2FYRA

Crystal structure of norwalk virus protease grown in the presence of aebsf
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
181
structure length
171
Chain Sequence
APPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like cysteine proteinase
publication title X-ray crystallographic structure of the Norwalk virus protease at 1.5-A resolution.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 41
structure length 171
sequence length 181
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fyrA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fyrA01
2C3SA 1O2IA 1SG8B 1XKAC 4TY6A 1W11U 3MH7A 2CMYA 3I77A 2J9NA 1EAUA 1ZMLA 3TJUA 3TNTA 1T4UH 1D3PB 1GPZA 4CBNA 2TIOA 2UWLA 1GG6B 1C5PA 1GHBF 4U2WA 1BBRE 1WUNH 3CENA 4K1SA 4MLFB 2GCTB 1CSOE 3RDZA 1O3NA 2A5IA 3HKIB 1Y3VA 3SJKA 2PW8H 2UUKB 3F9EA 2VVVA 5C3NA 1DUEA 4NIVA 4KP0A 4ZXYH 1BMAA 3JZ2B 3P6ZB 4X8VH 4RSPA 4ABAA 2BD2A 2RA3A 1Y5AT 1O2HA 2J94A 1WYKA 3UNQA 1TNHA 2R2MB 1OX1A 4E05H 5JB8S 3G01A 1ELAA 3MO3A 1Q31A 1F0UA 1G2MA 2V3OH 4BAHB 1C2EA 4DJZB 1H9IE 3BEIB 1QCPA 1K1NA 1V2MT 3PMHB 4KTUA 2C8ZB 2VIDA 5IDKA 1CBWC 1GL0E 1XUJA 2FOFA 3LOXA 4K1TA 4WMFA 2A7JA 1O3MA 2G8TA 3A8DA 4INHA 1C1TA 1GHZA 1K9OE 3NUMA 1GBAA 1E38B 1IQIA 4K60A 1H8DH 1BCUH 1ELDE 1O0DH 2Z3CA 1C1WH 2BLWA 2GDDA 4BOHA 1O30A 2QF3A 1MZDA 2J2UA 1MKWK 4ABHA 1O36A 2TGAA 7GCHF 2Y6TA 5EODA 2IJOB 5EPNA 3R0FA 4XDEA 5JBAS 2BY5X 1HXEH 4OS4A 1OWDA 4D8NA 3TVJB 1EJAA 1VCPA 5BRRE 2PTNA 3T26A 3T2NA 1V2KT 1O38A 2FZZA 2FOCA 1C9TA 1V2PT 1YC0A 1QRWA 3PMJA 1O3GA 1PPBH 1KXAA 5E0GA 2ZKSA 5CE1A 4H4FA 3GOVB 5C5NA 2Z9GA 2Q1JA 4BAKB 2GV7A 1O2WA 1GDUA 1Q3XA 2G55A 1LKAA 3R3GB 1BMNH 4RKJB 2FX6A 2PSYA 5CMXH 5AF9H 1SGFA 4J2YB 4O97A 1EZSC 5GWZA 4ZAEA 3P8OA 3M61U 1C5NH 3BG8A 7LPRA 1EQ9A 1ANEA 2WPIS 3RU4T 1LO6A 2EI6A 3T29A 4K5ZA 2R0LA 3VGCB 1PQ5A 1ZSJA 1XVMA 3BG4C 2JH6D 4NA7A 4TPYA 1TFXA 3RMLH 1C2IA 4NG9H 1O3JA 1W0ZU 2ZGBH 2B9LA 1O5AB 4H42U 4AORA 1EPTA 1GJ4H 1QB9A 3M37A 2BLQA 1A5GH 1HAPH 1G3DA 3FP8E 3PM3A 1AFEH 2DE8A 5EXMA 1UTKA 2CXVA 4DY7B 1SGPE 4WXVA 1RFNA 1TBRH 4UFGH 5EQQA 1TMBH 3ZYDA 1Y5UT 4I33A 1SGEE 4K8YA 1GCDA 5A0BA 1HRTH 3ELAH 3BTWE 2A5KA 4CRCA 1P2OA 3E8LA 5F03A 1GHAG 1QHRB 5DG6A 1F0TA 1CE5A 1MTNC 4FUBA 3S69A 1INCA 2OXSA 1GDNA 3MU1A 4GLYA 3SV2H 5H4IB 4AYYB 1CHOG 3W94A 1GBTA 1Z8JB 4UD9H 3H5CB 2I6QA 3SW2B 1HJ8A 4ZROA 5FPYA 3SGBE 1HAYB 4F4OC 3GCHB 5C2ZA 1J17T 2A45B 1NROH 1YLDA 2WYGA 4WH8A 1A7SA 3NWUA 3I29A 5DP9A 1P3EA 1FPCH 1QY6A 1QBNA 4I8HA 1JBUH 2A4QA 1GJ9B 1EP5A 1AE5A 1MKWH 1PYTC 1TONA 1E0FD 2VJ1A 5GIBA 4KELA 2GZ7A 2XCFA 2SNWA 3UIRA 1F7ZA 1YPLH 3A87A 3QWCH 1FIWA 1MU6B 3PWCA 4AFUA 4CH8B 1AVWA 4FUEA 1C5UA 4E7NA 1TB6H 1TWXB 1OYQA 4X1PU 1C5TA 3VB6A 4INLA 4XBCA 1C2JA 1CGJE 4K69A 5HM9A 1P02A 2UUYA 1HXFH 1KLTA 3Q00A 4ABEA 1RTLA 3Q3YA 2PKAB 3M5OA 5EU8A 3RMNH 1H9HE 1UK4A 3BF6H 3SU4A 1KXEA 1PPEE 1UO6A 4K3JA 2BHGA 1GI2A 2XC5A 4Y71A 1S6FA 1LHCH 4WXIA 4LK4A 2J4IA 1O32A 3PYHA 1A3EH 1G32B 1O3OA 4WY3A 4LXBH 3QTVH 2J95A 1S83A 4I8LA 2XBXA 4WJG2 3P92A 2ZDNA 3SNEA 1TGBA 2FI3E 1IQJA 1SQOA 1C5ZB 1Z8GA 4YM9A 1C4Y2 5GDSH 4M7GA 1DX5M 1YYY1 4SGAE 1W7XH 3URCA 1YPGH 1FAXA 1OKXA 3MWIU 3TK5A 2WPKS 2H5DA 3SJ8A 5JPMH 1PJPA 3A7ZA 4ZKSU 5DKMA 1S84A 4NIYA 1UTOA 2ZFTA 2ZNKH 1NO9H 1NPMA 4Y7AA 3LJOA 4WMDA 1OXGA 1ELFA 3SU1A 4B76A 5EOKA 2W3KA 2B7DH 1O2LA 1HAVB 3ZZ3A 5EW2H 4JZDH 5F8TA 4WVPE 5PTPA 4MPXA 3ZVCA 3O8RA 4Q7XA 4CRFA 3LC3A 1QQ4A 5LH8A 1GMHG 3F1SB 1TAWA 2EI8A 1ESBA 2FTMA 1VGCB 2BB4A 1L0ZA 1BT7A 5ESBA 1QQUA 4B73A 3E0PB 1C2GA 1RGQA 1T4VH 2LNCA 2Q6DA 1GI6A 4AG1A 2R3YA 4DURA 1G37A 1GI5A 1P2KA 2PTCE 1L4ZA 1THRH 3BV9B 4FUDA 2ZFRH 3GCTF 1EOLA 2O8TA 1MTWA 4X6PA 4RKOB 1W3CA 4X8SH 1IHSH 4JZFH 4X1NU 3QDZB 1RTKA 4UONA 1UVPA 4HI3A 3RXQA 2FYRA 2ZU5A 1GG6C 1QNJA 1CT4E 1FN8A 3SQEE 4TWYA 2ZWLH 3PTNA 2VIOA 2BZAA 1MBQA 2QXHA 2W5EA 2SGEE 3RU4E 4UDWH 4D76A 2GCTC 9LPRA 1LVOA 2H1UA 4X2WA 1NS3A 1AQ7A 3M7UA 3ZZ5A 2FM2A 2ZQ2A 1GL1A 1O3FA 1J16A 1AB9B 4MVNA 4F49A 3SNCA 1EASA 1TGNA 1BUIA 1P2QA 1P04A 2OC0A 1O33A 5HMAA 3SUEA 1BA8B 1ZLRA 4ABIA 2R3UA 2BY6X 3MU8A 3MU5A 3QUMP 5A0CA 1MD8A 1AI8H 1GJ5H 2RA0A 1ZPBA 4Z0KA 1T8LA 1PPGE 1BTUA 3PLBA 1UHBA 3NPSA 2H9TH 4NFEA 3RC6A 1ZTLA 4X0WU 1CT2E 4Y10E 4NA9H 5L30H 1DWEH 3SNAA 4A5TS 2G52A 1F0SA 3GCNA 3A7VA 3MH4A 1PPCE 1Y5BT 1CHOF 1YLCA 3TITA 4YT7H 2GT7A 3TK6A 1FMGA 3RMMH 4UFEH 4JZEH 1OOKB 3LH3A 1FY3A 3OTJE 4ASHA 2WV4A 2BQ7B 1GJBB 3LH1A 1SFQB 3P95A 2DUCA 5FBEA 1HIAB 9ESTA 4FU7A 1Z71A 1MKXK 1FDPA 3IG6B 3KF2A 5G4BA 3V0XA 3A7XA 3LGIA 3RXDA 5DO4H 4ABDA 4FVDA 1TOCB 5DP4A 1WCZA 1IHTH 1V2OT 1GWAA 2P8OB 1VR1H 4IS5A 1DLEA 1BRCE 2FOBA 2B0FA 1MUEB 1ARBA 2ASUB 1MU8B 4FVBA 4B2BA 1QFKH 1UTJA 4YOJA 1P05A 2PWXA 1DDJA 1FUJA 2VNTA 4THNH 2FOHA 1O2QA 3TGKE 3GCOA 2Y5FA 4FUJA 3PLPA 5DJ7A 3NXPA 4X1SU 1BMLA 1S82A 3RXFA 1W14U 1UTNA 1EB1H 1GBFA 3UPEA 1LHGH 1UK2A 5FXLA 1ETRH 1O5DH 1X7AC 3SN8A 1WQVH 3BTGE 1AWFH 4X6NA 8KME2 2ANMH 1NRSH 4FUIA 4ISLA 2JKHA 3BIUH 2ZC9H 1T31A 4Y11E 1NRNH 3VGCC 1C4V2 1QB1A 1TNGA 4CRGA 2ZFSA 5JB9S 1HDTH 4GCHG 2XCNA 3ZVDA 1FI8A 6ESTA 2VVCA 4MPUA 3TK9A 3PMAB 3S7KB 1K1PA 5C5OA 3LGWA 2FS9A 2HALA 1NFXA 3SGAE 2XRCA 1MZAA 3RM0H 2OUAA 1S85A 2AGIX 2VH0A 5FX5A 3Q3XA 2BDAA 2I6SA 1LVMA 1ZRKA 1PQ8A 3KN2A 2BXTH 1CVWH 1AVXA 1BDAA 1D6RA 1XUGA 1Z8IB 5FCRA 5C1YA 2P59A 2GMTB 5T3HA 4JZ1A 1O5FH 3MH6A 2Z9JA 1TIOA 1XXFA 3UOPA 3ZZDA 1NM6A 1FIZA 1N8OB 1V2QT 4NWKA 1ESAA 1ELGA 3SORA 1KLIH 1GMHF 1GHVH 1TBQH 1NRQH 1LPZB 2A7CA 1AMHA 6LPRA 2WPHS 1EAIA 1DVAH 1HYLA 5B6OA 3GCHC 1GBDA 3L33A 2XW9A 4OS5A 3AASA 1TRYA 1HAHH 1ELTA 3VB3A 8LPRA 3EQ0H 1GJCB 2SGDE 3GICB 1IQNA 2HGTH 1QB6A 2STAE 1B0FA 4Y7BA 1SQAA 2P3UB 2BDBA 3A7YA 3UNRA 5DPAA 2ZPRA 4AFZA 4AB9A 2GVFA 3BTQE 2LPRA 2ZEBA 3HGPA 1JWTA 1MKXH 1QBVH 2QA9E 3BTTE 1ZGIA 3MMGA 1C4U2 1C9PA 3STJA 3MFJA 3SUFA 4CR9A 1NC6A 4FU8A 1SLWB 1KTSB 1CA0B 1QRZA 1ZR0A 2A4GA 1OP2A 3SI3H 2C4FH 4JYTA 1TA6A 1KYNA 1O39A 1HJ9A 3SV6A 1C5XB 1DM4B 1RIWB 1V2UT 3ITIA 1HAOH 3N7OA 1RRKA 5EQRA 2O8UA 1C1QA 1UCYE 3RXLA 3UQVA 1Z7KA 2ODYB 1FXYA 1SLXB 1MTVA 2AEIH 1HPGA 1O2RA 3TU7H 3UFAA 1UTPA 2BTCE 2THFB 1C5QA 1AHTH 5EPYA 7ESTE 3MYWA 4YOGA 5EGMA 4OGXA 2PHBA 2UUFB 2ZHDA 1UVTH 1AY6H 2ZO3H 2F9UA 1PQ7A 3IITA 5J4QA 3P8FA 3AVZA 2ZTYA 2OCVB 3RXIA 1BITA 2ZF0H 2QN5T 1P03A 3RUOA 2VVUA 1O3EA 3QGJA 5DP5A 1P11E 2GD4B 1CA8B 1TNJA 4AN7A 5I25A 1H9LB 3SV8A 3RXOA 1AWHB 2GV6A 1SGYE 2FWWA 1ANBA 2GGVB 3DD2H 1O2ZA 3GYMA 3RXHA 4NSYA 1KDQA 1GDQA 2VWNA 1ZHPA 1ZZZA 2Y82A 3KGPA 1TGTA 3RXPA 2D2DA 3HK3B 2A4OA 3GDSA 5E0JA 1TLDA 4KGAA 2SGPE 4NIXA 3ZZCA 1VGCC 3T27A 1DWDH 4X8TH 1TE0A 1O3LA 4ZKNU 3CS0A 1PPFE 2ZGHA 4A1XA 1TX7A 3UUZA 1YPKH 3LKWA 2Y7ZA 1E35B 1CT0E 1LHDH 4O03A 2F9VA 1NU9A 4YLUA 5L2ZH 2C8WB 2FO9A 2C93B 2QIQA 1KY9A 1J14A 2PKAA 2A0QB 2O8LA 1HBTH 2ZCHP 2TGTA 5GJ4B 4GCHF 1ZYOA 4XBDA 1ELCA 3EA8A 3IWMA 2YNAA 1MBMA 3E0NB 2WUBA 1HV7A 1PYTD 2BXUH 1GBKA 1TPPA 3RXJA 1LTOA 3GCTG 3HATH 2GT8A 1AB9C 1DOJA 4U32A 1AZZA 2PKSB 1FN6A 3U1JB 3LU9B 2QF0A 4DG4A 2WPLS 1CU1A 4ESTE 1HAIH 3C1KA 2ZGJA 4Y8YA 3T5FH 1LHFH 3HKJB 1F5RA 3T25A 1D3TB 2G5VA 1GBIA 1A0JA 5FCKA 2OTVA 5EG4A 4ABBA 2V6NA 5L6NH 4ZXXH 1S81A 3E16B 2SNVA 4ZKOU 3LT3A 6GCHF 2PLXA 2H2ZA 1MAYA 1XUFA 1UTMA 3QGNB 1HAVA 4OS2A 1ZMNA 5EQSA 2VIQA 3E1XB 1C5YB 4TY7A 4IBLH 4X2YA 4X6MA 2P3TB 3ZYEA 3Q3KA 4DT7B 3HGNA 1O3HA 3MTYA 2KAIA 2VB0A 1U6QA 3FAOA 1KXCA 3S9AA 2O9QA 1TNIA 1ZTJA 2ILNA 4YTAA 2C8XB 2ZPQA 4GHTA 5HXFA 1GGDB 2P8OC 2GP9B 1ZPZA 3TIUA 1EXFA 5A0AE 2SFAA 1QGFA 2FEQH 3SI4H 2R9PA 1ETTH 4A1TA 1E37B 2GZ8A 2ZDKA 4LOYH 5EXLA 1O5EH 1ZMJA 3H7OA 1AZ8A 3E6PH 4WMEA 2BVRH 7KMEH 3A7WA 1C5VA 3OSYA 3GY5A 3ZZ6A 3FP7E 4ABGA 1PPZA 8ESTE 2QYIA 4U30A 2PR3A 1TGCA 4MNVA 1HLTH 5AHGH 2CJIA 2WUCA 1O2SA 2QC2A 1DANH 1TPOA 4MPVA 4RN6A 3A8AA 4INKA 3SNBA 3QX5H 1NFWA 3MNCA 3PO1B 1W8BH 1QBOA 3BTEE 3TJNA 1MMJN 1DT2A 2AGEX 1TA2A 3A86A 4O9VA 1IQEA 1SGCA 4JK6A 1GBJA 3A89A 3NCLA 3ZVGA 3ODDA 1KXDA 3BSQA 5HM2A 1O5BB 3K6ZA 1BBRK 4D7GA 1GVZA 4KTCA 1UCYK 2YNBA 2FLRH 6CHAB 4Q80A 3PMBB 1Y3UA 4ISHH 3NK8A 1MCTA 2V0BA 3ZZ7A 1TPSA 2FOEA 2VIWA 3KNXA 2FOAA 5ABWA 1QJ6B 1SHYA 1GCTB 1GI7B 4FUHA 3RC4A 3TH2H 2GMTC 3AAUA 2WV5A 3SGQE 1AKSA 1RS0A 3ZVFA 3HPTB 3OY5U 1O3CA 2SGQE 1SI5H 3RXBA 1N8OC 1UTQA 4JZIA 5J4SA 1S0QA 3GDUA 3STIA 1BMMH 2VWOA 3FZZA 4Y8ZA 4AG2A 3L6PA 4VGCB 1KLJH 3RU4D 3QZRA 1P12E 1ELEE 2BMGB 1ABIH 4A6LA 1EX3A 1WQSA 3OYPA 1Y3XA 3ODFA 3FZDA 3SBKA 4GPGA 4KTSA 1KXFA 1ANDA 3SU3A 2ZHEH 4GAWA 4K8BA 3RXMA 1EJNA 2IPHA 2ZU4A 3LPRA 1GBMA 1OWEA 2VWMA 1EPTB 1LVYA 1FZZA 3A80A 1QJ1B 2D1JA 4ISNA 1C2DA 2AIQA 2H5CA 5FX6A 5JDUB 2K1QA 1FJSA 3M36A 1ELVA 1OWJA 1YPEH 4D9QA 1K2I1 1K1JA 2FIRH 3LGTA 2CV3A 3QZQA 1CO7E 4CHAB 4NCYA 1L4DA 2R2WU 3M7TA 1HAXB 3P70B 4HFPB 1SGRE 1YPHE 1CA0C 2GTBA 2PGQB 3MOCA 3F6UH 5E2PA 2Z6BD 2O8WA 1RIWC 2NU2E 1J8AA 3MH5A 1MQ5A 1XMNB 3M5NA 1SGFG 3GDVA 4HZHA 1TMUH 1O3AA 3UTUH 1W12U 2BD4A 3NKKA 1O2JA 1GMCF 1SFIA 1TQ7B 1TX6A 2STBE 4Y76A 1OPHB 5A2MH 1V2WT 1M9UA 1O5GH 4BXSA 2OQ5A 2BY8X 4AX9H 1Z6EA 3D23A 3SOSA 1VITH 2BQ6B 2Y5HA 5E8EH 2ZCLP 2AERH 3F9HA 1UMAH 3AW0A 1IQFA 1YPHC 5A8ZA 1HJAB 1Z1IA 3TH4H 1V2VT 4DIIH 3KCGH 1JIRA 1BB0B 3NZIA 1JRSA 2V3HH 2Y5GA 3ZZ4A 2W7SA 2CGAA 4JCNA 1MTSA 3SJIA 1ZOMA 1TRMA 4JYVH 3I78A 1BBRH 1O5CB 1VZQH 1P2NA 4X8UH 1UCYH 2BLVA 2A5AA 5JBBS 1SHHB 2NWNA 1SGDE 3VXFH 1TBZH 4XBBA 2A31A 3FP6E 3SU5A 5CHAC 1K1OA 3TH3H 2BOKA 1G9IE 4BTIB 2BYAX 2G81E 1HFDA 1EP6A 1P3CA 5K0HA 3OX7U 1PPHE 1DSTA 2AYWA 1YCPM 2A1DB 1KSNA 5EXNA 4ZUHA 1OS8A 2F9OA 1WSSH 3ZZ8A 1IQHA 3RXAA 1OWKA 2UWPA 3SJOA 1GI1A 3WY8A 5EW1H 3KIDU 1HNEE 1SGIB 2OC7A 2NU3E 1W10U 2BDGA 2WPMS 4NWLA 1ZGVA 1BTZA 1ABJH 1A0HB 4YOIA 4AGKA 2XTTB 1QL8A 4B75A 2Y7XA 3S7HB 1SLVB 3ATLA 3PLKA 1Y59T 1BHXB 3GY4A 3QO6A 2XBYA 1ZSKA 5TCCA 2ZDLA 3D62A 3DUXH 1C2HA 3M5LA 2AMPA 1O34A 2ZI2H 4BAOB 1LQEA 2ZHWH 1SLUB 1NRPH 1G2LA 1GI0A 1DFPA 2FDAA 1V2ST 2PKSC 2XNIA 3V7TA 1DUAA 2W26A 3DT0H 3MU4A 2F83A 3EE0B 4CRBA 1FY5A 2ANKH 2YOLA 1QA0A 1UVOA 5E2OA 2EC9H 3RC5A 2QV1A 2D26C 1BIOA 1IQLA 5GCHG 1SR5C 2HWLB 1P2MA 5DK1A 2HPQH 3MO9A 2JH5D 1H8IH 4I8GA 1C5WB 4IGDA 1HUTH 1O2KA 2XWBI 4ZHLU 1TNKA 4K1EA 2PUXB 1DS2E 1EJMA 2G4UA 1P9UA 3LC5A 4SGBE 1QL9A 4MPWA 3T28A 1G3EA 4GSOA 2ESTE 3K65B 4X1RU 1F2SE 2B5TB 1LCYA 2ZDAH 1YF4A 4NSVA 1CGIE 2JETB 2ZDMA 2A2XH 5DP3A 4QT8C 1QJ7B 1A4WH 4FXGH 2FP7B 2F9PA 1PFXC 2BDYA 4E7RG 1DXWA 3UOUA 3U8TH 6GCHG 4NA8A 3MNBA 4X2XA 3RXTA 3K6YA 1UVSH 3BIVH 3RXKA 5F6MA 1BRUP 1C1NA 2P16A 3PV4A 1SB1H 5C67A 4TWWA 1GGDC 2PGBB 5JYIA 4LZ1H 1FNIA 4I8KA 2CF8H 2J92A 2VU8E 3M7QA 1O2YA 3UR9A 3VB5A 3ZVEA 4AOQA 2UUJB 5ETXA 3RMOH 1MAXA 1UVUH 2EI7A 1V2JT 1ZJKA 1UTLM 2Q6GA 1G36A 2BD5A 4ISIH 3QN7A 4ZKRU 3DA9B 1MTUA 4NIWA 4GUXA 1UHBB 1E36B 2ODQA 3V13A 5HGGA 1C2FA 1KTTB 1XUHA 1AUTC 1O3DA 4B2CA 4WF8A 1VITF 1SSXA 4MDSA 1F0RA 1AU8A 2PFEA 4D7FA 1ANCA 5LPFA 1YKTA 5JBCS 2IN2A 1ETSH 1FY4A 1SPJA 1O2OA 2GKVE 1BRAA 3AW1A 3ZVBA 1XM1A 4FU9A 4YESB 2PSXA 5T6DA 3PO1C 4XE4A 3A7TA 5LPEA 3W95A 3BN9A 2OC8A 3Q76A 4DGJA 2RCEA 3PROA 4BAQB 2FOGA 5GXPA 4A1VA 4AFSA 2QXGA 2OP9A 4J1YA 1TQ0B 1E34B 4AYVB 3EYDA 1DSUA 6CHAC 1JOUB 1J15A 4ABJA 4H6SB 1TMTH 2P94A 2TBSA 2SGFE 1AN1E 3S0NA 2XC4A 3ATWA 2Y81A 1IQMA 3E91A 4UFFH 4B1TA 1GCTC 4NZQA 1SGQE 2OINA 5BPEA 1T7CA 1Y3WA 3H7TA 4A7IB 1RD3B 1O2XA 1ZPCA 3SQHE 1YPJH 4UFDH 2VGCB 1C1UH 4BAMB 3LGYA 4Z6AH 1GJ7B 4IMQA 2ZU2A 8GCHG 1ZHMA 3SU2A 4Q2KA 4VGCC 1C1OA 3SUGA 3EAJA 4IN2A 4Y6DA 2ZP0H 2VWLA 1TALA 1MQ6A 3OY6U 1NRRH 1G3CA 2FLBH 5FAHA 1K21H 4BTTB 1ESTA 1V2TT 1F92A 3V12A 1A0LA 2BX4A 5CHAB 1EPTC 1YBWA 1SGTA 1AD8H 3F9FA 4CREA 1T8MA 1ZSLA 1V2RT 2G4TA 4DVAU 4H6TA 1F5LA 2ZG0H 5ESTE 1SQTA 1XXDA 2OBQA 4LZ4B 4YO9A 4CHAC 1EATA 2NU1E 1NFYA 2GCHF 4DW2U 2AS9A 1HCGA 2BQWB 3C27B 1OYTH 2PUQH 2ZGXH 1C2LA 1QRXA 1Q2WA 4GHQA 4HTCH 3TLOA 2HNTF 2SGAA 3KEEA 1YPMH 5F8XA 2HLCA 1IQKA 1G30B 1W7GH 2RDLA 4I7YH 2D8WA 1G3BA 1IAUA 1EKBB 1L1NA 1O2GH 1XUIA 1SMFE 2FYQA 3S9BA 1QA7A 1TNLA 1FQ3A 2CN0H 2C90B 1FY1A 5GCHF 3ZZAA 1EAWA 4DIHH 1ZJDA 1LHEH 1N1LA 2ZQ1A 5DP6A 1DXPA 4MQAA 3SUDA 2BM2A 1GI8B 2AGGX 1JRTA 1EOJA 2HNTE 3BTHE 1GJDB 3U8RH 1GBHA 2XC0A 2A7HA 1H1BA 2VH6A 5C1XA 2A4RA 3SV9A 1NTPA 1UK3A 2H9EH 3L3TA 1HJAC 3KQCA 2CHAB 4WH6A 1AIXH 1GMCG 2OBOA 1BHXF 3VB4A 4JK5A 1L1GA 1A3BH 4YZUA 1GI4A 2J34A 1F5KU 1IOEA 1TABE 2ZECA 2GX4A 2Z9LA 2ZU1A 3U69H 1FLEE 2W7UA 3T62A 3B23B 2ZIQH 3VB7A 1N6XA 2ZTXA 4TPIZ 1XUKA 2BD3A 5E0HA 3TGJE 2HNTC 3GY6A 1P06A 1LKBA 3VEQB 1A1RA 3VFEA 2WINI 5JBTA 3ATIA 4O3TA 1BRBE 3M3SA 4YLQH 3UWJH 3QLPH 3ATMA 3KL6A 1KIGH 1EAXA 1A61H 1GVLA 2QAAA 5IYTA 1D3DB 3TPIZ 3UQOA 3A83A 2O8MA 3O8CA 3SU0A 1GI9B 4ABFA 1P10A 1GBLA 2ZHFH 1GHWH 3DFJA 1AFQB 3B9FH 4FUGA 2W3IA 5FPSA 1HGTH 3A85A 3AAVA 1C5RA 4I32A 1CHGA 1C5LH 1OP8A 3V3MA 3K2UA 1A46H 2Z3EA 3BTME 2BVSH 3GYLB 2F9BH 3SZNA 1NT1A 3U9AH 1BQYA 2Z9KA 2Z9IA 1NESE 1O2NA 1S5SA 4TYDA 2B8OH 1GMDG 1THSH 3ZV9A 1KDQB 1O3KA 1SOTA 2J38A 1RTFB 1P0SH 1OWHA 1GJ6A 2NU4E 1EZQA 1RXPA 2G51A 3LJJA 4XFQA 1O31A 1TRNA 1C1RA 5FHTA 1K1MA 1O3BA 1Y8TA 1NZQH 4FUFA 1FV9A 1A5HA 3RLWH 1ORFA 2FI4E 3GY7A 1OP0A 1P8VC 5FPTA 1K28D 1C1VH 5A8YA 1C5SA 8GCHF 4AZ2B 3SHAH 4DCDA 3GISB 2BZ6H 1SOZA 1TPAE 1VJ9U 2WYJA 2TGPZ 1YP9A 2EEKA 3RLYH 1FPHH 1HIAA 2H6MA 4X1QU 2AFQB 2HRVA 1C5OH 4R0IA 3ESTA 3M3VA 2JETC 4FUCA 3SO3A 1FONA 5T6GA 4E06H 2QGRA 2GZ9A 3UREA 3ZZ9A 4CRAA 2Z7FE 3DHKH 4O3UA 5TCAA 4WWYA 2BLOA 1BJVA 3A8CA 4BANB 2QY0B 2QXJA 1OWIA 3GY8A 2ZPSA 4NFFA 4OGYA 1HB0B 2ULLA 4ZHAA 4Y0ZE 4YT6H 3UY9A 1NY22 1V2LT 3BTDE 1DICA 4CH2B 4B74A 1JIMA 1O3IA 1QL7A 3VPKA 1DY8A 1VCQA 1T8NA 1BTHH 4HGCA 3RXVA 3TJOA 1FAKH 2ZFPH 3K9XB 2ZU3A 3P8GA 2HPPH 3U8OH 4IN1A 1CBWB 1DPOA 1GHYH 1J9CH 5F8ZA 1GBCA 2OQUA 1LPKB 2A2QH 5AVDA 1AGJA 2AMQA 3O8BA 3JZ1B 2XYAA 3TNSA 2V35A 4CR5A 1W0YH 1ID5H 3A84A 3MNSA 1AE8H 2R0KA 1B0EA 2BDHA 2ZDVH 3MO6A 3RXSA 1P2JA 3RXRA 2KAIB 3RXGA 1P57B 1D9IA 1C2KA 2XXLA 2HVXA 1BOQA 1FY8E 3KHVA 4CRDA 1LDTT 1VCWA 3URDA 3PB1E 3QTOH 1QR3E 2NU0E 3RXEA 1VITG 1L1JA 1ZRBA 3A8BA 3VXEH 1YCPK 1TGSZ 2A32A 3DFLA 4BTUB 3MI4A 3GY2A 2VIPA 4X6OA 3ZZBA 1C2MA 2BX3A 1Y3YA 2QCYA 1VJAU 4U01A 2OD3B 2FXRA 3RP2A 5C1UA 1D4PB 2ANWA 3FFGA 4AFQA 2IOTA 2FX4A 4MNXA 4MTBA 4ZMAH 5I46H 4D9RA 2ANYA 2QXIA 2VGCC 1BJUA 1DLKB 1WOFA 3BEUA 5HYOA 3GY3A 1NN6A 4MNYA 5A8XA 5TJXA 2AIPA 3HK6B 3M5MA 2EA3A 1EB2A 1QURH 3U1IB 4BNRA 4AB8A 1L2EA 1NU7B 1O2VA 2XWAA 1HAZB 1CGHA 2TRMA 3A82A 1O35A 1T32A 3BG4B 2WPJS 1A2CH 1GHBG 2P95A 4XSKU 2CF9H 1N6YA 2FODA 1ELBA 2H9HA 1GBEA 3QK1A 4K2YA 3MU0A 4I8JA 3SHCH 2DE9A 2M5TA 3UWIA 2FS8A 1P01A 3E3TA 3MNXA 3P8NA 1GHAF 1EUFA 4NGAH 1SL3A 2BOHB 3D65E 3TGIE 1A5IA 4UE7H 1DE7H 1P2IA 3TJVA 1C5MD 3KQBA 2TGDA 1GHXH 4OS7A 1GJ8B 3BTFE 4ZH8A 4A92A 1TYNA 1LQDB 1O2TA 3RM2H 2P3FH 1PQAA 2C8YB 3OU0A 1AKSB 1BTXA 1GMDF 1C1MA 1S6HA 4R8TB 3ENSB 2VINA 4UEHH 2ZZUH 1Z1JA 5A09A 2BD7A 1MH0A 2FPZA 1MTNB 1TOMH 2F9NA 3LIWA 1ZTKA 1ACBE 1SBWA 4IC6A 4ISOA 2GCHG 3F68H 3A88A 3LDXH 3PTBA 1S0RA 4KKDA 5DP7A 4BXWA 1H4WA 1LPGB 2OC1A 7GCHG 3PWBA 3ZV8A 1UJ1A 1GI3A 1B7XB 1XKBC 2Y80A 1Z8RA 1YGCH 1CQQA 1BZXE 5FBIA 1EZXC 1JXPA 1THPB 3UNSA 2BDCA 1QIXB 2Z3DA 3SNDA 1ZHRA 2ALVA 5DGJA 3ATKA 4IMZA 2CHAC 2ZHQH 1SC8U 4PROA 3KQDA 1MD7A 4Q7YA 1KXBA 2BY9X 5GPIB 4XOJA 1DWBH 4DOQA 3ZVAA 1OSSA 3SU6A 3E90B 2Z94A 3KQEA 4GVUA 1K1LA 4IW4E 2FMJA 4AGJA 1AO5A 2BDIA 2JH0D 4MNWA 2AH4X 1P9SA 1GVKB 1EZUC 3U98H 1V2NT 1W2KH 3EA9A 2F91A 4Y8XA 1YCPH 3FANA 2ZCKP 1XVOA 1C1SA 1V3XA 2TPIZ 1TX8A 1O2MA 4OS6A 5L2YH 4JMYA 2UWOA 1BTWA 3S9CA 1P09A 2GDEH 5SGAE 1K1IA 2ZFFH 3LONA 1Z6JH 2ZTZA 2FOMB 2FTLE 1DWCH 2ZA5A 5AFZH 3RXCA 2BD8A 2G5NA 3F9GA 2Q6FA 3Q77A 3SV7A 5AFYH 1K22H 2ALPA 2FI5E 4JYUH 3BTKE 1WAYB 3LGUA 2BVXH 1GJAB 2AMDA 3UR6A 3SJ9A 4X2VA 5C20A 1B5GH 2ODPA 1NFUA 2XBWA 1IQGA 4I31A 2BD9A 1AFQC 3A81A 1T8OA 5T6FA 2FESH 1WV7H 5DP8A 1GBBA 1WU1A 2G00A 1BTPA 3O8DA 1HAGE 4Y79A 1DY9A 1W13U 1ARCA 1O3PB 1WTHD 3EA7A 3LGVA 2VIVA 2F3CE 5K7RA 3RXUA 1RJXB 4Y0YE 3EGKH 4OS1A 1AVGH 3EDXB 1MCVA 1SVPA 2OLGA 3BEFB 2ZGCA 1WTGH 3MHWU 1V6DA 3D49H 1D3QB 5LPRA 4Q7ZA 1JMOH 2XBVA 4ZHMU 4CBOA 1O2UA 1YM0A 1AUJA 1QTFA 1SGNE 1LMWB 2RG3A 3CS7A 4MG3A 2PV9B 2HOBA 3CP7A 1LVBA 1O37A 3M3TA 3B8JA 2ZFQH 4IC5A 3M35A 4B2AA 1XX9A 2P93A 3FVFB 4B71A 2BY7X 3P17H 1BTYA 1WBGB 1D6WA 5LGOA 1C1PA 4NZLA 1DITH 1O2PA
chains in the Genus database with same CATH superfamily
2C3SA 1O2IA 1SG8B 1XKAC 4TY6A 1W11U 3MH7A 2CMYA 3I77A 2J9NA 1EAUA 1ZMLA 3TJUA 3TNTA 1SQRA 1T4UH 1D3PB 1GPZA 4CBNA 2TIOA 2UWLA 1GG6B 1C5PA 1GHBF 4U2WA 1BBRE 1WUNH 3CENA 4K1SA 4MLFB 2GCTB 1CSOE 3RDZA 1O3NA 2A5IA 3HKIB 1Y3VA 3SJKA 2PW8H 2UUKB 3F9EA 2VVVA 5C3NA 1DUEA 4NIVA 4KP0A 4ZXYH 1BMAA 3JZ2B 3P6ZB 4X8VH 4RSPA 4ABAA 2BD2A 2RA3A 1Y5AT 2QE7D 1O2HA 2J94A 1WYKA 2WV9A 3UNQA 1TNHA 2WPDD 2R2MB 1OX1A 4E05H 5JB8S 3G01A 1ELAA 3MO3A 1Q31A 1F0UA 1G2MA 2V3OH 4BAHB 1C2EA 4DJZB 2W6ID 1H9IE 3BEIB 1QCPA 1K1NA 1V2MT 3PMHB 4KTUA 2C8ZB 2VIDA 3EE7A 5IDKA 1CBWC 2IJD1 1GL0E 1XUJA 2FOFA 3LOXA 4K1TA 4WMFA 2A7JA 1O3MA 2L74A 2G8TA 3A8DA 4INHA 1C1TA 1GHZA 1K9OE 3NUMA 1GBAA 1E38B 1IQIA 4K60A 1H8DH 1BCUH 1ELDE 1O0DH 2Z3CA 1C1WH 2BLWA 2GDDA 4BOHA 1O30A 2KM0A 2QF3A 1MZDA 2J2UA 1MKWK 4ABHA 1O36A 2TGAA 7GCHF 2Y6TA 5EODA 2IJOB 5EPNA 3R0FA 4XDEA 5JBAS 2BY5X 1HXEH 4OS4A 1OWDA 4D8NA 2KX4A 3TVJB 1EJAA 1VCPA 4B6EA 2PTNA 5BRRE 3T26A 3T2NA 1V2KT 1O38A 2FZZA 2FOCA 1C9TA 3F0PA 1V2PT 1YC0A 1QRWA 3PMJA 1O3GA 1PPBH 2V7QD 1KXAA 5E0GA 2ZKSA 5CE1A 4H4FA 3GOVB 5C5NA 2Z9GA 2Q1JA 4BAKB 2GV7A 1O2WA 1GDUA 1Q3XA 2G55A 1LKAA 3R3GB 1BMNH 4RKJB 2FX6A 2PSYA 5CMXH 5AF9H 1SGFA 4J2YB 4O97A 3U28C 1EZSC 5GWZA 4ZAEA 3P8OA 3M61U 1C5NH 3BG8A 7LPRA 1EQ9A 1ANEA 2WPIS 3RU4T 1LO6A 2EI6A 3T29A 4K5ZA 2R0LA 3VGCB 1PQ5A 1ZSJA 1XVMA 3BG4C 2JH6D 4NA7A 4TPYA 1TFXA 3RMLH 1C2IA 4NG9H 1O3JA 1W0ZU 2ZGBH 2B9LA 2YMSB 1O5AB 4H42U 4AORA 1EPTA 1GJ4H 1QB9A 3M37A 2BLQA 1A5GH 1HAPH 1G3DA 3FP8E 3PM3A 1K0HA 1AFEH 2DE8A 5EXMA 1UTKA 2CXVA 4DY7B 3OFND 3NRLA 1SGPE 4WXVA 1RFNA 1TBRH 4UFGH 5EQQA 1TMBH 5HKKD 4F48B 3ZYDA 1Y5UT 4I33A 1SGEE 4K8YA 1GCDA 5A0BA 1HRTH 3ELAH 3BTWE 2A5KA 4CRCA 1P2OA 3E8LA 5F03A 1GHAG 1QHRB 5DG6A 1F0TA 1CE5A 1MTNC 4FUBA 3S69A 1INCA 2OXSA 1GDNA 3MU1A 4GLYA 3SV2H 5H4IB 4AYYB 1CHOG 3W94A 1GBTA 1Z8JB 4UD9H 3H5CB 2I6QA 3SW2B 5DN6D 1HJ8A 4ZROA 5FPYA 3SGBE 1HAYB 4F4OC 3GCHB 5C2ZA 1J17T 2A45B 1NROH 1YLDA 2WYGA 4WH8A 1A7SA 2M2AA 3NWUA 3I29A 5DP9A 1P3EA 5T1VA 1FPCH 1QY6A 1QBNA 4I8HA 1JBUH 2A4QA 1GJ9B 1EP5A 1AE5A 1MKWH 1PYTC 1TONA 1E0FD 2VJ1A 2KFWA 5GIBA 3OAAD 4KELA 2GZ7A 2XCFA 2SNWA 3UIRA 1F7ZA 1YPLH 3A87A 3QWCH 1FIWA 1MU6B 3PWCA 4AFUA 4CH8B 1AVWA 4FUEA 1C5UA 4E7NA 1TB6H 1TWXB 1OYQA 4X1PU 1C5TA 3VB6A 4INLA 4XBCA 1C2JA 1CGJE 4K69A 5HM9A 1P02A 2UUYA 1HXFH 1KLTA 3Q00A 4ABEA 1RTLA 3Q3YA 2PKAB 3M5OA 5DSFA 5EU8A 3RMNH 1H9HE 1UK4A 3BF6H 3SU4A 1KXEA 1PPEE 1UO6A 4K3JA 2BHGA 1GI2A 2XC5A 4Y71A 1S6FA 1LHCH 4WXIA 4LK4A 2J4IA 1O32A 3PYHA 1A3EH 1G32B 1O3OA 4WY3A 4LXBH 3QTVH 2J95A 1S83A 4I8LA 2XBXA 4WJG2 3P92A 2ZDNA 3SNEA 1TGBA 2FI3E 1IQJA 1SQOA 1C5ZB 1Z8GA 4YM9A 1C4Y2 5GDSH 4M7GA 1OHHD 1DX5M 1YYY1 4SGAE 2RDEA 1W7XH 3URCA 1YPGH 1FAXA 1OKXA 2GJGA 3MWIU 3TK5A 2WPKS 2H5DA 3SJ8A 3VG8A 5JPMH 1PJPA 3A7ZA 4ZKSU 5DKMA 1S84A 4NIYA 1UTOA 2ZFTA 2ZNKH 1NO9H 1NPMA 4Y7AA 3LJOA 4WMDA 2EQNA 1OXGA 1ELFA 2WHXA 3SU1A 4B76A 5EOKA 2W3KA 2B7DH 1O2LA 1HAVB 3ZZ3A 5EW2H 4JZDH 5F8TA 4WVPE 5PTPA 4MPXA 3ZVCA 3O8RA 4Q7XA 4CRFA 3LC3A 4TSFD 1QQ4A 5LH8A 1GMHG 3F1SB 1TAWA 2JJ2D 2EI8A 1ESBA 5KGOA 2FTMA 1VGCB 2BB4A 1L0ZA 1BT7A 5ESBA 1QQUA 4B73A 3E0PB 1C2GA 1RGQA 1T4VH 2LNCA 2Q6DA 1GI6A 4AG1A 2R3YA 4DURA 1G37A 1GI5A 1P2KA 2PTCE 1L4ZA 1THRH 3BV9B 4FUDA 2ZFRH 3GCTF 1EOLA 2O8TA 1MTWA 4X6PA 4RKOB 1W3CA 4X8SH 1IHSH 4JZFH 4X1NU 3QDZB 1RTKA 4UONA 1UVPA 4HI3A 3RXQA 2FYRA 2ZU5A 1GG6C 1QNJA 1CT4E 1FN8A 3SQEE 3F2HA 4TWYA 2ZWLH 3PTNA 2VIOA 2BZAA 1MBQA 2QXHA 2W5EA 2SGEE 3RU4E 4UDWH 4D76A 2GCTC 9LPRA 1LVOA 2H1UA 4X2WA 1NS3A 1AQ7A 3M7UA 3ZZ5A 2FM2A 2ZQ2A 1GL1A 1O3FA 1J16A 1AB9B 4MVNA 4F49A 3SNCA 1EASA 1TGNA 3F2FA 1BUIA 4DT4A 1P2QA 1P04A 2OC0A 1O33A 5HMAA 3SUEA 1BA8B 1ZLRA 4ABIA 2R3UA 2BY6X 3MU8A 3MU5A 3QUMP 5A0CA 1MD8A 1AI8H 1GJ5H 2RA0A 1ZPBA 4Z0KA 1T8LA 1PPGE 1BTUA 3WWFA 3PLBA 1UHBA 3NPSA 2H9TH 4NFEA 3RC6A 1ZTLA 4X0WU 1CT2E 4Y10E 4NA9H 5L30H 2HVYB 1DWEH 3SNAA 4A5TS 2G52A 1F0SA 3GCNA 3A7VA 3MH4A 1PPCE 1Y5BT 1CHOF 1YLCA 3TITA 4YT7H 2GT7A 3TK6A 1FMGA 4Q63A 3RMMH 4UFEH 4JZEH 1OOKB 3LH3A 4ACAA 1FY3A 3OTJE 4ASHA 2WV4A 2BQ7B 1GJBB 3LH1A 1SFQB 3P95A 2DUCA 5CHBA 1HIAB 5FBEA 9ESTA 4FU7A 1Z71A 1MKXK 1FDPA 3IG6B 1KMHB 3KF2A 5G4BA 3V0XA 3A7XA 4RT1A 3LGIA 3RXDA 5DO4H 4ABDA 4FVDA 1TOCB 5DP4A 1WCZA 1IHTH 2KCYA 1V2OT 1GWAA 2P8OB 1VR1H 4IS5A 1DLEA 1BRCE 2FOBA 2B0FA 1MUEB 1ARBA 2ASUB 1MU8B 4FVBA 4B2BA 1QFKH 1UTJA 4YOJA 1P05A 2PWXA 1DDJA 1FUJA 2VNTA 4THNH 2FOHA 1O2QA 3TGKE 1E1QD 3PRDA 3GCOA 2Y5FA 4FUJA 3PLPA 5DJ7A 3NXPA 4X1SU 1BMLA 1S82A 3RXFA 3DCLA 1W14U 1UTNA 1EB1H 1GBFA 3UPEA 1LHGH 1UK2A 5FXLA 1ETRH 1O5DH 1X7AC 3SN8A 1WQVH 3BTGE 1AWFH 4X6NA 8KME2 2ANMH 3OTPA 1NRSH 4FUIA 4ISLA 2JKHA 3BIUH 2ZC9H 1T31A 4Y11E 1NRNH 3VGCC 1C4V2 1QB1A 1TNGA 4CRGA 2ZFSA 5JB9S 1HDTH 4GCHG 2XCNA 3ZVDA 1FI8A 6ESTA 2VVCA 1SKYE 2LELA 2YMSC 3FOAA 4MPUA 3TK9A 3PMAB 3S7KB 1K1PA 5C5OA 3LGWA 2FS9A 2HALA 1NFXA 3SGAE 2XRCA 1MZAA 3RM0H 2OUAA 1S85A 2AGIX 2VH0A 4XRNA 5FX5A 3Q3XA 2BDAA 2I6SA 1LVMA 1ZRKA 1PQ8A 3KN2A 2BXTH 1CVWH 1AVXA 1BDAA 1D6RA 1XUGA 5CDFE 1Z8IB 4OM9A 5FCRA 5C1YA 2P59A 2GMTB 5T3HA 4JZ1A 1O5FH 1UW7A 3MH6A 2Z9JA 1TIOA 1XXFA 3UOPA 3GS9A 3ZZDA 1NM6A 1FIZA 1N8OB 2RFKC 1V2QT 4NWKA 1ESAA 1ELGA 3SORA 1KLIH 2HLDD 1GMHF 1GHVH 1TBQH 1NRQH 1LPZB 2A7CA 1AMHA 6LPRA 2WPHS 1EAIA 1DVAH 3DSPA 1HYLA 5B6OA 3GCHC 1GBDA 3L33A 2XW9A 4OS5A 3AASA 1TRYA 1HAHH 1ELTA 3VB3A 8LPRA 3EQ0H 1GJCB 2SGDE 3GICB 1IQNA 2HGTH 1QB6A 2STAE 1B0FA 4Y7BA 1SQAA 2P3UB 2BDBA 3A7YA 3UNRA 5DPAA 2ZPRA 4AFZA 4AB9A 2GVFA 3BTQE 2LPRA 2ZEBA 3HGPA 1JWTA 1MKXH 1QBVH 2QA9E 3BTTE 1ZGIA 3MMGA 1C4U2 1C9PA 3STJA 3MFJA 3SUFA 4CR9A 1NC6A 4FU8A 1SLWB 1KTSB 1CA0B 1QRZA 1ZR0A 2A4GA 1OP2A 3SI3H 3F0OA 2C4FH 4JYTA 5C0TA 1TA6A 1KYNA 1O39A 1HJ9A 3SV6A 1C5XB 1DM4B 1RIWB 1V2UT 3ITIA 1HAOH 3N7OA 1RRKA 5EQRA 2O8UA 1C1QA 1UCYE 2JJ1D 3RXLA 3UQVA 1Z7KA 2ODYB 1FXYA 1SLXB 1MTVA 2AEIH 1HPGA 1O2RA 3TU7H 3UFAA 1UTPA 2BTCE 2THFB 1C5QA 1AHTH 5EPYA 7ESTE 3MYWA 3N7DA 4YOGA 5EGMA 1YWUA 4OGXA 2PHBA 2UUFB 2ZHDA 1UVTH 1AY6H 2ZO3H 2F9UA 1PQ7A 3IITA 5J4QA 3P8FA 3AVZA 2ZTYA 2OCVB 3RXIA 1BITA 2ZF0H 2QN5T 1P03A 3RUOA 2VVUA 1O3EA 3QGJA 5DP5A 1P11E 1QZ8A 2GD4B 1CA8B 3KYGA 1TNJA 4AN7A 5I25A 1H9LB 3SV8A 3RXOA 1AWHB 2GV6A 1SGYE 2FWWA 1ANBA 2GGVB 3DD2H 1O2ZA 5HIYA 3GYMA 3RXHA 4NSYA 1KDQA 1GDQA 2VWNA 1ZHPA 1ZZZA 2Y82A 3KGPA 1TGTA 3RXPA 2D2DA 3HK3B 2A4OA 3GDSA 5E0JA 1TLDA 4KGAA 2SGPE 4NIXA 3ZZCA 1VGCC 3T27A 1DWDH 4X8TH 1TE0A 1O3LA 4ZKNU 3CS0A 1PPFE 2ZGHA 4A1XA 1TX7A 3UUZA 1YPKH 3LKWA 2Y7ZA 1E35B 1CT0E 1LHDH 4O03A 2QF5A 2F9VA 1NU9A 4YLUA 5L2ZH 2C8WB 2FO9A 2C93B 2QIQA 2OK5A 1KY9A 2XOKD 1J14A 2PKAA 2A0QB 2O8LA 1HBTH 2ZCHP 2TGTA 5GJ4B 4GCHF 1ZYOA 4XBDA 1FX0B 1ELCA 3EA8A 3IWMA 2YNAA 1MBMA 3E0NB 2J98B 2WUBA 1HV7A 1PYTD 2BXUH 1GBKA 1TPPA 3RXJA 1LTOA 3GCTG 3HATH 2GT8A 1AB9C 1DOJA 4U32A 1AZZA 2PKSB 1FN6A 3U1JB 3LU9B 2QF0A 4DG4A 2WPLS 1CU1A 4ESTE 1HAIH 3C1KA 2ZGJA 4Y8YA 3T5FH 1LHFH 3HKJB 1F5RA 3T25A 1D3TB 2G5VA 1GBIA 1A0JA 5FCKA 2OTVA 5EG4A 1S6LA 4ABBA 2V6NA 5L6NH 4ZXXH 1S81A 3E16B 2SNVA 4ZKOU 3LT3A 6GCHF 2PLXA 2H2ZA 1MAYA 1XUFA 1UTMA 3QGNB 1HAVA 2IPQX 4OS2A 1ZMNA 5EQSA 2VIQA 3E1XB 1C5YB 4TY7A 4IBLH 4X2YA 4X6MA 2P3TB 3ZYEA 3Q3KA 4DT7B 3HGNA 1O3HA 3MTYA 2KAIA 2KCPA 2VB0A 1U6QA 3FAOA 1KXCA 3S9AA 2O9QA 1TNIA 1ZTJA 2ILNA 4YTAA 2C8XB 2ZPQA 4GHTA 5HXFA 1GGDB 2P8OC 2GP9B 1ZPZA 5B6LA 3TIUA 1WXRA 1EXFA 5A0AE 2SFAA 1QGFA 2FEQH 3SI4H 2R9PA 1ETTH 4A1TA 1E37B 2GZ8A 2ZDKA 4LOYH 5EXLA 1O5EH 1ZMJA 3H7OA 1AZ8A 3E6PH 4WMEA 2BVRH 7KMEH 3A7WA 1C5VA 3OSYA 5EJZA 3GY5A 3ZZ6A 3FP7E 5F53A 4ABGA 1PPZA 8ESTE 2QYIA 4U30A 2PR3A 1TGCA 4MNVA 1HLTH 3CNRA 5AHGH 2CJIA 2WUCA 1O2SA 2QC2A 1DANH 1TPOA 4MPVA 4RN6A 3A8AA 4INKA 3SNBA 3QX5H 1NFWA 3MNCA 3PO1B 1W8BH 1QBOA 3BTEE 3TJNA 1MMJN 1DT2A 2AGEX 1TA2A 3A86A 4O9VA 1IQEA 1SGCA 4JK6A 1GBJA 3A89A 3NCLA 3ZVGA 3ODDA 1KXDA 3BSQA 5HM2A 1O5BB 3K6ZA 1BBRK 4D7GA 1GVZA 4KTCA 1UCYK 4F55A 2YNBA 2FLRH 6CHAB 2J5UA 4Q80A 3PMBB 1Y3UA 4ISHH 3NK8A 1MCTA 2V0BA 1BMFD 1TPSA 2FOEA 2VIWA 3KNXA 2FOAA 3ZZ7A 5ABWA 1QJ6B 1SHYA 1GCTB 1GI7B 4FUHA 3RC4A 3TH2H 2GMTC 3AAUA 2WV5A 1E79D 4YXWD 3SGQE 1AKSA 1RS0A 3ZVFA 3HPTB 3OY5U 2PP6A 1O3CA 2SGQE 1SI5H 3RXBA 1N8OC 1UTQA 4JZIA 5J4SA 1S0QA 3GDUA 3STIA 1BMMH 2VWOA 3FZZA 4Y8ZA 4AG2A 3L6PA 1YY3A 4VGCB 1KLJH 3RU4D 3QZRA 1P12E 1ELEE 2BMGB 1ABIH 4A6LA 1EX3A 1WQSA 3OYPA 1Y3XA 2WZQA 3ODFA 3FZDA 3SBKA 4GPGA 4KTSA 1KXFA 1ANDA 3SU3A 2ZHEH 4GAWA 4K8BA 3RXMA 1EJNA 2IPHA 2ZU4A 3LPRA 1GBMA 1OWEA 2VWMA 1EPTB 1LVYA 1FZZA 3A80A 1QJ1B 2D1JA 4ISNA 1C2DA 2AIQA 2H5CA 5FX6A 5C17A 5JDUB 2K1QA 1FJSA 1WDIA 3M36A 1ELVA 1OWJA 1YPEH 4D9QA 1K2I1 1K1JA 2FIRH 3LGTA 2CV3A 3OEHD 1CO7E 3QZQA 4NCYA 4CHAB 1L4DA 2R2WU 3M7TA 1HAXB 3P70B 4HFPB 1SGRE 1YPHE 1CA0C 2GTBA 2PGQB 3MOCA 3F6UH 5E2PA 2Z6BD 2O8WA 1RIWC 2NU2E 1J8AA 3MH5A 1MQ5A 1XMNB 3M5NA 1SGFG 3GDVA 4HZHA 1TMUH 1O3AA 3UTUH 1W12U 2BD4A 3NKKA 1O2JA 1GMCF 1SFIA 1TQ7B 1TX6A 2STBE 4Y76A 1OPHB 5A2MH 1V2WT 1M9UA 1O5GH 4BXSA 2JDID 2OQ5A 2BY8X 3WW7A 4AX9H 1Z6EA 3D23A 3SOSA 1VITH 2BQ6B 2Y5HA 5E8EH 2ZCLP 2AERH 5C94A 3F9HA 1UMAH 3AW0A 1IQFA 1YPHC 5A8ZA 1HJAB 1Z1IA 3TH4H 2YMSD 1V2VT 4DIIH 3KCGH 1JIRA 1BB0B 3NZIA 1JRSA 2V3HH 2Y5GA 3ZZ4A 2W7SA 2CGAA 4JCNA 1MTSA 3SJIA 1ZOMA 1TRMA 4JYVH 3I78A 1BBRH 1O5CB 1VZQH 1P2NA 4X8UH 1UCYH 2BLVA 2A5AA 5JBBS 1SHHB 2NWNA 1SGDE 3VXFH 1TBZH 4XBBA 2A31A 3FP6E 3SU5A 5CHAC 2QF4A 1K1OA 3TH3H 2BOKA 1G9IE 5IK2D 4BTIB 2BYAX 2G81E 1HFDA 1EP6A 1P3CA 5K0HA 3OX7U 1PPHE 1DSTA 2AYWA 1YCPM 2A1DB 1KSNA 5EXNA 4ZUHA 1OS8A 2F9OA 1WSSH 3ZZ8A 1IQHA 3RXAA 1OWKA 2UWPA 3SJOA 1GI1A 3WY8A 5EW1H 3KIDU 1HNEE 1SGIB 2OC7A 4ASUD 2NU3E 1W10U 2BDGA 2WPMS 4NWLA 1ZGVA 1BTZA 1ABJH 1A0HB 4YOIA 4AGKA 2XTTB 1QL8A 4B75A 2Y7XA 3S7HB 1SLVB 3ATLA 3PLKA 1Y59T 1BHXB 3GY4A 3QO6A 2XBYA 1ZSKA 5TCCA 2ZDLA 3D62A 3DUXH 1C2HA 3M5LA 2AMPA 1O34A 2ZI2H 4BAOB 1LQEA 2ZHWH 1SLUB 1NRPH 1G2LA 1GI0A 1DFPA 2FDAA 1V2ST 2PKSC 4B6FA 4FETA 2XNIA 3V7TA 1DUAA 2W26A 3DT0H 3MU4A 1YLNA 2F83A 3EE0B 4CRBA 1FY5A 2ANKH 2YOLA 1QA0A 1UVOA 5E2OA 2EC9H 3RC5A 2QV1A 2D26C 1BIOA 1W0KD 1IQLA 5GCHG 1SR5C 2HWLB 1P2MA 5DK1A 2HPQH 3MO9A 2JH5D 4AC9A 1H8IH 4I8GA 1C5WB 4IGDA 1HUTH 1O2KA 2XWBI 4ZHLU 1TNKA 4K1EA 2PUXB 1DS2E 1EJMA 2G4UA 1P9UA 3LC5A 4SGBE 1QL9A 4MPWA 3T28A 1G3EA 4GSOA 1MABB 2ESTE 4I86A 3K65B 4X1RU 2F4LA 1F2SE 2B5TB 1LCYA 2ZDAH 1YF4A 4NSVA 1CGIE 2JETB 2ZDMA 2A2XH 5DP3A 4QT8C 1QJ7B 1A4WH 4FXGH 2FP7B 2F9PA 1PFXC 2BDYA 4E7RG 1DXWA 3UOUA 3U8TH 6GCHG 4NA8A 3MNBA 4X2XA 3RXTA 3K6YA 1UVSH 3BIVH 3RXKA 5F6MA 1BRUP 1C1NA 2P16A 3PV4A 1SB1H 5C0UA 4TWWA 5C67A 1GGDC 2PGBB 5JYIA 4LZ1H 1FNIA 4I8KA 2CF8H 2J92A 2VU8E 3M7QA 1O2YA 3UR9A 3VB5A 3ZVEA 4AOQA 2UUJB 5ETXA 3RMOH 1MAXA 1UVUH 2EI7A 1V2JT 1ZJKA 1UTLM 2Q6GA 1G36A 2BD5A 4ISIH 3QN7A 4ZKRU 3DA9B 1MTUA 2J98A 4NIWA 4GUXA 3W1EA 1UHBB 1E36B 2ODQA 3V13A 3H09A 5HGGA 1C2FA 1KTTB 1XUHA 3PV2A 1AUTC 1O3DA 4B2CA 4WF8A 1VITF 1SSXA 4MDSA 1F0RA 1AU8A 2PFEA 4D7FA 1ANCA 5LPFA 1YKTA 5JBCS 2IN2A 1ETSH 1FY4A 1SPJA 1O2OA 2GKVE 1BRAA 3AW1A 3ZVBA 1XM1A 4FU9A 4YESB 2PSXA 5T6DA 3PO1C 4XE4A 3A7TA 5LPEA 3W95A 4FOUC 3BN9A 2OC8A 3Q76A 4DGJA 2RCEA 3PROA 4BAQB 1NBME 2FOGA 5GXPA 4A1VA 4AFSA 2QXGA 2OP9A 2J97A 4J1YA 1TQ0B 1E34B 4AYVB 3EYDA 4RT0A 1DSUA 6CHAC 1JOUB 1J15A 4ABJA 4H6SB 1TMTH 2P94A 2TBSA 2SGFE 1AN1E 3S0NA 2XC4A 3ATWA 2Y81A 1IQMA 3E91A 4UFFH 4B1TA 1GCTC 4NZQA 1SGQE 3UB0A 2OINA 5BPEA 1T7CA 1Y3WA 3H7TA 5EJLA 4A7IB 1RD3B 1O2XA 1ZPCA 4TT3D 3SQHE 3SYJA 1YPJH 4UFDH 2VGCB 1C1UH 4BAMB 3LGYA 2LP6A 4Z6AH 1GJ7B 4IMQA 2ZU2A 8GCHG 1ZHMA 3SU2A 4Q2KA 4VGCC 1C1OA 3SUGA 3EAJA 4IN2A 4ZCNA 4Y6DA 2ZP0H 2VWLA 1TALA 1MQ6A 3OY6U 1NRRH 1G3CA 2FLBH 5FAHA 1K21H 4BTTB 1ESTA 1V2TT 1F92A 3V12A 1A0LA 2BX4A 2CK3D 5CHAB 1EPTC 1YBWA 1SGTA 1AD8H 3F9FA 3UAIC 4CREA 2WSSD 1T8MA 1ZSLA 1V2RT 2G4TA 4DVAU 4H6TA 1F5LA 2ZG0H 2L6OA 5ESTE 1SQTA 1XXDA 3FN8A 2OBQA 4LZ4B 4YO9A 4CHAC 1EATA 2NU1E 1NFYA 2GCHF 4DW2U 1W0JD 2AS9A 1HCGA 2BQWB 3C27B 1OYTH 3FKSD 2PUQH 2ZGXH 1C2LA 1QRXA 1Q2WA 4GHQA 4HTCH 3TLOA 2HNTF 2SGAA 3KEEA 1YPMH 2XNDD 5F8XA 2HLCA 1IQKA 1G30B 1VKYA 1W7GH 2RDLA 4I7YH 2D8WA 1G3BA 1IAUA 1EKBB 1L1NA 1O2GH 3F2GA 3PV5A 1XUIA 1SMFE 2FYQA 3S9BA 1QA7A 1TNLA 1FQ3A 2CN0H 2C90B 1FY1A 5GCHF 3ZZAA 1E1RD 1EAWA 4DIHH 1ZJDA 1LHEH 1N1LA 2ZQ1A 2VBCA 5DP6A 1DXPA 4MQAA 3SUDA 2BM2A 1GI8B 2AGGX 1JRTA 1EOJA 2HNTE 3BTHE 1GJDB 3U8RH 1GBHA 2XC0A 2A7HA 3KYFA 1H1BA 2VH6A 5C1XA 2A4RA 3SV9A 1NTPA 1UK3A 2H9EH 3L3TA 1HJAC 3KQCA 2CHAB 4WH6A 1AIXH 1GMCG 2OBOA 1BHXF 3VB4A 4JK5A 1L1GA 1A3BH 4YZUA 1GI4A 2J34A 1F5KU 1IOEA 1TABE 4Q4LA 2ZECA 2GX4A 2Z9LA 2ZU1A 3U69H 1FLEE 2W7UA 3T62A 3B23B 2ZIQH 3VB7A 1N6XA 2ZTXA 4TPIZ 1XUKA 2BD3A 5E0HA 3TGJE 2HNTC 3GY6A 1P06A 1LKBA 3VEQB 3N99A 1A1RA 3VFEA 2WINI 5JBTA 4HG6A 3SZEA 3ATIA 4O3TA 1BRBE 3M3SA 4YLQH 3UWJH 3QLPH 3ATMA 3KL6A 1KIGH 1EAXA 1A61H 1H8HD 1GVLA 2QAAA 1D3DB 5IYTA 3TPIZ 3UQOA 3A83A 2O8MA 3O8CA 3SU0A 1GI9B 4ABFA 1P10A 1GBLA 2ZHFH 1GHWH 3DFJA 1AFQB 3B9FH 4FUGA 2W3IA 5FPSA 1HGTH 3A85A 3AAVA 1C5RA 4I32A 1CHGA 1C5LH 1OP8A 3V3MA 3K2UA 1A46H 2Z3EA 3BTME 2BVSH 3GYLB 2F9BH 3SZNA 1NT1A 3U9AH 1BQYA 2Z9KA 2Z9IA 1NESE 1O2NA 1S5SA 4TYDA 2B8OH 1GMDG 1THSH 3ZV9A 1KDQB 1O3KA 1SOTA 2J38A 1RTFB 1P0SH 2JIZD 1OWHA 1GJ6A 2NU4E 1EZQA 1RXPA 2G51A 3FO8D 3LJJA 4XFQA 1O31A 1TRNA 1C1RA 5FHTA 1K1MA 1O3BA 1Y8TA 1NZQH 4FUFA 1FV9A 1A5HA 3RLWH 1ORFA 2FI4E 3GY7A 1OP0A 1P8VC 5FPTA 1K28D 1C1VH 5A8YA 1C5SA 8GCHF 4AZ2B 3SHAH 4DCDA 3GISB 2BZ6H 1SOZA 1TPAE 1VJ9U 2WYJA 2TGPZ 1YP9A 2EEKA 3RLYH 1FPHH 1HIAA 2H6MA 4X1QU 2AFQB 2HRVA 1C5OH 4R0IA 3ESTA 3DSGA 3M3VA 2JETC 4FUCA 3DSOA 3SO3A 1FONA 5T6GA 4E06H 2QGRA 2GZ9A 3UREA 3ZZ9A 4CRAA 2Z7FE 3DHKH 4P00A 4O3UA 5TCAA 4WWYA 2BLOA 1BJVA 3A8CA 4BANB 2QY0B 2QXJA 1OWIA 3GY8A 2K8IA 2ZPSA 4NFFA 4OGYA 1HB0B 2ULLA 4ZHAA 4Y0ZE 4YT6H 3UY9A 1NY22 1V2LT 3BTDE 1DICA 4CH2B 4B74A 1JIMA 1O3IA 1QL7A 3VPKA 1DY8A 1VCQA 1T8NA 1BTHH 4HGCA 3RXVA 3TJOA 1FAKH 2ZFPH 3K9XB 2ZU3A 2KCOA 3P8GA 2HPPH 3U8OH 4IN1A 1CBWB 1DPOA 1GHYH 1J9CH 5F8ZA 1GBCA 2OQUA 1LPKB 2A2QH 5AVDA 5HIZA 1AGJA 2AMQA 3O8BA 3JZ1B 2XYAA 3TNSA 2V35A 4CR5A 1W0YH 1ID5H 3A84A 3MNSA 1AE8H 2R0KA 1B0EA 2BDHA 2ZDVH 3MO6A 3RXSA 1P2JA 3RXRA 4M9FA 2KAIB 3RXGA 1P57B 1D9IA 1C2KA 2XXLA 2HVXA 1BOQA 1FY8E 3KHVA 4CRDA 1LDTT 1VCWA 2W6JD 3URDA 3PB1E 3QTOH 1QR3E 2NU0E 3RXEA 1VITG 1L1JA 1ZRBA 3MQKC 3A8BA 3VXEH 1YCPK 1TGSZ 5GNDA 2A32A 3DFLA 4BTUB 3MI4A 3GY2A 2VIPA 4X6OA 3ZZBA 1C2MA 2BX3A 1Y3YA 5KEDA 2QCYA 1VJAU 4U01A 2OD3B 2FXRA 3RP2A 5C1UA 1D4PB 2ANWA 3FFGA 4AFQA 4Z1MD 4ACBA 2IOTA 2FX4A 4MNXA 4MTBA 2KR7A 4ZMAH 5I46H 4D9RA 2F43B 2ANYA 2QXIA 2VGCC 1BJUA 1DLKB 1WOFA 3BEUA 5HYOA 3GY3A 1NN6A 4MNYA 5A8XA 5TJXA 3OE7D 2AIPA 3HK6B 3M5MA 2EA3A 1EB2A 1QURH 3U1IB 4BNRA 4AB8A 1L2EA 1NU7B 1O2VA 2XWAA 1HAZB 1CGHA 2TRMA 3A82A 1O35A 1T32A 3BG4B 2WPJS 1A2CH 1GHBG 2P95A 4XSKU 2CF9H 1N6YA 2FODA 1ELBA 2H9HA 1GBEA 3QK1A 4K2YA 3MU0A 4I8JA 3SHCH 2DE9A 2M5TA 3UWIA 2FS8A 1P01A 3E3TA 3MNXA 3P8NA 1GHAF 1EUFA 4NGAH 1SL3A 2BOHB 3D65E 3TGIE 4XD7D 1H8ED 1A5IA 4UE7H 1DE7H 1P2IA 3TJVA 1C5MD 3KQBA 2TGDA 1GHXH 4OS7A 1GJ8B 3BTFE 4ZH8A 4A92A 1TYNA 2V3MA 1LQDB 1O2TA 3RM2H 3F3BA 2P3FH 1PQAA 2C8YB 3OU0A 3N7EA 1AKSB 1BTXA 1GMDF 1C1MA 1S6HA 4R8TB 3ENSB 2VINA 4UEHH 2ZZUH 1Z1JA 5A09A 5EIYA 2BD7A 1MH0A 2FPZA 1MTNB 1TOMH 2F9NA 3LIWA 1ZTKA 1ACBE 1SBWA 4IC6A 4ISOA 2GCHG 3F68H 3A88A 3LDXH 3PTBA 1S0RA 4KKDA 5DP7A 4BXWA 1H4WA 1LPGB 2OC1A 7GCHG 3PWBA 3ZV8A 1UJ1A 1GI3A 1B7XB 1XKBC 2Y80A 1Z8RA 1YGCH 1CQQA 1BZXE 5FBIA 1EZXC 1JXPA 1THPB 3UNSA 3ZIAD 2BDCA 1QIXB 2Z3DA 3SNDA 1ZHRA 2ALVA 5DGJA 3ATKA 4IMZA 2CHAC 2ZHQH 1SC8U 4PROA 3KQDA 1MD7A 4Q7YA 1KXBA 2BY9X 2K0QA 5GPIB 4XOJA 1DWBH 4DOQA 3ZVAA 1OSSA 3SU6A 3E90B 2Z94A 3KQEA 4GVUA 2EY4C 1K1LA 4IW4E 2FMJA 4AGJA 1AO5A 2BDIA 2JH0D 4MNWA 2AH4X 1P9SA 1GVKB 1EZUC 3U98H 1V2NT 1W2KH 3EA9A 2F91A 4Y8XA 1YCPH 2KZ4A 2AHME 3FANA 2ZCKP 1XVOA 1C1SA 1V3XA 2TPIZ 1TX8A 1O2MA 4OS6A 5L2YH 4JMYA 2UWOA 1BTWA 3S9CA 3PRBA 1P09A 2GDEH 1NBMD 5SGAE 1K1IA 2ZFFH 5KECA 3LONA 1Z6JH 2ZTZA 3WWBA 2FOMB 3KQ5A 2FTLE 1DWCH 2ZA5A 5AFZH 3RXCA 2BD8A 2G5NA 3F9GA 2Q6FA 3Q77A 3SV7A 5AFYH 1K22H 2ALPA 2FI5E 4JYUH 3BTKE 1WAYB 3LGUA 2BVXH 2KCAA 1GJAB 2AMDA 3UR6A 3SJ9A 4X2VA 5C20A 1B5GH 2ODPA 1NFUA 2XBWA 1IQGA 4I31A 2BD9A 1EFRD 1AFQC 3OEED 3A81A 1T8OA 5T6FA 2FESH 3AK5A 1WV7H 5DP8A 1GBBA 1WU1A 2G00A 1BTPA 3O8DA 1HAGE 4Y79A 1DY9A 1W13U 1ARCA 1O3PB 1WTHD 3EA7A 3LGVA 4RI0A 2VIVA 1COWD 2F3CE 5K7RA 3RXUA 1RJXB 4Y0YE 5EJ1A 3EGKH 4OS1A 1AVGH 3EDXB 1MCVA 4P02A 1SVPA 2OLGA 3BEFB 2ZGCA 1WTGH 3MHWU 1V6DA 3D49H 1D3QB 5LPRA 4Q7ZA 1JMOH 2XBVA 4ZHMU 4CBOA 1O2UA 1YM0A 1AUJA 1QTFA 1SGNE 1LMWB 2RG3A 3CS7A 4MG3A 2PV9B 5FL7D 2HOBA 3CP7A 1LVBA 1O37A 3M3TA 3B8JA 2ZFQH 4IC5A 3M35A 4B2AA 1XX9A 2P93A 3FVFB 4B71A 2BY7X 3P17H 1BTYA 1WBGB 1D6WA 5LGOA 1C1PA 4NZLA 1DITH 1O2PA
chains in the Genus database with same CATH topology
2C3SA 1O2IA 1SG8B 1XKAC 4TY6A 1W11U 3MH7A 2CMYA 3I77A 2J9NA 1EAUA 1ZMLA 3TJUA 3TNTA 1T4UH 1D3PB 1GPZA 4CBNA 2TIOA 2UWLA 1GG6B 1C5PA 1GHBF 4U2WA 1BBRE 1WUNH 3CENA 4K1SA 4MLFB 2GCTB 1CSOE 3RDZA 1O3NA 2A5IA 3HKIB 1Y3VA 3SJKA 2PW8H 2UUKB 3F9EA 2VVVA 5C3NA 1DUEA 4NIVA 4KP0A 4ZXYH 1BMAA 3JZ2B 3P6ZB 4X8VH 4RSPA 4ABAA 2BD2A 2RA3A 1Y5AT 1O2HA 2J94A 1WYKA 3UNQA 1TNHA 2R2MB 1OX1A 4E05H 5JB8S 3G01A 1ELAA 3MO3A 1Q31A 1F0UA 1G2MA 2V3OH 4BAHB 1C2EA 4DJZB 1H9IE 3BEIB 1QCPA 1K1NA 1V2MT 3PMHB 4KTUA 2C8ZB 2VIDA 5IDKA 1CBWC 1GL0E 1XUJA 2FOFA 3LOXA 4K1TA 4WMFA 2A7JA 1O3MA 2G8TA 3A8DA 4INHA 1C1TA 1GHZA 1K9OE 3NUMA 1GBAA 1E38B 1IQIA 4K60A 1H8DH 1BCUH 1ELDE 1O0DH 2Z3CA 1C1WH 2BLWA 2GDDA 4BOHA 1O30A 2QF3A 1MZDA 2J2UA 1MKWK 4ABHA 1O36A 2TGAA 7GCHF 2Y6TA 5EODA 2IJOB 5EPNA 3R0FA 4XDEA 5JBAS 2BY5X 1HXEH 4OS4A 1OWDA 4D8NA 3TVJB 1EJAA 1VCPA 5BRRE 2PTNA 3T26A 3T2NA 1V2KT 1O38A 2FZZA 2FOCA 1C9TA 1V2PT 1YC0A 1QRWA 3PMJA 1O3GA 1PPBH 1KXAA 5E0GA 2ZKSA 5CE1A 4H4FA 3GOVB 5C5NA 2Z9GA 2Q1JA 4BAKB 2GV7A 1O2WA 1GDUA 1Q3XA 2G55A 1LKAA 3R3GB 1BMNH 4RKJB 2FX6A 2PSYA 5CMXH 5AF9H 1SGFA 4J2YB 4O97A 1EZSC 5GWZA 4ZAEA 3P8OA 3M61U 1C5NH 3BG8A 7LPRA 1EQ9A 1ANEA 2WPIS 3RU4T 1LO6A 2EI6A 3T29A 4K5ZA 2R0LA 3VGCB 1PQ5A 1ZSJA 1XVMA 3BG4C 2JH6D 4NA7A 4TPYA 1TFXA 3RMLH 1C2IA 4NG9H 1O3JA 1W0ZU 2ZGBH 2B9LA 1O5AB 4H42U 4AORA 1EPTA 1GJ4H 1QB9A 3M37A 2BLQA 1A5GH 1HAPH 1G3DA 3FP8E 3PM3A 1AFEH 2DE8A 5EXMA 1UTKA 2CXVA 4DY7B 1SGPE 4WXVA 1RFNA 1TBRH 4UFGH 5EQQA 1TMBH 3ZYDA 1Y5UT 4I33A 1SGEE 4K8YA 1GCDA 5A0BA 1HRTH 3ELAH 3BTWE 2A5KA 4CRCA 1P2OA 3E8LA 5F03A 1GHAG 1QHRB 5DG6A 1F0TA 1CE5A 1MTNC 4FUBA 3S69A 1INCA 2OXSA 1GDNA 3MU1A 4GLYA 3SV2H 5H4IB 4AYYB 1CHOG 3W94A 1GBTA 1Z8JB 4UD9H 3H5CB 2I6QA 3SW2B 1HJ8A 4ZROA 5FPYA 3SGBE 1HAYB 4F4OC 3GCHB 5C2ZA 1J17T 2A45B 1NROH 1YLDA 2WYGA 4WH8A 1A7SA 3NWUA 3I29A 5DP9A 1P3EA 1FPCH 1QY6A 1QBNA 4I8HA 1JBUH 2A4QA 1GJ9B 1EP5A 1AE5A 1MKWH 1PYTC 1TONA 1E0FD 2VJ1A 5GIBA 4KELA 2GZ7A 2XCFA 2SNWA 3UIRA 1F7ZA 1YPLH 3A87A 3QWCH 1FIWA 1MU6B 3PWCA 4AFUA 4CH8B 1AVWA 4FUEA 1C5UA 4E7NA 1TB6H 1TWXB 1OYQA 4X1PU 1C5TA 3VB6A 4INLA 4XBCA 1C2JA 1CGJE 4K69A 5HM9A 1P02A 2UUYA 1HXFH 1KLTA 3Q00A 4ABEA 1RTLA 3Q3YA 2PKAB 3M5OA 5EU8A 3RMNH 1H9HE 1UK4A 3BF6H 3SU4A 1KXEA 1PPEE 1UO6A 4K3JA 2BHGA 1GI2A 2XC5A 4Y71A 1S6FA 1LHCH 4WXIA 4LK4A 2J4IA 1O32A 3PYHA 1A3EH 1G32B 1O3OA 4WY3A 4LXBH 3QTVH 2J95A 1S83A 4I8LA 2XBXA 4WJG2 3P92A 2ZDNA 3SNEA 1TGBA 2FI3E 1IQJA 1SQOA 1C5ZB 1Z8GA 4YM9A 1C4Y2 5GDSH 4M7GA 1DX5M 1YYY1 4SGAE 1W7XH 3URCA 1YPGH 1FAXA 1OKXA 3MWIU 3TK5A 2WPKS 2H5DA 3SJ8A 5JPMH 1PJPA 3A7ZA 4ZKSU 5DKMA 1S84A 4NIYA 1UTOA 2ZFTA 2ZNKH 1NO9H 1NPMA 4Y7AA 3LJOA 4WMDA 1OXGA 1ELFA 3SU1A 4B76A 5EOKA 2W3KA 2B7DH 1O2LA 1HAVB 3ZZ3A 5EW2H 4JZDH 5F8TA 4WVPE 5PTPA 4MPXA 3ZVCA 3O8RA 4Q7XA 4CRFA 3LC3A 1QQ4A 5LH8A 1GMHG 3F1SB 1TAWA 2EI8A 1ESBA 2FTMA 1VGCB 2BB4A 1L0ZA 1BT7A 5ESBA 1QQUA 4B73A 3E0PB 1C2GA 1RGQA 1T4VH 2LNCA 2Q6DA 1GI6A 4AG1A 2R3YA 4DURA 1G37A 1GI5A 1P2KA 2PTCE 1L4ZA 1THRH 3BV9B 4FUDA 2ZFRH 3GCTF 1EOLA 2O8TA 1MTWA 4X6PA 4RKOB 1W3CA 4X8SH 1IHSH 4JZFH 4X1NU 3QDZB 1RTKA 4UONA 1UVPA 4HI3A 3RXQA 2FYRA 2ZU5A 1GG6C 1QNJA 1CT4E 1FN8A 3SQEE 4TWYA 2ZWLH 3PTNA 2VIOA 2BZAA 1MBQA 2QXHA 2W5EA 2SGEE 3RU4E 4UDWH 4D76A 2GCTC 9LPRA 1LVOA 2H1UA 4X2WA 1NS3A 1AQ7A 3M7UA 3ZZ5A 2FM2A 2ZQ2A 1GL1A 1O3FA 1J16A 1AB9B 4MVNA 4F49A 3SNCA 1EASA 1TGNA 1BUIA 1P2QA 1P04A 2OC0A 1O33A 5HMAA 3SUEA 1BA8B 1ZLRA 4ABIA 2R3UA 2BY6X 3MU8A 3MU5A 3QUMP 5A0CA 1MD8A 1AI8H 1GJ5H 2RA0A 1ZPBA 4Z0KA 1T8LA 1PPGE 1BTUA 3PLBA 1UHBA 3NPSA 2H9TH 4NFEA 3RC6A 1ZTLA 4X0WU 1CT2E 4Y10E 4NA9H 5L30H 1DWEH 3SNAA 4A5TS 2G52A 1F0SA 3GCNA 3A7VA 3MH4A 1PPCE 1Y5BT 1CHOF 1YLCA 3TITA 4YT7H 2GT7A 3TK6A 1FMGA 3RMMH 4UFEH 4JZEH 1OOKB 3LH3A 1FY3A 3OTJE 4ASHA 2WV4A 2BQ7B 1GJBB 3LH1A 1SFQB 3P95A 2DUCA 5FBEA 1HIAB 9ESTA 4FU7A 1Z71A 1MKXK 1FDPA 3IG6B 3KF2A 5G4BA 3V0XA 3A7XA 3LGIA 3RXDA 5DO4H 4ABDA 4FVDA 1TOCB 5DP4A 1WCZA 1IHTH 1V2OT 1GWAA 2P8OB 1VR1H 4IS5A 1DLEA 1BRCE 2FOBA 2B0FA 1MUEB 1ARBA 2ASUB 1MU8B 4FVBA 4B2BA 1QFKH 1UTJA 4YOJA 1P05A 2PWXA 1DDJA 1FUJA 2VNTA 4THNH 2FOHA 1O2QA 3TGKE 3GCOA 2Y5FA 4FUJA 3PLPA 5DJ7A 3NXPA 4X1SU 1BMLA 1S82A 3RXFA 1W14U 1UTNA 1EB1H 1GBFA 3UPEA 1LHGH 1UK2A 5FXLA 1ETRH 1O5DH 1X7AC 3SN8A 1WQVH 3BTGE 1AWFH 4X6NA 8KME2 2ANMH 1NRSH 4FUIA 4ISLA 2JKHA 3BIUH 2ZC9H 1T31A 4Y11E 1NRNH 3VGCC 1C4V2 1QB1A 1TNGA 4CRGA 2ZFSA 5JB9S 1HDTH 4GCHG 2XCNA 3ZVDA 1FI8A 6ESTA 2VVCA 4MPUA 3TK9A 3PMAB 3S7KB 1K1PA 5C5OA 3LGWA 2FS9A 2HALA 1NFXA 3SGAE 2XRCA 1MZAA 3RM0H 2OUAA 1S85A 2AGIX 2VH0A 5FX5A 3Q3XA 2BDAA 2I6SA 1LVMA 1ZRKA 1PQ8A 3KN2A 2BXTH 1CVWH 1AVXA 1BDAA 1D6RA 1XUGA 1Z8IB 5FCRA 5C1YA 2P59A 2GMTB 5T3HA 4JZ1A 1O5FH 3MH6A 2Z9JA 1TIOA 1XXFA 3UOPA 3ZZDA 1NM6A 1FIZA 1N8OB 1V2QT 4NWKA 1ESAA 1ELGA 3SORA 1KLIH 1GMHF 1GHVH 1TBQH 1NRQH 1LPZB 2A7CA 1AMHA 6LPRA 2WPHS 1EAIA 1DVAH 1HYLA 5B6OA 3GCHC 1GBDA 3L33A 2XW9A 4OS5A 3AASA 1TRYA 1HAHH 1ELTA 3VB3A 8LPRA 3EQ0H 1GJCB 2SGDE 3GICB 1IQNA 2HGTH 1QB6A 2STAE 1B0FA 4Y7BA 1SQAA 2P3UB 2BDBA 3A7YA 3UNRA 5DPAA 2ZPRA 4AFZA 4AB9A 2GVFA 3BTQE 2LPRA 2ZEBA 3HGPA 1JWTA 1MKXH 1QBVH 2QA9E 3BTTE 1ZGIA 3MMGA 1C4U2 1C9PA 3STJA 3MFJA 3SUFA 4CR9A 1NC6A 4FU8A 1SLWB 1KTSB 1CA0B 1QRZA 1ZR0A 2A4GA 1OP2A 3SI3H 2C4FH 4JYTA 1TA6A 1KYNA 1O39A 1HJ9A 3SV6A 1C5XB 1DM4B 1RIWB 1V2UT 3ITIA 1HAOH 3N7OA 1RRKA 5EQRA 2O8UA 1C1QA 1UCYE 3RXLA 3UQVA 1Z7KA 2ODYB 1FXYA 1SLXB 1MTVA 2AEIH 1HPGA 1O2RA 3TU7H 3UFAA 1UTPA 2BTCE 2THFB 1C5QA 1AHTH 5EPYA 7ESTE 3MYWA 4YOGA 5EGMA 4OGXA 2PHBA 2UUFB 2ZHDA 1UVTH 1AY6H 2ZO3H 2F9UA 1PQ7A 3IITA 5J4QA 3P8FA 3AVZA 2ZTYA 2OCVB 3RXIA 1BITA 2ZF0H 2QN5T 1P03A 3RUOA 2VVUA 1O3EA 3QGJA 5DP5A 1P11E 2GD4B 1CA8B 1TNJA 4AN7A 5I25A 1H9LB 3SV8A 3RXOA 1AWHB 2GV6A 1SGYE 2FWWA 1ANBA 2GGVB 3DD2H 1O2ZA 3GYMA 3RXHA 4NSYA 1KDQA 1GDQA 2VWNA 1ZHPA 1ZZZA 2Y82A 3KGPA 1TGTA 3RXPA 2D2DA 3HK3B 2A4OA 3GDSA 5E0JA 1TLDA 4KGAA 2SGPE 4NIXA 3ZZCA 1VGCC 3T27A 1DWDH 4X8TH 1TE0A 1O3LA 4ZKNU 3CS0A 1PPFE 2ZGHA 4A1XA 1TX7A 3UUZA 1YPKH 3LKWA 2Y7ZA 1E35B 1CT0E 1LHDH 4O03A 2F9VA 1NU9A 4YLUA 5L2ZH 2C8WB 2FO9A 2C93B 2QIQA 1KY9A 1J14A 2PKAA 2A0QB 2O8LA 1HBTH 2ZCHP 2TGTA 5GJ4B 4GCHF 1ZYOA 4XBDA 1ELCA 3EA8A 3IWMA 2YNAA 1MBMA 3E0NB 2WUBA 1HV7A 1PYTD 2BXUH 1GBKA 1TPPA 3RXJA 1LTOA 3GCTG 3HATH 2GT8A 1AB9C 1DOJA 4U32A 1AZZA 2PKSB 1FN6A 3U1JB 3LU9B 2QF0A 4DG4A 2WPLS 1CU1A 4ESTE 1HAIH 3C1KA 2ZGJA 4Y8YA 3T5FH 1LHFH 3HKJB 1F5RA 3T25A 1D3TB 2G5VA 1GBIA 1A0JA 5FCKA 2OTVA 5EG4A 4ABBA 2V6NA 5L6NH 4ZXXH 1S81A 3E16B 2SNVA 4ZKOU 3LT3A 6GCHF 2PLXA 2H2ZA 1MAYA 1XUFA 1UTMA 3QGNB 1HAVA 4OS2A 1ZMNA 5EQSA 2VIQA 3E1XB 1C5YB 4TY7A 4IBLH 4X2YA 4X6MA 2P3TB 3ZYEA 3Q3KA 4DT7B 3HGNA 1O3HA 3MTYA 2KAIA 2VB0A 1U6QA 3FAOA 1KXCA 3S9AA 2O9QA 1TNIA 1ZTJA 2ILNA 4YTAA 2C8XB 2ZPQA 4GHTA 5HXFA 1GGDB 2P8OC 2GP9B 1ZPZA 3TIUA 1EXFA 5A0AE 2SFAA 1QGFA 2FEQH 3SI4H 2R9PA 1ETTH 4A1TA 1E37B 2GZ8A 2ZDKA 4LOYH 5EXLA 1O5EH 1ZMJA 3H7OA 1AZ8A 3E6PH 4WMEA 2BVRH 7KMEH 3A7WA 1C5VA 3OSYA 3GY5A 3ZZ6A 3FP7E 4ABGA 1PPZA 8ESTE 2QYIA 4U30A 2PR3A 1TGCA 4MNVA 1HLTH 5AHGH 2CJIA 2WUCA 1O2SA 2QC2A 1DANH 1TPOA 4MPVA 4RN6A 3A8AA 4INKA 3SNBA 3QX5H 1NFWA 3MNCA 3PO1B 1W8BH 1QBOA 3BTEE 3TJNA 1MMJN 1DT2A 2AGEX 1TA2A 3A86A 4O9VA 1IQEA 1SGCA 4JK6A 1GBJA 3A89A 3NCLA 3ZVGA 3ODDA 1KXDA 3BSQA 5HM2A 1O5BB 3K6ZA 1BBRK 4D7GA 1GVZA 4KTCA 1UCYK 2YNBA 2FLRH 6CHAB 4Q80A 3PMBB 1Y3UA 4ISHH 3NK8A 1MCTA 2V0BA 3ZZ7A 1TPSA 2FOEA 2VIWA 3KNXA 2FOAA 5ABWA 1QJ6B 1SHYA 1GCTB 1GI7B 4FUHA 3RC4A 3TH2H 2GMTC 3AAUA 2WV5A 3SGQE 1AKSA 1RS0A 3ZVFA 3HPTB 3OY5U 1O3CA 2SGQE 1SI5H 3RXBA 1N8OC 1UTQA 4JZIA 5J4SA 1S0QA 3GDUA 3STIA 1BMMH 2VWOA 3FZZA 4Y8ZA 4AG2A 3L6PA 4VGCB 1KLJH 3RU4D 3QZRA 1P12E 1ELEE 2BMGB 1ABIH 4A6LA 1EX3A 1WQSA 3OYPA 1Y3XA 3ODFA 3FZDA 3SBKA 4GPGA 4KTSA 1KXFA 1ANDA 3SU3A 2ZHEH 4GAWA 4K8BA 3RXMA 1EJNA 2IPHA 2ZU4A 3LPRA 1GBMA 1OWEA 2VWMA 1EPTB 1LVYA 1FZZA 3A80A 1QJ1B 2D1JA 4ISNA 1C2DA 2AIQA 2H5CA 5FX6A 5JDUB 2K1QA 1FJSA 3M36A 1ELVA 1OWJA