2KAIA

Refined 2.5 angstroms x-ray crystal structure of the complex formed by porcine kallikrein a and the bovine pancreatic trypsin inhibitor. crystallization, patterson search, structure determination, refinement, structure and comparison with its components and with the bovine trypsin-pancreatic trypsin inhibitor complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
80
structure length
80
Chain Sequence
IIGGRECEKNSHPWQVAIYHYSSFQCGGVLVNPKWVLTAAHCKNDNYEVWLGRHNLFENENTAQFFGVTADFPHPGFNLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (proteinase-inhibitor)
molecule keywords KALLIKREIN A
publication title Refined 2.5 A X-ray crystal structure of the complex formed by porcine kallikrein A and the bovine pancreatic trypsin inhibitor. Crystallization, Patterson search, structure determination, refinement, structure and comparison with its components and with the bovine trypsin-pancreatic trypsin inhibitor complex
pubmed doi rcsb
source organism Sus scrofa
total genus 10
structure length 80
sequence length 80
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 1984-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2kaiA00
1ORFA 2ZGXH 2JETB 3OY6U 3TJOA 1DWCH 1A3BH 3TIUA 1GBCA 1W7XH 2OD3B 1CT2E 3SI3H 1IQFA 4WMFA 1CGIE 3LU9B 1WYKA 2CXVA 1DLKB 1BRUP 4XSKU 3BEFB 2DE9A 3GY7A 2PUQH 2PFEA 1GMDG 2XBXA 1XMNB 3E90B 1MTUA 2F9UA 3P8GA 3OY5U 1L0ZA 3L3TA 5F6MA 1NRSH 4DIHH 2C93B 5EQSA 3T27A 1ZSLA 3VGCB 3BTTE 1AWFH 5C1XA 1S82A 4UFEH 2KAIA 4JYVH 4U32A 1SGIB 3ZZ9A 1C5TA 2ILNA 4UFFH 3RXBA 3U8OH 3GY8A 1C2IA 3RLYH 1O3EA 3RU4E 1CBWC 4WMDA 1P3EA 1O2JA 1O3JA 4ZROA 5PTPA 1O2MA 1MTWA 5HMAA 5A8XA 1C5LH 5JB8S 1ELEE 1X7AC 5C1UA 2PTNA 2FOBA 1ARBA 3QGNB 8GCHG 4K5ZA 1Q3XA 1G32B 1KYNA 1BTPA 2ZU5A 1NRRH 1PYTD 2ODQA 4NA8A 1TPAE 1QFKH 3UWJH 1Z6JH 4CR5A 3E3TA 1A46H 8ESTE 2ZTZA 3CS0A 2WYJA 2ZCLP 2F9NA 5A8ZA 3EAJA 5ESBA 4R0IA 1GCTB 1HAHH 1HAGE 3SUEA 3ZZAA 1Y3VA 2GCHG 4OS1A 4ZKOU 3F68H 5K0HA 2FO9A 1WU1A 3MFJA 1OXGA 3OX7U 1SC8U 4ASHA 4X6MA 1GI1A 3OU0A 2O9QA 3M5LA 1TMBH 1GDNA 6CHAC 2HALA 1O3AA 1Z8RA 2R0LA 3W95A 1FIZA 3RXMA 1Y5BT 1FY3A 1YCPH 1LVYA 3KL6A 1HDTH 3GYLB 5FHTA 1W8BH 2NWNA 3PLBA 2ODYB 4INHA 3TGKE 4X1SU 3H7OA 5GCHG 5ETXA 1GMCF 1ZJKA 1ZTKA 2BDAA 2ZEBA 5JBBS 3SZNA 4RKJB 3KQBA 1LTOA 3HPTB 1HBTH 4D7GA 1C1PA 5T6GA 3AW1A 2P59A 1OWEA 1CVWH 4ZHAA 2GTBA 3MO6A 1S85A 2ZFRH 3TNTA 2GKVE 2TIOA 1NRNH 1CQQA 1OOKB 4K1SA 4ABEA 4E7RG 1TBQH 2BQ6B 3QTOH 2G4UA 2HPQH 2BDGA 1BTZA 3UY9A 3SQHE 3LJOA 1HAXB 3S0NA 3LOXA 3LONA 5GXPA 2FI3E 4HZHA 2A7CA 5T6DA 3A8DA 1MMJN 1RXPA 1KSNA 1ELBA 4ZUHA 1C5SA 1DOJA 1P2KA 3UUZA 1A2CH 1SMFE 1P05A 3GCHC 3TH4H 1TNLA 1QL9A 1O3DA 1YYY1 3M5NA 4UDWH 2WPIS 2ASUB 2F9OA 4ISOA 2XBYA 3VPKA 1QB6A 3QK1A 2VVVA 1IQHA 1Z1IA 4BNRA 1RTLA 1NM6A 5AF9H 2J38A 2XWBI 1CHGA 1NFUA 1HAOH 1WQVH 3KGPA 2IJOB 2BD5A 1GBKA 4BANB 5AHGH 4YLUA 3S7KB 3VFEA 1JBUH 3M7TA 4FUJA 2HNTE 1T4VH 4Y0ZE 1YP9A 4UE7H 5TCAA 1GI5A 1RS0A 2BM2A 2FXRA 5J4SA 2GCTB 3E0PB 3QZQA 1TONA 1SLUB 2CN0H 3A85A 3MO9A 2D2DA 1O0DH 2GT8A 1C2MA 2BD9A 1BOQA 1PPZA 3E16B 4AOQA 1H8IH 1K28D 1BZXE 2OP9A 2W3KA 2A4OA 2QXIA 2BHGA 3CS7A 4NIVA 1BRCE 2FEQH 2ZGJA 4O97A 5FX5A 2AEIH 1TNIA 4FUGA 3ESTA 2ZG0H 1FDPA 2PKSB 3SBKA 3AAUA 2GMTC 4AYVB 3UIRA 3UOUA 1O2HA 4CREA 1O3KA 3V13A 4ISNA 5E0GA 1P2QA 2Q1JA 5T3HA 2YNAA 2AERH 3UR6A 1PJPA 5FAHA 1ARCA 1TGSZ 1T4UH 2JH0D 4AG2A 4ISIH 2GGVB 3A8BA 3TH3H 1ZOMA 1AB9C 2RA3A 4ABBA 1EOJA 2HLCA 3FP6E 3GDVA 2R3UA 1GBLA 1O33A 3RMLH 4I8KA 3F6UH 4MNXA 1YPKH 4IGDA 1ELGA 1ZJDA 1D3PB 3NK8A 2FODA 1GG6B 4FUDA 1H1BA 3SNCA 1YKTA 1SGFA 1BTUA 4X1NU 1W14U 1CHOF 1QHRB 1YPLH 2ZU4A 1ZPBA 3GCOA 1GBDA 3D65E 1DANH 2VWMA 4FUIA 3ODFA 4Y8YA 4B74A 1UVOA 3OTJE 4Q7ZA 2ALVA 4X2YA 3BG8A 1FY8E 2F9BH 2KAIB 1V2VT 1F92A 1HV7A 1OPHB 2BB4A 3RXQA 3RXUA 4X2VA 3RXFA 2SGPE 1CA8B 3LPRA 4X1RU 5EPNA 4RN6A 2GV6A 2FOHA 1XM1A 2ZFFH 1Z7KA 3MH6A 3EYDA 1SVPA 1WQSA 2VGCC 1FJSA 2O8TA 2CHAC 2B8OH 4GCHG 2GDDA 3O8RA 1SQAA 1DDJA 2O8MA 6LPRA 3FAOA 3UOPA 1L1NA 4XOJA 1GHBF 3SJ9A 3CP7A 1MZAA 1P09A 3U8TH 1V2ST 5HM2A 4VGCC 2UUYA 1IOEA 1TRYA 4IMQA 2AGEX 1A3EH 3VB6A 3RXGA 1EAXA 2CF8H 1QRZA 2Q6GA 1LKBA 4DIIH 2V6NA 1O3NA 2THFB 1PPEE 2SGQE 3MH4A 1QCPA 3KQCA 2G51A 1P57B 2A1DB 5L6NH 4WXVA 2W3IA 1EZSC 3V7TA 1U6QA 1O2UA 3JZ1B 7GCHG 3EQ0H 3RXHA 2BQWB 1GJDB 5J4QA 2FYQA 1V2NT 1FNIA 2ZFPH 3R3GB 4CH2B 1CBWB 5C67A 3UNQA 4X8TH 3PO1C 1C1MA 1XUFA 1IQMA 1YF4A 5EQRA 1C5QA 5FPSA 1ZSJA 4INLA 4YOGA 5EU8A 8LPRA 4RKOB 3B9FH 2OQ5A 3GDSA 1AVGH 2CV3A 5DP9A 5LPFA 1G2MA 1A0JA 5EW1H 2ZCKP 1O2ZA 3QWCH 2TGTA 1F0SA 2A31A 1GBTA 1D9IA 5FBEA 3RC4A 2HVXA 2BMGB 1G3EA 1GI2A 5F03A 1EP6A 1ELFA 3NCLA 4OS2A 1HFDA 2I6SA 3NXPA 3MWIU 4ESTE 3AAVA 2ZKSA 1O36A 1SGTA 4MPUA 4WVPE 1HJ8A 1DY8A 4DCDA 2ZU2A 1UO6A 2DUCA 2C4FH 3BTHE 1LMWB 2Q6FA 2ZGHA 5ESTE 4LOYH 2ZI2H 1WAYB 1KXEA 1SI5H 1O31A 1WUNH 3KF2A 2H9TH 4WMEA 2ZZUH 3PLPA 2SFAA 5HM9A 3SNDA 3VB4A 2V3OH 3QGJA 2BVXH 1DXWA 3I78A 5CE1A 1HJAC 6CHAB 2RA0A 2ANWA 2FX6A 4XBBA 2ZDKA 4U2WA 3SU3A 2D1JA 3V12A 5A2MH 1LHEH 2ZFSA 1VITH 4JZEH 1LQEA 3A87A 2WPKS 2STBE 3D49H 4OS4A 1P02A 3UPEA 1UCYH 1Q31A 5JB9S 4YT7H 3SUDA 1DICA 1UVTH 1PQAA 1SSXA 2PTCE 1W0YH 1CSOE 5G4BA 2HPPH 2FM2A 1GMHF 1G9IE 3DUXH 1TRMA 4ABDA 3V3MA 1ESAA 1SR5C 1TBZH 3U8RH 4I33A 1V2OT 2WV5A 1OSSA 1C2LA 1YGCH 3ZVFA 1CU1A 1HNEE 2A4RA 1G37A 2P16A 2H6MA 1XVMA 5IDKA 1GVZA 4ISHH 3QO6A 1NFWA 2ZA5A 2CGAA 1AUTC 2Y5FA 1DVAH 1D4PB 2G5NA 3LC5A 5I46H 2J92A 2BYAX 1Q2WA 3RXPA 3GCHB 1UTNA 4ABJA 1A0HB 2BY6X 4DT7B 1AE8H 1O2IA 2AMQA 1GMCG 1AO5A 1THSH 4KTSA 3NWUA 4KKDA 2QF0A 1C1SA 4MQAA 3RU4D 2FZZA 2OC0A 1QQUA 3BG4C 1OWJA 2VWLA 1O2VA 2ZIQH 2OXSA 1TABE 2BOHB 2BZAA 2Z3EA 3RUOA 3ATKA 2ZDVH 1XKAC 3M36A 4E05H 5C5NA 1MQ6A 2P3FH 1TPSA 3RMNH 1O2WA 4GHQA 2VIDA 4BTUB 5K7RA 2ZGCA 1RTFB 1KIGH 4I31A 4OS6A 2O8WA 3SU2A 2QXGA 1DWDH 2EI6A 1VGCC 4DURA 4B2CA 1FLEE 1NESE 5E2OA 1FN8A 4UEHH 4OGYA 1QURH 2PWXA 6GCHF 2P95A 2Y82A 3U98H 1K1LA 1QBNA 2GMTB 1OS8A 1QB9A 3M3VA 1ESBA 4K2YA 1GGDC 1EPTC 1OWHA 2OC1A 3FANA 1FV9A 3RXJA 3U9AH 1ELVA 5BPEA 2GV7A 2BDCA 3QX5H 1TPOA 1HRTH 1GJ6A 2ZDNA 1A5HA 4F49A 4Q7XA 4Y79A 1AB9B 3PMHB 2ESTE 4IMZA 5DJ7A 1GI4A 3SV6A 1BDAA 2J9NA 3GY2A 4ZKNU 4LXBH 5B6OA 4KP0A 1HCGA 3BTGE 1AI8H 1B0EA 1TRNA 3VXFH 1D6WA 1MH0A 1PYTC 3T2NA 1YLCA 1TA2A 1PPHE 1FMGA 2F91A 3A7YA 1N6XA 2BZ6H 3RC5A 1MU6B 2HNTC 3KIDU 1ETRH 4CR9A 1ZMLA 1NO9H 5BRRE 1WTHD 3SU6A 2P8OC 1VCWA 2B5TB 1ZPCA 1OP8A 4A1TA 2F83A 2EI8A 1FQ3A 5DG6A 1OP2A 1TNKA 4YM9A 1EPTA 1AVWA 2FI4E 7ESTE 1BQYA 3A8AA 4Q2KA 2ZDMA 1P8VC 1HAZB 4JZDH 3TLOA 1ZZZA 2XC5A 1BTXA 1EJAA 2XNIA 2VGCB 4TWWA 3ITIA 4NZLA 2CHAB 2HOBA 4QT8C 1CA0C 2G55A 3A88A 4FUCA 3RXVA 3LIWA 2GX4A 2VB0A 1EQ9A 1GHXH 1MU8B 3LGIA 3QUMP 2QYIA 1FY1A 1HAYB 2FP7B 3SGAE 2BLWA 1TNJA 4VGCB 1QA7A 1TX7A 3Q00A 3UR9A 4YZUA 5DGJA 1CHOG 5JDUB 1THPB 4TYDA 2ANMH 1EASA 2BY5X 2XWAA 3ELAH 2WPLS 3GY4A 4FU8A 4X2WA 2A4GA 1SFIA 3AASA 1NN6A 5DP4A 1K2I1 1L1JA 2ANYA 3C27B 1D6RA 4E06H 1GJ9B 2ZHQH 3E6PH 4NZQA 1TNHA 2EC9H 3M35A 4DOQA 1S81A 1TLDA 4D7FA 1V2WT 1UK4A 3RXTA 5C5OA 6ESTA 1SGPE 1GI7B 1K1MA 2W5EA 1K1PA 2ZCHP 5F8XA 5FPYA 4JYUH 2Z3CA 3SUGA 2ZU3A 5AVDA 3U1IB 4KGAA 3E91A 3PO1B 4I8JA 2A0QB 4B75A 1L1GA 1F0RA 1GHBG 3EA8A 4D76A 1EP5A 1K1OA 1XUHA 1H8DH 1GBFA 3GDUA 2H2ZA 1KTSB 4H4FA 1O5EH 1P04A 1Y3UA 4XBCA 2TBSA 2VIVA 5EXMA 1NT1A 1UK3A 5EW2H 1GBHA 4JCNA 1S0RA 3GYMA 1ZRKA 2R0KA 5LH8A 4NFFA 2A2QH 3OYPA 3Q3YA 1TFXA 2PR3A 1UCYK 3PMAB 5LGOA 1KLTA 2G52A 3ZYDA 4B2AA 1QA0A 3MOCA 4NIXA 2JH6D 2C8WB 4GHTA 1YPGH 1TX6A 3T28A 1K21H 1P2IA 1F5KU 2UWLA 1SLWB 4AG1A 1DUEA 1SOZA 2VU8E 3K2UA 1N8OC 1SOTA 1IHTH 4UONA 3PWCA 3SV8A 3O8DA 1QRWA 2R2WU 2WV4A 3MU1A 2G4TA 1TPPA 4NSVA 4YOJA 2NU2E 2BD8A 2ZHDA 3ZVDA 1NPMA 1EJNA 2W7UA 1G3CA 1MBQA 5CMXH 3KN2A 4NFEA 1MUEB 1C2HA 2QA9E 1ZHRA 1DWEH 3SUFA 2OBQA 1O3GA 1FAXA 1L2EA 2P3UB 1HJAB 5EPYA 5A09A 4TY7A 1P12E 1TX8A 4BXWA 1A7SA 1S83A 1TMTH 3LGTA 4Q80A 4FUBA 2VWNA 3A7ZA 1GBJA 4O03A 3DHKH 1ANCA 1BBRH 2FESH 2UWPA 1AVXA 1UTLM 3HKJB 5DK1A 2NU0E 1O35A 4BOHA 2WPJS 4GPGA 3STJA 1LHCH 1QJ6B 5FX6A 1DPOA 1SGDE 3ZVGA 1FIWA 1FZZA 4TPIZ 1EZXC 1C9TA 4AFZA 2Y5GA 3SU1A 1NFXA 2XCFA 3NPSA 3NUMA 4GAWA 3BTWE 5CHAC 1W3CA 1YC0A 2UUJB 1TNGA 3ZVEA 1EKBB 3TK5A 1JMOH 3S9BA 1C4U2 2ZGBH 5FCRA 1S5SA 1V2RT 1GHYH 2XRCA 3EE0B 3LC3A 4X2XA 4INKA 4AFQA 5C20A 2RCEA 1OYTH 4AN7A 1HAVA 3GY6A 1JRSA 4I7YH 2BX4A 2Z9KA 4JZIA 3A89A 1LHGH 4YTAA 1E36B 1AKSA 1O3FA 4TWYA 5DP3A 3P8FA 4MG3A 2BY8X 1GL0E 1O2OA 1DFPA 2BTCE 3UFAA 4F4OC 2FOEA 1GMHG 3LGUA 1TQ0B 4ZMAH 2OUAA 4YLQH 4TY6A 2QY0B 1GWAA 2BLOA 4HFPB 3KNXA 3MH7A 2HWLB 1SLXB 1ZMJA 2QIQA 5FCKA 9ESTA 1CO7E 3SGBE 2JKHA 3QLPH 3HATH 3BIVH 1PPBH 1MQ5A 4A7IB 1O2YA 1FUJA 3IWMA 1J9CH 1ANEA 4CRGA 1PPGE 1VGCB 1V2LT 1JWTA 2EEKA 2ZO3H 4Y11E 1Z6EA 2ODPA 1M9UA 1C9PA 5C1YA 3BTQE 1C1TA 4FVBA 2G8TA 4YESB 5EODA 5DP7A 1LCYA 1O32A 1GGDB 1EPTB 1AGJA 3BEUA 3ATIA 1GDUA 1Y3XA 2C8XB 1ZHMA 7KMEH 2A7JA 2VH0A 4MDSA 3RU4T 2VIWA 2UWOA 1GPZA 3FFGA 3T29A 2G00A 4O9VA 5E8EH 3SJOA 1TGBA 2PW8H 3E0NB 3A81A 1QRXA 2ULLA 1B5GH 3BIUH 2HRVA 1H4WA 1O3IA 1ABJH 2ZHFH 3ZZ3A 4THNH 1P9UA 4NSYA 3SV9A 3JZ2B 1GI9B 2F3CE 3EA7A 1XUIA 1HB0B 1BA8B 3ZZ4A 4ABHA 1RD3B 4D9QA 1FY5A 3MMGA 4DVAU 2ZWLH 2Q6DA 3P8NA 4ABIA 2G81E 4AB9A 1LVBA 3P8OA 4ZHMU 8GCHF 1XX9A 1D3QB 1ZRBA 3EA9A 1HAIH 1ANBA 5F8TA 4KELA 2SNVA 2P8OB 1T8LA 3M5OA 1SQOA 1ZLRA 2ZNKH 1F5LA 4B76A 3ZZBA 2AIPA 3M7QA 3UNRA 3HKIB 3GY3A 1GJ5H 1P0SH 1BCUH 5HXFA 5A0CA 1EZQA 3SJIA 1C5OH 4FU9A 2TPIZ 4NA9H 4WXIA 2VNTA 1GHAF 3RLWH 1CA0B 2TGDA 2A7HA 1V6DA 2GT7A 3A86A 1S6FA 1P01A 1SGEE 2Z9LA 3A82A 4NG9H 3MU5A 2Y7ZA 4CRBA 4GVUA 3M37A 5JBTA 1GBIA 2J34A 3S9AA 3MNSA 1WBGB 2NU1E 3LGYA 3Q3KA 1MBMA 3DFJA 4X1QU 1P9SA 3MNCA 5C3NA 4I8GA 4WH6A 1GVLA 3T62A 3UWIA 3ZZDA 2FS8A 4MLFB 1YCPK 1JIRA 2C8ZB 4ABGA 2FTLE 1K1IA 1K1NA 1VZQH 3URCA 2BLQA 3BN9A 2FLBH 2RDLA 5JBAS 1TB6H 1XVOA 2M5TA 4O3UA 1YPJH 1GJ8B 1QY6A 5GCHF 4LZ1H 2VIQA 4AGKA 4E7NA 3HGNA 1QIXB 3KQEA 1AHTH 3A7WA 1HGTH 1GJAB 4LK4A 2QXJA 1K1JA 1O5BB 1AUJA 2O8LA 4JZ1A 1GCTC 4ZKRU 1C5WB 2BD3A 2ZP0H 1ZR0A 2YOLA 1QB1A 4K1EA 3SN8A 1KXFA 3QDZB 2FDAA 2CMYA 3KCGH 4KTCA 1H9LB 1BBRK 1W2KH 5A0AE 4XBDA 5AFZH 2H5CA 3P17H 2BY7X 1UTMA 1O2PA 2K1QA 3O8BA 2XTTB 1V2JT 5TCCA 1P2OA 1IQNA 2W26A 3OSYA 1NU7B 2FWWA 1C5RA 3LT3A 5DO4H 4JZFH 1L4ZA 4BAOB 1DLEA 1AFEH 1SHYA 1W10U 4FU7A 1O34A 1WV7H 2BD7A 1N8OB 5SGAE 1KXDA 2AMPA 3T26A 1VJAU 2I6QA 4JK5A 1C2JA 1EAIA 2BX3A 2J94A 4XDEA 3RP2A 1C5UA 5TJXA 1UVPA 1BMAA 4IW4E 2ZF0H 3LJJA 3SNEA 1DUAA 1RGQA 5DP8A 3LKWA 3BTDE 3V0XA 3RXEA 2VWOA 3M3TA 1J16A 3TK6A 4I8LA 2R9PA 4B73A 4SGAE 2W7SA 1TGTA 2PLXA 1SGYE 2V35A 2DE8A 3IITA 1SBWA 1GCDA 1HAVB 4OS7A 1ETTH 1AKSB 1K22H 1VCPA 3I77A 3RXCA 1O30A 1CE5A 3LH3A 3CENA 1SGCA 1LVMA 1JOUB 1Y59T 1S6HA 1SGRE 3BV9B 1O2GH 1O2XA 3RXKA 1A1RA 4NA7A 5AFYH 2PUXB 2BVSH 1TOMH 1DY9A 3GCTF 3D23A 1D3TB 1IQEA 3TJUA 1GHZA 4WF8A 1C5MD 1L4DA 2Y6TA 2FMJA 3RXRA 4K3JA 4X1PU 5EGMA 2AYWA 1AIXH 1Y5AT 4AFUA 5C2ZA 5CHAB 5GDSH 2ALPA 4YO9A 5GIBA 1C1WH 1Z8JB 1FXYA 2GVFA 1BMMH 1O2SA 1Y3WA 2LNCA 1GVKB 1BHXB 1GBAA 2GDEH 1OWIA 1O38A 1O2RA 3DD2H 1DITH 3FZDA 4IC5A 4NIYA 3BEIB 4LZ4B 1FAKH 1QGFA 2P3TB 3H7TA 2QV1A 4IN1A 3RXIA 1VITF 1QJ1B 2NU3E 3BSQA 1IQGA 1E0FD 3MU8A 1RIWC 1EJMA 1FN6A 1P03A 4ZH8A 4BAQB 1GHVH 3PMBB 1LDTT 1RJXB 4DGJA 2EA3A 1O37A 4BXSA 1YPHE 1O5DH 3STIA 3TK9A 4X6NA 4B71A 4JK6A 1UCYE 1C1UH 3QN7A 1V2KT 1JRTA 2P93A 5E0JA 3P95A 1LKAA 1C2GA 2V0BA 2ZPQA 3ATWA 3BTKE 3M61U 4GCHF 1NY22 3VB3A 3S69A 3ZZ5A 3EGKH 3NKKA 3O8CA 5GPIB 1H9IE 4MNYA 3MH5A 1O3MA 3P6ZB 3B8JA 2WUBA 1MAXA 2LPRA 4ABFA 1DX5M 7LPRA 1MAYA 5JBCS 2FI5E 1AZ8A 4O3TA 1A0LA 1P3CA 1SG8B 1NC6A 1TQ7B 1YPMH 2FOAA 3L6PA 1D3DB 1QL8A 5DP6A 2GZ7A 1ELDE 3F9EA 1HUTH 1DE7H 1EUFA 1MZDA 1IQLA 4I8HA 4A92A 3BTFE 1YCPM 3GOVB 3FZZA 2BDHA 1B7XB 2Z94A 4MTBA 2PKAB 2GZ8A 1AFQC 2A4QA 3TGIE 2C3SA 1DXPA 2NU4E 3D62A 1MTSA 1P10A 5H4IB 1V2TT 1EB1H 1O39A 4YOIA 4WH8A 1NROH 1GL1A 4H6SB 3FP8E 2H1UA 2AGGX 2FYRA 1UJ1A 2F9PA 1CGHA 1XUGA 4Z0KA 3MO3A 5EXLA 1C5NH 1O3PB 1GJCB 2R3YA 3PV4A 1YPEH 4ZXXH 1O2NA 2UUFB 1AMHA 3GCNA 4RSPA 5JPMH 3M5MA 2BY9X 2AGIX 1YBWA 1O3BA 3K6ZA 3A7TA 3P92A 1MTVA 2FS9A 3K65B 1TALA 1ELAA 1UHBA 3ZZCA 8KME2 1O3CA 2BQ7B 1MKXH 4U30A 1BITA 1AU8A 1T8MA 2Z6BD 1BRAA 1P2JA 1T7CA 4DY7B 1TAWA 4BAMB 1IQIA 1WOFA 4TPYA 3TU7H 3UQVA 2QF3A 2A5KA 4BAHB 1EAUA 2QC2A 4CH8B 1KDQA 4ZAEA 2BVRH 3LGWA 1W13U 1C2KA 1K9OE 1MCTA 2IOTA 1Y3YA 4B1TA 2PV9B 5FBIA 4A1VA 1JIMA 1TBRH 1VJ9U 2YNBA 1BJVA 4ZHLU 2A5IA 1P2NA 1ZYOA 4MNVA 2ZU1A 2GZ9A 3RXAA 1QBVH 1CGJE 2B0FA 5F8ZA 5EQQA 1QQ4A 4CHAC 2P94A 2V3HH 1EZUC 1C2DA 2XYAA 1GHAG 1XXFA 2ZECA 1GI0A 1AZZA 2WYGA 2FX4A 3TH2H 4R8TB 2BDBA 3ZZ8A 5DKMA 3GISB 3KEEA 1SHHB 1TA6A 2GD4B 3RC6A 2BXUH 3L33A 4CBOA 3KQDA 1LO6A 1NS3A 1GHWH 1UVUH 3PTNA 4X8VH 2Y7XA 4NGAH 1T8NA 1WSSH 3Q3XA 1PQ5A 2CJIA 1S84A 1RTKA 1DWBH 1C1RA 3SJKA 3QTVH 3Q76A 3UQOA 1ELCA 4U01A 2AS9A 5JYIA 4UFDH 1HPGA 3TVJB 1C5PA 3SHAH 3ZZ7A 1T32A 3VXEH 1S0QA 2PGBB 3NZIA 2QGRA 1V2UT 2ZC9H 3SU5A 1OWKA 3DT0H 3ZV8A 3PM3A 2B9LA 4X8SH 5EG4A 1O5GH 1EXFA 1O3HA 1P11E 1TGNA 3TITA 1ZGVA 4MPXA 3TGJE 4K1TA 4IC6A 1VR1H 3MU0A 3MTYA 2J2UA 2TRMA 1BTHH 1GI8B 1IQJA 1YM0A 1DT2A 3MNXA 1CT4E 1MKWH 1O3OA 1TWXB 3RDZA 1IQKA 4MPWA 3SNAA 1HLTH 2FTMA 4H42U 2ZTXA 2FOGA 4IN2A 5DP5A 2CF9H 1T31A 4DW2U 1SL3A 4Y0YE 3P70B 2XC4A 4Y8XA 4H6TA 1UTJA 1SGFG 3EDXB 2ZFTA 1ZSKA 1ID5H 1P2MA 1PPCE 4PROA 4XE4A 2VJ1A 2XBVA 1E38B 1EX3A 4AORA 2PHBA 1EOLA 1C1OA 3M7UA 2HNTF 3W94A 1GJ4H 1ESTA 1GI3A 3ODDA 5I25A 1IAUA 1TIOA 1C2FA 3M3SA 4UD9H 2STAE 1LHDH 2BD4A 3SO3A 3BG4B 5E0HA 1HXEH 1LPGB 3E1XB 2A2XH 2BOKA 4BTTB 1HIAA 5HGGA 2SGFE 1LPKB 2ZHEH 4FUHA 2SGAA 4Y7AA 4WJG2 4B2BA 3SQEE 2H9HA 1G30B 2XBWA 2XW9A 1AY6H 1SB1H 4CBNA 5FPTA 2OC7A 2Z9GA 2IN2A 4JMYA 2FOFA 1PQ8A 3SW2B 4NWKA 5HYOA 1OP0A 3GCTG 3SOSA 3RXLA 1RIWB 1O2LA 1G2LA 3T25A 2Y81A 5T6FA 1BBRE 4D8NA 1GMDF 3F9GA 2QXHA 3A84A 3A80A 3MNBA 3MHWU 1WCZA 3PYHA 2OQUA 3TJVA 2FLRH 3F9FA 1GBMA 2VIPA 1T8OA 2VVUA 3TNSA 3ZYEA 5DPAA 1A5IA 1QR3E 1AN1E 4AB8A 2PSYA 1A4WH 2WINI 1UMAH 1MTNC 3MU4A 4JYTA 1O5AB 4CRDA 1UTKA 1NRPH 1PFXC 1FONA 3B23B 1F0TA 1KLJH 2OINA 2ZPRA 1PPFE 1W0ZU 4HTCH 3RXOA 1MCVA 1F2SE 3Q77A 2VIOA 2JETC 1VITG 4AZ2B 1C2EA 2D8WA 2OBOA 4DG4A 1SFQB 4CRCA 1MKXK 1KXBA 4CRFA 3ATMA 6GCHG 1UHBB 4HGCA 1NRQH 3URDA 1DS2E 2WPMS 3K9XB 3BTME 1E37B 2ZDAH 1V2PT 2RG3A 4Z6AH 3HGPA 2QN5T 4FUEA 4IS5A 4YT6H 4ABAA 1THRH 2R2MB 3RMMH 3VGCC 3ZVCA 1ETSH 1YLDA 1WTGH 1AFQB 1ZHPA 2WUCA 4J1YA 2OC8A 2J4IA 2XC0A 1ANDA 4NCYA 3AW0A 1KXAA 1OWDA 1YPHC 1C5ZB 2Z3DA 1ABIH 1KDQB 2VH6A 1BT7A 1B0FA 1C4V2 1J15A 2Z7FE 4WWYA 1J8AA 2Z9JA 2Z9IA 1GJBB 2C90B 4Y7BA 3DA9B 1J14A 1ZPZA 2PKAA 3RXDA 3RXSA 3ZZ6A 1OYQA 2GCHF 4NWLA 4HI3A 2ZQ2A 1INCA 5FXLA 1EAWA 1W7GH 3LH1A 1SGQE 4M7GA 1F0UA 1QNJA 1BIOA 1C1QA 3SV2H 1BRBE 2O8UA 4K8YA 3PB1E 4ISLA 2XXLA 3A8CA 3FP7E 4FVDA 1ZTLA 5L30H 1MD7A 3MYWA 1P06A 1XXDA 4K8BA 3A7VA 3RM2H 2A5AA 5EXNA 3S9CA 1V3XA 3SORA 2ZPSA 1AWHB 2FPZA 1NTPA 4MNWA 4Y8ZA 9LPRA 4K60A 2PSXA 1GJ7B 3I29A 4OS5A 1GBBA 1J17T 1E34B 4FUFA 3GICB 2ZFQH 3A83A 1FY4A 2H9EH 2VINA 4BTIB 3T5FH 3GY5A 4DJZB 5GJ4B 2ZQ1A 2OLGA 2SNWA 3RMOH 3WY8A 3VEQB 2AMDA 1C4Y2 3ZVAA 3A7XA 4X6OA 3AVZA 2UUKB 1LPZB 3E8LA 3MI4A 1KY9A 3SV7A 5L2YH 1QJ7B 1FI8A 2ANKH 2HGTH 1UTPA 5EOKA 2G5VA 1O2QA 1Z8IB 1Z8GA 4CHAB 2TGAA 3ATLA 4X0WU 4I32A 1O3LA 2EI7A 1EB2A 3LDXH 3TPIZ 1BHXF 2JH5D 3PROA 4IBLH 1CT0E 2J95A 3SI4H 1G3DA 5GWZA 4A1XA 4GUXA 1MKWK 1GBEA 4ZKSU 2D26C 1ACBE 3H5CB 1SQTA 3HK6B 2A45B 5LPRA 1TOCB 1ZGIA 2QCYA 1C5YB 1JXPA 3K6YA 3S7HB 3ZVBA 4AGJA 2PGQB 2IPHA 2XCNA 1O5CB 1C5VA 1O2TA 2B7DH 4K69A 2WPHS 1NZQH 2BLVA 3LGVA 3R0FA 1N1LA 3VB7A 1QBOA 1E35B 1C1VH 1ZMNA 2GP9B 1KTTB 3RM0H 1FPCH 1V2QT 1A5GH 1F7ZA 4J2YB 4AYYB 3TJNA 3IG6B 1TMUH 1Z71A 1BJUA 4MVNA 1MD8A 1UTQA 4AX9H 3DFLA 1SLVB 1DSUA 2FOCA 1TE0A 2ZTYA 1HJ9A 1HIAB 3UTUH 1O5FH 1C1NA 5L2ZH 4FXGH 2AFQB 1G36A 3ENSB 4SGBE 4A5TS 3PLKA 1DM4B 1VCQA 2OTVA 3F1SB 1Y8TA 1ELTA 2FOMB 1G3BA 4BAKB 2FIRH 1BTWA 3UNSA 5A0BA 1W12U 1XUKA 2AH4X 3QZRA 3BF6H 2BD2A 2GCTC 1TGCA 3FVFB 4Y76A 3N7OA 3SGQE 5LPEA 2SGDE 1NFYA 1PQ7A 2BDYA 1XKBC 1NU9A 3BTEE 1DSTA 2BDIA 3SU0A 4Y10E 3PWBA 1BUIA 4OGXA 4GSOA 2F9VA 4Q7YA 1LVOA 4MPVA 2PKSC 1SPJA 1BMLA 2Y5HA 1V2MT 1KLIH 1RRKA 1GI6A 1H9HE 4Y6DA 3U69H 2H5DA 1QTFA 2TGPZ 1BTYA 1IHSH 2OCVB 3U1JB 1AQ7A 1LQDB 4UFGH 1OX1A 5ABWA 1A61H 1Z1JA 5A8YA 1LHFH 2BXTH 2ZHWH 1HAPH 1TYNA 3F9HA 4GLYA 1UTOA 3VB5A 1AD8H 1HYLA 2SGEE 2C8YB 4A6LA 4X6PA 2VVCA 1GG6C 4X8UH 1ZTJA 3SU4A 2ZDLA 2Y80A 1F5RA 3ZV9A 5IYTA 1UK2A 4AFSA 1AE5A 3HK3B 1BMNH 1QL7A 2QAAA 1HXFH 1SGNE 1OKXA 3C1KA 2AIQA 1N6YA 1BB0B 4Y71A 4NIWA 3UREA 1MTNB 1GDQA 3SHCH 4XFQA 3SJ8A 3PMJA 3SNBA 7GCHF 1EATA 3PTBA 4D9RA 5E2PA 4WY3A 1Y5UT 1FPHH 1XUJA 1O2KA 1RFNA 1UVSH 4ZXYH 4CRAA 1KXCA 2A32A 4KTUA 3KHVA 3G01A 1C5XB 1W11U
chains in the Genus database with same CATH superfamily
1ORFA 2ZGXH 2JETB 3OY6U 3TJOA 1DWCH 1A3BH 3TIUA 1GBCA 1W7XH 2OD3B 1CT2E 3SI3H 1IQFA 4WMFA 1CGIE 3LU9B 1WYKA 2CXVA 1DLKB 1BRUP 4XSKU 3BEFB 2DE9A 3GY7A 2PUQH 2PFEA 1GMDG 2XBXA 1XMNB 5HKKD 3E90B 1MTUA 2F9UA 3P8GA 3OY5U 1L0ZA 3L3TA 5F6MA 1NRSH 4DIHH 2C93B 5EQSA 3T27A 1ZSLA 3VGCB 3BTTE 1AWFH 3F2GA 5C1XA 1S82A 4UFEH 2KAIA 4JYVH 4U32A 1SGIB 3ZZ9A 1C5TA 2ILNA 2W6ID 4UFFH 3RXBA 3U8OH 3GY8A 1C2IA 3RLYH 1O3EA 3RU4E 1CBWC 4WMDA 3OFND 1COWD 1P3EA 1O2JA 4F55A 1O3JA 4ZROA 5PTPA 1O2MA 1MTWA 2KR7A 5HMAA 3DCLA 5A8XA 1C5LH 5JB8S 1ELEE 1X7AC 5C1UA 2PTNA 2FOBA 1ARBA 3QGNB 8GCHG 4K5ZA 1Q3XA 1G32B 1KYNA 2RFKC 1BTPA 2ZU5A 1NRRH 1PYTD 2ODQA 4NA8A 1TPAE 1QFKH 3UWJH 1Z6JH 4CR5A 3E3TA 1A46H 8ESTE 4YXWD 2ZTZA 3CS0A 2WYJA 2ZCLP 3N99A 2F9NA 5A8ZA 3EAJA 4F48B 5ESBA 1E1RD 4R0IA 1GCTB 1HAHH 1HAGE 3SUEA 3ZZAA 1Y3VA 2GCHG 4OS1A 4ZKOU 3F68H 5K0HA 2FO9A 2W6JD 1WU1A 3FOAA 3MFJA 1OXGA 3OX7U 1SC8U 3OEED 4ASHA 4X6MA 1GI1A 3OU0A 2QF5A 2O9QA 3M5LA 1TMBH 1GDNA 6CHAC 2HALA 1O3AA 1Z8RA 2R0LA 3W95A 1FIZA 3RXMA 1Y5BT 1FY3A 1YCPH 1LVYA 3KL6A 1HDTH 3GYLB 5FHTA 1W8BH 2NWNA 3PLBA 2ODYB 4INHA 3TGKE 4X1SU 3N7DA 3H7OA 5GCHG 5ETXA 1GMCF 1ZJKA 1ZTKA 2BDAA 2ZEBA 5JBBS 3SZNA 4RKJB 3KQBA 1LTOA 3HPTB 1HBTH 4D7GA 1C1PA 5T6GA 3AW1A 2P59A 1OWEA 1CVWH 4ZHAA 2GTBA 3MO6A 1S85A 2ZFRH 3TNTA 2GKVE 2TIOA 1NRNH 1CQQA 1OOKB 4K1SA 4ABEA 4E7RG 1TBQH 2BQ6B 2J5UA 3QTOH 2G4UA 2HPQH 2BDGA 1BTZA 3UY9A 3SQHE 3LJOA 1HAXB 3S0NA 3LOXA 3LONA 5GXPA 2FI3E 4HZHA 2A7CA 5T6DA 3A8DA 1MMJN 1RXPA 2XOKD 1KSNA 5EIYA 1ELBA 4ZUHA 1C5SA 1DOJA 1P2KA 3UUZA 1A2CH 1SMFE 1P05A 3GCHC 3TH4H 1TNLA 1QL9A 1O3DA 1YYY1 3M5NA 4UDWH 3F0PA 2WPIS 2ASUB 2F9OA 4ISOA 2XBYA 3VPKA 1QB6A 3QK1A 2VVVA 1IQHA 1Z1IA 3KQ5A 4BNRA 1RTLA 1NM6A 5AF9H 2J38A 2XWBI 1CHGA 1NFUA 1HAOH 1WQVH 3KGPA 2IJOB 2BD5A 1GBKA 4BANB 5AHGH 4YLUA 3S7KB 3VFEA 3AK5A 2J97A 1JBUH 3M7TA 4FUJA 2HNTE 3WWBA 1T4VH 4Y0ZE 1YP9A 4UE7H 5TCAA 1GI5A 1RS0A 2BM2A 2FXRA 5J4SA 2GCTB 3E0PB 3QZQA 4RI0A 1TONA 1SLUB 2PP6A 2CN0H 3A85A 3MO9A 1FX0B 2D2DA 1O0DH 2GT8A 1C2MA 2BD9A 1BOQA 1PPZA 3E16B 4AOQA 1H8IH 1K28D 1BZXE 2OP9A 2W3KA 2A4OA 2QXIA 2BHGA 3CS7A 4NIVA 1BRCE 2FEQH 2ZGJA 4O97A 5FX5A 2AEIH 1TNIA 4FUGA 3ESTA 2ZG0H 1FDPA 2PKSB 3SBKA 3AAUA 2GMTC 4AYVB 3UIRA 3UOUA 1KMHB 1O2HA 4CREA 1O3KA 3V13A 4ISNA 5E0GA 1P2QA 2YMSB 2Q1JA 5T3HA 2YNAA 2AERH 3UR6A 1PJPA 5FAHA 1ARCA 1TGSZ 1T4UH 2JH0D 4AG2A 4ISIH 2GGVB 3A8BA 3TH3H 1ZOMA 2WV9A 3F2HA 1AB9C 2RA3A 4ABBA 1EOJA 2HLCA 3FP6E 3GDVA 2R3UA 1GBLA 1O33A 3RMLH 4I8KA 3F6UH 4MNXA 1YPKH 4IGDA 1ELGA 1ZJDA 1D3PB 3NK8A 2FODA 1GG6B 4FUDA 1H1BA 3SNCA 1YKTA 1SGFA 1BTUA 4X1NU 1W14U 1CHOF 1QHRB 1YPLH 2ZU4A 1ZPBA 3GCOA 1GBDA 3D65E 1DANH 2VWMA 4FUIA 3ODFA 4Y8YA 4B74A 1UVOA 3NRLA 3OTJE 4Q7ZA 2ALVA 4X2YA 3BG8A 1FY8E 2F9BH 2KAIB 1V2VT 1F92A 1HV7A 1OPHB 2BB4A 3RXQA 3RXUA 4X2VA 3RXFA 2SGPE 1CA8B 3LPRA 4X1RU 5EPNA 4RN6A 2GV6A 2FOHA 1XM1A 2ZFFH 1Z7KA 3MH6A 3EYDA 1SVPA 1WQSA 2VGCC 1FJSA 2O8TA 2CHAC 2B8OH 4GCHG 2GDDA 2WZQA 3O8RA 1SQAA 1DDJA 2O8MA 6LPRA 3FAOA 3UOPA 1L1NA 4XOJA 1GHBF 3SJ9A 3CP7A 1MZAA 1P09A 3U8TH 1V2ST 5HM2A 4VGCC 2UUYA 1IOEA 1TRYA 4IMQA 2AGEX 1A3EH 3VB6A 3RXGA 1EAXA 2CF8H 1QRZA 2Q6GA 1LKBA 4DIIH 2V6NA 1O3NA 2THFB 1PPEE 2SGQE 3MH4A 1QCPA 3KQCA 2G51A 1P57B 2A1DB 5L6NH 4WXVA 2W3IA 1EZSC 3V7TA 1NBMD 4ZCNA 1U6QA 1O2UA 3JZ1B 7GCHG 3EQ0H 3RXHA 2BQWB 1GJDB 5J4QA 2FYQA 1V2NT 1FNIA 2ZFPH 3R3GB 4CH2B 1CBWB 5C67A 3UNQA 4X8TH 3PO1C 1C1MA 1XUFA 1IQMA 1YF4A 5EQRA 1C5QA 5FPSA 1ZSJA 4INLA 4YOGA 5EU8A 8LPRA 4RKOB 3B9FH 2OQ5A 3GDSA 5C0UA 1AVGH 2CV3A 5DP9A 5LPFA 1G2MA 1A0JA 1MABB 5EW1H 2ZCKP 1O2ZA 3QWCH 2TGTA 1F0SA 2A31A 1GBTA 1D9IA 3EE7A 5FBEA 3RC4A 2HVXA 2BMGB 1G3EA 1GI2A 5F03A 1EP6A 4ACAA 1ELFA 3NCLA 4OS2A 2V3MA 1HFDA 2I6SA 3NXPA 3MWIU 4ESTE 3AAVA 2ZKSA 1O36A 1SGTA 4MPUA 4WVPE 1HJ8A 1YY3A 1DY8A 4DCDA 2ZU2A 1UO6A 2DUCA 2C4FH 3BTHE 1LMWB 2Q6FA 2ZGHA 5ESTE 4LOYH 2ZI2H 1WAYB 1KXEA 1SI5H 1O31A 1WUNH 3KF2A 3OEHD 2H9TH 4WMEA 2ZZUH 3PLPA 2SFAA 5HM9A 3SNDA 3VB4A 2V3OH 3QGJA 2BVXH 1DXWA 4HG6A 3I78A 5CE1A 1HJAC 1BMFD 6CHAB 2RA0A 2ANWA 2FX6A 4XBBA 2ZDKA 4U2WA 3SU3A 2D1JA 3V12A 5A2MH 1LHEH 2ZFSA 1VITH 4JZEH 1LQEA 3A87A 4M9FA 2WPKS 2STBE 3D49H 4OS4A 1P02A 3UPEA 1UCYH 1Q31A 5JB9S 4YT7H 3SUDA 1DICA 1UVTH 1PQAA 1SSXA 2PTCE 1W0YH 1CSOE 5G4BA 2HPPH 2FM2A 1GMHF 1G9IE 3DUXH 1TRMA 4ABDA 4DT4A 3V3MA 1ESAA 1SR5C 1TBZH 3U8RH 4I33A 1V2OT 2WV5A 1OSSA 1C2LA 1YGCH 3ZVFA 1CU1A 1HNEE 2A4RA 1G37A 2P16A 2H6MA 1XVMA 5IDKA 2AHME 1GVZA 4ISHH 3QO6A 1NFWA 2ZA5A 2CGAA 1AUTC 2Y5FA 1DVAH 1D4PB 2G5NA 3LC5A 5I46H 2J98A 3WWFA 2J92A 2BYAX 1Q2WA 3RXPA 3GCHB 1UTNA 4ABJA 1A0HB 2BY6X 4DT7B 1AE8H 1O2IA 2AMQA 1GMCG 1AO5A 1THSH 4KTSA 3NWUA 4KKDA 2QF0A 1C1SA 4MQAA 3RU4D 2FZZA 2OC0A 1QQUA 3BG4C 1OWJA 2VWLA 1O2VA 2ZIQH 2OXSA 1TABE 2BOHB 2BZAA 4ASUD 2Z3EA 3RUOA 3ATKA 2ZDVH 1XKAC 3M36A 4E05H 5C5NA 1MQ6A 2P3FH 1TPSA 3RMNH 1O2WA 4GHQA 2VIDA 4BTUB 5K7RA 2ZGCA 1RTFB 1KIGH 4I31A 4OS6A 2O8WA 3SU2A 1VKYA 2QXGA 1DWDH 2EI6A 1VGCC 4DURA 4B2CA 1FLEE 1NESE 5E2OA 1FN8A 4UEHH 4OGYA 1QURH 2PWXA 6GCHF 2P95A 2Y82A 3UB0A 3U98H 1K1LA 1QBNA 2GMTB 1OS8A 1QB9A 2K8IA 3M3VA 1ESBA 4K2YA 1GGDC 1EPTC 1OWHA 5HIZA 2OC1A 3FANA 1FV9A 3RXJA 3U9AH 1ELVA 5BPEA 2XNDD 2GV7A 2BDCA 3QX5H 1TPOA 1HRTH 1GJ6A 2ZDNA 1A5HA 4F49A 4Q7XA 4Y79A 1AB9B 3PMHB 2ESTE 4IMZA 5DJ7A 1GI4A 3SV6A 1BDAA 2J9NA 3GY2A 4ZKNU 2QE7D 2JJ2D 4LXBH 5B6OA 4KP0A 1HCGA 3BTGE 1AI8H 1B0EA 1TRNA 3VXFH 1D6WA 1MH0A 1PYTC 3T2NA 1YLCA 1TA2A 1PPHE 1FMGA 2F91A 3A7YA 1N6XA 2BZ6H 3RC5A 1MU6B 2HNTC 3KIDU 1ETRH 4CR9A 1ZMLA 1NO9H 5BRRE 1WTHD 3SU6A 2P8OC 1VCWA 2B5TB 1ZPCA 4RT1A 1OP8A 4A1TA 2F83A 2EI8A 1FQ3A 5DG6A 1OP2A 1TNKA 4YM9A 1EPTA 1AVWA 2FI4E 7ESTE 1BQYA 3A8AA 4Q2KA 2ZDMA 1P8VC 1HAZB 4JZDH 3TLOA 1ZZZA 2XC5A 1BTXA 1EJAA 2XNIA 2VGCB 4TWWA 3ITIA 4NZLA 2CHAB 2HOBA 4QT8C 1CA0C 2G55A 3A88A 4FUCA 3RXVA 3LIWA 2GX4A 2VB0A 1EQ9A 2JDID 1GHXH 1MU8B 3LGIA 3QUMP 2QYIA 1FY1A 1HAYB 2FP7B 4FOUC 3ZIAD 4P02A 3SGAE 2BLWA 3GS9A 1TNJA 4VGCB 1QA7A 1TX7A 3Q00A 3UR9A 4YZUA 5DGJA 1CHOG 5JDUB 1THPB 4TYDA 2ANMH 1EASA 2BY5X 2XWAA 3ELAH 2WPLS 3GY4A 4FU8A 4X2WA 2A4GA 1SFIA 3AASA 1NN6A 5DP4A 1K2I1 1L1JA 2ANYA 3C27B 1D6RA 4E06H 1GJ9B 2ZHQH 3E6PH 4NZQA 1TNHA 2EC9H 3M35A 4DOQA 3FO8D 1S81A 1TLDA 4D7FA 1V2WT 1UK4A 3RXTA 5C5OA 6ESTA 1SGPE 1GI7B 1K1MA 2W5EA 1K1PA 2ZCHP 5F8XA 5FPYA 4JYUH 2Z3CA 3SUGA 2ZU3A 5AVDA 3U1IB 4KGAA 3E91A 3PO1B 4I8JA 2A0QB 4B75A 5DN6D 1L1GA 1F0RA 1GHBG 3EA8A 4D76A 1EP5A 1K1OA 1XUHA 1H8DH 1GBFA 3GDUA 2H2ZA 1KTSB 4H4FA 1O5EH 1P04A 1Y3UA 4XBCA 2TBSA 2VIVA 5EXMA 1NT1A 1UK3A 5EW2H 1GBHA 4JCNA 1S0RA 3GYMA 1ZRKA 3N7EA 2R0KA 5LH8A 4NFFA 2A2QH 3OYPA 3Q3YA 1TFXA 2PR3A 1UCYK 3PMAB 5LGOA 1KLTA 2G52A 3ZYDA 4B2AA 1QA0A 3MOCA 4NIXA 2JH6D 2C8WB 4GHTA 1YPGH 1TX6A 3T28A 1K21H 1P2IA 1F5KU 2UWLA 1SLWB 4AG1A 1DUEA 1SOZA 2VU8E 5C17A 3K2UA 1N8OC 1SOTA 1IHTH 4UONA 3PWCA 3SV8A 3O8DA 1QRWA 2R2WU 2WV4A 3MU1A 2G4TA 1TPPA 4NSVA 4YOJA 2NU2E 2BD8A 2ZHDA 3ZVDA 1NPMA 1EJNA 2QF4A 2W7UA 1G3CA 1MBQA 5CMXH 3KN2A 4NFEA 1MUEB 1C2HA 2QA9E 1ZHRA 1DWEH 3SUFA 2OBQA 1O3GA 1FAXA 1L2EA 2P3UB 1HJAB 5EPYA 5A09A 4TY7A 1P12E 1TX8A 2J98B 1A7SA 4BXWA 1S83A 1TMTH 3LGTA 4Q80A 4FUBA 2VWNA 3A7ZA 1GBJA 4O03A 3DHKH 3SZEA 1ANCA 1BBRH 2FESH 2UWPA 1AVXA 1UTLM 3HKJB 5DK1A 5KEDA 2NU0E 1O35A 4BOHA 2WPJS 4GPGA 3STJA 1LHCH 1QJ6B 5FX6A 1DPOA 1EFRD 1SGDE 3ZVGA 1FIWA 1FZZA 4TPIZ 1EZXC 1C9TA 4AFZA 2Y5GA 3SU1A 1NFXA 2XCFA 3NPSA 3NUMA 4GAWA 3BTWE 5CHAC 1W3CA 1YC0A 2UUJB 1TNGA 3ZVEA 3DSGA 1EKBB 3TK5A 1JMOH 3S9BA 1C4U2 2ZGBH 5FCRA 4Z1MD 1S5SA 1V2RT 1GHYH 2XRCA 3EE0B 3LC3A 4X2XA 4INKA 4AFQA 5C20A 2RCEA 1OYTH 3OE7D 4AN7A 1HAVA 3GY6A 1JRSA 4I7YH 2BX4A 2Z9KA 4JZIA 3A89A 1LHGH 4YTAA 1E36B 1AKSA 1O3FA 4TWYA 5DP3A 3P8FA 4MG3A 2BY8X 1GL0E 1O2OA 1DFPA 2BTCE 3UFAA 4F4OC 2FOEA 1GMHG 3LGUA 1TQ0B 4ZMAH 2OUAA 4YLQH 4TY6A 2QY0B 1GWAA 2BLOA 4HFPB 3KNXA 3MH7A 2HWLB 1SLXB 1ZMJA 2QIQA 5FCKA 9ESTA 1CO7E 3SGBE 2JKHA 3QLPH 3HATH 3BIVH 1PPBH 1MQ5A 4P00A 4A7IB 1O2YA 1FUJA 3IWMA 1J9CH 1ANEA 4CRGA 1PPGE 1VGCB 1V2LT 1JWTA 2EEKA 2ZO3H 4Y11E 1Z6EA 2ODPA 1M9UA 1C9PA 5C1YA 3BTQE 1C1TA 4FVBA 2G8TA 4YESB 5EODA 5DP7A 1LCYA 1O32A 5EJLA 1GGDB 1EPTB 1AGJA 3BEUA 3ATIA 1GDUA 1Y3XA 2C8XB 1ZHMA 7KMEH 2KZ4A 2A7JA 2VH0A 4MDSA 3RU4T 2VIWA 2UWOA 1GPZA 3FFGA 3T29A 2G00A 4O9VA 5E8EH 3SJOA 2KM0A 5KECA 1TGBA 2PW8H 3E0NB 3A81A 1QRXA 2ULLA 1B5GH 3BIUH 2HRVA 1H4WA 1O3IA 1ABJH 2ZHFH 3ZZ3A 4THNH 1P9UA 4NSYA 3SV9A 3JZ2B 1GI9B 2F3CE 4RT0A 3EA7A 1XUIA 1HB0B 1BA8B 3ZZ4A 4ABHA 1RD3B 1WDIA 1FY5A 3MMGA 4D9QA 4DVAU 2ZWLH 2Q6DA 3P8NA 4ABIA 2G81E 4AB9A 4ACBA 1LVBA 3P8OA 4ZHMU 8GCHF 1XX9A 1D3QB 1ZRBA 3EA9A 1HAIH 1ANBA 5F8TA 4KELA 2SNVA 2P8OB 1T8LA 3M5OA 1SQOA 1ZLRA 2ZNKH 1F5LA 4B76A 3ZZBA 2AIPA 3M7QA 1QZ8A 3HKIB 3GY3A 1GJ5H 3UNRA 1P0SH 1BCUH 5HXFA 5A0CA 1EZQA 3SJIA 1C5OH 4FU9A 2TPIZ 4NA9H 4WXIA 2KCAA 2VNTA 1GHAF 3RLWH 1CA0B 2TGDA 2A7HA 1V6DA 2GT7A 3A86A 1S6FA 1P01A 1SGEE 2Z9LA 3A82A 4NG9H 3MU5A 2Y7ZA 4CRBA 4GVUA 3M37A 2KCPA 5JBTA 1GBIA 2J34A 3S9AA 3MNSA 1WBGB 2RDEA 2NU1E 3LGYA 3Q3KA 1MBMA 3DFJA 2JIZD 4X1QU 1P9SA 3MNCA 5C3NA 4I8GA 4WH6A 1GVLA 3T62A 3UWIA 3ZZDA 2FS8A 4MLFB 1YCPK 1JIRA 2C8ZB 4ABGA 2FTLE 1K1IA 1K1NA 1VZQH 4I86A 3URCA 2BLQA 2L74A 3BN9A 5HIYA 2FLBH 2RDLA 5JBAS 1S6LA 1TB6H 1XVOA 2M5TA 4O3UA 1YPJH 1GJ8B 1QY6A 5GCHF 4LZ1H 2VIQA 4AGKA 2KX4A 3HGNA 4E7NA 1QIXB 3KQEA 1AHTH 4TSFD 3A7WA 1HGTH 1GJAB 4LK4A 2QXJA 1K1JA 1O5BB 1AUJA 2O8LA 4JZ1A 1GCTC 4ZKRU 1C5WB 2BD3A 2ZP0H 1ZR0A 2YOLA 1QB1A 4K1EA 3SN8A 1KXFA 3QDZB 2FDAA 2CMYA 3KCGH 4KTCA 4B6EA 1H9LB 1BBRK 1W2KH 5A0AE 4XBDA 5AFZH 2LP6A 2H5CA 3P17H 2BY7X 1UTMA 1O2PA 2K1QA 3O8BA 2XTTB 2GJGA 1V2JT 4Q63A 5TCCA 1P2OA 1IQNA 2W26A 3OSYA 1NU7B 2FWWA 1C5RA 3LT3A 5DO4H 4JZFH 1L4ZA 4BAOB 1DLEA 1AFEH 1SHYA 1W10U 4FU7A 1O34A 1WV7H 2BD7A 1N8OB 5SGAE 1KXDA 2AMPA 3T26A 1VJAU 2I6QA 4JK5A 1C2JA 1EAIA 2BX3A 2J94A 4XDEA 3RP2A 1C5UA 1OHHD 1UVPA 5TJXA 2LELA 1BMAA 4IW4E 4XD7D 2ZF0H 3LJJA 3SNEA 1DUAA 1RGQA 2WSSD 5DP8A 3LKWA 3PRDA 3BTDE 3V0XA 3RXEA 2VWOA 3M3TA 1J16A 3TK6A 4I8LA 2R9PA 4B73A 4SGAE 2W7SA 1TGTA 2PLXA 1SGYE 2V35A 2DE8A 3IITA 1SBWA 1GCDA 1HAVB 4OS7A 1ETTH 1AKSB 1K22H 1VCPA 1E1QD 3I77A 3H09A 3RXCA 1O30A 1CE5A 3LH3A 3CENA 1SGCA 1LVMA 1JOUB 1Y59T 1S6HA 1SGRE 3BV9B 1O2GH 1O2XA 3RXKA 1A1RA 4NA7A 5AFYH 2PUXB 2BVSH 1TOMH 1DY9A 3F2FA 3GCTF 3D23A 1D3TB 1IQEA 3TJUA 1GHZA 4WF8A 1C5MD 1L4DA 2Y6TA 2FMJA 3RXRA 4K3JA 4X1PU 5EGMA 2AYWA 1AIXH 1Y5AT 4AFUA 5C2ZA 5CHAB 5GDSH 2ALPA 4YO9A 1YLNA 5GIBA 1C1WH 1Z8JB 1FXYA 2GVFA 1BMMH 1O2SA 1Y3WA 2LNCA 1GVKB 1BHXB 1GBAA 2KCOA 1YWUA 2GDEH 1OWIA 1O38A 1O2RA 3DD2H 1DITH 3FZDA 4IC5A 4NIYA 3BEIB 4LZ4B 1FAKH 1QGFA 2P3TB 3H7TA 2QV1A 4IN1A 3RXIA 1VITF 1QJ1B 2NU3E 3BSQA 1IQGA 1E0FD 3MU8A 1RIWC 1EJMA 1FN6A 1P03A 4ZH8A 3UAIC 4BAQB 1GHVH 3PMBB 1LDTT 1RJXB 4DGJA 2EA3A 1O37A 4BXSA 1YPHE 1O5DH 3STIA 3TK9A 4X6NA 4B71A 4JK6A 1UCYE 1C1UH 3QN7A 1V2KT 1JRTA 2P93A 5E0JA 3P95A 1LKAA 1C2GA 2V0BA 2ZPQA 3ATWA 3BTKE 3M61U 4GCHF 1NY22 3VB3A 2VBCA 3S69A 3ZZ5A 3EGKH 3NKKA 3O8CA 5GPIB 1H9IE 4MNYA 1UW7A 3MH5A 1O3MA 3P6ZB 3B8JA 4OM9A 2WUBA 1MAXA 2LPRA 3VG8A 4ABFA 1DX5M 7LPRA 1MAYA 3PRBA 5JBCS 2FI5E 1AZ8A 4O3TA 1A0LA 1P3CA 1SG8B 1NC6A 1TQ7B 2HVYB 1YPMH 2FOAA 3L6PA 1D3DB 1QL8A 5DP6A 2GZ7A 1ELDE 3F9EA 1HUTH 1DE7H 1EUFA 1MZDA 1IQLA 4I8HA 4A92A 3BTFE 1W0KD 1YCPM 3GOVB 3FZZA 2BDHA 1B7XB 2Z94A 4MTBA 2PKAB 2GZ8A 1AFQC 2A4QA 3TGIE 2C3SA 1DXPA 2NU4E 3D62A 1MTSA 1P10A 5H4IB 1V2TT 1EB1H 1O39A 4YOIA 4WH8A 1NROH 1GL1A 4H6SB 3FP8E 2H1UA 2AGGX 2FYRA 1UJ1A 2F9PA 2YMSD 1CGHA 1XUGA 4Z0KA 3MO3A 5EXLA 2K0QA 1C5NH 1O3PB 1GJCB 2R3YA 3PV4A 1YPEH 4ZXXH 1O2NA 2UUFB 1AMHA 3GCNA 4RSPA 5JPMH 3M5MA 2BY9X 2AGIX 1YBWA 1O3BA 3K6ZA 3A7TA 3P92A 1MTVA 2FS9A 3K65B 1TALA 1ELAA 3DSPA 1UHBA 2CK3D 3ZZCA 1O3CA 8KME2 2OK5A 2BQ7B 1MKXH 4U30A 1BITA 1AU8A 2IJD1 1T8MA 2Z6BD 1BRAA 1P2JA 1T7CA 4DY7B 1TAWA 4BAMB 1IQIA 1WOFA 4TPYA 3TU7H 3UQVA 2QF3A 2A5KA 4BAHB 1EAUA 2QC2A 4CH8B 1KDQA 2F43B 4ZAEA 2BVRH 3LGWA 1W13U 1C2KA 1K9OE 1MCTA 2IOTA 1Y3YA 4B1TA 2PV9B 5FBIA 4A1VA 1JIMA 2HLDD 1TBRH 1VJ9U 2YNBA 1BJVA 4ZHLU 2A5IA 1P2NA 1ZYOA 4MNVA 2ZU1A 2GZ9A 3RXAA 1QBVH 1CGJE 2B0FA 5F8ZA 5EQQA 1QQ4A 4CHAC 2P94A 2V3HH 1EZUC 1C2DA 2XYAA 1GHAG 1XXFA 2ZECA 1GI0A 1AZZA 2WYGA 2FX4A 3TH2H 4R8TB 2BDBA 2M2AA 3ZZ8A 4FETA 5DKMA 3GISB 3KEEA 1SHHB 1TA6A 2GD4B 3RC6A 2BXUH 3L33A 4CBOA 3KQDA 1LO6A 1NS3A 1GHWH 1UVUH 3PTNA 3DSOA 4X8VH 2Y7XA 4NGAH 1T8NA 1WSSH 3Q3XA 1PQ5A 2CJIA 1S84A 1RTKA 1DWBH 1C1RA 1H8ED 3SJKA 3QTVH 3Q76A 3UQOA 1ELCA 4U01A 2AS9A 5JYIA 4UFDH 1HPGA 3CNRA 3TVJB 1C5PA 3SHAH 3ZZ7A 3KYGA 1T32A 3VXEH 2F4LA 1S0QA 2PGBB 3NZIA 2QGRA 1V2UT 2ZC9H 3SU5A 1OWKA 3DT0H 3ZV8A 3PM3A 2B9LA 4X8SH 5EG4A 1O5GH 1EXFA 1O3HA 1P11E 1TGNA 3TITA 1ZGVA 4MPXA 3TGJE 4K1TA 4IC6A 1VR1H 3MU0A 3MTYA 2J2UA 2TRMA 1BTHH 1GI8B 1IQJA 1YM0A 1DT2A 3MNXA 1CT4E 1MKWH 1O3OA 1TWXB 3RDZA 1IQKA 4MPWA 3SNAA 1HLTH 4B6FA 2FTMA 4H42U 2ZTXA 2FOGA 4IN2A 5EJ1A 5DP5A 2CF9H 1T31A 4DW2U 1SL3A 4Y0YE 3P70B 4AC9A 2V7QD 2XC4A 4Y8XA 4H6TA 1UTJA 1SGFG 3EDXB 2ZFTA 1ZSKA 1ID5H 1P2MA 1PPCE 4PROA 4XE4A 2VJ1A 2XBVA 1E38B 1EX3A 4AORA 2PHBA 1EOLA 1C1OA 3M7UA 2HNTF 3W94A 1GJ4H 1ESTA 1GI3A 3F3BA 3ODDA 5I25A 1IAUA 1TIOA 1C2FA 3M3SA 4UD9H 2STAE 1LHDH 2BD4A 3SO3A 3BG4B 2JJ1D 5E0HA 1HXEH 1LPGB 3E1XB 2A2XH 2BOKA 4BTTB 2KFWA 1HIAA 5HGGA 3PV5A 2SGFE 1LPKB 2ZHEH 4FUHA 2SGAA 4Y7AA 4WJG2 4B2BA 3SQEE 2H9HA 1G30B 2XBWA 2XW9A 1AY6H 5C0TA 1SB1H 4CBNA 5FPTA 2OC7A 2Z9GA 2IN2A 4JMYA 2FOFA 1PQ8A 3FN8A 3SW2B 4NWKA 5FL7D 5HYOA 1OP0A 3GCTG 3SOSA 5EJZA 3RXLA 1RIWB 1O2LA 1G2LA 3T25A 2Y81A 5T6FA 1BBRE 4D8NA 1GMDF 3F9GA 2QXHA 1W0JD 3A84A 3A80A 3MNBA 3OTPA 3MHWU 1WCZA 3MQKC 3PYHA 4Q4LA 2OQUA 3TJVA 2FLRH 3F9FA 1GBMA 2VIPA 1T8OA 2VVUA 3TNSA 3ZYEA 5DPAA 1A5IA 1QR3E 1AN1E 4AB8A 2PSYA 1A4WH 2WINI 1UMAH 1MTNC 3MU4A 4JYTA 1O5AB 4CRDA 1UTKA 1NRPH 1PFXC 1FONA 3B23B 5T1VA 1F0TA 1KLJH 2OINA 1WXRA 1SQRA 2ZPRA 1PPFE 1W0ZU 4HTCH 3RXOA 1MCVA 5IK2D 1F2SE 3Q77A 2VIOA 2JETC 1VITG 4AZ2B 1C2EA 2D8WA 2OBOA 4DG4A 1SFQB 5DSFA 4CRCA 1MKXK 1KXBA 4CRFA 3ATMA 6GCHG 1UHBB 4HGCA 1NRQH 3URDA 1DS2E 2WPMS 3K9XB 3BTME 1E37B 2ZDAH 1V2PT 2RG3A 4Z6AH 3HGPA 2QN5T 4FUEA 4IS5A 4YT6H 4ABAA 1THRH 2R2MB 3RMMH 3VGCC 3ZVCA 1ETSH 1YLDA 1WTGH 1AFQB 1ZHPA 2WUCA 4J1YA 2OC8A 2J4IA 4TT3D 2XC0A 1ANDA 4NCYA 3AW0A 1KXAA 1OWDA 1YPHC 1C5ZB 2Z3DA 1ABIH 1KDQB 2VH6A 1BT7A 1B0FA 1C4V2 1J15A 2Z7FE 4WWYA 1J8AA 2Z9JA 2Z9IA 1GJBB 2C90B 4Y7BA 3DA9B 1J14A 1ZPZA 2PKAA 3RXDA 3RXSA 3ZZ6A 1OYQA 2GCHF 4NWLA 4HI3A 2ZQ2A 1INCA 5FXLA 1EAWA 1W7GH 3LH1A 1SGQE 4M7GA 1F0UA 1QNJA 1BIOA 1C1QA 3SV2H 1BRBE 2O8UA 4K8YA 3PB1E 4ISLA 2IPQX 2XXLA 3A8CA 3FP7E 4FVDA 1ZTLA 5L30H 1MD7A 5F53A 3MYWA 1P06A 1XXDA 4K8BA 3A7VA 3RM2H 2A5AA 5EXNA 2EQNA 3S9CA 1V3XA 3SORA 2ZPSA 1AWHB 2FPZA 1NTPA 5GNDA 4MNWA 4Y8ZA 9LPRA 4K60A 2PSXA 1GJ7B 3I29A 4OS5A 1GBBA 1J17T 1E34B 4FUFA 3GICB 2ZFQH 3F0OA 3A83A 1FY4A 2H9EH 2VINA 4BTIB 3T5FH 3GY5A 4DJZB 5GJ4B 2ZQ1A 2OLGA 2SNWA 3RMOH 3WY8A 3VEQB 2AMDA 1C4Y2 3ZVAA 3A7XA 4X6OA 3AVZA 2UUKB 1LPZB 3E8LA 3MI4A 1KY9A 3SV7A 5L2YH 1QJ7B 1FI8A 2ANKH 1K0HA 2HGTH 1UTPA 5EOKA 2G5VA 1O2QA 1Z8IB 1Z8GA 4CHAB 2TGAA 3ATLA 4X0WU 4I32A 1O3LA 2EI7A 1EB2A 3LDXH 3TPIZ 1BHXF 2JH5D 3PROA 4IBLH 1CT0E 2J95A 3SI4H 1G3DA 5GWZA 4A1XA 4GUXA 1MKWK 1GBEA 4ZKSU 2D26C 1ACBE 3H5CB 1SQTA 1SKYE 4XRNA 3HK6B 2A45B 5LPRA 1TOCB 3SYJA 1ZGIA 2QCYA 1C5YB 1JXPA 3K6YA 3S7HB 3ZVBA 4AGJA 2PGQB 3OAAD 2IPHA 2XCNA 1E79D 1O5CB 1C5VA 1O2TA 2B7DH 3PV2A 4K69A 2WPHS 1NZQH 2BLVA 3LGVA 3R0FA 1N1LA 1H8HD 3WW7A 3VB7A 1QBOA 1E35B 1C1VH 1ZMNA 2GP9B 1KTTB 3RM0H 1FPCH 1V2QT 1A5GH 1F7ZA 4J2YB 2L6OA 4AYYB 3TJNA 3IG6B 1TMUH 1Z71A 1BJUA 4MVNA 1MD8A 1UTQA 4AX9H 5KGOA 3DFLA 1SLVB 1DSUA 2FOCA 1TE0A 2ZTYA 1HJ9A 1HIAB 3UTUH 1O5FH 1C1NA 5L2ZH 4FXGH 2AFQB 1NBME 1G36A 3ENSB 4SGBE 4A5TS 3PLKA 1DM4B 1VCQA 2OTVA 3F1SB 1Y8TA 1ELTA 2FOMB 1G3BA 4BAKB 2FIRH 1BTWA 3UNSA 5A0BA 1W12U 1XUKA 2AH4X 3QZRA 3BF6H 2BD2A 2GCTC 1TGCA 3FVFB 4Y76A 3N7OA 3SGQE 5LPEA 2SGDE 1NFYA 1PQ7A 2BDYA 1XKBC 1NU9A 3BTEE 1DSTA 2BDIA 3SU0A 4Y10E 3PWBA 5B6LA 1BUIA 4OGXA 4GSOA 2F9VA 4Q7YA 1LVOA 4MPVA 2PKSC 1SPJA 1BMLA 2Y5HA 1V2MT 1KLIH 1RRKA 1GI6A 1H9HE 4Y6DA 3U69H 2H5DA 1QTFA 2TGPZ 2YMSC 2EY4C 1BTYA 1IHSH 2KCYA 2OCVB 3U1JB 1AQ7A 1LQDB 5CDFE 4UFGH 1OX1A 5ABWA 1A61H 1Z1JA 5CHBA 5C94A 5A8YA 3KYFA 1LHFH 2BXTH 2ZHWH 1HAPH 1TYNA 3F9HA 4GLYA 1UTOA 3VB5A 1AD8H 1HYLA 2SGEE 2C8YB 2WHXA 4A6LA 2WPDD 4X6PA 2VVCA 1GG6C 4X8UH 1ZTJA 3SU4A 2ZDLA 2Y80A 1F5RA 3ZV9A 5IYTA 1UK2A 4AFSA 1AE5A 3U28C 3HK3B 1BMNH 1QL7A 2QAAA 1HXFH 1SGNE 1OKXA 3C1KA 2AIQA 1N6YA 1BB0B 4Y71A 4NIWA 3FKSD 3UREA 1MTNB 1GDQA 3SHCH 4XFQA 3SJ8A 3PMJA 3SNBA 7GCHF 1EATA 3PTBA 4D9RA 5E2PA 4WY3A 1Y5UT 1FPHH 1XUJA 1O2KA 1RFNA 3W1EA 1UVSH 4ZXYH 4CRAA 1KXCA 2A32A 4KTUA 3KHVA 3G01A 1C5XB 1W11U
chains in the Genus database with same CATH topology
1ORFA 2ZGXH 2JETB 3OY6U 3TJOA 1DWCH 1A3BH 3TIUA 1GBCA 1W7XH 2OD3B 1CT2E 3SI3H 1IQFA 4WMFA 1CGIE 3LU9B 1WYKA 2CXVA 1DLKB 1BRUP 4XSKU 3BEFB 2DE9A 3GY7A 2PUQH 2PFEA 1GMDG 2XBXA 1XMNB 3E90B 1MTUA 2F9UA 3P8GA 3OY5U 1L0ZA 3L3TA 5F6MA 1NRSH 4DIHH 2C93B 5EQSA 3T27A 1ZSLA 3VGCB 3BTTE 1AWFH 5C1XA 1S82A 4UFEH 2KAIA 4JYVH 4U32A 1SGIB 3ZZ9A 1C5TA 2ILNA 4UFFH 3RXBA 3U8OH 3GY8A 1C2IA 3RLYH 1O3EA 3RU4E 1CBWC 4WMDA 1P3EA 1O2JA 1O3JA 4ZROA 5PTPA 1O2MA 1MTWA 5HMAA 5A8XA 1C5LH 5JB8S 1ELEE 1X7AC 5C1UA 2PTNA 2FOBA 1ARBA 3QGNB 8GCHG 4K5ZA 1Q3XA 1G32B 1KYNA 1BTPA 2ZU5A 1NRRH 1PYTD 2ODQA 4NA8A 1TPAE 1QFKH 3UWJH 1Z6JH 4CR5A 3E3TA 1A46H 8ESTE 2ZTZA 3CS0A 2WYJA 2ZCLP 2F9NA 5A8ZA 3EAJA 5ESBA 4R0IA 1GCTB 1HAHH 1HAGE 3SUEA 3ZZAA 1Y3VA 2GCHG 4OS1A 4ZKOU 3F68H 5K0HA 2FO9A 1WU1A 3MFJA 1OXGA 3OX7U 1SC8U 4ASHA 4X6MA 1GI1A 3OU0A 2O9QA 3M5LA 1TMBH 1GDNA 6CHAC 2HALA 1O3AA 1Z8RA 2R0LA 3W95A 1FIZA 3RXMA 1Y5BT 1FY3A 1YCPH 1LVYA 3KL6A 1HDTH 3GYLB 5FHTA 1W8BH 2NWNA 3PLBA 2ODYB 4INHA 3TGKE 4X1SU 3H7OA 5GCHG 5ETXA 1GMCF 1ZJKA 1ZTKA 2BDAA 2ZEBA 5JBBS 3SZNA 4RKJB 3KQBA 1LTOA 3HPTB 1HBTH 4D7GA 1C1PA 5T6GA 3AW1A 2P59A 1OWEA 1CVWH 4ZHAA 2GTBA 3MO6A 1S85A 2ZFRH 3TNTA 2GKVE 2TIOA 1NRNH 1CQQA 1OOKB 4K1SA 4ABEA 4E7RG 1TBQH 2BQ6B 3QTOH 2G4UA 2HPQH 2BDGA 1BTZA 3UY9A 3SQHE 3LJOA 1HAXB 3S0NA 3LOXA 3LONA 5GXPA 2FI3E 4HZHA 2A7CA 5T6DA 3A8DA 1MMJN 1RXPA 1KSNA 1ELBA 4ZUHA 1C5SA 1DOJA 1P2KA 3UUZA 1A2CH 1SMFE 1P05A 3GCHC 3TH4H 1TNLA 1QL9A 1O3DA 1YYY1 3M5NA 4UDWH 2WPIS 2ASUB 2F9OA 4ISOA 2XBYA 3VPKA 1QB6A 3QK1A 2VVVA 1IQHA 1Z1IA 4BNRA 1RTLA 1NM6A 5AF9H 2J38A 2XWBI 1CHGA 1NFUA 1HAOH 1WQVH 3KGPA 2IJOB 2BD5A 1GBKA 4BANB 5AHGH 4YLUA 3S7KB 3VFEA 1JBUH 3M7TA 4FUJA 2HNTE 1T4VH 4Y0ZE 1YP9A 4UE7H 5TCAA 1GI5A 1RS0A 2BM2A 2FXRA 5J4SA 2GCTB 3E0PB 3QZQA 1TONA 1SLUB 2CN0H 3A85A 3MO9A 2D2DA 1O0DH 2GT8A 1C2MA 2BD9A 1BOQA 1PPZA 3E16B 4AOQA 1H8IH 1K28D 1BZXE 2OP9A 2W3KA 2A4OA 2QXIA 2BHGA 3CS7A 4NIVA 1BRCE 2FEQH 2ZGJA 4O97A 5FX5A 2AEIH 1TNIA 4FUGA 3ESTA 2ZG0H 1FDPA 2PKSB 3SBKA 3AAUA 2GMTC 4AYVB 3UIRA 3UOUA 1O2HA 4CREA 1O3KA 3V13A 4ISNA 5E0GA 1P2QA 2Q1JA 5T3HA 2YNAA 2AERH 3UR6A 1PJPA 5FAHA 1ARCA 1TGSZ 1T4UH 2JH0D 4AG2A 4ISIH 2GGVB 3A8BA 3TH3H 1ZOMA 1AB9C 2RA3A 4ABBA 1EOJA 2HLCA 3FP6E 3GDVA 2R3UA 1GBLA 1O33A 3RMLH 4I8KA 3F6UH 4MNXA 1YPKH 4IGDA 1ELGA 1ZJDA 1D3PB 3NK8A 2FODA 1GG6B 4FUDA 1H1BA 3SNCA 1YKTA 1SGFA 1BTUA 4X1NU 1W14U 1CHOF 1QHRB 1YPLH 2ZU4A 1ZPBA 3GCOA 1GBDA 3D65E 1DANH 2VWMA 4FUIA 3ODFA 4Y8YA 4B74A 1UVOA 3OTJE 4Q7ZA 2ALVA 4X2YA 3BG8A 1FY8E 2F9BH 2KAIB 1V2VT 1F92A 1HV7A 1OPHB 2BB4A 3RXQA 3RXUA 4X2VA 3RXFA 2SGPE 1CA8B 3LPRA 4X1RU 5EPNA 4RN6A 2GV6A 2FOHA 1XM1A 2ZFFH 1Z7KA 3MH6A 3EYDA 1SVPA 1WQSA 2VGCC 1FJSA 2O8TA 2CHAC 2B8OH 4GCHG 2GDDA 3O8RA 1SQAA 1DDJA 2O8MA 6LPRA 3FAOA 3UOPA 1L1NA 4XOJA 1GHBF 3SJ9A 3CP7A 1MZAA 1P09A 3U8TH 1V2ST 5HM2A 4VGCC 2UUYA 1IOEA 1TRYA 4IMQA 2AGEX 1A3EH 3VB6A 3RXGA 1EAXA 2CF8H 1QRZA 2Q6GA 1LKBA 4DIIH 2V6NA 1O3NA 2THFB 1PPEE 2SGQE 3MH4A 1QCPA 3KQCA 2G51A 1P57B 2A1DB 5L6NH 4WXVA 2W3IA 1EZSC 3V7TA 1U6QA 1O2UA 3JZ1B 7GCHG 3EQ0H 3RXHA 2BQWB 1GJDB 5J4QA 2FYQA 1V2NT 1FNIA 2ZFPH 3R3GB 4CH2B 1CBWB 5C67A 3UNQA 4X8TH 3PO1C 1C1MA 1XUFA 1IQMA 1YF4A 5EQRA 1C5QA 5FPSA 1ZSJA 4INLA 4YOGA 5EU8A 8LPRA 4RKOB 3B9FH 2OQ5A 3GDSA 1AVGH 2CV3A 5DP9A 5LPFA 1G2MA 1A0JA 5EW1H 2ZCKP 1O2ZA 3QWCH 2TGTA 1F0SA 2A31A 1GBTA 1D9IA 5FBEA 3RC4A 2HVXA 2BMGB 1G3EA 1GI2A 5F03A 1EP6A 1ELFA 3NCLA 4OS2A 1HFDA 2I6SA 3NXPA 3MWIU 4ESTE 3AAVA 2ZKSA 1O36A 1SGTA 4MPUA 4WVPE 1HJ8A 1DY8A 4DCDA 2ZU2A 1UO6A 2DUCA 2C4FH 3BTHE 1LMWB 2Q6FA 2ZGHA 5ESTE 4LOYH 2ZI2H 1WAYB 1KXEA 1SI5H 1O31A 1WUNH 3KF2A 2H9TH 4WMEA 2ZZUH 3PLPA 2SFAA 5HM9A 3SNDA 3VB4A 2V3OH 3QGJA 2BVXH 1DXWA 3I78A 5CE1A 1HJAC 6CHAB 2RA0A 2ANWA 2FX6A 4XBBA 2ZDKA 4U2WA 3SU3A 2D1JA 3V12A 5A2MH 1LHEH 2ZFSA 1VITH 4JZEH 1LQEA 3A87A 2WPKS 2STBE 3D49H 4OS4A 1P02A 3UPEA 1UCYH 1Q31A 5JB9S 4YT7H 3SUDA 1DICA 1UVTH 1PQAA 1SSXA 2PTCE 1W0YH 1CSOE 5G4BA 2HPPH 2FM2A 1GMHF 1G9IE 3DUXH 1TRMA 4ABDA 3V3MA 1ESAA 1SR5C 1TBZH 3U8RH 4I33A 1V2OT 2WV5A 1OSSA 1C2LA 1YGCH 3ZVFA 1CU1A 1HNEE 2A4RA 1G37A 2P16A 2H6MA 1XVMA 5IDKA 1GVZA 4ISHH 3QO6A 1NFWA 2ZA5A 2CGAA 1AUTC 2Y5FA 1DVAH 1D4PB 2G5NA 3LC5A 5I46H 2J92A 2BYAX 1Q2WA 3RXPA 3GCHB 1UTNA 4ABJA 1A0HB 2BY6X 4DT7B 1AE8H 1O2IA 2AMQA 1GMCG 1AO5A 1THSH 4KTSA 3NWUA 4KKDA 2QF0A 1C1SA 4MQAA 3RU4D 2FZZA 2OC0A 1QQUA 3BG4C 1OWJA 2VWLA 1O2VA 2ZIQH 2OXSA 1TABE 2BOHB 2BZAA 2Z3EA 3RUOA 3ATKA 2ZDVH 1XKAC 3M36A 4E05H 5C5NA 1MQ6A 2P3FH 1TPSA 3RMNH 1O2WA 4GHQA 2VIDA 4BTUB 5K7RA 2ZGCA 1RTFB 1KIGH 4I31A 4OS6A 2O8WA 3SU2A 2QXGA 1DWDH 2EI6A 1VGCC 4DURA 4B2CA 1FLEE 1NESE 5E2OA 1FN8A 4UEHH 4OGYA 1QURH 2PWXA 6GCHF 2P95A 2Y82A 3U98H 1K1LA 1QBNA 2GMTB 1OS8A 1QB9A 3M3VA 1ESBA 4K2YA 1GGDC 1EPTC 1OWHA 2OC1A 3FANA 1FV9A 3RXJA 3U9AH 1ELVA 5BPEA 2GV7A 2BDCA 3QX5H 1TPOA 1HRTH 1GJ6A 2ZDNA 1A5HA 4F49A 4Q7XA 4Y79A 1AB9B 3PMHB 2ESTE 4IMZA 5DJ7A 1GI4A 3SV6A 1BDAA 2J9NA 3GY2A 4ZKNU 4LXBH 5B6OA 4KP0A 1HCGA 3BTGE 1AI8H 1B0EA 1TRNA 3VXFH 1D6WA 1MH0A 1PYTC 3T2NA 1YLCA 1TA2A 1PPHE 1FMGA 2F91A 3A7YA 1N6XA 2BZ6H 3RC5A 1MU6B 2HNTC 3KIDU 1ETRH 4CR9A 1ZMLA 1NO9H 5BRRE 1WTHD 3SU6A 2P8OC 1VCWA 2B5TB 1ZPCA 1OP8A 4A1TA 2F83A 2EI8A 1FQ3A 5DG6A 1OP2A 1TNKA 4YM9A 1EPTA 1AVWA 2FI4E 7ESTE 1BQYA 3A8AA 4Q2KA 2ZDMA 1P8VC 1HAZB 4JZDH 3TLOA 1ZZZA 2XC5A 1BTXA 1EJAA 2XNIA 2VGCB 4TWWA 3ITIA 4NZLA 2CHAB 2HOBA 4QT8C 1CA0C 2G55A 3A88A 4FUCA 3RXVA 3LIWA 2GX4A 2VB0A 1EQ9A 1GHXH 1MU8B 3LGIA 3QUMP 2QYIA 1FY1A 1HAYB 2FP7B 3SGAE 2BLWA 1TNJA 4VGCB 1QA7A 1TX7A 3Q00A 3UR9A 4YZUA 5DGJA 1CHOG 5JDUB 1THPB 4TYDA 2ANMH 1EASA 2BY5X 2XWAA 3ELAH 2WPLS 3GY4A 4FU8A 4X2WA 2A4GA 1SFIA 3AASA 1NN6A 5DP4A 1K2I1 1L1JA 2ANYA 3C27B 1D6RA 4E06H 1GJ9B 2ZHQH 3E6PH 4NZQA 1TNHA 2EC9H 3M35A 4DOQA 1S81A 1TLDA 4D7FA 1V2WT 1UK4A 3RXTA 5C5OA 6ESTA 1SGPE 1GI7B 1K1MA 2W5EA 1K1PA 2ZCHP 5F8XA 5FPYA 4JYUH 2Z3CA 3SUGA 2ZU3A 5AVDA 3U1IB 4KGAA 3E91A 3PO1B 4I8JA 2A0QB 4B75A 1L1GA 1F0RA 1GHBG 3EA8A 4D76A 1EP5A 1K1OA 1XUHA 1H8DH 1GBFA 3GDUA 2H2ZA 1KTSB 4H4FA 1O5EH 1P04A 1Y3UA 4XBCA 2TBSA 2VIVA 5EXMA 1NT1A 1UK3A 5EW2H 1GBHA 4JCNA 1S0RA 3GYMA 1ZRKA 2R0KA 5LH8A 4NFFA 2A2QH 3OYPA 3Q3YA 1TFXA 2PR3A 1UCYK 3PMAB 5LGOA 1KLTA 2G52A 3ZYDA 4B2AA 1QA0A 3MOCA 4NIXA 2JH6D 2C8WB 4GHTA 1YPGH 1TX6A 3T28A 1K21H 1P2IA 1F5KU 2UWLA 1SLWB 4AG1A 1DUEA 1SOZA 2VU8E 3K2UA 1N8OC 1SOTA 1IHTH 4UONA 3PWCA 3SV8A 3O8DA 1QRWA 2R2WU 2WV4A 3MU1A 2G4TA 1TPPA 4NSVA 4YOJA 2NU2E 2BD8A 2ZHDA 3ZVDA 1NPMA 1EJNA 2W7UA 1G3CA 1MBQA 5CMXH 3KN2A 4NFEA 1MUEB 1C2HA 2QA9E 1ZHRA 1DWEH 3SUFA 2OBQA 1O3GA 1FAXA 1L2EA 2P3UB 1HJAB 5EPYA 5A09A 4TY7A 1P12E 1TX8A 4BXWA 1A7SA 1S83A 1TMTH 3LGTA 4Q80A 4FUBA 2VWNA 3A7ZA 1GBJA 4O03A 3DHKH 1ANCA 1BBRH 2FESH 2UWPA 1AVXA 1UTLM 3HKJB 5DK1A 2NU0E 1O35A 4BOHA 2WPJS 4GPGA 3STJA 1LHCH 1QJ6B 5FX6A 1DPOA 1SGDE 3ZVGA 1FIWA 1FZZA 4TPIZ 1EZXC 1C9TA 4AFZA 2Y5GA 3SU1A 1NFXA 2XCFA 3NPSA 3NUMA 4GAWA 3BTWE 5CHAC 1W3CA 1YC0A 2UUJB 1TNGA 3ZVEA 1EKBB 3TK5A 1JMOH 3S9BA 1C4U2 2ZGBH 5FCRA 1S5SA 1V2RT 1GHYH 2XRCA 3EE0B 3LC3A 4X2XA 4INKA 4AFQA 5C20A 2RCEA 1OYTH 4AN7A 1HAVA 3GY6A 1JRSA 4I7YH 2BX4A 2Z9KA 4JZIA 3A89A 1LHGH 4YTAA 1E36B 1AKSA 1O3FA 4TWYA 5DP3A 3P8FA 4MG3A 2BY8X 1GL0E 1O2OA 1DFPA 2BTCE 3UFAA 4F4OC 2FOEA 1GMHG 3LGUA 1TQ0B 4ZMAH 2OUAA 4YLQH 4TY6A 2QY0B 1GWAA 2BLOA 4HFPB 3KNXA 3MH7A 2HWLB 1SLXB 1ZMJA 2QIQA 5FCKA 9ESTA 1CO7E 3SGBE 2JKHA 3QLPH 3HATH 3BIVH 1PPBH 1MQ5A 4A7IB 1O2YA 1FUJA 3IWMA 1J9CH 1ANEA 4CRGA 1PPGE 1VGCB 1V2LT 1JWTA 2EEKA 2ZO3H 4Y11E 1Z6EA 2ODPA 1M9UA 1C9PA 5C1YA 3BTQE 1C1TA 4FVBA 2G8TA 4YESB 5EODA 5DP7A 1LCYA 1O32A 1GGDB 1EPTB 1AGJA 3BEUA 3ATIA 1GDUA 1Y3XA 2C8XB 1ZHMA 7KMEH 2A7JA 2VH0A 4MDSA 3RU4T 2VIWA 2UWOA 1GPZA 3FFGA 3T29A 2G00A 4O9VA 5E8EH 3SJOA 1TGBA 2PW8H 3E0NB 3A81A 1QRXA 2ULLA 1B5GH 3BIUH 2HRVA 1H4WA 1O3IA 1ABJH 2ZHFH 3ZZ3A 4THNH 1P9UA 4NSYA 3SV9A 3JZ2B 1GI9B 2F3CE 3EA7A 1XUIA 1HB0B 1BA8B 3ZZ4A 4ABHA 1RD3B 4D9QA 1FY5A 3MMGA 4DVAU 2ZWLH 2Q6D