA 3NWUA 1GHXH 4XD7D 1TNIA 4H6SB 1YF4A 4MNWA 1NRQH 4K8YA 1BHXF 2BD3A 1IHTH 1O0DH 5T6DA 2BOKA 4YLUA 1LCYA 1PPZA 3NK8A 1CT0E 4CR9A 1DICA 4E05H 1G3EA 2AGEX 1EX3A 4AFSA 4X8SH 2PSYA 3M7TA 1GI5A 1AWFH 1DT2A 1K9OE 3PV2A 1BTYA 3WY8A 3DA9B 1J9CH 4BNRA 2EA3A 1H4WA 1SSXA 1O3IA 2L74A 1QJ6B 1N8OB 4NIVA 1FLEE 3QTVH 3LH3A 5A0CA 1HCGA 4A5TS 2G52A 4I31A 1LHDH 4H6TA 4K1EA 4Z0KA 1EOJA 1O2QA 1UTPA 4NWLA 2FOFA 2Y5HA 1HFDA 2H2ZA 4Q4LA 1ZTLA 1BBRK 9LPRA 2GDEH 2PHBA 1C1UH 1O3GA 2BX4A 2C3SA 1AFQC 4HTCH 3NKKA 3E6PH 1CO7E 3TJVA 2ZKSA 2J92A 4OS2A 4TPYA 1GMDF 1YKTA 1O3PB 5JPMH 4X1QU 2KCAA 4NIWA 1O2ZA 1V6DA 2ZTYA 1VJAU 4IMQA 4HFPB 1MD8A 1C2KA 1K21H 2HNTE 1K1LA 3URDA 1AIXH 1GI0A 2OBOA 4YTAA 2R0LA 3KEEA 2ZWLH 4RT1A 3DFLA 3F9GA 1SGEE 3Q77A 3KHVA 1H8IH 2ANKH 2QGRA 2ZC9H 2A7JA 1QJ7B 3GY7A 3SI4H 3SZEA 5C0UA 2W6JD 4ABFA 1KMHB 1QHRB 4B74A 2FESH 3F1SB 4X0WU 1MU8B 1ETTH 3RMNH 4TWYA 3SHCH 3VEQB 2HLDD 5T3HA 3E8LA 4MPUA 1YLNA 2TGAA 1A2CH 1SQRA 2BQWB 1BCUH 1S6LA 1SGNE 5CHAB 3R0FA 3BTWE 1P9SA 3B9FH 5C5OA 1ESTA 3PWCA 4ISLA 3FZZA 3F0OA 3ZZDA 2OC7A 5DSFA 2PKAA 1ORFA 1ZHMA 1MH0A 3GYLB 2FS8A 3VB7A 3ZYEA 2ZIQH 4UD9H 2TGPZ 4TPIZ 4UFEH 3A86A 4ZKOU 1P2QA 5L30H 1VITG 1YCPH 2ZQ2A 2XCFA 4RSPA 1FY4A 1E34B 1NBMD 1AB9C 3SV7A 2QXJA 1C1OA 1QA0A 5J4SA 3GYMA 3VG8A 1QRXA 1AQ7A 4K3JA 5A09A 1RGQA 1NFYA 3RXUA 3STIA 5FX5A 1ZMLA 1NBME 1PYTD 1MKWH 2YNAA 3RXVA 1GHBG 1WTHD 3TGJE 1DXWA 3LGTA 1XX9A 1TGBA 2V0BA 4DURA 1QL9A 1TPSA 4GHTA 5IYTA 2C4FH 2LP6A 3PLKA 1EPTC 2XBVA 4JYUH 5EJLA 3TGIE 3MI4A 1ELFA 2BY7X 5IK2D 3EDXB 2Z6BD 1AFEH 5DP5A 2ZU2A 4AC9A 1V2ST 1UHBA 4ABEA 4ZMAH 1UVUH 5A8XA 1TB6H 3O8DA 2KZ4A 1O2JA 1Z71A 4KTSA 3RXGA 1OWIA 1ZSJA 3U28C 2ZGHA 2FM2A 4B73A 2IOTA 2BDBA 2HLCA 3HPTB 1Y8TA 3H7TA 4Y0ZE 1SVPA 1HXEH 2ZPSA 2J95A 2ESTE 1P57B 3RM2H 1ANEA 3FANA 3T26A 4BAOB 1KLJH 5GIBA 2ZPQA 5CE1A 4K5ZA 3VB5A 2Y6TA 1AMHA 4O3UA 3ZV9A 4ABAA 2VIOA 1ELCA 1O3KA 1MD7A 2BDIA 1DLEA 3UIRA 1DVAH 1W7GH 3K6ZA 1THSH 2V3HH 1FY8E 1C2JA 3VPKA 1O2NA 1EFRD 2ZDMA 4Y11E 1NESE 5FXLA 3SN8A 1RXPA 3MU1A 1CSOE 5H4IB 3A85A 4UFFH 1S81A 1VGCC 2FYRA 5HKKD 1BBRH 3ENSB 2F4LA 5HMAA 3RC5A 5ABWA 3ODDA 2V3MA 2C93B 1P03A 4JZ1A 5DP7A 1UCYK 2FLRH 1O5BB 1AVXA 1QCPA 2PV9B 2VGCB 4AG1A 1TGSZ 5A8ZA 1C5OH 1QIXB 8GCHG 4Y8ZA 3HGNA 1V2WT 1C2GA 3F9HA 4WMDA 3P6ZB 3E16B 3CS0A 5FBIA 1ZZZA 1FY3A 3U8TH 1ANDA 1HAXB 2PLXA 5C1XA 4I7YH 1A0JA 1SR5C 2P3FH 2YMSB 1TNLA 3ZZCA 3ZVFA 2ZFFH 3E0NB 1NU7B 3BTHE 4BTTB 5E2PA 4ABJA 2OQ5A 4UEHH 5C0TA 2GP9B 1BTPA 4JZIA 1A61H 1C9PA 3NZIA 3QWCH 5EJZA 1LVOA 2AEIH 3BG8A 3QK1A 1ZOMA 2ZQ1A 5F8TA 1C5SA 4AFQA 1HAYB 3KYGA 1RTKA 4OS6A 5B6LA 2HPQH 2BQ6B 1BTHH 1GI7B 2ZU3A 3SNEA 1EB1H 2PUXB 3NRLA 1PPCE 1SOTA 1E35B 2Z9GA 4X6OA 3VGCB 5EXNA 1C9TA 1WQSA 1FDPA 1MBQA 2A4QA 4NIXA 4A1TA 2BB4A 2QF5A 1GI6A 2UUFB 1GBJA 2Y81A 2ZHDA 1TBZH 2NU1E 4Q63A 3L33A 2UUYA 2CJIA 1ELEE 4I32A 3NXPA 1GJ9B 5TCAA 4Z6AH 1C4V2 1ZMJA 1GMHG 3LIWA 1QL7A 1L4DA 1HAOH 3RXJA 4BOHA 3NPSA 1LPGB 1WU1A 1UCYE 2ZFPH 1GDQA 2IJOB 3U8OH 5J4QA 1ZGVA 2PKSB 1C5ZB 1GJCB 2WV9A 3OYPA 1O3NA 2F9OA 3LT3A 1TONA 4ACBA 5A2MH 1O5FH 4FU8A 1FY1A 4CR5A 5EPYA 3EA9A 2ODYB 1Y3YA 1MTVA 3SGQE 1XXDA 2VWLA 1YPHE 4I33A 1D3TB 1PYTC 2EEKA 4U30A 2W6ID 4FUEA 2FTLE 1K2I1 3TK5A 3E91A 5GCHG 2PKAB 1EASA 1IHSH 3E90B 2Z7FE 1SG8B 5FPSA 1IAUA 1GCTB 3FFGA 4Y8YA 4XBCA 1Y5UT 1CE5A 4ASHA 4R8TB 1VCQA 3TPIZ 1L1NA 1A46H 4FU7A 4VGCB 1AUJA 4ABDA 4XDEA 1SL3A 1DDJA 5EQRA 5GXPA 3H5CB 2BTCE 1W0YH 5EODA 5JB9S 1JBUH 2Q1JA 1P02A 2ZCHP 1QB9A 3W95A 2FX4A 3BTDE 2F9UA 3LDXH 2OTVA 1NO9H 1NTPA 4CREA 4F48B 3SUGA 2FOMB 1EB2A 2IPQX 4ZCNA 1HIAB 1GHAF 2VB0A 4K69A 1P10A 2O9QA 3GOVB 3QGNB 1H9LB 4NA8A 3UTUH 2LPRA 2JJ2D 1YWUA 2ZZUH 3UREA 1MCVA 1SPJA 2CV3A 3QO6A 1ZHPA 2Z3EA 1CHOF 3H7OA 2R2MB 3L3TA 3DD2H 2KM0A 5AF9H 2V7QD 1TQ7B 2ZHQH 1UVTH 3RXRA 5DJ7A 2PTNA 4WWYA 2F91A 1IQKA 5LGOA 3RXPA 3P95A 3A7WA 4Y79A 1KTSB 3MNBA 2H9TH 3OU0A 3S69A 1C1NA 2O8WA 1PFXC 1TE0A 4IS5A 3KL6A 1V2PT 2B7DH 4XRNA 1TAWA 4XBBA 1SOZA 4IC5A 5EU8A 1IOEA 4WH6A 3SJ8A 1P06A 3HATH 2JETC 1C2IA 1V2TT 3QX5H 1N6XA 5L6NH 4X1SU 3SUEA 1SQAA 1S84A 1QNJA 3V12A 3QLPH 3EAJA 5EJ1A 2ZGBH 1T8NA 4B2BA 1ZPCA 3ATIA 3ATLA 1GI1A 1QBOA 2FDAA 1ABJH 2NU2E 3S9AA 3DHKH 4DVAU 2I6SA 1TNHA 1AU8A 2XBYA 4HGCA 1AN1E 4LK4A 2D8WA 2WPDD 4AFUA 2HGTH 2OC8A 4NFEA 1W0JD 5KGOA 3EGKH 2R3YA 4PROA 3ATKA 5E0HA 2VNTA 3ATWA 5FCKA 2ZDVH 2C8WB 4IN1A 1L2EA 2VIDA 1NRSH 1HNEE 1SGPE 2WZQA 4I8HA 1N6YA 3H09A 3BTGE 2NU0E 1SHYA 1SFQB 3FZDA 1P2KA 4MTBA 4ZHMU 1KYNA 2IPHA 2PWXA 1XMNB 1K1NA 2VIVA 3BIVH 4GVUA 1TYNA 7GCHF 2A2XH 2G81E 3OFND 1C1TA 5DP3A 3WW7A 3U9AH 1YLCA 2W3KA 2BD9A 2FODA 3EA7A 3RM0H 5T6FA 2L6OA 1S82A 4MNVA 2VIPA 1H8DH 1ESAA 1DM4B 3UY9A 3MOCA 1A5HA 2UWLA 2ANYA 1GCDA 2HNTF 4HI3A 1ELBA 1A0LA 1L4ZA 1W10U 2BD5A 3DSOA 4O03A 1HJAC 1C2HA 2VWNA 1C5LH 4D9QA 1DWEH 2C8ZB 1DXPA 5JYIA 2OP9A 3DUXH 2P94A 4CH2B 4ZUHA 3BIUH 3SU3A 4JZEH 4GLYA 1Y3VA 2BLVA 4DT4A 1WAYB 4KTCA 5EXLA 1A3BH 2SGEE 2JDID 1O34A 1C2LA 1C2EA 3AAVA 1TPAE 3U1IB 4CRDA 3SNBA 2PUQH 2BY6X 2WUBA 1DY8A 3C1KA 1HXFH 1C2FA 4ZHAA 4JYVH 1GBLA 3MH5A 5C67A 3PROA 1TGTA 1O2WA 2FOAA 1BMNH 5C3NA 5HXFA 3F2HA 2FOBA 3SU5A 1EZXC 5ESTE 1P11E 1GBFA 1BTZA 2OLGA 4WMEA 3PTBA 2NU3E 2ALPA 2BDAA 2RCEA 1QB1A 2O8MA 4ISIH 4KELA 4ABBA 4BXWA 4YOJA 3RXQA 1SLUB 1YCPK 1Z8IB 1BB0B 1DANH 1BRUP 1JIMA 2Y82A 1O32A 1Z1JA 1KSNA 3EE0B 1ZYOA 1MQ5A 1GJBB 3A7ZA 1SQTA 1MTUA 1YPJH 3QZRA 1MKWK 1ZRBA 2VBCA 4YM9A 2QV1A 1P2IA 1LHCH 1OS8A 3B8JA 2Y5GA 2BD7A 1NN6A 1FQ3A 1LPZB 4WVPE 2A4OA 1JRTA 4BTUB 1Y59T 1Z1IA 2EY4C 1EJMA 2RA0A 4DIHH 2K1QA 3ZZBA 1HUTH 1BT7A 1QB6A 1SGRE 1ZJDA 1BITA 1PPHE 4K8BA 3GY4A 2A32A 1YPKH 1TIOA 4DCDA 1FV9A 1TNKA 2GCHF 2VVCA 1O2IA 3QTOH 1AWHB 4O3TA 3QZQA 5K7RA 3SV2H 3I29A 1UTJA 3RU4E 1WCZA 1NU9A 1TFXA 1PQAA 4IGDA 1MABB 4AG2A 3AK5A 1GVLA 3S9BA 3PB1E 2JIZD 3RXIA 1AUTC 1VJ9U 4DY7B 4BANB 1O2RA 4CRFA 1KXEA 2ZTZA 2AH4X 1CBWB 2P8OB 4YT6H 1H1BA 3D62A 2ZTXA 1GVKB 5FPYA 5DN6D 1O3DA 5AVDA 1KLTA 2A2QH 1BJVA 4X2VA 5IDKA 2C8XB 2OQUA 3RUOA 4ZXYH 5C20A 1KDQB 1O2SA 1OXGA 5AHGH 2WHXA 1HAVB 3PRBA 4FUCA 4FUHA 4BAQB 2KFWA 4RT0A 4YO9A 2ZCKP 2PGBB 2QN5T 1GI9B 3A7YA 1T31A 2P3UB 2FOCA 2JETB 3RXAA 3KQ5A 2JKHA 3A83A 4P02A 1GG6C 1HAIH 2FS9A 1DWDH 4GAWA 1SLVB 2ZECA 1MTNB 2KCOA 4INKA 2RDEA 1V2LT 1TMBH 2G4UA 1T4UH 3MMGA 5DGJA 1XM1A 3RC4A 1S0QA 1LTOA 2CF8H 1SGDE 4F49A 3GDUA 2BLQA 3BSQA 3VFEA 1W3CA 2F83A 3MH4A 1C5NH 1NC6A 1NFWA 1Q3XA 3TH3H 4AORA 3FP6E 2WUCA 4CRAA 1ZSKA 3V0XA 3EQ0H 1XUGA 2XC0A 4Q7XA 1QRWA 3UNQA 1TRMA 1ETRH 3IITA 4E06H 4ASUD 3GISB 1J14A 1WUNH 1E38B 4A92A 3KGPA 2YOLA 1RIWC 1EXFA 1O3FA 1TNJA 5B6OA 2GZ7A 4GCHG 3PRDA 3GY6A 1ANBA 3MNXA 1DSTA 4RKOB 3VXFH 3ZZ8A 2AHME 2ODPA 4K1TA 2BD8A 4X8VH 5FCRA 3BG4B 1DWBH 2BVSH 5A8YA 3T29A 1E36B 2Q6GA 1AZ8A 1FMGA 2Z9LA 1B5GH 1O2VA 4Y76A 1DITH 2ASUB 2GV7A 2F9PA 1TRNA 3HK3B 1XUHA 3KQDA 1BBRE 1O3BA 5DPAA 4AGJA 1LHGH 1GHWH 4UONA 2GV6A 1UMAH 1QBNA 2PTCE 1DUEA 1X7AC 3KQCA 1HJ8A 3LKWA 1NS3A 3M5OA 3NCLA 4JZFH 4E7NA 2BVXH 3S7HB 1SGYE 3FAOA 4R0IA 4CHAC 3PYHA 3MFJA 1Z7KA 4Y8XA 3SBKA 2FO9A 2Z9KA 3FKSD 1HIAA 2TBSA 1DY9A 2GGVB 3LPRA 1C5TA 2OC1A 1IQLA 1U6QA 3A8CA 4CRBA 1DX5M 1UTOA 5AFYH 2BOHB 5JBTA 2HVXA 4Y0YE 1GHZA 2D26C 3RMMH 3SU1A 1EPTA 4AB9A 3K6YA 5C17A 4ISHH 4A1XA 2GMTC 5FBEA 4FETA 2O8UA 1MCTA 4INHA 1AZZA 5EOKA 3GICB 1MTWA 1VITF 1OWHA 4CH8B 4OM9A 3M7QA 2ZP0H 4THNH 3BTME 4XSKU 1PJPA 1LPKB 3SJOA 1A3EH 1SLXB 4TT3D 5DKMA 1EJNA 3FP7E 1M9UA 2FXRA 3O8CA 4K60A 4FU9A 3M7UA 2ZFRH 1GHBF 2SFAA 1YY3A 1EATA 1OOKB 2O8LA 3LGIA 1V2JT 4FUBA 2GD4B 1J17T 1O3LA 1YBWA 3ATMA 3Q76A 3A7TA 4CBOA 3FO8D 3SU0A 3SQHE 2QF4A 2TGTA 2KX4A 3SQEE 3SJKA 1MQ6A 2OXSA 1A7SA 2BVRH 1W11U 1BOQA 1PPFE 2XWBI 2B9LA 3OE7D 1IQFA 1LDTT 1EP6A 3P17H 5L2YH 4OS7A 2J5UA 3O8BA 3RXLA 3GS9A 1BTWA 1HLTH 2AIQA 1A1RA 3UWIA 1V2NT 3BV9B 1YM0A 1HB0B 1BRBE 4OGYA 6CHAC 1UTKA 4OS4A 4AFZA 1XVOA 3PO1C 4NA9H 2WINI 4AZ2B 3SZNA 5ESBA 2VWMA 1UVOA 2FWWA 2A0QB 1NT1A 1FZZA 2XNIA 1TQ0B 4P00A 2QXIA 3PTNA 1UVPA 1XUKA 4LXBH 3V13A 1AE5A 1WTGH 1K1PA 2H5DA 3M3SA 1TX6A 1MZDA 1O2KA 1MTSA 3LJJA 2QYIA 2EI8A 1B0EA 3A82A 2CHAC 3RC6A 3LJOA 1PQ8A 3SORA 3SU2A 4X1NU 1J8AA 3OY5U 2A5KA 1V2MT 1THPB 4INLA 2VJ1A 2HNTC 1D4PB 1MBMA 2VH0A 2F3CE 2UWPA 3KCGH 4OS5A 3M3VA 1UK3A 3B23B 1XUJA 4CRCA 1G9IE 1GGDC 1AI8H 2G55A 1C5VA 3RXOA 2EQNA 7KMEH 3MQKC 4H4FA 2GKVE 4Q80A 4MLFB 2C90B 3TK6A 3FVFB 5BRRE 2BLWA 1GBBA 8GCHF 3HK6B 2XOKD 3ZVCA 1P2JA 2AFQB 4NSYA 1V2KT 2WPLS 1ZSLA 4NZQA 2BY9X 3PV4A 1OHHD 2QE7D 4Q2KA 1O3OA 5T6GA 3UUZA 1FY5A 3SO3A 5JBCS 3LGVA 3BTQE 1AFQB 1P8VC 3BTFE 4CBNA 2DE9A 4MNYA 1KTTB 1TABE 2FEQH 2ZO3H 2D1JA 2W3IA 1CA0C 4KP0A 8ESTE 4MNXA 1HBTH 2CGAA 2BMGB 3D65E 2BXUH 1NFXA 2AS9A 5EQQA 1C1WH 1P09A 3FP8E 2A4RA 3N7DA 1ABIH 2BDCA 1F0UA 7ESTE 5CMXH 1EAWA 3HKIB 2M5TA 5GDSH 1FX0B 2CK3D 3U98H 2BD4A 1MKXH 1UTQA 2FPZA 2OBQA 3UB0A 1GMHF 1XXFA 2RA3A 3TNSA 2GJGA 4YOGA 1MMJN 5CHBA 3A84A 1DSUA 1TOCB 4IMZA 3MH6A 1UW7A 4Q7ZA 3SU4A 3UNRA 3LGWA 3F3BA 5HYOA 5F8ZA 3KQBA 2FI3E 5FHTA 5SGAE 3MO3A 1FIZA 3GCTG 3K65B 2SGDE 2GDDA 3KN2A 3URCA 1ESBA 1GJ6A 1ZJKA 1BQYA 1QQUA 5LH8A 2BYAX 4TY6A 3RMOH 1IQJA 1VZQH 2PW8H 1AB9B 1GBDA 2LELA 3ZZ9A 1O5CB 3MU5A 2BZAA 1C5QA 4AOQA 1K28D 1P05A 4Z1MD 1KY9A 3K2UA 4XBDA 2ZGXH 1XVMA 1FXYA 1MU6B 2EC9H 1PQ7A 4X2WA 4ABGA 5GCHF 1W2KH 1EPTB 2XXLA 1DPOA 6GCHG 1OSSA 2EI7A 2VVUA 4HG6A 3OY6U 1SQOA 2Y80A 3KIDU 2IJD1 3OTJE 1ZLRA 1HAPH 1RTFB 1T4VH 2BY8X 2A45B 3K9XB 4D76A 3L6PA 1MUEB 1ANCA 1P2NA 3DCLA 1SMFE 1G3CA 1RS0A 1F7ZA 3GY3A 2J98B 1GJAB 4I86A 4NG9H 1C5PA 1V2VT 4ZKRU 5FPTA 3MNCA 1KDQA 1ZPBA 3LGUA 3V3MA 4AYYB 4JK6A 2XBWA 2THFB 4FUGA 2B0FA 4I8KA 3WWFA 1HAVA 1FN6A 3LU9B 3G01A 1O3JA 2YMSD 3LONA 1YGCH 2WYJA 1FNIA 1O2GH 5L2ZH 1ARBA 4QT8C 1BRCE 3RLYH 1WSSH 2STAE 2P16A 2WV4A 1YPMH 2JH0D 3CS7A 3A7VA 4ABHA 2A4GA 3TJNA 4LZ4B 2A1DB 3IWMA 3MH7A 1EZUC 3BTEE 4KGAA 4B75A 1P04A 1EQ9A 3P8OA 3BEUA 3WWBA 3MTYA 5I25A 1C1PA 2QCYA 1C1RA 1VGCB 2W5EA 1Z8GA 2FZZA 1QQ4A 3SGAE 1OPHB 1QY6A 3M3TA 1CT4E 3A80A 5JBAS 4MPVA 1GBCA 1TOMH 1WYKA 3F9EA 2QXGA 1JOUB 2CF9H 2XNDD 2UUKB 1ZTKA 2ZU1A 4X2YA 1UK2A 2FOEA 4B2CA 3ZVAA 2J97A 3OEED 1C5MD 3P8GA 3ZIAD 1GI4A 2G8TA 1ZPZA 1AD8H 1HAZB 4AB8A 1TBQH 2SGFE 4X8TH 4ZAEA 2WPKS 4RN6A 3VB6A 1SGFA 1MAXA 1LMWB 1TNGA 1E1QD 1GPZA 3SYJA 2YNBA 3TGKE 1GWAA 4JMYA 2TPIZ 1V2RT 5F6MA 5JDUB 2VIQA 1C1MA 2CHAB 3MWIU 1EAXA 1Y5AT 1N1LA 3SW2B 1GBIA 1Z6EA 2ZDKA 3SNCA 2PFEA 1FJSA 3OAAD 3E0PB 1BZXE 3F0PA 2GZ8A 4X6NA 3F6UH 2FI4E 3TH4H 2XC5A 2Y7XA 2FP7B 4OS1A 2RG3A 4F55A 2A5IA 1TA6A 4NFFA 1D3DB 1VR1H 4WH8A 4K2YA 4M7GA 4A6LA 1V2OT 1JXPA 1YPHC 1O2PA 1YPLH 2XWAA 2JH6D 2CN0H 1ZGIA 1BA8B 1A5IA 3MYWA 4GSOA 1K0HA 1FUJA 1DS2E 2RFKC 2A5AA 4GPGA 1DLKB 3LC5A 3SI3H 3GDSA 3U8RH 4F4OC 1W12U 3PLPA 1WDIA 2V35A 2ODQA 5EPNA 4B2AA 2R9PA 1CA0B 1IQHA 2G00A 2Z3DA 3P8NA 4FVBA 2P59A 1ELAA 1GBHA 2GCTC 3SOSA 3D49H 1GJDB 5HM2A 4U2WA 8LPRA 1EAUA 4JCNA 1O2OA 4WF8A 1Q31A 1SB1H 3CNRA 3ZZ6A 1ELVA 3RMLH 3I77A 1QJ1B 2FMJA 1LKAA 3P8FA 1BIOA 3TJUA 1XKAC 2CMYA 1ELDE 1FPCH 3PLBA 3PWBA 3TIUA 1GMCG 1QFKH 2BD2A 2XCNA 1TGNA 1BMAA 2HALA 1P2MA 2QF3A 3N99A 3PMAB 1JMOH 1G36A 5K0HA 3TU7H 5G4BA 1SGTA 2TRMA 1CVWH 1G2LA 5C1YA 4DG4A 1BRAA 3PMHB 4FOUC 1THRH 2ZDNA 2J34A 2W7UA 3UNSA 4WXIA 2SNVA 1Q2WA 1GDUA 1YLDA 3RU4D 1UTNA 3MNSA 4X2XA 3MU0A 1KIGH 4U01A 2C8YB 2XW9A 4GUXA 2AMDA 1F0RA 2Q6FA 2OINA 1T7CA 5EXMA 1BHXB 4M9FA 1O2LA 1ELTA 1FIWA 3GCHC 4TYDA 1LQDB 2GVFA 3ZVGA 3P92A 1O33A 5E2OA 3RDZA 1PQ5A 2YMSC 1OWDA 1E1RD 2XYAA 3AW0A 1S5SA 1C4U2 5LPRA 2P93A 2SNWA 3GY2A 1S85A 1F2SE 3RXMA 5EW2H 3TK9A 1NRPH 1OYQA 1A5GH 2ZA5A 1GMDG 1S6FA 1C5RA 1C5WB 1KXDA 4IW4E 2G5VA 2XBXA 2ZHWH 1W7XH 4I8LA 3KYFA 3TH2H 1LVMA 9ESTA 1W0ZU 1IQMA 2G4TA 3VGCC 1TA2A 4ZROA 1NY22 3SV6A 1IQEA 1L1GA 3RXHA 4BAHB 2ZDLA 4WXVA 5EG4A 1QA7A 2RDLA 1TWXB 1F0SA 4BAMB 3VXEH 4NA7A 1O39A 2K8IA 3M61U 4UFGH 1OKXA 4NGAH 1H8ED 1RTLA 4WY3A 1FAKH 4X6PA 5DG6A 1OP0A 1SGFG 2GT7A 3EYDA 2PKSC 4MDSA 2ZCLP 4ABIA 5LPEA 1AVGH 5TJXA 1AVWA 3STJA 3SU6A 3RXDA 4K1SA 5JBBS 6LPRA 1S6HA 4CRGA 1GHYH 4FUIA 1C4Y2 1SGQE 3E3TA 1V2QT 3F9FA 1D6RA 1VCPA 4ACAA 5CDFE 3S9CA 1QGFA 5TCCA 4ZH8A 1C1VH 1GL1A 1O38A 2FYQA 2WV5A 1AHTH 1H9HE 1E0FD 3SJIA 4I8JA 3A88A 1HGTH 2Z3CA 4ZKNU 1RFNA 1BUIA 4A7IB 1BTUA 1G30B 5C1UA 2O8TA 1BJUA 2BY5X 1GCTC 2R3UA 2G51A 1W8BH 5LPFA 4X8UH 3D23A 4MVNA 3MO6A 4VGCC 3ELAH 3ZVEA 3VB3A 3UR6A 4B1TA 2B8OH 2J9NA 2JJ1D 1ZR0A 1HJAB 1FONA 1D3QB 4X1PU 3V7TA 4SGBE 1Y3UA 4GCHF 1OP2A 2F9NA 5F53A 3S0NA 1EZQA 5JB8S 2Z9JA 1HYLA 4NWKA 3P70B 1K22H 2KAIA 4XE4A 1FN8A 4J1YA 2H6MA 5DP6A 4NZLA 3MO9A 1LQEA 1DWCH 3A81A 1W14U 4RI0A 1TMTH 1KXFA 4SGAE 1NROH 1NZQH 1SHHB 1Z8RA 1WQVH 2VINA 4AX9H 1O36A 3RXKA 1MKXK 5DP8A 4GHQA 2ZDAH 2FOGA 5ETXA 2FLBH 1JIRA 3QUMP 2QY0B 2ZU5A 4KKDA 5EW1H 2J94A 2F9VA 1QURH 3ZV8A 2ALVA 2J98A 1HV7A 3F68H 2A7HA 2LNCA 4ZHLU 1QRZA 2ILNA 3M36A 4MPWA 1ELGA 2WYGA 2OCVB 2ZFSA 1GVZA 2FIRH 4FUJA 4WMFA 2D2DA 1SI5H 2W7SA 2GCTB 1L1JA 2H5CA 3S7KB 1AO5A 2BLOA 1O31A 3ZZAA 3I78A 1P2OA 3UR9A 3N7EA 4YZUA 2ZEBA 3N7OA 1NM6A 3TNTA 1BMFD 1S83A 4YXWD 4D7FA 4FUFA 1P0SH 1NRNH 2ZPRA 1F92A 1GBEA 1INCA 4UDWH 4IN2A 1GJ7B 1C5XB 8KME2 1YYY1 3T25A 4LZ1H 3T2NA 4X1RU 2V6NA 1HPGA 4I8GA 1UVSH 4OGXA 4DJZB 2H9EH 2IN2A 1YC0A 2OK5A 3OEHD 3U69H 4B76A 4TWWA 4O9VA 2BZ6H 3PMBB 2KCPA 1O2YA 3LH1A 3GCOA 4TY7A 2XC4A 3MU4A 3SV8A 1FPHH 2NWNA 1RD3B 2Y5FA 3KNXA 1O37A 1P01A 1SC8U 1OP8A 4YESB 1EAIA 1AKSB 1O2MA 3LC3A 3DSPA 2KCYA 4D7GA 2VIWA 1Y3XA 3GY8A 4KTUA 3PV5A 2B5TB 2ZGJA 3LGYA 1QR3E 5GJ4B 3RU4T 2WSSD 4XFQA 4ISNA 2ZGCA 3AW1A 3RXSA 3GY5A 3IG6B 3GCHB 4YOIA 3M5LA 2UUJB 1GDNA 4IBLH 1T32A 1AY6H 3AAUA 3GDVA 2AERH 1ACBE 2WPIS 1OWEA 3OX7U 1V2UT 3RLWH 3AVZA 3F2FA 3R3GB 5DP4A 1HAHH 1HDTH 3DFJA 3HKJB 2A31A 1J16A 1CU1A 1LKBA 1RJXB 1TLDA 1XUFA 3BN9A 2BXTH 1QTFA 1ETSH 1LO6A 1A4WH 1TGCA 1O30A 3A8BA 2Z94A 1FAXA 2OC0A 3UOUA 1CQQA 2NU4E 3M5NA 5HIYA 1O2TA 1BMMH 1D3PB 1WBGB 3W94A 4Y10E 5FL7D 4AGKA 1GG6B 2ZNKH 1WXRA 1KXBA 4B6FA 1BMLA 3LOXA 2J38A 3RXBA 3T27A 1DUAA 3QN7A 2ZI2H 3UQVA 1V3XA 1NFUA 5HGGA 1EZSC 1O5AB 1H9IE 1E79D 7LPRA 1O5DH 3SGBE 5HIZA 2G5NA 2SGQE 2BX3A 1TALA 2VH6A 2UWOA 1WV7H 3ZYDA 1C1SA 1GBKA 2GT8A 4DGJA 1G32B 1GL0E 5AFZH 1T8LA 1FI8A 4JK5A 1ID5H 2BQ7B 3SJ9A 2P3TB 1C5YB 1TRYA 1RIWB 3M5MA 1CGIE 2QA9E 3SUFA 2DUCA 2VU8E 1GJ8B 3KQEA 1TPOA 3Q3XA 3FN8A 5GWZA 3ITIA 1BDAA 3RXCA 3QGJA
chains in the Genus database with same CATH topology
1EP5A 2TGDA 4RKJB 4AN7A 3CP7A 1GBAA 1KXCA 1GHAG 1K1IA 1T8MA 3BF6H 1AE8H 2FI5E 2BDGA 2ZFTA 3BEFB 3UFAA 1O3MA 2DE8A 2AYWA 1CHOG 2FTMA 5C2ZA 3Q3YA 2TIOA 1G3BA 4FVDA 1WOFA 4J2YB 5EGMA 2WPHS 3ZZ4A 1K1JA 2KAIB 2QF0A 1C2MA 4CHAB 1TX8A 1CA8B 2SGPE 3ODFA 3BEIB 3UPEA 4MPXA 1K1MA 2ZFQH 3KF2A 1GI8B 5DO4H 2HRVA 1ZHRA 1UK4A 5F8XA 4XOJA 1T8OA 3GCNA 2P95A 1ZMNA 1SGCA 2H1UA 3O8RA 1C5UA 1GI3A 3GCTF 4NIYA 2GMTB 1UHBB 5HM9A 1YPGH 1EKBB 2ANWA 3NUMA 1TX7A 1UCYH 1ZRKA 1O3CA 1HAGE 1IQIA 3A87A 3UQOA 1CBWC 2P8OC 3A7XA 3BTTE 1GJ5H 3RXTA 3SV9A 2AGIX 1NRRH 1O5GH 1IQGA 4YLQH 1O3HA 1A0HB 1N8OC 3BTKE 1F0TA 1MAYA 5A0BA 1AGJA 5PTPA 3Q00A 4DIIH 2ZU4A 1F5RA 1XUIA 6GCHF 2OD3B 2J2UA 4LOYH 4MQAA 4O97A 5BPEA 3RXFA 2BDYA 3UWJH 1O2XA 5I46H 3T62A 3TLOA 3M35A 1DFPA 2J4IA 1VCWA 1HJ9A 3A8DA 1OWKA 5GPIB 4ZKSU 1ZTJA 1UTLM 1MTNC 2I6QA 4YT7H 4HZHA 1VITH 3A8AA 2ANMH 7GCHG 1O2UA 2Q6DA 4IC6A 2GZ9A 6CHAB 2EI6A 1O5EH 2AGGX 4ESTE 1UJ1A 4NSVA 3PO1B 1K1OA 3UOPA 3TITA 3PM3A 4U32A 2QIQA 4Y7AA 1G2MA 4WJG2 4JYTA 1GBTA 1QBVH 1L0ZA 4E7RG 1BTXA 3RXEA 1CGHA 1PPEE 1OYTH 3Q3KA 4Y7BA 1Z8JB 2BDHA 2R0KA 2AMPA 2ULLA 1C1QA 1IQNA 5CHAC 3ZVBA 3M37A 1GHVH 3ZZ7A 1S0RA 2VWOA 3MU8A 4B71A 3MHWU 1UTMA 6ESTA 1TPPA 3BG4C 1SLWB 1SBWA 2HWLB 1ARCA 3TJOA 4Y6DA 1GGDB 2FX6A 1TMUH 3EA8A 1PPBH 1Z6JH 1P9UA 2ZF0H 1OWJA 4H42U 1P12E 1F5LA 1P3EA 5EQSA 1LVYA 2QXHA 3JZ2B 3DT0H 1CT2E 3CENA 2BHGA 2F9BH 4ZXXH 1LHFH 3QDZB 1P3CA 2QC2A 1B7XB 3SNDA 2BM2A 2H9HA 3PMJA 3U1JB 2ZHFH 1YP9A 2HOBA 1SGIB 2Y7ZA 3VB4A 4DOQA 2ZHEH 1Y3WA 3ZZ5A 1G37A 2PR3A 1D9IA 1W13U 2FOHA 3T5FH 5DP9A 4BTIB 1QL8A 1TBRH 1RRKA 1JRSA 1G3DA 3HGPA 4D8NA 4X6MA 2GX4A 1F5KU 1EOLA 3A89A 3SUDA 2SGAA 2STBE 2QAAA 2JH5D 4NCYA 2VVVA 5E8EH 4UE7H 1C2DA 1MZAA 5E0GA 5FAHA 2V3OH 2AIPA 4UFDH 1LHEH 1EUFA 1NPMA 2HPPH 2OUAA 3OSYA 4FUDA 1OX1A 2CXVA 2XTTB 3C27B 2A7CA 1O35A 1UO6A 4BXSA 3AASA 4MG3A 1HRTH 4Y71A 2XRCA 1PPGE 1GJ4H 1YCPM 1D6WA 2GCHG 1CHGA 2WPJS 5A0AE 1KLIH 1XKBC 1SFIA 1Y5BT 3JZ1B 3RP2A 5C5NA 3E1XB 1E37B 1YPEH 4A1VA 3ZZ3A 1GBMA 1GI2A 3SHAH 1CGJE 2PSXA 4AYVB 2R2WU 1B0FA 4DW2U 4ISOA 4BAKB 1AKSA 1O2HA 1O3EA 2ZG0H 2VGCC 5FX6A 2Z9IA 4FXGH 1J15A 3ESTA 3T28A 4JZDH 3SNAA 2AMQA 1EJAA 1GMCF 2W26A 2GTBA 2WPMS 1JWTA 1DE7H 2PGQB 5DK1A 4DT7B 5F03A 1DOJA 3TVJB 3ZVDA 1O3AA 1KXAA 5E0JA 4D9RA 1LVBA 4Q7YA 3NWUA 1GHXH 1TNIA 4H6SB 1YF4A 4MNWA 1NRQH 4K8YA 1BHXF 2BD3A 1IHTH 1O0DH 5T6DA 2BOKA 4YLUA 1LCYA 1PPZA 3NK8A 1CT0E 4CR9A 1DICA 4E05H 1G3EA 2AGEX 1EX3A 4AFSA 4X8SH 2PSYA 3M7TA 1GI5A 1AWFH 1DT2A 1K9OE 1BTYA 3WY8A 3DA9B 1J9CH 4BNRA 2EA3A 1H4WA 1SSXA 1O3IA 1QJ6B 1N8OB 4NIVA 1FLEE 3QTVH 3LH3A 5A0CA 1HCGA 4A5TS 2G52A 4I31A 1LHDH 4H6TA 4K1EA 4Z0KA 1EOJA 1O2QA 1UTPA 4NWLA 2FOFA 2Y5HA 1HFDA 2H2ZA 9LPRA 1ZTLA 1BBRK 2GDEH 2PHBA 1C1UH 1O3GA 2BX4A 2C3SA 1AFQC 4HTCH 3NKKA 3E6PH 1CO7E 3TJVA 2ZKSA 2J92A 4OS2A 4TPYA 1GMDF 1YKTA 1O3PB 5JPMH 4X1QU 4NIWA 1O2ZA 1V6DA 2ZTYA 1VJAU 4IMQA 4HFPB 1MD8A 1C2KA 1K21H 2HNTE 1K1LA 3URDA 1AIXH 1GI0A 2OBOA 4YTAA 2R0LA 3KEEA 2ZWLH 3DFLA 3F9GA 1SGEE 3Q77A 3KHVA 1H8IH 2ANKH 2QGRA 2ZC9H 2A7JA 1QJ7B 3GY7A 3SI4H 4ABFA 1QHRB 4B74A 2FESH 3F1SB 4X0WU 1MU8B 1ETTH 3RMNH 4TWYA 3SHCH 3VEQB 5T3HA 3E8LA 4MPUA 2TGAA 1A2CH 2BQWB 1BCUH 1SGNE 5CHAB 3R0FA 3BTWE 1P9SA 3B9FH 5C5OA 1ESTA 3PWCA 4ISLA 3FZZA 3ZZDA 2OC7A 2PKAA 1ORFA 1ZHMA 1MH0A 3GYLB 2FS8A 3VB7A 3ZYEA 2ZIQH 4UD9H 2TGPZ 4TPIZ 4UFEH 3A86A 4ZKOU 1P2QA 5L30H 1VITG 1YCPH 2ZQ2A 2XCFA 4RSPA 1FY4A 1E34B 3SV7A 1AB9C 2QXJA 1C1OA 1QA0A 5J4SA 3GYMA 1QRXA 1AQ7A 4K3JA 5A09A 1RGQA 1NFYA 3RXUA 3STIA 5FX5A 1ZMLA 1PYTD 1MKWH 2YNAA 3RXVA 1GHBG 1WTHD 3TGJE 1DXWA 3LGTA 1XX9A 1TGBA 2V0BA 4DURA 1QL9A 1TPSA 4GHTA 5IYTA 2C4FH 3PLKA 1EPTC 2XBVA 4JYUH 3TGIE 3MI4A 1ELFA 2BY7X 3EDXB 2Z6BD 1AFEH 5DP5A 2ZU2A 1V2ST 1UHBA 4ABEA 4ZMAH 1UVUH 5A8XA 1TB6H 3O8DA 1O2JA 1Z71A 4KTSA 3RXGA 1OWIA 1ZSJA 2ZGHA 2FM2A 4B73A 2IOTA 2BDBA 2HLCA 3HPTB 1Y8TA 3H7TA 4Y0ZE 1SVPA 1HXEH 2ZPSA 2J95A 2ESTE 1P57B 3RM2H 1ANEA 3FANA 3T26A 4BAOB 1KLJH 5GIBA 2ZPQA 5CE1A 4K5ZA 3VB5A 2Y6TA 1AMHA 4O3UA 3ZV9A 4ABAA 2VIOA 1ELCA 1O3KA 1MD7A 2BDIA 1DLEA 3UIRA 1DVAH 1W7GH 3K6ZA 1THSH 2V3HH 1FY8E 1C2JA 3VPKA 1O2NA 2ZDMA 4Y11E 1NESE 5FXLA 3SN8A 1RXPA 3MU1A 1CSOE 5H4IB 3A85A 4UFFH 1S81A 1VGCC 2FYRA 1BBRH 3ENSB 5HMAA 3RC5A 5ABWA 3ODDA 2C93B 1P03A 4JZ1A 5DP7A 1UCYK 2FLRH 1O5BB 1AVXA 1QCPA 2PV9B 2VGCB 4AG1A 1TGSZ 5A8ZA 1C5OH 1QIXB 8GCHG 4Y8ZA 3HGNA 1V2WT 1C2GA 3F9HA 4WMDA 3P6ZB 3E16B 3CS0A 5FBIA 1ZZZA 1FY3A 3U8TH 1ANDA 1HAXB 2PLXA 5C1XA 4I7YH 1A0JA 1SR5C 2P3FH 1TNLA 3ZZCA 3ZVFA 2ZFFH 3E0NB 1NU7B 3BTHE 4BTTB 5E2PA 4ABJA 2OQ5A 4UEHH 2GP9B 1BTPA 4JZIA 1A61H 1C9PA 3NZIA 3QWCH 1LVOA 2AEIH 3BG8A 3QK1A 1ZOMA 2ZQ1A 5F8TA 1C5SA 4AFQA 1HAYB 1RTKA 4OS6A 2HPQH 2BQ6B 1BTHH 1GI7B 2ZU3A 3SNEA 1EB1H 2PUXB 1PPCE 1SOTA 1E35B 2Z9GA 4X6OA 3VGCB 5EXNA 1C9TA 1WQSA 1FDPA 1MBQA 2A4QA 4NIXA 4A1TA 2BB4A 1GI6A 2UUFB 1GBJA 2Y81A 2ZHDA 1TBZH 2NU1E 3L33A 2UUYA 2CJIA 1ELEE 4I32A 3NXPA 1GJ9B 5TCAA 4Z6AH 1C4V2 1ZMJA 1GMHG 3LIWA 1QL7A 1L4DA 1HAOH 3RXJA 4BOHA 3NPSA 1LPGB 1WU1A 1UCYE 2ZFPH 1GDQA 2IJOB 3U8OH 5J4QA 1ZGVA 2PKSB 1C5ZB 1GJCB 3OYPA 1O3NA 2F9OA 3LT3A 1TONA 5A2MH 1O5FH 4FU8A 1FY1A 4CR5A 5EPYA 3EA9A 2ODYB 1Y3YA 1MTVA 3SGQE 1XXDA 2VWLA 1YPHE 4I33A 1D3TB 1PYTC 2EEKA 4U30A 4FUEA 2FTLE 1K2I1 3TK5A 3E91A 5GCHG 2PKAB 1EASA 1IHSH 3E90B 2Z7FE 1SG8B 5FPSA 1IAUA 1GCTB 3FFGA 4Y8YA 4XBCA 1Y5UT 1CE5A 4ASHA 4R8TB 1VCQA 3TPIZ 1L1NA 1A46H 4FU7A 4VGCB 1AUJA 4ABDA 4XDEA 1SL3A 1DDJA 5EQRA 5GXPA 3H5CB 2BTCE 1W0YH 5EODA 5JB9S 1JBUH 2Q1JA 1P02A 2ZCHP 1QB9A 3W95A 2FX4A 3BTDE 2F9UA 3LDXH 2OTVA 1NO9H 1NTPA 4CREA 3SUGA 2FOMB 1EB2A 1HIAB 1GHAF 2VB0A 4K69A 1P10A 2O9QA 3GOVB 3QGNB 1H9LB 4NA8A 3UTUH 2LPRA 2ZZUH 3UREA 1MCVA 1SPJA 2CV3A 3QO6A 1ZHPA 2Z3EA 1CHOF 3H7OA 2R2MB 3L3TA 3DD2H 5AF9H 1TQ7B 2ZHQH 1UVTH 3RXRA 5DJ7A 2PTNA 4WWYA 2F91A 1IQKA 5LGOA 3RXPA 3P95A 3A7WA 4Y79A 1KTSB 3MNBA 2H9TH 3OU0A 3S69A 1C1NA 2O8WA 1PFXC 1TE0A 4IS5A 3KL6A 1V2PT 2B7DH 1TAWA 4XBBA 1SOZA 4IC5A 5EU8A 1IOEA 4WH6A 3SJ8A 1P06A 3HATH 2JETC 1C2IA 1V2TT 3QX5H 1N6XA 5L6NH 4X1SU 3SUEA 1SQAA 1S84A 1QNJA 3V12A 3QLPH 3EAJA 2ZGBH 1T8NA 4B2BA 1ZPCA 3ATIA 3ATLA 1GI1A 1QBOA 2FDAA 1ABJH 2NU2E 3S9AA 3DHKH 4DVAU 2I6SA 1TNHA 1AU8A 2XBYA 4HGCA 1AN1E 4LK4A 2D8WA 4AFUA 2HGTH 2OC8A 4NFEA 3EGKH 2R3YA 4PROA 3ATKA 5E0HA 2VNTA 3ATWA 5FCKA 2ZDVH 2C8WB 4IN1A 1L2EA 2VIDA 1NRSH 1HNEE 1SGPE 4I8HA 1N6YA 3BTGE 2NU0E 1SHYA 1SFQB 3FZDA 1P2KA 4MTBA 4ZHMU 1KYNA 2IPHA 2PWXA 1XMNB 1K1NA 2VIVA 3BIVH 4GVUA 1TYNA 7GCHF 2A2XH 2G81E 5DP3A 1C1TA 3U9AH 1YLCA 2W3KA 2BD9A 2FODA 3EA7A 3RM0H 5T6FA 1S82A 4MNVA 2VIPA 1H8DH 1ESAA 1DM4B 3UY9A 3MOCA 1A5HA 2UWLA 2ANYA 1GCDA 2HNTF 4HI3A 1ELBA 1A0LA 1L4ZA 1W10U 2BD5A 4O03A 1HJAC 1C2HA 2VWNA 1C5LH 4D9QA 1DWEH 2C8ZB 1DXPA 5JYIA 2OP9A 3DUXH 2P94A 4CH2B 4ZUHA 3BIUH 3SU3A 4JZEH 4GLYA 1Y3VA 2BLVA 1WAYB 4KTCA 5EXLA 1A3BH 2SGEE 1O34A 1C2LA 1C2EA 3AAVA 1TPAE 3U1IB 4CRDA 3SNBA 2PUQH 2BY6X 2WUBA 1DY8A 3C1KA 1HXFH 1C2FA 4ZHAA 4JYVH 1GBLA 3MH5A 5C67A 3PROA 1TGTA 1O2WA 2FOAA 1BMNH 5C3NA 5HXFA 2FOBA 3SU5A 1EZXC 5ESTE 1P11E 1GBFA 1BTZA 2OLGA 4WMEA 3PTBA 2NU3E 2ALPA 2BDAA 2RCEA 1QB1A 2O8MA 4ISIH 4KELA 4ABBA 4BXWA 4YOJA 3RXQA 1SLUB 1YCPK 1Z8IB 1BB0B 1DANH 1BRUP 1JIMA 2Y82A 1O32A 1Z1JA 1KSNA 3EE0B 1ZYOA 1MQ5A 1GJBB 3A7ZA 1SQTA 1MTUA 1YPJH 3QZRA 1MKWK 1ZRBA 4YM9A 2QV1A 1P2IA 1LHCH 1OS8A 3B8JA 2Y5GA 2BD7A 1NN6A 1FQ3A 1LPZB 4WVPE 2A4OA 1JRTA 4BTUB 1Y59T 1Z1IA 1BT7A 1EJMA 2RA0A 4DIHH 2K1QA 3ZZBA 1HUTH 1QB6A 1SGRE 1ZJDA 1BITA 1PPHE 4K8BA 3GY4A 2A32A 1YPKH 1TIOA 4DCDA 1FV9A 1TNKA 2GCHF 2VVCA 1O2IA 3QTOH 1AWHB 4O3TA 3QZQA 5K7RA 3SV2H 3I29A 1UTJA 3RU4E 1WCZA 1NU9A 1TFXA 1PQAA 4IGDA 4AG2A 1GVLA 3S9BA 3PB1E 3RXIA 1AUTC 1VJ9U 4DY7B 4BANB 1O2RA 4CRFA 1KXEA 2ZTZA 2AH4X 1CBWB 2P8OB 4YT6H 1H1BA 3D62A 2ZTXA 1GVKB 5FPYA 1O3DA 5AVDA 1KLTA 2A2QH 1BJVA 4X2VA 5IDKA 2C8XB 2OQUA 3RUOA 4ZXYH 5C20A 1KDQB 1O2SA 1OXGA 5AHGH 1HAVB 4FUCA 4FUHA 4BAQB 4YO9A 2ZCKP 2PGBB 2QN5T 1GI9B 3A7YA 1T31A 2P3UB 2FOCA 2JETB