1OWJA

Substituted 2-naphthamidine inhibitors of urokinase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of Novel Binding Interactions in the Development of Potent, Selective 2-Naphthamidine Inhibitors of Urokinase. Synthesis, Structural Analysis, and SAR of N-Phenyl Amide 6-Substitution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
total genus 48
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1owjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1owjA01
4NG9H 4ZKRU 3SNEA 1TPPA 4OS6A 1L1NA 1C5UA 2JH0D 1C2FA 2OC7A 1V2ST 4D9QA 1OWIA 3QN7A 1HPGA 2BD3A 1W0ZU 3S9AA 4E7NA 3TH3H 4ISIH 1AGJA 2IOTA 1FAKH 4A6LA 1N6XA 1GHZA 1WQSA 3VFEA 1LO6A 4FUJA 2BXUH 1C1TA 2BDYA 2GD4B 3PLKA 2ZHWH 4UFFH 1O37A 4NIYA 1GWAA 1F5LA 4FUGA 4NWLA 4ZMAH 1SGPE 1Z8GA 1XVOA 1KXCA 1YM0A 4YOJA 1H8DH 1DY9A 4DY7B 2CXVA 4CRCA 1LTOA 2GZ8A 4KP0A 2G00A 3SI4H 4CHAC 1XKBC 1O2VA 1D3QB 3MH5A 5A8ZA 4LZ4B 1UHBB 4XFQA 4ABFA 2CMYA 3FP7E 1ZMNA 2O8TA 3UPEA 1KTTB 1J8AA 2W5EA 1RTFB 3CS0A 4X2XA 3FVFB 1MTNB 3A7VA 4R0IA 1CQQA 3UUZA 1V2TT 4BAMB 1QRXA 2ZGHA 4Z6AH 4I31A 4TY6A 1O38A 1C5MD 1CE5A 1ELBA 1C2MA 5EXMA 2TRMA 4WH8A 1OKXA 2ZFPH 3PMJA 1A4WH 5L2ZH 2JETB 3ZZ3A 1HAYB 2W7SA 3UNSA 1ELFA 1OWJA 1O2MA 1O3AA 2VNTA 1DITH 1Z71A 4Y79A 3A88A 5A8YA 4JZIA 1GPZA 4YZUA 1IHSH 3OX7U 2PFEA 1RJXB 2ZECA 1K1MA 1GJDB 2KAIA 2V3OH 3HKIB 3OY6U 1MBMA 1AN1E 2FTMA 4ZXXH 2BVXH 2P59A 1WCZA 1A0LA 2DUCA 1H9LB 1V2RT 1MAYA 2BD9A 2ZGXH 2H6MA 1TYNA 4O3UA 3ZYEA 4WMDA 4XBCA 1TONA 1XUGA 4D9RA 1UK4A 1SC8U 2P3FH 2R3UA 2QA9E 4JZEH 4VGCB 3MU1A 3NZIA 1LKAA 1GI9B 3M7UA 1NTPA 4KGAA 3A83A 1NRPH 1CGJE 3BF6H 2FOEA 3SU0A 3RXOA 3T25A 4UD9H 1ZMJA 1F92A 1PJPA 3DFLA 2ZP0H 1OS8A 3FP8E 1O33A 5JBCS 3EAJA 1ZPCA 1HBTH 4J1YA 3MU8A 1AE8H 1KTSB 1N8OB 1BTXA 1JRTA 3ENSB 3P8FA 5HMAA 3H7TA 1FIZA 3P92A 1FY4A 3A8CA 2XBXA 1FJSA 4HTCH 1NC6A 2QIQA 1QQUA 2BD8A 1TGNA 1LVBA 1EATA 4I32A 1P2MA 1RIWB 2ANMH 3PWCA 4B75A 3NWUA 3UWJH 1YPEH 1TNKA 4LXBH 3L6PA 3GCTF 4I8LA 1FONA 1G30B 3SN8A 3M5NA 2C8ZB 1WU1A 1EX3A 1CHOF 4X1NU 5DGJA 5C67A 2UWPA 2WINI 3P70B 4LZ1H 3PTBA 1FY3A 1O3FA 2R2WU 3BTKE 1UCYH 3SV8A 1HIAA 2BY5X 2OC0A 4DCDA 2LNCA 2CF9H 2V3HH 4E06H 3I77A 4AGKA 1C2GA 1GJ5H 1IQJA 2CJIA 4YT7H 2A0QB 1EJMA 1W0YH 1QJ7B 2FLRH 1KDQA 2GVFA 4TWWA 2ZDAH 5GXPA 2G81E 4ZKOU 5JDUB 2AIPA 2SGEE 3N7OA 4IMQA 1GI2A 5E8EH 1Y5AT 1LPGB 5C20A 4DGJA 3CS7A 5GCHF 1ZSJA 3RXFA 1QA7A 1BMAA 2ZFSA 4B1TA 1X7AC 1EB1H 5F8XA 2BY7X 2HNTE 4I8GA 4ZROA 3TNTA 3ZVGA 4NGAH 3VB7A 1TPAE 1G37A 3LIWA 5EPYA 2VH6A 1E35B 2PV9B 3A80A 5HM2A 1YLCA 3RC6A 3IG6B 4IN1A 1EOJA 1LPZB 3RXDA 5H4IB 3VB4A 5E2PA 3TLOA 1O3CA 1KXBA 1NM6A 3VPKA 1W10U 4B2BA 1MU6B 1BTZA 1UHBA 1C5SA 2F9VA 3SJKA 3A7YA 3RC4A 2H9HA 1A2CH 3MWIU 4UDWH 5I46H 4UEHH 3BEFB 4UONA 1GBDA 1ZOMA 1MKXK 4CRFA 2CN0H 2WUCA 5LH8A 1G32B 2WV4A 2F9PA 3QWCH 4GHQA 3RUOA 1FXYA 2ZZUH 3RM2H 2F9NA 2QF0A 1GGDB 3BSQA 1QA0A 2VIDA 1HFDA 3EA8A 2EI7A 1GBIA 2FPZA 1PPFE 1W12U 2AMQA 1ESTA 3G01A 4RKJB 2GCHF 1YPMH 2PSYA 1GL0E 1ELGA 4ZHMU 1SVPA 1E0FD 3GICB 2B9LA 1ZR0A 3ZZ4A 4JYTA 5AFYH 2YOLA 1QB1A 2TBSA 2BMGB 2HRVA 1RS0A 2OC8A 1OWHA 3HGPA 5FX6A 3A89A 3MO9A 1O35A 3RMMH 3RXMA 3A8DA 1KXFA 2GX4A 4ZKSU 1C5PA 4X8TH 2ZI2H 5GIBA 3BEIB 1XUIA 2R0KA 5T6GA 2H9TH 2ZA5A 2EI6A 1C1PA 4CRGA 4AB8A 4CHAB 1BOQA 3S9CA 3U1IB 1BBRK 2BD5A 1TPSA 1FN6A 1O5FH 3MH4A 1P06A 2M5TA 1E36B 5EODA 2I6SA 4CH2B 4Y7BA 1TNHA 4CREA 2BVSH 1PQ8A 1SGFG 4B76A 4TWYA 1SHYA 3LGUA 3E16B 2GZ7A 1IQEA 3UWIA 1BMMH 3NKKA 5AF9H 3RXAA 5FAHA 4HZHA 1A5GH 2BDGA 5FHTA 1IQLA 1ANDA 4HI3A 1EXFA 1A7SA 1HXEH 1SGEE 1V2PT 1VGCC 5IDKA 2RA0A 3V0XA 5GDSH 2AGGX 1P9UA 2QCYA 4IN2A 3F1SB 1OYTH 1THRH 2C3SA 5A0CA 1A5HA 3HK3B 3T27A 5GCHG 1P2QA 2ZG0H 4R8TB 1HAVB 5CHAB 2VWMA 3GY8A 1C4Y2 5TJXA 1GBKA 1HLTH 2FI5E 4AYVB 3W94A 4X6MA 1S84A 3K6ZA 5FBEA 1LHCH 4OS1A 3E90B 1NU7B 1GBJA 2Q6DA 2D1JA 4ZAEA 4ABHA 5F03A 1NU9A 2BQWB 5L2YH 4FUCA 3CENA 3U1JB 3UQVA 1F5KU 4BXWA 2Z9IA 1TOCB 1AFEH 1VGCB 2AS9A 1F0RA 4LOYH 1GBAA 1SSXA 4OS2A 5GWZA 1C5XB 5JB9S 1ZTKA 3KNXA 1ZPBA 8ESTE 4ABEA 1CBWC 2FIRH 4ZKNU 1O5GH 2FOHA 3QTOH 1HCGA 3UTUH 3QDZB 2IJOB 3LGWA 2BXTH 2JH5D 4AOQA 1Q31A 1UTNA 3RXVA 1JOUB 2FI3E 4NIWA 1C5YB 4KTCA 2TIOA 1BBRE 1O3JA 1YPHE 1QFKH 1KSNA 3A7TA 3K2UA 4E7RG 1IQMA 3Q3XA 3Q77A 2F9BH 1VITG 3M3VA 7KMEH 2CHAC 4TPYA 4I33A 1W14U 1WSSH 1HJ9A 4MQAA 1GCDA 2ZFRH 1ZLRA 5EG4A 1CHOG 3O8BA 4X8SH 3WY8A 3SUGA 1Z1JA 2A7CA 1S85A 1PFXC 1RXPA 2ILNA 5IYTA 3O8CA 5A0BA 3QX5H 4MG3A 3M37A 1TWXB 3ZVEA 2Y5HA 1YPJH 1AMHA 3TGKE 2J92A 2ALVA 3BG4C 1Z8RA 3EYDA 4AFSA 1O3HA 1SL3A 3URCA 1NRSH 4JMYA 3S0NA 1IAUA 1F7ZA 2SGFE 3FFGA 1SGNE 3SO3A 5CE1A 1EZQA 4MNYA 1BRCE 3QTVH 3A7ZA 2FMJA 4FUDA 4WXIA 2A31A 3RDZA 3SJOA 3PB1E 2Q6FA 1GHBF 4IGDA 2VVCA 5LPFA 1V2OT 3L3TA 3TGIE 1N8OC 1O2TA 5ETXA 4Y71A 1BIOA 2V0BA 2ZKSA 1MKWH 1TAWA 1YPHC 2VVUA 1QB9A 1SOTA 2TGDA 3ZZ7A 1YGCH 2QGRA 1KIGH 2FYQA 1FMGA 1GI7B 3SQEE 1O2RA 2IN2A 3DA9B 1VCWA 4H4FA 1FNIA 1CU1A 4U01A 2A2XH 1K1LA 4MNWA 1VZQH 1C9PA 5E2OA 3TK5A 4FVDA 1ANEA 2RA3A 1C1SA 1ORFA 2SNVA 1OWKA 1C5TA 2OBOA 1DPOA 1TIOA 1EPTC 3BTQE 1GHBG 4GCHF 1GI4A 1NFYA 3ZV9A 3M5OA 1DWEH 1F0TA 5CHAC 3UOUA 1UMAH 1UTJA 4Y8YA 2AEIH 5FPSA 3T2NA 3PMHB 1A3EH 2VJ1A 2HWLB 3TH4H 2BOKA 4PROA 4BTIB 2WYJA 2ZHEH 3BTEE 5AHGH 1HDTH 3TPIZ 2ULLA 2STBE 1J9CH 1TMUH 1BZXE 1P2IA 2OINA 3DT0H 2FI4E 3V7TA 5C3NA 4K3JA 1HAIH 1DSTA 2P93A 4AN7A 1GBCA 1NPMA 4K8BA 1C5RA 1TRNA 2EI8A 4HFPB 2PKSB 1CA0B 1O5CB 4D76A 3RXRA 1BJVA 5DPAA 2W3IA 1V6DA 1C1NA 4DOQA 2A4OA 3RMLH 2HLCA 1QQ4A 1MQ6A 3L33A 3K6YA 1A3BH 1MKWK 1UTKA 4INHA 4OS4A 1T4VH 1SI5H 3P95A 3LKWA 1K9OE 1RFNA 2QXJA 1H9HE 3EQ0H 1GDQA 1QBVH 1H4WA 2NU2E 3UFAA 5E0GA 1QY6A 2PKAA 4GPGA 3RXBA 3T29A 1ID5H 5C5OA 1GVLA 3VGCB 2J38A 1YBWA 3LJOA 1S81A 3PM3A 3OU0A 3RMOH 5SGAE 4UFDH 2SNWA 1P9SA 3VB5A 1QHRB 1GG6B 1NFWA 2ALPA 4MVNA 1J15A 1UCYK 3ITIA 5ABWA 3MU0A 3P17H 5F8TA 1T32A 1Y5BT 1ZGIA 1Y3VA 3PMAB 3R0FA 1UVOA 1GBTA 1FDPA 2QF3A 1V3XA 2A4RA 1G3DA 1OYQA 3F9FA 3MNCA 4ESTE 3V13A 1FPCH 1EOLA 2SGPE 4X8VH 6LPRA 2ZEBA 1AVWA 3RXGA 4FU9A 1QJ1B 2UUKB 3ZZ6A 3AASA 3EGKH 1Y59T 1O3BA 4Y8XA 1W7XH 2ZCLP 4BTUB 3TVJB 2G51A 4ZHAA 4AFQA 1TX6A 2PHBA 3UQOA 2GDDA 1SGYE 1LVMA 1JMOH 4FUFA 3SUDA 1P2NA 5AVDA 3ZZBA 2PUQH 1ZZZA 1KLJH 1D9IA 1U6QA 3ATLA 4FUHA 1GVKB 1SLXB 1JIRA 1D6WA 3ZZCA 3M7TA 4U2WA 1CGIE 5T6DA 1L1GA 1YF4A 1MMJN 5FCKA 1UTMA 3EE0B 1CA0C 3LGVA 5EU8A 2Z3DA 2GMTC 3RU4E 4A1TA 1A1RA 3P8GA 3RMNH 4BOHA 4O9VA 3UREA 4JZ1A 1O2JA 1NS3A 3RLWH 1K1IA 4WJG2 3ATKA 4YESB 2XC5A 1EB2A 3LPRA 4A1VA 1FY1A 1O2HA 2BM2A 1AHTH 3GCOA 1G3CA 3E0PB 2XC4A 3URDA 1O2IA 3BTME 3HPTB 4ZH8A 1INCA 1AY6H 2FODA 3A85A 1H8IH 2AGEX 1W13U 4JYUH 7GCHG 1SGRE 2NU1E 3T5FH 2HALA 4K60A 3NCLA 1L1JA 3KQDA 3FANA 4AYYB 1C5LH 2BYAX 1VJ9U 2WV5A 2JKHA 3SNBA 4A1XA 3KIDU 3SHAH 1GCTB 1P57B 1NN6A 4BANB 3MHWU 1AD8H 1AIXH 4GCHG 1S6HA 2A45B 1YC0A 1CGHA 1P2OA 2FLBH 2OLGA 1TBQH 2SGDE 3M35A 2FX6A 2TGAA 3DHKH 1QURH 4FUIA 4OS5A 1OWEA 1ZMLA 2OC1A 4CBNA 4CRDA 1F0SA 6CHAB 3GDSA 1WQVH 1V2LT 3QO6A 4K2YA 4X8UH 1QGFA 4Y0ZE 4YM9A 5A0AE 2VWOA 2BLOA 1O5BB 4O3TA 3PYHA 5LPRA 4D7FA 3SGAE 2ANYA 1NRNH 4H6SB 3B23B 2ZU2A 5C5NA 1A0HB 1MTVA 4CBOA 4I8KA 4CRAA 1YPGH 2Y5FA 3C27B 2P94A 3TK6A 1UK2A 1DDJA 2ESTE 2GCTB 1P05A 4OGXA 1GDUA 1MTWA 2ZF0H 2OQUA 1XUKA 3SU3A 1EAXA 4GAWA 1FUJA 1HB0B 2HOBA 1GMDG 1TX8A 3ZVDA 1SLVB 2AH4X 2UUYA 3GCHB 2YNAA 1J16A 3MFJA 1EZSC 2P16A 1VR1H 3IITA 4JK5A 3QZQA 2ODYB 1TNLA 2A4QA 4MPVA 2NU4E 1ELTA 1GHXH 1O5DH 1ELEE 1O0DH 4YTAA 2H1UA 2GT7A 2BVRH 1SMFE 4JK6A 4Y7AA 3BV9B 2O8UA 5J4QA 5FPTA 3SV7A 5FCRA 1YPKH 2QV1A 1C1UH 3FAOA 1SGQE 3M5MA 2ZDVH 1A61H 4U30A 3GY4A 1TRMA 5EPNA 1TALA 3RXEA 1V2MT 4NA9H 5DG6A 1HAXB 4D8NA 3MNBA 3VXEH 4AG1A 4WY3A 4Y6DA 2XC0A 3MH7A 1EJAA 3HATH 2BZ6H 1BA8B 2Q1JA 3PO1B 3ZYDA 5C2ZA 4IW4E 1A5IA 2A1DB 2AMDA 1CHGA 3LGTA 1YYY1 2F9UA 2A5KA 1P2KA 2FS8A 5DP8A 3UY9A 4AGJA 1W7GH 1ZSKA 2B5TB 9LPRA 1C5QA 3ELAH 2JH6D 1K1OA 2BY6X 2EEKA 3EA9A 1GG6C 3GDVA 3VB3A 4DW2U 1BTHH 6GCHG 5EOKA 1THPB 3LU9B 3PMBB 1QIXB 1GJAB 1TA6A 1ACBE 1P12E 1PPBH 1Z8JB 1EUFA 2BB4A 2XW9A 1FV9A 1B0EA 3SJ9A 3PLPA 3GOVB 1HJAB 1GI3A 1ABJH 1NT1A 1TE0A 2ZDLA 2W7UA 2UUJB 2BD7A 5ESBA 3SQHE 1GHAF 4MPUA 1SLWB 4SGBE 5I25A 2FYRA 1TPOA 2VINA 1O3KA 5GJ4B 3P8NA 2XWBI 1FZZA 4BAQB 1ZRBA 1IOEA 2ZHDA 4IMZA 4Q7YA 1EP5A 3LGYA 1EAIA 1ESAA 3TU7H 4YT6H 1S0RA 1L4ZA 4B73A 4X6OA 3KHVA 2BQ7B 1O2ZA 3C1KA 4FUBA 1XM1A 1DUAA 5A8XA 2PKSC 1GBLA 3RXJA 1K28D 1O2OA 2C4FH 1ZHPA 4X1QU 1JWTA 1PQ7A 2PKAB 1T8OA 3GY5A 1BTYA 5T3HA 5E0JA 2J34A 3SUFA 1PPHE 5EQRA 1BT7A 1PPEE 1SHHB 3ATWA 4F49A 3RXQA 7ESTE 2AMPA 1LVYA 3E91A 1Y3YA 1OOKB 2VWNA 1LVOA 4FU7A 4YOIA 1VCPA 1PYTD 1TB6H 1AI8H 2VH0A 3M3SA 4WMEA 2A2QH 4DIIH 2PSXA 4KELA 2FOMB 4YO9A 1TOMH 1E37B 3P8OA 3A7XA 1HGTH 1ZHMA 3KQCA 4E05H 1UVTH 4WH6A 1O31A 1BRUP 5HM9A 1ETRH 2EC9H 3MH6A 2QXHA 3ODFA 2BD4A 5DP7A 3RXSA 1EKBB 1CSOE 1H9IE 3Q76A 2ZCHP 1BMNH 3UR9A 4YLUA 3HKJB 2C93B 3OSYA 3SNAA 1O2QA 2O8LA 1AZZA 2FTLE 1O5EH 3MNSA 3KF2A 1PYTC 4BNRA 4ABGA 1QTFA 4ABDA 5TCCA 1TMBH 1LHDH 1UTLM 3SNDA 1C2LA 1RIWC 3H5CB 4ISLA 2V6NA 1DVAH 3M36A 4B74A 1UTPA 2NU0E 1O2GH 3U8OH 2Z6BD 4AZ2B 4IC5A 1ZJDA 2D26C 2WYGA 3E3TA 3RXKA 4NA7A 1P3CA 4F4OC 3A81A 2WPJS 1A46H 1C5OH 3B8JA 1TRYA 1UTQA 2ZPQA 1KLTA 1UO6A 4NSVA 1QCPA 1O2XA 3A84A 1J14A 2OP9A 4JZDH 2NWNA 1P09A 2I6QA 3VEQB 2C90B 1Z1IA 2ZQ2A 1L4DA 2PLXA 2VIVA 5JBAS 1XUFA 1TBRH 3RXIA 1WAYB 1TBZH 1GMHG 1KXEA 3SGQE 2BLQA 1O3NA 1NRQH 1MTUA 1AWHB 1S5SA 1E38B 3E6PH 3GYLB 3QZRA 1MUEB 3ZZDA 5B6OA 1O2YA 1GCTC 3TJVA 1QL9A 2BLWA 1SGIB 2G8TA 5BRRE 2DE9A 1S6FA 1GI8B 1YKTA 2A7HA 1TA2A 2ZCKP 3BIUH 2FEQH 2BX3A 1BQYA 1XUJA 2FXRA 4AG2A 3MOCA 1ETSH 3TITA 1E34B 1O5AB 1AB9C 1BRBE 5HGGA 1BTPA 1CVWH 2JETC 4ISOA 1DM4B 1YP9A 6CHAC 1XXDA 1P04A 1EZUC 1D3DB 3AAUA 1HV7A 1TNIA 1O39A 3EDXB 1C4V2 1GJ8B 2PGQB 2FM2A 3SI3H 2ODPA 2XXLA 1HXFH 3Q3YA 3RLYH 1FAXA 1ZGVA 3U69H 3ZZ9A 3F6UH 2RDLA 2BY9X 1QRWA 3TNSA 2ZDKA 2QN5T 3STJA 1WYKA 1W3CA 1C9TA 3K9XB 3D49H 3SBKA 3TJUA 1WUNH 2Z3CA 2BD2A 3STIA 4XDEA 2CF8H 1O36A 2AGIX 5AFZH 3RXHA 2VIOA 3RXCA 3SZNA 1G2MA 2SFAA 3U98H 1XUHA 1GJ4H 3AW1A 1FPHH 2ZFFH 3GDUA 1TGSZ 2BDCA 1GHVH 2GP9B 1O3DA 2G4UA 1CO7E 2ZGJA 3F68H 4X2WA 5F6MA 2ZPSA 4K5ZA 5J4SA 3ATMA 3MO3A 1YCPM 3A7WA 1O2SA 1TMTH 1V2WT 6GCHF 1AUJA 3A86A 1XVMA 2ZHFH 1OSSA 2AERH 3S7HB 1GBMA 1V2UT 2A4GA 3U8TH 4WWYA 2ZDMA 1GI5A 1K1NA 1Y3WA 2YNBA 4IC6A 1RD3B 1O3PB 2OUAA 3SUEA 3DFJA 2J9NA 4IBLH 1Y5UT 3UIRA 3MU5A 4Y11E 3M7QA 1M9UA 2C8YB 5G4BA 1WTGH 4YLQH 1AFQC 4FVBA 1B0FA 2GV7A 3VGCC 1P2JA 8KME2 3CP7A 4UFEH 1ABIH 1AQ7A 1AUTC 3SJIA 1GJ9B 4X1PU 1GMCG 1FIWA 1C2KA 5EW2H 4NCYA 1BB0B 1DE7H 1F5RA 1BJUA 1SFQB 1AO5A 2AYWA 2QY0B 1TX7A 3M3TA 2ANKH 3ODDA 4Y76A 1N6YA 1LDTT 1WV7H 3A82A 4NFFA 2WPMS 1EASA 3ZVBA 1SBWA 1YPLH 3I29A 2UWLA 4BAHB 1RRKA 1GHYH 4CR9A 5C1YA 4Y8ZA 3ZZ8A 2BY8X 4ABJA 1P3EA 4ZUHA 3BIVH 4GUXA 1O3OA 3SNCA 1EQ9A 5ESTE 3P6ZB 1BHXF 2HGTH 3SV2H 2CHAB 2BDAA 2G5VA 1BBRH 4X1SU 5HXFA 1GL1A 2BZAA 3E0NB 2XWAA 9ESTA 1LHGH 3O8RA 1EAUA 4I8JA 2PWXA 1O3GA 2GMTB 2VIQA 1CBWB 1SGDE 1SPJA 2GGVB 3DUXH 1QL8A 2O8WA 5A2MH 2O8MA 1DFPA 3NK8A 1OP0A 1AB9B 1HNEE 1OXGA 3K65B 4IS5A 2QAAA 1EP6A 3AVZA 1MU8B 3E1XB 1C2IA 3LDXH 3JZ2B 4WVPE 1Z8IB 1ZPZA 1W2KH 4RN6A 1KXDA 1TLDA 2HNTF 2VU8E 1TQ7B 2XCNA 1GHWH 1L2EA 3Q00A 4MNXA 1MD7A 4TYDA 4FUEA 1GBFA 3BTTE 1TQ0B 3A8BA 1K1JA 1LPKB 3QK1A 2XRCA 4DT7B 1ELAA 3ZZAA 3SJ8A 1J17T 3BG8A 3MYWA 1A0JA 3F9GA 1UK3A 3HGNA 3AW0A 2OBQA 3BEUA 5DP3A 1PPCE 3FZDA 1ARBA 2G52A 1KYNA 4H6TA 2HVXA 4CRBA 2Y6TA 1V2KT 1NO9H 2RCEA 1EZXC 1O32A 4FU8A 1WBGB 2XBYA 5DP9A 2B8OH 1ZTJA 1ELVA 2J2UA 4U32A 3RU4D 5K0HA 1Y8TA 4XSKU 1UJ1A 2Z94A 4BTTB 3VB6A 1ELDE 2FOGA 7LPRA 2WPIS 1LQEA 2ZGCA 4FXGH 4K1SA 2HNTC 3RM0H 3SOSA 1AKSA 2J4IA 5FX5A 2Y7ZA 1SGFA 3T28A 3GY3A 2P8OC 4NIVA 1Z7KA 1IQIA 3ESTA 3TJNA 8LPRA 3KN2A 1OP8A 1C1VH 3SU6A 2FESH 1GI0A 3BG4B 3SV9A 4NZQA 1W11U 4KKDA 1KY9A 1QB6A 1AZ8A 1JIMA 2BOHB 1LQDB 1MD8A 1MH0A 3F9EA 1NRRH 2QXGA 1JXPA 2Z9GA 1P01A 1MZAA 1OP2A 2ODQA 1BCUH 2FS9A 4INKA 2P3TB 2D8WA 4MTBA 2OXSA 1QNJA 2BX4A 4ISNA 3SV6A 3QLPH 1G3EA 2FOFA 3MU4A 1PPGE 1C2DA 2STAE 3FP6E 3UR6A 2J95A 1NROH 4DJZB 3PWBA 1AU8A 4ZXYH 3KQBA 3LH3A 1N1LA 1C1QA 3O8DA 2SGAA 3QGJA 1HJ8A 1EPTB 3A8AA 2H2ZA 2Y81A 4QT8C 2WPKS 3NXPA 5FPYA 5K7RA 1W8BH 1L0ZA 2VGCB 2C8XB 4INLA 1C5VA 1MCVA 2ZQ1A 1D3TB 5JPMH 3MNXA 1P02A 1K1PA 1AE5A 1DT2A 2OQ5A 1SG8B 4NA8A 2P3UB 1BITA 4Q80A 2DE8A 1C2JA 1TABE 1AWFH 3LOXA 3KL6A 5LPEA 1LMWB 2A7JA 3ZVCA 5JBTA 4GLYA 1HAOH 1S82A 2UUFB 4AFUA 3D65E 3BTHE 4D7GA 1PQAA 4WMFA 2ZO3H 3T26A 2IPHA 1RGQA 2NU3E 2THFB 3H7OA 4GHTA 4MDSA 1ETTH 3T62A 2V35A 3M61U 4I7YH 1TNGA 2F83A 3S69A 4AFZA 3RXLA 1XMNB 2F3CE 3V12A 1GBBA 2A5IA 1C2HA 1HAHH 4Y0YE 5DKMA 1EJNA 3LJJA 4XBDA 1ANCA 1DICA 7GCHF 3MTYA 4DG4A 1NY22 5DO4H 2ZC9H 2FWWA 5EW1H 1DSUA 3NPSA 1KLIH 4I8HA 3LC3A 4ABBA 2QYIA 2WPLS 1EAWA 1O2WA 2ZFQH 4K1EA 5E0HA 2Z9JA 2W26A 1IQHA 3E8LA 3BTFE 1DWBH 3RXTA 2K1QA 2ZU3A 1O2UA 2EA3A 5DK1A 1HAPH 5TCAA 1F2SE 3SW2B 2BHGA 2Q6GA 1Q2WA 1GDNA 2G55A 2ZNKH 2R2MB 2CGAA 1GMDF 1O34A 3GISB 2QXIA 1WTHD 4M7GA 2BDIA 3TGJE 1SR5C 2AIQA 4XBBA 3MO6A 4SGAE 1EPTA 2ANWA 1G2LA 1FY5A 4ISHH 1T8MA 1K21H 1Z6EA 3ZVFA 2VIPA 1BDAA 1GBHA 4WF8A 3GCNA 2KAIB 1KDQB 3OYPA 3KEEA 2O9QA 2H5CA 3SU2A 1S0QA 1C2EA 1BTUA 4X6PA 1V2VT 5BPEA 2G4TA 3IWMA 1T8NA 1MTNC 1GMCF 1SGTA 1PQ5A 5LGOA 1C5NH 4UE7H 2Y7XA 3BTWE 1C1MA 1D3PB 3KQEA 3GY6A 2HPQH 4ABIA 1ZYOA 4O97A 2A5AA 1QJ6B 1QBNA 4X2VA 3EA7A 1K22H 1D6RA 4TY7A 4Q2KA 2F9OA 5JB8S 2PW8H 4KTSA 1LHEH 2TGTA 2ZGBH 5EQQA 4AX9H 1MZDA 2Y80A 5PTPA 1GHAG 2F91A 5DJ7A 4NIXA 3RC5A 4ABAA 4NWKA 8GCHF 2R9PA 1SLUB 2RG3A 3RXPA 2TPIZ 3UNQA 3BTGE 1MQ5A 5DP5A 3SU5A 1P03A 1GJ6A 1YLDA 3RU4T 4OGYA 3AAVA 2ZFTA 4B2AA 1HIAB 2GT8A 2Z9KA 1DXPA 1SGCA 4MPXA 1HAVA 1OX1A 1UTOA 1P10A 3ATIA 3RP2A 1ZSLA 4XOJA 1P11E 2VWLA 1Z6JH 1P0SH 2GCHG 2UWOA 1T4UH 1SB1H 1OWDA 3SU4A 1SQOA 1QRZA 1BMLA 1GJBB 3LONA 2PTNA 2OTVA 5L6NH 1ZJKA 2ZHQH 1NFUA 3I78A 1O2PA 2ASUB 2VB0A 1V2JT 2GDEH 2WPHS 4TPIZ 3S7KB 8GCHG 1VITH 3D62A 1IQKA 3D23A 4XE4A 1IQGA 1MBQA 1ARCA 1AVGH 1ZRKA 4A92A 2ZU1A 1V2NT 4Q7ZA 2TGPZ 2P8OB 1FQ3A 4ASHA 1O30A 2LPRA 3OY5U 4GSOA 4J2YB 4K8YA 1VJAU 2CV3A 1O3EA 1LKBA 3W95A 1HUTH 4MNVA 1MCTA 2HPPH 1SQAA 4RKOB 3JZ1B 4THNH 1C1WH 4JCNA 4WXVA 3QGNB 4H42U 4A7IB 2PUXB 4MLFB 1DLEA 3TIUA 1KXAA 5EXLA 1IQFA 5EXNA 1C5ZB 2PGBB 2P95A 3R3GB 1DS2E 2FOCA 3U9AH 1ELCA 1QL7A 2XCFA 2PR3A 2GZ9A 1BRAA 4CR5A 1GVZA 2ZDNA 1T8LA 1P8VC 1XXFA 3ZVAA 3PROA 4DVAU 2BTCE 1RTLA 2D2DA 1LHFH 1BTWA 1HYLA 1VCQA 1RTKA 4Z0KA 1QR3E 1TGBA 1BHXB 3TJOA 3UOPA 2G5NA 4OS7A 3KCGH 2XNIA 1MKXH 5CMXH 1UVSH 3LH1A 2R0LA 4ZHLU 2FX4A 1JRSA 2VGCC 1DXWA 2Z7FE 1C1RA 2VIWA 3GYMA 4BXSA 5F8ZA 2VVVA 5JBBS 3SORA 4K69A 4K1TA 2ZWLH 3PLBA 2FDAA 4Q7XA 3V3MA 3GCHC 2XBWA 2FZZA 2Z9LA 1DOJA 3UNRA 1FLEE 1UVUH 1ESBA 1FI8A 1LCYA 1XX9A 2ZIQH 3SGBE 1G3BA 4X1RU 4A5TS 2XBVA 3MI4A 4NFEA 1O2KA 2ZTZA 1CA8B 5HYOA 1QBOA 3B9FH 4YOGA 1NESE 1DX5M 2WUBA 3GY7A 1UVPA 2R3YA 1CT0E 1HAGE 1O3LA 2SGQE 3VXFH 6ESTA 3NUMA 5EQSA 2ZU4A 1Y3UA 2QC2A 1B7XB 1CT2E 4NZLA 1C1OA 3KGPA 1O3MA 1MAXA 2W3KA 4UFGH 1C4U2 3RXUA 1Y3XA 1NZQH 1T31A 1SQTA 4BAKB 5L30H 1DANH 1K2I1 1MTSA 2BDHA 3GCTG 3U8RH 4X6NA 2OD3B 1CT4E 4JYVH 5JYIA 3TH2H 3PO1C 4B71A 3HK6B 1YCPH 1F0UA 5FBIA 1HRTH 2FOAA 3QUMP 4NSYA 1HJAC 3M5LA 2FO9A 3FZZA 2XTTB 1GBEA 5C1UA 3PTNA 1V2QT 2GV6A 2ZPRA 2A32A 4X0WU 1JBUH 2J94A 2BQ6B 1GGDC 2ZTYA 1PPZA 1Q3XA 3Q3KA 1D4PB 5T6FA 3BTDE 1HAZB 2PTCE 4BAOB 1DUEA 5GPIB 3GY2A 1WOFA 1IHTH 3A87A 1T7CA 1S83A 3BN9A 1TGCA 4LK4A 2B0FA 2BDBA 2GCTC 1DLKB 2XYAA 1B5GH 4B2CA 3ZV8A 2GKVE 1G36A 1DWCH 1SOZA 3MMGA 5FXLA 3DD2H 2Z3EA 3LT3A 3SHCH 3F9HA 2B7DH 1O3IA 4GVUA 4X2YA 2H9EH 3ZZ5A 3S9BA 1TFXA 2FP7B 3TK9A 1GJ7B 2H5DA 5EGMA 1BUIA 1O2NA 1AKSB 5DP6A 1FY8E 1SFIA 1XKAC 4DURA 4AORA 4KTUA 1AVXA 3SU1A 1TNJA 3OTJE 1GI6A 2ZTXA 2FOBA 1ANBA 1NFXA 4O03A 1GI1A 1ZTLA 1UCYE 1ZHRA 2BLVA 4HGCA 1H1BA 2AFQB 1OPHB 5C1XA 2ZU5A 2GTBA 5DP4A 4DIHH 2OCVB 1DWDH 4MPWA 2Y82A 1GJCB 1GMHF 4Y10E 1YCPK 4AB9A 2Y5GA 3LC5A 3LGIA 1IQNA 1VITF 1O2LA 1DY8A 4JZFH 1C5WB 5A09A 1G9IE 1TGTA 1THSH 4RSPA 1FN8A 4VGCC 1AFQB 4CH8B 3PV4A 2C8WB
chains in the Genus database with same CATH superfamily
4NG9H 4ZKRU 3SNEA 1TPPA 4OS6A 1L1NA 1C5UA 2JH0D 1C2FA 2OC7A 4YXWD 1V2ST 4D9QA 1OWIA 3QN7A 1HPGA 2BD3A 4P02A 1W0ZU 3S9AA 4E7NA 3TH3H 4ISIH 1AGJA 2IOTA 1FAKH 4A6LA 1N6XA 2J5UA 3MQKC 1GHZA 1WQSA 3VFEA 1LO6A 4FUJA 2BXUH 1C1TA 2BDYA 2GD4B 3PLKA 2ZHWH 4UFFH 1O37A 4NIYA 1GWAA 1F5LA 4FUGA 4NWLA 4ZMAH 1SGPE 1Z8GA 1XVOA 1KXCA 1YM0A 4YOJA 1H8DH 2HVYB 1DY9A 2V7QD 4DY7B 2CXVA 4CRCA 1LTOA 2GZ8A 4KP0A 2G00A 3SI4H 4CHAC 1XKBC 1O2VA 1D3QB 3MH5A 4I86A 5A8ZA 4LZ4B 1UHBB 4XFQA 4ABFA 3FKSD 2CMYA 3FP7E 1ZMNA 2O8TA 3UPEA 1KTTB 1J8AA 2W5EA 1RTFB 3CS0A 4X2XA 3FVFB 1MTNB 3A7VA 4R0IA 1CQQA 3UUZA 1V2TT 2F43B 4BAMB 1QRXA 2ZGHA 4Z6AH 4I31A 4TY6A 1O38A 1C5MD 1CE5A 1ELBA 1C2MA 5EXMA 2TRMA 4WH8A 1OKXA 2ZFPH 3PMJA 1A4WH 5L2ZH 2JETB 3ZZ3A 1HAYB 2W7SA 3UNSA 1ELFA 1OWJA 1O2MA 1O3AA 2VNTA 1DITH 1Z71A 4Y79A 3A88A 5A8YA 4JZIA 1GPZA 4YZUA 1IHSH 3OX7U 2PFEA 1RJXB 5C94A 2ZECA 1K1MA 1GJDB 2KAIA 5HKKD 2V3OH 3HKIB 3OY6U 1MBMA 3WWBA 1AN1E 2FTMA 4ZXXH 2BVXH 2P59A 1WCZA 1A0LA 2DUCA 1H9LB 1V2RT 4B6FA 1MAYA 2BD9A 2ZGXH 2H6MA 1TYNA 4O3UA 3ZYEA 4WMDA 4XBCA 1TONA 1XUGA 3UB0A 4D9RA 1UK4A 1SC8U 2P3FH 2R3UA 2QA9E 4JZEH 4VGCB 3MU1A 3NZIA 1LKAA 1GI9B 3M7UA 1NTPA 4KGAA 3A83A 1NRPH 1CGJE 3BF6H 2FOEA 3SU0A 3RXOA 3T25A 4UD9H 1ZMJA 1F92A 1PJPA 5KGOA 3DFLA 2ZP0H 1OS8A 3FP8E 1O33A 5JBCS 3EAJA 1ZPCA 1HBTH 4J1YA 3MU8A 1AE8H 1KTSB 1N8OB 1BTXA 1JRTA 3ENSB 3P8FA 5HMAA 3H7TA 1FIZA 3P92A 1FY4A 3A8CA 2XBXA 1FJSA 4HTCH 1NC6A 2QIQA 1QQUA 2BD8A 1TGNA 1LVBA 1EATA 4I32A 1P2MA 1RIWB 2ANMH 3PWCA 4B75A 3NWUA 3UWJH 1YPEH 1TNKA 4LXBH 3L6PA 3GCTF 4I8LA 1FONA 1G30B 3SN8A 3M5NA 2C8ZB 1WU1A 1EX3A 1CHOF 4X1NU 5DGJA 5C67A 3AK5A 2UWPA 2WINI 3P70B 4LZ1H 3PTBA 1FY3A 1O3FA 2R2WU 3BTKE 1UCYH 3SV8A 1HIAA 2BY5X 2OC0A 3PRDA 4DCDA 2LNCA 2CF9H 2V3HH 4E06H 3I77A 4AGKA 1C2GA 1GJ5H 1IQJA 2CJIA 4YT7H 2A0QB 1EJMA 1W0YH 1QJ7B 2FLRH 1KDQA 2GVFA 4TWWA 2ZDAH 5GXPA 2G81E 4ZKOU 5JDUB 2AIPA 2SGEE 3N7OA 3N7DA 4IMQA 1GI2A 5E8EH 1Y5AT 1LPGB 5C20A 4DGJA 3CS7A 5GCHF 1ZSJA 3RXFA 1QA7A 1BMAA 2ZFSA 4B1TA 1X7AC 1EB1H 3ZIAD 5F8XA 2BY7X 2HNTE 4I8GA 4ZROA 3TNTA 3ZVGA 4NGAH 3VB7A 1TPAE 1G37A 3LIWA 5EJLA 5EPYA 2VH6A 1E35B 2PV9B 3A80A 5HM2A 1YLCA 3RC6A 3IG6B 4IN1A 1EOJA 1LPZB 3RXDA 5H4IB 3VB4A 5E2PA 3TLOA 1O3CA 1KXBA 1NM6A 3VPKA 2KZ4A 1W10U 4B2BA 1MU6B 1BTZA 1UHBA 1C5SA 2J98A 2F9VA 3SJKA 3A7YA 3RC4A 2H9HA 1A2CH 3MWIU 4UDWH 5I46H 4UEHH 3BEFB 4UONA 1GBDA 1ZOMA 1MKXK 4CRFA 1E1RD 2CN0H 2WUCA 5LH8A 1G32B 2WV4A 2F9PA 3QWCH 4GHQA 3RUOA 1FXYA 2ZZUH 3RM2H 2F9NA 2QF0A 1GGDB 3BSQA 1QA0A 2VIDA 1HFDA 3DCLA 3EA8A 2EI7A 1GBIA 2FPZA 1PPFE 1W12U 2AMQA 1ESTA 3G01A 4RKJB 2GCHF 1YPMH 2PSYA 1GL0E 1ELGA 4ZHMU 1SVPA 1E0FD 3GICB 2B9LA 1ZR0A 3ZZ4A 4JYTA 5AFYH 2YOLA 1QB1A 2TBSA 2BMGB 2HRVA 1RS0A 2OC8A 1OWHA 3HGPA 5FX6A 3A89A 3MO9A 1O35A 3FO8D 3RMMH 3RXMA 3A8DA 1KXFA 2GX4A 4FOUC 4ZKSU 1C5PA 4X8TH 2ZI2H 5GIBA 3BEIB 1XUIA 2R0KA 5T6GA 2H9TH 2ZA5A 2EI6A 1W0JD 1C1PA 4CRGA 4AB8A 4CHAB 1BOQA 3S9CA 3U1IB 1BBRK 2BD5A 1TPSA 1FN6A 1O5FH 3MH4A 5C17A 1P06A 2M5TA 1E36B 5EODA 2I6SA 4CH2B 4Y7BA 1TNHA 4CREA 2BVSH 1PQ8A 1SGFG 4B76A 4ASUD 4TWYA 1SHYA 3LGUA 3E16B 2GZ7A 1IQEA 3UWIA 4XD7D 1BMMH 3NKKA 5AF9H 2IPQX 3RXAA 5FAHA 4HZHA 1A5GH 2BDGA 5FHTA 1IQLA 1ANDA 4HI3A 1WXRA 1EXFA 1A7SA 1HXEH 1SGEE 1V2PT 1VGCC 5IDKA 2RA0A 3V0XA 5GDSH 2AGGX 1P9UA 2QCYA 4IN2A 3F1SB 1OYTH 1THRH 2C3SA 5A0CA 1A5HA 3N7EA 3HK3B 3T27A 3PV5A 5GCHG 1P2QA 2ZG0H 4R8TB 1HAVB 5CHAB 2VWMA 3GY8A 1C4Y2 5TJXA 4OM9A 1GBKA 1HLTH 2FI5E 4AYVB 3W94A 4X6MA 1S84A 3K6ZA 5FBEA 1LHCH 4OS1A 3E90B 1NU7B 1GBJA 2Q6DA 2D1JA 4ZAEA 4ABHA 5F03A 1NU9A 2BQWB 5L2YH 4FUCA 3CENA 3U1JB 3UQVA 1F5KU 4BXWA 2Z9IA 1TOCB 1AFEH 1VGCB 2AS9A 1F0RA 4LOYH 1GBAA 1SSXA 4OS2A 5GWZA 1C5XB 4RI0A 5JB9S 1ZTKA 3KNXA 1ZPBA 8ESTE 4ABEA 1CBWC 2FIRH 3PRBA 4ZKNU 1O5GH 2FOHA 3QTOH 1HCGA 3UTUH 3QDZB 2IJOB 3LGWA 2BXTH 2JH5D 4AOQA 1Q31A 1UTNA 3RXVA 1JOUB 4Q4LA 2FI3E 4NIWA 1C5YB 4KTCA 2TIOA 1BBRE 1O3JA 1YPHE 1QFKH 1KSNA 3A7TA 3H09A 3K2UA 4E7RG 1IQMA 2JIZD 3Q3XA 3Q77A 2F9BH 1VITG 3M3VA 7KMEH 2CHAC 4TPYA 4I33A 1W14U 1WSSH 1HJ9A 4MQAA 1GCDA 2ZFRH 1VKYA 1ZLRA 5EG4A 1CHOG 3O8BA 1KMHB 4X8SH 3WY8A 3SUGA 1Z1JA 2A7CA 1S85A 1PFXC 1RXPA 2ILNA 5IYTA 3O8CA 5A0BA 3QX5H 4MG3A 3M37A 1TWXB 3ZVEA 2Y5HA 2KCPA 1YPJH 1AMHA 3TGKE 4F48B 2J92A 2ALVA 3BG4C 1Z8RA 3EYDA 4AFSA 1O3HA 1SL3A 3URCA 1NRSH 4JMYA 3S0NA 1IAUA 1F7ZA 2SGFE 3FFGA 1SGNE 3SO3A 5CE1A 3UAIC 2QE7D 1EZQA 4MNYA 1BRCE 3QTVH 3A7ZA 2FMJA 4FUDA 4WXIA 2A31A 3RDZA 3SJOA 3PB1E 2Q6FA 1GHBF 4IGDA 2VVCA 5LPFA 1V2OT 3L3TA 3TGIE 1N8OC 1O2TA 2AHME 5ETXA 4Y71A 1BIOA 2V0BA 2ZKSA 1MKWH 1TAWA 1YPHC 2VVUA 1QB9A 1SOTA 2TGDA 3ZZ7A 1YGCH 2QGRA 1KIGH 2FYQA 1FMGA 1GI7B 3SQEE 1O2RA 2KM0A 2IN2A 3DA9B 1VCWA 4H4FA 1FNIA 1CU1A 4U01A 4AC9A 2A2XH 1K1LA 4MNWA 1VZQH 1C9PA 5E2OA 3TK5A 4FVDA 1ANEA 2RA3A 5EJZA 1C1SA 1ORFA 2SNVA 1OWKA 1C5TA 2WSSD 2OBOA 1DPOA 1TIOA 1EPTC 3BTQE 4Z1MD 1GHBG 4GCHF 1GI4A 1NFYA 3ZV9A 3M5OA 1F0TA 1DWEH 5CHAC 3UOUA 1UMAH 1UTJA 4Y8YA 2AEIH 4RT0A 2L74A 5FPSA 3T2NA 3PMHB 1A3EH 2VJ1A 2HWLB 3TH4H 2BOKA 4PROA 4BTIB 2WYJA 2ZHEH 3BTEE 5AHGH 1HDTH 3TPIZ 4M9FA 2ULLA 2STBE 1J9CH 1TMUH 1BZXE 1P2IA 2OINA 3DT0H 2FI4E 3V7TA 5C3NA 4K3JA 1HAIH 1DSTA 2P93A 4AN7A 1GBCA 5DSFA 1NPMA 4K8BA 5EIYA 1C5RA 1TRNA 2EI8A 4HFPB 2PKSB 1CA0B 1O5CB 4D76A 3RXRA 1BJVA 5DPAA 2W3IA 1V6DA 1C1NA 4DOQA 2A4OA 3F2GA 4P00A 3RMLH 2HLCA 4ACBA 1QQ4A 1MQ6A 3L33A 3K6YA 1A3BH 1MKWK 1UTKA 4INHA 4OS4A 1T4VH 1SI5H 3P95A 3LKWA 1K9OE 1RFNA 2QXJA 1H9HE 3EQ0H 1GDQA 1QBVH 1H4WA 2NU2E 3UFAA 5E0GA 4TSFD 1QY6A 2PKAA 4GPGA 3RXBA 3T29A 1ID5H 5C5OA 1GVLA 3VGCB 2J38A 1YBWA 3LJOA 1S81A 3PM3A 1EFRD 3OU0A 3RMOH 3F3BA 5SGAE 4UFDH 2SNWA 1P9SA 3VB5A 1QHRB 1GG6B 1NFWA 2ALPA 4MVNA 1J15A 1UCYK 3ITIA 5ABWA 3MU0A 3P17H 5F8TA 1T32A 1Y5BT 1ZGIA 1Y3VA 2M2AA 3PMAB 3R0FA 1UVOA 1GBTA 1FDPA 2QF3A 1YWUA 1V3XA 2A4RA 1G3DA 1OYQA 3F9FA 3MNCA 4ESTE 3V13A 1FPCH 1EOLA 2SGPE 4X8VH 6LPRA 2ZEBA 1AVWA 3RXGA 4FU9A 1QJ1B 2UUKB 3ZZ6A 3AASA 3EGKH 1Y59T 1O3BA 4Y8XA 1W7XH 2ZCLP 5CDFE 4BTUB 3TVJB 2G51A 4ZHAA 4AFQA 1TX6A 2PHBA 3UQOA 2GDDA 1SGYE 1LVMA 1JMOH 4FUFA 3SUDA 1P2NA 5AVDA 3ZZBA 2PUQH 1ZZZA 4ACAA 1KLJH 1D9IA 4Q63A 1U6QA 3ATLA 4FUHA 1GVKB 1SLXB 1JIRA 1D6WA 3ZZCA 3M7TA 4U2WA 1CGIE 5T6DA 1L1GA 1YF4A 1MMJN 2F4LA 5FCKA 1UTMA 3EE0B 1CA0C 3LGVA 5EU8A 2Z3DA 2GMTC 3RU4E 4A1TA 1NBME 1A1RA 3P8GA 3RMNH 4BOHA 4O9VA 3UREA 4JZ1A 1O2JA 1NS3A 2LELA 3W1EA 3RLWH 1K1IA 4WJG2 3ATKA 4YESB 2XC5A 1EB2A 3LPRA 4A1VA 1FY1A 1O2HA 2BM2A 1AHTH 2YMSB 3GCOA 1G3CA 3E0PB 2J98B 2XC4A 3URDA 1O2IA 5KEDA 3BTME 3HPTB 4ZH8A 1INCA 1AY6H 2FODA 3A85A 1H8IH 2AGEX 1W13U 4JYUH 7GCHG 1SGRE 2NU1E 3T5FH 2HALA 4K60A 3NCLA 1L1JA 3KQDA 3FANA 4AYYB 1C5LH 2BYAX 1VJ9U 2WV5A 2JKHA 3SNBA 4A1XA 3KIDU 3SHAH 1GCTB 1P57B 1NN6A 4BANB 3MHWU 2WV9A 1AD8H 3SYJA 1AIXH 4GCHG 1S6HA 2A45B 1K0HA 1YC0A 1CGHA 1P2OA 2FLBH 2OLGA 1TBQH 2SGDE 3M35A 2FX6A 2TGAA 3DHKH 1QURH 4FUIA 4OS5A 1OWEA 1ZMLA 2OC1A 4CBNA 4CRDA 1F0SA 6CHAB 3OEED 3GDSA 1WQVH 1V2LT 3QO6A 4K2YA 4X8UH 1QGFA 4Y0ZE 4YM9A 5A0AE 2VWOA 2BLOA 1O5BB 4O3TA 3VG8A 3PYHA 3OEHD 5LPRA 4D7FA 3SGAE 2ANYA 1NRNH 4H6SB 3B23B 2ZU2A 5C5NA 1A0HB 5GNDA 1MTVA 4CBOA 4HG6A 4I8KA 4CRAA 1YPGH 2Y5FA 3C27B 2P94A 3TK6A 1UK2A 1DDJA 2ESTE 2GCTB 3KYFA 1WDIA 1P05A 4OGXA 1GDUA 1MTWA 2ZF0H 2OQUA 1XUKA 2EY4C 3SU3A 1EAXA 4GAWA 1FUJA 1HB0B 2HOBA 1GMDG 1TX8A 3ZVDA 1SLVB 2AH4X 2UUYA 3GCHB 4XRNA 2YNAA 1J16A 3CNRA 1EZSC 3MFJA 2P16A 1VR1H 3IITA 4JK5A 3QZQA 2ODYB 1TNLA 2A4QA 4MPVA 2NU4E 1ELTA 1GHXH 1O5DH 1ELEE 1O0DH 4YTAA 2H1UA 2GT7A 5C0TA 2BVRH 1SMFE 4JK6A 4Y7AA 3BV9B 2O8UA 5J4QA 5FPTA 3SV7A 5FCRA 1YPKH 2QV1A 1C1UH 3FAOA 1SGQE 3M5MA 2ZDVH 1A61H 4U30A 3GY4A 1TRMA 5EPNA 1TALA 3RXEA 1V2MT 4NA9H 5DG6A 1HAXB 4D8NA 3MNBA 3VXEH 4AG1A 4WY3A 4Y6DA 2XC0A 3MH7A 1EJAA 3HATH 2BZ6H 1BA8B 2Q1JA 3PO1B 3ZYDA 5C2ZA 4IW4E 1A5IA 2A1DB 2AMDA 1CHGA 3LGTA 1YYY1 2F9UA 2A5KA 1P2KA 2FS8A 5DP8A 3UY9A 4AGJA 1W7GH 1ZSKA 2B5TB 9LPRA 1C5QA 3ELAH 2JH6D 1K1OA 2BY6X 2EEKA 3EA9A 1GG6C 3GDVA 3VB3A 4DW2U 1BTHH 6GCHG 5EOKA 1THPB 3LU9B 3PMBB 1QIXB 1GJAB 1TA6A 3N99A 1ACBE 1P12E 1PPBH 1Z8JB 1EUFA 2BB4A 2XW9A 1FV9A 1B0EA 3SJ9A 3PLPA 3GOVB 1HJAB 1GI3A 1ABJH 1NT1A 1TE0A 2ZDLA 2W7UA 2UUJB 2BD7A 5ESBA 3SQHE 1GHAF 4MPUA 1SLWB 4SGBE 5I25A 2FYRA 1TPOA 2VINA 1O3KA 5GJ4B 3P8NA 2XWBI 1FZZA 4BAQB 1ZRBA 1IOEA 2ZHDA 3DSGA 4IMZA 4Q7YA 1EP5A 3LGYA 1EAIA 1ESAA 3TU7H 4YT6H 1S0RA 1L4ZA 4B73A 4X6OA 3KHVA 2BQ7B 1O2ZA 3C1KA 4FUBA 1XM1A 1DUAA 5A8XA 2PKSC 1GBLA 3RXJA 1K28D 1O2OA 2C4FH 1ZHPA 4X1QU 1JWTA 1PQ7A 2PKAB 1T8OA 3GY5A 1BTYA 5T3HA 5E0JA 2J34A 3SUFA 1PPHE 5EQRA 1BT7A 1PPEE 1SHHB 3ATWA 4F49A 3RXQA 7ESTE 2AMPA 1LVYA 3E91A 1Y3YA 1OOKB 1W0KD 2VWNA 1LVOA 4FU7A 4YOIA 5T1VA 1VCPA 1PYTD 1TB6H 2YMSD 1AI8H 2VH0A 3M3SA 4WMEA 2A2QH 3DSPA 4DIIH 2PSXA 2LP6A 4KELA 2FOMB 4YO9A 1TOMH 1E37B 4ZCNA 3P8OA 3A7XA 1HGTH 1ZHMA 3KQCA 4E05H 1FX0B 4DT4A 1UVTH 4WH6A 1O31A 1BRUP 5HM9A 1ETRH 2EC9H 3MH6A 2QXHA 3ODFA 2BD4A 5DP7A 3RXSA 1EKBB 1CSOE 1H9IE 3Q76A 2ZCHP 1BMNH 3UR9A 4YLUA 3HKJB 2C93B 3OSYA 3SNAA 1O2QA 2O8LA 1AZZA 2FTLE 1O5EH 3MNSA 3KF2A 1PYTC 4BNRA 4ABGA 1QTFA 3F2FA 4ABDA 2JDID 5TCCA 1TMBH 1LHDH 1UTLM 3SNDA 1C2LA 1RIWC 3H5CB 4ISLA 2V6NA 1DVAH 3M36A 4B74A 1UTPA 2NU0E 1O2GH 3U8OH 2Z6BD 4AZ2B 4IC5A 1ZJDA 2D26C 2WYGA 3E3TA 3RXKA 4NA7A 1P3CA 4F4OC 3A81A 2WPJS 1A46H 1C5OH 3B8JA 1TRYA 1UTQA 2ZPQA 1KLTA 1UO6A 4NSVA 1QCPA 1O2XA 3A84A 1J14A 2OP9A 4JZDH 2K0QA 2NWNA 1P09A 2I6QA 3VEQB 2C90B 1Z1IA 2ZQ2A 1L4DA 2PLXA 2VIVA 5JBAS 1XUFA 1TBRH 2WHXA 3RXIA 1WAYB 1TBZH 1GMHG 1KXEA 3SGQE 2BLQA 1O3NA 1NRQH 1MTUA 1AWHB 5B6LA 1S5SA 1E38B 3E6PH 3GYLB 3QZRA 1MUEB 3ZZDA 5B6OA 1YLNA 1O2YA 1GCTC 5IK2D 3TJVA 1QL9A 2BLWA 1SGIB 2G8TA 5BRRE 2DE9A 1S6FA 1GI8B 2L6OA 1YKTA 2A7HA 1TA2A 2ZCKP 3BIUH 5CHBA 2FEQH 2BX3A 4RT1A 1BQYA 1XUJA 2FXRA 4AG2A 3MOCA 1ETSH 2GJGA 3TITA 1E34B 1O5AB 1AB9C 1BRBE 5HGGA 1BTPA 1CVWH 2JETC 4ISOA 1DM4B 1YP9A 6CHAC 1XXDA 1P04A 1EZUC 1D3DB 3AAUA 1HV7A 1TNIA 1O39A 2JJ2D 2XOKD 1C4V2 1GJ8B 2PGQB 3EDXB 2FM2A 3SI3H 2ODPA 2XXLA 1HXFH 3Q3YA 3RLYH 1FAXA 1ZGVA 3U69H 3ZZ9A 3F6UH 2RDLA 2BY9X 1QRWA 4TT3D 2ZDKA 3TNSA 2QN5T 3STJA 1WYKA 1W3CA 1C9TA 3K9XB 3D49H 3SBKA 3TJUA 1WUNH 2Z3CA 2BD2A 3STIA 4XDEA 2CF8H 1O36A 2AGIX 5AFZH 2RDEA 2VIOA 3RXHA 3U28C 3RXCA 3SZNA 1G2MA 2SFAA 1NBMD 3U98H 1XUHA 1GJ4H 3AW1A 1FPHH 2ZFFH 3GDUA 1TGSZ 2BDCA 1GHVH 2GP9B 1O3DA 2G4UA 1CO7E 2ZGJA 3F68H 4X2WA 5F6MA 2ZPSA 1YY3A 4K5ZA 5J4SA 3ATMA 3MO3A 1YCPM 3A7WA 1O2SA 1TMTH 1V2WT 6GCHF 1AUJA 3FN8A 1MABB 3A86A 4B6EA 1XVMA 2ZHFH 1OSSA 2AERH 3S7HB 1GBMA 1V2UT 2A4GA 3U8TH 4WWYA 2ZDMA 1GI5A 1K1NA 1Y3WA 2YNBA 4IC6A 1RD3B 2VBCA 1O3PB 2OUAA 3SUEA 3DFJA 2J9NA 4IBLH 1Y5UT 3UIRA 3MU5A 4Y11E 3M7QA 1M9UA 2C8YB 5G4BA 1WTGH 4YLQH 1AFQC 4FVBA 1B0FA 2GV7A 3VGCC 1P2JA 8KME2 3CP7A 4UFEH 1ABIH 3OAAD 1AQ7A 1AUTC 3SJIA 1GJ9B 4X1PU 1GMCG 1FIWA 2J97A 1C2KA 2IJD1 5C0UA 5EW2H 4NCYA 1BB0B 1DE7H 1F5RA 1BJUA 1SFQB 1AO5A 2AYWA 2QY0B 1TX7A 1OHHD 3M3TA 2ANKH 3ODDA 4Y76A 1N6YA 1LDTT 1WV7H 3A82A 4NFFA 2WPMS 1EASA 1BMFD 3ZVBA 1SBWA 1YPLH 3I29A 2UWLA 4BAHB 1RRKA 1GHYH 4CR9A 5C1YA 4Y8ZA 3ZZ8A 2BY8X 4ABJA 1P3EA 4ZUHA 3BIVH 4GUXA 1O3OA 3SNCA 1EQ9A 5ESTE 3P6ZB 1BHXF 2HGTH 1E79D 3SV2H 2CHAB 2BDAA 2G5VA 1BBRH 4X1SU 5HXFA 1GL1A 2BZAA 3E0NB 2XWAA 9ESTA 2W6JD 5EJ1A 1LHGH 3O8RA 1EAUA 2KR7A 4I8JA 2PWXA 1O3GA 2GMTB 2VIQA 1CBWB 1SGDE 1SPJA 2GGVB 3DUXH 1QL8A 3WW7A 2O8WA 1SKYE 5A2MH 2O8MA 1DFPA 3NK8A 1OP0A 5KECA 1AB9B 1HNEE 1OXGA 3K65B 4IS5A 2QAAA 1EP6A 3NRLA 3AVZA 1MU8B 3E1XB 1C2IA 3LDXH 3JZ2B 4WVPE 1Z8IB 1ZPZA 1W2KH 2YMSC 4RN6A 1KXDA 1TLDA 2HNTF 2VU8E 1TQ7B 2XCNA 1GHWH 1L2EA 3Q00A 4MNXA 1MD7A 4TYDA 4FUEA 1GBFA 3BTTE 1TQ0B 3A8BA 1K1JA 1LPKB 3QK1A 2XRCA 4DT7B 1ELAA 3ZZAA 3SJ8A 1J17T 3BG8A 3MYWA 1A0JA 3F9GA 1UK3A 3HGNA 3AW0A 2OBQA 3BEUA 2K8IA 5DP3A 3KYGA 1PPCE 2QF5A 3FZDA 1ARBA 2W6ID 2G52A 1KYNA 4H6TA 2HVXA 4CRBA 2Y6TA 1V2KT 1NO9H 2RCEA 1EZXC 1O32A 4FU8A 1WBGB 2XBYA 5DP9A 2B8OH 1ZTJA 1ELVA 1UW7A 2KFWA 2J2UA 4U32A 3RU4D 5K0HA 1Y8TA 4XSKU 1UJ1A 2Z94A 4BTTB 3VB6A 1ELDE 2FOGA 7LPRA 2WPIS 1LQEA 2ZGCA 4FXGH 4K1SA 2HNTC 3RM0H 3SOSA 1AKSA 2J4IA 2KX4A 5FX5A 2Y7ZA 1SGFA 3T28A 3GY3A 2P8OC 4NIVA 1Z7KA 1IQIA 3ESTA 3TJNA 8LPRA 3KN2A 1OP8A 1C1VH 3SU6A 2FESH 2KCAA 1GI0A 3BG4B 3SV9A 4NZQA 1W11U 4KKDA 1KY9A 1QB6A 1AZ8A 1JIMA 2BOHB 1LQDB 1MD8A 1MH0A 3F9EA 1NRRH 2QXGA 1JXPA 2Z9GA 1P01A 1MZAA 1OP2A 2ODQA 1BCUH 2FS9A 2KCYA 4INKA 2P3TB 2D8WA 4MTBA 2OXSA 1QNJA 2BX4A 4ISNA 3SV6A 3QLPH 1G3EA 3OFND 2FOFA 3MU4A 1PPGE 1C2DA 3WWFA 2STAE 3FP6E 3UR6A 2J95A 1NROH 4DJZB 3PWBA 1AU8A 4ZXYH 3KQBA 3LH3A 1N1LA 1C1QA 3O8DA 2SGAA 3QGJA 1HJ8A 1EPTB 3A8AA 2H2ZA 2Y81A 4QT8C 2WPKS 3NXPA 5FPYA 5K7RA 1W8BH 1L0ZA 2VGCB 2C8XB 4INLA 1C5VA 1MCVA 2ZQ1A 1D3TB 5JPMH 3MNXA 1P02A 3DSOA 1K1PA 1H8ED 1AE5A 1DT2A 2OQ5A 1SG8B 4NA8A 2P3UB 1BITA 4Q80A 2DE8A 1C2JA 1TABE 1AWFH 3LOXA 3KL6A 5LPEA 1LMWB 2A7JA 3ZVCA 5JBTA 2WZQA 4GLYA 1HAOH 1S82A 2UUFB 4AFUA 3D65E 3BTHE 4D7GA 1PQAA 3OE7D 4WMFA 5HIZA 2ZO3H 3T26A 2IPHA 1RGQA 2NU3E 2THFB 3H7OA 4GHTA 4MDSA 1ETTH 3T62A 2V35A 3M61U 4I7YH 1TNGA 2F83A 3S69A 4AFZA 3RXLA 1XMNB 2F3CE 3V12A 1GBBA 2A5IA 1C2HA 1HAHH 4Y0YE 5DKMA 1EJNA 3LJJA 4XBDA 1ANCA 1DICA 7GCHF 3MTYA 4DG4A 1NY22 5DO4H 2ZC9H 2FWWA 5EW1H 1E1QD 1DSUA 3NPSA 1KLIH 4I8HA 3LC3A 4ABBA 2QYIA 2WPLS 1EAWA 1O2WA 2ZFQH 4K1EA 5E0HA 2Z9JA 2W26A 1IQHA 3E8LA 3BTFE 1DWBH 3RXTA 2K1QA 2ZU3A 1O2UA 3FOAA 2EA3A 5DK1A 1HAPH 5TCAA 1F2SE 3SW2B 2BHGA 2Q6GA 1Q2WA 1GDNA 1S6LA 2G55A 2ZNKH 2R2MB 2CGAA 1GMDF 1O34A 3GISB 2QXIA 1WTHD 4M7GA 2BDIA 3TGJE 1SR5C 2AIQA 4XBBA 3MO6A 3EE7A 4SGAE 1EPTA 2ANWA 1G2LA 1FY5A 4ISHH 1T8MA 1K21H 1Z6EA 3ZVFA 2VIPA 1BDAA 1GBHA 4WF8A 3GCNA 2KAIB 1KDQB 3OYPA 3KEEA 2O9QA 2H5CA 3SU2A 1S0QA 1C2EA 1BTUA 4X6PA 1V2VT 5BPEA 2G4TA 3IWMA 1T8NA 1MTNC 1GMCF 1SGTA 1PQ5A 5LGOA 1C5NH 4UE7H 2Y7XA 3BTWE 1C1MA 1D3PB 3KQEA 3GY6A 2HPQH 4ABIA 1ZYOA 4O97A 2A5AA 1QJ6B 1QBNA 4X2VA 3EA7A 1K22H 5HIYA 1D6RA 4TY7A 1H8HD 4Q2KA 5FL7D 2F9OA 5JB8S 2PW8H 4KTSA 1LHEH 2TGTA 2ZGBH 5EQQA 4AX9H 2PP6A 3F0OA 1MZDA 2Y80A 5PTPA 1GHAG 2F91A 5DJ7A 3F0PA 4NIXA 3RC5A 4ABAA 4NWKA 8GCHF 2R9PA 1SLUB 2RG3A 3RXPA 2TPIZ 3UNQA 3BTGE 1MQ5A 5DP5A 3SU5A 1P03A 1GJ6A 1YLDA 2RFKC 3RU4T 4OGYA 3AAVA 2ZFTA 4B2AA 1HIAB 5DN6D 2GT8A 2Z9KA 1DXPA 1SGCA 2OK5A 4MPXA 1HAVA 1OX1A 1UTOA 1P10A 3ATIA 3RP2A 1SQRA 1ZSLA 4XOJA 1P11E 2VWLA 1Z6JH 1P0SH 2GCHG 2UWOA 1T4UH 1SB1H 1OWDA 3SU4A 1SQOA 1QRZA 1BMLA 1GJBB 3LONA 2PTNA 2OTVA 5L6NH 1ZJKA 2ZHQH 1NFUA 3I78A 1O2PA 2ASUB 2VB0A 1V2JT 2GDEH 2WPHS 4TPIZ 3S7KB 8GCHG 1VITH 3D62A 1IQKA 3D23A 4XE4A 1IQGA 1MBQA 1ARCA 1AVGH 2QF4A 1ZRKA 4A92A 2ZU1A 1V2NT 4Q7ZA 2TGPZ 2P8OB 1FQ3A 4ASHA 1O30A 2LPRA 3GS9A 3OY5U 4GSOA 4J2YB 3KQ5A 4K8YA 1VJAU 2CV3A 1O3EA 1LKBA 3W95A 5F53A 1HUTH 4MNVA 1MCTA 2HPPH 1SQAA 4RKOB 3JZ1B 4THNH 1C1WH 4JCNA 4WXVA 3QGNB 4H42U 4A7IB 2PUXB 4MLFB 1DLEA 3TIUA 1KXAA 5EXLA 2XNDD 1IQFA 3OTPA 5EXNA 1C5ZB 2PGBB 2P95A 3R3GB 1DS2E 2FOCA 3U9AH 1ELCA 1QL7A 2XCFA 2PR3A 2GZ9A 1BRAA 4CR5A 1GVZA 2ZDNA 1T8LA 1P8VC 1XXFA 3ZVAA 3PROA 4DVAU 2BTCE 1RTLA 2D2DA 1LHFH 1BTWA 1HYLA 1VCQA 1RTKA 4Z0KA 1QR3E 1TGBA 1BHXB 3TJOA 3UOPA 2G5NA 4OS7A 3KCGH 2XNIA 1MKXH 5CMXH 1UVSH 3LH1A 2R0LA 4ZHLU 2FX4A 1JRSA 2VGCC 1DXWA 2EQNA 2Z7FE 1C1RA 2VIWA 3GYMA 2HLDD 4BXSA 5F8ZA 2VVVA 5JBBS 3SORA 4K69A 4K1TA 2ZWLH 3PLBA 2FDAA 4Q7XA 3V3MA 3GCHC 2XBWA 2FZZA 2Z9LA 1DOJA 3UNRA 1FLEE 1UVUH 1ESBA 1FI8A 1LCYA 1XX9A 2ZIQH 3SGBE 1G3BA 4X1RU 4A5TS 2XBVA 3MI4A 4NFEA 1O2KA 2ZTZA 1CA8B 5HYOA 1QBOA 3B9FH 4YOGA 1NESE 4F55A 1DX5M 2WUBA 3GY7A 1UVPA 2R3YA 1CT0E 1HAGE 1O3LA 2SGQE 3VXFH 6ESTA 3NUMA 5EQSA 2ZU4A 1Y3UA 2QC2A 1B7XB 1CT2E 4NZLA 1C1OA 3KGPA 1O3MA 1MAXA 2W3KA 2JJ1D 4UFGH 1C4U2 2KCOA 3RXUA 1Y3XA 1NZQH 1T31A 1SQTA 4BAKB 5L30H 1DANH 1K2I1 1MTSA 2BDHA 3GCTG 3U8RH 4X6NA 2OD3B 1CT4E 4JYVH 5JYIA 3TH2H 3PO1C 4B71A 2WPDD 3HK6B 1QZ8A 1YCPH 1F0UA 5FBIA 1HRTH 2FOAA 3QUMP 4NSYA 1HJAC 3M5LA 2FO9A 3FZZA 2XTTB 1GBEA 5C1UA 3PTNA 1V2QT 2GV6A 2ZPRA 2A32A 4X0WU 1JBUH 2J94A 2BQ6B 1GGDC 2ZTYA 1PPZA 1Q3XA 3Q3KA 1D4PB 5T6FA 3F2HA 3BTDE 1HAZB 2PTCE 4BAOB 4FETA 1DUEA 5GPIB 3GY2A 1WOFA 1IHTH 3A87A 1T7CA 1S83A 3BN9A 1TGCA 2CK3D 4LK4A 2B0FA 2BDBA 2GCTC 1DLKB 2XYAA 1B5GH 4B2CA 3ZV8A 2GKVE 1G36A 1DWCH 1SOZA 3MMGA 5FXLA 3DD2H 2Z3EA 3LT3A 3SHCH 3F9HA 2B7DH 1O3IA 4GVUA 4X2YA 2H9EH 3ZZ5A 3S9BA 1TFXA 1COWD 2FP7B 3TK9A 1GJ7B 2H5DA 5EGMA 1BUIA 1O2NA 1AKSB 5DP6A 1FY8E 1SFIA 1XKAC 4DURA 4AORA 4KTUA 1AVXA 3SU1A 1TNJA 3OTJE 1GI6A 2ZTXA 2FOBA 1ANBA 3PV2A 1NFXA 4O03A 1GI1A 1ZTLA 1UCYE 1ZHRA 2BLVA 4HGCA 1H1BA 2AFQB 2V3MA 1OPHB 5C1XA 2ZU5A 2GTBA 5DP4A 4DIHH 2OCVB 1DWDH 4MPWA 2Y82A 1GJCB 1GMHF 4Y10E 1YCPK 4AB9A 2Y5GA 3LC5A 3LGIA 1IQNA 1VITF 1O2LA 1DY8A 4JZFH 1C5WB 5A09A 1G9IE 1TGTA 1THSH 4RSPA 1FN8A 4VGCC 1AFQB 4CH8B 3SZEA 3PV4A 2C8WB
chains in the Genus database with same CATH topology
4NG9H 4ZKRU 3SNEA 1TPPA 4OS6A 1L1NA 1C5UA 2JH0D 1C2FA 2OC7A 1V2ST 4D9QA 1OWIA 3QN7A 1HPGA 2BD3A 1W0ZU 3S9AA 4E7NA 3TH3H 4ISIH 1AGJA 2IOTA 1FAKH 4A6LA 1N6XA 1GHZA 1WQSA 3VFEA 1LO6A 4FUJA 2BXUH 1C1TA 2BDYA 2GD4B 3PLKA 2ZHWH 4UFFH 1O37A 4NIYA 1GWAA 1F5LA 4FUGA 4NWLA 4ZMAH 1SGPE 1Z8GA 1XVOA 1KXCA 1YM0A 4YOJA 1H8DH 1DY9A 4DY7B 2CXVA 4CRCA 1LTOA 2GZ8A 4KP0A 2G00A 3SI4H 4CHAC 1XKBC 1O2VA 1D3QB 3MH5A 5A8ZA 4LZ4B 1UHBB 4XFQA 4ABFA 2CMYA 3FP7E 1ZMNA 2O8TA 3UPEA 1KTTB 1J8AA 2W5EA 1RTFB 3CS0A 4X2XA 3FVFB 1MTNB 3A7VA 4R0IA 1CQQA 3UUZA 1V2TT 4BAMB 1QRXA 2ZGHA 4Z6AH 4I31A 4TY6A 1O38A 1C5MD 1CE5A 1ELBA 1C2MA 5EXMA 2TRMA 4WH8A 1OKXA 2ZFPH 3PMJA 1A4WH 5L2ZH 2JETB 3ZZ3A 1HAYB 2W7SA 3UNSA 1ELFA 1OWJA 1O2MA 1O3AA 2VNTA 1DITH 1Z71A 4Y79A 3A88A 5A8YA 4JZIA 1GPZA 4YZUA 1IHSH 3OX7U 2PFEA 1RJXB 2ZECA 1K1MA 1GJDB 2KAIA 2V3OH 3HKIB 3OY6U 1MBMA 1AN1E 2FTMA 4ZXXH 2BVXH 2P59A 1WCZA 1A0LA 2DUCA 1H9LB 1V2RT 1MAYA 2BD9A 2ZGXH 2H6MA 1TYNA 4O3UA 3ZYEA 4WMDA 4XBCA 1TONA 1XUGA 4D9RA 1UK4A 1SC8U 2P3FH 2R3UA 2QA9E 4JZEH 4VGCB 3MU1A 3NZIA 1LKAA 1GI9B 3M7UA 1NTPA 4KGAA 3A83A 1NRPH 1CGJE 3BF6H 2FOEA 3SU0A 3RXOA 3T25A 4UD9H 1ZMJA 1F92A 1PJPA 3DFLA 2ZP0H 1OS8A 3FP8E 1O33A 5JBCS 3EAJA 1ZPCA 1HBTH 4J1YA 3MU8A 1AE8H 1KTSB 1N8OB 1BTXA 1JRTA 3ENSB 3P8FA 5HMAA 3H7TA 1FIZA 3P92A 1FY4A 3A8CA 2XBXA 1FJSA 4HTCH 1NC6A 2QIQA 1QQUA 2BD8A 1TGNA 1LVBA 1EATA 4I32A 1P2MA 1RIWB 2ANMH 3PWCA 4B75A 3NWUA 3UWJH 1YPEH 1TNKA 4LXBH 3L6PA 3GCTF 4I8LA 1FONA 1G30B 3SN8A 3M5NA 2C8ZB 1WU1A 1EX3A 1CHOF 4X1NU 5DGJA 5C67A 2UWPA 2WINI 3P70B 4LZ1H 3PTBA 1FY3A 1O3FA 2R2WU 3BTKE 1UCYH 3SV8A 1HIAA 2BY5X 2OC0A 4DCDA 2LNCA 2CF9H 2V3HH 4E06H 3I77A 4AGKA 1C2GA 1GJ5H 1IQJA 2CJIA 4YT7H 2A0QB 1EJMA 1W0YH 1QJ7B 2FLRH 1KDQA 2GVFA 4TWWA 2ZDAH 5GXPA 2G81E 4ZKOU 5JDUB 2AIPA 2SGEE 3N7OA 4IMQA 1GI2A 5E8EH 1Y5AT 1LPGB 5C20A 4DGJA 3CS7A 5GCHF 1ZSJA 3RXFA 1QA7A 1BMAA 2ZFSA 4B1TA 1X7AC 1EB1H 5F8XA 2BY7X 2HNTE 4I8GA 4ZROA 3TNTA 3ZVGA 4NGAH 3VB7A 1TPAE 1G37A 3LIWA 5EPYA 2VH6A 1E35B 2PV9B 3A80A 5HM2A 1YLCA 3RC6A 3IG6B 4IN1A 1EOJA 1LPZB 3RXDA 5H4IB 3VB4A 5E2PA 3TLOA 1O3CA 1KXBA 1NM6A 3VPKA 1W10U 4B2BA 1MU6B 1BTZA 1UHBA 1C5SA 2F9VA 3SJKA 3A7YA 3RC4A 2H9HA 1A2CH 3MWIU 4UDWH 5I46H 4UEHH 3BEFB 4UONA 1GBDA 1ZOMA 1MKXK 4CRFA 2CN0H 2WUCA 5LH8A 1G32B 2WV4A 2F9PA 3QWCH 4GHQA 3RUOA 1FXYA 2ZZUH 3RM2H 2F9NA 2QF0A 1GGDB 3BSQA 1QA0A 2VIDA 1HFDA 3EA8A 2EI7A 1GBIA 2FPZA 1PPFE 1W12U 2AMQA 1ESTA 3G01A 4RKJB 2GCHF 1YPMH 2PSYA 1GL0E 1ELGA 4ZHMU 1SVPA 1E0FD 3GICB 2B9LA 1ZR0A 3ZZ4A 4JYTA 5AFYH 2YOLA 1QB1A 2TBSA 2BMGB 2HRVA 1RS0A 2OC8A 1OWHA 3HGPA 5FX6A 3A89A 3MO9A 1O35A 3RMMH 3RXMA 3A8DA 1KXFA 2GX4A 4ZKSU 1C5PA 4X8TH 2ZI2H 5GIBA 3BEIB 1XUIA 2R0KA 5T6GA 2H9TH 2ZA5A 2EI6A 1C1PA 4CRGA 4AB8A 4CHAB 1BOQA 3S9CA 3U1IB 1BBRK 2BD5A 1TPSA 1FN6A 1O5FH 3MH4A 1P06A 2M5TA 1E36B 5EODA 2I6SA 4CH2B 4Y7BA 1TNHA 4CREA 2BVSH 1PQ8A 1SGFG 4B76A 4TWYA 1SHYA 3LGUA 3E16B 2GZ7A 1IQEA 3UWIA 1BMMH 3NKKA 5AF9H 3RXAA 5FAHA 4HZHA 1A5GH 2BDGA 5FHTA 1IQLA 1ANDA 4HI3A 1EXFA 1A7SA 1HXEH 1SGEE 1V2PT 1VGCC 5IDKA 2RA0A 3V0XA 5GDSH 2AGGX 1P9UA 2QCYA 4IN2A 3F1SB 1OYTH 1THRH 2C3SA 5A0CA 1A5HA 3HK3B 3T27A 5GCHG 1P2QA 2ZG0H 4R8TB 1HAVB 5CHAB 2VWMA 3GY8A 1C4Y2 5TJXA 1GBKA 1HLTH 2FI5E 4AYVB 3W94A 4X6MA 1S84A 3K6ZA 5FBEA 1LHCH 4OS1A 3E90B 1NU7B 1GBJA 2Q6DA 2D1JA 4ZAEA 4ABHA 5F03A 1NU9A 2BQWB 5L2YH 4FUCA 3CENA 3U1JB 3UQVA 1F5KU 4BXWA 2Z9IA 1TOCB 1AFEH 1VGCB 2AS9A 1F0RA 4LOYH 1GBAA 1SSXA 4OS2A 5GWZA 1C5XB 5JB9S 1ZTKA 3KNXA 1ZPBA 8ESTE 4ABEA 1CBWC 2FIRH 4ZKNU 1O5GH 2FOHA 3QTOH 1HCGA 3UTUH 3QDZB 2IJOB 3LGWA 2BXTH 2JH5D 4AOQA 1Q31A 1UTNA 3RXVA 1JOUB 2FI3E 4NIWA 1C5YB 4KTCA 2TIOA 1BBRE 1O3JA 1YPHE 1QFKH 1KSNA 3A7TA 3K2UA 4E7RG 1IQMA 3Q3XA 3Q77A 2F9BH 1VITG 3M3VA 7KMEH 2CHAC 4TPYA 4I33A 1W14U 1WSSH 1HJ9A 4MQAA 1GCDA 2ZFRH 1ZLRA 5EG4A 1CHOG 3O8BA 4X8SH 3WY8A 3SUGA 1Z1JA 2A7CA 1S85A 1PFXC 1RXPA 2ILNA 5IYTA 3O8CA 5A0BA 3QX5H 4MG3A 3M37A 1TWXB 3ZVEA 2Y5HA 1YPJH 1AMHA 3TGKE 2J92A 2ALVA 3BG4C 1Z8RA 3EYDA 4AFSA 1O3HA 1SL3A 3URCA 1NRSH 4JMYA 3S0NA 1IAUA 1F7ZA 2SGFE 3FFGA 1SGNE 3SO3A 5CE1A 1EZQA 4MNYA 1BRCE 3QTVH 3A7ZA 2FMJA 4FUDA 4WXIA 2A31A 3RDZA 3SJOA 3PB1E 2Q6FA 1GHBF 4IGDA 2VVCA 5LPFA 1V2OT 3L3TA 3TGIE 1N8OC 1O2TA 5ETXA 4Y71A 1BIOA 2V0BA 2ZKSA 1MKWH 1TAWA 1YPHC 2VVUA 1QB9A 1SOTA 2TGDA 3ZZ7A 1YGCH 2QGRA 1KIGH 2FYQA 1FMGA 1GI7B 3SQEE 1O2RA 2IN2A 3DA9B 1VCWA 4H4FA 1FNIA 1CU1A 4U01A 2A2XH 1K1LA 4MNWA 1VZQH 1C9PA 5E2OA 3TK5A 4FVDA 1ANEA 2RA3A 1C1SA 1ORFA 2SNVA 1OWKA 1C5TA 2OBOA 1DPOA 1TIOA 1EPTC 3BTQE 1GHBG 4GCHF 1GI4A 1NFYA 3ZV9A 3M5OA 1DWEH 1F0TA 5CHAC 3UOUA 1UMAH 1UTJA 4Y8YA 2AEIH 5FPSA 3T2NA 3PMHB 1A3EH 2VJ1A 2HWLB 3TH4H 2BOKA 4PROA 4BTIB 2WYJA 2ZHEH 3BTEE 5AHGH 1HDTH 3TPIZ 2ULLA 2STBE 1J9CH 1TMUH 1BZXE 1P2IA 2OINA 3DT0H 2FI4E 3V7TA 5C3NA 4K3JA 1HAIH 1DSTA 2P93A 4AN7A 1GBCA 1NPMA 4K8BA 1C5RA 1TRNA 2EI8A 4HFPB 2PKSB 1CA0B 1O5CB 4D76A 3RXRA 1BJVA 5DPAA 2W3IA 1V6DA 1C1NA 4DOQA 2A4OA 3RMLH 2HLCA 1QQ4A 1MQ6A 3L33A 3K6YA 1A3BH 1MKWK 1UTKA 4INHA 4OS4A 1T4VH 1SI5H 3P95A 3LKWA 1K9OE 1RFNA 2QXJA 1H9HE 3EQ0H 1GDQA 1QBVH 1H4WA 2NU2E 3UFAA 5E0GA 1QY6A 2PKAA 4GPGA 3RXBA 3T29A 1ID5H 5C5OA 1GVLA 3VGCB 2J38A 1YBWA 3LJOA 1S81A 3PM3A 3OU0A 3RMOH 5SGAE 4UFDH 2SNWA 1P9SA 3VB5A 1QHRB 1GG6B 1NFWA 2ALPA 4MVNA 1J15A 1UCYK 3ITIA 5ABWA 3MU0A 3P17H 5F8TA 1T32A 1Y5BT 1ZGIA 1Y3VA 3PMAB 3R0FA 1UVOA 1GBTA 1FDPA 2QF3A 1V3XA 2A4RA 1G3DA 1OYQA 3F9FA 3MNCA 4ESTE 3V13A 1FPCH 1EOLA 2SGPE 4X8VH 6LPRA 2ZEBA 1AVWA 3RXGA 4FU9A 1QJ1B 2UUKB 3ZZ6A 3AASA 3EGKH 1Y59T 1O3BA 4Y8XA 1W7XH 2ZCLP 4BTUB 3TVJB 2G51A 4ZHAA 4AFQA 1TX6A 2PHBA 3UQOA 2GDDA 1SGYE 1LVMA 1JMOH 4FUFA 3SUDA 1P2NA 5AVDA 3ZZBA 2PUQH 1ZZZA 1KLJH 1D9IA 1U6QA 3ATLA 4FUHA 1GVKB 1SLXB 1JIRA 1D6WA 3ZZCA 3M7TA 4U2WA 1CGIE 5T6DA 1L1GA 1YF4A 1MMJN 5FCKA 1UTMA 3EE0B 1CA0C 3LGVA 5EU8A 2Z3DA 2GMTC 3RU4E 4A1TA 1A1RA 3P8GA 3RMNH 4BOHA 4O9VA 3UREA 4JZ1A 1O2JA 1NS3A 3RLWH 1K1IA 4WJG2 3ATKA 4YESB 2XC5A 1EB2A 3LPRA 4A1VA 1FY1A 1O2HA 2BM2A 1AHTH 3GCOA 1G3CA 3E0PB 2XC4A 3URDA 1O2IA 3BTME 3HPTB 4ZH8A 1INCA 1AY6H 2FODA 3A85A 1H8IH 2AGEX 1W13U 4JYUH 7GCHG 1SGRE 2NU1E 3T5FH 2HALA 4K60A 3NCLA 1L1JA 3KQDA 3FANA 4AYYB 1C5LH 2BYAX 1VJ9U 2WV5A 2JKHA 3SNBA 4A1XA 3KIDU 3SHAH 1GCTB 1P57B 1NN6A 4BANB 3MHWU 1AD8H 1AIXH 4GCHG 1S6HA 2A45B 1YC0A 1CGHA 1P2OA 2FLBH 2OLGA 1TBQH 2SGDE 3M35A 2FX6A 2TGAA 3DHKH 1QURH 4FUIA 4OS5A 1OWEA 1ZMLA 2OC1A 4CBNA 4CRDA 1F0SA 6CHAB 3GDSA 1WQVH 1V2LT 3QO6A 4K2YA 4X8UH 1QGFA 4Y0ZE 4YM9A 5A0AE 2VWOA 2BLOA 1O5BB 4O3TA 3PYHA 5LPRA 4D7FA 3SGAE 2ANYA 1NRNH 4H6SB 3B23B 2ZU2A 5C5NA 1A0HB 1MTVA 4CBOA 4I8KA 4CRAA 1YPGH 2Y5FA 3C27B 2P94A 3TK6A 1UK2A 1DDJA 2ESTE 2GCTB 1P05A 4OGXA 1GDUA 1MTWA 2ZF0H 2OQUA 1XUKA 3SU3A 1EAXA 4GAWA 1FUJA 1HB0B 2HOBA 1GMDG 1TX8A 3ZVDA 1SLVB 2AH4X 2UUYA 3GCHB 2YNAA 1J16A 3MFJA 1EZSC 2P16A 1VR1H 3IITA 4JK5A 3QZQA 2ODYB 1TNLA 2A4QA 4MPVA 2NU4E 1ELTA 1GHXH 1O5DH 1ELEE 1O0DH 4YTAA 2H1UA 2GT7A 2BVRH 1SMFE 4JK6A 4Y7AA 3BV9B 2O8UA 5J4QA 5FPTA 3SV7A 5FCRA 1YPKH 2QV1A 1C1UH 3FAOA 1SGQE 3M5MA 2ZDVH 1A61H 4U30A 3GY4A 1TRMA 5EPNA 1TALA 3RXEA 1V2MT 4NA9H 5DG6A 1HAXB 4D8NA 3MNBA 3VXEH 4AG1A 4WY3A 4Y6DA 2XC0A 3MH7A 1EJAA 3HATH 2BZ6H 1BA8B 2Q1JA 3PO1B 3ZYDA 5C2ZA 4IW4E 1A5IA 2A1DB 2AMDA 1CHGA 3LGTA 1YYY1 2F9UA 2A5KA 1P2KA 2FS8A 5DP8A 3UY9A 4AGJA 1W7GH 1ZSKA 2B5TB 9LPRA 1C5QA 3ELAH 2JH6D 1K1OA 2BY6X 2EEKA 3EA9A 1GG6C 3GDVA 3VB3A 4DW2U 1BTHH 6GCHG 5EOKA 1THPB 3LU9B 3PMBB 1QIXB 1GJAB 1TA6A 1ACBE 1P12E 1PPBH 1Z8JB 1EUFA 2BB4A 2XW9A 1FV9A 1B0EA 3SJ9A 3PLPA 3GOVB 1HJAB 1GI3A 1ABJH 1NT1A 1TE0A 2ZDLA 2W7UA 2UUJB 2BD7A 5ESBA 3SQHE 1GHAF 4MPUA 1SLWB 4SGBE 5I25A 2FYRA 1TPOA 2VINA 1O3KA 5GJ4B 3P8NA 2XWBI 1FZZA 4BAQB 1ZRBA 1IOEA 2ZHDA 4IMZA 4Q7YA 1EP5A 3LGYA 1EAIA 1ESAA 3TU7H 4YT6H 1S0RA 1L4ZA 4B73A 4X6OA 3KHVA 2BQ7B 1O2ZA 3C1KA 4FUBA 1XM1A 1DUAA 5A8XA 2PKSC 1GBLA 3RXJA 1K28D 1O2OA 2C4FH 1ZHPA 4X1QU 1JWTA 1PQ7A 2PKAB 1T8OA 3GY5A