2KAIA

Refined 2.5 angstroms x-ray crystal structure of the complex formed by porcine kallikrein a and the bovine pancreatic trypsin inhibitor. crystallization, patterson search, structure determination, refinement, structure and comparison with its components and with the bovine trypsin-pancreatic trypsin inhibitor complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
80
structure length
80
Chain Sequence
b'IIGGRECEKNSHPWQVAIYHYSSFQCGGVLVNPKWVLTAAHCKNDNYEVWLGRHNLFENENTAQFFGVTADFPHPGFNLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KALLIKREIN A
publication title Refined 2.5 A X-ray crystal structure of the complex formed by porcine kallikrein A and the bovine pancreatic trypsin inhibitor. Crystallization, Patterson search, structure determination, refinement, structure and comparison with its components and with the bovine trypsin-pancreatic trypsin inhibitor complex
pubmed doi rcsb
source organism Sus scrofa
molecule tags Complex (proteinase-inhibitor)
total genus 10
structure length 80
sequence length 80
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 1984-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2kaiA00
2JETB 2V3HH 1C4V2 1WTGH 1PPHE 1DM4B 3MU4A 1O2JA 3LGVA 2GV6A 2JH5D 2UUFB 1IHSH 1O36A 3ZZ6A 1SSXA 3BN9A 5HXFA 2WV5A 1V2MT 1K2I1 1L4ZA 2SGPE 4YZUA 3SJ8A 1AE5A 4X6OA 1OYTH 2FP7B 2BLVA 1P02A 2EEKA 1P2OA 1L1NA 4XOJA 1UK2A 1FNIA 2O8UA 1C2DA 4ESTE 4HGCA 1TMBH 3M61U 2AGIX 3SV9A 1NS3A 4J1YA 2PWXA 1S6HA 1SGYE 2VVUA 4NZQA 3RC4A 4CHAB 3F6UH 3RLYH 1WQVH 4E7RG 4O3UA 1SL3A 3UTUH 2ZDLA 3O8DA 1FXYA 2BD5A 3RMNH 1XM1A 1P2QA 1HAXB 1ELAA 4OS7A 4A1TA 1FN8A 1VCWA 2SFAA 1O2XA 3BIUH 1DWBH 4XBDA 2AERH 4XBBA 2OINA 1GJBB 3TLOA 1J14A 1NFXA 2BDHA 1INCA 3AAVA 1TBZH 4YESB 4JK6A 1GCTC 4AFQA 1AHTH 2FOCA 2NWNA 5LH8A 4CBOA 3GY4A 1G30B 3S9AA 2ZGBH 1ZTJA 1SGIB 3K65B 1TPOA 2R2MB 3BEIB 3B8JA 5JBAS 2UWLA 2C8WB 1EZUC 1DLKB 1C9TA 1HPGA 1GJCB 1DSUA 1T4VH 1HNEE 3GISB 4INLA 1PJPA 2UWPA 6ESTA 1FY4A 3EE0B 4CRDA 4FUBA 2WPIS 4ABBA 2ZGXH 3HGPA 3RMOH 1GBEA 3RXTA 5E2PA 1FPCH 1DY9A 2VGCC 4WF8A 3QN7A 4Y0YE 2Q6DA 5EW2H 4GSOA 1HUTH 3U9AH 3B23B 4OS4A 1D3QB 3VB3A 3IWMA 4TY7A 3QX5H 1LDTT 1V2TT 5GIBA 2PV9B 3OY6U 2A2XH 2BY8X 2SGEE 1QRWA 1ELVA 3BSQA 3UNQA 3RXUA 1BRCE 1Q3XA 3MU0A 5FAHA 1KXCA 1P09A 2J38A 1SQTA 1DOJA 4DCDA 1IQIA 3SJIA 1NROH 4E05H 2ZP0H 2BDYA 1TAWA 4X2XA 1GJDB 1G37A 5EQQA 3M7QA 2A32A 2HOBA 3A80A 1EP5A 5EOKA 1DITH 2BLQA 3FP6E 2ODQA 1A3BH 1SQOA 1EJNA 2GV7A 5DO4H 1UVUH 3NXPA 4U01A 5GDSH 1G3BA 2EA3A 4YOJA 1QQUA 1GDNA 3UR6A 4LK4A 4A1XA 1J15A 1TX8A 5A0CA 5DJ7A 2Z9JA 4IC6A 1BZXE 2PGQB 1W0YH 2FWWA 1M9UA 3RXEA 2IN2A 3KF2A 3OX7U 3LGIA 5H4IB 1DPOA 1MUEB 2CMYA 1QBVH 2Q1JA 3OTJE 2ZDMA 4BANB 5EPNA 1TRMA 1GBIA 2C8ZB 1QB9A 1OXGA 5EG4A 2AH4X 4U30A 2AMQA 1G9IE 1S83A 1FY8E 3GCHC 4CBNA 1J9CH 2G81E 1UCYE 1H9LB 3PMHB 1C5NH 4TWWA 1NRQH 1MQ6A 3FP8E 2O9QA 3A88A 1Y3UA 4FUJA 1FY1A 5J4SA 1QJ6B 5GWZA 2BZ6H 1NRSH 2FXRA 2P93A 2XCFA 4NA7A 4JZ1A 1O3LA 1MTNB 1S0RA 1Y3YA 1ELDE 3A7VA 1QB6A 1PYTD 1EAIA 1D3PB 2A45B 1EUFA 1MTWA 1WSSH 4X0WU 3SGAE 1ZSLA 4X8UH 4BTIB 1O3GA 3D49H 3EDXB 4Y7AA 2P94A 4ISLA 1WV7H 3KHVA 4YLUA 3CP7A 4NCYA 4B2AA 1ZPCA 1WOFA 1MCVA 2FI4E 4NIXA 1BMAA 2WYJA 2ZHDA 2TIOA 5FBIA 3QO6A 1Z1IA 2ZWLH 1WUNH 4AG1A 4BXSA 1VITF 5A8ZA 2A4QA 3E0NB 4JZIA 1A0HB 1GG6C 1DXPA 1HAPH 3HATH 2H9HA 3OU0A 3VB4A 2FOAA 2C3SA 1GJ5H 2BVSH 1C5TA 2Y5FA 3PWCA 1A5HA 1TRYA 1YC0A 5E2OA 4ABEA 2HNTC 4YTAA 1O3HA 2LNCA 3SJ9A 6LPRA 5ABWA 1W14U 1AZ8A 2W7UA 2ZNKH 1F2SE 1XKBC 3RC6A 1GMDG 1IOEA 1BMNH 3TK6A 1LKBA 1A3EH 3MU5A 3RXCA 2PGBB 2ZDNA 3GCTG 4XDEA 3RXBA 2BQWB 3VB5A 3GY5A 5L6NH 1GMHG 3F9GA 1O3MA 1UTPA 3GCNA 2Z94A 1VZQH 4K5ZA 1W10U 1SGPE 2SNWA 3PB1E 1Y3VA 2C93B 2IPHA 1W0ZU 4JYVH 5JB8S 5C20A 1T8OA 3FANA 3ZZAA 2WV4A 3AW0A 2J4IA 1P03A 2RDLA 3TNTA 2K1QA 1V2WT 2BD7A 3FP7E 7LPRA 7GCHF 2BXUH 1C2HA 1Y59T 1C5UA 2A7CA 2FX6A 1K9OE 3E6PH 1O32A 1P8VC 1H9IE 3RU4T 3A89A 1OWJA 1AO5A 1YPEH 1PPEE 3ZZ5A 1GL1A 3GICB 2OCVB 1GHAG 5DP4A 2BY7X 4JZEH 1SC8U 3TJNA 1LKAA 5L2YH 1QIXB 4SGBE 1SLWB 2Y82A 4MNYA 1SR5C 2A5KA 2Y6TA 3BG4C 1GMCG 2ULLA 1H8DH 3VGCC 1AQ7A 4ABJA 4LOYH 5JBBS 4BAQB 1BTUA 1V2JT 2F9VA 3PTNA 1PYTC 1BBRK 3QGJA 2VIOA 4JK5A 4YOGA 2ZDVH 2WPMS 1GPZA 1MBQA 1D3TB 1TBQH 2FLBH 3RU4D 3PO1B 2R2WU 5EXNA 3SUFA 2M5TA 4Y71A 1KXBA 3TH2H 1ELEE 4KP0A 1TA2A 1GVKB 4DIIH 1KIGH 1C1NA 3BTFE 1YPJH 1AVWA 1HAIH 2THFB 3RM2H 1O3AA 3W94A 2Y7ZA 3MH7A 1GJAB 4IGDA 2O8MA 1GBLA 1GBMA 1G3DA 2C8XB 4TYDA 5C5NA 3ZV8A 1QR3E 1Z6EA 5A0BA 1GI3A 2PTNA 2VWOA 5ESBA 3LU9B 2Y5HA 1EZSC 4AFSA 3DA9B 2FIRH 4AYYB 2VB0A 3S7KB 2HALA 4Y79A 2TGDA 1GHZA 1TA6A 4Q80A 4ZXXH 1TFXA 3HKJB 2DE8A 1XUFA 4IBLH 3OY5U 1GBBA 1V6DA 1NRRH 2PFEA 3F1SB 4XFQA 2UWOA 4FUDA 3E91A 2BOHB 1HJ8A 1C2KA 9LPRA 1LPZB 2FZZA 2R0LA 1O3OA 1QFKH 1TGSZ 1GJ8B 2OBQA 1OWIA 4XBCA 3PM3A 1C1SA 1W8BH 2QXJA 7ESTE 3MMGA 4IN1A 2CHAC 1GHXH 2V35A 1BITA 2A4OA 1MZAA 3ATLA 3ODDA 1FY3A 1TNKA 1NT1A 4O03A 1O2ZA 5TCAA 3GYMA 1QBNA 1A61H 4OS2A 4YO9A 2GDDA 3LGTA 1AUJA 4KELA 4I31A 1FAXA 1MTUA 1GBCA 2WPLS 3D65E 3LC3A 2ZDAH 1NZQH 1T8MA 2ZF0H 3JZ1B 1ARBA 1C5XB 1G36A 1RJXB 1BA8B 1G3EA 2H9TH 1T7CA 1FV9A 2QV1A 4RKJB 3H7OA 1BRAA 1O2LA 2ZA5A 4INHA 3ZYEA 1TLDA 4R8TB 4B74A 2P3UB 5F8XA 1L0ZA 1ZTLA 1S85A 3F9FA 1AUTC 2O8TA 1YF4A 4IC5A 1P10A 2C90B 2W3KA 1RTFB 3UQOA 1V2ST 1ZGVA 3MNCA 2VIVA 3BEFB 2TGTA 1AWHB 5T3HA 5TCCA 3TIUA 4ABAA 1MBMA 1Y3XA 1ZSKA 2R3UA 2EI6A 5K0HA 1MKWH 3C27B 1JXPA 1AY6H 1NRPH 1TE0A 2XBXA 4H42U 3PTBA 1S0QA 1LHEH 5EW1H 1C9PA 4SGAE 1P57B 4BTUB 4FUGA 3FZZA 3GY8A 4TWYA 2AFQB 5HM9A 5FPSA 2Z9LA 1SOZA 1G2MA 3E90B 1C1RA 1YLCA 3ESTA 3TGJE 2J94A 1AB9C 2P16A 2OD3B 2EC9H 4H4FA 5FCKA 2J9NA 3V3MA 1FZZA 2XYAA 1ELFA 1CT4E 1CA0C 4AGKA 1VITH 2Y81A 3FAOA 4MTBA 5FBEA 5FPYA 2VNTA 1H9HE 2BOKA 1K1OA 3LT3A 1FIWA 1TRNA 3QTVH 1OX1A 1V3XA 2WPKS 1ESAA 1AU8A 4ZKRU 1AIXH 2ZHQH 1GBDA 2FX4A 2XBYA 3E1XB 3RXRA 2A5AA 4U32A 4UEHH 1ELGA 2H2ZA 1AVXA 1CT2E 2H9EH 1BIOA 1NM6A 2RCEA 1GGDB 3VPKA 4KTSA 5JDUB 1KYNA 1LHGH 3MFJA 5C5OA 3FFGA 2XW9A 2FS9A 1IQLA 1RRKA 3LIWA 3STJA 1MKXK 1W12U 4B71A 4GPGA 1BTWA 2OC7A 1EOLA 1UCYK 4CHAC 1UK3A 1HCGA 2FOGA 2PSXA 3L33A 4LZ1H 1P2NA 1XXDA 3T27A 1Z8RA 3E8LA 2BLWA 3LKWA 1GHBG 3RC5A 1B0EA 4Y8YA 1HJ9A 1HJAB 1MU6B 1P05A 1LVYA 2HNTE 1DS2E 1PQ5A 2OUAA 1DUEA 2SGAA 3SU5A 5JYIA 1YPKH 3RXMA 3TK9A 5ETXA 1SVPA 5GXPA 1NFUA 1BTHH 4FXGH 1L1JA 1XUKA 3ELAH 4X1QU 1AFQC 3RM0H 1UVTH 1WAYB 3KEEA 4INKA 1KTTB 1O3EA 3KQCA 1WTHD 3T5FH 1GBFA 2BDCA 2BZAA 3FZDA 2G51A 1O2NA 2P3TB 2NU0E 2QXGA 2FTLE 1HAYB 4B2CA 3DFLA 3KNXA 5HGGA 2GD4B 2B5TB 3U69H 3IITA 2STBE 4BAKB 1GBTA 1V2UT 4FUCA 1XVMA 1KTSB 1W11U 1JRTA 1NTPA 1SOTA 1YP9A 3SU2A 8KME2 3PYHA 3UR9A 5SGAE 4CREA 2A5IA 3BTTE 4O3TA 3TK5A 1IQGA 5T6FA 4CRCA 1S84A 1MH0A 3SNCA 3ITIA 3RXSA 1F7ZA 2CF8H 3F9EA 4ZKNU 1RIWB 1CA8B 1A1RA 1FY5A 1QQ4A 1FJSA 4K1EA 1OWEA 1A5GH 2A4RA 1EB1H 1YPMH 1EB2A 4DURA 3SOSA 4D8NA 3W95A 1Z1JA 3P8FA 2AIQA 3UWJH 1OKXA 5B6OA 1BJVA 1KXAA 4YOIA 5IYTA 2FOFA 3STIA 3GDUA 1A4WH 2AMPA 2FOBA 4B76A 1AKSB 1AKSA 1SFIA 2XWBI 3CS7A 3ZZDA 2PHBA 1F0UA 2Z3EA 1SGFG 1BHXB 5J4QA 3TJVA 1T32A 2A31A 1DUAA 5EXMA 1O37A 2ZCLP 3U1IB 4UFEH 2BD3A 1BTZA 1XX9A 1B5GH 1GL0E 2QYIA 4X2VA 1ELTA 1JRSA 3VXEH 1O2MA 2QIQA 4B73A 1EOJA 2DE9A 1A2CH 2WINI 1GBHA 4K1SA 1GVZA 2G4TA 3QZQA 1JOUB 1SLXB 3ZVBA 2NU3E 3MU1A 1DVAH 2FOEA 4AORA 1F0SA 3SU1A 2ASUB 3LJOA 1ABIH 3A7YA 2Z9IA 3B9FH 1G32B 2R3YA 2RA3A 5AF9H 1GJ7B 3A7XA 4AX9H 1O5BB 1DXWA 2G52A 3M3TA 1LHCH 4WJG2 2ODPA 2Z6BD 4UONA 1G2LA 1GJ9B 1TALA 3ZZ3A 2QGRA 1GCTB 3RXOA 1EKBB 1ID5H 1YKTA 5EGMA 3H7TA 3A8BA 3GY3A 1GHVH 4F49A 1N8OC 1C4Y2 3GY7A 3KQBA 3EQ0H 4CH8B 4FUIA 2NU2E 4Y0ZE 4AFZA 2F91A 2F9BH 3SGQE 3TH3H 3EA7A 4IMZA 2VH0A 2P3FH 2C8YB 3QLPH 2JKHA 1W2KH 1S6FA 1GBKA 1EPTB 1EPTA 1ORFA 3LOXA 4FU9A 2QAAA 1LHFH 1EQ9A 2VGCB 3MHWU 1CE5A 1SGDE 3NKKA 4ASHA 2GCHG 2Z7FE 1OYQA 3UOUA 5C1XA 3I78A 2A1DB 2ZKSA 1V2PT 1EZQA 2FODA 4I7YH 4DY7B 3LGYA 1C5SA 1WQSA 5C67A 4NFEA 1ETSH 3P70B 1QB1A 2F9PA 3P92A 3UY9A 3U8TH 1UHBB 1UHBA 2H1UA 2XBVA 1PPCE 3PMJA 2ANKH 3NCLA 1CQQA 1AGJA 2AGEX 3RXLA 3TPIZ 1C5YB 3P8GA 2D8WA 2BY6X 5GCHG 4DG4A 4AB8A 1SPJA 3S9CA 1DICA 4X6NA 1FAKH 2GZ8A 1LMWB 3BIVH 1PPBH 1W7XH 3NZIA 1E35B 1NO9H 6GCHG 1T8NA 4OGXA 3MWIU 1C5LH 2AIPA 4X6PA 1QL9A 4UFGH 2OTVA 3UREA 1WBGB 1IQJA 2ZIQH 4O97A 1ETRH 4LZ4B 3A86A 1LCYA 1V2KT 2BM2A 2QF3A 3H5CB 1P0SH 2WUCA 1EX3A 2F3CE 3P6ZB 1Z7KA 2Y7XA 1X7AC 1ZYOA 4Y7BA 1PQAA 3RXDA 1BUIA 4I8KA 5DP6A 2F9NA 4WMFA 2Q6FA 1ZMLA 4X1RU 3GCHB 4ZROA 4K8YA 6CHAC 1K1IA 3ATMA 2OBOA 1B7XB 1D6WA 1QGFA 5HM2A 2OC0A 1NRNH 1UTJA 2B0FA 1LVMA 3M36A 4J2YB 2G4UA 3M5LA 1LPGB 4Y6DA 4E06H 3SW2B 3K6ZA 4BAMB 4DGJA 1O2GH 2GVFA 3RXIA 2BD2A 3ZVGA 1SGTA 4ZKSU 2XBWA 2ZHFH 1K1JA 2FO9A 5LGOA 2FEQH 4AOQA 2GKVE 2QXIA 2ZHWH 1C2FA 1KLIH 3AVZA 2BYAX 1UTQA 4QT8C 4BXWA 1ABJH 2BD8A 5JBTA 1P9SA 3PO1C 2BVRH 1BDAA 4X8TH 2FS8A 2PKSC 1UVPA 1Y5UT 3PROA 1LPKB 4K3JA 3A8AA 1BHXF 2EI8A 4RKOB 1RXPA 2ANWA 1GWAA 3RXVA 4K60A 2XC5A 1GG6B 1TGNA 1VGCB 1YCPM 2BX3A 1QNJA 5C1YA 5A2MH 1DWEH 2BTCE 4I8JA 5LPEA 1SLVB 4Z6AH 2J2UA 1GI6A 1HIAA 1HIAB 4PROA 1C5MD 3A81A 4OS1A 4R0IA 1GI8B 1GI0A 1TOMH 4YT7H 1O38A 1K1LA 3HKIB 5FX5A 3KQDA 1NU7B 2NU1E 3QUMP 1O5CB 2F9UA 2DUCA 1W7GH 2TPIZ 3RXAA 2HPPH 1OWHA 1YGCH 4JMYA 3R0FA 1PFXC 3HPTB 1EZXC 1TMTH 2JH6D 4CRGA 4O9VA 3ZZCA 3A8CA 2XTTB 3BF6H 1YYY1 1ESTA 3UFAA 4Y76A 5BRRE 3S0NA 2ZGJA 1LQDB 1L1GA 2A2QH 1IQFA 4B1TA 2IOTA 3A82A 4HI3A 1IAUA 1RFNA 4GCHG 4LXBH 3MI4A 2VWNA 1MMJN 2D2DA 3MH5A 1TOCB 2PSYA 1YBWA 4CRFA 1VJAU 5E0HA 2ZU3A 1N6XA 1GHWH 2ZU5A 5DP9A 1YPHE 2VVCA 1G3CA 2HVXA 3M5MA 2ODYB 1MTVA 4D7GA 5EODA 4ABFA 1P06A 3KGPA 3VXFH 3V12A 3A8DA 1HFDA 2ESTE 2RA0A 1WYKA 4NSVA 3MTYA 4E7NA 1HDTH 1E38B 2XWAA 1KXDA 2ZCHP 2ZG0H 3BG4B 2BDIA 1NFYA 2O8LA 3EAJA 2W5EA 3VGCB 5I25A 1TIOA 1TGBA 4Q7YA 2ANMH 4JZDH 3O8RA 2ZZUH 3SNBA 1O2TA 2J95A 3URDA 4ABGA 4DVAU 4NIVA 1C5WB 1GMDF 4X6MA 4KTCA 1MQ5A 5TJXA 2TGAA 1THPB 4WMEA 4K2YA 3ZYDA 1ZR0A 3GCTF 1NPMA 3LGWA 5HYOA 3ZV9A 1GMHF 1O5EH 1ZZZA 1TPAE 2KAIB 2KAIA 2VIQA 1DDJA 3S69A 3LDXH 1KXEA 2G8TA 4FU8A 1RD3B 4A92A 2XRCA 3RXFA 2HPQH 4MLFB 3BTWE 1S81A 3URCA 1EASA 1ETTH 5A8YA 2ZCKP 1GI9B 3TJOA 1QJ1B 2QF0A 1K1MA 1ZLRA 4MDSA 1BOQA 1CBWB 1UMAH 2HWLB 3TH4H 1P3EA 4B75A 4H6SB 3V7TA 1O2HA 1JMOH 3OSYA 5EXLA 4BAOB 3MOCA 1MD8A 2OQ5A 2PW8H 2TRMA 2A7JA 1K28D 1NN6A 5DPAA 3LJJA 1GCDA 3NK8A 1QL7A 3AW1A 1GHAF 4WH6A 3SI3H 1RGQA 4NWKA 2ZQ1A 3KL6A 2A4GA 2ZPSA 2ZPQA 3G01A 4K8BA 3RMLH 5C1UA 5L30H 1CVWH 2CF9H 3SHCH 1ZTKA 4WY3A 5I46H 2GCTB 1GMCF 1AI8H 3RXGA 3UNRA 1C5RA 3SQHE 1SMFE 3SV7A 1P2IA 4A1VA 1CHOF 4D9RA 3RXKA 3JZ2B 1P04A 3UOPA 4AFUA 5FXLA 3HK6B 2HLCA 2CHAB 5DP8A 5T6DA 1XUGA 4UFDH 1O33A 1EAWA 4Z0KA 3U8OH 2ZQ2A 3PMBB 1C5PA 3BTME 2QN5T 2FMJA 2BQ6B 3O8BA 1J16A 4UD9H 3TJUA 3A7TA 1ANBA 1HB0B 4KKDA 4U2WA 3SNAA 4D76A 1AFEH 4I8HA 1A5IA 2ZO3H 3M35A 1UO6A 1D6RA 1Y5AT 2W3IA 1O3NA 4B2BA 2H5CA 3RXJA 2WPHS 2W7SA 2P8OC 1ZHPA 1MZDA 2NU4E 1C5ZB 1AE8H 1DWDH 2P59A 1V2NT 1U6QA 2HGTH 4MPUA 1BQYA 3DHKH 1O3IA 3U98H 1CGJE 1J8AA 1TNJA 2UUJB 1TNLA 2AEIH 1H8IH 2JETC 2Z3DA 3MNXA 2GTBA 4D9QA 2Z3CA 1DE7H 1FDPA 2AS9A 2VJ1A 3GY2A 4TPIZ 3TGIE 2VIDA 1GBJA 4GHQA 3KQEA 1W13U 4UE7H 3U8RH 2QA9E 1VCQA 1C1PA 3DFJA 5CHAB 3SU0A 5CMXH 1C5QA 3OYPA 1S5SA 2GDEH 2UUYA 2TGPZ 1BTYA 1UTKA 4Y10E 4ZAEA 1E36B 4VGCB 1D4PB 1FUJA 1ZRBA 3ZVAA 4NGAH 1S82A 1YCPH 1GI7B 2VIWA 2PKAA 1PPZA 2PKAB 3P8OA 4YT6H 2W26A 3EYDA 1MCTA 3RXPA 2ZECA 2R9PA 1CGIE 3RP2A 1BT7A 1YLDA 2D1JA 4A6LA 4Q7ZA 1GJ6A 3MO9A 2QC2A 1QA0A 2AMDA 1HXFH 4ZKOU 1Z8IB 8LPRA 1ZGIA 1SBWA 5A8XA 3QDZB 1DX5M 1UTOA 2H5DA 3SV6A 1AB9B 1LVBA 2GMTB 2A0QB 1QY6A 1ZHRA 1Z71A 2PUXB 2VWLA 1WCZA 1O2QA 1QRZA 2CGAA 1XKAC 5F6MA 3TNSA 5FCRA 1O2IA 1CA0B 3F9HA 3SV8A 4DJZB 2SGDE 4MG3A 5CE1A 2PR3A 4FVDA 4TY6A 4JCNA 1MAXA 4MPXA 4NA9H 2VU8E 1TNGA 4ZXYH 4DIHH 2C4FH 3SUEA 2BXTH 1C5VA 5DG6A 8ESTE 1V2LT 2OQUA 1O39A 2P95A 3DUXH 1QURH 1PQ7A 4ISHH 1TONA 1JIMA 1TQ7B 5FHTA 3Q76A 2BD9A 4ISOA 3EA9A 1QCPA 3T62A 1O2VA 1SGFA 2BX4A 3SORA 4IMQA 1F5KU 3A83A 4CR9A 4WH8A 1E34B 1YPHC 1GI5A 3NWUA 1GI4A 3MH6A 4HFPB 4XE4A 3ZVEA 5E0GA 1MKWK 1ESBA 4MPWA 1ZMNA 3AAUA 4JZFH 4ABHA 1ACBE 3SU4A 1EJMA 3M3SA 8GCHF 4GAWA 2ANYA 1GDUA 1IQMA 4IN2A 4ZMAH 1CSOE 2LPRA 3MU8A 3Q77A 1C1UH 1GJ4H 4Y8XA 1T31A 1C2GA 1C2JA 1A7SA 2D26C 3SN8A 1Q31A 1DLEA 4UFFH 1Z8JB 3MO6A 1SQAA 1TYNA 4WXIA 1LTOA 4GUXA 2EI7A 1F0RA 4I8GA 3GDVA 2I6QA 3CENA 1Y3WA 3LC5A 1O3JA 2ZDKA 1BTXA 1AFQB 1TX6A 4BOHA 2BB4A 3BV9B 3LH3A 1VITG 2ALPA 4RN6A 3ATIA 3LH1A 3UWIA 2QXHA 4CH2B 3M7TA 3FVFB 3DD2H 1EP6A 1SG8B 1GI1A 4THNH 1BMLA 1NFWA 1L2EA 2OP9A 1QBOA 1P2MA 4IS5A 3T25A 3ZVCA 1EPTC 4NSYA 2XCNA 1O3PB 1SGCA 3F68H 3E16B 1K1PA 1BRUP 1ANEA 1F0TA 1O2WA 1V2RT 5DK1A 3T26A 1GBAA 1PPFE 4MNXA 4MQAA 2ZTZA 4X2YA 1C2IA 2I6SA 4JYUH 2V0BA 1O2YA 5T6GA 1TPPA 4X1SU 2VWMA 1P9UA 2UUKB 3ZZ8A 1E0FD 1ZMJA 1MTNC 1O2SA 1EAXA 1YCPK 3A7ZA 1SGQE 2OC1A 5F8TA 3RUOA 3BTHE 1EATA 1SI5H 1GHBF 4JYTA 2XNIA 1V2QT 5JPMH 1O0DH 2ZHEH 1A46H 2ZGHA 4H6TA 3BTQE 4I33A 5A0AE 3BG8A 3MH4A 4FUHA 3CS0A 2B9LA 3UIRA 7GCHG 1QTFA 4MPVA 1YM0A 1ANCA 4I32A 1Y5BT 4AGJA 2OC8A 4HTCH 3KN2A 5FX6A 2FOMB 2YOLA 4YM9A 1A0LA 2ALVA 5PTPA 3BTGE 3MYWA 2OLGA 3GCOA 1OSSA 2ZU1A 3SNDA 1CU1A 3GYLB 3S7HB 1TX7A 1Z8GA 1HAZB 2VINA 3A85A 1MD7A 1O30A 4NG9H 1HBTH 3PMAB 1NU9A 4OS6A 4FUFA 3PLBA 1BMMH 1DANH 1TB6H 1OPHB 3K2UA 3M7UA 4FUEA 1KXFA 1C1QA 1UVSH 2F83A 2VVVA 2AGGX 1V2VT 1ELBA 3SBKA 1BBRH 5JBCS 1DFPA 2B8OH 4X1NU 5E8EH 2H6MA 5ESTE 1OS8A 2WUBA 1EJAA 2G55A 1CO7E 5BPEA 3Q3KA 4ISIH 1O5AB 3MNBA 3VFEA 4WMDA 1JWTA 4A5TS 1A0JA 1KSNA 1P01A 1THSH 3PWBA 1RTLA 3E3TA 1P2JA 1GVLA 1N8OB 1LHDH 1P12E 1B0FA 2ZEBA 3GY6A 1HV7A 3GOVB 1EAUA 3BTKE 1V2OT 3NUMA 1O5DH 3ZZ9A 1O34A 1DSTA 5GJ4B 2GP9B 3M5NA 2ZI2H 1BB0B 4X1PU 1O2OA 2ZFSA 3AASA 1C1WH 1FQ3A 1WU1A 1HXEH 3SNEA 3VB7A 3ATKA 3A84A 1Z6JH 1YPGH 2FPZA 1C1VH 1TBRH 3P17H 2XXLA 1VGCC 3Q3XA 2BVXH 2WYGA 5EQRA 2F9OA 1UTMA 3TVJB 3TGKE 3RU4E 4XSKU 1F5RA 1PQ8A 1XMNB 4X2WA 4RSPA 2FI3E 2YNAA 4CR5A 4M7GA 1FPHH 3SUGA 5C2ZA 3O8CA 4FVBA 3QTOH 1XUIA 3QK1A 1W3CA 3K9XB 2Z9KA 1TGCA 3ZVFA 1DY8A 2FOHA 3SJOA 2FESH 2BLOA 1RS0A 1KDQB 1KDQA 1UK4A 2CV3A 4KTUA 3L6PA 4NZLA 1SGNE 1DWCH 1H1BA 2ZU2A 4MVNA 1BJUA 2GGVB 1ELCA 4MNWA 4D7FA 2J34A 4ISNA 1O2UA 1CHGA 4K1TA 1HYLA 5F03A 3TU7H 1HLTH 3P8NA 4AN7A 3UQVA 2QCYA 2FM2A 3BTDE 3MNSA 5EU8A 2RG3A 1IHTH 1AWFH 4Q7XA 3EGKH 1IQNA 2Y80A 5DP7A 4X8VH 1OOKB 4Y8ZA 5G4BA 1GHYH 1AD8H 4BNRA 1SFQB 3BTEE 2PUQH 4Y11E 2SNVA 2Y5GA 3I29A 1SHYA 1L4DA 2G5NA 1O3CA 1PPGE 1LO6A 3Q00A 5L2ZH 1IQEA 6CHAB 3RXHA 5DGJA 2GT8A 2GCHF 1TWXB 5EPYA 3V0XA 5AFYH 3LPRA 1D9IA 2BDAA 2SGQE 2XC4A 4ZUHA 1OP2A 4Q2KA 1CHOG 4DW2U 3RLWH 2ZFFH 1KLTA 2ZFRH 3BEUA 1JIRA 4ABDA 3ZZ4A 1CT0E 5E0JA 1NY22 3U1JB 1C5OH 1XUHA 1FIZA 2SGFE 4ZH8A 1O35A 5GCHF 1QRXA 3S9BA 4NIYA 1FI8A 1FONA 1F5LA 1HAGE 1SHHB 1BRBE 3UNSA 6GCHF 4FU7A 4WXVA 4K69A 2PKSB 3ATWA 2HRVA 1O2RA 2IJOB 1E37B 2BY9X 4CRAA 3TITA 1FN6A 4MNVA 2TBSA 3SUDA 4BTTB 2G00A 1CBWC 1TGTA 4NWLA 1SGRE 3RDZA 3DT0H 4ZHMU 4A7IB 1TPSA 2R0KA 1C2MA 3GDSA 4GHTA 3V13A 1K1NA 9ESTA 1UVOA 3T2NA 3HGNA 2FDAA 2BDBA 3SU6A 2BD4A 4F4OC 5AHGH 1C1MA 1ZRKA 4UDWH 2ZFTA 3SJKA 2GX4A 5LPFA 3N7OA 1MKXH 4YLQH 1XVOA 3VB6A 5C3NA 3M3VA 2GCTC 2BDGA 3D23A 4GVUA 5F8ZA 1LVOA 1K21H 1O3FA 1UCYH 2ZFQH 2QY0B 1ANDA 3K6YA 1TNIA 2PTCE 3ZVDA 2PLXA 1UTLM 1BCUH 4ZHAA 1TABE 1SB1H 4NA8A 4KGAA 2A7HA 3UPEA 4ABIA 1YPLH 1THRH 3E0PB 1TNHA 7KMEH 1SLUB 4CRBA 4AG2A 1C2EA 1P2KA 2GZ9A 1K22H 1NESE 3L3TA 1C1OA 1GI2A 1OP0A 3SV2H 1BTPA 2V3OH 5EQSA 2FYQA 1ZPBA 3RXQA 3SGBE 1QL8A 4AB9A 3KIDU 3VEQB 3UUZA 1C2LA 2V6NA 1HGTH 1Y8TA 1XXFA 2ZC9H 1J17T 3LGUA 5DKMA 2AYWA 1T4UH 3PLPA 1C1TA 2WPJS 4GLYA 1OP8A 1AN1E 1O31A 2Z9GA 1P3CA 2ILNA 4NIWA 1GDQA 1HRTH 1VCPA 3HK3B 5LPRA 1DT2A 1ZSJA 3I77A 2STAE 1GGDC 1T8LA 3A87A 5CHAC 5HMAA 2GZ7A 2ZFPH 5IDKA 4VGCC 2ZU4A 1O5GH 2VIPA 2OXSA 1N1LA 1RTKA 1IQKA 3RMMH 3A7WA 3PLKA 3NPSA 1HAHH 4OGYA 5GPIB 1ZPZA 8GCHG 1UTNA 5DP5A 2VH6A 1Q2WA 2O8WA 4AZ2B 3ZZBA 1O3DA 1H4WA 2GT7A 1O3KA 3LONA 2B7DH 1ZJDA 1AVGH 1HJAC 1LQEA 4GCHF 1IQHA 1AZZA 1D3DB 4DOQA 4HZHA 1VR1H 2GMTC 2G5VA 4NFFA 2ZPRA 1HAVB 1HAVA 3MO3A 1O5FH 2ZTXA 3SU3A 3IG6B 3R3GB 1OWKA 3SHAH 2HNTF 2CN0H 1O2PA 3PV4A 5AVDA 4AYVB 5K7RA 1AMHA 1NC6A 4IW4E 3T28A 2ZTYA 1MTSA 4WVPE 1HAOH 3QWCH 1ZOMA 3M37A 1KLJH 1MU8B 1EXFA 1F92A 1JBUH 1P11E 1ZHMA 4I8LA 2ZGCA 3QGNB 3ENSB 2FI5E 5DP3A 2FYRA 1BBRE 1O3BA 5JB9S 1ZJKA 3P95A 1QHRB 2CJIA 1FMGA 1FLEE 3EA8A 1SGEE 3C1KA 1ARCA 3QZRA 1CGHA 3SI4H 3M5OA 3SZNA 1OWDA 4BAHB 2YNBA 3WY8A 4WWYA 1N6YA 1XUJA 2XC0A 5FPTA 1RIWC 5AFZH 3KCGH 2BMGB 4DT7B 1MAYA 3D62A 3T29A 4TPYA 3ODFA 3SQEE 1QA7A 2Q6GA 1C4U2 1KY9A 3Q3YA 2CXVA 2BY5X 2BHGA 4ZHLU 2BQ7B 2P8OB 2FTMA 3SO3A 1TQ0B 1UJ1A 2JH0D 1VJ9U 4X8SH 1QJ7B 5A09A 1TMUH 3ZZ7A 4OS5A 1O2KA 2FLRH 2J92A
chains in the Genus database with same CATH superfamily
2JETB 2V3HH 1C4V2 1WTGH 1PPHE 1DM4B 3MU4A 1O2JA 3LGVA 2GV6A 2JH5D 2UUFB 1IHSH 1O36A 3ZZ6A 1SSXA 3BN9A 5HXFA 2WV5A 1V2MT 1K2I1 1L4ZA 2SGPE 4YZUA 3SJ8A 1AE5A 4X6OA 1OYTH 2FP7B 3CNRA 2BLVA 1P02A 2EEKA 1P2OA 2K0QA 1L1NA 4XOJA 1UK2A 1FNIA 2O8UA 1C2DA 4ESTE 4HGCA 1TMBH 2RDEA 3M61U 2AGIX 3SV9A 1NS3A 4J1YA 2PWXA 1S6HA 1SGYE 2VVUA 4NZQA 3RC4A 4CHAB 1SQRA 3F6UH 3RLYH 1WQVH 4E7RG 4O3UA 1SL3A 3UTUH 2ZDLA 3O8DA 1FXYA 2BD5A 3RMNH 1XM1A 5C94A 1P2QA 1HAXB 1ELAA 4OS7A 4A1TA 1FN8A 1VCWA 2SFAA 1O2XA 3BIUH 1DWBH 5F53A 4XBDA 2AERH 4XBBA 2OINA 1GJBB 3TLOA 1J14A 1NFXA 2BDHA 1INCA 3AAVA 1TBZH 4YESB 4JK6A 1GCTC 4AFQA 1AHTH 2FOCA 2NWNA 5LH8A 3AK5A 4CBOA 3GY4A 1G30B 3S9AA 2ZGBH 1ZTJA 1SGIB 3K65B 1TPOA 2R2MB 3BEIB 3B8JA 5JBAS 2UWLA 2C8WB 1EZUC 1DLKB 1C9TA 3F0OA 1HPGA 1GJCB 1DSUA 1T4VH 1HNEE 3GISB 4INLA 1PJPA 2UWPA 6ESTA 1FY4A 2LELA 3EE0B 4CRDA 4FUBA 2WPIS 4ABBA 2ZGXH 3HGPA 3RMOH 1GBEA 3RXTA 5E2PA 1FPCH 1DY9A 2VGCC 4WF8A 3QN7A 4Y0YE 2Q6DA 5EW2H 4GSOA 1HUTH 3U9AH 3B23B 4OS4A 1D3QB 3VB3A 3IWMA 4TY7A 3QX5H 5HKKD 1LDTT 1V2TT 5GIBA 2PV9B 3OY6U 2A2XH 2BY8X 2SGEE 1QRWA 1WDIA 1ELVA 3BSQA 3UNQA 3RXUA 1BRCE 1Q3XA 3MU0A 5FAHA 1KXCA 1P09A 2J38A 1SQTA 1DOJA 4DCDA 1IQIA 3DSGA 3SJIA 1NROH 4E05H 2ZP0H 2BDYA 1TAWA 4X2XA 1W0JD 1GJDB 1G37A 5EQQA 2HVYB 3M7QA 2A32A 2HOBA 3A80A 1EP5A 5EOKA 1DITH 2BLQA 3SYJA 3FP6E 2ODQA 1A3BH 1SQOA 1EJNA 2GV7A 5DO4H 1UVUH 3NXPA 4U01A 5GDSH 1G3BA 2EA3A 5EJLA 4YOJA 1QQUA 1GDNA 3UR6A 4LK4A 4A1XA 1J15A 1TX8A 5A0CA 5DJ7A 1YY3A 2Z9JA 4IC6A 1BZXE 2PGQB 1W0YH 2FWWA 1M9UA 3RXEA 2IN2A 3KF2A 3OX7U 3LGIA 5H4IB 1DPOA 1MUEB 2CMYA 1QBVH 2Q1JA 3OTJE 2ZDMA 4BANB 5EPNA 1TRMA 1GBIA 2C8ZB 1QB9A 1OXGA 5EG4A 2AH4X 4U30A 2AMQA 1G9IE 1S83A 1FY8E 1KMHB 3GCHC 4CBNA 1J9CH 2G81E 1UCYE 1H9LB 3PMHB 1C5NH 4TWWA 1NRQH 1MQ6A 3FP8E 2O9QA 3A88A 1Y3UA 4FUJA 1FY1A 5J4SA 1QJ6B 5GWZA 2BZ6H 1NRSH 2FXRA 2P93A 2XCFA 4NA7A 4JZ1A 1O3LA 1MTNB 1S0RA 1Y3YA 1ELDE 3A7VA 2YMSD 1QB6A 1PYTD 1EAIA 1D3PB 2A45B 1EUFA 1MTWA 1WSSH 4F55A 4X0WU 3SGAE 1ZSLA 4X8UH 4BTIB 1O3GA 3D49H 3EDXB 4Y7AA 2P94A 4ISLA 1WV7H 3KHVA 4YLUA 3CP7A 4NCYA 4B2AA 1ZPCA 1WOFA 1MCVA 2FI4E 4NIXA 1BMAA 2WYJA 2ZHDA 5DSFA 2TIOA 5FBIA 3QO6A 1Z1IA 2ZWLH 1WUNH 4AG1A 3F0PA 4BXSA 1VITF 5A8ZA 2A4QA 3E0NB 4JZIA 1A0HB 1GG6C 1DXPA 1HAPH 3HATH 5KEDA 2H9HA 3OU0A 3VB4A 2FOAA 2C3SA 1GJ5H 2BVSH 1C5TA 2Y5FA 3PWCA 1A5HA 1TRYA 1YC0A 5E2OA 4ABEA 2HNTC 4YTAA 1O3HA 2LNCA 3SJ9A 6LPRA 5ABWA 1W14U 1AZ8A 2W7UA 2ZNKH 1F2SE 1XKBC 3RC6A 1GMDG 1IOEA 1BMNH 3TK6A 1LKBA 1A3EH 3MU5A 3RXCA 2PGBB 2ZDNA 3GCTG 4XDEA 3RXBA 2BQWB 3VB5A 3GY5A 5L6NH 1GMHG 3F9GA 1O3MA 1UTPA 3GCNA 3FO8D 3DCLA 2Z94A 1VZQH 4K5ZA 1W10U 1SGPE 2SNWA 3PB1E 1Y3VA 3OEHD 2C93B 2IPHA 1W0ZU 4JYVH 5JB8S 3UB0A 5C20A 1T8OA 3FANA 3ZZAA 2WV4A 3AW0A 2J4IA 1P03A 2RDLA 3TNTA 2K1QA 1V2WT 2BD7A 3FP7E 7LPRA 7GCHF 2BXUH 1C2HA 1Y59T 2GJGA 1C5UA 2A7CA 2FX6A 1K9OE 3E6PH 1O32A 1P8VC 1H9IE 3RU4T 3A89A 1OWJA 1AO5A 1YPEH 1PPEE 3ZZ5A 1GL1A 3GICB 2OCVB 1GHAG 5DP4A 2BY7X 4JZEH 1SC8U 3TJNA 1LKAA 5L2YH 1QIXB 4SGBE 1SLWB 2Y82A 4MNYA 1SR5C 2A5KA 3KYFA 2Y6TA 3BG4C 1GMCG 3F2FA 2ULLA 1H8DH 3VGCC 1AQ7A 4ABJA 2F43B 4LOYH 5JBBS 4P02A 4BAQB 1BTUA 1V2JT 2F9VA 3PTNA 1PYTC 1BBRK 3QGJA 2VIOA 4JK5A 4YOGA 2ZDVH 2WPMS 1GPZA 1MBQA 1D3TB 1TBQH 2FLBH 3RU4D 3PO1B 2R2WU 5EXNA 3SUFA 4XRNA 2M5TA 4TT3D 3EE7A 4Y71A 1KXBA 3TH2H 1ELEE 4KP0A 1TA2A 1GVKB 4DIIH 1KIGH 1C1NA 3BTFE 1YPJH 1AVWA 1HAIH 2THFB 3RM2H 1O3AA 3W94A 2Y7ZA 4B6FA 3MH7A 1GJAB 4IGDA 2O8MA 1GBLA 1GBMA 1G3DA 2C8XB 4TYDA 5C5NA 3ZV8A 1QR3E 1Z6EA 3WW7A 1GI3A 2PTNA 2VWOA 5A0BA 5ESBA 3LU9B 2Y5HA 1EZSC 4AFSA 3DA9B 2FIRH 4AYYB 2VB0A 3S7KB 2HALA 4Y79A 2TGDA 1GHZA 1TA6A 4Q80A 4ZXXH 1TFXA 3HKJB 2DE8A 1XUFA 4IBLH 3OY5U 1GBBA 1V6DA 1NRRH 2PFEA 3F1SB 4XFQA 2UWOA 4FUDA 3E91A 2KX4A 2BOHB 1HJ8A 1C2KA 9LPRA 1LPZB 4ACAA 2FZZA 2R0LA 1O3OA 1QFKH 1TGSZ 4XD7D 1GJ8B 2OBQA 1OWIA 4XBCA 3PM3A 1C1SA 1W8BH 2QXJA 7ESTE 3MMGA 4IN1A 2CHAC 3OEED 1GHXH 2V35A 1BITA 2A4OA 1MZAA 3ATLA 3ODDA 1FY3A 1TNKA 1NT1A 4O03A 1O2ZA 5TCAA 3GYMA 1QBNA 1A61H 4OS2A 2WSSD 4YO9A 2GDDA 3LGTA 1AUJA 4KELA 4I31A 1FAXA 1MTUA 1GBCA 2WPLS 3D65E 3LC3A 2ZDAH 1NZQH 1T8MA 2ZF0H 3JZ1B 1ARBA 1C5XB 1G36A 1RJXB 1BA8B 1G3EA 2H9TH 1T7CA 1FV9A 2QV1A 4RKJB 3H7OA 1BRAA 1O2LA 2EY4C 2ZA5A 4INHA 3ZYEA 1TLDA 4R8TB 4B74A 2P3UB 5F8XA 4DT4A 2W6JD 1L0ZA 4ZCNA 1FX0B 1ZTLA 1S85A 3F9FA 1AUTC 2O8TA 1YF4A 4IC5A 1P10A 2C90B 2W3KA 1RTFB 3UQOA 1V2ST 1ZGVA 3MNCA 2VIVA 3BEFB 2TGTA 1AWHB 5T3HA 5TCCA 3TIUA 4ABAA 1MBMA 1Y3XA 1ZSKA 2R3UA 2V7QD 2EI6A 5K0HA 1MKWH 3C27B 1JXPA 1AY6H 1NRPH 1TE0A 2XBXA 4H42U 3PTBA 1S0QA 1LHEH 4TSFD 5EW1H 1C9PA 4SGAE 1P57B 4BTUB 4FUGA 4FOUC 3FZZA 3GY8A 4TWYA 5HIZA 2AFQB 5HM9A 5FPSA 2Z9LA 1SOZA 3SZEA 1G2MA 3E90B 1C1RA 1YLCA 3ESTA 3TGJE 2J94A 5EJ1A 1AB9C 2P16A 2OD3B 2EC9H 4H4FA 5FCKA 2J9NA 5CHBA 1FZZA 3V3MA 2XYAA 1ELFA 1CT4E 1CA0C 4AGKA 3F2GA 1VITH 2Y81A 3FAOA 4MTBA 2JJ2D 5FBEA 5FPYA 2VNTA 1H9HE 2BOKA 1K1OA 3LT3A 1FIWA 1TRNA 3QTVH 1OX1A 1V3XA 2WPKS 1QZ8A 1ESAA 1AU8A 4ZKRU 1AIXH 2ZHQH 1GBDA 2FX4A 2XBYA 3E1XB 3RXRA 2A5AA 4U32A 4UEHH 1ELGA 2H2ZA 1WXRA 1AVXA 1CT2E 2H9EH 1BIOA 1NM6A 2RCEA 1GGDB 3VPKA 4KTSA 5JDUB 1KYNA 1LHGH 3MFJA 1VKYA 5C5OA 3FFGA 2XW9A 2FS9A 1IQLA 1RRKA 3LIWA 3STJA 1MKXK 1W12U 4B71A 4GPGA 1BTWA 2XNDD 2OC7A 1EOLA 1UCYK 4CHAC 1UK3A 1HCGA 2FOGA 2PSXA 3L33A 4LZ1H 1P2NA 1XXDA 3T27A 1Z8RA 3FOAA 3E8LA 2BLWA 3LKWA 1GHBG 3RC5A 1B0EA 4Y8YA 1HJ9A 1HJAB 1MU6B 1P05A 1LVYA 2HNTE 1DS2E 1PQ5A 2OUAA 1DUEA 2SGAA 3SU5A 5JYIA 1YPKH 3RXMA 3TK9A 5ETXA 1SVPA 5GXPA 3NRLA 1NFUA 5EJZA 1BTHH 4FXGH 1L1JA 1XUKA 3DSPA 3ELAH 4X1QU 2L74A 1AFQC 2RFKC 3RM0H 1UVTH 1WAYB 3KEEA 4INKA 1KTTB 1O3EA 3KQCA 1WTHD 3T5FH 1GBFA 2BDCA 2BZAA 3FZDA 2G51A 1O2NA 2P3TB 2NU0E 3UAIC 2QXGA 2FTLE 1HAYB 4B2CA 3DFLA 3KNXA 5HGGA 2GD4B 2B5TB 3U69H 3IITA 2STBE 4BAKB 1GBTA 1V2UT 4FUCA 1XVMA 2J5UA 1YWUA 1KTSB 1W11U 3PRBA 1JRTA 1NTPA 1SOTA 1YP9A 3SU2A 8KME2 3PYHA 3UR9A 5SGAE 4CREA 2A5IA 3BTTE 3F2HA 4O3TA 2WV9A 1H8HD 3TK5A 1IQGA 5T6FA 4CRCA 1S84A 1MH0A 3SNCA 3ITIA 3RXSA 1F7ZA 2CF8H 3F9EA 4ZKNU 1RIWB 1CA8B 2KCAA 1A1RA 1FY5A 1QQ4A 1FJSA 4K1EA 1OWEA 4Q4LA 1A5GH 2A4RA 1EB1H 1YPMH 1UW7A 1EB2A 4DURA 3SOSA 4D8NA 3W95A 3N99A 1Z1JA 3P8FA 2AIQA 3UWJH 1OKXA 5B6OA 1BJVA 1KXAA 4YOIA 5IYTA 2AHME 2FOFA 4I86A 3GDUA 3STIA 1A4WH 2AMPA 2FOBA 4B76A 3OE7D 1AKSB 1AKSA 2EQNA 1SFIA 2XWBI 3CS7A 3ZZDA 2PHBA 1F0UA 2Z3EA 1SGFG 1BHXB 5J4QA 3TJVA 1T32A 2A31A 1DUAA 5EXMA 1O37A 2ZCLP 3U1IB 4UFEH 2BD3A 1BTZA 1XX9A 5IK2D 1B5GH 1GL0E 2QYIA 4X2VA 1ELTA 1JRSA 3VXEH 1O2MA 2QIQA 4B73A 1EOJA 2DE9A 1A2CH 2WINI 1GBHA 4K1SA 1GVZA 2G4TA 3QZQA 1JOUB 1SLXB 3ZVBA 2NU3E 3MU1A 1DVAH 2FOEA 4AORA 1F0SA 3SU1A 2ASUB 3LJOA 1ABIH 3A7YA 2Z9IA 3B9FH 1G32B 2R3YA 2RA3A 5AF9H 1GJ7B 3A7XA 4AX9H 1O5BB 1DXWA 2G52A 3M3TA 1LHCH 4WJG2 2ODPA 2Z6BD 4UONA 1G2LA 1GJ9B 1TALA 3ZZ3A 2QGRA 1GCTB 3RXOA 1W0KD 1EKBB 1ID5H 1YKTA 5EGMA 3H7TA 3A8BA 3GY3A 1GHVH 4F49A 1N8OC 1C4Y2 3GY7A 3KQBA 3EQ0H 4CH8B 4FUIA 2NU2E 4Y0ZE 4AFZA 2F91A 2F9BH 3SGQE 3TH3H 3EA7A 4FETA 2VH0A 2P3FH 4IMZA 2C8YB 3QLPH 2JKHA 1W2KH 1S6FA 1GBKA 1EPTB 1EPTA 1ORFA 3LOXA 4FU9A 2QAAA 1LHFH 1EQ9A 2VGCB 2KM0A 3MHWU 1CE5A 1SGDE 3NKKA 4ASHA 5T1VA 2GCHG 2Z7FE 2PP6A 1OYQA 3UOUA 5C1XA 3I78A 2A1DB 2ZKSA 1V2PT 1EZQA 2FODA 4I7YH 4DY7B 3LGYA 1C5SA 1WQSA 5C67A 4NFEA 1ETSH 3P70B 1QB1A 2F9PA 3P92A 3UY9A 3U8TH 1UHBB 1UHBA 2IPQX 2H1UA 2XBVA 1PPCE 3PMJA 2ANKH 3NCLA 1CQQA 1AGJA 2AGEX 3RXLA 3TPIZ 1C5YB 3P8GA 2D8WA 2BY6X 5GCHG 4DG4A 4AB8A 1SPJA 3S9CA 1DICA 4X6NA 1FAKH 2GZ8A 2KR7A 1LMWB 3BIVH 1PPBH 1W7XH 3NZIA 2KFWA 1E35B 1NO9H 6GCHG 1T8NA 4OGXA 3MWIU 1C5LH 2AIPA 4X6PA 1QL9A 4UFGH 2OTVA 3H09A 3UREA 1WBGB 1IQJA 3WWFA 2ZIQH 4O97A 1ETRH 4LZ4B 3A86A 1LCYA 1V2KT 2BM2A 2QF3A 3H5CB 1P0SH 2WUCA 1EX3A 2F3CE 3P6ZB 1Z7KA 5EIYA 2Y7XA 1X7AC 1ZYOA 4Y7BA 1PQAA 3RXDA 1BUIA 4I8KA 5DP6A 2F9NA 4WMFA 2Q6FA 1ZMLA 4X1RU 3GCHB 4ZROA 4K8YA 6CHAC 1K1IA 3ATMA 2OBOA 1B7XB 1D6WA 1QGFA 5HM2A 2OC0A 1NRNH 1UTJA 2B0FA 1LVMA 3M36A 4J2YB 2G4UA 3M5LA 1LPGB 4Y6DA 4E06H 3SW2B 3K6ZA 4BAMB 4DGJA 1O2GH 2GVFA 3RXIA 2BD2A 3ZVGA 1SGTA 4ZKSU 2XBWA 2ZHFH 1K1JA 2FO9A 5LGOA 2FEQH 4AOQA 2GKVE 2QXIA 2ZHWH 1C2FA 1KLIH 3AVZA 2BYAX 1UTQA 4QT8C 4BXWA 1ABJH 2BD8A 5JBTA 1P9SA 3PO1C 2BVRH 1BDAA 4X8TH 2FS8A 2PKSC 1UVPA 1Y5UT 3PROA 1LPKB 4K3JA 3A8AA 1BHXF 2EI8A 4RKOB 1RXPA 2ANWA 1GWAA 3RXVA 4K60A 2XC5A 1GG6B 1TGNA 1VGCB 2XOKD 1YCPM 2BX3A 1QNJA 5C1YA 5A2MH 1DWEH 2BTCE 4I8JA 5LPEA 1SLVB 4Z6AH 2J2UA 1GI6A 1HIAA 1HIAB 4PROA 1C5MD 3A81A 4OS1A 4R0IA 1GI8B 1GI0A 1TOMH 4YT7H 1O38A 1K1LA 3HKIB 5FX5A 3KQDA 1NU7B 2NU1E 3QUMP 1O5CB 2F9UA 5KGOA 2DUCA 1W7GH 2TPIZ 3RXAA 2HPPH 3KQ5A 1OWHA 1YGCH 4JMYA 3R0FA 1PFXC 3HPTB 1EZXC 2V3MA 1TMTH 2JH6D 4CRGA 4O9VA 3ZZCA 1SKYE 3A8CA 2XTTB 3BF6H 1YYY1 1ESTA 2LP6A 3UFAA 4Y76A 5BRRE 3S0NA 4ACBA 2ZGJA 1LQDB 1L1GA 2A2QH 1IQFA 3PV5A 4B1TA 2IOTA 3A82A 4HI3A 1IAUA 1RFNA 1EFRD 4GCHG 4LXBH 3MI4A 2VWNA 1MMJN 2D2DA 3MH5A 1TOCB 2PSYA 1YBWA 4CRFA 1VJAU 5E0HA 2ZU3A 3DSOA 1N6XA 1GHWH 2ZU5A 5DP9A 1YPHE 2VVCA 1G3CA 2HVXA 3M5MA 2ODYB 1MTVA 4D7GA 5EODA 4ABFA 1P06A 3KGPA 4P00A 3VXFH 3V12A 1YLNA 3A8DA 1HFDA 2ESTE 2RA0A 1WYKA 4NSVA 3MTYA 4E7NA 1HDTH 1E38B 2XWAA 1KXDA 2ZCHP 2ZG0H 3BG4B 2BDIA 1NFYA 2O8LA 3EAJA 2W5EA 3VGCB 5I25A 1TIOA 4Z1MD 1TGBA 4Q7YA 2ANMH 4JZDH 3O8RA 2ZZUH 3SNBA 1O2TA 2J95A 3URDA 4ABGA 5GNDA 4DVAU 4NIVA 1C5WB 1GMDF 4X6MA 4KTCA 1MQ5A 5TJXA 2YMSB 2TGAA 1THPB 4WMEA 4K2YA 3ZYDA 1ZR0A 3GCTF 1NPMA 3LGWA 5HYOA 3ZV9A 1GMHF 1O5EH 1ZZZA 1TPAE 2KAIB 2KAIA 2VIQA 1DDJA 3S69A 3LDXH 1KXEA 2G8TA 4FU8A 4RT1A 1RD3B 4A92A 2XRCA 3RXFA 2HPQH 4MLFB 3BTWE 1S81A 3URCA 1EASA 1ETTH 5A8YA 2ZCKP 1GI9B 3TJOA 1QJ1B 2QF0A 1K1MA 1ZLRA 4MDSA 1BOQA 1CBWB 1UMAH 2HWLB 3TH4H 1P3EA 4B75A 4H6SB 3V7TA 1O2HA 1JMOH 3OSYA 5EXLA 4BAOB 3MOCA 1MD8A 2OQ5A 2PW8H 2TRMA 2A7JA 1K28D 2J97A 1NN6A 5DPAA 3LJJA 1GCDA 3NK8A 1QL7A 3AW1A 1GHAF 4WH6A 3SI3H 1RGQA 4NWKA 2ZQ1A 3KL6A 2A4GA 2ZPSA 2ZPQA 3G01A 4K8BA 3RMLH 5C1UA 5L30H 1CVWH 2CF9H 3SHCH 1ZTKA 4WY3A 5I46H 2GCTB 1GMCF 1AI8H 3RXGA 3UNRA 1C5RA 3SQHE 1SMFE 3SV7A 1P2IA 4A1VA 1CHOF 4D9RA 3RXKA 3JZ2B 1P04A 3UOPA 4AFUA 5FXLA 3HK6B 2HLCA 2CHAB 5DP8A 5T6DA 1XUGA 4UFDH 1O33A 1EAWA 4Z0KA 3U8OH 2ZQ2A 3PMBB 1C5PA 3BTME 2QN5T 2FMJA 2BQ6B 3O8BA 1J16A 4UD9H 3TJUA 2KCPA 3A7TA 1ANBA 1HB0B 4KKDA 4U2WA 3SNAA 4D76A 1AFEH 4I8HA 1A5IA 2ZO3H 3M35A 1UO6A 3F3BA 1D6RA 1Y5AT 2W3IA 1O3NA 4B2BA 2H5CA 3RXJA 2WPHS 2W7SA 3WWBA 3FN8A 2P8OC 1ZHPA 1MZDA 2NU4E 1C5ZB 1AE8H 1DWDH 2P59A 3N7DA 1V2NT 1U6QA 2HGTH 4MPUA 1BQYA 3DHKH 1O3IA 3U98H 1CGJE 1J8AA 1TNJA 2UUJB 1TNLA 2AEIH 1H8IH 2JETC 2Z3DA 3MNXA 2GTBA 4D9QA 2Z3CA 1DE7H 1FDPA 2AS9A 2VJ1A 3GY2A 4TPIZ 3TGIE 2VIDA 1GBJA 4GHQA 3KQEA 1W13U 4UE7H 3U8RH 2QA9E 1VCQA 1C1PA 3DFJA 5CHAB 3SU0A 5CMXH 1C5QA 3OYPA 1S5SA 2GDEH 2QE7D 2UUYA 2TGPZ 1BTYA 2HLDD 1UTKA 4Y10E 2KCOA 4ZAEA 1E36B 4VGCB 1D4PB 1FUJA 3VG8A 1ZRBA 3ZVAA 4NGAH 1S82A 1YCPH 1GI7B 2VIWA 2PKAA 1PPZA 2PKAB 3P8OA 4YT6H 2W26A 3EYDA 1MCTA 3RXPA 2ZECA 2R9PA 1CGIE 3RP2A 1BT7A 1YLDA 2D1JA 4A6LA 4Q7ZA 1GJ6A 3MO9A 2QC2A 1QA0A 3OFND 2AMDA 1HXFH 4ZKOU 1Z8IB 8LPRA 1ZGIA 1SBWA 5A8XA 3QDZB 1DX5M 1UTOA 2H5DA 3SV6A 1AB9B 1LVBA 2GMTB 2A0QB 1QY6A 1ZHRA 1Z71A 2PUXB 2VWLA 1WCZA 1O2QA 1QRZA 2CGAA 1XKAC 5F6MA 3TNSA 5FCRA 1O2IA 1CA0B 3F9HA 3SV8A 4DJZB 2SGDE 2IJD1 4MG3A 5CE1A 2PR3A 4FVDA 1E79D 4TY6A 2QF5A 4JCNA 1MAXA 4MPXA 4NA9H 2VU8E 1TNGA 4ZXYH 4DIHH 3OTPA 2C4FH 3SUEA 2BXTH 1C5VA 5DG6A 8ESTE 1V2LT 2OQUA 1H8ED 1O39A 2P95A 3DUXH 1QURH 1PQ7A 4ISHH 1TONA 1JIMA 1TQ7B 5FHTA 3Q76A 2BD9A 4ISOA 3EA9A 1QCPA 3T62A 4YXWD 1O2VA 1SGFA 2BX4A 3SORA 4IMQA 5HIYA 1F5KU 3A83A 4CR9A 4WH8A 1E34B 1YPHC 1GI5A 3NWUA 1GI4A 3MH6A 4HFPB 4XE4A 3ZVEA 5E0GA 1MKWK 1ESBA 4MPWA 1ZMNA 3AAUA 4JZFH 4ABHA 3OAAD 1ACBE 3SU4A 1EJMA 3M3SA 8GCHF 4GAWA 2ANYA 1GDUA 1IQMA 4IN2A 4ZMAH 1CSOE 2LPRA 3MU8A 3Q77A 1C1UH 1GJ4H 4Y8XA 1T31A 1C2GA 1C2JA 1A7SA 2D26C 3SN8A 1Q31A 1DLEA 4M9FA 4UFFH 1Z8JB 3MO6A 1SQAA 1TYNA 1COWD 4WXIA 1LTOA 4GUXA 2EI7A 1F0RA 4I8GA 3GDVA 2I6QA 3CENA 1Y3WA 3LC5A 1O3JA 2ZDKA 1BTXA 1AFQB 1TX6A 4BOHA 2BB4A 3BV9B 3LH3A 1VITG 2ALPA 4RN6A 3ATIA 3LH1A 3UWIA 2QXHA 4CH2B 3M7TA 3FVFB 3DD2H 1EP6A 1SG8B 1GI1A 4THNH 1BMLA 1NFWA 1L2EA 1MABB 2OP9A 1QBOA 1P2MA 4IS5A 3T25A 3MQKC 3ZVCA 1EPTC 4NSYA 2XCNA 1O3PB 1SGCA 3F68H 3E16B 1K1PA 1BRUP 1ANEA 1F0TA 1O2WA 1V2RT 5DK1A 3T26A 1GBAA 1PPFE 4MNXA 5B6LA 4MQAA 2ZTZA 4X2YA 1C2IA 2I6SA 4JYUH 2V0BA 1O2YA 5T6GA 1TPPA 4X1SU 2VWMA 1P9UA 2UUKB 3ZZ8A 1E0FD 1ZMJA 1MTNC 1O2SA 1BMFD 1EAXA 1YCPK 3A7ZA 1K0HA 1SGQE 2OC1A 5F8TA 4RI0A 3RUOA 3BTHE 1EATA 1SI5H 1GHBF 4JYTA 2XNIA 1V2QT 5JPMH 1O0DH 2ZHEH 1A46H 2ZGHA 4H6TA 3BTQE 4I33A 5A0AE 3BG8A 3MH4A 4FUHA 3CS0A 2B9LA 3UIRA 7GCHG 1QTFA 4MPVA 1YM0A 1ANCA 4I32A 1Y5BT 4AGJA 2OC8A 4HTCH 3KN2A 5FX6A 2FOMB 2YOLA 4YM9A 1A0LA 2ALVA 5PTPA 3BTGE 3MYWA 2OLGA 3GCOA 1OSSA 2ZU1A 3SNDA 2OK5A 1CU1A 3GYLB 3S7HB 1TX7A 1Z8GA 1HAZB 2VINA 3A85A 1MD7A 1O30A 4NG9H 1HBTH 3PMAB 2M2AA 1E1RD 1NU9A 4OS6A 4FUFA 3PLBA 1BMMH 1DANH 1TB6H 1OPHB 3K2UA 2WPDD 3M7UA 4FUEA 1KXFA 1C1QA 1UVSH 2F83A 2VVVA 2AGGX 1V2VT 1ELBA 3SBKA 3U28C 4ASUD 5CDFE 1BBRH 5JBCS 1DFPA 2B8OH 4X1NU 5E8EH 2H6MA 5ESTE 3PRDA 4AC9A 1OS8A 2WUBA 1EJAA 2G55A 1CO7E 5BPEA 3Q3KA 4ISIH 1O5AB 3MNBA 3VFEA 4WMDA 1JWTA 4A5TS 1A0JA 1KSNA 1P01A 1THSH 3PWBA 1RTLA 3E3TA 1P2JA 1GVLA 1N8OB 1LHDH 1P12E 1B0FA 2ZEBA 3GY6A 1HV7A 3GOVB 1EAUA 3BTKE 1V2OT 3NUMA 1O5DH 2W6ID 3ZZ9A 1O34A 1DSTA 5GJ4B 2GP9B 1E1QD 3M5NA 2ZI2H 1BB0B 4X1PU 1O2OA 2ZFSA 3W1EA 3AASA 1C1WH 1FQ3A 1WU1A 1HXEH 3SNEA 3VB7A 3ATKA 3A84A 1Z6JH 1YPGH 2FPZA 1C1VH 1TBRH 5DN6D 3P17H 2XXLA 1VGCC 3Q3XA 2BVXH 2WYGA 5EQRA 2F9OA 1UTMA 3TVJB 3TGKE 3RU4E 4XSKU 1F5RA 1PQ8A 1XMNB 4X2WA 4RSPA 2FI3E 2YNAA 4CR5A 4M7GA 1FPHH 2WHXA 3SUGA 5C2ZA 3O8CA 4FVBA 3QTOH 1XUIA 3QK1A 5FL7D 1W3CA 3K9XB 2Z9KA 1TGCA 2QF4A 3ZVFA 1DY8A 2FOHA 3SJOA 2FESH 2BLOA 1RS0A 1KDQB 1KDQA 1UK4A 2CV3A 4KTUA 3L6PA 4NZLA 1SGNE 1DWCH 1H1BA 2ZU2A 4MVNA 1BJUA 5C0UA 2GGVB 1ELCA 4MNWA 4D7FA 2J34A 4ISNA 1O2UA 1CHGA 4K1TA 1HYLA 5F03A 5KECA 3TU7H 1HLTH 3P8NA 4AN7A 3UQVA 2QCYA 2FM2A 3BTDE 3MNSA 5EU8A 2RG3A 1IHTH 1AWFH 4Q7XA 3EGKH 1IQNA 2Y80A 3ZIAD 5DP7A 4X8VH 1OOKB 4Y8ZA 5G4BA 1GHYH 1AD8H 4BNRA 1SFQB 3BTEE 2PUQH 4Y11E 2SNVA 2Y5GA 3I29A 1SHYA 1L4DA 2G5NA 2KZ4A 1O3CA 1PPGE 1LO6A 3Q00A 5L2ZH 1IQEA 6CHAB 3RXHA 5DGJA 2L6OA 2GT8A 2GCHF 1TWXB 5EPYA 3V0XA 5AFYH 3LPRA 1D9IA 2BDAA 2SGQE 2XC4A 4ZUHA 1OP2A 3PV2A 4Q2KA 1CHOG 4HG6A 4DW2U 3RLWH 2ZFFH 1KLTA 2ZFRH 3BEUA 1JIRA 4ABDA 3ZZ4A 2YMSC 1CT0E 5E0JA 4RT0A 1NY22 3U1JB 1C5OH 1XUHA 1FIZA 2SGFE 4ZH8A 1O35A 5GCHF 1QRXA 3S9BA 4NIYA 1FI8A 1FONA 1F5LA 1HAGE 1SHHB 1BRBE 3UNSA 6GCHF 4FU7A 4WXVA 4K69A 2PKSB 3ATWA 2HRVA 1O2RA 2IJOB 1E37B 1S6LA 2BY9X 3TITA 4CRAA 1FN6A 4MNVA 2TBSA 3SUDA 4BTTB 2G00A 1CBWC 1TGTA 2KCYA 4NWLA 1SGRE 3RDZA 3DT0H 4ZHMU 4A7IB 3FKSD 1TPSA 2R0KA 1C2MA 3GDSA 4GHTA 3V13A 1K1NA 9ESTA 1UVOA 3T2NA 3HGNA 2FDAA 2BDBA 3SU6A 2K8IA 2BD4A 4F4OC 5AHGH 1C1MA 1ZRKA 4UDWH 2ZFTA 3SJKA 2GX4A 5LPFA 3N7OA 3GS9A 1MKXH 4YLQH 1XVOA 3VB6A 5C3NA 2JJ1D 3M3VA 2GCTC 2BDGA 1OHHD 3D23A 4GVUA 5F8ZA 1LVOA 1K21H 1O3FA 1UCYH 2ZFQH 1NBME 1ANDA 2QY0B 3K6YA 1TNIA 2PTCE 4OM9A 3ZVDA 2PLXA 1UTLM 1BCUH 4ZHAA 1TABE 1SB1H 4NA8A 4KGAA 2A7HA 3UPEA 4ABIA 1YPLH 1THRH 3E0PB 1TNHA 7KMEH 1SLUB 4CRBA 4AG2A 1C2EA 1P2KA 2GZ9A 1K22H 1NESE 3L3TA 1C1OA 1GI2A 1OP0A 3SV2H 1BTPA 2V3OH 5EQSA 2FYQA 1ZPBA 5C17A 3RXQA 3SGBE 1QL8A 4AB9A 3KIDU 3VEQB 3UUZA 1C2LA 2V6NA 1HGTH 1Y8TA 1XXFA 2ZC9H 1J17T 3LGUA 5DKMA 2AYWA 1T4UH 3PLPA 1C1TA 2WPJS 4GLYA 1OP8A 1AN1E 1O31A 2Z9GA 1P3CA 2ILNA 4NIWA 1GDQA 1HRTH 1VCPA 3HK3B 5LPRA 1DT2A 1ZSJA 3I77A 2J98A 2CK3D 2J98B 2STAE 1GGDC 1T8LA 3A87A 5CHAC 5HMAA 2GZ7A 2ZFPH 5IDKA 4Q63A 2VBCA 4F48B 4VGCC 2ZU4A 1O5GH 2VIPA 2OXSA 1N1LA 1RTKA 1IQKA 3RMMH 3A7WA 3PLKA 3NPSA 1HAHH 4OGYA 5GPIB 1ZPZA 8GCHG 1UTNA 5DP5A 2VH6A 1Q2WA 2O8WA 4AZ2B 3ZZBA 1O3DA 1H4WA 2GT7A 1O3KA 3LONA 4B6EA 2B7DH 1ZJDA 1AVGH 1HJAC 1LQEA 4GCHF 1IQHA 1AZZA 1D3DB 4DOQA 4HZHA 1VR1H 2GMTC 2G5VA 4NFFA 2F4LA 2ZPRA 1HAVB 1HAVA 3MO3A 1O5FH 2ZTXA 3SU3A 3IG6B 3R3GB 1NBMD 1OWKA 3SHAH 2HNTF 2CN0H 1O2PA 3PV4A 5AVDA 4AYVB 5K7RA 1AMHA 1NC6A 4IW4E 3T28A 2ZTYA 1MTSA 4WVPE 2JIZD 3N7EA 3QWCH 1HAOH 1ZOMA 3M37A 1KLJH 1MU8B 1EXFA 1F92A 1JBUH 1P11E 1ZHMA 4I8LA 2ZGCA 3QGNB 3ENSB 2FI5E 5DP3A 2FYRA 1BBRE 1O3BA 5JB9S 1ZJKA 5C0TA 3P95A 1QHRB 2CJIA 1FMGA 1FLEE 3EA8A 1SGEE 3C1KA 1ARCA 2JDID 3QZRA 1CGHA 3SI4H 3M5OA 3SZNA 1OWDA 4BAHB 2YNBA 3WY8A 4WWYA 1N6YA 1XUJA 2XC0A 5FPTA 1RIWC 5AFZH 3KCGH 2BMGB 4DT7B 1MAYA 3D62A 3T29A 4TPYA 3ODFA 3SQEE 1QA7A 2Q6GA 1C4U2 1KY9A 3Q3YA 2CXVA 2BY5X 2BHGA 4ZHLU 2BQ7B 2P8OB 2FTMA 3SO3A 1TQ0B 1UJ1A 2JH0D 1VJ9U 2WZQA 4X8SH 1QJ7B 5A09A 1TMUH 3KYGA 3ZZ7A 4OS5A 1O2KA 2FLRH 2J92A
chains in the Genus database with same CATH topology
2JETB 2V3HH 1C4V2 1WTGH 1PPHE 1DM4B 3MU4A 1O2JA 3LGVA 2GV6A 2JH5D 2UUFB 1IHSH 1O36A 3ZZ6A 1SSXA 3BN9A 5HXFA 2WV5A 1V2MT 1K2I1 1L4ZA 2SGPE 4YZUA 3SJ8A 1AE5A 4X6OA 1OYTH 2FP7B 2BLVA 1P02A 2EEKA 1P2OA 1L1NA 4XOJA 1UK2A 1FNIA 2O8UA 1C2DA 4ESTE 4HGCA 1TMBH 3M61U 2AGIX 3SV9A 1NS3A 4J1YA 2PWXA 1S6HA 1SGYE 2VVUA 4NZQA 3RC4A 4CHAB 3F6UH 3RLYH 1WQVH 4E7RG 4O3UA 1SL3A 3UTUH 2ZDLA 3O8DA 1FXYA 2BD5A 3RMNH 1XM1A 1P2QA 1HAXB 1ELAA 4OS7A 4A1TA 1FN8A 1VCWA 2SFAA 1O2XA 3BIUH 1DWBH 4XBDA 2AERH 4XBBA 2OINA 1GJBB 3TLOA 1J14A 1NFXA 2BDHA 1INCA 3AAVA 1TBZH 4YESB 4JK6A 1GCTC 4AFQA 1AHTH 2FOCA 2NWNA 5LH8A 4CBOA 3GY4A 1G30B 3S9AA 2ZGBH 1ZTJA 1SGIB 3K65B 1TPOA 2R2MB 3BEIB 3B8JA 5JBAS 2UWLA 2C8WB 1EZUC 1DLKB 1C9TA 1HPGA 1GJCB 1DSUA 1T4VH 1HNEE 3GISB 4INLA 1PJPA 2UWPA 6ESTA 1FY4A 3EE0B 4CRDA 4FUBA 2WPIS 4ABBA 2ZGXH 3HGPA 3RMOH 1GBEA 3RXTA 5E2PA 1FPCH 1DY9A 2VGCC 4WF8A 3QN7A 4Y0YE 2Q6DA 5EW2H 4GSOA 1HUTH 3U9AH 3B23B 4OS4A 1D3QB 3VB3A 3IWMA 4TY7A 3QX5H 1LDTT 1V2TT 5GIBA 2PV9B 3OY6U 2A2XH 2BY8X 2SGEE 1QRWA 1ELVA 3BSQA 3UNQA 3RXUA 1BRCE 1Q3XA 3MU0A 5FAHA 1KXCA 1P09A 2J38A 1SQTA 1DOJA 4DCDA 1IQIA 3SJIA 1NROH 4E05H 2ZP0H 2BDYA 1TAWA 4X2XA 1GJDB 1G37A 5EQQA 3M7QA 2A32A 2HOBA 3A80A 1EP5A 5EOKA 1DITH 2BLQA 3FP6E 2ODQA 1A3BH 1SQOA 1EJNA 2GV7A 5DO4H 1UVUH 3NXPA 4U01A 5GDSH 1G3BA 2EA3A 4YOJA 1QQUA 1GDNA 3UR6A 4LK4A 4A1XA 1J15A 1TX8A 5A0CA 5DJ7A 2Z9JA 4IC6A 1BZXE 2PGQB 1W0YH 2FWWA 1M9UA 3RXEA 2IN2A 3KF2A 3OX7U 3LGIA 5H4IB 1DPOA 1MUEB 2CMYA 1QBVH 2Q1JA 3OTJE 2ZDMA 4BANB 5EPNA 1TRMA 1GBIA 2C8ZB 1QB9A 1OXGA 5EG4A 2AH4X 4U30A 2AMQA 1G9IE 1S83A 1FY8E 3GCHC 4CBNA 1J9CH 2G81E 1UCYE 1H9LB 3PMHB 1C5NH 4TWWA 1NRQH 1MQ6A 3FP8E 2O9QA 3A88A 1Y3UA 4FUJA 1FY1A 5J4SA 1QJ6B 5GWZA 2BZ6H 1NRSH 2FXRA 2P93A 2XCFA 4NA7A 4JZ1A 1O3LA 1MTNB 1S0RA 1Y3YA 1ELDE 3A7VA 1QB6A 1PYTD 1EAIA 1D3PB 2A45B 1EUFA 1MTWA 1WSSH 4X0WU 3SGAE 1ZSLA 4X8UH 4BTIB 1O3GA 3D49H 3EDXB 4Y7AA 2P94A 4ISLA 1WV7H 3KHVA 4YLUA 3CP7A 4NCYA 4B2AA 1ZPCA 1WOFA 1MCVA 2FI4E 4NIXA 1BMAA 2WYJA 2ZHDA 2TIOA 5FBIA 3QO6A 1Z1IA 2ZWLH 1WUNH 4AG1A 4BXSA 1VITF 5A8ZA 2A4QA 3E0NB 4JZIA 1A0HB 1GG6C 1DXPA 1HAPH 3HATH 2H9HA 3OU0A 3VB4A 2FOAA 2C3SA 1GJ5H 2BVSH 1C5TA 2Y5FA 3PWCA 1A5HA 1TRYA 1YC0A 5E2OA 4ABEA 2HNTC 4YTAA 1O3HA 2LNCA 3SJ9A 6LPRA 5ABWA 1W14U 1AZ8A 2W7UA 2ZNKH 1F2SE 1XKBC 3RC6A 1GMDG 1IOEA 1BMNH 3TK6A 1LKBA 1A3EH 3MU5A 3RXCA 2PGBB 2ZDNA 3GCTG 4XDEA 3RXBA 2BQWB 3VB5A 3GY5A 5L6NH 1GMHG 3F9GA 1O3MA 1UTPA 3GCNA 2Z94A 1VZQH 4K5ZA 1W10U 1SGPE 2SNWA 3PB1E 1Y3VA 2C93B 2IPHA 1W0ZU 4JYVH 5JB8S 5C20A 1T8OA 3FANA 3ZZAA 2WV4A 3AW0A 2J4IA 1P03A 2RDLA 3TNTA 2K1QA 1V2WT 2BD7A 3FP7E 7LPRA 7GCHF 2BXUH 1C2HA 1Y59T 1C5UA 2A7CA 2FX6A 1K9OE 3E6PH 1O32A 1P8VC 1H9IE 3RU4T 3A89A 1OWJA 1AO5A 1YPEH 1PPEE 3ZZ5A 1GL1A 3GICB 2OCVB 1GHAG 5DP4A 2BY7X 4JZEH 1SC8U 3TJNA 1LKAA 5L2YH 1QIXB 4SGBE 1SLWB 2Y82A 4MNYA 1SR5C 2A5KA 2Y6TA 3BG4C 1GMCG 2ULLA 1H8DH 3VGCC 1AQ7A 4ABJA 4LOYH 5JBBS 4BAQB 1BTUA 1V2JT 2F9VA 3PTNA 1PYTC 1BBRK 3QGJA 2VIOA 4JK5A 4YOGA 2ZDVH 2WPMS 1GPZA 1MBQA 1D3TB 1TBQH 2FLBH 3RU4D 3PO1B 2R2WU 5EXNA 3SUFA 2M5TA 4Y71A 1KXBA 3TH2H 1ELEE 4KP0A 1TA2A 1GVKB 4DIIH 1KIGH 1C1NA 3BTFE 1YPJH 1AVWA 1HAIH 2THFB 3RM2H 1O3AA 3W94A 2Y7ZA 3MH7A 1GJAB 4IGDA 2O8MA 1GBLA 1GBMA 1G3DA 2C8XB 4TYDA 5C5NA 3ZV8A 1QR3E 1Z6EA 5A0BA 1GI3A 2PTNA 2VWOA 5ESBA 3LU9B 2Y5HA 1EZSC 4AFSA 3DA9B 2FIRH 4AYYB 2VB0A 3S7KB 2HALA 4Y79A 2TGDA 1GHZA 1TA6A 4Q80A 4ZXXH 1TFXA 3HKJB 2DE8A 1XUFA 4IBLH 3OY5U 1GBBA 1V6DA 1NRRH 2PFEA 3F1SB 4XFQA 2UWOA 4FUDA 3E91A 2BOHB 1HJ8A 1C2KA 9LPRA 1LPZB 2FZZA 2R0LA 1O3OA 1QFKH 1TGSZ 1GJ8B 2OBQA 1OWIA 4XBCA 3PM3A 1C1SA 1W8BH 2QXJA 7ESTE 3MMGA 4IN1A 2CHAC 1GHXH 2V35A 1BITA 2A4OA 1MZAA 3ATLA 3ODDA 1FY3A 1TNKA 1NT1A 4O03A 1O2ZA 5TCAA 3GYMA 1QBNA 1A61H 4OS2A 4YO9A 2GDDA 3LGTA 1AUJA 4KELA 4I31A 1FAXA 1MTUA 1GBCA 2WPLS 3D65E 3LC3A 2ZDAH 1NZQH 1T8MA 2ZF0H 3JZ1B 1ARBA 1C5XB 1G36A 1RJXB 1BA8B 1G3EA 2H9TH 1T7CA 1FV9A 2QV1A 4RKJB 3H7OA 1BRAA 1O2LA 2ZA5A 4INHA 3ZYEA 1TLDA 4R8TB 4B74A 2P3UB 5F8XA 1L0ZA 1ZTLA 1S85A 3F9FA 1AUTC 2O8TA 1YF4A 4IC5A 1P10A 2C90B 2W3KA 1RTFB 3UQOA 1V2ST 1ZGVA 3MNCA 2VIVA 3BEFB 2TGTA 1AWHB 5T3HA 5TCCA 3TIUA 4ABAA 1MBMA 1Y3XA 1ZSKA 2R3UA 2EI6A 5K0HA 1MKWH 3C27B 1JXPA 1AY6H 1NRPH 1TE0A 2XBXA 4H42U 3PTBA 1S0QA 1LHEH 5EW1H 1C9PA 4SGAE 1P57B 4BTUB 4FUGA 3FZZA 3GY8A 4TWYA 2AFQB 5HM9A 5FPSA 2Z9LA 1SOZA 1G2MA 3E90B 1C1RA 1YLCA 3ESTA 3TGJE 2J94A 1AB9C 2P16A 2OD3B 2EC9H 4H4FA 5FCKA 2J9NA 3V3MA 1FZZA 2XYAA 1ELFA 1CT4E 1CA0C 4AGKA 1VITH 2Y81A 3FAOA 4MTBA 5FBEA 5FPYA 2VNTA 1H9HE 2BOKA 1K1OA 3LT3A 1FIWA 1TRNA 3QTVH 1OX1A 1V3XA 2WPKS 1ESAA 1AU8A 4ZKRU 1AIXH 2ZHQH 1GBDA 2FX4A 2XBYA 3E1XB 3RXRA 2A5AA 4U32A 4UEHH 1ELGA 2H2ZA 1AVXA 1CT2E 2H9EH 1BIOA 1NM6A 2RCEA 1GGDB 3VPKA 4KTSA 5JDUB 1KYNA 1LHGH 3MFJA 5C5OA 3FFGA 2XW9A 2FS9A 1IQLA 1RRKA 3LIWA 3STJA 1MKXK 1W12U 4B71A 4GPGA 1BTWA 2OC7A 1EOLA 1UCYK 4CHAC 1UK3A 1HCGA 2FOGA 2PSXA 3L33A 4LZ1H 1P2NA 1XXDA 3T27A 1Z8RA 3E8LA 2BLWA 3LKWA 1GHBG 3RC5A 1B0EA 4Y8YA 1HJ9A 1HJAB 1MU6B 1P05A 1LVYA 2HNTE 1DS2E 1PQ5A 2OUAA 1DUEA 2SGAA 3SU5A 5JYIA 1YPKH 3RXMA 3TK9A 5ETXA 1SVPA 5GXPA 1NFUA 1BTHH 4FXGH 1L1JA 1XUKA 3ELAH 4X1QU 1AFQC 3RM0H 1UVTH 1WAYB 3KEEA 4INKA 1KTTB 1O3EA 3KQCA 1WTHD 3T5FH 1GBFA 2BDCA 2BZAA 3FZDA 2G51A 1O2NA 2P3TB 2NU0E 2QXGA 2FTLE 1HAYB 4B2CA 3DFLA 3KNXA 5HGGA 2GD4B 2B5TB 3U69H 3IITA 2STBE 4BAKB 1GBTA 1V2UT 4FUCA 1XVMA 1KTSB 1W11U 1JRTA 1NTPA 1SOTA 1YP9A 3SU2A 8KME2 3PYHA 3UR9A 5SGAE 4CREA 2A5IA 3BTTE 4O3TA 3TK5A 1IQGA 5T6FA 4CRCA 1S84A 1MH0A 3SNCA 3ITIA 3RXSA 1F7ZA 2CF8H 3F9EA 4ZKNU 1RIWB 1CA8B 1A1RA 1FY5A 1QQ4A 1FJSA 4K1EA 1OWEA 1A5GH 2A4RA 1EB1H 1YPMH 1EB2A 4DURA 3SOSA 4D8NA 3W95A 1Z1JA 3P8FA 2AIQA 3UWJH 1OKXA 5B6OA 1BJVA 1KXAA 4YOIA 5IYTA 2FOFA 3STIA 3GDUA 1A4WH 2AMPA 2FOBA 4B76A 1AKSB 1AKSA 1SFIA 2XWBI 3CS7A 3ZZDA 2PHBA 1F0UA 2Z3EA 1SGFG 1BHXB 5J4QA 3TJVA 1T32A 2A31A 1DUAA 5EXMA 1O37A 2ZCLP 3U1IB 4UFEH 2BD3A 1BTZA 1XX9A 1B5GH 1GL0E 2QYIA 4X2VA 1ELTA 1JRSA 3VXEH 1O2MA 2QIQA 4B73A 1EOJA 2DE9A 1A2CH 2WINI 1GBHA 4K1SA 1GVZA 2G4TA 3QZQA 1JOUB 1SLXB 3ZVBA 2NU3E 3MU1A 1DVAH 2FOEA 4AORA 1F0SA 3SU1A 2ASUB 3LJOA 1ABIH 3A7YA 2Z9IA 3B9FH 1G32B 2R3YA 2RA3A 5AF9H 1GJ7B 3A7XA 4AX9H 1O5BB 1DXWA 2G52A 3M3TA 1LHCH 4WJG2 2ODPA 2Z6BD 4UONA 1G2LA 1GJ9B 1TALA 3ZZ3A 2QGRA 1GCTB 3RXOA 1EKBB 1ID5H 1YKTA 5EGMA 3H7TA 3A8BA 3GY3A 1GHVH 4F49A 1N8OC 1C4Y2 3GY7A 3KQBA 3EQ0H 4CH8B 4FUIA 2NU2E 4Y0ZE 4AFZA 2F91A 2F9BH 3SGQE 3TH3H 3EA7A 4IMZA 2VH0A 2P3FH 2C8YB 3QLPH 2JKHA 1W2KH 1S6FA 1GBKA 1EPTB 1EPTA 1ORFA 3LOXA 4FU9A 2QAAA 1LHFH 1EQ9A 2VGCB 3MHWU 1CE5A 1SGDE 3NKKA 4ASHA 2GCHG 2Z7FE 1OYQA 3UOUA 5C1XA 3I78A 2A1DB 2ZKSA 1V2PT 1EZQA 2FODA 4I7YH 4DY7B 3LGYA 1C5SA 1WQSA 5C67A 4NFEA 1ETSH 3P70B 1QB1A 2F9PA 3P92A 3UY9A 3U8TH 1UHBB 1UHBA 2H1UA 2XBVA 1PPCE 3PMJA 2ANKH 3NCLA 1CQQA 1AGJA 2AGEX 3RXLA 3TPIZ 1C5YB 3P8GA 2D8WA 2BY6X 5GCHG 4DG4A 4AB8A 1SPJA 3S9CA 1DICA 4X6NA 1FAKH 2GZ8A 1LMWB 3BIVH 1PPBH 1W7XH 3NZIA 1E35B 1NO9H 6GCHG 1T8NA 4OGXA 3MWIU 1C5LH 2AIPA 4X6PA 1QL9A 4UFGH 2OTVA 3UREA 1WBGB 1IQJA 2ZIQH 4O97A 1ETRH 4LZ4B 3A86A 1LCYA 1V2KT 2BM2A 2QF3A 3H5CB 1P0SH 2WUCA 1EX3A 2F3CE 3P6ZB 1Z7KA 2Y7XA 1X7AC 1ZYOA 4Y7BA 1PQAA 3RXDA 1BUIA 4I8KA 5DP6A 2F9NA 4WMFA 2Q6FA 1ZMLA 4X1RU 3GCHB 4ZROA 4K8YA 6CHAC 1K1IA 3ATMA 2OBOA 1B7XB 1D6WA 1QGFA 5HM2A 2OC0A 1NRNH 1UTJA 2B0FA 1LVMA 3M36A 4J2YB 2G4UA 3M5LA 1LPGB 4Y6DA 4E06H 3SW2B 3K6ZA 4BAMB 4DGJA 1O2GH 2GVFA 3RXIA 2BD2A 3ZVGA 1SGTA 4ZKSU 2XBWA 2ZHFH 1K1JA 2FO9A 5LGOA 2FEQH 4AOQA 2GKVE 2QXIA 2ZHWH 1C2FA 1KLIH 3AVZA 2BYAX 1UTQA 4QT8C 4BXWA 1ABJH 2BD8A 5JBTA 1P9SA 3PO1C 2BVRH 1BDAA 4X8TH 2FS8A 2PKSC 1UVPA 1Y5UT 3PROA 1LPKB 4K3JA 3A8AA 1BHXF 2EI8A 4RKOB 1RXPA 2ANWA 1GWAA 3RXVA 4K60A 2XC5A 1GG6B 1TGNA 1VGCB 1YCPM 2BX3A 1QNJA 5C1YA 5A2MH 1DWEH 2BTCE 4I8JA 5LPEA 1SLVB 4Z6AH 2J2UA 1GI6A 1HIAA 1HIAB 4PROA 1C5MD 3A81A 4OS1A 4R0IA 1GI8B 1GI0A 1TOMH 4YT7H 1O38A 1K1LA 3HKIB 5FX5A 3KQDA 1NU7B 2NU1E 3QUMP