1OWJA

Substituted 2-naphthamidine inhibitors of urokinase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Identification of Novel Binding Interactions in the Development of Potent, Selective 2-Naphthamidine Inhibitors of Urokinase. Synthesis, Structural Analysis, and SAR of N-Phenyl Amide 6-Substitution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1owjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1owjA01
3M35A 3DA9B 3VB5A 1XVOA 1K1MA 1Z1JA 4I31A 3SU6A 3U8RH 2BY8X 1H9IE 5L2YH 1K22H 2Q6GA 2QGRA 3GDUA 4ISIH 3TK9A 3BG8A 4TPYA 5HYOA 5HM2A 2PSYA 1LHFH 2NWNA 1K1LA 4MNYA 5E2PA 3SV8A 1XUHA 1VITH 1VCPA 1NU7B 3S0NA 1TNJA 1P3CA 2BDBA 4MNWA 2ZIQH 1E36B 2AMQA 1ZMJA 1O2WA 3UPEA 1C1VH 1TB6H 1ESAA 1XXDA 2V35A 3MI4A 4H4FA 5A8YA 1HAYB 1Z6JH 1HIAB 1ORFA 1C1QA 3VXEH 4UEHH 2QN5T 3MH4A 2BM2A 1C4Y2 3RU4T 4CRAA 2OQ5A 3A83A 3SUFA 1E38B 1N8OC 3M3SA 1ZPBA 3RU4E 1RTLA 4ABEA 1G32B 1XKBC 3HATH 1QURH 3PMBB 4CRGA 1MTNC 2BY6X 1P2QA 3NCLA 1PQ7A 3BTKE 2XBVA 1KXDA 1T8MA 2ZC9H 1BRCE 4MDSA 3UNSA 3TU7H 2HRVA 5FX5A 4FUBA 1AFQC 1S0QA 2F83A 5AFZH 1MTUA 4Y8XA 1GI9B 3TPIZ 3GCOA 1DICA 3A7VA 1C2HA 3BV9B 3EA9A 3RLYH 2ZU2A 1HJAC 1TX7A 3TJNA 2VIQA 1UK3A 2GKVE 1BMNH 1ZHPA 2SNWA 2BDYA 4B76A 2ZNKH 2B9LA 2IPHA 1DSUA 1IQKA 1G9IE 1HAHH 3BTEE 3ZV9A 3TITA 1T8OA 2M5TA 1C1SA 1TNIA 1AZ8A 1GJAB 3P17H 2FI5E 5DP5A 1PQ8A 1GPZA 1QR3E 2AGIX 1W7GH 2QXHA 2R2MB 2BB4A 3BTWE 1C2LA 5K7RA 1GDNA 4MLFB 3ZZAA 1HPGA 1RRKA 1DITH 4BAOB 1C5LH 1Y5UT 3A87A 1ZSKA 1DT2A 2Y82A 1UHBA 1B5GH 2QXIA 2R0KA 1KXBA 1BB0B 2FESH 1V2TT 2TRMA 1GL0E 2TGPZ 3PM3A 3TVJB 2BXUH 5A8ZA 1INCA 1F5KU 1YCPH 3PB1E 1J8AA 1QB1A 1GI1A 1ABJH 3JZ2B 1V3XA 4PROA 5SGAE 1HAVB 3G01A 1HAPH 1YM0A 2VNTA 1IQGA 5C5OA 2BDIA 1UVUH 1O34A 4J1YA 3F9HA 4BAQB 3UQVA 2GCHF 3AVZA 1S6FA 1AE5A 1C2FA 2ZGHA 1K21H 2ZP0H 3RLWH 1D4PB 3RC4A 3PYHA 1AUTC 5L6NH 2ALPA 1NRPH 3ATIA 1MTNB 4Q2KA 1O2SA 2FEQH 1FZZA 2BVSH 4K8YA 1RTFB 5G4BA 1TGSZ 1FN8A 2ZPSA 3F9GA 1ZJDA 4GCHF 2BX3A 1O2IA 4RKJB 2FLBH 1Q3XA 1V2ST 1AFQB 3GY2A 5EQQA 2ZGBH 1YPGH 1OYQA 2QCYA 4YT7H 3MH7A 1GBIA 5F8ZA 2A32A 1C1TA 2FPZA 1GHAG 1QQ4A 1A5IA 4LXBH 1L4DA 1SGFA 1HJAB 3ELAH 1FV9A 4U01A 1K28D 2ZDLA 4X1QU 4WH6A 3SGQE 1TE0A 5EW1H 1MH0A 3PMHB 2ZECA 4RN6A 1Z8JB 1Y3XA 1O0DH 3Q76A 4AFZA 2A7JA 1QA0A 1C5UA 1OP0A 2IJOB 3T29A 1GBAA 1AVWA 4ABJA 1H9HE 2BD2A 1C5YB 2OD3B 2EI8A 2VH0A 4YT6H 1BTXA 1Y3VA 3GICB 2QIQA 3FFGA 3HK6B 2ZFRH 4NIWA 3ZZBA 1LMWB 3ZV8A 3ZVDA 1O2YA 2BOKA 3SJ9A 1IQIA 3PV4A 4ISHH 3PLKA 3NUMA 4HTCH 3OTJE 5A0AE 1D3DB 3GCNA 3SOSA 3SHCH 3SU2A 4GVUA 1ANCA 1OP2A 5DGJA 1GMDG 1MQ6A 2C8WB 2PUXB 3T26A 2XXLA 1FN6A 1EB2A 3A8BA 2CJIA 5E0GA 2AEIH 1MKWK 3SNEA 1GI3A 2FYRA 1A0LA 7LPRA 1GCDA 3RXIA 1UCYE 1UTMA 3M37A 2G8TA 2XWBI 1MZAA 1T7CA 2ASUB 2A31A 1XUFA 1UMAH 3KF2A 5EPNA 5LH8A 1NC6A 1VJ9U 2VJ1A 2ZO3H 2XYAA 1MAYA 4KTSA 1IHTH 1UTKA 2O8TA 3ZVBA 1YPMH 5FX6A 4IBLH 4X1RU 2TBSA 4X6OA 1EUFA 2Y5FA 1THPB 2Z9GA 1TFXA 2XBXA 1C5TA 3RMNH 3BEUA 2C8XB 1EOJA 1JBUH 3BIUH 1DS2E 1HNEE 1WCZA 5LPFA 1P9SA 2RG3A 4AB8A 4R0IA 2O8WA 1GHXH 2ZFPH 1TGTA 1O2HA 2XBWA 1QIXB 4OGYA 4K5ZA 5DP9A 4BANB 1HV7A 7GCHF 1JIMA 5TCAA 4YZUA 1E35B 1IQNA 2ZDVH 1CU1A 4AGKA 1W2KH 4BAKB 1O3JA 1QB9A 4AG2A 3ATWA 1KXFA 1V2NT 4CBNA 1XVMA 1O2RA 2BQ6B 3I77A 1QL9A 3F9FA 4IC5A 1O2NA 3AAUA 4K3JA 2J92A 4YLQH 3NPSA 1WU1A 1OWHA 1LHDH 1MCVA 3BN9A 2FWWA 2FI4E 1O2VA 1LHEH 5HM9A 3RC5A 4I8KA 1P02A 1ACBE 3A89A 1C5OH 1ELVA 1A46H 1EQ9A 1KXAA 2ODYB 4X2XA 3UR6A 3IWMA 3O8CA 4AX9H 1AWHB 4X6PA 3GCTF 3I78A 1EJAA 1T32A 1WV7H 3BEIB 1C5PA 2PW8H 3RXPA 2OXSA 3SJIA 2Z9IA 3RXMA 1MBQA 4YOIA 2Z3EA 4FUJA 3RXEA 2SNVA 3S7KB 2ZGCA 3A80A 2LNCA 4HFPB 3SUDA 3VB7A 1EKBB 4FU9A 5AF9H 2Z9KA 1O2OA 4ZKSU 1OPHB 1GDQA 4MG3A 1FY1A 3SBKA 2CMYA 1J14A 3RXRA 4FUHA 1DWEH 1ANBA 4KTUA 2ZDNA 1ZOMA 5F8XA 1MD7A 1E0FD 3ODFA 1MTSA 2CHAC 3UNQA 4AOQA 1Y5AT 1MUEB 2A5AA 3ZZ5A 1YF4A 3STIA 2HALA 1BRAA 3S9BA 2VGCC 1DUEA 1FY8E 5HMAA 4BXSA 1ABIH 3E0NB 4X6NA 2CGAA 2Y81A 4UFGH 2EA3A 1ZRKA 3ZZ9A 2G4UA 3GDSA 4OS4A 1FY5A 1NFXA 4UFEH 5TJXA 3UOPA 1GBHA 2W3IA 1HAZB 3HKJB 3BTDE 1QJ1B 4Y0YE 1TA2A 4TY6A 8GCHG 1H8IH 2ESTE 1CGIE 1BUIA 1LHCH 4NIYA 1C2MA 4NWLA 5C5NA 3SW2B 5GCHF 3Q00A 5A0CA 3TGIE 4DJZB 2A5KA 2XCNA 1SI5H 3UR9A 3MWIU 4DVAU 1ZGVA 5ETXA 2BD3A 2TGTA 2BX4A 2THFB 3MTYA 5DK1A 1EPTA 4NWKA 1TMBH 1BA8B 2BDGA 1K2I1 4Y0ZE 1ELEE 2VVCA 4ABHA 2FS9A 1OOKB 1QCPA 1C2EA 1THSH 1C1NA 1L1GA 2BMGB 3D49H 3QDZB 4DG4A 2P16A 2ZEBA 2TGAA 1Z8GA 2ZWLH 1PPBH 1IQFA 1RS0A 5B6OA 3TGJE 3D23A 3ZZ3A 3FZDA 1LVYA 1JMOH 2OINA 4LK4A 5FBEA 3V13A 1C1UH 1OKXA 2HNTF 3K2UA 3ZVFA 1FAKH 2YOLA 2ZPRA 3KHVA 1P2KA 4Q7XA 1V2KT 1BMLA 4K1EA 1EPTB 2D1JA 1OSSA 3VPKA 1SPJA 1A3EH 5DP6A 1TLDA 4XE4A 1UTPA 3MNCA 3SUEA 1HRTH 1EP6A 1H4WA 3SJKA 3ZVAA 1WQVH 1MU8B 1UVOA 5AVDA 3ZVEA 1K1NA 4OS2A 1B0EA 5LGOA 2FZZA 4ISNA 1VITG 2C4FH 4X6MA 1NRRH 2VWOA 2CHAB 2Y7XA 3EDXB 2VIDA 5FBIA 3GY5A 3TNSA 1SSXA 1GBTA 1Y3YA 2VGCB 1V2RT 2Q6FA 2H5DA 3FZZA 2B0FA 1H1BA 3BTHE 4TWWA 1WQSA 2CF9H 5TCCA 4DT7B 4K8BA 2PUQH 2UUYA 2QY0B 3KEEA 6GCHF 2FOMB 3EE0B 2GMTC 5EW2H 2C93B 4ISOA 2STAE 1CHGA 1O3HA 3TH2H 5FCRA 2GGVB 1HAIH 2FODA 4TPIZ 2VIPA 1EJMA 1OX1A 1HAOH 4AYYB 5EXNA 2A4RA 1ESTA 2BZ6H 4I8HA 3VB3A 1NZQH 2DE8A 2OC8A 2ZCLP 2FO9A 5C2ZA 3PO1C 2RDLA 2QF3A 1WAYB 2GCTC 1UK4A 1EP5A 1K1IA 5A2MH 3ODDA 1GMCG 3S69A 4AFQA 2NU3E 3IG6B 1EX3A 4Q7YA 3Q3KA 1D3PB 2PTCE 1LKAA 1V2UT 1RJXB 4ASHA 1XXFA 4GSOA 2EI7A 1BMMH 1LTOA 3UWIA 3S7HB 1OS8A 1EASA 3TIUA 1EZUC 2EEKA 4IC6A 1SGCA 1VJAU 5CE1A 1O32A 1DXWA 1FNIA 4NA9H 4GLYA 3AASA 3SV7A 1BCUH 1TOMH 3RXSA 4KGAA 1A61H 1NO9H 1D6RA 4Y79A 2HLCA 2TIOA 2VH6A 4ZMAH 2AFQB 1O30A 1O5BB 2BHGA 1QA7A 1G37A 1DWCH 2ZHEH 3KQBA 4AGJA 4JMYA 1AHTH 3SU5A 2C90B 3V12A 1DWDH 1LO6A 5FCKA 1PJPA 1MQ5A 1GHBG 2P95A 3MO3A 2A1DB 1CQQA 1LVMA 1JIRA 4X1NU 4BNRA 2G55A 2VVUA 1S83A 3SJOA 1DLKB 3FAOA 2PKAA 2P3TB 1A1RA 3B8JA 4GHTA 1O39A 3C1KA 3AAVA 2FOCA 3A7YA 1C1WH 3SN8A 1DLEA 3HGPA 2XW9A 4FUDA 4MTBA 2HNTC 1NROH 1GL1A 3M3VA 3MFJA 3NXPA 1ELBA 5EXMA 2GVFA 3DUXH 1O2GH 4XSKU 3TLOA 4AFSA 1O5AB 1P2MA 2R3UA 3LH1A 1SB1H 4UE7H 4IN2A 2GMTB 2DE9A 4RSPA 1T31A 2ZU3A 1NM6A 1CGJE 1AQ7A 1QGFA 1QFKH 4WWYA 2SGEE 1PPFE 1GI6A 1CA0C 3M3TA 1BTYA 1C1OA 6CHAC 3KIDU 3K6ZA 2W3KA 2BQWB 2ILNA 1LQDB 1GDUA 3P6ZB 2ZHDA 3A8DA 3RXUA 1N6XA 1VGCC 1MD8A 1IOEA 2WPJS 3BTME 1X7AC 1GI7B 2SGAA 1N1LA 2PKAB 3PO1B 3RU4D 3E91A 4XDEA 5F03A 5HGGA 2YNBA 2AIQA 2GCTB 3ZYDA 2A4GA 2FI3E 2ZU1A 3DT0H 2ZDAH 2WYGA 2ZHFH 2RCEA 5EOKA 3K65B 3JZ1B 3VFEA 1O5DH 2ZFQH 1UK2A 5C1UA 2JH0D 3ESTA 1G3DA 1CHOF 4NGAH 4O3TA 2OC0A 5DP4A 1SOTA 1N6YA 3VB4A 2F3CE 3BG4C 5C67A 1SGTA 2QXGA 1GHVH 1HXEH 4VGCC 1ETTH 4I33A 3UWJH 1T8NA 4UFDH 5FPTA 2PGQB 4NZQA 2AMDA 3KN2A 2UUFB 1YGCH 1C2KA 4NFEA 2OBQA 5DP8A 1O2PA 4YLUA 4CRCA 4WH8A 4JYTA 1GBJA 1BIOA 1M9UA 1GCTC 1SLWB 1LCYA 3RXLA 1IQHA 3FANA 2WINI 4FUCA 5DJ7A 2BD7A 3TGKE 2PR3A 3GCHC 2ZKSA 2WV5A 4K2YA 1P3EA 3M5LA 1P03A 1V2MT 2TGDA 1LPZB 1L4ZA 2H1UA 3SJ8A 2JH5D 1EAUA 5AFYH 2WUCA 3FP7E 3S9CA 1THRH 2WPMS 1W8BH 3ZZ8A 1GBEA 2LPRA 1BMAA 1GBBA 3BSQA 1GHYH 2B5TB 2PFEA 1G30B 2H6MA 3SGAE 4ESTE 2KAIA 3RXFA 3SUGA 2BOHB 1TMUH 4JZIA 3PMAB 1C1PA 3RXQA 1HFDA 2HPQH 1MMJN 1P2OA 2R0LA 3PWCA 3STJA 1C5MD 1O31A 3E90B 2BQ7B 1IQJA 1UHBB 3UY9A 5A8XA 5FPSA 1CA0B 1P01A 1BTWA 1C9TA 1O2JA 6CHAB 4YESB 1ELGA 4D9RA 1MZDA 1YPLH 1PFXC 2BZAA 1DUAA 1VGCB 1DPOA 1O3PB 5DPAA 5E0JA 1NT1A 4YM9A 1GJCB 4HZHA 4ABGA 1MKXK 3T27A 4CR9A 5FXLA 1CBWC 1GG6C 1ZZZA 1QJ7B 2HVXA 4DW2U 4X8SH 4D7FA 2A2QH 1NFWA 3M5MA 1QL8A 4JZFH 4ZXXH 2KAIB 2Z7FE 4THNH 3SU3A 1ID5H 3T2NA 1GBLA 2FM2A 1CVWH 3LKWA 3SORA 2ZQ1A 3BF6H 1TGCA 3BG4B 2V6NA 2WPKS 4O97A 5DG6A 1YPJH 2ZFTA 1WBGB 2UWOA 3QO6A 4VGCB 2GV7A 1B7XB 1W14U 4MPXA 1BTPA 1K1PA 1BITA 4B71A 4X8VH 2W5EA 2HNTE 1Q2WA 1HXFH 1ZPZA 1YBWA 1LDTT 2G51A 2QXJA 4UONA 1DWBH 1O3FA 3ATMA 1B0FA 5I46H 3RXVA 2OTVA 1SLUB 1GCTB 1GBDA 1F0UA 2C8ZB 2J34A 1Z8RA 1OWKA 1JRTA 3GCHB 5IDKA 1EAIA 4D9QA 4AORA 4ZROA 2V0BA 2FLRH 3GY3A 1TONA 2RA3A 2BY9X 2G5VA 3ZVCA 1SOZA 3SI3H 5JBAS 1O3CA 4XBBA 4GPGA 1Q31A 1IQLA 4OS7A 4O3UA 1AUJA 2D8WA 3WY8A 5GXPA 3H7OA 4Y7BA 3QTVH 1PPZA 1O2UA 3PROA 3RXCA 1GVKB 2C8YB 4IGDA 3RXJA 1PPCE 5J4SA 4RKOB 5JB8S 4Y7AA 1D6WA 1WSSH 2BDHA 2ZTYA 5ESBA 1QRWA 2CN0H 2B8OH 1FDPA 2J38A 1FAXA 1QL7A 4YOGA 5PTPA 1BTUA 1ZSLA 4NA7A 3ITIA 2QAAA 1OWJA 1YPHC 2VINA 1EZQA 1P2IA 1A3BH 1LPGB 1QRXA 1V2QT 5EODA 1ELFA 2V3OH 1CT0E 2ODQA 3MU1A 1LKBA 5FAHA 2OCVB 6ESTA 1BDAA 1CBWB 3OX7U 1GG6B 2ZU4A 5GCHG 1QBOA 1K1JA 1OXGA 4M7GA 1SQOA 3PWBA 2Z9JA 1O2QA 1YCPM 3O8DA 2Y5GA 1T4UH 1C2IA 2O9QA 5K0HA 3A84A 5JB9S 3A7TA 3KGPA 3U1JB 1SGPE 1P12E 3A81A 1E37B 3RUOA 1C4U2 4CR5A 2HPPH 4WMEA 4A5TS 1HB0B 1AE8H 1GHAF 3A85A 1O5CB 1SG8B 2P94A 2AMPA 1A0JA 4A1TA 4ABAA 1HAGE 4WXIA 1DE7H 2XNIA 4GUXA 2ZA5A 4Z0KA 3EA8A 1WUNH 2VWNA 5E0HA 3UIRA 5JYIA 1C5RA 2BYAX 4I7YH 2PGBB 1TBQH 3N7OA 4D8NA 3SU4A 2VIOA 3BTTE 3KL6A 2C3SA 2J9NA 1MU6B 4O9VA 4CRFA 4UD9H 5DKMA 2SFAA 2QC2A 1EPTC 3CS0A 5HXFA 3QLPH 1KY9A 1L2EA 1GI0A 1JWTA 2VIVA 2ZHWH 4INLA 1J17T 4FUEA 3QK1A 1AY6H 1G3BA 1VZQH 3GY4A 3LONA 1KTTB 2FS8A 3SNBA 3A7WA 1SL3A 3UFAA 1GMDF 2JH6D 1GI4A 2GZ8A 1O3OA 3RXKA 5JBCS 2J4IA 1SR5C 1EOLA 4FU7A 1V6DA 4U2WA 3TJUA 1GMHG 1BZXE 3MU0A 1Z6EA 2BLOA 2A5IA 1D3TB 1CGHA 1OYTH 1TPPA 1W13U 2FOEA 5DP3A 1DVAH 1P0SH 5C1XA 3L6PA 2ZHQH 1ZRBA 1S82A 1FI8A 4DGJA 3A7XA 4CBOA 1DY9A 1O3AA 4IMQA 6GCHG 1F2SE 2H9EH 1AZZA 5IYTA 1O3BA 1W0YH 1AKSA 2ULLA 4ABFA 4GHQA 1TRNA 2O8MA 1TNLA 3RMMH 3TK5A 1UVSH 4X2WA 1LVOA 4WMDA 1DM4B 2AS9A 1L1JA 1O3MA 2H5CA 2QYIA 3V0XA 1C2JA 1TNHA 5FPYA 1TAWA 3CENA 4Y11E 1S5SA 2UUKB 2A4QA 1CA8B 2O8UA 3B9FH 1V2LT 2ZTXA 2BTCE 1S81A 1AVGH 3E16B 4H6TA 3R3GB 1SGFG 4A6LA 1C2DA 3OY5U 4HGCA 1FPCH 3KQDA 1NESE 2H9TH 1TQ0B 1AU8A 5EQRA 1BRBE 3ZYEA 3A82A 1EATA 3A86A 1GVLA 4ZHMU 1TQ7B 3QUMP 3LDXH 1YLCA 2ZCKP 1KTSB 1SGNE 2I6SA 3QGNB 3U1IB 1FJSA 3SO3A 2FX4A 5I25A 1GGDC 2PHBA 4D7GA 3QZQA 1O33A 1QRZA 4F49A 2P93A 1SFQB 2VWMA 4K60A 4TYDA 1MKXH 1YPHE 2ANYA 3EYDA 1T4VH 2FIRH 4CHAC 1HAXB 2F9UA 2JKHA 1TX8A 4A1XA 3RXHA 3MH6A 1A0HB 2A7HA 4DY7B 3DHKH 1K9OE 1EAXA 1C5XB 4AB9A 2GT7A 3MU8A 1C5NH 1F5LA 4ZKOU 3Q77A 1TMTH 1YP9A 1SQTA 3FP8E 1CO7E 3NKKA 4INHA 4FUFA 3AW1A 2ZDKA 1IQEA 1A5GH 5DO4H 1Y3WA 1Z7KA 3C27B 3IITA 4YOJA 3NWUA 3E6PH 4NSVA 3EGKH 1QB6A 3OY6U 3M7QA 2CF8H 4HI3A 5DP7A 2VB0A 3P8OA 5ABWA 4DIHH 1SHHB 3W94A 4Y10E 3PMJA 4ISLA 1BJVA 4KP0A 1FUJA 4X8TH 1OWDA 1EJNA 1SGQE 1P57B 3SZNA 3T28A 1TRYA 3D62A 1E34B 2F9NA 3MHWU 2UWLA 2ANKH 1GBFA 1FIWA 2A2XH 1F0TA 2PKSC 3RXDA 3SV9A 5T3HA 1MTVA 4B75A 7KMEH 2Y5HA 8GCHF 3VGCC 3TH3H 4Y76A 1SLVB 4DURA 2XBYA 3LC5A 4KTCA 5LPRA 1S6HA 1PYTD 3DFJA 1XKAC 1Y5BT 2FMJA 1GBMA 4R8TB 5GPIB 2SGQE 2Y7ZA 4B2BA 2GD4B 3L33A 2AGEX 3TJVA 3RP2A 2XTTB 4Z6AH 1CHOG 1DOJA 1F0RA 2F9PA 3TK6A 3SNCA 1NFYA 1NTPA 1ZTLA 2FOFA 3V3MA 1D3QB 3LPRA 1ZHMA 7ESTE 1ZHRA 1J16A 1FLEE 1GGDB 4U32A 1NPMA 1XMNB 1RD3B 1D9IA 1FMGA 1V2OT 1SHYA 2Z94A 1QBVH 4JK5A 2G52A 4QT8C 1TALA 1FY3A 2PTNA 3GY8A 3P8NA 3LJOA 3T25A 1PPEE 2QA9E 1SLXB 4CHAB 1TWXB 1W12U 4BTUB 1JXPA 1O3LA 2BLQA 4MPWA 1GHZA 1J15A 3LIWA 4B74A 2TPIZ 5T6DA 1GJBB 1TNGA 1SC8U 1ELCA 4OS6A 4UDWH 1LVBA 4Y8ZA 2GT8A 3GYLB 2WV4A 4H42U 1P11E 1DFPA 1RTKA 1HIAA 5EPYA 2Y80A 3F68H 1P9UA 3ZZ4A 3E0PB 2J2UA 4ABBA 6LPRA 1KLTA 4B2AA 1KLJH 2BDCA 2R2WU 4WXVA 2HWLB 2NU4E 1VITF 2GTBA 4DCDA 2RA0A 4CH2B 4BXWA 1V2WT 2IN2A 1SGEE 1SVPA 5JDUB 4ABDA 1HGTH 4NIXA 1AVXA 3RDZA 1O3DA 1GJ5H 2A0QB 2CV3A 2GCHG 2GX4A 3LGWA 3Q3XA 4U30A 1ELTA 1GJ6A 4A92A 2AYWA 2PKSB 1BTHH 3VXFH 1KIGH 4LZ4B 2BLWA 1NY22 2ZQ2A 1AIXH 1TPOA 3VGCB 2J94A 1EB1H 1K1OA 1YPKH 1DANH 8KME2 2PV9B 1C2GA 1LQEA 1TBRH 5BPEA 2ANMH 1QY6A 2QV1A 4GCHG 3W95A 1BQYA 3V7TA 2JETB 2P59A 4NZLA 1CE5A 1F5RA 2ZU5A 1C5WB 4I8JA 4DIIH 1ANEA 1FONA 3FP6E 3LGUA 1AN1E 1GJ8B 2BVRH 1V2PT 2BD8A 1SFIA 3OSYA 3ZZDA 2FOHA 5GJ4B 4TY7A 1XUJA 1GMCF 4BTTB 4CRBA 4X8UH 1AGJA 3I29A 2G4TA 3P8GA 1HBTH 4XFQA 3CP7A 2SGFE 1HLTH 1C5ZB 1ETSH 2ANWA 2I6QA 3TNTA 5L2ZH 1GBCA 1OWIA 3FVFB 5BRRE 1UTQA 4GAWA 2WPLS 1HAVA 3F9EA 3PLBA 4MPUA 1IHSH 1S0RA 1XX9A 1RGQA 1NRNH 1VCQA 2GV6A 4IW4E 2B7DH 1TX6A 3M7TA 3L3TA 4ZAEA 2OUAA 1P10A 4JCNA 3LU9B 3U8TH 4H6SB 1J9CH 3M5NA 1G2MA 2ZGXH 3MMGA 2G81E 4CREA 3HKIB 1XM1A 2Z9LA 1GHBF 5LPEA 1TYNA 1QBNA 1HUTH 2Q6DA 3RXBA 1PPGE 1AB9C 2P3FH 1ZTJA 1IAUA 3ZZ6A 4A1VA 1BJUA 3KQCA 1C5SA 4Y8YA 5CMXH 1P06A 1O2LA 1ZGIA 1EZSC 3HPTB 4MNVA 1QNJA 4E05H 1TGBA 2OQUA 3U8OH 1W11U 1GVZA 3MU4A 1TOCB 3QX5H 1BHXF 4K1SA 1L0ZA 1IQMA 2V3HH 2EC9H 5ESTE 1DX5M 1WTGH 3AW0A 1AI8H 3QGJA 1N8OB 3BTQE 4IMZA 4NA8A 4NSYA 3TJOA 3PTBA 4ZH8A 3SU0A 2BVXH 7GCHG 1TRMA 4KELA 1W0ZU 1ZMNA 4YO9A 2FTLE 3LC3A 2OC1A 4WVPE 3ATLA 2HGTH 4JYVH 2P3UB 1SQAA 1C5VA 1SGRE 1P8VC 3DD2H 1G3EA 2ZTZA 3ZVGA 1NRSH 4YTAA 3LT3A 3D65E 2PWXA 2XCFA 3BTFE 2O8LA 1YPEH 4B2CA 1TBZH 3RMLH 3SU1A 1NFUA 2Y6TA 1MAXA 4WJG2 3EA7A 1G36A 3DFLA 1XUIA 1ZMLA 1AFEH 1YYY1 1P09A 4FVBA 2XC0A 3OU0A 1O3GA 3MU5A 1G2LA 1UVPA 1PQAA 2FOGA 4I32A 1ZPCA 1GI2A 1UTLM 1S84A 4LOYH 2BLVA 1P2NA 3GCTG 3P8FA 3U98H 4LZ1H 4O03A 1ZSJA 2WUBA 1C5QA 2BXTH 1TNKA 4A7IB 4X0WU 5EU8A 5E2OA 3T62A 4KKDA 3SGBE 1UCYK 3LGYA 5F6MA 2ZI2H 4WMFA 3UTUH 3F6UH 4ZHAA 3RM0H 5JBBS 4AZ2B 1GJ4H 4UFFH 5GWZA 3KQEA 1CT2E 1GBKA 3ENSB 3RXOA 4I8LA 3EQ0H 1KXCA 1ZYOA 1AB9B 1CSOE 1O3NA 3S9AA 2D2DA 1FQ3A 4OS5A 3K9XB 3M61U 2AIPA 2F91A 1LHGH 1PPHE 1HCGA 2A7CA 2ZZUH 2H2ZA 1ZR0A 3O8BA 1O5GH 2XRCA 1FY4A 3ATKA 2STBE 1O5FH 1Y3UA 2GDDA 2GZ7A 5C1YA 4I8GA 3M5OA 1O3IA 3PLPA 1MCTA 1O37A 3SV6A 3UNRA 1ZTKA 2BY7X 1Y8TA 1BBRK 2BD4A 1MBMA 3KNXA 3LGIA 4ZHLU 1BTZA 2HOBA 3RXAA 1KDQA 2A45B 2D26C 3VEQB 3MYWA 4AG1A 4E06H 1L1NA 2BD5A 1FIZA 2FP7B 2UUJB 1ARCA 4X1SU 3NZIA 3T5FH 4E7RG 2FOBA 2ZF0H 1EAWA 1BRUP 2Q1JA 5L30H 3UQOA 3QWCH 1KXEA 5GDSH 1SBWA 4IN1A 3URDA 3CS7A 4E7NA 2VWLA 5A09A 1F7ZA 1QTFA 1BBRE 1OP8A 2R3YA 4Q80A 1WOFA 2IOTA 1AWFH 5E8EH 1HJ8A 5C20A 3M36A 3SNDA 3ZZ7A 2P8OC 4NIVA 3BTGE 1O5EH 1GHWH 1SMFE 3BEFB 2ZFSA 4ABIA 4AYVB 1TA6A 1KSNA 3SI4H 2CXVA 4D76A 1GJDB 1HYLA 1ETRH 4B1TA 1P05A 1PYTC 1KDQB 5T6GA 8ESTE 3VB6A 1UTOA 4JYUH 3GYMA 2ALVA 1O2XA 4BAHB 3SQEE 4ZXYH 1S85A 4MPVA 1NN6A 3A7ZA 1KYNA 3E3TA 1V2VT 3H7TA 4NCYA 3MNBA 1EXFA 4X1PU 1XUGA 4INKA 2F9VA 4K1TA 4BAMB 4ZKNU 3SV2H 1ESBA 1GJ7B 2FDAA 3PTNA 1GWAA 1TABE 4XOJA 5CHAC 2AH4X 1DXPA 1F0SA 1VCWA 5AHGH 1TPSA 9ESTA 2OC7A 1C1MA 1FPHH 2FX6A 3RXTA 1SGYE 3A88A 2VVVA 5F8TA 3OYPA 3RM2H 1JOUB 1G3CA 1LPKB 1RFNA 2W26A 1O2TA 3GISB 8LPRA 1W7XH 4FVDA 1P2JA 1WTHD 4OGXA 4BOHA 4JZEH 3B23B 3QN7A 1A7SA 3MNXA 1UTNA 2AGGX 5T6FA 1AO5A 4TWYA 5C3NA 2R9PA 3A8CA 1H8DH 3ZZCA 2W7SA 2GP9B 1UO6A 1T8LA 1Z71A 3MOCA 1OWEA 2F9OA 2NU2E 1HJ9A 1O3EA 2ZFFH 3O8RA 4B73A 1RIWC 5EQSA 3EAJA 1BHXB 2BY5X 1SGDE 2FTMA 4JZ1A 4Q7ZA 3P70B 2NU0E 1AKSB 4OS1A 4IS5A 2WYJA 1YCPK 1QHRB 3U69H 4JZDH 2H9HA 1XUKA 3MH5A 1JRSA 4ZUHA 1O35A 2W7UA 3NK8A 1GI5A 4J2YB 1CT4E 4MVNA 2P8OB 3GY6A 3RXGA 2SGDE 3GDVA 1Z1IA 1EZXC 3LGTA 1A4WH 1O38A 2BD9A 2ZDMA 3Q3YA 4DOQA 3SQHE 1V2JT 1ZJKA 5JPMH 4FUIA 4AFUA 2XC5A 5EG4A 1NU9A 4BTIB 2AERH 2ZG0H 1FXYA 2VU8E 1ELAA 4NFFA 2A4OA 3LOXA 4Y71A 3F1SB 4NG9H 2GZ9A 3UREA 3RC6A 3UUZA 2QF0A 3LGVA 4MNXA 1W10U 5CHAB 1UTJA 4SGAE 2VIWA 3TH4H 1AMHA 3K6YA 3MNSA 1ELDE 1W3CA 1TPAE 2XC4A 1DY8A 4WY3A 1C1RA 4X2VA 1A2CH 1GMHF 2ZPQA 1C9PA 4Y6DA 1Z8IB 2DUCA 2WPHS 3A8AA 4CH8B 3H5CB 4CRDA 1P04A 3MO9A 2J95A 2BDAA 1H9LB 1O3KA 3QTOH 4K69A 3GOVB 1O2ZA 1O36A 1WYKA 1QQUA 4MQAA 2FYQA 2ZGJA 2Z3CA 1ANDA 4WF8A 1VR1H 4X2YA 1UCYH 3LH3A 1NS3A 1KLIH 1C4V2 2ODPA 3KCGH 2K1QA 3P95A 2EI6A 3HGNA 2PSXA 2PLXA 1O2MA 1HDTH 1BT7A 5GIBA 3URCA 2JETC 1GJ9B 3M7UA 3RMOH 2FOAA 2ZCHP 1AD8H 3E8LA 1DDJA 1RIWB 2G00A 3R0FA 5EGMA 1YKTA 1A5HA 9LPRA 2YNAA 2WPIS 3QZRA 2OLGA 4JK6A 1MKWH 1UJ1A 4F4OC 3GY7A 1O2KA 3HK3B 1MTWA 2G5NA 5FHTA 1NRQH 1U6QA 4SGBE 3SHAH 4AN7A 1Y59T 5EXLA 1TIOA 4XBDA 1ARBA 4FU8A 5H4IB 1DSTA 1RXPA 1UVTH 5J4QA 4XBCA 4ZKRU 3UOUA 2FXRA 1BOQA 1QJ6B 5JBTA 2SGPE 1SGIB 3BIVH 2NU1E 1ZLRA 2Z6BD 4FUGA 1YC0A 1GI8B 1TGNA 3P92A 2Z3DA 1YLDA 4FXGH 1F92A 5A0BA 1BBRH 2UWPA 2F9BH 2OP9A 3E1XB 3SNAA 1PQ5A 2OBOA 2XWAA 3LJJA 3U9AH 3MO6A 2GDEH
chains in the Genus database with same CATH superfamily
2K8IA 3M35A 3DA9B 3VB5A 1XVOA 1K1MA 1Z1JA 4I31A 3SU6A 3U8RH 2BY8X 1H9IE 5L2YH 1K22H 2Q6GA 2QGRA 3GDUA 4ISIH 3TK9A 3BG8A 4TPYA 2YMSB 5HYOA 5HM2A 2PSYA 1LHFH 2NWNA 1K1LA 4MNYA 5E2PA 3SV8A 1XUHA 1VITH 1VCPA 1NU7B 3S0NA 1TNJA 4ZCNA 1P3CA 2BDBA 4MNWA 2ZIQH 1E36B 1QZ8A 2AMQA 1ZMJA 1O2WA 3UPEA 1C1VH 1TB6H 1ESAA 1XXDA 2V35A 3MI4A 4H4FA 5EJ1A 5A8YA 1HAYB 1Z6JH 1HIAB 1ORFA 1C1QA 3VXEH 4UEHH 2QN5T 3MH4A 2BM2A 1C4Y2 3RU4T 4CRAA 2OQ5A 3A83A 3SUFA 1E38B 1N8OC 3M3SA 1ZPBA 3RU4E 1RTLA 4ABEA 1G32B 1XKBC 3HATH 1QURH 3PMBB 4CRGA 1MTNC 2BY6X 1P2QA 3NCLA 1PQ7A 3BTKE 2XBVA 1KXDA 1T8MA 2ZC9H 1BRCE 4MDSA 3UNSA 3TU7H 2WSSD 2HRVA 5FX5A 4FUBA 1AFQC 3EE7A 1S0QA 3SYJA 2F83A 5AFZH 1MTUA 4Y8XA 1GI9B 3TPIZ 3GCOA 3OAAD 1DICA 3A7VA 5HIZA 1C2HA 3BV9B 3EA9A 3RLYH 2ZU2A 1HJAC 1TX7A 3TJNA 2VIQA 1UK3A 2GKVE 1BMNH 1ZHPA 2SNWA 2BDYA 4B76A 3AK5A 2ZNKH 2B9LA 2IPHA 1DSUA 1IQKA 1G9IE 1HAHH 3BTEE 3ZV9A 3TITA 1T8OA 2M5TA 1C1SA 1TNIA 1AZ8A 1GJAB 2RDEA 3P17H 2FI5E 5DP5A 1PQ8A 3H09A 1GPZA 1QR3E 2AGIX 1W7GH 2QXHA 2R2MB 2BB4A 3BTWE 1C2LA 5K7RA 1GDNA 4MLFB 3ZZAA 1HPGA 1RRKA 1DITH 4BAOB 1C5LH 1Y5UT 3A87A 1ZSKA 1DT2A 2Y82A 1UHBA 1B5GH 1K0HA 2QXIA 2R0KA 1KXBA 1BB0B 2FESH 1V2TT 2TRMA 1GL0E 2TGPZ 3PM3A 3TVJB 3OTPA 2BXUH 5A8ZA 1INCA 1F5KU 1YCPH 3PB1E 1J8AA 1QB1A 1GI1A 1ABJH 3JZ2B 1V3XA 4PROA 5SGAE 1HAVB 3G01A 1HAPH 1YM0A 2VNTA 1IQGA 5C5OA 2BDIA 2JJ2D 1UVUH 1O34A 4J1YA 3F9HA 4BAQB 3UQVA 2GCHF 3AVZA 1S6FA 1AE5A 1C2FA 1COWD 2ZGHA 1K21H 2ZP0H 3RLWH 1D4PB 3RC4A 3PYHA 1AUTC 5L6NH 2ALPA 1NRPH 3ATIA 1MTNB 4Q2KA 1O2SA 2FEQH 1FZZA 2BVSH 4K8YA 1RTFB 5G4BA 1TGSZ 1FN8A 2ZPSA 3F9GA 1ZJDA 4GCHF 2BX3A 1O2IA 4RKJB 2FLBH 1Q3XA 1V2ST 1AFQB 3GY2A 5EQQA 2ZGBH 1YPGH 1OYQA 2QCYA 4YT7H 3MH7A 1GBIA 5F8ZA 2A32A 1C1TA 2FPZA 1GHAG 1QQ4A 5EIYA 1A5IA 4LXBH 4HG6A 1L4DA 1SGFA 1HJAB 3ELAH 1FV9A 4U01A 1K28D 2ZDLA 4X1QU 4WH6A 3SGQE 1TE0A 5EW1H 1MH0A 3PMHB 2ZECA 4RN6A 1Z8JB 1Y3XA 1O0DH 3Q76A 4AFZA 2A7JA 1QA0A 1C5UA 1OP0A 2IJOB 3T29A 1AVWA 1GBAA 4ABJA 1H9HE 2BD2A 1C5YB 2OD3B 2EI8A 2VH0A 4YT6H 1BTXA 1Y3VA 3GICB 2QIQA 3FFGA 3HK6B 2ZFRH 4NIWA 3ZZBA 1LMWB 3ZV8A 3ZVDA 1O2YA 2BOKA 3SJ9A 1IQIA 3PV4A 4ISHH 3F3BA 3PLKA 5KECA 3NUMA 4HTCH 3OTJE 3GS9A 5A0AE 1D3DB 3GCNA 3SOSA 3SHCH 3SU2A 4GVUA 1ANCA 1OP2A 5DGJA 1GMDG 1MQ6A 2C8WB 2PUXB 3T26A 2XXLA 1FN6A 1EB2A 2F4LA 3A8BA 2CJIA 5E0GA 2AEIH 1MKWK 3SNEA 5IK2D 1GI3A 2FYRA 1A0LA 7LPRA 1GCDA 3RXIA 1UCYE 1UTMA 3M37A 2G8TA 2XWBI 1MZAA 1T7CA 2ASUB 2A31A 1XUFA 1UMAH 3KF2A 5EPNA 5LH8A 1NC6A 1VJ9U 2VJ1A 2ZO3H 2XYAA 1MAYA 4KTSA 1IHTH 1UTKA 2O8TA 3ZVBA 1YPMH 2GJGA 4IBLH 5FX6A 4X1RU 2TBSA 4X6OA 1EUFA 2Y5FA 1THPB 2Z9GA 1TFXA 2XBXA 1C5TA 3RMNH 3BEUA 2C8XB 1EOJA 1JBUH 3BIUH 1DS2E 1HNEE 1WCZA 5LPFA 1P9SA 2RG3A 4AB8A 4R0IA 2O8WA 1GHXH 2ZFPH 1TGTA 1O2HA 2XBWA 1QIXB 4OGYA 4K5ZA 5DP9A 4BANB 1HV7A 7GCHF 1JIMA 5TCAA 4YZUA 1E35B 1IQNA 2ZDVH 1CU1A 4AGKA 2KCPA 1W2KH 4BAKB 1O3JA 1QB9A 4AG2A 3ATWA 1KXFA 1V2NT 4CBNA 1XVMA 1O2RA 2JIZD 2BQ6B 3I77A 1QL9A 3F9FA 4IC5A 1O2NA 3AAUA 4K3JA 2J92A 4YLQH 3NPSA 1WU1A 1OWHA 1LHDH 1MCVA 1SQRA 3BN9A 2FWWA 2FI4E 1O2VA 4P02A 1LHEH 5HM9A 3RC5A 4I8KA 1P02A 1ACBE 3A89A 4XD7D 1C5OH 1ELVA 1A46H 1EQ9A 1KXAA 2ODYB 3F0PA 2WHXA 4X2XA 3UR6A 3IWMA 3O8CA 4AX9H 1AWHB 4X6PA 3GCTF 4TSFD 3I78A 1EJAA 1T32A 1WV7H 3BEIB 1C5PA 2PW8H 3RXPA 2OXSA 3F2FA 2Z9IA 3SJIA 3RXMA 1MBQA 4YOIA 2Z3EA 4FUJA 3RXEA 2SNVA 3S7KB 2ZGCA 3A80A 2LNCA 4HFPB 3SUDA 3VB7A 1EKBB 4FU9A 5AF9H 2Z9KA 1O2OA 4ZKSU 1OPHB 1GDQA 4MG3A 1FY1A 3SBKA 2CMYA 1J14A 3RXRA 4FUHA 1DWEH 1ANBA 4KTUA 2ZDNA 1ZOMA 5F8XA 1MD7A 1E0FD 3ODFA 1MTSA 2CHAC 3UNQA 4AOQA 1Y5AT 1MUEB 2A5AA 3ZZ5A 1YF4A 3STIA 2HALA 1BRAA 3S9BA 2VGCC 1DUEA 1FY8E 5HMAA 4BXSA 1ABIH 3E0NB 4X6NA 2CGAA 2Y81A 4UFGH 2EA3A 1ZRKA 3ZZ9A 2G4UA 3GDSA 4OS4A 1FY5A 1NFXA 3F0OA 4UFEH 5TJXA 3UOPA 1GBHA 2W3IA 1HAZB 3HKJB 3BTDE 3PV2A 1QJ1B 4Y0YE 1TA2A 4TY6A 8GCHG 1H8IH 2ESTE 1CGIE 1BUIA 1LHCH 4NIYA 1C2MA 4NWLA 5C5NA 3SW2B 5GCHF 3Q00A 5A0CA 3TGIE 4DJZB 2A5KA 2XCNA 1SI5H 3UR9A 3MWIU 4DVAU 1ZGVA 5ETXA 2BD3A 2TGTA 2BX4A 2THFB 3MTYA 5DK1A 1EPTA 4NWKA 1TMBH 1BA8B 2BDGA 1K2I1 4Y0ZE 1ELEE 2VVCA 4ABHA 2FS9A 3UB0A 1OOKB 1QCPA 1C2EA 1THSH 1C1NA 1L1GA 2BMGB 3D49H 3QDZB 4DG4A 2P16A 2ZEBA 2TGAA 1Z8GA 2ZWLH 1PPBH 1IQFA 1RS0A 5B6OA 3TGJE 3D23A 3ZZ3A 3FZDA 1LVYA 1JMOH 2KR7A 4AC9A 2OINA 4LK4A 5FBEA 3V13A 1C1UH 1OKXA 2HNTF 3K2UA 3ZVFA 1FAKH 2YOLA 2ZPRA 3KHVA 1P2KA 4Q7XA 5KEDA 1V2KT 1BMLA 4K1EA 1EPTB 2D1JA 1OSSA 3VPKA 1SPJA 1A3EH 5DP6A 1TLDA 4XE4A 1UTPA 3MNCA 3SUEA 1HRTH 1EP6A 1H4WA 3SJKA 3ZVAA 1WQVH 1MU8B 1UVOA 5AVDA 3ZVEA 1K1NA 4OS2A 1B0EA 2F43B 5LGOA 1E1QD 2FZZA 4ISNA 1VITG 2C4FH 4P00A 4X6MA 1NRRH 2VWOA 2CHAB 2Y7XA 3EDXB 2VIDA 5FBIA 3GY5A 3TNSA 2LELA 1SSXA 2JDID 1GBTA 1Y3YA 2VGCB 1V2RT 2Q6FA 2H5DA 3FZZA 2B0FA 1H1BA 3BTHE 4TWWA 1WQSA 2CF9H 5TCCA 2J97A 4DT7B 4K8BA 2PUQH 2UUYA 2QY0B 3KEEA 6GCHF 2FOMB 1YY3A 3EE0B 3F2HA 2GMTC 5EW2H 2C93B 4ISOA 2STAE 1CHGA 1O3HA 3TH2H 5FCRA 2GGVB 4I86A 1HAIH 2FODA 4TPIZ 2VIPA 1EJMA 1OX1A 1HAOH 4AYYB 5EXNA 2A4RA 1ESTA 2BZ6H 4I8HA 3VB3A 1NZQH 2DE8A 2OC8A 2ZCLP 2FO9A 5C2ZA 3PO1C 2RDLA 2QF3A 1WAYB 2GCTC 3OEED 1UK4A 2KZ4A 1EP5A 1K1IA 5A2MH 3ODDA 1GMCG 3S69A 4AFQA 2NU3E 3IG6B 1EX3A 4Q7YA 3Q3KA 1D3PB 2PTCE 1LKAA 1V2UT 1RJXB 4ASHA 1XXFA 4GSOA 2EI7A 1BMMH 1LTOA 3UWIA 3S7HB 1OS8A 1EASA 3TIUA 1EZUC 2EEKA 4IC6A 1SGCA 1VJAU 5CE1A 1O32A 1DXWA 1FNIA 4NA9H 1WXRA 4GLYA 3AASA 3SV7A 1BCUH 1TOMH 3RXSA 2KM0A 1A61H 1NO9H 4KGAA 1D6RA 2W6JD 2HLCA 2TIOA 2VH6A 4Y79A 4ZMAH 3N7EA 2AFQB 4XRNA 1O30A 1O5BB 2BHGA 5B6LA 1QA7A 1G37A 1DWCH 2ZHEH 3KQBA 4AGJA 4JMYA 1AHTH 3SU5A 2C90B 3V12A 2XNDD 1DWDH 1LO6A 2J98A 5FCKA 1PJPA 1MQ5A 1GHBG 2P95A 3MO3A 2A1DB 1CQQA 1LVMA 1JIRA 4X1NU 4BNRA 2G55A 2VVUA 1S83A 3SJOA 1DLKB 5F53A 3FAOA 2PKAA 2P3TB 1A1RA 3B8JA 4GHTA 1O39A 3C1KA 3AAVA 2FOCA 3A7YA 4F48B 1C1WH 3SN8A 1DLEA 3HGPA 2XW9A 4FUDA 4MTBA 2HNTC 1NROH 1GL1A 3M3VA 3MFJA 4ACBA 3NXPA 1ELBA 5EXMA 2GVFA 3DUXH 1O2GH 4XSKU 3TLOA 4AFSA 1O5AB 1P2MA 2R3UA 3LH1A 1SB1H 4UE7H 5FL7D 4IN2A 2GMTB 2DE9A 4RSPA 1T31A 2ZU3A 1NM6A 1CGJE 1AQ7A 4RT1A 1QGFA 1QFKH 4WWYA 2SGEE 1PPFE 1GI6A 1CA0C 3M3TA 1BTYA 1C1OA 6CHAC 2J98B 3KIDU 3K6ZA 2W3KA 4B6FA 2BQWB 2ILNA 1LQDB 1GDUA 3P6ZB 2ZHDA 3A8DA 3RXUA 1N6XA 1VGCC 1MD8A 1IOEA 2WPJS 3BTME 1X7AC 1GI7B 2SGAA 1N1LA 2PKAB 3PO1B 3RU4D 3E91A 2WPDD 4XDEA 5F03A 5HGGA 2YNBA 2AIQA 2GCTB 3ZYDA 2A4GA 2FI3E 2ZU1A 3FN8A 3DT0H 2ZDAH 2WYGA 2ZHFH 2RCEA 5EOKA 3K65B 3JZ1B 3VFEA 1O5DH 2ZFQH 1UK2A 5C1UA 2JH0D 2PP6A 3ESTA 1G3DA 1CHOF 4NGAH 4O3TA 2OC0A 5DP4A 3WWFA 1SOTA 1N6YA 3VB4A 2F3CE 3BG4C 5C67A 1SGTA 2QXGA 1GHVH 1HXEH 4VGCC 1ETTH 2KCAA 4I33A 3UWJH 1T8NA 4UFDH 5FPTA 2PGQB 4NZQA 2AMDA 3KN2A 2UUFB 1YGCH 1C2KA 4NFEA 2OBQA 5DP8A 1O2PA 4YLUA 4CRCA 4WH8A 4JYTA 1GBJA 1BIOA 1M9UA 1GCTC 1SLWB 1LCYA 3RXLA 1IQHA 3FANA 1EFRD 2WINI 4FUCA 5DJ7A 2BD7A 3TGKE 2PR3A 3GCHC 2ZKSA 2WV5A 4K2YA 1P3EA 3M5LA 1P03A 1V2MT 2TGDA 1LPZB 1L4ZA 2H1UA 3SJ8A 2JH5D 1EAUA 5AFYH 2WUCA 3FP7E 3S9CA 1THRH 2WPMS 1W8BH 3ZZ8A 1GBEA 2LPRA 1BMAA 1GBBA 3BSQA 1GHYH 2B5TB 2PFEA 1G30B 2H6MA 3SGAE 4ESTE 2KAIA 3RXFA 3SUGA 2BOHB 1TMUH 4JZIA 3PMAB 1C1PA 3RXQA 1HFDA 2HPQH 1MMJN 1P2OA 2R0LA 3PWCA 3STJA 1C5MD 1O31A 3E90B 2BQ7B 1IQJA 1UHBB 3UY9A 5A8XA 5FPSA 1CA0B 1P01A 1BTWA 3DSGA 1C9TA 1O2JA 6CHAB 4YESB 1ELGA 4D9RA 1MZDA 1YPLH 1PFXC 2BZAA 1DUAA 1VGCB 1DPOA 1O3PB 5DPAA 5E0JA 1NT1A 4M9FA 4YM9A 5C94A 1GJCB 4HZHA 4ABGA 1MKXK 3T27A 4CR9A 5FXLA 1CBWC 1GG6C 1ZZZA 1QJ7B 2HVXA 4DW2U 4X8SH 4D7FA 2A2QH 1NFWA 3M5MA 1QL8A 1W0KD 4JZFH 4ZXXH 2KAIB 2Z7FE 4THNH 3SU3A 1ID5H 3T2NA 1GBLA 2FM2A 1CVWH 3LKWA 3SORA 2ZQ1A 3BF6H 1TGCA 3BG4B 2V6NA 2WPKS 2VBCA 4O97A 5DG6A 1YPJH 2ZFTA 1WBGB 2UWOA 3QO6A 4VGCB 2GV7A 1B7XB 3VG8A 1W14U 4MPXA 1BTPA 1K1PA 1BITA 4B71A 4X8VH 2W5EA 2HNTE 1Q2WA 1HXFH 1ZPZA 1YBWA 1LDTT 2G51A 2QXJA 4UONA 1DWBH 1O3FA 3ATMA 1B0FA 5I46H 3RXVA 2OTVA 2EQNA 1SLUB 1GCTB 1GBDA 1WDIA 1F0UA 2C8ZB 4YXWD 2J34A 1Z8RA 1OWKA 1JRTA 3GCHB 5IDKA 1EAIA 4D9QA 1FX0B 4AORA 4ZROA 2V0BA 2FLRH 3GY3A 1TONA 2RA3A 2BY9X 2G5VA 3ZVCA 3FO8D 1SOZA 3SI3H 5JBAS 1O3CA 4XBBA 4GPGA 1Q31A 1IQLA 1W0JD 4OS7A 4O3UA 1AUJA 2D8WA 3WY8A 5GXPA 3H7OA 4Y7BA 3QTVH 3FOAA 1PPZA 1O2UA 3PROA 3RXCA 1GVKB 3F2GA 2C8YB 4IGDA 3RXJA 1PPCE 5J4SA 4RKOB 5JB8S 4Y7AA 1D6WA 3WW7A 1WSSH 2BDHA 2ZTYA 5ESBA 1QRWA 2CN0H 2B8OH 1FDPA 2J38A 1FAXA 1QL7A 4YOGA 5PTPA 1BTUA 1ZSLA 4NA7A 3ITIA 2QAAA 1OWJA 1YPHC 2VINA 1EZQA 1VKYA 1P2IA 1A3BH 1LPGB 1QRXA 1V2QT 5EODA 1ELFA 2V3OH 1CT0E 2ODQA 3MU1A 1LKBA 5FAHA 2OCVB 6ESTA 1BDAA 1CBWB 3OX7U 1GG6B 2ZU4A 5GCHG 1QBOA 1K1JA 1OXGA 4M7GA 1SQOA 3KYGA 3PWBA 2Z9JA 1O2QA 1YCPM 3O8DA 2Y5GA 1T4UH 1C2IA 2O9QA 5K0HA 3A84A 5JB9S 3A7TA 3KGPA 3U1JB 1BMFD 1SGPE 1P12E 3A81A 1E37B 3RUOA 1C4U2 4CR5A 2HPPH 4WMEA 4A5TS 1HB0B 1AE8H 1GHAF 3A85A 1O5CB 1SG8B 2P94A 2AMPA 2XOKD 1A0JA 4A1TA 4ABAA 1HAGE 4WXIA 1DE7H 2XNIA 4RI0A 4GUXA 2ZA5A 4Z0KA 3EA8A 1WUNH 2VWNA 5E0HA 3UIRA 5JYIA 1C5RA 2BYAX 4I7YH 2PGBB 1TBQH 3N7OA 4D8NA 3SU4A 2VIOA 4Q4LA 3BTTE 3KL6A 2C3SA 2J9NA 1MU6B 4O9VA 4CRFA 4UD9H 5DKMA 2SFAA 2QC2A 1EPTC 3CS0A 5HXFA 3QLPH 1KY9A 1L2EA 1GI0A 1JWTA 2VIVA 2ZHWH 4INLA 1J17T 2J5UA 4FUEA 3QK1A 1AY6H 1G3BA 1VZQH 3GY4A 5EJLA 3LONA 1KTTB 2K0QA 2FS8A 3SNBA 3A7WA 1SL3A 3UFAA 1H8HD 1GMDF 2JH6D 1GI4A 2GZ8A 1O3OA 3RXKA 2EY4C 5JBCS 2J4IA 3MQKC 1SR5C 1EOLA 4FU7A 1V6DA 4U2WA 3TJUA 1GMHG 1BZXE 3MU0A 1Z6EA 2BLOA 2A5IA 1D3TB 1CGHA 1OYTH 1TPPA 1W13U 2FOEA 5DP3A 1DVAH 1P0SH 5C1XA 3L6PA 2ZHQH 1ZRBA 1S82A 1FI8A 4DGJA 3A7XA 4CBOA 1DY9A 1O3AA 4IMQA 6GCHG 1F2SE 2H9EH 2M2AA 1AZZA 5IYTA 1O3BA 1W0YH 1AKSA 2ULLA 4ABFA 4GHQA 1TRNA 2O8MA 1TNLA 3RMMH 3TK5A 1UVSH 4X2WA 1LVOA 4WMDA 1DM4B 5DSFA 2AS9A 1L1JA 1O3MA 2H5CA 2QYIA 3V0XA 1C2JA 1TNHA 5FPYA 1TAWA 3CENA 4Y11E 1S5SA 2UUKB 2A4QA 1CA8B 2O8UA 3B9FH 1V2LT 2ZTXA 2BTCE 1S81A 1AVGH 3E16B 4H6TA 3R3GB 1SGFG 4A6LA 1C2DA 1MABB 3OY5U 4HGCA 1FPCH 3KQDA 1NESE 2H9TH 1TQ0B 1AU8A 5EQRA 1BRBE 3ZYEA 3A82A 1EATA 3A86A 1GVLA 4ZHMU 1TQ7B 3QUMP 3LDXH 1YLCA 2ZCKP 1KTSB 1SGNE 2I6SA 3QGNB 3U1IB 1FJSA 3SO3A 2FX4A 5I25A 1GGDC 3KQ5A 2PHBA 1NBME 4D7GA 3QZQA 1O33A 1QRZA 4F49A 2P93A 1SFQB 2VWMA 4K60A 4TYDA 1MKXH 1YPHE 2ANYA 3EYDA 1T4VH 2FIRH 4CHAC 1HAXB 2F9UA 2JKHA 1TX8A 4A1XA 3RXHA 3MH6A 5T1VA 4FOUC 1A0HB 2A7HA 4DY7B 3DHKH 1K9OE 1EAXA 1C5XB 3OE7D 4AB9A 2GT7A 3MU8A 1C5NH 1F5LA 4ZKOU 3Q77A 1TMTH 1YP9A 1SQTA 3FP8E 1CO7E 3NKKA 4INHA 4FUFA 3AW1A 2ZDKA 1IQEA 1A5GH 5DO4H 2QE7D 1Y3WA 1Z7KA 3C27B 3IITA 4YOJA 3NWUA 3E6PH 4NSVA 3EGKH 1QB6A 3OY6U 3M7QA 2CF8H 4HI3A 5DP7A 2VB0A 2LP6A 3P8OA 5ABWA 4DIHH 1SHHB 3W94A 4Y10E 3PMJA 4ISLA 1BJVA 4KP0A 1FUJA 4X8TH 1OWDA 3CNRA 1EJNA 1SGQE 1P57B 3SZNA 3UAIC 3T28A 1TRYA 3D62A 1E34B 2F9NA 3MHWU 2UWLA 2ANKH 1GBFA 1FIWA 2A2XH 1H8ED 1F0TA 2PKSC 3RXDA 3SV9A 5T3HA 1MTVA 4B75A 7KMEH 2Y5HA 8GCHF 3VGCC 3TH3H 3WWBA 4Y76A 1SLVB 4DURA 2XBYA 3LC5A 4KTCA 3W1EA 5LPRA 1S6HA 1PYTD 3DFJA 1XKAC 1Y5BT 2FMJA 1GBMA 4R8TB 5GPIB 2SGQE 2Y7ZA 5DN6D 4B2BA 2GD4B 3ZIAD 3L33A 2AGEX 3TJVA 3RP2A 2XTTB 4Z6AH 1CHOG 1DOJA 1F0RA 2F9PA 3TK6A 3SNCA 1NFYA 1NTPA 1ZTLA 2FOFA 4OM9A 3V3MA 1D3QB 3LPRA 1ZHMA 7ESTE 2WV9A 1ZHRA 1J16A 1FLEE 4ASUD 1GGDB 4U32A 1NPMA 1XMNB 1RD3B 1D9IA 1FMGA 1SKYE 1SHYA 1V2OT 2Z94A 1QBVH 4JK5A 2G52A 4QT8C 1TALA 1FY3A 2PTNA 3GY8A 3P8NA 3LJOA 3T25A 1PPEE 2QA9E 1SLXB 4CHAB 1TWXB 1W12U 4BTUB 1JXPA 1O3LA 2BLQA 4MPWA 1GHZA 1J15A 3LIWA 4B74A 2TPIZ 5T6DA 1GJBB 1TNGA 1SC8U 1ELCA 4OS6A 4UDWH 1LVBA 4Y8ZA 2GT8A 3GYLB 2WV4A 4H42U 1P11E 1DFPA 1RTKA 1HIAA 5EPYA 2Y80A 3F68H 1P9UA 3ZZ4A 3E0PB 2J2UA 4ABBA 6LPRA 1KLTA 4B2AA 1KLJH 2BDCA 2R2WU 4WXVA 2HWLB 2NU4E 1VITF 2GTBA 4DCDA 2RA0A 4CH2B 4BXWA 5HIYA 1V2WT 2IN2A 1SGEE 1SVPA 5JDUB 4ABDA 1HGTH 4NIXA 1AVXA 3RDZA 1O3DA 1GJ5H 2A0QB 2CV3A 3DSOA 2GCHG 2GX4A 3LGWA 3Q3XA 4U30A 1ELTA 1GJ6A 1E79D 4A92A 2AYWA 2PKSB 1BTHH 3VXFH 1KIGH 4LZ4B 2BLWA 1NY22 2ZQ2A 1AIXH 1TPOA 3VGCB 2J94A 1EB1H 1K1OA 1YPKH 1DANH 8KME2 2PV9B 1C2GA 1LQEA 1TBRH 5BPEA 2ANMH 1QY6A 2QV1A 2V3MA 4GCHG 3W95A 1BQYA 3V7TA 2JETB 2P59A 4NZLA 1CE5A 1F5RA 2ZU5A 1C5WB 4I8JA 4DIIH 1ANEA 1FONA 3FP6E 3LGUA 1AN1E 1GJ8B 2BVRH 1V2PT 2BD8A 1SFIA 3OSYA 3ZZDA 2FOHA 5GJ4B 4TY7A 1XUJA 5CDFE 4Z1MD 1GMCF 4BTTB 4CRBA 4X8UH 1AGJA 3I29A 2G4TA 3P8GA 1HBTH 4XFQA 3CP7A 2IJD1 2YMSD 2SGFE 1HLTH 1C5ZB 1ETSH 2ANWA 2I6QA 3TNTA 5L2ZH 1GBCA 1OWIA 3FVFB 5BRRE 1YWUA 1UTQA 4GAWA 2WPLS 1HAVA 3F9EA 3PLBA 4MPUA 1IHSH 1S0RA 1XX9A 1RGQA 1NRNH 1VCQA 2GV6A 4IW4E 2OK5A 2B7DH 1TX6A 3M7TA 3L3TA 4ZAEA 2OUAA 1P10A 4JCNA 3LU9B 3U8TH 4H6SB 1J9CH 3M5NA 1G2MA 2ZGXH 3MMGA 2G81E 4CREA 3HKIB 1XM1A 2Z9LA 1GHBF 5LPEA 1TYNA 1QBNA 2W6ID 1HUTH 2KX4A 2Q6DA 3RXBA 1PPGE 1AB9C 2P3FH 1ZTJA 1IAUA 3ZZ6A 4A1VA 1BJUA 3KQCA 2L74A 1C5SA 4Y8YA 5CMXH 1P06A 1O2LA 1ZGIA 1EZSC 3HPTB 4MNVA 1QNJA 4E05H 1TGBA 2OQUA 3U8OH 1W11U 1GVZA 3MU4A 1TOCB 3QX5H 1BHXF 4K1SA 1L0ZA 1IQMA 2V3HH 2EC9H 4RT0A 5ESTE 1DX5M 1WTGH 3AW0A 1AI8H 3QGJA 1N8OB 3BTQE 4IMZA 4NA8A 4NSYA 3TJOA 3PTBA 4ZH8A 3SU0A 2BVXH 7GCHG 1TRMA 4KELA 1W0ZU 1ZMNA 4YO9A 2AHME 2FTLE 3LC3A 2OC1A 4WVPE 2L6OA 3ATLA 2HGTH 4JYVH 2P3UB 1SQAA 3N99A 1C5VA 1SGRE 1P8VC 3DD2H 1G3EA 2JJ1D 2ZTZA 1NRSH 3ZVGA 4YTAA 3LT3A 3D65E 2PWXA 2XCFA 3BTFE 2O8LA 1YPEH 2V7QD 4B2CA 1TBZH 3RMLH 3SU1A 1NFUA 2Y6TA 1MAXA 4WJG2 3EA7A 1G36A 3DFLA 1XUIA 1ZMLA 1AFEH 1YYY1 3PRDA 1P09A 4FVBA 2XC0A 3OU0A 1O3GA 3MU5A 1G2LA 1UVPA 1PQAA 2FOGA 4I32A 1ZPCA 1GI2A 1UTLM 1S84A 4LOYH 2BLVA 1P2NA 3GCTG 3P8FA 3U98H 4LZ1H 4O03A 1ZSJA 2IPQX 2WUBA 1C5QA 2BXTH 2KFWA 1TNKA 4A7IB 4X0WU 5EU8A 5E2OA 3T62A 4B6EA 4KKDA 3SGBE 1UCYK 3LGYA 5F6MA 2CK3D 2ZI2H 4WMFA 3UTUH 3F6UH 4ZHAA 3RM0H 5JBBS 4AZ2B 1GJ4H 4UFFH 5GWZA 3KQEA 1CT2E 1GBKA 3ENSB 3RXOA 4I8LA 3EQ0H 2HVYB 1KXCA 1ZYOA 1AB9B 1CSOE 1O3NA 3S9AA 2D2DA 1FQ3A 2KCOA 4OS5A 3K9XB 3M61U 2AIPA 2F91A 5C0UA 1LHGH 1PPHE 1HCGA 2A7CA 2ZZUH 2H2ZA 1ZR0A 3O8BA 1O5GH 2XRCA 1FY4A 3ATKA 2STBE 2QF4A 1O5FH 1Y3UA 2GDDA 2GZ7A 5C1YA 3SZEA 4I8GA 3M5OA 1O3IA 3PLPA 1MCTA 1O37A 3SV6A 3UNRA 4F55A 1ZTKA 1E1RD 2BY7X 1Y8TA 1BBRK 2BD4A 1MBMA 3KNXA 3LGIA 4ZHLU 1BTZA 2HOBA 3RXAA 1KDQA 2A45B 2D26C 3VEQB 3MYWA 4AG1A 2WZQA 4E06H 1L1NA 2BD5A 1FIZA 2FP7B 2UUJB 1ARCA 4X1SU 3NZIA 3T5FH 4E7RG 2FOBA 3N7DA 2ZF0H 1EAWA 1BRUP 2Q1JA 5L30H 3UQOA 3QWCH 1KMHB 1KXEA 5GDSH 1SBWA 4IN1A 3URDA 3CS7A 3DSPA 4E7NA 2VWLA 5A09A 1F7ZA 1QTFA 1BBRE 1OP8A 2R3YA 4Q80A 1WOFA 2IOTA 1AWFH 5E8EH 1HJ8A 5C20A 3M36A 3SNDA 3ZZ7A 2P8OC 4NIVA 3BTGE 1O5EH 1GHWH 1SMFE 3BEFB 2ZFSA 5C17A 4ABIA 4AYVB 1TA6A 1KSNA 3SI4H 2CXVA 2HLDD 1GJDB 1HYLA 1ETRH 4B1TA 4D76A 1P05A 1PYTC 1KDQB 5T6GA 4FETA 8ESTE 3VB6A 1UTOA 4JYUH 3GYMA 2ALVA 1O2XA 4BAHB 1OHHD 3SQEE 4ZXYH 1S85A 4MPVA 1NN6A 3A7ZA 1KYNA 3E3TA 1V2VT 3H7TA 4NCYA 3MNBA 1EXFA 4X1PU 1XUGA 4INKA 2F9VA 4K1TA 4BAMB 4ZKNU 3SV2H 1ESBA 1GJ7B 2FDAA 2KCYA 3PTNA 4ACAA 1GWAA 1TABE 4XOJA 5CHAC 2AH4X 1DXPA 1F0SA 1VCWA 5AHGH 1TPSA 9ESTA 2OC7A 1C1MA 1FPHH 2FX6A 3RXTA 1SGYE 3PV5A 3A88A 2VVVA 5F8TA 3OYPA 3RM2H 1JOUB 1G3CA 1LPKB 1RFNA 3OEHD 2W26A 1O2TA 3GISB 8LPRA 1W7XH 4FVDA 1P2JA 1WTHD 4OGXA 4TT3D 4BOHA 4JZEH 3B23B 3QN7A 1A7SA 3MNXA 1UTNA 2AGGX 5T6FA 1AO5A 4TWYA 5C3NA 2R9PA 3A8CA 1H8DH 3ZZCA 2W7SA 2GP9B 1UO6A 5CHBA 1T8LA 1Z71A 3MOCA 1OWEA 2F9OA 2NU2E 1HJ9A 1O3EA 2ZFFH 3O8RA 4B73A 1RIWC 5EQSA 3EAJA 1BHXB 2BY5X 1SGDE 2FTMA 4JZ1A 4Q7ZA 1UW7A 3P70B 2NU0E 1AKSB 4OS1A 2RFKC 4IS5A 2WYJA 1YCPK 1QHRB 3U69H 4JZDH 2H9HA 1XUKA 3MH5A 1JRSA 4ZUHA 1O35A 2W7UA 3NK8A 1GI5A 4J2YB 1CT4E 4MVNA 2P8OB 3GY6A 3RXGA 2SGDE 3GDVA 1Z1IA 1EZXC 3LGTA 1A4WH 1O38A 2BD9A 2ZDMA 3Q3YA 3DCLA 4DOQA 3SQHE 1V2JT 1ZJKA 5JPMH 4FUIA 4AFUA 2XC5A 1NBMD 5EG4A 5EJZA 1NU9A 1YLNA 4BTIB 2AERH 2ZG0H 1FXYA 2VU8E 5C0TA 1ELAA 4NFFA 2A4OA 3LOXA 4Y71A 3F1SB 4NG9H 2GZ9A 3UREA 3RC6A 3UUZA 2QF0A 3LGVA 4MNXA 1W10U 5CHAB 1UTJA 4SGAE 2VIWA 3TH4H 4DT4A 1AMHA 3K6YA 3MNSA 1ELDE 1W3CA 2YMSC 1TPAE 2XC4A 4Q63A 1DY8A 4WY3A 1C1RA 4X2VA 1A2CH 1GMHF 2ZPQA 1S6LA 1C9PA 4Y6DA 1Z8IB 2DUCA 2WPHS 3A8AA 4CH8B 3H5CB 4CRDA 1P04A 3PRBA 3MO9A 2J95A 2BDAA 1H9LB 1O3KA 3QTOH 4K69A 3GOVB 1O2ZA 1O36A 1WYKA 3OFND 1QQUA 4MQAA 2FYQA 2ZGJA 2Z3CA 1ANDA 4WF8A 1VR1H 4X2YA 1UCYH 3LH3A 1NS3A 1KLIH 1C4V2 2ODPA 3KCGH 2K1QA 3P95A 2EI6A 3HGNA 3NRLA 2QF5A 2PSXA 2PLXA 1O2MA 1HDTH 1BT7A 5GIBA 3URCA 2JETC 1GJ9B 3M7UA 3RMOH 2FOAA 2ZCHP 1AD8H 3E8LA 1DDJA 1RIWB 2G00A 3KYFA 3R0FA 5EGMA 1YKTA 1A5HA 9LPRA 2YNAA 2WPIS 3QZRA 2OLGA 4JK6A 1MKWH 1UJ1A 4F4OC 3GY7A 1O2KA 3HK3B 1MTWA 2G5NA 5FHTA 1NRQH 1U6QA 4SGBE 3SHAH 4AN7A 1Y59T 5EXLA 1TIOA 4XBDA 1ARBA 5GNDA 4FU8A 5H4IB 1DSTA 1RXPA 1UVTH 3U28C 5J4QA 4XBCA 4ZKRU 3UOUA 2FXRA 5KGOA 1BOQA 1QJ6B 5JBTA 2SGPE 1SGIB 3BIVH 2NU1E 1ZLRA 2Z6BD 4FUGA 3FKSD 1YC0A 1GI8B 1TGNA 5HKKD 3P92A 2Z3DA 1YLDA 4FXGH 1F92A 5A0BA 1BBRH 2UWPA 2F9BH 2OP9A 3E1XB 3SNAA 1PQ5A 2OBOA 2XWAA 3LJJA 3U9AH 3MO6A 2GDEH
chains in the Genus database with same CATH topology
3M35A 3DA9B 3VB5A 1XVOA 1K1MA 1Z1JA 4I31A 3SU6A 3U8RH 2BY8X 1H9IE 5L2YH 1K22H 2Q6GA 2QGRA 3GDUA 4ISIH 3TK9A 3BG8A 4TPYA 5HYOA 5HM2A 2PSYA 1LHFH 2NWNA 1K1LA 4MNYA 5E2PA 3SV8A 1XUHA 1VITH 1VCPA 1NU7B 3S0NA 1TNJA 1P3CA 2BDBA 4MNWA 2ZIQH 1E36B 2AMQA 1ZMJA 1O2WA 3UPEA 1C1VH 1TB6H 1ESAA 1XXDA 2V35A 3MI4A 4H4FA 5A8YA 1HAYB 1Z6JH 1HIAB 1ORFA 1C1QA 3VXEH 4UEHH 2QN5T 3MH4A 2BM2A 1C4Y2 3RU4T 4CRAA 2OQ5A 3A83A 3SUFA 1E38B 1N8OC 3M3SA 1ZPBA 3RU4E 1RTLA 4ABEA 1G32B 1XKBC 3HATH 1QURH 3PMBB 4CRGA 1MTNC 2BY6X 1P2QA 3NCLA 1PQ7A 3BTKE 2XBVA 1KXDA 1T8MA 2ZC9H 1BRCE 4MDSA 3UNSA 3TU7H 2HRVA 5FX5A 4FUBA 1AFQC 1S0QA 2F83A 5AFZH 1MTUA 4Y8XA 1GI9B 3TPIZ 3GCOA 1DICA 3A7VA 1C2HA 3BV9B 3EA9A 3RLYH 2ZU2A 1HJAC 1TX7A 3TJNA 2VIQA 1UK3A 2GKVE 1BMNH 1ZHPA 2SNWA 2BDYA 4B76A 2ZNKH 2B9LA 2IPHA 1DSUA 1IQKA 1G9IE 1HAHH 3BTEE 3ZV9A 3TITA 1T8OA 2M5TA 1C1SA 1TNIA 1AZ8A 1GJAB 3P17H 2FI5E 5DP5A 1PQ8A 1GPZA 1QR3E 2AGIX 1W7GH 2QXHA 2R2MB 2BB4A 3BTWE 1C2LA 5K7RA 1GDNA 4MLFB 3ZZAA 1HPGA 1RRKA 1DITH 4BAOB 1C5LH 1Y5UT 3A87A 1ZSKA 1DT2A 2Y82A 1UHBA 1B5GH 2QXIA 2R0KA 1KXBA 1BB0B 2FESH 1V2TT 2TRMA 1GL0E 2TGPZ 3PM3A 3TVJB 2BXUH 5A8ZA 1INCA 1F5KU 1YCPH 3PB1E 1J8AA 1QB1A 1GI1A 1ABJH 3JZ2B 1V3XA 4PROA 5SGAE 1HAVB 3G01A 1HAPH 1YM0A 2VNTA 1IQGA 5C5OA 2BDIA 1UVUH 1O34A 4J1YA 3F9HA 4BAQB 3UQVA 2GCHF 3AVZA 1S6FA 1AE5A 1C2FA 2ZGHA 1K21H 2ZP0H 3RLWH 1D4PB 3RC4A 3PYHA 1AUTC 5L6NH 2ALPA 1NRPH 3ATIA 1MTNB 4Q2KA 1O2SA 2FEQH 1FZZA 2BVSH 4K8YA 1RTFB 5G4BA 1TGSZ 1FN8A 2ZPSA 3F9GA 1ZJDA 4GCHF 2BX3A 1O2IA 4RKJB 2FLBH 1Q3XA 1V2ST 1AFQB 3GY2A 5EQQA 2ZGBH 1YPGH 1OYQA 2QCYA 4YT7H 3MH7A 1GBIA 5F8ZA 2A32A 1C1TA 2FPZA 1GHAG 1QQ4A 1A5IA 4LXBH 1L4DA 1SGFA 1HJAB 3ELAH 1FV9A 4U01A 1K28D 2ZDLA 4X1QU 4WH6A 3SGQE 1TE0A 5EW1H 1MH0A 3PMHB 2ZECA 4RN6A 1Z8JB 1Y3XA 1O0DH 3Q76A 4AFZA 2A7JA 1QA0A 1C5UA 1OP0A 2IJOB 3T29A 1GBAA 1AVWA 4ABJA 1H9HE 2BD2A 1C5YB 2OD3B 2EI8A 2VH0A 4YT6H 1BTXA 1Y3VA 3GICB 2QIQA 3FFGA 3HK6B 2ZFRH 4NIWA 3ZZBA 1LMWB 3ZV8A 3ZVDA 1O2YA 2BOKA 3SJ9A 1IQIA 3PV4A 4ISHH 3PLKA 3NUMA 4HTCH 3OTJE 5A0AE 1D3DB 3GCNA 3SOSA 3SHCH 3SU2A 4GVUA 1ANCA 1OP2A 5DGJA 1GMDG 1MQ6A 2C8WB 2PUXB 3T26A 2XXLA 1FN6A 1EB2A 3A8BA 2CJIA 5E0GA 2AEIH 1MKWK 3SNEA 1GI3A 2FYRA 1A0LA 7LPRA 1GCDA 3RXIA 1UCYE 1UTMA 3M37A 2G8TA 2XWBI 1MZAA 1T7CA 2ASUB 2A31A 1XUFA 1UMAH 3KF2A 5EPNA 5LH8A 1NC6A 1VJ9U 2VJ1A 2ZO3H 2XYAA 1MAYA 4KTSA 1IHTH 1UTKA 2O8TA 3ZVBA 1YPMH 5FX6A 4IBLH 4X1RU 2TBSA 4X6OA 1EUFA 2Y5FA 1THPB 2Z9GA 1TFXA 2XBXA 1C5TA 3RMNH 3BEUA 2C8XB 1EOJA 1JBUH 3BIUH 1DS2E 1HNEE 1WCZA 5LPFA 1P9SA 2RG3A 4AB8A 4R0IA 2O8WA 1GHXH 2ZFPH 1TGTA 1O2HA 2XBWA 1QIXB 4OGYA 4K5ZA 5DP9A 4BANB 1HV7A 7GCHF 1JIMA 5TCAA 4YZUA 1E35B 1IQNA 2ZDVH 1CU1A 4AGKA 1W2KH 4BAKB 1O3JA 1QB9A 4AG2A 3ATWA 1KXFA 1V2NT 4CBNA 1XVMA 1O2RA 2BQ6B 3I77A 1QL9A 3F9FA 4IC5A 1O2NA 3AAUA 4K3JA 2J92A 4YLQH 3NPSA 1WU1A 1OWHA 1LHDH 1MCVA 3BN9A 2FWWA 2FI4E 1O2VA 1LHEH 5HM9A 3RC5A 4I8KA 1P02A 1ACBE 3A89A 1C5OH 1ELVA 1A46H 1EQ9A 1KXAA 2ODYB 4X2XA 3UR6A 3IWMA 3O8CA 4AX9H 1AWHB 4X6PA 3GCTF 3I78A 1EJAA 1T32A 1WV7H 3BEIB 1C5PA 2PW8H 3RXPA 2OXSA 3SJIA 2Z9IA 3RXMA 1MBQA 4YOIA 2Z3EA 4FUJA 3RXEA 2SNVA 3S7KB 2ZGCA 3A80A 2LNCA 4HFPB 3SUDA 3VB7A 1EKBB 4FU9A 5AF9H 2Z9KA 1O2OA 4ZKSU 1OPHB 1GDQA 4MG3A 1FY1A 3SBKA 2CMYA 1J14A 3RXRA 4FUHA 1DWEH 1ANBA 4KTUA 2ZDNA 1ZOMA 5F8XA 1MD7A 1E0FD 3ODFA 1MTSA 2CHAC 3UNQA 4AOQA 1Y5AT 1MUEB 2A5AA 3ZZ5A 1YF4A 3STIA 2HALA 1BRAA 3S9BA 2VGCC 1DUEA 1FY8E 5HMAA 4BXSA 1ABIH 3E0NB 4X6NA 2CGAA 2Y81A 4UFGH 2EA3A 1ZRKA 3ZZ9A 2G4UA 3GDSA 4OS4A 1FY5A 1NFXA 4UFEH 5TJXA 3UOPA 1GBHA 2W3IA 1HAZB 3HKJB 3BTDE 1QJ1B 4Y0YE 1TA2A 4TY6A 8GCHG 1H8IH 2ESTE 1CGIE 1BUIA 1LHCH 4NIYA 1C2MA 4NWLA 5C5NA 3SW2B 5GCHF 3Q00A 5A0CA 3TGIE 4DJZB 2A5KA 2XCNA 1SI5H 3UR9A 3MWIU 4DVAU 1ZGVA 5ETXA 2BD3A 2TGTA 2BX4A 2THFB 3MTYA 5DK1A 1EPTA 4NWKA 1TMBH 1BA8B 2BDGA 1K2I1 4Y0ZE 1ELEE 2VVCA 4ABHA 2FS9A 1OOKB 1QCPA 1C2EA 1THSH 1C1NA 1L1GA 2BMGB 3D49H 3QDZB 4DG4A 2P16A 2ZEBA 2TGAA 1Z8GA 2ZWLH 1PPBH 1IQFA 1RS0A 5B6OA 3TGJE 3D23A 3ZZ3A 3FZDA 1LVYA 1JMOH 2OINA 4LK4A 5FBEA 3V13A 1C1UH 1OKXA 2HNTF 3K2UA 3ZVFA 1FAKH 2YOLA 2ZPRA 3KHVA 1P2KA 4Q7XA 1V2KT 1BMLA 4K1EA 1EPTB 2D1JA 1OSSA 3VPKA 1SPJA 1A3EH 5DP6A 1TLDA 4XE4A 1UTPA 3MNCA 3SUEA 1HRTH 1EP6A 1H4WA 3SJKA 3ZVAA 1WQVH 1MU8B 1UVOA 5AVDA 3ZVEA 1K1NA 4OS2A 1B0EA 5LGOA 2FZZA 4ISNA 1VITG 2C4FH 4X6MA 1NRRH 2VWOA 2CHAB 2Y7XA 3EDXB 2VIDA 5FBIA 3GY5A 3TNSA 1SSXA 1GBTA 1Y3YA 2VGCB 1V2RT 2Q6FA 2H5DA 3FZZA 2B0FA 1H1BA 3BTHE 4TWWA 1WQSA 2CF9H 5TCCA 4DT7B 4K8BA 2PUQH 2UUYA 2QY0B 3KEEA 6GCHF 2FOMB 3EE0B 2GMTC 5EW2H 2C93B 4ISOA 2STAE 1CHGA 1O3HA 3TH2H 5FCRA 2GGVB 1HAIH 2FODA 4TPIZ 2VIPA 1EJMA 1OX1A 1HAOH 4AYYB 5EXNA 2A4RA 1ESTA 2BZ6H 4I8HA 3VB3A 1NZQH 2DE8A 2OC8A 2ZCLP 2FO9A 5C2ZA 3PO1C 2RDLA 2QF3A 1WAYB 2GCTC 1UK4A 1EP5A 1K1IA 5A2MH 3ODDA 1GMCG 3S69A 4AFQA 2NU3E 3IG6B 1EX3A 4Q7YA 3Q3KA 1D3PB 2PTCE 1LKAA 1V2UT 1RJXB 4ASHA 1XXFA 4GSOA 2EI7A 1BMMH 1LTOA 3UWIA 3S7HB 1OS8A 1EASA 3TIUA 1EZUC 2EEKA 4IC6A 1SGCA 1VJAU 5CE1A 1O32A 1DXWA 1FNIA 4NA9H 4GLYA 3AASA 3SV7A 1BCUH 1TOMH 3RXSA 4KGAA 1A61H 1NO9H 1D6RA 4Y79A 2HLCA 2TIOA 2VH6A 4ZMAH 2AFQB 1O30A 1O5BB 2BHGA 1QA7A 1G37A 1DWCH 2ZHEH 3KQBA 4AGJA 4JMYA 1AHTH 3SU5A 2C90B 3V12A 1DWDH 1LO6A 5FCKA 1PJPA 1MQ5A 1GHBG 2P95A 3MO3A 2A1DB 1CQQA 1LVMA 1JIRA 4X1NU 4BNRA 2G55A 2VVUA 1S83A 3SJOA 1DLKB 3FAOA 2PKAA 2P3TB 1A1RA 3B8JA 4GHTA 1O39A 3C1KA 3AAVA 2FOCA 3A7YA 1C1WH 3SN8A 1DLEA 3HGPA 2XW9A 4FUDA 4MTBA 2HNTC 1NROH 1GL1A 3M3VA 3MFJA 3NXPA 1ELBA 5EXMA 2GVFA 3DUXH 1O2GH 4XSKU 3TLOA 4AFSA 1O5AB 1P2MA 2R3UA 3LH1A 1SB1H 4UE7H 4IN2A 2GMTB 2DE9A 4RSPA 1T31A 2ZU3A 1NM6A 1CGJE 1AQ7A 1QGFA 1QFKH 4WWYA 2SGEE 1PPFE 1GI6A 1CA0C 3M3TA 1BTYA 1C1OA 6CHAC 3KIDU 3K6ZA 2W3KA 2BQWB 2ILNA 1LQDB 1GDUA 3P6ZB 2ZHDA 3A8DA 3RXUA 1N6XA 1VGCC 1MD8A 1IOEA 2WPJS 3BTME 1X7AC 1GI7B 2SGAA 1N1LA 2PKAB 3PO1B 3RU4D 3E91A 4XDEA 5F03A 5HGGA 2YNBA 2AIQA 2GCTB 3ZYDA 2A4GA 2FI3E 2ZU1A 3DT0H 2ZDAH 2WYGA 2ZHFH 2RCEA 5EOKA 3K65B 3JZ1B 3VFEA 1O5DH 2ZFQH 1UK2A 5C1UA 2JH0D 3ESTA 1G3DA 1CHOF 4NGAH 4O3TA 2OC0A 5DP4A 1SOTA 1N6YA 3VB4A 2F3CE 3BG4C 5C67A 1SGTA 2QXGA 1GHVH 1HXEH 4VGCC 1ETTH 4I33A 3UWJH 1T8NA 4UFDH 5FPTA 2PGQB 4NZQA 2AMDA 3KN2A 2UUFB 1YGCH 1C2KA 4NFEA 2OBQA 5DP8A 1O2PA 4YLUA 4CRCA 4WH8A 4JYTA 1GBJA 1BIOA 1M9UA 1GCTC 1SLWB 1LCYA 3RXLA 1IQHA 3FANA 2WINI 4FUCA 5DJ7A 2BD7A 3TGKE 2PR3A 3GCHC 2ZKSA 2WV5A 4K2YA 1P3EA 3M5LA 1P03A 1V2MT 2TGDA 1LPZB 1L4ZA 2H1UA 3SJ8A 2JH5D 1EAUA 5AFYH 2WUCA 3FP7E 3S9CA 1THRH 2WPMS 1W8BH 3ZZ8A 1GBEA 2LPRA 1BMAA 1GBBA 3BSQA 1GHYH 2B5TB 2PFEA 1G30B 2H6MA 3SGAE 4ESTE 2KAIA 3RXFA 3SUGA 2BOHB 1TMUH 4JZIA 3PMAB 1C1PA 3RXQA 1HFDA 2HPQH 1MMJN 1P2OA 2R0LA 3PWCA 3STJA 1C5MD 1O31A 3E90B 2BQ7B 1IQJA 1UHBB 3UY9A 5A8XA 5FPSA 1CA0B 1P01A 1BTWA 1C9TA 1O2JA 6CHAB 4YESB 1ELGA 4D9RA 1MZDA 1YPLH 1PFXC 2BZAA 1DUAA 1VGCB 1DPOA 1O3PB 5DPAA 5E0JA 1NT1A 4YM9A 1GJCB 4HZHA 4ABGA 1MKXK 3T27A 4CR9A 5FXLA 1CBWC 1GG6C 1ZZZA 1QJ7B 2HVXA 4DW2U 4X8SH 4D7FA 2A2QH 1NFWA 3M5MA 1QL8A 4JZFH 4ZXXH 2KAIB 2Z7FE 4THNH 3SU3A 1ID5H 3T2NA 1GBLA 2FM2A 1CVWH 3LKWA 3SORA 2ZQ1A 3BF6H 1TGCA 3BG4B 2V6NA 2WPKS 4O97A 5DG6A 1YPJH 2ZFTA 1WBGB 2UWOA 3QO6A 4VGCB 2GV7A 1B7XB 1W14U 4MPXA 1BTPA 1K1PA 1BITA 4B71A 4X8VH 2W5EA 2HNTE 1Q2WA 1HXFH 1ZPZA 1YBWA 1LDTT 2G51A 2QXJA 4UONA 1DWBH 1O3FA 3ATMA 1B0FA 5I46H 3RXVA 2OTVA 1SLUB 1GCTB 1GBDA 1F0UA 2C8ZB 2J34A 1Z8RA 1OWKA 1JRTA 3GCHB 5IDKA 1EAIA 4D9QA 4AORA 4ZROA 2V0BA 2FLRH 3GY3A 1TONA 2RA3A 2BY9X 2G5VA 3ZVCA 1SOZA 3SI3H 5JBAS 1O3CA 4XBBA 4GPGA 1Q31A 1IQLA 4OS7A 4O3UA 1AUJA 2D8WA 3WY8A 5GXPA 3H7OA 4Y7BA 3QTVH 1PPZA 1O2UA 3PROA 3RXCA 1GVKB 2C8YB 4IGDA 3RXJA 1PPCE 5J4SA 4RKOB 5JB8S 4Y7AA 1D6WA 1WSSH 2BDHA 2ZTYA 5ESBA 1QRWA 2CN0H 2B8OH 1FDPA 2J38A 1FAXA 1QL7A 4YOGA 5PTPA 1BTUA 1ZSLA 4NA7A 3ITIA 2QAAA 1OWJA 1YPHC 2VINA 1EZQA 1P2IA 1A3BH 1LPGB 1QRXA 1V2QT 5EODA 1ELFA 2V3OH 1CT0E 2ODQA 3MU1A 1LKBA 5FAHA 2OCVB 6ESTA