1OWJA

Substituted 2-naphthamidine inhibitors of urokinase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
publication title Identification of Novel Binding Interactions in the Development of Potent, Selective 2-Naphthamidine Inhibitors of Urokinase. Synthesis, Structural Analysis, and SAR of N-Phenyl Amide 6-Substitution.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1owjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1owjA01
1ELVA 3PO1B 2Z3DA 1EB2A 3OYPA 1P03A 4INLA 2QF3A 3A8CA 3LJOA 5E2PA 4X1RU 2ZQ1A 4CBOA 3MO9A 5EXLA 1YPHE 3MU0A 4XE4A 2GCTB 2Z9GA 3QN7A 1RJXB 2FP7B 4NGAH 4J1YA 3QZRA 1A3EH 3BSQA 1FIWA 1EPTA 3TH3H 2P3UB 1A0LA 1Y5AT 2HVXA 1ZJKA 3P8GA 1UJ1A 1RGQA 4CRAA 1Z8RA 3ZVGA 1C5YB 1FUJA 3LC5A 1O2OA 1O3HA 2G55A 1BTWA 1OYQA 2BDCA 2BTCE 4CRFA 1BZXE 3SBKA 4FUDA 3F9GA 1YKTA 3RUOA 1QY6A 1SFQB 1XUGA 3M3VA 1PPHE 3A82A 2SGQE 3QZQA 1V2ST 3HK6B 1YYY1 3LH3A 1HIAB 4UEHH 3A87A 2PSYA 2VVCA 1V2UT 1AFEH 5JBAS 1UHBB 4JYUH 2ZU1A 1BCUH 1C5TA 2EEKA 3MU4A 4Y8ZA 2ZFTA 2ZTYA 1UK3A 1ZHMA 3M35A 1AVWA 1GMCF 2F83A 1AI8H 3K2UA 1K1PA 4ABGA 1XKBC 3M7QA 1K2I1 2VB0A 1JIRA 4ZAEA 3SW2B 4HTCH 1ETSH 3U8OH 2W3IA 1UVUH 3ZZBA 2XC4A 2JETC 4A1VA 2ZF0H 1WSSH 4XSKU 5F6MA 1GHYH 4GCHF 1XUFA 4O3TA 1NFYA 1O5DH 4AFQA 3G01A 1OP8A 1CHOF 4B76A 8GCHF 3TK9A 1K1JA 3M36A 1F5KU 3Q77A 1GDQA 4HZHA 5DGJA 5ETXA 1V3XA 1F0RA 2ZHQH 2UWLA 3RM2H 1THSH 2FOAA 2V6NA 1DWDH 5DG6A 1L4DA 2R0KA 4ZMAH 1Y5UT 1F5RA 1Y3XA 4FUGA 3E1XB 1T4VH 1P12E 1YCPK 4LK4A 3M7TA 2F9PA 3NK8A 3W95A 1GGDB 1OWJA 3AW0A 1VITF 4KELA 1JWTA 3MFJA 1UCYK 1GL1A 2A5KA 3BTDE 1OWKA 4AG1A 2UWPA 4LZ4B 1TQ0B 1HAVB 1GI6A 3BIUH 4OGXA 4I8HA 4U32A 2XW9A 2A32A 2GV6A 3A8DA 2A31A 3QTVH 5C5NA 2FS8A 2XCNA 2ZDNA 1BMNH 5A09A 1SOTA 2O8LA 1CGJE 1PPEE 1EZSC 2QA9E 3RXRA 1C5SA 1DT2A 2XNIA 1MTSA 1GCDA 1GMHF 4BTUB 1MKWK 1XXFA 1O36A 4CR5A 3TGKE 1AB9C 1Z7KA 4Y0YE 1IQGA 1BBRE 1YGCH 2F91A 1J14A 1E37B 2ANWA 4E06H 1AKSB 2B5TB 3M3SA 1GHBF 3SU2A 2FS9A 5JPMH 1V2WT 2C8WB 4GUXA 3A80A 1O2XA 2CF9H 3ZVBA 1GJAB 4DCDA 1O3OA 3DT0H 2YOLA 2PFEA 2HRVA 1CT2E 5A8XA 1ELGA 4I8GA 5TCAA 1CO7E 2FO9A 1IQKA 1SLVB 1P2MA 3H5CB 2Z9IA 8LPRA 1K1MA 1TA2A 4DW2U 1O3KA 1ZMLA 4DJZB 1NT1A 1SLUB 2DUCA 3GY8A 5HM9A 2VH0A 3HPTB 4MVNA 1V2QT 1TA6A 3SU6A 1ORFA 3UNRA 1P8VC 2FPZA 2A0QB 3E0PB 3MNXA 3MU8A 5DPAA 4GHQA 1C5XB 3UPEA 4B2BA 4RKOB 5C67A 1ANBA 1O5GH 3A7XA 2NU0E 4SGBE 1AUTC 1P2JA 1P2NA 3PMJA 2ZCKP 1IHSH 1XUIA 5EXMA 3RLYH 1TOMH 1OPHB 1EJNA 2R3UA 1V2NT 2ZFQH 2BHGA 5BRRE 3RC6A 1SGRE 3TITA 1UTQA 2WPMS 2ZZUH 1SFIA 2PSXA 5SGAE 1A3BH 1UMAH 4B71A 1F7ZA 2FM2A 1CHGA 1YPHC 3ZZ7A 5FPYA 2OTVA 2P3FH 5FCKA 5FAHA 3SU0A 2WPIS 1NFXA 2FOMB 2XBWA 3C27B 1OOKB 2FOGA 4BAOB 1QQ4A 2XC0A 3PO1C 1THPB 4M7GA 1C2KA 2B0FA 7GCHG 1KXCA 2BM2A 5L2ZH 1XVOA 1HIAA 1CA8B 1UTMA 1UHBA 1ZMNA 5TCCA 1FXYA 2GCTC 3RC5A 1O3CA 3B23B 1CGIE 1YC0A 5T6GA 2FODA 1NM6A 1B0EA 1FN8A 1LHEH 1SQOA 1SC8U 2BD8A 1C5LH 2ZC9H 1LHDH 5EW2H 3EGKH 3ZVCA 1C2IA 2FOFA 2H5DA 3VGCB 3ZZ9A 2SGFE 1HPGA 3O8CA 3ZZAA 1NS3A 2W26A 1PPZA 2VWLA 2OXSA 3LDXH 4Y8XA 3BEFB 5EODA 4ZKOU 3VB7A 1SGYE 3ATLA 1C9TA 1P05A 3I78A 4NFEA 1O38A 3A8BA 3L33A 5ABWA 3RXAA 4I8JA 3GY4A 1FY8E 2IPHA 2VVVA 3AW1A 3BF6H 2TRMA 1HAPH 3B9FH 1VCPA 3NZIA 3RXSA 3WY8A 2OC1A 3VXEH 3E3TA 3OY5U 1IQMA 1ZRKA 3UOPA 1MD7A 1P3CA 4FUJA 4NSVA 1CQQA 2PTCE 4K8YA 2ZFPH 4Y8YA 4BTIB 1MD8A 4UD9H 1C1TA 1L0ZA 1O3MA 1QL7A 4JCNA 1EQ9A 2HNTF 2BLVA 1O35A 3S0NA 2F9VA 2GV7A 2WPHS 1D9IA 1GBMA 2IN2A 2CN0H 1KXBA 2J92A 1NFWA 2BXUH 4JK6A 4B2CA 1WAYB 4AB9A 4Q7YA 1CGHA 1AIXH 4KKDA 3UUZA 2VU8E 4D8NA 3RMMH 1MAXA 4ZUHA 2BOKA 2FDAA 3B8JA 3TLOA 1BTYA 1ID5H 1C1MA 2UUKB 5I25A 3BTQE 1AKSA 1C5VA 2B7DH 4IMQA 1K1NA 4JYTA 1C5WB 3RU4D 1ELDE 2ZTZA 5C5OA 2VIVA 2P16A 1DFPA 1GGDC 1TGBA 1O34A 5JBBS 2HPPH 2ZI2H 2OC0A 1OWEA 3RXVA 3VB4A 3O8RA 2EC9H 2Y6TA 4YT6H 5ESBA 3KQBA 1L2EA 1J9CH 1IQJA 2HALA 3STJA 4GLYA 2BDAA 3LKWA 1XUHA 4MPVA 3GY6A 4IC5A 4WY3A 3MI4A 1GI4A 1W3CA 2VJ1A 1W8BH 1TNJA 2Q6GA 4DOQA 1ELBA 3VEQB 5AVDA 3S7KB 3DUXH 4AGJA 2FXRA 1HAZB 1W0YH 2LNCA 2PR3A 4AYYB 5F8ZA 1VGCB 2GCHG 2SGEE 1GBAA 1P57B 2AGGX 1NZQH 4TYDA 1MTUA 1NRNH 3S69A 3P6ZB 4E7NA 4TPIZ 2GZ7A 1O31A 4NG9H 1EOLA 5GXPA 3H7OA 1BRBE 2ZU5A 1FV9A 2AMPA 1S5SA 3NPSA 3TJNA 1VCQA 1H1BA 1GPZA 1E34B 1WCZA 1TPSA 4GSOA 3L6PA 1G9IE 1ZPCA 1XX9A 5DP4A 3CP7A 1JRTA 1LCYA 4XFQA 4FUFA 4UFDH 3PMBB 3HKIB 4J2YB 1YPGH 2R3YA 2VIQA 1TALA 5IDKA 1TQ7B 4FUHA 1K9OE 4ABEA 1AFQC 4X6PA 1TPOA 2G52A 2VWOA 4NZQA 1TX7A 1V2RT 4ABFA 2GTBA 1TRMA 1AHTH 2JH6D 3O8DA 4CREA 1TOCB 3PTNA 3IG6B 1RS0A 2BVSH 2GMTC 2C8XB 4A92A 1MCTA 2HNTC 1ZSJA 1MKWH 3M37A 1O2JA 1LPKB 3RMOH 5T3HA 2ZGBH 1HJAC 3RXDA 4AOQA 2SGDE 3UQOA 4X8TH 1LVYA 2BOHB 2ZKSA 5H4IB 3P8OA 1PPGE 3MYWA 1BQYA 4DURA 3SNEA 1BBRH 1AB9B 1EAUA 3ZV9A 2ZDLA 3TJVA 1QURH 3LGWA 2GKVE 3M3TA 4I31A 2PKAB 2Y80A 4R0IA 1CE5A 1TGCA 2QXHA 4WF8A 4Y6DA 1AY6H 7GCHF 3FFGA 1GJDB 1O2GH 1P2IA 1ESTA 3U8TH 1QRWA 2F9NA 1BHXF 1Z71A 4H6SB 1ZPBA 1EZQA 2QC2A 4XDEA 5EG4A 1NROH 3D49H 2AS9A 4WMDA 1W7XH 1WTHD 3VB6A 4NCYA 5GPIB 2PGBB 1O3NA 3MMGA 3ZV8A 3ELAH 1JIMA 2SGAA 2R0LA 3ZVEA 3F1SB 1N1LA 1YPLH 3VGCC 2BLOA 1B5GH 1ZOMA 1DSUA 1WTGH 3RU4E 1O5CB 3S7HB 3LT3A 3UREA 2BY6X 1TNLA 1A0HB 2C4FH 3FVFB 1GBJA 4I8LA 1JBUH 3SOSA 1Y8TA 2ZHEH 1LHGH 1OWDA 2GX4A 1HFDA 4B74A 1GI7B 5F8TA 3AAVA 1DOJA 2WYGA 5EOKA 1KYNA 4CRCA 4A5TS 2NU3E 2TGAA 1GBKA 1BMLA 1SGQE 1QA0A 3ATIA 2Q6DA 3HK3B 3ZZ5A 2BQ6B 3U1IB 3DA9B 2TBSA 4WXVA 1SB1H 4LOYH 5HGGA 3RXEA 2TGDA 5EQSA 1PFXC 4DGJA 1EP6A 2ASUB 3HGPA 2OC8A 1IQNA 1QBNA 3DHKH 3UNQA 2VVUA 4B1TA 1C5OH 1GBDA 3PV4A 2P93A 5PTPA 1BTZA 2ZDMA 2ANKH 2BB4A 1P10A 5E0GA 2OQ5A 1YM0A 5EW1H 1NRQH 1QTFA 1C2GA 2D1JA 3QK1A 1GJCB 2O8MA 1BIOA 1FAKH 2Z9LA 1S83A 4K69A 1AZ8A 1ZLRA 2G4TA 4OS4A 4ZKNU 3BTME 4E05H 1HXFH 2PW8H 3KEEA 4PROA 1XM1A 1QBVH 1PPBH 3A86A 2BZAA 3KGPA 3LGIA 1GJ6A 3GOVB 1O2WA 3RXIA 1SMFE 1O2SA 2A2QH 1Q3XA 2ZTXA 1H9IE 1V2OT 4BNRA 1BRUP 1J16A 1KSNA 1OYTH 1GHZA 2J94A 1DS2E 1O5FH 1G3CA 3UWIA 4GHTA 5DK1A 1KY9A 1ETRH 1A5IA 2B9LA 3PM3A 1NY22 1C1PA 3PB1E 4D76A 4Y7AA 1ELAA 2J2UA 3NXPA 1MZDA 3ESTA 1O2RA 1BOQA 1KIGH 4K1EA 1C1RA 1DY9A 4DG4A 1C5UA 1VGCC 5C1XA 4SGAE 3Q76A 4AFSA 2RA0A 3BIVH 4YM9A 2VWNA 3TJUA 1H8IH 4IW4E 4R8TB 1LHFH 3ATWA 4AFUA 5FXLA 3UNSA 1G2MA 3RXJA 2VIPA 1KDQB 3S9BA 1W14U 4NIXA 3TNSA 4Y7BA 4X2XA 1P04A 2IOTA 1LQDB 2ALVA 1MKXH 3RDZA 1FQ3A 3PLPA 2VIDA 3LPRA 2CXVA 3BTTE 1S6FA 2FI4E 1C1SA 1P9UA 3TVJB 1SHHB 1S0QA 1TONA 1FI8A 3RXUA 1C5MD 2PKAA 4AN7A 4Z0KA 1GI3A 1ZZZA 3D62A 1UO6A 2BDBA 5JYIA 2AFQB 3SU1A 1LQEA 1C5PA 1O3EA 2KAIB 1C4Y2 2G51A 5DP6A 1KLIH 1C2MA 2FI3E 3VB5A 4OS7A 1EKBB 3EA7A 3RXKA 4HI3A 4X2WA 3SO3A 1NN6A 4CH8B 3V0XA 1AVGH 2OLGA 1PPCE 2J34A 4YT7H 1GHXH 4AYVB 1MUEB 3DFLA 2A2XH 2D2DA 4AORA 1C4V2 2BDGA 1O2IA 2ZCLP 3SNCA 1O2KA 1DM4B 1O3AA 1P01A 1KXEA 2XC5A 3HKJB 1O2YA 1SGEE 2O8TA 1HRTH 4UONA 1HNEE 5LH8A 1O3BA 3ENSB 4XBCA 1ELTA 2VIOA 1M9UA 1PQ8A 1DWEH 1SHYA 6ESTA 2YNAA 3UQVA 2Z7FE 2J38A 1O3FA 2ZECA 1LKAA 4K3JA 3N7OA 4UE7H 3F6UH 1BBRK 3Q3YA 2AEIH 1O2VA 4BAMB 1O2TA 3CENA 2FOCA 3GDVA 4WH6A 1A0JA 5GIBA 2Z6BD 4YLUA 2OQUA 5C2ZA 1MMJN 2BY9X 3R3GB 1EATA 3TIUA 2XWAA 1Z8GA 4THNH 3TGJE 1C5QA 8ESTE 3MOCA 1T7CA 3TNTA 1QJ6B 4Y11E 4BAQB 1CSOE 1ZTKA 3M5OA 3LGTA 5AFZH 2ZPSA 2A4RA 1EUFA 1AFQB 1O37A 2BVXH 3M7UA 2G4UA 1DANH 4X1NU 2BDHA 3BTHE 1ESBA 2ZGJA 1KLJH 4MPUA 2FOHA 4IC6A 1C1OA 4X1SU 2ZEBA 1GHAG 1T31A 1FAXA 5BPEA 1QFKH 5EXNA 2GMTB 4OGYA 4XBBA 1YPJH 1RFNA 2CV3A 9ESTA 2W5EA 1SLXB 2P95A 3SQEE 1HJAB 1MH0A 4F4OC 3A7ZA 3LGYA 1HCGA 2BVRH 1HAYB 2BXTH 1RTLA 5I46H 5FPSA 1ACBE 5F03A 2ZU3A 4OS6A 2XRCA 4TY7A 4X8VH 1TNIA 1P06A 5LPFA 1GI1A 2W7SA 1ZSKA 3ZYDA 3O8BA 3T5FH 1YF4A 1DLEA 1KLTA 1NC6A 3TK6A 1IAUA 2HNTE 1BTHH 1OWHA 4ABAA 5K7RA 2ZDVH 1BTUA 1NRSH 1SGTA 2NU4E 3RXOA 1DWBH 2Y7ZA 2RCEA 4GVUA 3OY6U 1T8OA 1PJPA 2A4OA 1TX8A 3TJOA 1AE8H 1GBHA 4WWYA 1G32B 1TNHA 1Q31A 2PV9B 4Q2KA 4D7FA 1V2VT 4NWKA 2A7HA 1T4UH 2AERH 1TX6A 1KDQA 3ZYEA 5J4SA 3A84A 4JZIA 5FBEA 1UTKA 1BJVA 4U01A 2J9NA 1HAOH 2BDYA 1GBLA 5TJXA 4ISHH 1TNGA 3U1JB 4IN1A 4WVPE 4DVAU 1Z1JA 3SV7A 3D65E 5B6OA 2BD7A 1G3EA 1AE5A 2AH4X 1AZZA 2TIOA 3QGNB 3ODDA 2BLWA 3PTBA 2KAIA 3MWIU 4OS5A 1XVMA 4CH2B 2WPJS 1HJ9A 1P09A 3BV9B 5DKMA 3KQDA 4F49A 3SV6A 1B7XB 3GY3A 3C1KA 3LC3A 2FZZA 4ABDA 1HAVA 3MH4A 2BMGB 5JDUB 4CHAC 1AGJA 3VPKA 1C1VH 3E90B 1MTWA 5T6FA 1SGFA 1GBEA 1UVSH 3SU5A 1C1QA 4UFGH 3V12A 4NFFA 2Z9KA 4ABJA 3E91A 1MU8B 1Y3YA 2ZDKA 2I6QA 1EAXA 1FY1A 2ZU4A 4FUIA 5G4BA 4YOGA 2FLBH 1NFUA 1FLEE 3EDXB 2UWOA 4XBDA 4X6OA 3LU9B 3A7YA 1Y3UA 2BY7X 1MKXK 2AYWA 4MQAA 3SUDA 1YPKH 2GVFA 1WQSA 4KTCA 1Y3WA 2UUYA 3EA8A 3QWCH 2EI6A 1S81A 5EQRA 1SR5C 4WJG2 1D3PB 1C2DA 1MU6B 3T25A 1V6DA 1VITH 1MBMA 4K1TA 2ESTE 7KMEH 1BMMH 2FOBA 4CRBA 3FP8E 4MNYA 4ZXYH 1AWFH 3EQ0H 1FIZA 3F9FA 3SJ9A 1YP9A 5CMXH 1TWXB 5DJ7A 1O2PA 1P0SH 4X2VA 1GI5A 1FY3A 1HGTH 1L1GA 2HOBA 1ZRBA 1FZZA 1O3JA 3GCHC 3RMLH 2RDLA 3FP7E 1SSXA 4MDSA 5FX6A 3M5NA 3RXGA 4MNWA 2BQWB 2F9UA 1TMBH 1K22H 2BQ7B 2GT8A 5AFYH 5E8EH 1BHXB 1FJSA 2O8WA 2WUBA 2R2MB 3P92A 3PMHB 1O5EH 2V3HH 1EZUC 1BITA 3GYLB 2YNBA 1YLCA 4FU9A 3SU4A 4X1PU 1C9PA 1A61H 1LVOA 2WV4A 2V3OH 8KME2 2THFB 1JMOH 5EPNA 2SFAA 4Y76A 5CE1A 4A1TA 2OBOA 2Y81A 1PYTD 4INHA 1EOJA 1TRNA 2A4GA 3Q3KA 1E35B 3AASA 2ULLA 4UDWH 3V3MA 5GJ4B 1NRRH 4QT8C 4IBLH 4UFFH 3A81A 5E0HA 2ZNKH 4GCHG 1C5ZB 2BX3A 1EXFA 1K21H 1CHOG 3SV9A 1QB9A 1RRKA 4NZLA 4X8SH 4RKJB 1TMUH 1UK4A 1D3QB 1NU7B 3IITA 1VR1H 3A7WA 1QBOA 1HAIH 1P02A 2BD2A 2FMJA 1P11E 1Z8IB 1O2NA 1MTVA 4ZHLU 6CHAB 2QYIA 3FZDA 1BMAA 1GBCA 1P2QA 1RXPA 1BDAA 1SL3A 1TIOA 4X0WU 1S0RA 1HDTH 3BEUA 2JKHA 6LPRA 3P8FA 3E0NB 1ARBA 3K6ZA 1VJAU 2HLCA 2PTNA 1O33A 3PMAB 4IGDA 1BRAA 3SJIA 1YPEH 1O0DH 2HWLB 3PLBA 1GHVH 3NCLA 1OS8A 1T32A 3RLWH 2P94A 3QDZB 1QNJA 4HFPB 2ZU2A 1CU1A 1NPMA 3OTJE 3UR9A 2ZGHA 3SJOA 1QL8A 3AVZA 2HPQH 4NA7A 3S9AA 1N6YA 2XXLA 3UY9A 1EAWA 3A83A 1GMHG 2WV5A 2H9EH 1P9SA 1XUKA 1TGSZ 3RXPA 3MNSA 4O03A 2ODPA 2ANMH 1UTLM 2QV1A 5FBIA 1D6RA 2PHBA 3F9HA 5EQQA 4ABBA 2PKSC 1Y59T 1V2PT 5LPEA 3GCOA 4ZH8A 3UR6A 2AIQA 2BY5X 1ZPZA 2UUJB 4MPWA 1ARCA 1YLDA 1SBWA 2WINI 1GJ8B 2XBXA 4MTBA 1AN1E 3ATKA 1ZJDA 1WOFA 1PQ7A 2H2ZA 4CBNA 1VJ9U 2PUXB 4BAHB 2BD9A 1SQAA 2QXJA 3TPIZ 1DXPA 1HXEH 4Q80A 1S85A 1LKBA 2ODYB 1QQUA 2H5CA 3KCGH 3QGJA 1BRCE 2ZG0H 2C8ZB 2VNTA 5C20A 1IQLA 2CHAB 3QO6A 5EU8A 1ZYOA 5HXFA 3MH7A 3ZZ6A 2XTTB 1RD3B 2FESH 1F5LA 1JXPA 2G5NA 4IN2A 5C1UA 2QXIA 2F9OA 1GMDG 2A5IA 1FONA 4ABHA 4U30A 1GI9B 4GAWA 4ESTE 2FI5E 3CS7A 5LGOA 3SUEA 3Q3XA 4H42U 2W7UA 5JB8S 3RM0H 2OINA 4MG3A 1HLTH 3RXHA 1X7AC 1K1IA 4VGCC 1AQ7A 5L2YH 1U6QA 3ODFA 4Q7ZA 3URCA 3VB3A 3P95A 1TFXA 1SVPA 3SGQE 3SHCH 2ZO3H 1H4WA 1O2ZA 2P3TB 2BD5A 2CJIA 3F9EA 3V7TA 1O3DA 2XWBI 3TU7H 1O3IA 1DUAA 4KTSA 5L30H 2QAAA 1GJ4H 1LVMA 2TGTA 3JZ2B 1Z1IA 2A4QA 1RTKA 1QA7A 1LPGB 1LTOA 1FPCH 1CA0B 3U98H 1LPZB 5A0AE 1QRXA 1IQEA 4IMZA 2V0BA 3PWCA 2Z94A 3KL6A 4WH8A 1MQ6A 1ELEE 1NU9A 1GI8B 1VCWA 1W10U 3BG8A 2GD4B 3OSYA 2PWXA 3F68H 1GCTB 1Z6JH 5A0BA 5GCHG 4ZKRU 2WUCA 1YBWA 4MPXA 1EZXC 3NUMA 2CGAA 3QX5H 4FVDA 1LO6A 1UTJA 3RXQA 2ZQ2A 1TGTA 3MNBA 3GY7A 1JOUB 2C3SA 4O3UA 1GVZA 2VWMA 3BG4B 3A88A 2GCHF 3GCNA 4LXBH 4Y71A 4DT7B 1N8OB 4MNVA 1GBBA 1TNKA 2ZP0H 3BTWE 2WPLS 3TK5A 3RXCA 1O3GA 4CHAB 1P3EA 2ALPA 5E0JA 4FU8A 1NTPA 2FYRA 1MQ5A 3VXFH 1TE0A 3UTUH 1SGDE 4UFEH 4MNXA 1V2KT 7LPRA 1TPAE 1P2OA 1Z6EA 1TGNA 3PLKA 2ZHFH 3UOUA 2ZGCA 1GBTA 1T8LA 2A45B 5DP9A 2ANYA 4X1QU 1J17T 1HUTH 2D26C 4KP0A 1EPTC 1LHCH 4I8KA 4O9VA 4NA8A 1KXAA 3RC4A 1HAXB 1BTXA 1SOZA 1LDTT 1W0ZU 4FUEA 3DFJA 1K28D 2XYAA 1ANEA 3RXBA 3GY2A 1ANDA 3A89A 4TY6A 5FX5A 2OUAA 1F2SE 3QUMP 2FYQA 1EB1H 4ASHA 5J4QA 1Y5BT 2TGPZ 3E8LA 1G30B 5JBTA 1ZSLA 4BXSA 2FX6A 1L4ZA 2FTLE 2ZFSA 3T62A 2OCVB 6CHAC 1W11U 3A8AA 4LZ1H 1UCYE 2GGVB 4FVBA 2QF0A 1QL9A 5CHAC 1DY8A 4DIHH 5IYTA 1XKAC 1MTNC 3ZVDA 5GWZA 5HM2A 3HGNA 2ZDAH 1GG6C 3S9CA 4K60A 3GCHB 1RTFB 3T26A 1P2KA 1HV7A 3FAOA 2BX4A 3ZZ4A 1G3BA 1DLKB 2TPIZ 1AWHB 4NA9H 4I7YH 3BN9A 4X8UH 3OU0A 2JH0D 1THRH 4FU7A 1GVKB 1E0FD 1DDJA 4YESB 1ZHRA 2AMQA 3SGAE 1AUJA 3SHAH 1GVLA 4JYVH 1UTOA 1H8DH 2VGCC 1TB6H 1KTTB 3SJKA 1HAHH 2UUFB 1EASA 4NWLA 3A7VA 1ABJH 2B8OH 1GJ5H 3E16B 2ZPRA 2O9QA 4AGKA 2G8TA 3K9XB 3EAJA 3NKKA 2H9TH 2J4IA 2H9HA 5EGMA 1AVXA 3LIWA 1N6XA 2IJOB 1A5HA 1GJBB 1HAGE 1AO5A 1UTNA 1H9HE 1O5BB 4JZ1A 4BANB 1GI0A 3OX7U 2BDIA 4BTTB 4X6MA 1NO9H 1ANCA 1L1JA 5FPTA 5L6NH 3IWMA 6GCHG 3M5MA 2GT7A 2CHAC 4YZUA 2PGQB 1WQVH 4TWYA 2LPRA 2R9PA 1GBFA 4MLFB 4JMYA 2G5VA 1C1NA 1C2FA 2BY8X 4B73A 5E2OA 4B2AA 1D3TB 1OWIA 2ILNA 3BTGE 4ZHMU 1GMDF 3ZZCA 1KXFA 2C93B 2EI8A 2NU2E 5HYOA 1EJAA 1C2JA 3MTYA 5DO4H 3MU1A 2P8OC 4Z6AH 1DX5M 1CT0E 1ELFA 1TYNA 3MH6A 2Z9JA 5GDSH 1PYTC 1QCPA 2FEQH 1QRZA 1RIWB 3TH2H 1D3DB 2ZFFH 3TGIE 5DP5A 4NIWA 1GL0E 1CBWC 1TMTH 3MU5A 4YOIA 1FMGA 3LGVA 4YLQH 1MBQA 2FX4A 1GJ9B 1Q2WA 2Y5HA 2Y7XA 3U69H 3GCTG 3T27A 1C2HA 3SGBE 3GISB 1FPHH 2AGIX 1EJMA 2PKSB 1EAIA 1HBTH 2ZHDA 3KNXA 3KQCA 2R2WU 1C2EA 3I29A 4NSYA 3PYHA 3L3TA 3UFAA 1A5GH 3ATMA 4H4FA 3LJJA 3SI3H 1DUEA 3U9AH 1B0FA 1CA0C 1V2LT 1SGPE 1S84A 1QJ7B 2ZCHP 1UK2A 3EE0B 2XBYA 1SLWB 1GBIA 1NRPH 1G2LA 3BTKE 4K5ZA 4H6TA 1GCTC 2OP9A 3FZZA 1W12U 2M5TA 2QY0B 2BZ6H 5GCHF 3M61U 3SI4H 3SN8A 2GDDA 2EI7A 1ZTJA 1E38B 3EYDA 2A7CA 1GI2A 3BG4C 4Y10E 1O2LA 3K6YA 3LONA 1UVOA 3MO6A 1W7GH 1EX3A 1JRSA 1N8OC 2STAE 3ZZ8A 1QR3E 1F92A 4NIVA 2NWNA 2CF8H 5T6DA 1TBQH 2ZWLH 4TWWA 2BLQA 2F3CE 4RN6A 3V13A 2OC7A 1IOEA 3JZ1B 3SV8A 2CMYA 3SJ8A 1MCVA 4BAKB 1XMNB 1GDUA 5AHGH 2AIPA 1DPOA 1AD8H 1XXDA 4VGCB 1UTPA 1ESAA 2Q1JA 1DE7H 1K1LA 1O5AB 3HATH 3SNDA 4D9QA 4ISLA 1PQ5A 1IQIA 3AAUA 4CRDA 1O2UA 1ABIH 1ZGIA 1TRYA 1PQAA 5AF9H 4OS2A 3BTFE 2EA3A 3RMNH 4CR9A 3ZVAA 2STBE 1O39A 5K0HA 1DSTA 2GP9B 5A8ZA 3SNBA 2ODQA 1C2LA 1SQTA 1XUJA 2BYAX 2QXGA 2I6SA 3GDUA 1PPFE 1KTSB 1SGNE 1DWCH 3VFEA 2GZ8A 1IQFA 1W13U 3GYMA 3KQEA 1FDPA 2ZIQH 4ISOA 1O2QA 2G81E 3H7TA 2WPKS 1FY4A 4RSPA 3K65B 4CRGA 1L1NA 1IQHA 1DITH 4ISIH 3T2NA 3DD2H 1OP2A 1QJ1B 2DE9A 3W94A 1G37A 1QB6A 4FUBA 2H6MA 1C5NH 3RXTA 3ZZ3A 1C1WH 1AU8A 3UWJH 1V2TT 1T8MA 2Y82A 4ZKSU 1G36A 3SORA 4AB8A 4ISNA 3T29A 1BB0B 2C90B 2VH6A 3ITIA 1SGIB 4Y0ZE 4D9RA 2A5AA 5LPRA 3STIA 1UVPA 4A6LA 3UIRA 4JZEH 1V2JT 5A0CA 3KHVA 3R0FA 2BD3A 2VINA 4AG2A 1AMHA 1A46H 1EP5A 2H1UA 4TPYA 2J95A 1DICA 3KIDU 3NWUA 1J8AA 4K2YA 2QGRA 3MO3A 4X6NA 4AZ2B 3SUGA 3RP2A 1GMCG 1O30A 1Y3VA 1BJUA 4FUCA 3LH1A 7ESTE 1MZAA 1BUIA 1TBZH 3BEIB 4KGAA 1GJ7B 5FHTA 1ZHPA 1O3PB 2QN5T 3SQHE 3FP6E 2RG3A 3P17H 2D8WA 3PWBA 1EPTB 1CT4E 2ZHWH 1YPMH 1WYKA 2ZPQA 2BD4A 5FCRA 2JETB 2QCYA 1O2MA 2NU1E 3T28A 1T8NA 2RA3A 8GCHG 2G00A 4FXGH 3D23A 2O8UA 2Y5FA 3CS0A 1UVTH 1YCPH 3RXLA 1E36B 1GWAA 1ELCA 3E6PH 4B75A 6GCHF 1QHRB 4JZDH 1W2KH 3Q00A 1VZQH 1UCYH 1GHAF 3LGUA 3GY5A 3P8NA 2FOEA 1LMWB 5CHAB 1BTPA 4OS1A 1BT7A 2PUQH 5DP3A 2AMDA 1F0UA 4YO9A 3RXMA 4K1SA 1A2CH 1HB0B 1VITG 2SNVA 1GHWH 1MTNB 1TAWA 2ZGXH 2Y5GA 2HGTH 5JBCS 1TBRH 4HGCA 1GG6B 4ZROA 4Y79A 1D6WA 1C4U2 3GDSA 3P70B 1V2MT 1FNIA 1J15A 1LVBA 3SNAA 1WV7H 1ZGVA 2OBQA 2XCFA 1DVAH 4IS5A 1TLDA 3ZVFA 2VIWA 3KF2A 1RIWC 3GICB 2Z3EA 1O32A 1D4PB 1OX1A 2SGPE 1OP0A 1HYLA 2K1QA 1WU1A 2VGCB 1F0SA 2P59A 3QLPH 3U8RH 2AGEX 1IHTH 5JB9S 3A85A 1OKXA 4JZFH 1S6HA 1WUNH 1MAYA 3MHWU 1GHBG 4U2WA 4BOHA 1K1OA 1A1RA 3GCTF 5A2MH 3KN2A 3MH5A 2GDEH 4Q7XA 2SNWA 4INKA 5DP8A 1ZR0A 2GZ9A 1SG8B 5F8XA 1G3DA 3FANA 1NESE 1KXDA 1C5RA 2QIQA 4D7GA 2ZFRH 4YTAA 1INCA 4K8BA 5EPYA 2W3KA 3MNCA 5ESTE 1QGFA 1S82A 1SI5H 4DY7B 1A7SA 4O97A 1OXGA 1SPJA 4I33A 4YOJA 4ZHAA 1FN6A 3TH4H 1SGCA 4I32A 1BA8B 4WMEA 1TPPA 1WBGB 4WMFA 1ZMJA 5C3NA 1A4WH 2FLRH 1CVWH 3LOXA 3A7TA 1TABE 2Q6FA 4XOJA 1HJ8A 1FY5A 3QTOH 3SZNA 2DE8A 2FTMA 2WYJA 2OD3B 1YCPM 3SV2H 4AFZA 4DIIH 2V35A 3I77A 1ZTLA 4BXWA 4NIYA 1ETTH 1O3LA 1QIXB 2ZA5A 4A1XA 2A7JA 3PROA 2P8OB 2JH5D 4E7RG 3URDA 1H9LB 4KTUA 1O2HA 2Z3CA 1Z8JB 4WXIA 3BTEE 4AX9H 2C8YB 2FIRH 4X2YA 5C1YA 4ZXXH 3M5LA 3SU3A 3SUFA 2PLXA 2F9BH 5HMAA 3EA9A 1QB1A 1C1UH 4JK5A 1CBWB 1GDNA 1DXWA 2XBVA 4A7IB 4ABIA 3ZZDA 3RU4T 9LPRA 5A8YA 2FWWA 1F0TA 1SGFG 5DP7A 3RXFA 4GPGA 2A1DB 1OSSA
chains in the Genus database with same CATH superfamily
1ELVA 3PO1B 2Z3DA 1EB2A 3OYPA 1P03A 4INLA 2QF3A 3A8CA 5IK2D 3LJOA 5E2PA 4X1RU 2ZQ1A 4CBOA 3MO9A 3VG8A 5EXLA 1YPHE 3MU0A 4XE4A 2GCTB 2Z9GA 2IPQX 3QN7A 3UAIC 5HKKD 1RJXB 2FP7B 4NGAH 4J1YA 3QZRA 1A3EH 3BSQA 1FIWA 1EPTA 3TH3H 2P3UB 1A0LA 4TT3D 1Y5AT 2HVXA 1ZJKA 3P8GA 1UJ1A 1RGQA 4CRAA 1Z8RA 3ZVGA 1C5YB 1FUJA 3LC5A 1O2OA 1O3HA 2G55A 3WWFA 1BTWA 1OYQA 2BDCA 2BTCE 4CRFA 1BZXE 3SBKA 4FUDA 3F9GA 1YKTA 3RUOA 1QY6A 1SFQB 1XUGA 3M3VA 1PPHE 3A82A 2SGQE 3QZQA 1V2ST 3HK6B 1YYY1 3LH3A 5KGOA 1HIAB 4UEHH 3A87A 2PSYA 2VVCA 1V2UT 1AFEH 5JBAS 1COWD 1UHBB 4JYUH 2ZU1A 1BCUH 1C5TA 2EEKA 3MU4A 4Y8ZA 2ZFTA 2ZTYA 1UK3A 1ZHMA 3M35A 1AVWA 1GMCF 2F83A 1AI8H 3K2UA 1K1PA 4ABGA 1XKBC 3M7QA 1K2I1 2VB0A 1JIRA 4ZAEA 3SW2B 4HTCH 1ETSH 3U8OH 2W3IA 2IJD1 1UVUH 3ZZBA 2J5UA 2XC4A 2JETC 4A1VA 2ZF0H 1WSSH 4XSKU 5F6MA 1GHYH 4GCHF 1XUFA 4O3TA 1NFYA 1O5DH 4AFQA 3G01A 1OP8A 1CHOF 4B76A 8GCHF 3TK9A 1K1JA 1NBME 3M36A 1F5KU 3Q77A 1GDQA 4HZHA 5DGJA 5ETXA 1V3XA 1F0RA 2ZHQH 2UWLA 3RM2H 3UB0A 1THSH 2FOAA 2V6NA 1DWDH 5DG6A 1L4DA 2R0KA 4ZMAH 1Y5UT 1F5RA 1Y3XA 4FUGA 3E1XB 1T4VH 1VKYA 1P12E 1YCPK 4LK4A 2L6OA 3M7TA 2F9PA 3NK8A 3W95A 1OHHD 1E1RD 1GGDB 1OWJA 3AW0A 1VITF 4ZCNA 4KELA 1JWTA 3MFJA 1UCYK 1GL1A 2A5KA 3BTDE 1OWKA 4AG1A 2UWPA 4LZ4B 1TQ0B 1HAVB 1GI6A 3BIUH 4OGXA 4I8HA 4U32A 2XW9A 2A32A 2GV6A 3A8DA 2A31A 3QTVH 5C5NA 2FS8A 2XCNA 2ZDNA 1BMNH 5A09A 1SOTA 2O8LA 1CGJE 1PPEE 5CHBA 1EZSC 2QA9E 3RXRA 1C5SA 1DT2A 2XNIA 1MTSA 1GCDA 1GMHF 4BTUB 1MKWK 1XXFA 1O36A 4CR5A 3TGKE 1AB9C 1Z7KA 4Y0YE 1IQGA 1BBRE 1YGCH 2F91A 1J14A 1E37B 2ANWA 4E06H 2JDID 1AKSB 2B5TB 3M3SA 1GHBF 3SU2A 2FS9A 5JPMH 1V2WT 2C8WB 4GUXA 3A80A 2WHXA 1O2XA 2CF9H 4ACAA 3ZVBA 1GJAB 4DCDA 3GS9A 1O3OA 3DT0H 2YOLA 2PFEA 2HRVA 2YMSC 1CT2E 5C0TA 5A8XA 1ELGA 4I8GA 5TCAA 1CO7E 2FO9A 1IQKA 1SLVB 2F4LA 1P2MA 3H5CB 2Z9IA 8LPRA 3DSGA 1K1MA 1TA2A 4DW2U 1O3KA 1ZMLA 4DJZB 1NT1A 1SLUB 2DUCA 3GY8A 4OM9A 5HM9A 2VH0A 3HPTB 4MVNA 1V2QT 1TA6A 3SU6A 1ORFA 3UNRA 1P8VC 2FPZA 2A0QB 3E0PB 3MNXA 3PV2A 3MU8A 5DPAA 4GHQA 1C5XB 3UPEA 4B2BA 4RKOB 5C67A 1ANBA 1O5GH 3A7XA 2NU0E 4SGBE 1AUTC 1P2JA 1P2NA 3PMJA 2ZCKP 1IHSH 1XUIA 5EXMA 3RLYH 1TOMH 1OPHB 1EJNA 2R3UA 1V2NT 2ZFQH 2BHGA 5BRRE 3RC6A 1SGRE 3TITA 1UTQA 2WPMS 2ZZUH 1SFIA 2PSXA 5SGAE 1A3BH 1UMAH 4B71A 1F7ZA 2FM2A 1CHGA 1YPHC 3ZZ7A 5FPYA 2OTVA 2P3FH 5FCKA 5FAHA 3SU0A 2WPIS 2XOKD 1NFXA 2FOMB 2XBWA 3C27B 1OOKB 2FOGA 4BAOB 1QQ4A 2XC0A 3PO1C 1THPB 4M7GA 1C2KA 2B0FA 7GCHG 1KXCA 2BM2A 2JIZD 5L2ZH 1XVOA 1HIAA 3DSOA 1CA8B 1UTMA 1UHBA 1ZMNA 5TCCA 1FXYA 2GCTC 3RC5A 1O3CA 3B23B 1CGIE 1YC0A 5T6GA 2FODA 1NM6A 1B0EA 1FN8A 1LHEH 1SQOA 1SC8U 3PRBA 2BD8A 1C5LH 2ZC9H 1LHDH 5EW2H 3EGKH 3ZIAD 3ZVCA 1C2IA 2FOFA 2H5DA 3VGCB 3ZZ9A 2SGFE 1HPGA 3O8CA 3ZZAA 1NS3A 2W26A 1PPZA 2VWLA 2OXSA 3LDXH 4Y8XA 3BEFB 5EODA 4ZKOU 3VB7A 1SGYE 3ATLA 1C9TA 1P05A 3I78A 4NFEA 1O38A 3A8BA 3L33A 5ABWA 3RXAA 4I8JA 3GY4A 1FY8E 2IPHA 2VVVA 3AW1A 3BF6H 2TRMA 1HAPH 3B9FH 1VCPA 3NZIA 3RXSA 3WY8A 2OC1A 3VXEH 3E3TA 3OY5U 1IQMA 1ZRKA 3UOPA 1MD7A 1P3CA 4FUJA 4NSVA 1CQQA 2PTCE 4K8YA 2ZFPH 4Y8YA 4BTIB 1MD8A 4UD9H 1C1TA 1L0ZA 1O3MA 1QL7A 4JCNA 4ACBA 1EQ9A 2HNTF 2BLVA 1O35A 3S0NA 2F9VA 2GV7A 2WPHS 1D9IA 1GBMA 2IN2A 2CN0H 1KXBA 2J92A 2CK3D 1NFWA 2BXUH 4JK6A 4B2CA 1WAYB 4AB9A 4Q7YA 1CGHA 1AIXH 4KKDA 3UUZA 2VU8E 4D8NA 3RMMH 1MAXA 4ZUHA 2BOKA 2FDAA 2XNDD 3B8JA 3TLOA 1BTYA 1ID5H 1C1MA 2UUKB 5I25A 3BTQE 1AKSA 1C5VA 2B7DH 4IMQA 1K1NA 4JYTA 1C5WB 3OEED 3RU4D 1ELDE 2ZTZA 5C5OA 2VIVA 2P16A 1DFPA 1GGDC 1TGBA 1O34A 3WW7A 5JBBS 2HPPH 2ZI2H 2OC0A 1OWEA 3RXVA 3VB4A 3O8RA 2EC9H 2Y6TA 4YT6H 5ESBA 3KQBA 1L2EA 5CDFE 1J9CH 1IQJA 2HALA 3STJA 4GLYA 2BDAA 3LKWA 1XUHA 4MPVA 3GY6A 4IC5A 4WY3A 3MI4A 1GI4A 1W3CA 2VJ1A 1W8BH 1TNJA 2Q6GA 4DOQA 1ELBA 3VEQB 5AVDA 3S7KB 3DUXH 4AGJA 2FXRA 1HAZB 1W0YH 2LNCA 2PR3A 4AYYB 5F8ZA 1VGCB 2GCHG 2SGEE 1GBAA 5HIZA 3FN8A 1P57B 2AGGX 1NZQH 4TYDA 3F2HA 1MTUA 1NRNH 3S69A 3P6ZB 4E7NA 4TPIZ 2GZ7A 1O31A 4NG9H 1EOLA 5GXPA 3H7OA 1BRBE 2ZU5A 1FV9A 1S6LA 2AMPA 1S5SA 3NPSA 3TJNA 2J98B 1VCQA 1H1BA 1GPZA 1E34B 1WCZA 1TPSA 4GSOA 3L6PA 1G9IE 1ZPCA 1XX9A 5DP4A 3CP7A 1JRTA 1LCYA 3KQ5A 4XFQA 4FUFA 4UFDH 3PMBB 3HKIB 4J2YB 1YPGH 2R3YA 2VIQA 1TALA 5IDKA 1TQ7B 4FUHA 1K9OE 4ABEA 1AFQC 4X6PA 2KX4A 5F53A 1TPOA 2G52A 2VWOA 4NZQA 1TX7A 1V2RT 4ABFA 2GTBA 1TRMA 1AHTH 1WDIA 2JH6D 3O8DA 4CREA 1TOCB 3WWBA 3PTNA 3IG6B 1RS0A 2BVSH 2GMTC 2C8XB 4A92A 1MCTA 2HNTC 1ZSJA 1MKWH 3M37A 1O2JA 1LPKB 4RI0A 3RMOH 5T3HA 2ZGBH 1HJAC 3RXDA 4AOQA 2SGDE 3UQOA 4X8TH 1LVYA 5HIYA 2BOHB 4YXWD 2ZKSA 5H4IB 3P8OA 1PPGE 3MYWA 3N99A 1BQYA 4DURA 4P00A 3SNEA 1BBRH 1AB9B 1EAUA 1FX0B 3ZV9A 2ZDLA 3TJVA 1QURH 3LGWA 2GKVE 3M3TA 4I31A 2PKAB 2Y80A 4R0IA 1CE5A 1TGCA 3PV5A 3H09A 2QXHA 4WF8A 4Y6DA 1AY6H 7GCHF 3FFGA 1GJDB 1O2GH 1P2IA 1ESTA 3U8TH 1QRWA 3F0OA 2F9NA 1BHXF 3N7DA 1Z71A 4H6SB 1ZPBA 1MABB 1EZQA 2QC2A 4XDEA 5EG4A 3OTPA 1NROH 3D49H 3PRDA 2AS9A 4WMDA 1W7XH 1WTHD 3VB6A 4NCYA 5GPIB 2PGBB 1O3NA 3MMGA 3ZV8A 3ELAH 1JIMA 2SGAA 2R0LA 3ZVEA 3F1SB 1N1LA 1YPLH 3VGCC 2BLOA 1B5GH 1ZOMA 1DSUA 1WTGH 3RU4E 1O5CB 3S7HB 3LT3A 3UREA 2BY6X 1TNLA 1A0HB 2C4FH 3FVFB 1GBJA 4I8LA 1JBUH 3SOSA 3W1EA 1Y8TA 2ZHEH 1LHGH 1OWDA 2GX4A 1HFDA 4B74A 1GI7B 5F8TA 3AAVA 1DOJA 2WYGA 5EOKA 1KYNA 4CRCA 4A5TS 2NU3E 2TGAA 1GBKA 1BMLA 1SGQE 5T1VA 1QA0A 3ATIA 2Q6DA 3HK3B 3ZZ5A 4Z1MD 2BQ6B 3U1IB 3DA9B 2TBSA 4WXVA 1SB1H 4LOYH 5HGGA 3RXEA 2TGDA 2KCOA 5EQSA 1PFXC 4DGJA 2KCYA 1EP6A 3F2GA 2ASUB 3HGPA 2OC8A 1IQNA 1QBNA 3DHKH 3UNQA 2VVUA 4B1TA 1C5OH 1GBDA 3PV4A 4XD7D 2P93A 5PTPA 1BTZA 2ZDMA 2ANKH 2BB4A 1P10A 5E0GA 2OQ5A 1YM0A 5EW1H 1NRQH 1QTFA 1C2GA 2D1JA 4B6EA 3QK1A 1GJCB 1KMHB 2O8MA 1BIOA 1FAKH 2Z9LA 1S83A 4K69A 1AZ8A 1ZLRA 2G4TA 4OS4A 4ZKNU 3BTME 4E05H 1HXFH 2PW8H 3F0PA 3KEEA 4PROA 1XM1A 1QBVH 1PPBH 3A86A 2BZAA 5C94A 3KGPA 3LGIA 1GJ6A 3GOVB 1O2WA 3RXIA 1SMFE 1O2SA 2A2QH 1Q3XA 2ZTXA 1H9IE 1V2OT 2J98A 4BNRA 1BRUP 1J16A 1KSNA 1OYTH 1GHZA 2J94A 1DS2E 1O5FH 1G3CA 3UWIA 4GHTA 5DK1A 1KY9A 1ETRH 1A5IA 2B9LA 3PM3A 1NY22 1C1PA 3PB1E 4D76A 4Y7AA 1ELAA 2J2UA 3NXPA 1MZDA 3ESTA 1O2RA 1BOQA 1KIGH 4K1EA 1C1RA 1DY9A 4DG4A 1C5UA 1VGCC 5C1XA 4SGAE 3Q76A 4AFSA 2RA0A 3BIVH 4YM9A 2VWNA 3TJUA 1H8IH 4IW4E 4R8TB 1LHFH 3ATWA 4AFUA 5FXLA 3UNSA 1G2MA 3RXJA 2VIPA 1KDQB 3S9BA 1W14U 4FOUC 2JJ1D 4NIXA 3TNSA 4Y7BA 4X2XA 1P04A 2IOTA 1LQDB 2EQNA 2ALVA 1MKXH 3RDZA 1FQ3A 3PLPA 2VIDA 3LPRA 2CXVA 3BTTE 1S6FA 2FI4E 3F3BA 1C1SA 1P9UA 3TVJB 1SHHB 1S0QA 1TONA 1FI8A 3RXUA 1C5MD 2PKAA 4AN7A 4Z0KA 1GI3A 1ZZZA 3D62A 1UO6A 2BDBA 5JYIA 2AFQB 3SU1A 1LQEA 1C5PA 1O3EA 2KAIB 1C4Y2 2G51A 5DP6A 4B6FA 1KLIH 2HLDD 1C2MA 2AHME 2FI3E 3VB5A 4OS7A 1EKBB 3EA7A 3RXKA 4HI3A 4X2WA 3SO3A 1NN6A 4CH8B 3V0XA 1AVGH 2OLGA 1PPCE 2J34A 4YT7H 1GHXH 4AYVB 1MUEB 3DFLA 2A2XH 2D2DA 4AORA 1C4V2 2BDGA 1O2IA 2ZCLP 3SNCA 1O2KA 1DM4B 1O3AA 1P01A 1KXEA 2XC5A 3HKJB 1O2YA 1SGEE 2O8TA 1HRTH 4UONA 2KM0A 1HNEE 5LH8A 1O3BA 3ENSB 4XBCA 1ELTA 2VIOA 1M9UA 1PQ8A 1DWEH 1SHYA 6ESTA 2YNAA 3UQVA 2Z7FE 2J38A 1O3FA 2ZECA 1LKAA 4K3JA 3N7OA 4UE7H 3F6UH 1BBRK 3Q3YA 2AEIH 1O2VA 4BAMB 1O2TA 3CENA 2FOCA 3GDVA 4WH6A 1A0JA 5GIBA 2Z6BD 4YLUA 2OQUA 2QE7D 5C0UA 5C2ZA 1MMJN 2BY9X 3R3GB 1EATA 3TIUA 2XWAA 1Z8GA 4THNH 3TGJE 1C5QA 8ESTE 3MOCA 1T7CA 3TNTA 1QJ6B 4Y11E 4BAQB 1CSOE 1ZTKA 3M5OA 3LGTA 5AFZH 2ZPSA 2A4RA 1EUFA 1AFQB 1O37A 2BVXH 3M7UA 2G4UA 1DANH 2V3MA 4X1NU 2BDHA 3BTHE 1ESBA 2ZGJA 1KLJH 4MPUA 2FOHA 4IC6A 1C1OA 4X1SU 2ZEBA 1GHAG 1T31A 1FAXA 5BPEA 1QFKH 5EXNA 2GMTB 4OGYA 4XBBA 1YPJH 1RFNA 2CV3A 9ESTA 2W5EA 1SLXB 2P95A 3SQEE 1HJAB 1MH0A 4F4OC 3A7ZA 3LGYA 1HCGA 2BVRH 1HAYB 1YY3A 2BXTH 1RTLA 5I46H 5FPSA 1ACBE 5F03A 2ZU3A 4OS6A 2XRCA 4TY7A 4X8VH 1TNIA 1P06A 5LPFA 1GI1A 2W7SA 1ZSKA 3ZYDA 3O8BA 3T5FH 1YF4A 1DLEA 1KLTA 1NC6A 3TK6A 1K0HA 1IAUA 4AC9A 2HNTE 1BTHH 1OWHA 4ABAA 5K7RA 2ZDVH 1BTUA 1NRSH 1SGTA 2NU4E 3RXOA 1DWBH 2Y7ZA 2RCEA 4GVUA 3OY6U 1T8OA 2KR7A 1PJPA 4F55A 2A4OA 1TX8A 3TJOA 1AE8H 1GBHA 4WWYA 1G32B 1TNHA 1Q31A 2PV9B 4Q2KA 4D7FA 1V2VT 4NWKA 2A7HA 1T4UH 2AERH 1TX6A 1KDQA 3ZYEA 5J4SA 3A84A 4JZIA 3AK5A 5FBEA 1SQRA 1UTKA 1BJVA 4U01A 2J9NA 2WPDD 1HAOH 2BDYA 1GBLA 4RT1A 5TJXA 4ISHH 1TNGA 3U1JB 4IN1A 4WVPE 4DVAU 1Z1JA 1WXRA 3SV7A 3D65E 5B6OA 2BD7A 1QZ8A 1G3EA 1AE5A 2AH4X 1AZZA 2TIOA 3QGNB 3ODDA 2BLWA 3PTBA 2KAIA 3MWIU 4OS5A 1XVMA 4CH2B 2WPJS 1HJ9A 1P09A 3BV9B 5DKMA 3KQDA 4F49A 3SV6A 1B7XB 3GY3A 3C1KA 3LC3A 2FZZA 4ABDA 1HAVA 3MH4A 2BMGB 5JDUB 4CHAC 1AGJA 3VPKA 1C1VH 3E90B 1MTWA 5T6FA 1SGFA 1GBEA 1UVSH 3SU5A 1C1QA 2WZQA 4UFGH 3V12A 2QF5A 4NFFA 2Z9KA 4ABJA 3E91A 1MU8B 1Y3YA 2ZDKA 2I6QA 1EAXA 1FY1A 2ZU4A 4FUIA 5G4BA 4YOGA 2FLBH 1NFUA 1FLEE 3EDXB 2UWOA 4XBDA 4X6OA 3LU9B 3A7YA 1Y3UA 2BY7X 1MKXK 2AYWA 4MQAA 3SUDA 1YPKH 2GVFA 3MQKC 1WQSA 4KTCA 1Y3WA 2UUYA 3EA8A 3QWCH 2EI6A 1S81A 5EQRA 1SR5C 4F48B 4WJG2 3DSPA 1D3PB 5FL7D 1C2DA 1MU6B 3T25A 1V6DA 1VITH 1MBMA 4K1TA 2ESTE 7KMEH 1BMMH 2FOBA 4CRBA 3FP8E 4MNYA 4ZXYH 1AWFH 3EQ0H 1FIZA 3F9FA 3SJ9A 1YP9A 5CMXH 1TWXB 5DJ7A 1O2PA 1P0SH 4X2VA 1GI5A 1FY3A 1HGTH 1L1GA 2HOBA 1ZRBA 1FZZA 1O3JA 3GCHC 3RMLH 2RDLA 3FP7E 1SSXA 4MDSA 3KYGA 3M5NA 5FX6A 3RXGA 4MNWA 2BQWB 2F9UA 1TMBH 1K22H 2BQ7B 2GT8A 5AFYH 5E8EH 1BHXB 1FJSA 2O8WA 2WUBA 2R2MB 3P92A 3PMHB 1O5EH 2V3HH 1EZUC 1BITA 3GYLB 2V7QD 2YNBA 1YLCA 4FU9A 3SU4A 4X1PU 1C9PA 1A61H 1LVOA 5EIYA 2WV4A 2V3OH 8KME2 2THFB 1JMOH 5EPNA 2SFAA 4Y76A 5CE1A 4A1TA 2OBOA 2Y81A 1PYTD 4INHA 1EOJA 1TRNA 2A4GA 3Q3KA 1E35B 3AASA 2ULLA 4UDWH 3V3MA 5GJ4B 1NRRH 4QT8C 4IBLH 4UFFH 3A81A 5E0HA 2ZNKH 4GCHG 1C5ZB 2BX3A 1EXFA 1K21H 1CHOG 3SV9A 1QB9A 1RRKA 4NZLA 4X8SH 4RKJB 1TMUH 1UK4A 1D3QB 1NU7B 3IITA 1VR1H 3A7WA 1QBOA 1HAIH 1P02A 2BD2A 2FMJA 1P11E 1Z8IB 1O2NA 1MTVA 4ZHLU 6CHAB 2QYIA 3FZDA 1BMAA 1GBCA 1P2QA 1RXPA 1BDAA 1SL3A 1TIOA 4X0WU 5EJLA 1S0RA 1HDTH 3BEUA 2JKHA 6LPRA 3P8FA 3E0NB 1ARBA 3K6ZA 1VJAU 2HLCA 2PTNA 1O33A 3PMAB 4IGDA 1BRAA 3SJIA 1YPEH 1O0DH 2HWLB 3PLBA 1GHVH 3NCLA 1OS8A 1T32A 3RLWH 2P94A 3QDZB 1QNJA 4HFPB 2ZU2A 1CU1A 1NPMA 3OTJE 3UR9A 2ZGHA 3SJOA 1QL8A 3AVZA 2HPQH 4NA7A 3S9AA 1N6YA 2XXLA 3UY9A 1EAWA 3A83A 1GMHG 2WV5A 2H9EH 1P9SA 1XUKA 1TGSZ 3RXPA 3MNSA 4O03A 2ODPA 2ANMH 1UTLM 2KCAA 2QV1A 5FBIA 1D6RA 2PHBA 3F9HA 5EQQA 4ABBA 2PKSC 1Y59T 1V2PT 5LPEA 3GCOA 4ZH8A 3UR6A 2AIQA 2BY5X 1ZPZA 2UUJB 4MPWA 1ARCA 1YLDA 1SBWA 2WINI 1GJ8B 2XBXA 4MTBA 1AN1E 3ATKA 1ZJDA 1WOFA 1PQ7A 2H2ZA 4CBNA 1VJ9U 2PUXB 4BAHB 2BD9A 1SQAA 2QXJA 3TPIZ 1DXPA 1HXEH 4Q80A 1S85A 1LKBA 2ODYB 1QQUA 2H5CA 3KCGH 3QGJA 1BRCE 2ZG0H 2C8ZB 2VNTA 5C20A 1IQLA 2CHAB 3QO6A 5EU8A 1ZYOA 5HXFA 3MH7A 3ZZ6A 2XTTB 1RD3B 2FESH 1F5LA 1JXPA 2G5NA 4IN2A 5C1UA 2QXIA 2F9OA 1GMDG 2A5IA 1FONA 4ABHA 4U30A 1GI9B 4GAWA 4ESTE 2FI5E 3CS7A 5LGOA 3SUEA 3Q3XA 4H42U 2W7UA 5JB8S 3RM0H 2OINA 4MG3A 1HLTH 3RXHA 1X7AC 1H8ED 1K1IA 4VGCC 1AQ7A 5L2YH 1U6QA 3ODFA 4Q7ZA 3URCA 3VB3A 2F43B 3P95A 1TFXA 1SVPA 3SGQE 3SHCH 4XRNA 2ZO3H 1H4WA 1O2ZA 2P3TB 2BD5A 2CJIA 3N7EA 3F9EA 3V7TA 1O3DA 2XWBI 3TU7H 3F2FA 1O3IA 1DUAA 3KYFA 4KTSA 5L30H 2QAAA 1GJ4H 1LVMA 2TGTA 3JZ2B 1Z1IA 2A4QA 1RTKA 1QA7A 5EJ1A 1LPGB 1LTOA 1FPCH 1CA0B 3U98H 1LPZB 5A0AE 1QRXA 1IQEA 4IMZA 2V0BA 3PWCA 2Z94A 3KL6A 4WH8A 3U28C 1MQ6A 1ELEE 1NU9A 1GI8B 1VCWA 1W10U 3BG8A 2GD4B 3OSYA 2PWXA 3F68H 1GCTB 1Z6JH 5A0BA 5GCHG 4ZKRU 2WUCA 1YBWA 4MPXA 1EZXC 3NUMA 2CGAA 3QX5H 4FVDA 1LO6A 1UTJA 3RXQA 2ZQ2A 1TGTA 3MNBA 3GY7A 1JOUB 2C3SA 4O3UA 1GVZA 2VWMA 3BG4B 3A88A 2GCHF 3GCNA 4LXBH 4Y71A 4DT7B 4Q4LA 1N8OB 3DCLA 4MNVA 2M2AA 1GBBA 1TNKA 2ZP0H 3BTWE 2WPLS 3TK5A 3RXCA 1O3GA 4CHAB 1P3EA 2ALPA 5E0JA 4FU8A 1NTPA 2FYRA 1MQ5A 3VXFH 1TE0A 3UTUH 1SGDE 5DSFA 4UFEH 4MNXA 1V2KT 7LPRA 1TPAE 1P2OA 2JJ2D 1Z6EA 1TGNA 3PLKA 2ZHFH 3UOUA 2ZGCA 1GBTA 1T8LA 2A45B 5DP9A 2ANYA 4X1QU 1J17T 1HUTH 2D26C 4KP0A 1EPTC 1LHCH 4I8KA 4O9VA 4NA8A 1KXAA 3RC4A 1HAXB 1BTXA 1SOZA 1LDTT 1W0ZU 2OK5A 4FUEA 3DFJA 1K28D 2XYAA 1ANEA 3RXBA 3GY2A 1ANDA 3A89A 4TY6A 5FX5A 2OUAA 1F2SE 3QUMP 2FYQA 1EB1H 4ASHA 5J4QA 1Y5BT 2TGPZ 3E8LA 1G30B 5JBTA 1ZSLA 4BXSA 2FX6A 1L4ZA 2FTLE 2ZFSA 3T62A 2OCVB 6CHAC 1W11U 3A8AA 4LZ1H 1UCYE 2GGVB 4FVBA 2QF0A 1QL9A 5CHAC 2K8IA 1DY8A 4DIHH 5IYTA 1XKAC 1MTNC 3ZVDA 5GWZA 5HM2A 3HGNA 3FOAA 2ZDAH 1GG6C 3S9CA 4K60A 3GCHB 1RTFB 3T26A 1P2KA 1HV7A 3FAOA 2BX4A 3ZZ4A 2VBCA 1G3BA 1DLKB 2TPIZ 1AWHB 4NA9H 4I7YH 3BN9A 4X8UH 3OU0A 2JH0D 1THRH 4FU7A 1GVKB 1EFRD 1W0KD 1E0FD 2RFKC 1DDJA 2GJGA 4YESB 1ZHRA 2AMQA 3SGAE 1AUJA 3SHAH 1GVLA 2EY4C 4JYVH 1UTOA 1H8DH 2VGCC 1TB6H 1KTTB 3SJKA 1HAHH 4TSFD 2UUFB 1EASA 4NWLA 3A7VA 1ABJH 2B8OH 1GJ5H 3E16B 2ZPRA 2O9QA 4AGKA 2G8TA 3K9XB 3OFND 3EAJA 3NKKA 2H9TH 1YWUA 2J4IA 3OEHD 2H9HA 4M9FA 1AVXA 5EGMA 3LIWA 1N6XA 2IJOB 1A5HA 1GJBB 1HAGE 1AO5A 1UTNA 3OAAD 1H9HE 1O5BB 4JZ1A 4BANB 1GI0A 2K0QA 3OX7U 2BDIA 4BTTB 4X6MA 1NO9H 1ANCA 1L1JA 5FPTA 5L6NH 3IWMA 6GCHG 3M5MA 2GT7A 2CHAC 4YZUA 2PGQB 1WQVH 4TWYA 2LPRA 1E79D 1GBFA 2R9PA 4MLFB 4JMYA 1H8HD 2G5VA 1C1NA 1C2FA 2BY8X 4B73A 5E2OA 4B2AA 1D3TB 1OWIA 3FKSD 2ILNA 3BTGE 4ZHMU 1GMDF 3ZZCA 1KXFA 2C93B 2EI8A 2NU2E 5HYOA 1EJAA 1C2JA 3MTYA 5DO4H 3MU1A 2P8OC 4Z6AH 1DX5M 1CT0E 1ELFA 1TYNA 3MH6A 2Z9JA 5GDSH 1PYTC 2W6JD 1QCPA 2FEQH 5DN6D 1QRZA 1RIWB 3TH2H 1D3DB 2ZFFH 3TGIE 5DP5A 4NIWA 1GL0E 1CBWC 2KCPA 1TMTH 5KEDA 3MU5A 4YOIA 1FMGA 3LGVA 4YLQH 1MBQA 2FX4A 1GJ9B 1Q2WA 2Y5HA 2Y7XA 3U69H 3GCTG 5KECA 3T27A 1C2HA 3SGBE 3GISB 1FPHH 2AGIX 1EJMA 2PKSB 1EAIA 1HBTH 2ZHDA 3KNXA 3KQCA 2R2WU 1C2EA 3I29A 4NSYA 3PYHA 3L3TA 3UFAA 1A5GH 3ATMA 2LELA 4H4FA 3LJJA 3SI3H 1DUEA 3U9AH 1B0FA 1CA0C 1V2LT 4P02A 1SGPE 1S84A 1QJ7B 2ZCHP 1UK2A 1UW7A 3EE0B 2XBYA 1SLWB 1GBIA 1NRPH 1G2LA 3BTKE 4K5ZA 4H6TA 1GCTC 2OP9A 3FZZA 1W12U 2M5TA 2QY0B 2BZ6H 5GCHF 3M61U 3SI4H 3SN8A 2GDDA 2EI7A 1ZTJA 1E38B 2L74A 3EYDA 5B6LA 2A7CA 1GI2A 3BG4C 3SYJA 4Y10E 1O2LA 3K6YA 3LONA 1UVOA 3MO6A 1W7GH 3CNRA 1EX3A 1JRSA 1N8OC 2STAE 3ZZ8A 1QR3E 1F92A 4NIVA 2NWNA 2CF8H 5T6DA 1TBQH 2ZWLH 4TWWA 2BLQA 2F3CE 4RN6A 3V13A 2OC7A 1IOEA 3JZ1B 3SV8A 2CMYA 3SJ8A 1MCVA 4BAKB 1XMNB 1GDUA 5AHGH 2AIPA 1DPOA 1AD8H 1XXDA 4VGCB 1UTPA 1ESAA 2Q1JA 1DE7H 1K1LA 2PP6A 1O5AB 3HATH 3SNDA 4D9QA 2KZ4A 4ISLA 1PQ5A 1IQIA 3AAUA 4CRDA 1O2UA 1ABIH 1ZGIA 1TRYA 1PQAA 2WV9A 5AF9H 4OS2A 3BTFE 2EA3A 2LP6A 3RMNH 4CR9A 3ZVAA 2STBE 1O39A 5K0HA 1DSTA 2GP9B 5A8ZA 3SNBA 2ODQA 1C2LA 1SQTA 1XUJA 2BYAX 2QXGA 2I6SA 3GDUA 1PPFE 1KTSB 1SGNE 1DWCH 3VFEA 2GZ8A 1IQFA 1W13U 3GYMA 3KQEA 1FDPA 2ZIQH 4ISOA 1O2QA 2G81E 3H7TA 2WPKS 1FY4A 4RSPA 3K65B 4CRGA 1L1NA 1IQHA 1DITH 4ISIH 3T2NA 3DD2H 1OP2A 2YMSD 1QJ1B 2DE9A 3W94A 1G37A 1QB6A 4FUBA 2H6MA 1C5NH 3RXTA 3ZZ3A 1C1WH 1AU8A 3UWJH 1V2TT 2W6ID 1T8MA 4HG6A 2Y82A 4ZKSU 1G36A 3SORA 4AB8A 4ISNA 5EJZA 3T29A 1BB0B 2C90B 2VH6A 3ITIA 1SGIB 4Y0ZE 4D9RA 2A5AA 2QF4A 5LPRA 3STIA 1UVPA 4A6LA 3UIRA 4JZEH 4I86A 1V2JT 5A0CA 3NRLA 3KHVA 3R0FA 1W0JD 2BD3A 2VINA 4AG2A 1AMHA 1A46H 1EP5A 2H1UA 4TPYA 4DT4A 2J95A 1DICA 3KIDU 3NWUA 1J8AA 4K2YA 2QGRA 1YLNA 3MO3A 4X6NA 3SUGA 4AZ2B 3RP2A 1GMCG 1O30A 1Y3VA 1BJUA 4FUCA 3LH1A 7ESTE 1MZAA 1BUIA 1TBZH 3BEIB 4KGAA 1GJ7B 5FHTA 1ZHPA 1O3PB 2QN5T 3SZEA 3SQHE 3FP6E 2RG3A 3P17H 2D8WA 3PWBA 1EPTB 1CT4E 2ZHWH 1YPMH 1WYKA 2ZPQA 2BD4A 5FCRA 2JETB 2QCYA 2WSSD 4ASUD 1O2MA 2NU1E 3T28A 1T8NA 2RA3A 8GCHG 2G00A 4FXGH 3D23A 2O8UA 2Y5FA 3CS0A 1UVTH 1YCPH 3RXLA 1E36B 4RT0A 1GWAA 1ELCA 3E6PH 4B75A 6GCHF 1QHRB 4JZDH 1W2KH 3Q00A 1VZQH 1UCYH 1GHAF 3LGUA 2KFWA 3GY5A 3P8NA 2FOEA 1LMWB 5CHAB 1BTPA 4OS1A 1BT7A 2PUQH 5DP3A 2AMDA 1F0UA 4YO9A 3RXMA 4K1SA 1A2CH 1HB0B 1VITG 2SNVA 1GHWH 1MTNB 1TAWA 2ZGXH 2Y5GA 2HGTH 5JBCS 1TBRH 4HGCA 1GG6B 4ZROA 4Y79A 1D6WA 1C4U2 3GDSA 3P70B 1V2MT 1FNIA 1J15A 1LVBA 3SNAA 1WV7H 1ZGVA 2OBQA 2XCFA 1DVAH 3FO8D 4IS5A 1TLDA 3ZVFA 2VIWA 3KF2A 1RIWC 3GICB 2Z3EA 1O32A 1D4PB 2J97A 1OX1A 2SGPE 1OP0A 1HYLA 2K1QA 1WU1A 2VGCB 1F0SA 5GNDA 2P59A 3QLPH 3U8RH 2AGEX 1IHTH 5JB9S 3A85A 1OKXA 4JZFH 1E1QD 1S6HA 1WUNH 1MAYA 3MHWU 1GHBG 4U2WA 4BOHA 1K1OA 1A1RA 3GCTF 5A2MH 3KN2A 3MH5A 2GDEH 4Q7XA 2SNWA 1NBMD 4INKA 5DP8A 1ZR0A 2GZ9A 1SG8B 5F8XA 1G3DA 3FANA 1NESE 2YMSB 1KXDA 1C5RA 2QIQA 4D7GA 2ZFRH 4YTAA 1INCA 4K8BA 2RDEA 5EPYA 3EE7A 2W3KA 3MNCA 5ESTE 1QGFA 1S82A 1SI5H 4DY7B 1A7SA 4O97A 1OXGA 1SPJA 4I33A 4YOJA 4ZHAA 1FN6A 3TH4H 1SGCA 4I32A 1BA8B 4WMEA 1TPPA 1WBGB 4WMFA 1ZMJA 4Q63A 5C3NA 1A4WH 4FETA 2FLRH 1CVWH 3LOXA 3A7TA 1TABE 2HVYB 2Q6FA 4XOJA 1HJ8A 1FY5A 3QTOH 3SZNA 2DE8A 2FTMA 2WYJA 2OD3B 1YCPM 3SV2H 4AFZA 4DIIH 2V35A 3I77A 1ZTLA 4BXWA 1SKYE 4NIYA 1ETTH 1O3LA 1QIXB 2ZA5A 1BMFD 2A7JA 3PROA 4A1XA 2P8OB 2JH5D 4E7RG 3URDA 1H9LB 4KTUA 1O2HA 2Z3CA 1Z8JB 4WXIA 3BTEE 4AX9H 2C8YB 2FIRH 4X2YA 5C1YA 4ZXXH 3M5LA 3SU3A 3SUFA 2PLXA 2F9BH 5HMAA 3EA9A 1QB1A 3OE7D 1C1UH 4JK5A 1CBWB 1GDNA 1DXWA 2XBVA 4A7IB 4ABIA 5C17A 3ZZDA 3RU4T 9LPRA 5A8YA 2FWWA 1F0TA 1SGFG 5DP7A 3RXFA 4GPGA 2A1DB 1OSSA
chains in the Genus database with same CATH topology
1ELVA 3PO1B 2Z3DA 1EB2A 3OYPA 1P03A 4INLA 2QF3A 3A8CA 3LJOA 5E2PA 4X1RU 2ZQ1A 4CBOA 3MO9A 5EXLA 1YPHE 3MU0A 4XE4A 2GCTB 2Z9GA 3QN7A 1RJXB 2FP7B 4NGAH 4J1YA 3QZRA 1A3EH 3BSQA 1FIWA 1EPTA 3TH3H 2P3UB 1A0LA 1Y5AT 2HVXA 1ZJKA 3P8GA 1UJ1A 1RGQA 4CRAA 1Z8RA 3ZVGA 1C5YB 1FUJA 3LC5A 1O2OA 1O3HA 2G55A 1BTWA 1OYQA 2BDCA 2BTCE 4CRFA 1BZXE 3SBKA 4FUDA 3F9GA 1YKTA 3RUOA 1QY6A 1SFQB 1XUGA 3M3VA 1PPHE 3A82A 2SGQE 3QZQA 1V2ST 3HK6B 1YYY1 3LH3A 1HIAB 4UEHH 3A87A 2PSYA 2VVCA 1V2UT 1AFEH 5JBAS 1UHBB 4JYUH 2ZU1A 1BCUH 1C5TA 2EEKA 3MU4A 4Y8ZA 2ZFTA 2ZTYA 1UK3A 1ZHMA 3M35A 1AVWA 1GMCF 2F83A 1AI8H 3K2UA 1K1PA 4ABGA 1XKBC 3M7QA 1K2I1 2VB0A 1JIRA 4ZAEA 3SW2B 4HTCH 1ETSH 3U8OH 2W3IA 1UVUH 3ZZBA 2XC4A 2JETC 4A1VA 2ZF0H 1WSSH 4XSKU 5F6MA 1GHYH 4GCHF 1XUFA 4O3TA 1NFYA 1O5DH 4AFQA 3G01A 1OP8A 1CHOF 4B76A 8GCHF 3TK9A 1K1JA 3M36A 1F5KU 3Q77A 1GDQA 4HZHA 5DGJA 5ETXA 1V3XA 1F0RA 2ZHQH 2UWLA 3RM2H 1THSH 2FOAA 2V6NA 1DWDH 5DG6A 1L4DA 2R0KA 4ZMAH 1Y5UT 1F5RA 1Y3XA 4FUGA 3E1XB 1T4VH 1P12E 1YCPK 4LK4A 3M7TA 2F9PA 3NK8A 3W95A 1GGDB 1OWJA 3AW0A 1VITF 4KELA 1JWTA 3MFJA 1UCYK 1GL1A 2A5KA 3BTDE 1OWKA 4AG1A 2UWPA 4LZ4B 1TQ0B 1HAVB 1GI6A 3BIUH 4OGXA 4I8HA 4U32A 2XW9A 2A32A 2GV6A 3A8DA 2A31A 3QTVH 5C5NA 2FS8A 2XCNA 2ZDNA 1BMNH 5A09A 1SOTA 2O8LA 1CGJE 1PPEE 1EZSC 2QA9E 3RXRA 1C5SA 1DT2A 2XNIA 1MTSA 1GCDA 1GMHF 4BTUB 1MKWK 1XXFA 1O36A 4CR5A 3TGKE 1AB9C 1Z7KA 4Y0YE 1IQGA 1BBRE 1YGCH 2F91A 1J14A 1E37B 2ANWA 4E06H 1AKSB 2B5TB 3M3SA 1GHBF 3SU2A 2FS9A 5JPMH 1V2WT 2C8WB 4GUXA 3A80A 1O2XA 2CF9H 3ZVBA 1GJAB 4DCDA 1O3OA 3DT0H 2YOLA 2PFEA 2HRVA 1CT2E 5A8XA 1ELGA 4I8GA 5TCAA 1CO7E 2FO9A 1IQKA 1SLVB 1P2MA 3H5CB 2Z9IA 8LPRA 1K1MA 1TA2A 4DW2U 1O3KA 1ZMLA 4DJZB 1NT1A 1SLUB 2DUCA 3GY8A 5HM9A 2VH0A 3HPTB 4MVNA 1V2QT 1TA6A 3SU6A 1ORFA 3UNRA 1P8VC 2FPZA 2A0QB 3E0PB 3MNXA 3MU8A 5DPAA 4GHQA 1C5XB 3UPEA 4B2BA 4RKOB 5C67A 1ANBA 1O5GH 3A7XA 2NU0E 4SGBE 1AUTC 1P2JA 1P2NA 3PMJA 2ZCKP 1IHSH 1XUIA 5EXMA 3RLYH 1TOMH 1OPHB 1EJNA 2R3UA 1V2NT 2ZFQH 2BHGA 5BRRE 3RC6A 1SGRE 3TITA 1UTQA 2WPMS 2ZZUH 1SFIA 2PSXA 5SGAE 1A3BH 1UMAH 4B71A 1F7ZA 2FM2A 1CHGA 1YPHC 3ZZ7A 5FPYA 2OTVA 2P3FH 5FCKA 5FAHA 3SU0A 2WPIS 1NFXA 2FOMB 2XBWA 3C27B 1OOKB 2FOGA 4BAOB 1QQ4A 2XC0A 3PO1C 1THPB 4M7GA 1C2KA 2B0FA 7GCHG 1KXCA 2BM2A 5L2ZH 1XVOA 1HIAA 1CA8B 1UTMA 1UHBA 1ZMNA 5TCCA 1FXYA 2GCTC 3RC5A 1O3CA 3B23B 1CGIE 1YC0A 5T6GA 2FODA 1NM6A 1B0EA 1FN8A 1LHEH 1SQOA 1SC8U 2BD8A 1C5LH 2ZC9H 1LHDH 5EW2H 3EGKH 3ZVCA 1C2IA 2FOFA 2H5DA 3VGCB 3ZZ9A 2SGFE 1HPGA 3O8CA 3ZZAA 1NS3A 2W26A 1PPZA 2VWLA 2OXSA 3LDXH 4Y8XA 3BEFB 5EODA 4ZKOU 3VB7A 1SGYE 3ATLA 1C9TA 1P05A 3I78A 4NFEA 1O38A 3A8BA 3L33A 5ABWA 3RXAA 4I8JA 3GY4A 1FY8E 2IPHA 2VVVA 3AW1A 3BF6H 2TRMA 1HAPH 3B9FH 1VCPA 3NZIA 3RXSA 3WY8A 2OC1A 3VXEH 3E3TA 3OY5U 1IQMA 1ZRKA 3UOPA 1MD7A 1P3CA 4FUJA 4NSVA 1CQQA 2PTCE 4K8YA 2ZFPH 4Y8YA 4BTIB 1MD8A 4UD9H 1C1TA 1L0ZA 1O3MA 1QL7A 4JCNA 1EQ9A 2HNTF 2BLVA 1O35A 3S0NA 2F9VA 2GV7A 2WPHS 1D9IA 1GBMA 2IN2A 2CN0H 1KXBA 2J92A 1NFWA 2BXUH 4JK6A 4B2CA 1WAYB 4AB9A 4Q7YA 1CGHA 1AIXH 4KKDA 3UUZA 2VU8E 4D8NA 3RMMH 1MAXA 4ZUHA 2BOKA 2FDAA 3B8JA 3TLOA 1BTYA 1ID5H 1C1MA 2UUKB 5I25A 3BTQE 1AKSA 1C5VA 2B7DH 4IMQA 1K1NA 4JYTA 1C5WB 3RU4D 1ELDE 2ZTZA 5C5OA 2VIVA 2P16A 1DFPA 1GGDC 1TGBA 1O34A 5JBBS 2HPPH 2ZI2H 2OC0A 1OWEA 3RXVA 3VB4A 3O8RA 2EC9H 2Y6TA 4YT6H 5ESBA 3KQBA 1L2EA 1J9CH 1IQJA 2HALA 3STJA 4GLYA 2BDAA 3LKWA 1XUHA 4MPVA 3GY6A 4IC5A 4WY3A 3MI4A 1GI4A 1W3CA 2VJ1A 1W8BH 1TNJA 2Q6GA 4DOQA 1ELBA 3VEQB 5AVDA 3S7KB 3DUXH 4AGJA 2FXRA 1HAZB 1W0YH 2LNCA 2PR3A 4AYYB 5F8ZA 1VGCB 2GCHG 2SGEE 1GBAA 1P57B 2AGGX 1NZQH 4TYDA 1MTUA 1NRNH 3S69A 3P6ZB 4E7NA 4TPIZ 2GZ7A 1O31A 4NG9H 1EOLA 5GXPA 3H7OA 1BRBE 2ZU5A 1FV9A 2AMPA 1S5SA 3NPSA 3TJNA 1VCQA 1H1BA 1GPZA 1E34B 1WCZA 1TPSA 4GSOA 3L6PA 1G9IE 1ZPCA 1XX9A 5DP4A 3CP7A 1JRTA 1LCYA 4XFQA 4FUFA 4UFDH 3PMBB 3HKIB 4J2YB 1YPGH 2R3YA 2VIQA 1TALA 5IDKA 1TQ7B 4FUHA 1K9OE 4ABEA 1AFQC 4X6PA 1TPOA 2G52A 2VWOA 4NZQA 1TX7A 1V2RT 4ABFA 2GTBA 1TRMA 1AHTH 2JH6D 3O8DA 4CREA 1TOCB 3PTNA 3IG6B 1RS0A 2BVSH 2GMTC 2C8XB 4A92A 1MCTA 2HNTC 1ZSJA 1MKWH 3M37A 1O2JA 1LPKB 3RMOH 5T3HA 2ZGBH 1HJAC 3RXDA 4AOQA 2SGDE 3UQOA 4X8TH 1LVYA 2BOHB 2ZKSA 5H4IB 3P8OA 1PPGE 3MYWA 1BQYA 4DURA 3SNEA 1BBRH 1AB9B 1EAUA 3ZV9A 2ZDLA 3TJVA 1QURH 3LGWA 2GKVE 3M3TA 4I31A 2PKAB 2Y80A 4R0IA 1CE5A 1TGCA 2QXHA 4WF8A 4Y6DA 1AY6H 7GCHF 3FFGA 1GJDB 1O2GH 1P2IA 1ESTA 3U8TH 1QRWA 2F9NA 1BHXF 1Z71A 4H6SB 1ZPBA 1EZQA 2QC2A 4XDEA 5EG4A 1NROH 3D49H 2AS9A 4WMDA 1W7XH 1WTHD 3VB6A 4NCYA 5GPIB 2PGBB 1O3NA 3MMGA 3ZV8A 3ELAH 1JIMA 2SGAA 2R0LA 3ZVEA 3F1SB 1N1LA 1YPLH 3VGCC 2BLOA 1B5GH 1ZOMA 1DSUA 1WTGH 3RU4E 1O5CB 3S7HB 3LT3A 3UREA 2BY6X 1TNLA 1A0HB 2C4FH 3FVFB 1GBJA 4I8LA 1JBUH 3SOSA 1Y8TA 2ZHEH 1LHGH 1OWDA 2GX4A 1HFDA 4B74A 1GI7B 5F8TA 3AAVA 1DOJA 2WYGA 5EOKA 1KYNA 4CRCA 4A5TS 2NU3E 2TGAA 1GBKA 1BMLA 1SGQE 1QA0A 3ATIA 2Q6DA 3HK3B 3ZZ5A 2BQ6B 3U1IB 3DA9B 2TBSA 4WXVA 1SB1H 4LOYH 5HGGA 3RXEA 2TGDA 5EQSA 1PFXC 4DGJA 1EP6A 2ASUB 3HGPA 2OC8A 1IQNA 1QBNA 3DHKH 3UNQA 2VVUA 4B1TA 1C5OH 1GBDA 3PV4A 2P93A 5PTPA 1BTZA 2ZDMA 2ANKH 2BB4A 1P10A 5E0GA 2OQ5A 1YM0A 5EW1H 1NRQH 1QTFA 1C2GA 2D1JA 3QK1A 1GJCB 2O8MA 1BIOA 1FAKH 2Z9LA 1S83A 4K69A 1AZ8A 1ZLRA 2G4TA 4OS4A 4ZKNU 3BTME 4E05H 1HXFH 2PW8H 3KEEA 4PROA 1XM1A 1QBVH 1PPBH 3A86A 2BZAA 3KGPA 3LGIA 1GJ6A 3GOVB 1O2WA 3RXIA 1SMFE 1O2SA 2A2QH 1Q3XA 2ZTXA 1H9IE 1V2OT 4BNRA 1BRUP 1J16A 1KSNA 1OYTH 1GHZA 2J94A 1DS2E 1O5FH 1G3CA 3UWIA 4GHTA 5DK1A 1KY9A 1ETRH 1A5IA 2B9LA 3PM3A 1NY22 1C1PA 3PB1E 4D76A 4Y7AA 1ELAA 2J2UA 3NXPA 1MZDA 3ESTA 1O2RA 1BOQA 1KIGH 4K1EA 1C1RA 1DY9A 4DG4A 1C5UA 1VGCC 5C1XA 4SGAE 3Q76A 4AFSA 2RA0A 3BIVH 4YM9A 2VWNA 3TJUA 1H8IH 4IW4E 4R8TB 1LHFH 3ATWA 4AFUA 5FXLA 3UNSA 1G2MA 3RXJA 2VIPA 1KDQB 3S9BA 1W14U 4NIXA 3TNSA 4Y7BA 4X2XA 1P04A 2IOTA 1LQDB 2ALVA 1MKXH 3RDZA 1FQ3A 3PLPA 2VIDA 3LPRA 2CXVA 3BTTE 1S6FA 2FI4E 1C1SA 1P9UA 3TVJB 1SHHB 1S0QA 1TONA 1FI8A 3RXUA 1C5MD 2PKAA 4AN7A 4Z0KA 1GI3A 1ZZZA 3D62A 1UO6A 2BDBA 5JYIA 2AFQB 3SU1A 1LQEA 1C5PA 1O3EA 2KAIB 1C4Y2 2G51A 5DP6A 1KLIH 1C2MA 2FI3E 3VB5A 4OS7A 1EKBB 3EA7A 3RXKA 4HI3A 4X2WA 3SO3A 1NN6A 4CH8B 3V0XA 1AVGH 2OLGA 1PPCE 2J34A 4YT7H 1GHXH 4AYVB 1MUEB 3DFLA 2A2XH 2D2DA 4AORA 1C4V2 2BDGA 1O2IA 2ZCLP 3SNCA 1O2KA 1DM4B 1O3AA 1P01A 1KXEA 2XC5A 3HKJB 1O2YA 1SGEE 2O8TA 1HRTH 4UONA 1HNEE 5LH8A 1O3BA 3ENSB 4XBCA 1ELTA 2VIOA 1M9UA 1PQ8A 1DWEH 1SHYA 6ESTA 2YNAA 3UQVA 2Z7FE 2J38A 1O3FA 2ZECA 1LKAA 4K3JA 3N7OA 4UE7H 3F6UH 1BBRK 3Q3YA 2AEIH 1O2VA 4BAMB 1O2TA 3CENA 2FOCA 3GDVA 4WH6A 1A0JA 5GIBA 2Z6BD 4YLUA 2OQUA 5C2ZA 1MMJN 2BY9X 3R3GB 1EATA 3TIUA 2XWAA 1Z8GA 4THNH 3TGJE 1C5QA 8ESTE 3MOCA 1T7CA 3TNTA 1QJ6B 4Y11E 4BAQB 1CSOE 1ZTKA 3M5OA 3LGTA 5AFZH 2ZPSA 2A4RA 1EUFA 1AFQB 1O37A 2BVXH 3M7UA 2G4UA 1DANH 4X1NU 2BDHA 3BTHE 1ESBA 2ZGJA 1KLJH 4MPUA 2FOHA 4IC6A 1C1OA 4X1SU 2ZEBA 1GHAG 1T31A 1FAXA 5BPEA 1QFKH 5EXNA 2GMTB 4OGYA 4XBBA 1YPJH 1RFNA 2CV3A 9ESTA 2W5EA 1SLXB 2P95A 3SQEE 1HJAB 1MH0A 4F4OC 3A7ZA 3LGYA 1HCGA 2BVRH 1HAYB 2BXTH 1RTLA 5I46H 5FPSA 1ACBE 5F03A 2ZU3A 4OS6A 2XRCA 4TY7A 4X8VH 1TNIA 1P06A 5LPFA 1GI1A 2W7SA 1ZSKA 3ZYDA 3O8BA 3T5FH 1YF4A 1DLEA 1KLTA 1NC6A 3TK6A 1IAUA 2HNTE 1BTHH 1OWHA 4ABAA 5K7RA 2ZDVH 1BTUA 1NRSH 1SGTA 2NU4E 3RXOA 1DWBH 2Y7ZA 2RCEA 4GVUA 3OY6U 1T8OA 1PJPA 2A4OA 1TX8A 3TJOA 1AE8H 1GBHA 4WWYA 1G32B 1TNHA 1Q31A 2PV9B 4Q2KA 4D7FA 1V2VT 4NWKA 2A7HA 1T4UH 2AERH 1TX6A 1KDQA 3ZYEA 5J4SA 3A84A 4JZIA 5FBEA 1UTKA 1BJVA 4U01A 2J9NA 1HAOH 2BDYA 1GBLA 5TJXA 4ISHH 1TNGA 3U1JB 4IN1A 4WVPE 4DVAU 1Z1JA 3SV7A 3D65E 5B6OA 2BD7A 1G3EA 1AE5A 2AH4X 1AZZA 2TIOA 3QGNB 3ODDA 2BLWA 3PTBA 2KAIA 3MWIU 4OS5A 1XVMA 4CH2B 2WPJS 1HJ9A 1P09A 3BV9B 5DKMA 3KQDA 4F49A 3SV6A 1B7XB 3GY3A 3C1KA 3LC3A 2FZZA 4ABDA 1HAVA 3MH4A 2BMGB 5JDUB 4CHAC 1AGJA 3VPKA 1C1VH 3E90B 1MTWA 5T6FA 1SGFA 1GBEA 1UVSH 3SU5A 1C1QA 4UFGH 3V12A 4NFFA 2Z9KA 4ABJA 3E91A 1MU8B 1Y3YA 2ZDKA 2I6QA 1EAXA</