2FYRA

Crystal structure of norwalk virus protease grown in the presence of aebsf
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
181
structure length
171
Chain Sequence
b'APPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like cysteine proteinase
publication title X-ray crystallographic structure of the Norwalk virus protease at 1.5-A resolution.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 41
structure length 171
sequence length 181
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fyrA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fyrA01
1C4V2 4ABDA 1N1LA 1DANH 1GGDB 1FI8A 1RD3B 3SO3A 3T26A 3VB5A 1NM6A 4X8SH 1Y3UA 3TNSA 2YOLA 1FY5A 1OWJA 2J94A 2FODA 3I29A 4NFFA 1HJ8A 2AMPA 3RMOH 3ZZDA 1O3OA 3ZVDA 4Y10E 3QO6A 1QNJA 1TALA 1P3CA 4WF8A 2Y7ZA 1E37B 1QL8A 4MNYA 2BY9X 4CRFA 1YCPM 5T6GA 3RXMA 2LNCA 2Z7FE 1UHBA 1KY9A 3PTBA 1UCYH 3PM3A 4MLFB 2FXRA 4ABEA 3ATIA 1ABJH 1NU7B 2PGQB 2ZIQH 3ZZBA 3SJ8A 2I6QA 4MPUA 3SUFA 2UWLA 1LVMA 3KF2A 1B5GH 4NIWA 1TWXB 1J16A 5HYOA 1AY6H 1O3FA 3EQ0H 1AQ7A 2XCFA 4DIHH 5CHAB 1BQYA 2QF0A 1EAIA 1GHZA 1SLVB 4J2YB 2GD4B 4NIYA 1S84A 1TBQH 3EE0B 4FU8A 1AWHB 1C2MA 1GHYH 2ZKSA 1G3CA 4SGAE 1GBMA 6CHAC 1TQ0B 1RRKA 4I33A 5C2ZA 1GJDB 1O5DH 1F0TA 1GJBB 1RFNA 2PW8H 5E0JA 5A0BA 2TBSA 4ASHA 4ZUHA 1F0RA 4GCHF 2B5TB 2WUBA 3RXAA 1N6XA 2R2WU 1ELVA 3NWUA 1V2JT 4OS5A 2O9QA 1MKWK 1FAKH 2FZZA 1LHDH 2K1QA 1CHGA 3UOPA 2BQWB 4QT8C 2VIPA 4UFGH 3V0XA 9LPRA 5JBTA 2BD8A 1T4UH 2A7JA 3A8DA 2FYQA 1XUKA 1O5GH 2ZFQH 1CE5A 1ZPBA 2PGBB 1TGCA 1O3HA 4Q7YA 1IQIA 3M3TA 3RXTA 4THNH 2QYIA 3ATWA 4E05H 1IHSH 5EQRA 1MCVA 5J4SA 3RLYH 2VJ1A 3A89A 1JRTA 2A5KA 2P8OC 1UCYE 1ELTA 4NZQA 2R3YA 1B0EA 3BTEE 4JMYA 4TYDA 1GJ7B 5EG4A 4WXVA 3L6PA 3HK3B 1LPGB 3T2NA 3S69A 3UNSA 1DS2E 1H9IE 1ETTH 2OINA 3KQDA 1C5NH 1CA0B 2ZFTA 1UTKA 2C3SA 4ABBA 2PKSB 3SJIA 1C1VH 5HM2A 4A92A 5FPSA 1GHVH 2ZG0H 3M5OA 1P10A 2WINI 1LHGH 2VH6A 1WYKA 1A7SA 1GI4A 1HXFH 3EAJA 3U98H 6LPRA 1OOKB 5EPYA 4O97A 4KELA 3LGUA 3RC4A 2VINA 2VVUA 5I25A 2Y5GA 4XBCA 2BDCA 3U1IB 1Z71A 2WPLS 3E6PH 3QK1A 1CO7E 1SGRE 4IGDA 1HJAB 2RA3A 3RXUA 1AI8H 4HZHA 4NIVA 3SV9A 2FS8A 3L33A 1DLKB 4ABAA 1MTVA 1TNGA 2B9LA 2HPPH 1W0ZU 1ACBE 5FBIA 2A32A 3CS0A 2XWBI 3ZYDA 3RXHA 1CGHA 1Y3VA 2ZHDA 2FDAA 1HBTH 3BG8A 5DP8A 3T27A 5LPEA 4XSKU 1LPZB 1FN8A 3BTME 3BF6H 2F9VA 4X8UH 2VWOA 1BMMH 2G81E 1EP6A 1T8LA 2ZF0H 1OXGA 4A6LA 2ZTZA 1QCPA 5LPRA 3M3VA 2OCVB 1HAOH 2XYAA 1MU6B 2UUYA 1N6YA 2XC0A 2FPZA 2IOTA 3A86A 1A5IA 1E34B 5G4BA 3BTDE 3RXOA 1DITH 3TU7H 2ZFPH 1XXDA 2OBOA 1Y3WA 1P9UA 1HFDA 3OU0A 3SNAA 1KXCA 2SNWA 3UFAA 1BBRH 2GCHF 1SGIB 3HATH 1HIAA 1C2IA 3P17H 1ETSH 1D3TB 1S82A 2R0LA 1CHOF 3UTUH 1NRSH 3URCA 3HPTB 1NFXA 5SGAE 4CH8B 2OLGA 4HFPB 2XC4A 4AG2A 4YO9A 1ZMLA 3M5NA 1NPMA 3PB1E 4AOQA 2FTMA 2ZFRH 1KDQB 3S9BA 1VZQH 1HAVA 3TJNA 2ZCKP 3FP6E 2J4IA 3QGJA 3RXFA 5F8ZA 5EU8A 1GG6B 1C2KA 3P70B 3MWIU 2O8UA 1IOEA 5TJXA 1F5KU 1MTWA 1XKBC 1D6RA 2FM2A 3ELAH 4WMFA 3A88A 1E0FD 2F9NA 1Z1JA 3BEUA 2BOHB 5TCAA 3D23A 2FS9A 1W0YH 2BYAX 4OS4A 1AB9B 2ZI2H 1OWIA 3R0FA 2BOKA 5DPAA 1UTQA 4K1SA 2QF3A 1BMLA 4DURA 1PPBH 1W10U 2YNBA 1EB2A 3QDZB 2HOBA 4BAOB 1GBAA 1UTMA 1EXFA 1T31A 1TNJA 1NZQH 1HAGE 1RXPA 1YCPH 1C1WH 4TWYA 3UREA 2ZHQH 1BBRE 3MU5A 4MTBA 2V35A 1EZXC 2EC9H 1C1PA 3G01A 5AF9H 2TGPZ 2ZPSA 3H7OA 2UUFB 4B76A 1TMTH 1LVOA 2BLQA 3SQHE 1KLJH 2QGRA 1Z8GA 5A8YA 3VGCB 2EA3A 2W7SA 1C1RA 5DK1A 4BAQB 2ZDAH 4BAHB 3P8NA 1O2UA 3AASA 2CHAC 1V2PT 2GDDA 4K8YA 4UFEH 2NU0E 1PYTD 1O2OA 4CRGA 2BLOA 3RU4T 3RUOA 1IQJA 1EJNA 1GVLA 1TPPA 1YYY1 1VITF 5E2OA 4OS6A 2SNVA 1IQFA 1OP0A 1ZRKA 1LKAA 1TA2A 2BDGA 1V2LT 1BTPA 1V2RT 2BD7A 1AO5A 2A0QB 4XFQA 3UWIA 1HDTH 2P94A 5TCCA 4ABJA 1T4VH 2W7UA 2VIDA 1SL3A 2WV4A 1Z8JB 4JYUH 4H6SB 1PQ7A 1BMNH 1GVZA 1ARCA 4TWWA 2ZDNA 4K2YA 1MKXH 3IWMA 2OBQA 2WUCA 3SUDA 1T8OA 4LXBH 5EW1H 3PLPA 3A8BA 2NU3E 3A7YA 5FCRA 1KTSB 1O3AA 3BV9B 2GCTC 2VWMA 3TK9A 2A5IA 2DE8A 3M37A 1NN6A 1XVMA 1PQAA 1LQEA 3DUXH 9ESTA 1LCYA 1ZHPA 2GZ7A 4O3UA 4X6PA 1F92A 4AORA 1ZJKA 3O8CA 2A45B 3GCHC 1F5RA 4KTUA 2BY6X 3FAOA 1CVWH 5JDUB 2ZEBA 4U2WA 1P12E 3QUMP 1OS8A 2XW9A 2ZFFH 1L4ZA 3KQBA 4R0IA 1VITH 2UWOA 3MMGA 4MQAA 3TGJE 1FONA 2Z3EA 4AGJA 1GBEA 4Q80A 2FOHA 1QRZA 2P3FH 3ZYEA 2D2DA 2W3IA 1P2JA 3FZDA 2D1JA 3O8BA 5FX6A 2V0BA 1YLCA 2Y81A 3M61U 2AEIH 4DJZB 2F91A 2BHGA 3UR9A 3K6YA 2H9TH 5I46H 3LJJA 1SGFG 3UPEA 1HB0B 2JH0D 4B2AA 2W3KA 2B7DH 3PWCA 1HAXB 2P3TB 1BTUA 3KHVA 5E0HA 2BXTH 4A1XA 2ALVA 2FLRH 4DVAU 1GMDF 3BN9A 5K0HA 1MTUA 1C2HA 1SC8U 3ZZ3A 1DWDH 2Q6DA 1NY22 5C67A 3BG4B 2BMGB 2F9BH 2FTLE 3ZZ5A 2ESTE 4B71A 3DFJA 4B2CA 1F0UA 1ZGVA 5ETXA 3BSQA 2XC5A 1GBKA 4J1YA 1DXWA 1A2CH 3RXBA 1T8NA 4WVPE 3N7OA 1O5CB 1TMUH 3LDXH 3BEFB 1GHAG 4E06H 2J34A 1WSSH 2FOCA 4KTCA 3A80A 1YCPK 4ZXYH 1P2OA 1RIWC 1GJ9B 2G55A 2PTCE 1C5ZB 3FZZA 2C90B 3UR6A 3T29A 1LPKB 1O38A 4NG9H 1ANCA 1C2EA 3LH1A 1SOTA 1WOFA 1WCZA 3MTYA 1O33A 3ZZ8A 2H1UA 4ISLA 2FX6A 4NSVA 5F6MA 1TBRH 1GBHA 1VCPA 3AW0A 5EODA 3ZZ6A 3M5MA 3PMHB 3SN8A 1ELCA 3RXVA 2UUJB 1AHTH 3RC6A 1P2KA 2AS9A 1C2DA 1SSXA 4LOYH 1O2SA 2VVVA 2P3UB 1GHWH 3TPIZ 1L4DA 2VWLA 3TK6A 1SBWA 3AAUA 4O03A 3EYDA 1EZSC 2STBE 1Z7KA 2ZZUH 3B9FH 4D7FA 2WPHS 2HALA 3GICB 3EGKH 4ZROA 1P57B 4JCNA 1QBVH 2BDAA 1FIWA 5EXMA 4KP0A 1O2RA 4TY6A 4F49A 1O2ZA 1W14U 3GY2A 4ZH8A 4Y79A 1NTPA 3RU4D 1NRPH 2ZQ1A 3MU4A 1AZZA 4BNRA 1XXFA 4BOHA 1ZTKA 4ZKOU 3EA7A 3K9XB 1MH0A 4JK5A 3UUZA 1NFYA 1NESE 2HWLB 1IQGA 1PPHE 2J9NA 3F9GA 4FUIA 2C8ZB 1MBQA 4INKA 1H4WA 1Z8IB 2AGIX 1ZHRA 4FUDA 1P06A 4CR5A 1CU1A 5DGJA 3BIUH 1SGQE 1TX8A 4TPYA 2STAE 1GJAB 3KQCA 1JOUB 1UTPA 5L2YH 1WBGB 3A84A 3TIUA 4GCHG 4R8TB 3HGNA 1YPHC 1ESTA 2HVXA 2J38A 3OSYA 3W95A 1GBCA 1ETRH 2FMJA 3GY7A 3DHKH 1LHFH 2NU1E 1C5QA 3SHCH 1LHCH 1WAYB 2ZP0H 1IQMA 2BZAA 3MU8A 4B74A 2OD3B 4UD9H 4WXIA 2HGTH 2XXLA 2HNTC 1O2YA 1D3QB 1HIAB 1ARBA 3EDXB 1ZTLA 1UK2A 1T7CA 3F6UH 3M36A 4NSYA 5EOKA 3UNRA 3RM2H 1FPHH 3P92A 1PPCE 4YT7H 1LDTT 4Y7BA 2ANKH 1GJ6A 4IC6A 1GI5A 5C20A 1A3BH 1O3GA 1OSSA 1ZYOA 2J95A 1O3BA 3PO1C 1RS0A 2BX3A 1HAVB 5EXNA 5DP9A 1X7AC 4ABHA 3F9HA 2OUAA 1C5OH 4HI3A 2FOGA 2ZO3H 5HMAA 4AYYB 1SB1H 1NO9H 2ZDMA 1K1IA 4CHAC 1O31A 1EATA 1TLDA 3WY8A 5JB8S 3UNQA 5DKMA 4D7GA 1TAWA 1XUGA 4LK4A 3TH2H 2UWPA 1V2QT 4GLYA 4ABFA 3SU0A 1W7XH 3SNDA 4DY7B 3STIA 3MHWU 2PSYA 4DW2U 1O34A 1C2GA 1AIXH 1O39A 3LONA 4BTIB 3SBKA 1WUNH 1ESAA 2D26C 2PUQH 2V3OH 1P11E 1SVPA 2ZU3A 1JBUH 1U6QA 1UTLM 2GT8A 7GCHF 3BTTE 3FANA 4E7RG 3E3TA 3BTQE 2QC2A 2FOFA 1IQNA 5IYTA 2PFEA 2PWXA 2ZGJA 1FJSA 1EUFA 1C9TA 1ZR0A 1AKSA 5AVDA 1L2EA 1EOJA 1K1MA 4WH8A 4SGBE 3Q77A 2Z9IA 3MO9A 1DOJA 3B8JA 1GJ8B 3ATKA 1QRWA 1FPCH 3TJVA 1IQLA 1SQOA 1WQVH 3ZZAA 1UO6A 1BITA 1Q31A 5E2PA 2A7HA 5A2MH 1ZOMA 1BTXA 3B23B 1HRTH 2FP7B 3F68H 3S9AA 1PPGE 4CRBA 1C5TA 4A5TS 3SU4A 1HNEE 1UVPA 1HCGA 1VJAU 1MAXA 2KAIA 4MVNA 2R3UA 1LQDB 1AE5A 5LH8A 1DY9A 1RIWB 1GHBF 2QN5T 5EXLA 4DIIH 1D9IA 5FCKA 3O8DA 4H42U 4K60A 2FI3E 1FLEE 4WMDA 3VB4A 4JZFH 1C2FA 1QL7A 2A4OA 2FO9A 4F4OC 2AMQA 2ILNA 2A2QH 1O2IA 1C5WB 1GI1A 1KIGH 4YOJA 2C93B 1SHYA 1QQUA 3SJKA 4GUXA 2GCHG 4CH2B 4I8HA 1GI9B 4U01A 1ELFA 1DY8A 3GYLB 2ZGXH 3ZVGA 3TGIE 1DSUA 1CHOG 3GCNA 4NWKA 5GCHF 3T25A 1V6DA 1XM1A 3ODFA 3OTJE 2HPQH 1GJ5H 1XUHA 5GJ4B 1DVAH 1G3EA 1V2UT 1EZQA 1MU8B 1Z1IA 4GHTA 4ZHMU 1TNHA 2R2MB 2QCYA 3UQOA 2HNTF 1QB6A 5C1UA 2VIWA 1OWDA 1SHHB 2IN2A 2JETC 4CBNA 1QL9A 1YPKH 1MD7A 1TABE 3R3GB 4X6NA 3T62A 4XE4A 5AFZH 3AAVA 2ZU2A 3EA8A 1UK4A 1UVUH 3S0NA 3ATMA 1BIOA 2P16A 1L1GA 3M7QA 3RDZA 1SLXB 4JZDH 1C5SA 2EEKA 1WQSA 4ISHH 1K1NA 1AVGH 1S5SA 5CE1A 1H9HE 1OP8A 4FXGH 1BOQA 3JZ1B 3SI4H 2PLXA 5C5OA 1EAUA 1TOMH 1ZRBA 1ZTJA 3LGIA 4WWYA 1K9OE 1QTFA 1KXDA 1IQHA 4FUGA 3BTHE 1GBTA 1BDAA 1TBZH 1DXPA 3MNBA 2EI7A 1HYLA 3CENA 3SV2H 3GOVB 1ELDE 1ZSLA 1O3PB 3O8RA 3HK6B 5DP6A 7ESTE 1ZHMA 1EQ9A 3E90B 1AVXA 1ZSJA 2JH6D 1O3MA 1N8OC 2Z94A 2SGEE 1K21H 8GCHF 1VCQA 1G32B 3MO3A 2CN0H 4FVBA 3QLPH 1TB6H 1GWAA 3TH4H 2W26A 4DG4A 3A7WA 3MH5A 1DWBH 2WPIS 2DE9A 1G3DA 4DT7B 1K22H 3SU5A 4D9QA 2FI4E 5ABWA 1O2KA 2ZGBH 4IN1A 2GV6A 3VXEH 1BRCE 1QIXB 3PO1B 3RMMH 2THFB 1C1NA 1VITG 1YPLH 1BRAA 1UJ1A 3ODDA 4GSOA 2C4FH 2GDEH 3RM0H 1UVSH 1Y3XA 2XBWA 4NCYA 2ZU5A 2Z3CA 1C5MD 2Y6TA 3LT3A 1QGFA 2FOAA 2TGTA 4KKDA 1LTOA 3EA9A 4I32A 2ODQA 3TK5A 4CHAB 1O3KA 3ZVBA 1A4WH 4MNVA 3KNXA 4JZ1A 2A1DB 1SGCA 2ZTXA 2J92A 3MU1A 3TH3H 3M7UA 4AB9A 1HXEH 1AN1E 1O3CA 1YPJH 1YPHE 3E0NB 1SFQB 1JIRA 3PTNA 1D4PB 2XNIA 3ZZCA 1TQ7B 3GDVA 1GI3A 2BQ7B 1XVOA 3VEQB 3PYHA 6CHAB 4FVDA 2UUKB 3BTKE 1T8MA 1K2I1 1O2TA 1TMBH 1KSNA 4DGJA 4Y7AA 1AWFH 3RMLH 3GCOA 5F8XA 3RXKA 2HNTE 2ANYA 3FVFB 1AFEH 1A0HB 2QAAA 2ZU4A 1ELEE 2V6NA 4MPVA 4Y71A 4M7GA 5DO4H 1C9PA 1TFXA 4U32A 3RLWH 1P0SH 1D3DB 1INCA 1F0SA 1MUEB 4OS7A 1EZUC 4INLA 3RXDA 4ZKRU 1V2OT 5JPMH 3RXIA 1O3JA 1O2NA 1MZAA 4X8TH 3Q3XA 1C2JA 2XBYA 1MQ5A 4FUEA 4K69A 3RXEA 1GJ4H 5GIBA 4UE7H 2P8OB 3AW1A 3LIWA 1EAXA 1JIMA 2HRVA 1GMDG 1CSOE 2AFQB 5LPFA 3ZV9A 4BTTB 4D76A 3OY5U 2ZPRA 3BTFE 3MH4A 1YC0A 5C1YA 2CV3A 3RXLA 4I8KA 1BJVA 1HJ9A 3A7ZA 4KTSA 1YBWA 2F9OA 4LZ4B 4Q2KA 5HGGA 4MDSA 1O2MA 3A7TA 4IMZA 3SGAE 2QY0B 2QXIA 1CBWC 2CGAA 2YNAA 3P95A 4MG3A 2GP9B 5EQSA 1SOZA 1GGDC 3OX7U 4FU9A 1GMCF 5GXPA 3E91A 4ZKNU 1UHBB 2ODYB 2ZGHA 1BTHH 1EPTA 1EOLA 5H4IB 1MTSA 2JETB 2B0FA 2BD5A 2ZDVH 2AIPA 3A8AA 3ZV8A 3F1SB 4I31A 3U1JB 5AHGH 1AUJA 2FLBH 2WPJS 4MPXA 1WTGH 3C1KA 3MI4A 1BZXE 2B8OH 4K5ZA 3NZIA 1PPZA 3RXCA 3SHAH 3BTWE 3ZVEA 4MNXA 2P59A 1E38B 2AH4X 3SZNA 4K8BA 3UQVA 4X2WA 1QURH 1SGEE 1IQEA 1PQ5A 3ZVFA 2H9EH 4NZLA 1BRUP 1NRNH 1P9SA 2F3CE 2TPIZ 2VH0A 2Z3DA 1ESBA 1SGPE 1O3NA 1C5VA 4I7YH 2FOBA 2GZ8A 4CRAA 5CHAC 1HAHH 2OQUA 2R0KA 1DDJA 1LO6A 1TA6A 2NWNA 2Y7XA 2CMYA 2FEQH 4X6MA 5A8ZA 1GPZA 1A46H 1IHTH 1AKSB 1NRRH 1UTOA 3VB7A 3S7HB 4YT6H 1TOCB 1Z8RA 3IG6B 2GTBA 3SOSA 5JBCS 3PROA 1Y8TA 4X0WU 4VGCC 1FNIA 1BJUA 1O3IA 1TGSZ 3FFGA 1AU8A 1MCTA 8KME2 1A1RA 1VR1H 1O35A 1BTZA 3ZZ4A 1P2NA 3ESTA 1O2QA 1Y5BT 1ELAA 1TGBA 4RN6A 4BAMB 4CR9A 1A3EH 3P8GA 2G4TA 4WH6A 2A2XH 3UOUA 1KLTA 1GI2A 3SU1A 1O2VA 1G2MA 1PFXC 3U9AH 5A0CA 1RTKA 1CQQA 2FESH 1O5AB 2RG3A 3M5LA 1GBIA 2CF8H 3FP7E 5A09A 4D9RA 1DFPA 2XBVA 1V2VT 3GY3A 1GL0E 1W3CA 4YLUA 1LMWB 2VIOA 1P2QA 3F9FA 1SR5C 1TONA 1C5YB 1AMHA 2V3HH 1CA0C 5EGMA 1ZSKA 1YM0A 2JKHA 2JH5D 1C1MA 1Z6EA 3Q3KA 1MZDA 4ISNA 2TGDA 5T6DA 4I8GA 3TVJB 1O2JA 2CXVA 3CP7A 4B1TA 1EPTC 4A1TA 1O32A 2SGAA 1QA7A 2I6SA 1J8AA 4Y0YE 1ANDA 1NU9A 3VPKA 1TYNA 4IBLH 5ESBA 1MD8A 1VGCC 4A1VA 1FIZA 2ZQ2A 1YGCH 2EI6A 3GCTF 1SG8B 1BT7A 3GYMA 2Z6BD 3V3MA 1XKAC 2A5AA 1EAWA 2BY7X 1SGNE 3GDSA 4RSPA 4X1RU 3E16B 6GCHF 1O5FH 1HJAC 1CGIE 3KIDU 1T32A 1ZGIA 3MH7A 1K28D 1QJ6B 4K1TA 1HAPH 2WYGA 4GAWA 1K1LA 1UVOA 4ISOA 1A5GH 2VNTA 1KXFA 1L0ZA 1W8BH 2R9PA 2BY8X 5K7RA 2C8WB 3RXRA 2VU8E 2Z9GA 1HGTH 2CHAB 1RTLA 1OYTH 2DUCA 1OP2A 1BTYA 1TNLA 4X1SU 3URDA 7KMEH 3E0PB 1BHXF 5FXLA 1SI5H 4ZHAA 3RXPA 4ESTE 4UONA 1GBFA 4D8NA 3P8FA 5EW2H 3U8OH 3ZZ7A 1ELGA 1GVKB 1HPGA 5A8XA 1A5HA 3D49H 1YP9A 4AG1A 3D62A 2ZDLA 3E1XB 3GISB 5E8EH 2GV7A 2BVRH 1S83A 1CA8B 1ZMJA 3MU0A 4HGCA 4X1NU 3NXPA 1TGTA 3ATLA 1YPMH 4K3JA 3SU3A 5DP4A 3C27B 1GI0A 1NT1A 2NU4E 4NGAH 1TPAE 1OX1A 4ZHLU 1JWTA 2BDBA 1AGJA 1G36A 4WMEA 1GHBG 4UFDH 1Y59T 2GCTB 1QQ4A 4JK6A 4E7NA 1AE8H 4Y11E 4FU7A 2OQ5A 4JZIA 2ANWA 2ODPA 1J14A 1GMHF 1E35B 4KGAA 4OS1A 4AB8A 3NKKA 1KLIH 4X2VA 1O2XA 2PTNA 3SUEA 1AD8H 3GCHB 2ZC9H 3UY9A 3LGTA 5HXFA 1C5LH 3SORA 1WV7H 3MNXA 2H2ZA 2PHBA 3M35A 1GDQA 1O5EH 2ZCHP 1BHXB 5GCHG 3TITA 3KGPA 1K1PA 4YESB 4IN2A 1IQKA 1GG6C 1IAUA 4UFFH 3TLOA 1O30A 1O0DH 3SU2A 2G51A 5DG6A 4ISIH 2GKVE 1DX5M 2A4GA 5DP7A 1P09A 2ALPA 3P8OA 4FUCA 1TRMA 2BD2A 1RJXB 1TIOA 3RXJA 1E36B 1J17T 5IDKA 1S85A 2SGQE 3LU9B 1GCDA 1Q2WA 1SLUB 1AB9C 3I78A 1NC6A 3QTOH 4LZ1H 1YKTA 1JRSA 8ESTE 4JYVH 1SLWB 1XUFA 2BXUH 4ZMAH 1XMNB 1MBMA 1TE0A 2SGDE 1A61H 3A8CA 2WV5A 3NUMA 3RMNH 3FP8E 4CRCA 5BPEA 1MAYA 3NCLA 1PPFE 4VGCB 3F9EA 1ZPZA 1V2KT 1MQ6A 1QB1A 1W11U 2PKAA 2BQ6B 1B7XB 3GY4A 1K1JA 5FHTA 1GDUA 1PPEE 7LPRA 1KTTB 2ZTYA 1BUIA 4YOIA 3BIVH 3VGCC 1G37A 1W2KH 3KCGH 1TX6A 5ESTE 1EASA 4O9VA 1V2ST 4YM9A 1BRBE 1QB9A 1FQ3A 1YPGH 1BMAA 8GCHG 3K65B 4Y8YA 2H6MA 2OC0A 4AFSA 2BD4A 2FYRA 5FPYA 1PJPA 3JZ2B 2Z9KA 2OTVA 2A7CA 4GVUA 4HTCH 5C3NA 1QR3E 4ABIA 2G8TA 4U30A 3V12A 3VXFH 4NFEA 5L2ZH 1M9UA 3OY6U 3LH3A 1L1NA 1GDNA 1GJCB 1FZZA 3HKIB 5C1XA 2P95A 1HV7A 2GVFA 1FY4A 3TJUA 1Y3YA 3LC3A 4X2YA 3OYPA 1C5RA 3QX5H 1O3EA 2BM2A 2ZCLP 5GDSH 1EPTB 2M5TA 2ZECA 4TY7A 2FX4A 3HGPA 1DT2A 3KN2A 1VGCB 4RKJB 1GCTC 2XWAA 2ZHWH 2BLVA 3SV8A 1VJ9U 2XRCA 3E8LA 1C4U2 1UMAH 4WY3A 3GY5A 3ITIA 5A0AE 2PSXA 3TJOA 2A4QA 4YTAA 4YZUA 1OWHA 1FV9A 4INHA 4Q7XA 1GI6A 1O36A 1C5PA 1FAXA 1TRNA 3LJOA 1G2LA 3K2UA 5FX5A 1C1TA 1UK3A 2PUXB 1DUAA 4Y8XA 1TRYA 2TGAA 1LVYA 5CMXH 2GT7A 2FI5E 5AFYH 1TNIA 3H5CB 1C1SA 4XBDA 4Y76A 1TPOA 1CT0E 1QRXA 2GX4A 1UTNA 4NA9H 1YF4A 1YLDA 4WJG2 2BLWA 1G30B 4XDEA 4YLQH 1UCYK 3SI3H 3SU6A 3V13A 1WTHD 1P2IA 3LGVA 1O2LA 3QZRA 1DLEA 5EQQA 1O37A 1SPJA 1TX7A 4BXSA 2F9UA 2ZDKA 3MNSA 1ZZZA 2QXGA 2F83A 1TNKA 2G00A 4OGXA 3BG4C 2ZFSA 3A7VA 3BEIB 1GBBA 2H5DA 2BDIA 4NWLA 1QBOA 1C5UA 1QBNA 1SGFA 2OC8A 2ANMH 1S0QA 1ZLRA 3P6ZB 2FWWA 4B75A 4BANB 2O8LA 1GBJA 1W13U 1DUEA 3M3SA 4Y0ZE 3ZZ9A 1SQAA 5FBEA 3NPSA 3RU4E 4OS2A 5PTPA 1XUJA 1O2GH 2RCEA 1ZPCA 3LGWA 5E0GA 3T5FH 5JYIA 4BXWA 2H9HA 1OYQA 1OKXA 1QY6A 1S6FA 1V2MT 5DJ7A 5JB9S 5L30H 4JYTA 2O8MA 3UIRA 1ZMNA 2H5CA 4X6OA 1UTJA 1BA8B 2GZ9A 2G5VA 1CT2E 1GMCG 3VFEA 1OPHB 3RC5A 2BD9A 1O3DA 2A4RA 2SGFE 4H6TA 3NK8A 1S81A 1ELBA 1J15A 4UEHH 2Q6GA 3RP2A 1QJ1B 1P8VC 1SFIA 2RA0A 4I8LA 2QA9E 3PMBB 2AGGX 1XX9A 2PV9B 2Z9JA 1AFQC 2BX4A 2VWNA 3LKWA 2GMTC 5T6FA 2QV1A 1O2PA 4MPWA 4AYVB 3RXGA 3PMAB 3S9CA 1NROH 1C5XB 2IPHA 1GBDA 4O3TA 1RGQA 2BB4A 1FXYA 3A87A 1H9LB 3I77A 1AVWA 2PR3A 3PWBA 4JZEH 3Q00A 1J9CH 4IW4E 2W5EA 4YOGA 1O2WA 5BRRE 4AFQA 2BVXH 4BTUB 1C1OA 3A7XA 1W7GH 1QHRB 1DWCH 3CS7A 3MNCA 1ID5H 4B73A 3A81A 2BY5X 3SV7A 1Z6JH 2G52A 1TPSA 3QZQA 2VIQA 1THRH 1MTNC 1DM4B 5F03A 4AN7A 2C8XB 1H8DH 3PLBA 5FAHA 3A82A 1A0LA 3SGBE 3STJA 2VGCC 4Z0KA 2IJOB 1PYTC 4ZKSU 3A83A 2WPMS 1GBLA 3SV6A 1DICA 2ZU1A 3AVZA 1BB0B 3ZVCA 2ZWLH 1ANEA 2TRMA 1SGYE 2VVCA 1EB1H 2G4UA 1W12U 1HUTH 1HAYB 4DOQA 5T3HA 4X1QU 4X2XA 4AFZA 4Q7ZA 2CF9H 5J4QA 1YPEH 2VB0A 2RDLA 4A7IB 1QA0A 1EX3A 2C8YB 4FUHA 2SFAA 3TGKE 1HAIH 1Y5UT 4UDWH 4ZXXH 3PMJA 2BDYA 1C1UH 4H4FA 1OWEA 2AGEX 2Z9LA 4CBOA 3S7KB 1V3XA 1GCTB 2Q6FA 1BTWA 3Q76A 1FY3A 4K1EA 1KXEA 3T28A 1P05A 8LPRA 1DWEH 1G9IE 2LPRA 1Q3XA 2BVSH 1O2HA 1JMOH 2XBXA 1MMJN 1G3BA 1BBRK 2WPKS 1UVTH 5B6OA 1QJ7B 3K6ZA 3SNEA 2ZA5A 4NIXA 4X8VH 2ULLA 1Y5AT 2Q1JA 4Z6AH 4ZAEA 2AYWA 3KQEA 1EP5A 1F7ZA 1GI8B 1L1JA 1HLTH 1OWKA 1FMGA 3Q3YA 2BTCE 1KXAA 4GPGA 3QWCH 3D65E 1P3EA 5FPTA 4X1PU 1DSTA 1FDPA 3DA9B 1TGNA 4ABGA 2A31A 1CT4E 3GCTG 1DE7H 1LVBA 1WU1A 2Y82A 3IITA 3VB6A 2ZNKH 3GY6A 2CJIA 6GCHG 1LHEH 1N8OB 3DT0H 3TNTA 3BTGE 2F9PA 1ORFA 2ZHEH 2OC7A 4IS5A 3SQEE 1GHXH 2PKAB 3LOXA 3SJ9A 2HLCA 3ENSB 5EPNA 1BCUH 1C4Y2 2KAIB 1NFWA 1V2NT 3GDUA 4MNWA 4Y6DA 3MFJA 3GY8A 4PROA 4B2BA 3MO6A 2OP9A 5HM9A 1VCWA 1ABIH 2FIRH 1KYNA 3SGQE 1XUIA 3LGYA 1D6WA 1NRQH 3SJOA 1C2LA 3MYWA 1EJAA 2ZGCA 3U8RH 4GHQA 2BZ6H 1QFKH 2AERH 4Y8ZA 3V7TA 4TPIZ 3SW2B 1DPOA 5F8TA 1HAZB 2Y5HA 2FOMB 1SQTA 2AIQA 1KDQA 2OC1A 2AMDA 2J2UA 5GWZA 3MH6A 3MOCA 1S6HA 2TIOA 4OGYA 3VB3A 4AFUA 2OXSA 2XTTB 3M7TA 2NU2E 1SGDE 4XOJA 1PQ8A 2PKSC 1D3PB 2ZPQA 2QIQA 2FOEA 1F2SE 3L3TA 2Y5FA 1THSH 1SGTA 1P04A 2XCNA 1MKWH 3RXQA 1H1BA 1LKBA 1GMHG 4FUFA 1K1OA 1A0JA 1GL1A 3U8TH 2Y80A 1THPB 2G5NA 2ZHFH 4FUBA 3LPRA 4IC5A 3PV4A 1AFQB 2GGVB 4CREA 2GMTB 1O3LA 1P01A 3KL6A 2ASUB 5JBBS 2QXJA 2VIVA 2BD3A 3SNBA 5LGOA 1GI7B 3RXSA 2WYJA 3KEEA 1RTFB 5GPIB 1V2TT 1NS3A 2EI8A 3DFLA 4AX9H 4NA8A 2QXHA 3ZVAA 1SMFE 4I8JA 2BDHA 1FY8E 4IMQA 1MKXK 4AZ2B 4RKOB 7GCHG 3W94A 1FY1A 3UWJH 1ZJDA 3HKJB 4FUJA 3LC5A 3PLKA 1AZ8A 2O8WA 4BAKB 4DCDA 1FN6A 1H8IH 2O8TA 1MTNB 6ESTA 1ANBA 1GHAF 1JXPA 5L6NH 1EKBB 3QTVH 3DD2H 1F5LA 1C1QA 2VGCB 3U69H 3QGNB 4CRDA 1AUTC 1P02A 4XBBA 1P03A 1NFUA 3SUGA 5DP3A 3QN7A 2P93A 4NA7A 1O5BB 1B0FA 5DP5A 2D8WA 1CBWB 2SGPE 1P2MA 1FUJA 1KXBA 1V2WT 1CGJE 4AGKA 5C5NA 5JBAS 3SNCA 1S0RA 1EJMA 3H7TA 3A85A
chains in the Genus database with same CATH superfamily
2WHXA 1C4V2 3VG8A 4ABDA 1N1LA 1DANH 1GGDB 1FI8A 1RD3B 3SO3A 3T26A 3VB5A 1NM6A 4X8SH 1Y3UA 3TNSA 2YOLA 1FY5A 1OWJA 2J94A 2FODA 3I29A 4NFFA 1HJ8A 2AMPA 3RMOH 3ZZDA 2WZQA 1O3OA 3ZVDA 4Y10E 3QO6A 1QNJA 5IK2D 1TALA 1P3CA 4WF8A 2Y7ZA 1E37B 1QL8A 2J5UA 4MNYA 2BY9X 4CRFA 1YCPM 5T6GA 1H8HD 3RXMA 2LNCA 2Z7FE 1UHBA 1KY9A 3PTBA 1UCYH 3PM3A 4FETA 4MLFB 2FXRA 4ABEA 3ATIA 1ABJH 1NU7B 2PGQB 2ZIQH 3ZZBA 3SJ8A 2I6QA 4MPUA 3SUFA 4ZCNA 2UWLA 1LVMA 3KF2A 1B5GH 4AC9A 4NIWA 1TWXB 1J16A 5HYOA 1AY6H 1O3FA 3EQ0H 1AQ7A 2XCFA 4DIHH 5CHAB 1BQYA 2QF0A 1MABB 1EAIA 1GHZA 1NBMD 1SLVB 4J2YB 2GJGA 2GD4B 4NIYA 1S84A 1TBQH 2QF4A 3EE0B 1AWHB 1C2MA 1GHYH 4FU8A 2ZKSA 1G3CA 4SGAE 1GBMA 6CHAC 1TQ0B 1RRKA 4I33A 1SKYE 1GJDB 1O5DH 5C2ZA 1F0TA 1GJBB 1RFNA 2PW8H 5E0JA 5A0BA 2TBSA 4ASHA 4ZUHA 1F0RA 4GCHF 2B5TB 2M2AA 2WUBA 3RXAA 1N6XA 2R2WU 1ELVA 3NWUA 1V2JT 4OS5A 2O9QA 1MKWK 1FAKH 2FZZA 1LHDH 1E1QD 2K1QA 1CHGA 3UOPA 2BQWB 3OAAD 4QT8C 2VIPA 4UFGH 3V0XA 9LPRA 5JBTA 2BD8A 1T4UH 2A7JA 3A8DA 2FYQA 2JJ1D 1XUKA 1O5GH 2IPQX 2ZFQH 1CE5A 1ZPBA 2PGBB 3WW7A 5C17A 1TGCA 1O3HA 4Q7YA 1IQIA 3M3TA 3RXTA 4THNH 2QYIA 3ATWA 4E05H 1IHSH 5EQRA 1MCVA 5J4SA 3RLYH 2VJ1A 3A89A 1JRTA 2A5KA 2P8OC 1UCYE 1ELTA 4NZQA 2R3YA 1B0EA 3BTEE 4JMYA 4TYDA 1GJ7B 5EG4A 4WXVA 3L6PA 3HK3B 1LPGB 3T2NA 3S69A 3UNSA 1DS2E 1H9IE 1ETTH 2OINA 3KQDA 1C5NH 1CA0B 2ZFTA 1UTKA 2C3SA 1W0JD 4ABBA 2PKSB 3SJIA 1C1VH 5HM2A 4A92A 5FPSA 1GHVH 2ZG0H 3M5OA 1P10A 2WINI 1LHGH 2VH6A 1WYKA 1A7SA 1GI4A 2JIZD 1HXFH 3EAJA 3U98H 6LPRA 1OOKB 5EPYA 4O97A 4KELA 3LGUA 3RC4A 2VINA 2VVUA 5I25A 2V7QD 2Y5GA 4XBCA 2BDCA 3U1IB 1Z71A 2WPLS 3E6PH 3QK1A 1CO7E 1SGRE 4IGDA 1HJAB 2RA3A 3RXUA 1AI8H 4HZHA 4NIVA 3SV9A 2FS8A 3L33A 1DLKB 4ABAA 1MTVA 1TNGA 2B9LA 2HPPH 1W0ZU 1ACBE 5FBIA 5HKKD 2A32A 3CS0A 2XWBI 3ZYDA 3RXHA 1CGHA 1Y3VA 2ZHDA 2FDAA 1HBTH 3BG8A 5DP8A 3T27A 5LPEA 4XSKU 3GS9A 1LPZB 1FN8A 3BTME 3BF6H 2F9VA 4X8UH 2VWOA 1BMMH 2G81E 1EP6A 1T8LA 2ZF0H 1OXGA 4A6LA 2ZTZA 1QCPA 5LPRA 3M3VA 2OCVB 1HAOH 2XYAA 1MU6B 2UUYA 1N6YA 2XC0A 2FPZA 2IOTA 3A86A 1A5IA 1E34B 5G4BA 3BTDE 3RXOA 1DITH 3TU7H 5CDFE 2ZFPH 1XXDA 2OBOA 1Y3WA 1P9UA 1HFDA 3OU0A 3SNAA 5EJ1A 1KXCA 2SNWA 3UFAA 1BBRH 2GCHF 1SGIB 3HATH 1HIAA 1C2IA 3P17H 1ETSH 1D3TB 1S82A 2R0LA 1CHOF 3UTUH 1NRSH 3URCA 3HPTB 1NFXA 5SGAE 4CH8B 2OLGA 4HFPB 2XC4A 2WPDD 4AG2A 4YO9A 1ZMLA 3M5NA 1NPMA 3PB1E 4AOQA 2FTMA 2ZFRH 1KDQB 3S9BA 1VZQH 1HAVA 3TJNA 2ZCKP 3FP6E 2J4IA 3QGJA 3RXFA 2J98B 5F8ZA 5EU8A 1GG6B 1C2KA 3P70B 3MWIU 2O8UA 1IOEA 5TJXA 1F5KU 1MTWA 1XKBC 1D6RA 2FM2A 3ELAH 4WMFA 3A88A 1E0FD 2F9NA 1Z1JA 3BEUA 2F4LA 2BOHB 5TCAA 3D23A 2FS9A 1W0YH 2BYAX 4B6FA 4OS4A 1AB9B 2ZI2H 1OWIA 3R0FA 2BOKA 5DPAA 1UTQA 4K1SA 3OE7D 2QF3A 1BMLA 4DURA 1PPBH 1W10U 2YNBA 1EB2A 3QDZB 2HOBA 2WV9A 4BAOB 1GBAA 1UTMA 1EXFA 1T31A 1TNJA 1NZQH 1HAGE 1RXPA 1YCPH 1C1WH 4TWYA 3UREA 2ZHQH 1BBRE 3MU5A 4MTBA 2V35A 1EZXC 2EC9H 1C1PA 3G01A 5AF9H 2TGPZ 2ZPSA 3H7OA 2UUFB 4B76A 1TMTH 1LVOA 2BLQA 3SQHE 1KLJH 2QGRA 1Z8GA 5A8YA 4HG6A 3VGCB 2EA3A 2W7SA 1C1RA 5DK1A 4BAQB 2ZDAH 4BAHB 3P8NA 1O2UA 3AASA 2CHAC 1V2PT 2GDDA 4K8YA 4UFEH 2NU0E 1PYTD 1O2OA 4CRGA 2BLOA 3RU4T 3F2HA 3RUOA 1IQJA 1EJNA 1GVLA 1TPPA 1YYY1 1VITF 5E2OA 4OS6A 2SNVA 1IQFA 1OP0A 1ZRKA 1LKAA 1TA2A 2BDGA 1V2LT 1BTPA 1V2RT 2BD7A 1AO5A 2A0QB 4XFQA 3UWIA 1HDTH 2P94A 5TCCA 4ABJA 1T4VH 2W7UA 2VIDA 1SL3A 2WV4A 5C94A 1Z8JB 4JYUH 4H6SB 1PQ7A 1BMNH 1GVZA 1ARCA 4TWWA 2ZDNA 4K2YA 1MKXH 3IWMA 2OBQA 2WUCA 3SUDA 1T8OA 2YMSC 4LXBH 5EW1H 3PLPA 3A8BA 2NU3E 3A7YA 5FCRA 1KTSB 1O3AA 3BV9B 2RFKC 2GCTC 2VWMA 3TK9A 2A5IA 2DE8A 3M37A 1NN6A 1XVMA 1PQAA 1LQEA 3DUXH 1KMHB 9ESTA 1LCYA 1ZHPA 2GZ7A 4O3UA 3MQKC 3U28C 4X6PA 1F92A 4AORA 1ZJKA 3O8CA 2A45B 3GCHC 5HIYA 1F5RA 4KTUA 2BY6X 3FAOA 1CVWH 5JDUB 2ZEBA 4U2WA 1P12E 3QUMP 1OS8A 2XW9A 2ZFFH 1L4ZA 3KQBA 4R0IA 1VITH 2UWOA 3MMGA 4MQAA 3TGJE 1FONA 2Z3EA 4AGJA 1GBEA 4Q80A 2FOHA 1QRZA 2P3FH 3ZYEA 2D2DA 2W3IA 4P00A 1P2JA 3FZDA 2D1JA 3O8BA 5FX6A 2V0BA 1YLCA 2Y81A 3M61U 2AEIH 4DJZB 2F91A 2BHGA 3UR9A 2KR7A 3K6YA 2H9TH 5I46H 3LJJA 1SGFG 3UPEA 1HB0B 2JH0D 4B2AA 2W3KA 2B7DH 3PWCA 1HAXB 2P3TB 1BTUA 3KHVA 5E0HA 2BXTH 4A1XA 2ALVA 2FLRH 3F2FA 1GMDF 3BN9A 4DVAU 5K0HA 4RT1A 1MTUA 1C2HA 1SC8U 3ZZ3A 1DWDH 2Q6DA 1NY22 5C67A 2W6JD 3BG4B 2BMGB 2F9BH 2FTLE 3ZZ5A 2ESTE 4B71A 3DFJA 4B2CA 1F0UA 1ZGVA 5ETXA 3BSQA 2XC5A 1GBKA 4J1YA 1DXWA 1A2CH 3RXBA 1T8NA 4WVPE 3N7OA 1O5CB 1TMUH 3LDXH 3BEFB 1GHAG 5B6LA 4E06H 2L6OA 2J34A 1WSSH 2FOCA 4KTCA 3A80A 1YCPK 4ZXYH 1P2OA 1RIWC 1GJ9B 2G55A 2PTCE 1C5ZB 3FZZA 2C90B 3UR6A 3T29A 2JDID 5CHBA 1LPKB 1O38A 4NG9H 1ANCA 1C2EA 3F0OA 3LH1A 1SOTA 1WOFA 1WCZA 3MTYA 1O33A 3ZZ8A 2H1UA 4ISLA 2FX6A 4NSVA 5F6MA 1TBRH 1GBHA 1VCPA 3AW0A 1W0KD 5EODA 3ZZ6A 3M5MA 3PMHB 3SN8A 1ELCA 3RXVA 2UUJB 1AHTH 2W6ID 3RC6A 4Q63A 1P2KA 2AS9A 1C2DA 1SSXA 4LOYH 5FL7D 1O2SA 2VVVA 2P3UB 1GHWH 3TPIZ 1L4DA 2VWLA 3TK6A 1SBWA 3AAUA 4O03A 3EYDA 1EZSC 2STBE 1Z7KA 2ZZUH 3B9FH 4D7FA 2WPHS 2EY4C 2HALA 3GICB 3EGKH 4ZROA 1P57B 4JCNA 1QBVH 2BDAA 1FIWA 5EXMA 4KP0A 2RDEA 1O2RA 4TY6A 4F49A 1O2ZA 1W14U 3GY2A 4ZH8A 4Y79A 1NTPA 3RU4D 1NRPH 2ZQ1A 3MU4A 1AZZA 4BNRA 1XXFA 4BOHA 1ZTKA 4ZKOU 3EA7A 3K9XB 1MH0A 4JK5A 3UUZA 1NFYA 1NESE 2HWLB 1IQGA 1PPHE 2J9NA 3F9GA 4FUIA 4B6EA 2C8ZB 1MBQA 4INKA 1H4WA 1Z8IB 2AGIX 1ZHRA 4FUDA 1P06A 4CR5A 1CU1A 5DGJA 3BIUH 1SGQE 1TX8A 4TPYA 2STAE 4ACAA 1GJAB 3KQCA 1JOUB 1UTPA 5L2YH 1WBGB 3A84A 3TIUA 4GCHG 4R8TB 3HGNA 1YPHC 1ESTA 2HVXA 2J38A 2QF5A 3OSYA 3W95A 1GBCA 3UB0A 1ETRH 2FMJA 3GY7A 3DHKH 1LHFH 2NU1E 1C5QA 3F3BA 3SHCH 1LHCH 1WAYB 2ZP0H 1IQMA 2BZAA 3MU8A 4B74A 2OD3B 1YY3A 4UD9H 4WXIA 2HGTH 2XXLA 2HNTC 1O2YA 1D3QB 1HIAB 1ARBA 3AK5A 3EDXB 1ZTLA 1UK2A 1T7CA 2YMSB 3DCLA 3F6UH 3M36A 4NSYA 5EOKA 3RM2H 1FPHH 3P92A 1PPCE 3UNRA 4YT7H 1LDTT 4Y7BA 2ANKH 1GJ6A 4IC6A 1GI5A 5C20A 1A3BH 2KCYA 1O3GA 1OSSA 1ZYOA 2J95A 1O3BA 2EQNA 3PO1C 1RS0A 2OK5A 2BX3A 1HAVB 5EXNA 5DP9A 1X7AC 4ABHA 3F9HA 2HVYB 4XD7D 2OUAA 1C5OH 4HI3A 2FOGA 2ZO3H 5HMAA 4AYYB 1SB1H 1NO9H 5F53A 2ZDMA 1K1IA 2JJ2D 1EFRD 4CHAC 1O31A 1EATA 1TLDA 3WY8A 5JB8S 3UNQA 5DKMA 4D7GA 1TAWA 1XUGA 4LK4A 3TH2H 2UWPA 1V2QT 4GLYA 4ABFA 3SU0A 1W7XH 3SNDA 4DY7B 5DN6D 3STIA 3MHWU 2PSYA 4DW2U 1O34A 1C2GA 1AIXH 1O39A 3LONA 4BTIB 3SBKA 1WUNH 1ESAA 2D26C 2PUQH 2V3OH 1P11E 1SVPA 2ZU3A 1JBUH 1U6QA 1UTLM 2GT8A 7GCHF 3BTTE 3FANA 4E7RG 3E3TA 3BTQE 2QC2A 2FOFA 1IQNA 5IYTA 2PFEA 4YXWD 2PWXA 2ZGJA 1FJSA 1EUFA 1C9TA 1ZR0A 1AKSA 5AVDA 1L2EA 1EOJA 1K1MA 4WH8A 4SGBE 3Q77A 2Z9IA 3MO9A 1DOJA 3PRBA 3B8JA 1GJ8B 3ATKA 1QRWA 1FPCH 3TJVA 1IQLA 1SQOA 1WQVH 3ZZAA 1UO6A 1BITA 1Q31A 5E2PA 2A7HA 5A2MH 1ZOMA 1BTXA 3B23B 1HRTH 2FP7B 3F68H 3S9AA 1PPGE 4CRBA 1C5TA 4A5TS 3SU4A 1HNEE 1UVPA 3OEED 1HCGA 1VJAU 1MAXA 2KAIA 4MVNA 2R3UA 1LQDB 1AE5A 5LH8A 1DY9A 1RIWB 1GHBF 2QN5T 5EXLA 4DIIH 1D9IA 5FCKA 3O8DA 4H42U 4K60A 2FI3E 1FLEE 4WMDA 3VB4A 4JZFH 1C2FA 1QL7A 2A4OA 2FO9A 4F4OC 2AMQA 2ILNA 2A2QH 1O2IA 1C5WB 1GI1A 1KIGH 4YOJA 2C93B 1SHYA 3OEHD 1QQUA 3SJKA 5EJLA 3OFND 4GUXA 2GCHG 4CH2B 4I8HA 1GI9B 4U01A 1ELFA 1DY8A 3GYLB 2ZGXH 3ZVGA 3TGIE 1DSUA 1CHOG 3GCNA 4NWKA 5GCHF 3T25A 1V6DA 1XM1A 3ODFA 3OTJE 2HPQH 1GJ5H 1XUHA 5GJ4B 1DVAH 3DSOA 1G3EA 1V2UT 1EZQA 1MU8B 1Z1IA 4F48B 4GHTA 4ZHMU 1TNHA 2R2MB 2QCYA 3UQOA 2HNTF 1QB6A 5C1UA 2VIWA 3F2GA 1OWDA 1SHHB 2IN2A 2JETC 4CBNA 1QL9A 1YPKH 1MD7A 1TABE 3R3GB 4X6NA 3T62A 4XE4A 2VBCA 5AFZH 3AAVA 2ZU2A 3EA8A 1UK4A 1UVUH 3S0NA 3N99A 3ATMA 1BIOA 2P16A 1L1GA 3M7QA 3RDZA 1SLXB 4JZDH 1C5SA 2EEKA 1WQSA 4ISHH 1K1NA 1AVGH 1S5SA 5CE1A 1H9HE 1OP8A 4FXGH 1BOQA 3JZ1B 3SI4H 2PLXA 3DSPA 5C5OA 1EAUA 1TOMH 1ZRBA 1ZTJA 3LGIA 4WWYA 1K9OE 1QTFA 1KXDA 1IQHA 4FUGA 3BTHE 1GBTA 1BDAA 1TBZH 1DXPA 3MNBA 2EI7A 1HYLA 3CENA 3SV2H 2K0QA 3GOVB 1ELDE 1ZSLA 1O3PB 3O8RA 3HK6B 5DP6A 7ESTE 1ZHMA 1EQ9A 3E90B 1AVXA 1ZSJA 2JH6D 1O3MA 1N8OC 2Z94A 2SGEE 1K21H 8GCHF 1VCQA 1G32B 3MO3A 2CN0H 4FVBA 5C0UA 1TB6H 3QLPH 1GWAA 3TH4H 2W26A 4DG4A 1BMFD 3A7WA 1DWBH 2WPIS 3MH5A 2DE9A 1G3DA 4DT7B 1K22H 3SU5A 4D9QA 2FI4E 5ABWA 1O2KA 2ZGBH 4IN1A 2GV6A 3VXEH 1BRCE 1QIXB 3PO1B 3RMMH 2THFB 4FOUC 1C1NA 1VITG 1YPLH 1BRAA 1UJ1A 3ODDA 4GSOA 2C4FH 2GDEH 3RM0H 1UVSH 1Y3XA 2XBWA 4NCYA 2ZU5A 2Z3CA 1C5MD 2Y6TA 3LT3A 1QGFA 2FOAA 2TGTA 4KKDA 1LTOA 3EA9A 4I32A 2ODQA 3TK5A 4CHAB 1O3KA 3ZVBA 1A4WH 4MNVA 3KNXA 4JZ1A 2A1DB 1SGCA 2ZTXA 2J92A 3MU1A 3TH3H 3M7UA 4AB9A 1HXEH 1AN1E 1O3CA 1YPJH 1YPHE 3E0NB 1SFQB 1JIRA 3PTNA 1D4PB 2XNIA 3ZZCA 1TQ7B 3GDVA 1GI3A 2BQ7B 1XVOA 2KZ4A 3VEQB 3PYHA 6CHAB 4FVDA 2UUKB 3BTKE 1T8MA 1K2I1 1O2TA 1TMBH 1KSNA 4DGJA 4Y7AA 1AWFH 3RMLH 3GCOA 5F8XA 3RXKA 2HNTE 2ANYA 3FVFB 1AFEH 1A0HB 2QAAA 2ZU4A 1ELEE 2V6NA 4MPVA 4DT4A 4Y71A 4M7GA 5DO4H 1C9PA 1TFXA 4U32A 3RLWH 2LP6A 1P0SH 1D3DB 1INCA 1F0SA 1MUEB 4OS7A 1EZUC 4INLA 3RXDA 4ZKRU 1V2OT 4OM9A 5JPMH 3RXIA 1O3JA 1O2NA 1MZAA 4X8TH 3Q3XA 1C2JA 2XBYA 1MQ5A 4FUEA 4K69A 3RXEA 1GJ4H 3NRLA 5GIBA 4UE7H 2P8OB 3AW1A 3LIWA 1EAXA 1JIMA 2HRVA 1GMDG 1CSOE 2AFQB 5LPFA 3ZV9A 4BTTB 4D76A 2J97A 2KCPA 3OY5U 2ZPRA 3BTFE 3MH4A 1YC0A 5C1YA 2CV3A 3RXLA 4I8KA 1BJVA 1HJ9A 3A7ZA 4KTSA 1YBWA 2F9OA 4LZ4B 4Q2KA 5HGGA 4MDSA 1O2MA 3A7TA 4IMZA 3SGAE 2QY0B 2QXIA 1CBWC 2CGAA 2YNAA 1NBME 3P95A 2YMSD 4MG3A 2GP9B 5EQSA 1SOZA 1GGDC 3OX7U 4FU9A 4ASUD 1GMCF 5GXPA 3E91A 4ZKNU 1UHBB 2ODYB 2ZGHA 1BTHH 1EPTA 1EOLA 5H4IB 1MTSA 2JETB 2B0FA 2BD5A 2ZDVH 2AIPA 3A8AA 3ZV8A 3F1SB 4I31A 3U1JB 5AHGH 1AUJA 2FLBH 2WPJS 4MPXA 1WTGH 3C1KA 3MI4A 1BZXE 2B8OH 4K5ZA 3NZIA 1PPZA 3RXCA 3SHAH 3BTWE 3ZVEA 4MNXA 2P59A 1E38B 2AH4X 3SZNA 4K8BA 3UQVA 4X2WA 1QURH 1SGEE 1IQEA 1PQ5A 3ZVFA 2H9EH 4NZLA 1BRUP 1NRNH 1P9SA 2F3CE 2TPIZ 2VH0A 2Z3DA 1ESBA 1SGPE 1O3NA 1C5VA 5T1VA 4I7YH 2FOBA 2GZ8A 3PV5A 4CRAA 5CHAC 1HAHH 2OQUA 2R0KA 1DDJA 1LO6A 1TA6A 2K8IA 2NWNA 2Y7XA 2CMYA 2FEQH 4X6MA 5A8ZA 1GPZA 1A46H 1IHTH 1AKSB 1NRRH 1UTOA 3VB7A 3S7HB 4YT6H 1TOCB 1Z8RA 3IG6B 2GTBA 3SOSA 5JBCS 3PROA 3EE7A 1Y8TA 4X0WU 4VGCC 1FNIA 1BJUA 1O3IA 1TGSZ 3FFGA 1AU8A 1MCTA 8KME2 1A1RA 1VR1H 1O35A 1YLNA 1BTZA 3ZZ4A 1P2NA 3ESTA 1O2QA 1Y5BT 1ELAA 1TGBA 4RN6A 4BAMB 4CR9A 1A3EH 3P8GA 2G4TA 4WH6A 2A2XH 3UOUA 1KLTA 1GI2A 3SU1A 1O2VA 1G2MA 1PFXC 1H8ED 3U9AH 5A0CA 1RTKA 1CQQA 2FESH 1O5AB 2RG3A 3M5LA 1GBIA 2CF8H 3FP7E 5A09A 4D9RA 1DFPA 3KYFA 2XBVA 1V2VT 3GY3A 3N7DA 1GL0E 1W3CA 4YLUA 1LMWB 2VIOA 1P2QA 1UW7A 3F9FA 1SR5C 1YWUA 1TONA 1C5YB 1AMHA 2V3HH 1CA0C 5EGMA 1ZSKA 1YM0A 2JKHA 2JH5D 1C1MA 4Q4LA 1Z6EA 3Q3KA 1MZDA 4ISNA 2TGDA 5T6DA 4I8GA 3TVJB 1O2JA 2CXVA 3CP7A 4B1TA 1EPTC 4A1TA 1O32A 2SGAA 1QA7A 2I6SA 1J8AA 4Y0YE 1ANDA 1NU9A 3VPKA 1TYNA 4IBLH 5ESBA 1MD8A 1VGCC 4A1VA 1FIZA 2ZQ2A 1YGCH 2EI6A 3GCTF 1SG8B 1BT7A 3GYMA 2Z6BD 3V3MA 1XKAC 2A5AA 1EAWA 2BY7X 1SGNE 3GDSA 4RSPA 4X1RU 3E16B 6GCHF 1O5FH 1HJAC 1CGIE 3KIDU 1T32A 1ZGIA 3MH7A 1K28D 1QJ6B 4K1TA 1HAPH 2WYGA 4GAWA 1K1LA 1UVOA 4ISOA 1A5GH 2VNTA 1KXFA 1L0ZA 1W8BH 2R9PA 2BY8X 5K7RA 2C8WB 3RXRA 2VU8E 2Z9GA 1HGTH 2CHAB 1RTLA 1OYTH 2DUCA 1OP2A 1BTYA 1TNLA 4X1SU 3URDA 7KMEH 3E0PB 1BHXF 5FXLA 1SI5H 4ZHAA 3RXPA 4ESTE 1WDIA 4UONA 1GBFA 4D8NA 3P8FA 5EW2H 3U8OH 5EIYA 3ZZ7A 1ELGA 1GVKB 1HPGA 5A8XA 1A5HA 3D49H 1YP9A 4AG1A 3D62A 2ZDLA 3E1XB 3GISB 3FN8A 5E8EH 2GV7A 2BVRH 1S83A 1CA8B 1ZMJA 3MU0A 4HGCA 4X1NU 3NXPA 1TGTA 3ATLA 1YPMH 4K3JA 3SU3A 5DP4A 3C27B 1GI0A 1NT1A 2NU4E 1QZ8A 4NGAH 1TPAE 1OX1A 4ZHLU 1JWTA 2BDBA 1AGJA 1G36A 4WMEA 1GHBG 4UFDH 1Y59T 5C0TA 2GCTB 1QQ4A 4JK6A 4E7NA 1AE8H 4Y11E 4FU7A 2OQ5A 4JZIA 2ANWA 2ODPA 1J14A 1GMHF 1E35B 4KGAA 3WWFA 4OS1A 4AB8A 3NKKA 1KLIH 4X2VA 1O2XA 2PTNA 3SUEA 1AD8H 3GCHB 2ZC9H 3UY9A 3LGTA 3PV2A 5HXFA 1C5LH 3SORA 1WV7H 2F43B 3MNXA 2H2ZA 2PHBA 2KCOA 3M35A 1GDQA 1O5EH 2ZCHP 5KGOA 1BHXB 5GCHG 3TITA 3KGPA 1K1PA 4YESB 4IN2A 1IQKA 1GG6C 1IAUA 4UFFH 3TLOA 1O30A 1O0DH 3SU2A 2G51A 5KEDA 5DG6A 4ISIH 2GKVE 1DX5M 2A4GA 5DP7A 4TT3D 1P09A 2ALPA 3P8OA 4FUCA 3OTPA 1TRMA 2BD2A 1RJXB 1TIOA 3RXJA 1E36B 2CK3D 1J17T 5IDKA 1S85A 2SGQE 3LU9B 1GCDA 1Q2WA 1SLUB 2KFWA 4XRNA 1AB9C 3I78A 1NC6A 3QTOH 4LZ1H 1YKTA 1JRSA 8ESTE 4JYVH 1SLWB 1XUFA 2BXUH 4ZMAH 1XMNB 1MBMA 1TE0A 2SGDE 1A61H 3A8CA 2WV5A 5HIZA 3NUMA 3RMNH 3FP8E 4CRCA 5BPEA 1MAYA 3NCLA 1PPFE 4VGCB 3F9EA 1ZPZA 1V2KT 1MQ6A 1QB1A 1W11U 2PKAA 2BQ6B 1B7XB 3GY4A 1K1JA 5FHTA 1GDUA 1PPEE 2IJD1 7LPRA 1KTTB 2ZTYA 1BUIA 4YOIA 3BIVH 3VGCC 1G37A 1W2KH 3KCGH 1TX6A 5ESTE 1EASA 4O9VA 1V2ST 4YM9A 4M9FA 1BRBE 1QB9A 1FQ3A 1YPGH 1BMAA 8GCHG 3K65B 4Y8YA 2H6MA 2OC0A 4AFSA 2BD4A 2FYRA 5FPYA 1PJPA 3JZ2B 2Z9KA 2OTVA 2A7CA 4GVUA 4HTCH 5C3NA 1QR3E 4ABIA 2G8TA 4U30A 3V12A 3VXFH 4NFEA 5L2ZH 1M9UA 3OY6U 3LH3A 1L1NA 1GDNA 1GJCB 1FZZA 3HKIB 5C1XA 2P95A 1HV7A 2GVFA 1FY4A 3TJUA 1Y3YA 3LC3A 4X2YA 3OYPA 1C5RA 3QX5H 1O3EA 2BM2A 2ZCLP 5GDSH 1EPTB 2M5TA 2ZECA 4TY7A 2FX4A 3HGPA 4I86A 1DT2A 1SQRA 3KN2A 1VGCB 4RKJB 1GCTC 2PP6A 2XWAA 2ZHWH 3ZIAD 2BLVA 3SV8A 1VJ9U 1E79D 2XRCA 3E8LA 1C4U2 1UMAH 4WY3A 3GY5A 3ITIA 5A0AE 2PSXA 3TJOA 2A4QA 4YTAA 4YZUA 1OWHA 1FV9A 4INHA 4Q7XA 1GI6A 1O36A 1C5PA 1FAXA 3DSGA 3KQ5A 1TRNA 3LJOA 1G2LA 3K2UA 5FX5A 1C1TA 1UK3A 2PUXB 1DUAA 4Y8XA 3W1EA 1TRYA 2TGAA 1LVYA 3CNRA 5CMXH 2GT7A 2FI5E 5AFYH 1TNIA 3H5CB 1C1SA 4XBDA 4Y76A 1TPOA 1CT0E 2XNDD 1QRXA 3SZEA 2GX4A 1UTNA 4NA9H 1YF4A 1YLDA 4WJG2 2BLWA 1G30B 4XDEA 4YLQH 1UCYK 3SI3H 3SU6A 3V13A 1WTHD 1P2IA 3LGVA 1O2LA 4P02A 2HLDD 1DLEA 3QZRA 5EQQA 1O37A 1VKYA 1SPJA 1TX7A 4BXSA 5GNDA 2F9UA 2ZDKA 3MNSA 1ZZZA 2QXGA 4Z1MD 2F83A 1TNKA 2G00A 4OGXA 3BG4C 2ZFSA 3A7VA 3BEIB 1GBBA 2H5DA 2BDIA 4NWLA 1QBOA 1E1RD 1C5UA 1QBNA 1SGFA 2OC8A 2ANMH 1S0QA 1ZLRA 3P6ZB 2FWWA 4B75A 4BANB 2O8LA 2L74A 1GBJA 1W13U 1DUEA 3M3SA 4Y0ZE 3ZZ9A 1SQAA 5FBEA 3NPSA 3RU4E 3KYGA 4OS2A 5PTPA 1XUJA 1O2GH 2RCEA 1ZPCA 3LGWA 5E0GA 3T5FH 5JYIA 4BXWA 2H9HA 1OYQA 1OKXA 1QY6A 1S6FA 1V2MT 3FOAA 5DJ7A 5JB9S 5L30H 4JYTA 2O8MA 3UIRA 1ZMNA 2H5CA 4ACBA 4X6OA 1UTJA 1BA8B 2GZ9A 2G5VA 1CT2E 1GMCG 3VFEA 1OPHB 3RC5A 2BD9A 1O3DA 2A4RA 2SGFE 4H6TA 3NK8A 1COWD 1S81A 1ELBA 1J15A 4UEHH 2Q6GA 3RP2A 1QJ1B 1P8VC 1SFIA 1FX0B 2RA0A 4I8LA 2QA9E 3PMBB 2AGGX 1XX9A 2PV9B 2Z9JA 1AFQC 2BX4A 2VWNA 3LKWA 2GMTC 5T6FA 2QV1A 1O2PA 4MPWA 4AYVB 3RXGA 3PMAB 3S9CA 3F0PA 1NROH 1C5XB 2IPHA 1GBDA 4O3TA 1RGQA 2BB4A 1FXYA 3A87A 1H9LB 3I77A 1AVWA 2PR3A 3PWBA 4JZEH 3Q00A 1J9CH 4IW4E 2W5EA 4YOGA 1O2WA 5BRRE 4AFQA 2BVXH 4BTUB 1C1OA 3A7XA 1W7GH 1QHRB 1DWCH 3CS7A 3MNCA 1ID5H 4B73A 3A81A 2BY5X 3SV7A 1Z6JH 2G52A 1TPSA 3QZQA 2VIQA 1THRH 1MTNC 1DM4B 5F03A 4AN7A 2WSSD 2C8XB 1H8DH 3PLBA 5FAHA 3A82A 1A0LA 3SGBE 3STJA 2VGCC 4Z0KA 2IJOB 1PYTC 4ZKSU 2KCAA 1S6LA 3A83A 2WPMS 1GBLA 3SV6A 1DICA 2ZU1A 3AVZA 1BB0B 3ZVCA 2LELA 2ZWLH 2KX4A 1ANEA 2TRMA 1SGYE 2VVCA 1EB1H 2G4UA 1W12U 1HUTH 1HAYB 4DOQA 5T3HA 4X1QU 4X2XA 4AFZA 4Q7ZA 3UAIC 2CF9H 5J4QA 1YPEH 4F55A 2VB0A 2RDLA 4A7IB 1QA0A 1EX3A 2C8YB 4FUHA 2SFAA 3TGKE 1HAIH 1Y5UT 4UDWH 4ZXXH 3PMJA 2QE7D 2BDYA 1C1UH 4H4FA 1OWEA 2AGEX 2Z9LA 4CBOA 3S7KB 1V3XA 1GCTB 2Q6FA 1BTWA 2KM0A 1K0HA 3Q76A 1FY3A 4K1EA 1KXEA 4TSFD 3T28A 1P05A 8LPRA 1DWEH 1G9IE 2LPRA 1Q3XA 2BVSH 1O2HA 1JMOH 2XBXA 1MMJN 1G3BA 1BBRK 2WPKS 1UVTH 5B6OA 1QJ7B 3K6ZA 3SNEA 2ZA5A 4NIXA 4X8VH 2ULLA 1Y5AT 2Q1JA 4Z6AH 4ZAEA 2AYWA 3KQEA 1EP5A 1F7ZA 1GI8B 1L1JA 1HLTH 1OWKA 1FMGA 3Q3YA 2BTCE 1KXAA 4GPGA 3QWCH 3D65E 1P3EA 5FPTA 4X1PU 1DSTA 1FDPA 3DA9B 1TGNA 4ABGA 2A31A 1CT4E 3GCTG 1DE7H 1LVBA 1WU1A 2Y82A 3IITA 3VB6A 2ZNKH 3GY6A 2CJIA 6GCHG 1LHEH 1N8OB 3DT0H 3TNTA 3BTGE 2F9PA 1ORFA 2ZHEH 2OC7A 4IS5A 3SQEE 1GHXH 5EJZA 2PKAB 3LOXA 3SJ9A 2HLCA 3ENSB 5EPNA 1BCUH 1C4Y2 2KAIB 1NFWA 1V2NT 3GDUA 4MNWA 4Y6DA 3MFJA 3GY8A 4PROA 4B2BA 3MO6A 2OP9A 5HM9A 1VCWA 1ABIH 2FIRH 1KYNA 3SGQE 1XUIA 3LGYA 1D6WA 1NRQH 3SJOA 1C2LA 3MYWA 1EJAA 2ZGCA 3U8RH 4GHQA 2BZ6H 1QFKH 2AERH 4Y8ZA 3V7TA 4TPIZ 3SW2B 1DPOA 5F8TA 1HAZB 2Y5HA 2FOMB 1SQTA 2AIQA 1KDQA 2OC1A 2AMDA 2J2UA 3WWBA 5GWZA 3MH6A 3MOCA 1S6HA 2TIOA 4OGYA 3VB3A 4AFUA 2OXSA 1OHHD 2J98A 2XTTB 3M7TA 2NU2E 1SGDE 4XOJA 1PQ8A 2PKSC 1D3PB 2ZPQA 2QIQA 2FOEA 1F2SE 3L3TA 2Y5FA 1THSH 1SGTA 3SYJA 1P04A 2XCNA 1MKWH 5KECA 3RXQA 1H1BA 1LKBA 1WXRA 1GMHG 4FUFA 1K1OA 1A0JA 4RI0A 1GL1A 3U8TH 2Y80A 1THPB 2G5NA 2ZHFH 4FUBA 2XOKD 2AHME 3LPRA 4IC5A 3PV4A 1AFQB 2GGVB 4CREA 2GMTB 1O3LA 1P01A 3KL6A 2ASUB 5JBBS 2QXJA 2VIVA 2BD3A 3SNBA 5LGOA 1GI7B 3RXSA 2WYJA 3KEEA 1RTFB 5GPIB 1V2TT 1NS3A 2EI8A 3DFLA 4AX9H 4NA8A 2QXHA 3ZVAA 1SMFE 4I8JA 2BDHA 1FY8E 4IMQA 1MKXK 4AZ2B 3H09A 4RKOB 3PRDA 7GCHG 3W94A 1FY1A 3UWJH 1ZJDA 3N7EA 3HKJB 4FUJA 3LC5A 3PLKA 3FKSD 1AZ8A 2O8WA 4BAKB 4DCDA 2V3MA 1FN6A 1H8IH 3FO8D 2O8TA 1MTNB 6ESTA 1ANBA 1GHAF 5DSFA 1JXPA 5L6NH 1EKBB 3QTVH 4RT0A 3DD2H 1F5LA 1C1QA 2VGCB 3U69H 3QGNB 4CRDA 1AUTC 1P02A 4XBBA 1P03A 1NFUA 3SUGA 5DP3A 3QN7A 2P93A 4NA7A 1O5BB 1B0FA 5DP5A 2D8WA 1CBWB 2SGPE 1P2MA 1FUJA 1KXBA 1V2WT 1CGJE 4AGKA 5C5NA 5JBAS 3SNCA 1S0RA 1EJMA 3H7TA 3A85A
chains in the Genus database with same CATH topology
1C4V2 4ABDA 1N1LA 1DANH 1GGDB 1FI8A 1RD3B 3SO3A 3T26A 3VB5A 1NM6A 4X8SH 1Y3UA 3TNSA 2YOLA 1FY5A 1OWJA 2J94A 2FODA 3I29A 4NFFA 1HJ8A 2AMPA 3RMOH 3ZZDA 1O3OA 3ZVDA 4Y10E 3QO6A 1QNJA 1TALA 1P3CA 4WF8A 2Y7ZA 1E37B 1QL8A 4MNYA 2BY9X 4CRFA 1YCPM 5T6GA 3RXMA 2LNCA 2Z7FE 1UHBA 1KY9A 3PTBA 1UCYH 3PM3A 4MLFB 2FXRA 4ABEA 3ATIA 1ABJH 1NU7B 2PGQB 2ZIQH 3ZZBA 3SJ8A 2I6QA 4MPUA 3SUFA 2UWLA 1LVMA 3KF2A 1B5GH 4NIWA 1TWXB 1J16A 5HYOA 1AY6H 1O3FA 3EQ0H 1AQ7A 2XCFA 4DIHH 5CHAB 1BQYA 2QF0A 1EAIA 1GHZA 1SLVB 4J2YB 2GD4B 4NIYA 1S84A 1TBQH 3EE0B 4FU8A 1AWHB 1C2MA 1GHYH 2ZKSA 1G3CA 4SGAE 1GBMA 6CHAC 1TQ0B 1RRKA 4I33A 5C2ZA 1GJDB 1O5DH 1F0TA 1GJBB 1RFNA 2PW8H 5E0JA 5A0BA 2TBSA 4ASHA 4ZUHA 1F0RA 4GCHF 2B5TB 2WUBA 3RXAA 1N6XA 2R2WU 1ELVA 3NWUA 1V2JT 4OS5A 2O9QA 1MKWK 1FAKH 2FZZA 1LHDH 2K1QA 1CHGA 3UOPA 2BQWB 4QT8C 2VIPA 4UFGH 3V0XA 9LPRA 5JBTA 2BD8A 1T4UH 2A7JA 3A8DA 2FYQA 1XUKA 1O5GH 2ZFQH 1CE5A 1ZPBA 2PGBB 1TGCA 1O3HA 4Q7YA 1IQIA 3M3TA 3RXTA 4THNH 2QYIA 3ATWA 4E05H 1IHSH 5EQRA 1MCVA 5J4SA 3RLYH 2VJ1A 3A89A 1JRTA 2A5KA 2P8OC 1UCYE 1ELTA 4NZQA 2R3YA 1B0EA 3BTEE 4JMYA 4TYDA 1GJ7B 5EG4A 4WXVA 3L6PA 3HK3B 1LPGB 3T2NA 3S69A 3UNSA 1DS2E 1H9IE 1ETTH 2OINA 3KQDA 1C5NH 1CA0B 2ZFTA 1UTKA 2C3SA 4ABBA 2PKSB 3SJIA 1C1VH 5HM2A 4A92A 5FPSA 1GHVH 2ZG0H 3M5OA 1P10A 2WINI 1LHGH 2VH6A 1WYKA 1A7SA 1GI4A 1HXFH 3EAJA 3U98H 6LPRA 1OOKB 5EPYA 4O97A 4KELA 3LGUA 3RC4A 2VINA 2VVUA 5I25A 2Y5GA 4XBCA 2BDCA 3U1IB 1Z71A 2WPLS 3E6PH 3QK1A 1CO7E 1SGRE 4IGDA 1HJAB 2RA3A 3RXUA 1AI8H 4HZHA 4NIVA 3SV9A 2FS8A 3L33A 1DLKB 4ABAA 1MTVA 1TNGA 2B9LA 2HPPH 1W0ZU 1ACBE 5FBIA 2A32A 3CS0A 2XWBI 3ZYDA 3RXHA 1CGHA 1Y3VA 2ZHDA 2FDAA 1HBTH 3BG8A 5DP8A 3T27A 5LPEA 4XSKU 1LPZB 1FN8A 3BTME 3BF6H 2F9VA 4X8UH 2VWOA 1BMMH 2G81E 1EP6A 1T8LA 2ZF0H 1OXGA 4A6LA 2ZTZA 1QCPA 5LPRA 3M3VA 2OCVB 1HAOH 2XYAA 1MU6B 2UUYA 1N6YA 2XC0A 2FPZA 2IOTA 3A86A 1A5IA 1E34B 5G4BA 3BTDE 3RXOA 1DITH 3TU7H 2ZFPH 1XXDA 2OBOA 1Y3WA 1P9UA 1HFDA 3OU0A 3SNAA 1KXCA 2SNWA 3UFAA 1BBRH 2GCHF 1SGIB 3HATH 1HIAA 1C2IA 3P17H 1ETSH 1D3TB 1S82A 2R0LA 1CHOF 3UTUH 1NRSH 3URCA 3HPTB 1NFXA 5SGAE 4CH8B 2OLGA 4HFPB 2XC4A 4AG2A 4YO9A 1ZMLA 3M5NA 1NPMA 3PB1E 4AOQA 2FTMA 2ZFRH 1KDQB 3S9BA 1VZQH 1HAVA 3TJNA 2ZCKP 3FP6E 2J4IA 3QGJA 3RXFA 5F8ZA 5EU8A 1GG6B 1C2KA 3P70B 3MWIU 2O8UA 1IOEA 5TJXA 1F5KU 1MTWA 1XKBC 1D6RA 2FM2A 3ELAH 4WMFA 3A88A 1E0FD 2F9NA 1Z1JA 3BEUA 2BOHB 5TCAA 3D23A 2FS9A 1W0YH 2BYAX 4OS4A 1AB9B 2ZI2H 1OWIA 3R0FA 2BOKA 5DPAA 1UTQA 4K1SA 2QF3A 1BMLA 4DURA 1PPBH 1W10U 2YNBA 1EB2A 3QDZB 2HOBA 4BAOB 1GBAA 1UTMA 1EXFA 1T31A 1TNJA 1NZQH 1HAGE 1RXPA 1YCPH 1C1WH 4TWYA 3UREA 2ZHQH 1BBRE 3MU5A 4MTBA 2V35A 1EZXC 2EC9H 1C1PA 3G01A 5AF9H 2TGPZ 2ZPSA 3H7OA 2UUFB 4B76A 1TMTH 1LVOA 2BLQA 3SQHE 1KLJH 2QGRA 1Z8GA 5A8YA 3VGCB 2EA3A 2W7SA 1C1RA 5DK1A 4BAQB 2ZDAH 4BAHB 3P8NA 1O2UA 3AASA 2CHAC 1V2PT 2GDDA 4K8YA 4UFEH 2NU0E 1PYTD 1O2OA 4CRGA 2BLOA 3RU4T 3RUOA 1IQJA 1EJNA 1GVLA 1TPPA 1YYY1 1VITF 5E2OA 4OS6A 2SNVA 1IQFA 1OP0A 1ZRKA 1LKAA 1TA2A 2BDGA 1V2LT 1BTPA 1V2RT 2BD7A 1AO5A 2A0QB 4XFQA 3UWIA 1HDTH 2P94A 5TCCA 4ABJA 1T4VH 2W7UA 2VIDA 1SL3A 2WV4A 1Z8JB 4JYUH 4H6SB 1PQ7A 1BMNH 1GVZA 1ARCA 4TWWA 2ZDNA 4K2YA 1MKXH 3IWMA 2OBQA 2WUCA 3SUDA 1T8OA 4LXBH 5EW1H 3PLPA 3A8BA 2NU3E 3A7YA 5FCRA 1KTSB 1O3AA 3BV9B 2GCTC 2VWMA 3TK9A 2A5IA 2DE8A 3M37A 1NN6A 1XVMA 1PQAA 1LQEA 3DUXH 9ESTA 1LCYA 1ZHPA 2GZ7A 4O3UA 4X6PA 1F92A 4AORA 1ZJKA 3O8CA 2A45B 3GCHC 1F5RA 4KTUA 2BY6X 3FAOA 1CVWH 5JDUB 2ZEBA 4U2WA 1P12E 3QUMP 1OS8A 2XW9A 2ZFFH 1L4ZA 3KQBA 4R0IA 1VITH 2UWOA 3MMGA 4MQAA 3TGJE 1FONA 2Z3EA 4AGJA 1GBEA 4Q80A 2FOHA 1QRZA 2P3FH 3ZYEA 2D2DA 2W3IA 1P2JA 3FZDA 2D1JA 3O8BA 5FX6A 2V0BA 1YLCA 2Y81A 3M61U 2AEIH 4DJZB 2F91A 2BHGA 3UR9A 3K6YA 2H9TH 5I46H 3LJJA 1SGFG 3UPEA 1HB0B 2JH0D 4B2AA 2W3KA 2B7DH 3PWCA 1HAXB 2P3TB 1BTUA 3KHVA 5E0HA 2BXTH 4A1XA 2ALVA 2FLRH 4DVAU 1GMDF 3BN9A 5K0HA 1MTUA 1C2HA 1SC8U 3ZZ3A 1DWDH 2Q6DA 1NY22 5C67A 3BG4B 2BMGB 2F9BH 2FTLE 3ZZ5A 2ESTE 4B71A 3DFJA 4B2CA 1F0UA 1ZGVA 5ETXA 3BSQA 2XC5A 1GBKA 4J1YA 1DXWA 1A2CH 3RXBA 1T8NA 4WVPE 3N7OA 1O5CB 1TMUH 3LDXH 3BEFB 1GHAG 4E06H 2J34A 1WSSH 2FOCA 4KTCA 3A80A 1YCPK 4ZXYH 1P2OA 1RIWC 1GJ9B 2G55A 2PTCE 1C5ZB 3FZZA 2C90B 3UR6A 3T29A 1LPKB 1O38A 4NG9H 1ANCA 1C2EA 3LH1A 1SOTA 1WOFA 1WCZA 3MTYA 1O33A 3ZZ8A 2H1UA 4ISLA 2FX6A 4NSVA 5F6MA 1TBRH 1GBHA 1VCPA 3AW0A 5EODA 3ZZ6A 3M5MA 3PMHB 3SN8A 1ELCA 3RXVA 2UUJB 1AHTH 3RC6A 1P2KA 2AS9A 1C2DA 1SSXA 4LOYH 1O2SA 2VVVA 2P3UB 1GHWH 3TPIZ 1L4DA 2VWLA 3TK6A 1SBWA 3AAUA 4O03A 3EYDA 1EZSC 2STBE 1Z7KA 2ZZUH 3B9FH 4D7FA 2WPHS 2HALA 3GICB 3EGKH 4ZROA 1P57B 4JCNA 1QBVH 2BDAA 1FIWA 5EXMA 4KP0A 1O2RA 4TY6A 4F49A 1O2ZA 1W14U 3GY2A 4ZH8A 4Y79A 1NTPA 3RU4D 1NRPH 2ZQ1A 3MU4A 1AZZA 4BNRA 1XXFA 4BOHA 1ZTKA 4ZKOU 3EA7A 3K9XB 1MH0A 4JK5A 3UUZA 1NFYA 1NESE 2HWLB 1IQGA 1PPHE 2J9NA 3F9GA 4FUIA 2C8ZB 1MBQA 4INKA 1H4WA 1Z8IB 2AGIX 1ZHRA 4FUDA 1P06A 4CR5A 1CU1A 5DGJA 3BIUH 1SGQE 1TX8A 4TPYA 2STAE 1GJAB 3KQCA 1JOUB 1UTPA 5L2YH 1WBGB 3A84A 3TIUA 4GCHG 4R8TB 3HGNA 1YPHC 1ESTA 2HVXA 2J38A 3OSYA 3W95A 1GBCA 1ETRH 2FMJA 3GY7A 3DHKH 1LHFH 2NU1E 1C5QA 3SHCH 1LHCH 1WAYB 2ZP0H 1IQMA 2BZAA 3MU8A 4B74A 2OD3B 4UD9H 4WXIA 2HGTH 2XXLA 2HNTC 1O2YA 1D3QB 1HIAB 1ARBA 3EDXB 1ZTLA 1UK2A 1T7CA 3F6UH 3M36A 4NSYA 5EOKA 3UNRA 3RM2H 1FPHH 3P92A 1PPCE 4YT7H 1LDTT 4Y7BA 2ANKH 1GJ6A 4IC6A 1GI5A 5C20A 1A3BH 1O3GA 1OSSA 1ZYOA 2J95A 1O3BA 3PO1C 1RS0A 2BX3A 1HAVB 5EXNA 5DP9A 1X7AC 4ABHA 3F9HA 2OUAA 1C5OH 4HI3A 2FOGA 2ZO3H 5HMAA 4AYYB 1SB1H 1NO9H 2ZDMA 1K1IA 4CHAC 1O31A 1EATA 1TLDA 3WY8A 5JB8S 3UNQA 5DKMA 4D7GA 1TAWA 1XUGA 4LK4A 3TH2H 2UWPA 1V2QT 4GLYA 4ABFA 3SU0A 1W7XH 3SNDA 4DY7B 3STIA 3MHWU 2PSYA 4DW2U 1O34A 1C2GA 1AIXH 1O39A 3LONA 4BTIB 3SBKA 1WUNH 1ESAA 2D26C 2PUQH 2V3OH 1P11E 1SVPA 2ZU3A 1JBUH 1U6QA 1UTLM 2GT8A 7GCHF 3BTTE 3FANA 4E7RG 3E3TA 3BTQE 2QC2A 2FOFA 1IQNA 5IYTA 2PFEA 2PWXA 2ZGJA 1FJSA 1EUFA 1C9TA 1ZR0A 1AKSA 5AVDA 1L2EA 1EOJA 1K1MA 4WH8A 4SGBE 3Q77A 2Z9IA 3MO9A 1DOJA 3B8JA 1GJ8B 3ATKA 1QRWA 1FPCH 3TJVA 1IQLA 1SQOA 1WQVH 3ZZAA 1UO6A 1BITA 1Q31A 5E2PA 2A7HA 5A2MH 1ZOMA 1BTXA 3B23B 1HRTH 2FP7B 3F68H 3S9AA 1PPGE 4CRBA 1C5TA 4A5TS 3SU4A 1HNEE 1UVPA 1HCGA 1VJAU 1MAXA 2KAIA 4MVNA 2R3UA 1LQDB 1AE5A 5LH8A 1DY9A 1RIWB 1GHBF 2QN5T 5EXLA 4DIIH 1D9IA 5FCKA 3O8DA 4H42U 4K60A 2FI3E 1FLEE 4WMDA 3VB4A 4JZFH 1C2FA 1QL7A 2A4OA 2FO9A 4F4OC 2AMQA 2ILNA 2A2QH 1O2IA 1C5WB 1GI1A 1KIGH 4YOJA 2C93B 1SHYA 1QQUA 3SJKA 4GUXA 2GCHG 4CH2B 4I8HA 1GI9B 4U01A 1ELFA 1DY8A 3GYLB 2ZGXH 3ZVGA 3TGIE 1DSUA 1CHOG 3GCNA 4NWKA 5GCHF 3T25A 1V6DA 1XM1A 3ODFA 3OTJE 2HPQH 1GJ5H 1XUHA 5GJ4B 1DVAH 1G3EA 1V2UT 1EZQA 1MU8B 1Z1IA 4GHTA 4ZHMU 1TNHA 2R2MB 2QCYA 3UQOA 2HNTF 1QB6A 5C1UA 2VIWA 1OWDA 1SHHB 2IN2A 2JETC 4CBNA 1QL9A 1YPKH 1MD7A 1TABE 3R3GB 4X6NA 3T62A 4XE4A 5AFZH 3AAVA 2ZU2A 3EA8A 1UK4A 1UVUH 3S0NA 3ATMA 1BIOA 2P16A 1L1GA 3M7QA 3RDZA 1SLXB 4JZDH 1C5SA 2EEKA 1WQSA 4ISHH 1K1NA 1AVGH 1S5SA 5CE1A 1H9HE 1OP8A 4FXGH 1BOQA 3JZ1B 3SI4H 2PLXA 5C5OA 1EAUA 1TOMH 1ZRBA 1ZTJA 3LGIA 4WWYA 1K9OE 1QTFA 1KXDA 1IQHA 4FUGA 3BTHE 1GBTA 1BDAA 1TBZH 1DXPA 3MNBA 2EI7A 1HYLA 3CENA 3SV2H 3GOVB 1ELDE 1ZSLA 1O3PB 3O8RA 3HK6B 5DP6A 7ESTE 1ZHMA 1EQ9A 3E90B 1AVXA 1ZSJA 2JH6D 1O3MA 1N8OC 2Z94A 2SGEE 1K21H 8GCHF 1VCQA 1G32B 3MO3A 2CN0H 4FVBA 3QLPH 1TB6H 1GWAA 3TH4H 2W26A 4DG4A 3A7WA 3MH5A 1DWBH 2WPIS 2DE9A 1G3DA 4DT7B 1K22H 3SU5A 4D9QA 2FI4E 5ABWA 1O2KA 2ZGBH 4IN1A 2GV6A 3VXEH 1BRCE 1QIXB 3PO1B 3RMMH 2THFB 1C1NA 1VITG 1YPLH 1BRAA 1UJ1A 3ODDA 4GSOA 2C4FH 2GDEH 3RM0H 1UVSH 1Y3XA 2XBWA 4NCYA 2ZU5A 2Z3CA 1C5MD 2Y6TA 3LT3A 1QGFA 2FOAA 2TGTA 4KKDA 1LTOA 3EA9A 4I32A 2ODQA 3TK5A 4CHAB 1O3KA 3ZVBA 1A4WH 4MNVA 3KNXA 4JZ1A 2A1DB 1SGCA 2ZTXA 2J92A 3MU1A 3TH3H 3M7UA 4AB9A 1HXEH 1AN1E 1O3CA 1YPJH 1YPHE 3E0NB 1SFQB 1JIRA 3PTNA 1D4PB 2XNIA 3ZZCA 1TQ7B 3GDVA 1GI3A 2BQ7B 1XVOA 3VEQB 3PYHA 6CHAB 4FVDA 2UUKB 3BTKE 1T8MA 1K2I1 1O2TA 1TMBH 1KSNA 4DGJA 4Y7AA 1AWFH 3RMLH 3GCOA 5F8XA 3RXKA