2FYRA

Crystal structure of norwalk virus protease grown in the presence of aebsf
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
181
structure length
171
Chain Sequence
APPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Chymotrypsin-like cysteine proteinase
publication title X-ray crystallographic structure of the Norwalk virus protease at 1.5-A resolution.
pubmed doi rcsb
source organism Norwalk virus
total genus 41
structure length 171
sequence length 181
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fyrA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fyrA01
3U8RH 1C2DA 2PTCE 1BRAA 1AZ8A 3IITA 2GZ7A 3LGWA 1GI8B 1T8NA 2XWAA 3IG6B 4YT6H 3HPTB 4JZIA 2IN2A 1ZHRA 3NZIA 1MKXH 3RM0H 3RUOA 3SUDA 4X1RU 3RC6A 1THRH 3URDA 2BOHB 3QO6A 5HYOA 4GAWA 1ELFA 1O3GA 3A89A 3KCGH 4HI3A 1HFDA 3SV7A 2ZGXH 3T26A 1K28D 2QYIA 1ZPCA 1MZDA 2A4QA 3VXFH 3GISB 4JCNA 1DXWA 1C2IA 1D3PB 2IPHA 1G30B 5F03A 3SU6A 1PJPA 1F5LA 2BQ7B 2G4UA 2ZDNA 4CHAB 2PHBA 1HBTH 2F91A 1XM1A 2ANYA 2AMPA 4WWYA 1WQVH 1ZLRA 1AN1E 1GI5A 1O2YA 2C8XB 3FZZA 3SNBA 2VIQA 1GHYH 1GJ4H 3GCHC 1SPJA 1BB0B 4ZUHA 4JYUH 4MTBA 1E0FD 1A46H 1ZTJA 1EPTB 5EQSA 3E3TA 1F2SE 4CRBA 1FAXA 1YPKH 1ELAA 4HTCH 4KELA 4UFFH 1HRTH 3G01A 1C2EA 1L0ZA 1C1QA 1AE8H 2OD3B 5CHAB 2ZFSA 2GP9B 4DG4A 1C1WH 2D8WA 4MPVA 2H6MA 1SFQB 3M7UA 1O3AA 1XUIA 2BD5A 1FN6A 2DUCA 4KTUA 3TJVA 2M5TA 2Y82A 1M9UA 1P03A 1WU1A 5FCRA 4MQAA 4HZHA 3GYMA 2H9TH 1A3BH 3A84A 3RMLH 4VGCB 3UQVA 1K1LA 1AWFH 1TAWA 2YNBA 5T3HA 2ZCLP 3VB7A 2XRCA 4X2WA 1V6DA 3STIA 5SGAE 1RS0A 1BJVA 1NC6A 3DFJA 1NFWA 1A4WH 4IMQA 2TGAA 1PPCE 1YF4A 5AHGH 1L1GA 5DP6A 1O2MA 3MU8A 2Z3CA 2STAE 4K1EA 1KXEA 5HMAA 2PUXB 2G00A 1O5GH 3HK3B 1Z7KA 2ANWA 9LPRA 3MYWA 2GT8A 1HDTH 2CMYA 1QR3E 2ZO3H 5AFYH 1WCZA 2A2XH 1GMCG 1DT2A 2GCHF 4NSVA 2HLCA 3NPSA 1GI9B 1JRTA 1TGSZ 1AZZA 1AFQB 1OPHB 2BDYA 5TCCA 1QBNA 3MNCA 1NZQH 1GWAA 4Y71A 2JKHA 2BDHA 1V2PT 1C4Y2 2BB4A 1YYY1 4FU7A 2AIPA 1D3QB 1J15A 1O3PB 4GVUA 4Z6AH 4YLQH 4YOJA 4KP0A 1RIWB 1GJ8B 3U1JB 2EC9H 4U32A 1BRUP 1Z1JA 1HAOH 4R8TB 1EZXC 3PO1C 3PO1B 4ZMAH 1GBFA 1W8BH 3CS7A 5ESBA 3SJOA 3UWJH 4OS5A 1O31A 1SL3A 3HGNA 4ZXXH 5L2YH 2UUYA 3E16B 1BHXF 3RMMH 3D49H 1ZYOA 1GGDC 1GHAG 4YOIA 1HAGE 1DOJA 2OXSA 1OWIA 1TIOA 1V2ST 2ZU5A 2BY8X 1THSH 2BDGA 3URCA 1G37A 1DY8A 1QTFA 2XBWA 3PMBB 1Z8GA 4NA9H 2H5CA 1W7GH 3OX7U 4FUJA 4SGBE 4B2BA 4E05H 1SFIA 1GI7B 2B5TB 1OOKB 3SUFA 1PPEE 1LKBA 5JB8S 1HUTH 4LZ1H 1OWEA 1V2RT 1SBWA 1GJDB 1UTLM 1BRCE 3P17H 3CS0A 5I25A 1HIAA 1TGCA 1DWCH 1UTNA 5A8ZA 1AI8H 3P70B 1EJMA 2VIWA 1RTFB 3PYHA 1RGQA 1V2TT 3E8LA 4OS2A 1Q3XA 2FI3E 3SI4H 1BCUH 2TGTA 4DCDA 4RKOB 5EXLA 1ID5H 1LVYA 3LC5A 1T8OA 1GBAA 2QXIA 4KKDA 1AHTH 3RXOA 3VGCC 2FESH 1YCPH 1V2LT 1TA6A 2ZFQH 3PLKA 1O3HA 4ISIH 3QWCH 3GCNA 1AKSA 7KMEH 4BAKB 1AVGH 3RXHA 1GMCF 1UTOA 5C1YA 1PPBH 2PTNA 1C5TA 2GZ9A 1EZSC 3E0NB 1T32A 2AMDA 1MBMA 1YC0A 1O2SA 1UHBB 1F5RA 1GBEA 3E1XB 1HJAB 1HLTH 2K1QA 1EJAA 4WVPE 4K60A 1JWTA 2QXHA 5DP4A 4A1VA 1PQ7A 1SGRE 3KHVA 1MQ6A 2FO9A 4WF8A 5TCAA 4BTUB 2Z9KA 5TJXA 3ZYEA 4AB9A 1EZQA 3SJ8A 2BVRH 1MAYA 2AGIX 1ANCA 9ESTA 2OQ5A 4Q7YA 1C1SA 2W5EA 2P3FH 1C1VH 1C5XB 1CT0E 1GI0A 3BTGE 2VWLA 1GHAF 1QJ6B 1TX6A 2XC0A 3A8CA 3ELAH 3UPEA 1AY6H 4ZROA 1GBCA 2O9QA 2RA0A 3SU5A 3LGTA 3SJKA 5A0BA 2FYQA 1PPHE 4X2YA 1AQ7A 2FODA 2P8OC 2P8OB 4OS1A 1P11E 4ISNA 4ABGA 2W7SA 2G5NA 4ABAA 1YPGH 4BANB 1TALA 3A87A 3E6PH 3ZVGA 2CF8H 1B0FA 1OX1A 2HGTH 1EZUC 2HNTE 1O30A 1P05A 2Z9IA 5LGOA 2DE9A 4AN7A 3U8TH 1HXEH 3RC5A 3S9CA 2FOBA 2G5VA 8KME2 1JBUH 1O32A 3B8JA 2C8WB 3E91A 1RFNA 1O5EH 1H9HE 1LDTT 1SB1H 2ZCHP 1H8IH 2Y7ZA 1IHSH 4FUBA 1TB6H 3V7TA 4NA8A 2GDDA 5J4SA 3FP7E 1EUFA 3CP7A 1FZZA 1HGTH 4TWYA 3UWIA 2BVSH 3A8DA 2JH6D 3SNAA 4ZHLU 3TH3H 3DA9B 4F4OC 3RXLA 2BY7X 1QIXB 1A7SA 1TX7A 2ZHFH 3SUEA 5L6NH 4A7IB 1O34A 1WTHD 4YLUA 5EG4A 2A1DB 3HKIB 5C20A 2QXGA 4NIWA 3C1KA 3EAJA 1CT2E 3VFEA 3STJA 3LKWA 4Y76A 2BZAA 1L4DA 1WYKA 4MLFB 5HM9A 5AFZH 2SGAA 5E0HA 1KXFA 1VZQH 3Q76A 2J34A 1MTNC 2BX3A 1OWKA 3F9EA 3SU1A 1G3CA 1BIOA 1KY9A 1GI3A 1JMOH 1DPOA 2ZDAH 1GI1A 1P04A 1W2KH 1BBRE 2XCNA 1CA0B 3MO6A 4AORA 5JBBS 2J94A 3RXIA 3A82A 1A3EH 2FZZA 2FOAA 2WPLS 2ZGJA 1C5QA 1BMNH 1GJCB 1Z6JH 4DVAU 2GX4A 2A2QH 2A4OA 1TPPA 5A8XA 4FUCA 1K1PA 3PV4A 3BTDE 3TNTA 3SZNA 3NCLA 1OYTH 1LHCH 3ODDA 1SLWB 4HGCA 1P01A 3P8NA 4LZ4B 1UK2A 4NFEA 4YESB 3F6UH 3GCTG 2UUKB 1VITG 2Y5GA 1UTMA 2P59A 1T31A 1P12E 2HOBA 2QA9E 2V0BA 4UDWH 5FX6A 3ZZDA 1XUGA 1QA0A 2FMJA 2Y6TA 4A1TA 3GY4A 2H2ZA 1BZXE 1S0RA 1GG6B 5EXNA 5L30H 4TPIZ 1HB0B 3RM2H 2BD3A 3M7QA 2LPRA 3QGJA 4K1TA 4XBBA 3S0NA 1Z6EA 1V2MT 4X1PU 2PKSB 1QRZA 4H4FA 1TWXB 1FONA 2H9HA 2R2WU 1PQAA 1P2KA 3SO3A 2ZGCA 1UVTH 4OGXA 5GWZA 3SV9A 3M61U 4QT8C 1NRQH 2F9VA 1MKWK 1P9UA 4FXGH 4J1YA 4LXBH 1LPZB 1O2QA 1K1IA 3V13A 3UQOA 3BF6H 5CE1A 2ANMH 8ESTE 6GCHG 4Q80A 2J92A 3KQEA 4Y7AA 1G36A 5DG6A 3CENA 1O38A 3QN7A 3LH3A 3BV9B 2G55A 1V2VT 4B2CA 1FI8A 1BT7A 1DM4B 2XWBI 3ZZAA 1D4PB 2ZPRA 1ZMJA 4K8YA 1O3MA 2ZC9H 1ZZZA 1HNEE 1T7CA 3MNBA 4FVDA 2AIQA 4LOYH 1FNIA 1ANEA 3Q3KA 1GI4A 3UREA 2STBE 3UNQA 1O3IA 3K9XB 1A0JA 3MU5A 1T4VH 1ZR0A 3HK6B 1QCPA 4J2YB 3BTTE 3VB5A 1O2XA 2Q1JA 5FPSA 2BVXH 4OGYA 5FX5A 3SV2H 3ZZ5A 1YP9A 5AF9H 3MNXA 2RA3A 4IC5A 1DITH 3Q77A 1AE5A 2QF3A 4OS4A 1KTSB 1AD8H 2QN5T 1CVWH 4ASHA 1S6HA 4WMDA 3E0PB 1A0HB 2R2MB 1QFKH 1BTXA 1KXAA 1FIWA 2SFAA 1QL9A 4RKJB 1VITF 2HRVA 2FTMA 1BJUA 3L33A 3P6ZB 4IC6A 2C3SA 1AVXA 1FIZA 3T5FH 3EA7A 1GJ6A 1Q2WA 1TMTH 1KIGH 1OS8A 1G32B 2ZECA 2CHAC 2CHAB 4JYTA 3SORA 3HGPA 1W0YH 3A7ZA 3SU0A 1O5FH 1KYNA 1JXPA 3UNSA 1TBQH 2ZDLA 4IMZA 2LNCA 2ZP0H 1EAUA 1O2HA 4U01A 2OBQA 1Z8JB 2ZEBA 3UR9A 1FY1A 1SGFG 3DFLA 5GCHG 3T2NA 1INCA 3F1SB 6CHAC 2FM2A 2ODQA 4O97A 2ZKSA 2TIOA 1W0ZU 1TONA 3ZZ8A 1QB1A 5DP3A 3GY6A 4ESTE 3F9GA 3EDXB 6GCHF 1O3OA 3O8DA 4WXIA 3W95A 4NFFA 1UTKA 1GI6A 1O3KA 3SHCH 3UFAA 2FOCA 1ZMLA 2UUJB 4B71A 5C1UA 1C2GA 2Q6FA 3F68H 2Z3EA 2V3OH 1C9PA 2GCHG 5DP8A 1L4ZA 4ZAEA 3GY7A 3S7KB 3JZ1B 1EX3A 4Z0KA 1V2KT 3H7OA 2WUBA 5GDSH 5F8TA 1E35B 1SI5H 3A7YA 4UD9H 1HAHH 2FOHA 3KQDA 1IQKA 4NSYA 2XBXA 2A32A 2ANKH 2WV5A 2BDCA 1LVBA 5EODA 1X7AC 5JBAS 5A0CA 4K5ZA 2HWLB 4DURA 1SGEE 3GCHB 2ZA5A 1N8OC 1N8OB 3EGKH 3PMHB 4I33A 1BTHH 4I8HA 4FUDA 1C1PA 1NFYA 1EXFA 3M5LA 3BTKE 5ETXA 1TNIA 1TMBH 2XYAA 3MO3A 1O2LA 3BSQA 1XKBC 7GCHG 1E37B 2QGRA 1S5SA 2GV7A 3OYPA 4Y0YE 3ZVFA 3TJNA 1GMHG 1GJBB 3HKJB 3D62A 3A7VA 4JZDH 2WINI 1IAUA 3U98H 1YKTA 2GD4B 5EU8A 3EE0B 1CO7E 2VWMA 3ENSB 1TNGA 1P3EA 1J14A 1HCGA 1HAZB 2SGDE 1FV9A 1O5CB 3T28A 3A8BA 3RXEA 3P92A 5C3NA 1C1NA 5EXMA 1BTUA 1J8AA 1OKXA 3L6PA 4NCYA 1XXDA 1HJ8A 2QIQA 4MPWA 2FOFA 1YLCA 1G3EA 1LMWB 4D7GA 3LOXA 4BTIB 2WPJS 3QUMP 1LHFH 2ZQ2A 1C5PA 1GL0E 3LPRA 1LKAA 1DFPA 3M3TA 4JZ1A 2F9BH 1BBRK 5GCHF 2GV6A 2PGQB 4Y8XA 1S6FA 3S9AA 5C67A 4ABDA 2V3HH 1O36A 1MQ5A 2BLOA 2FX6A 2JETC 2TGDA 1QL7A 1BTPA 4UEHH 1FQ3A 1DWBH 1KXBA 2Y5HA 1ZJDA 4CR9A 4ZHAA 3BEIB 1ZJKA 2BTCE 2BM2A 3RMNH 1QY6A 1A5HA 1LPGB 4IS5A 2QV1A 2NU4E 5JB9S 2GMTC 1P09A 1HJ9A 1ETRH 2FWWA 2FXRA 5LPFA 1ESAA 4FUEA 1IQNA 1XKAC 2VU8E 2B0FA 1P9SA 4WJG2 1BTZA 4A6LA 2UWLA 3GYLB 3B9FH 4FU8A 3NUMA 4X1QU 1MCVA 3RXUA 3BTEE 2OC8A 1O2NA 1CU1A 4RSPA 3ZV8A 5LPEA 3V12A 4AG1A 2QCYA 2ZHQH 2JH0D 1G3BA 1YLDA 1OYQA 1O2IA 3SBKA 3ATIA 1GHXH 1C2HA 2TPIZ 2B9LA 5T6GA 1GGDB 1TGNA 5E8EH 7GCHF 2UWOA 4PROA 3SNDA 2ZG0H 3IWMA 1GMHF 4JK5A 2C93B 4BAQB 2BQ6B 1S83A 1SR5C 3RU4D 3SHAH 1AWHB 2BLQA 1BTWA 3DD2H 5C5NA 1FY4A 3O8RA 2CN0H 1OWHA 1BMAA 3B23B 3RDZA 3KQBA 1F0UA 1F0RA 1P57B 3LDXH 1A0LA 1F0TA 3ATWA 1A61H 1C4U2 1XX9A 4CBOA 1SGYE 1C5YB 1O5AB 1C1TA 3BEFB 2O8WA 4U30A 4OS6A 2H9EH 1ANBA 3H7TA 5DP5A 1ZSKA 1ZTLA 4D8NA 2ZHEH 3TU7H 4NIVA 1RTLA 1RD3B 2BX4A 1EQ9A 2ILNA 4JZFH 1HAXB 1DS2E 1PPGE 1L2EA 1GCTC 1GCTB 4FUHA 1ETTH 1BRBE 5E0JA 4BAMB 1CGJE 1UVSH 3BTQE 1P3CA 2TBSA 5C1XA 4Y79A 2A31A 1O2VA 3D23A 3QTVH 2WYGA 3VGCB 2ZTZA 4YO9A 1F5KU 1ELEE 2C4FH 1G2MA 1VCWA 7LPRA 1QQUA 1QRWA 1EATA 3SV6A 1SQOA 4CH8B 1SGQE 3U9AH 8LPRA 1O5BB 3NWUA 1DUEA 4NA7A 1FN8A 1BDAA 1CHOG 1DWEH 1W7XH 5L2ZH 1N6XA 4INHA 1NRRH 3ESTA 1FMGA 4GSOA 3PMJA 1O2KA 2R0KA 2BD4A 2VIPA 1C5OH 3BG4C 5K0HA 4D9QA 1DXPA 2XBYA 1OP0A 3A83A 1TPAE 4D7FA 3UOPA 5F6MA 1LPKB 1Y3YA 3BTHE 2Y80A 1ZHPA 3D65E 2ZNKH 2ZF0H 3MH7A 4CBNA 2F3CE 4K3JA 5DPAA 1O2GH 1DANH 1PQ5A 1C5SA 1YCPM 3P8GA 1OWDA 4I7YH 4O3TA 1VGCC 2GTBA 3BTWE 4XFQA 1O0DH 3P95A 5BRRE 4I8JA 2ZU3A 2PKAB 2HPPH 4ISOA 1LQDB 2BHGA 3KGPA 4LK4A 1P2MA 2A7CA 5FBEA 3RU4E 3W94A 5A8YA 1K21H 3GCOA 3NXPA 2ZDMA 1ARCA 4AFSA 5K7RA 3SGBE 2BD9A 2FS8A 4Y0ZE 5FBIA 1TGBA 1BITA 2Q6DA 1SGCA 4H6TA 5HM2A 1A2CH 5JPMH 1DVAH 2SGEE 4XBCA 2HNTF 3VB3A 5EQRA 4ABJA 4Q7ZA 1UO6A 1QQ4A 1O2UA 4AFZA 1V2UT 1GBHA 1SGFA 1LTOA 1H1BA 4FUGA 2J9NA 4AG2A 1TFXA 4UFGH 3ATKA 3ITIA 1O2ZA 2NWNA 2ZQ1A 3SJ9A 2AMQA 2NU2E 1UVUH 2ODYB 4BAHB 4ZKRU 4CRFA 2NU1E 1QBVH 1GBJA 1MTSA 1TRMA 4ISLA 2KAIA 4I32A 4BOHA 1ORFA 2FPZA 3F9FA 3MFJA 3LONA 1O2OA 2A7HA 5PTPA 3VB4A 1A5IA 1CBWC 3ATMA 1J17T 1QGFA 1CT4E 5DKMA 1GJ7B 1UJ1A 2ZFFH 4GUXA 1CHOF 1EAXA 3BIUH 3SU4A 2A7JA 1BUIA 3AW1A 4ABHA 1IQJA 1C5WB 1NROH 1TOMH 1P0SH 1MTNB 3TJUA 1EAWA 2I6SA 2P3TB 3KNXA 5H4IB 4FU9A 1K1MA 1B0EA 1QNJA 2ASUB 3M7TA 4X6NA 1NO9H 3MU0A 1BMMH 2ZFPH 7ESTE 1TPSA 1GCDA 3MH5A 4CH2B 2Z9LA 3PLBA 2J4IA 1GBBA 4NZLA 3AVZA 1C9TA 1XXFA 2RCEA 4A92A 2CJIA 3SI3H 1N1LA 1KLIH 2A45B 2Z3DA 1PPZA 4JMYA 4ABFA 4IGDA 4ZXYH 2V35A 1TNLA 1YPLH 4KTCA 4RN6A 2ZU1A 5LPRA 2A4GA 1PQ8A 1QJ7B 2XXLA 4Y10E 1MKXK 4ZKNU 2D26C 1IQHA 2OQUA 2R9PA 3QK1A 2R3YA 2BZ6H 3NK8A 1W11U 1EP6A 4GHQA 2FX4A 4BNRA 4XOJA 1KLJH 1LCYA 3FP6E 1P2IA 2OC0A 2PSYA 4X6OA 4Y8ZA 5DP9A 1KDQB 1TRYA 1N6YA 1GJ9B 4ZKSU 3TVJB 4I8LA 4DGJA 2ZU2A 1VITH 3E90B 2NU0E 3LT3A 1NS3A 1TYNA 2A5IA 3ZZ6A 1GI2A 1O2JA 1O5DH 4IBLH 3K6ZA 1G3DA 1UK4A 4MDSA 1NPMA 4WXVA 4X6PA 1PFXC 1OWJA 3M35A 2H5DA 1O33A 1KXDA 1G9IE 1IQFA 1V2JT 5F8ZA 3A85A 3MH4A 4MVNA 1K22H 4ZH8A 3C27B 2PUQH 3PM3A 1K1JA 2HALA 4XBDA 5GIBA 1GVLA 2BY5X 3FFGA 1DLEA 4K8BA 4TYDA 1AUJA 4JZEH 2D2DA 5JBTA 4MNYA 8GCHG 1AO5A 2FLBH 2ZTYA 4K2YA 3PTNA 2J2UA 4AFQA 2W26A 3VEQB 2VH6A 2XW9A 1V2OT 1ANDA 1GHZA 4DOQA 1GDNA 1DLKB 1ZHMA 3Q3YA 2Y81A 5DJ7A 1DX5M 2BQWB 1TNKA 4B74A 3ZZ3A 1ZOMA 2ALPA 3T27A 4ZHMU 3OU0A 1SQTA 2GCTC 1E34B 3QX5H 4ABEA 1VR1H 1AIXH 1FY5A 3VPKA 2PLXA 1O35A 1FJSA 3QZRA 1EASA 1LHDH 3MU4A 4Q2KA 4D76A 1HAVB 1S85A 3F9HA 1KTTB 3TNSA 2VVVA 1ZPZA 4AYVB 2F83A 2SGPE 2O8LA 2FI5E 4O03A 2BD8A 3MI4A 2OCVB 1C1RA 2WUCA 4A5TS 1FPCH 2UWPA 1U6QA 1QL8A 4X2VA 3S69A 3MOCA 1QURH 1FLEE 4CRCA 1FAKH 4KTSA 3ZVCA 2GGVB 2HPQH 1W10U 2OINA 2XC4A 2ZPQA 2FOGA 1UVOA 2QY0B 2P95A 3SJIA 4BXSA 2G51A 1F0SA 3ZVDA 3ODFA 4NIXA 1P2JA 1DSUA 4K1SA 3S9BA 3FZDA 3AASA 6CHAB 3O8BA 1EB2A 2TRMA 2BD2A 3A7TA 3EQ0H 5A0AE 1F92A 1AVWA 3RXMA 4WMEA 2BLWA 2ESTE 4GHTA 2QF0A 2Y7XA 4X1NU 3PLPA 3QLPH 2EI8A 1V3XA 4MNVA 3O8CA 1O3NA 3H5CB 1TMUH 5EPNA 1TA2A 4H6SB 1BA8B 3UTUH 3FP8E 4E7RG 8GCHF 1AUTC 1G2LA 5B6OA 2OUAA 4KGAA 1C2FA 3Q3XA 5GXPA 3P8OA 1GBDA 2BDBA 3PB1E 3RXFA 1S81A 2P16A 1MAXA 3RXKA 1O3DA 3TGJE 1QB9A 2OLGA 2Z6BD 2CV3A 1EB1H 1ZGVA 1O3FA 1ELTA 5ABWA 1W14U 2ZDKA 4I8KA 3RXGA 1K1NA 1ZSJA 2ZI2H 2PFEA 3ZV9A 3SU2A 4XSKU 2Z9GA 4Y6DA 2EA3A 1T4UH 1KLTA 1SLXB 2SNWA 2JH5D 2P3UB 2IOTA 4WMFA 1LO6A 4UFEH 1UTJA 1D9IA 4TY6A 4ZKOU 1YPEH 4DW2U 4CHAC 1NRSH 2O8TA 3BTME 4INLA 1NY22 2ZFRH 2FS9A 4U2WA 4XDEA 1TE0A 3SGQE 2PR3A 1MKWH 3LJJA 1GJ5H 1T8MA 4X8SH 1V2NT 2AFQB 1J16A 1QHRB 1Y5AT 1AU8A 1EPTA 3K65B 5EW1H 2QAAA 1YCPK 2FLRH 2QXJA 3AAVA 1EPTC 3M37A 3LC3A 3QDZB 3Q00A 1OP2A 4B1TA 2D1JA 2CF9H 1MD8A 3L3TA 1FPHH 1V2WT 2ALVA 1TX8A 1DICA 1ZSLA 4GPGA 3ZVBA 5CHAC 1UTPA 2J38A 1GVZA 1YPHC 1WAYB 1TQ7B 5FPYA 1SMFE 3AAUA 2OC1A 3MHWU 1KSNA 1GBIA 4AYYB 1DSTA 4CRDA 1FUJA 2FI4E 1ELVA 1SG8B 2BY9X 5JDUB 1C5UA 4UE7H 1GVKB 3R0FA 3ATLA 1JIRA 1YM0A 3TH2H 3M36A 1O3BA 4VGCC 2SGQE 1IHTH 2W7UA 1GHVH 4IN1A 2JETB 1ZMNA 3V3MA 1JOUB 1SGTA 2OTVA 2ZWLH 3RMOH 3SW2B 3A81A 4X8TH 3A88A 2G52A 3AW0A 1VCQA 3OTJE 4F49A 4D9RA 1XUHA 1SHHB 4AZ2B 4WH6A 3V0XA 3M3VA 3DHKH 1BTYA 1ABJH 1TOCB 3PMAB 2GMTB 3UNRA 1O39A 2VH0A 4GLYA 4Q7XA 1ZRKA 2XC5A 3A7WA 5JYIA 2FIRH 5T6DA 3VXEH 1PPFE 5G4BA 4CRGA 5EW2H 1YPJH 2WV4A 1WOFA 2FOMB 1GBTA 2XBVA 5E2OA 2GVFA 1P06A 4JK6A 1MUEB 6ESTA 3LGYA 1AGJA 3PTBA 1Q31A 3RXCA 5CMXH 2SGFE 1VJ9U 1UCYH 1AFQC 4MNXA 2XNIA 1P2NA 2WPMS 4X8UH 3RXPA 1BQYA 1QA7A 1XMNB 1O37A 5DK1A 2PW8H 2VVCA 1RIWC 2O8UA 1Y3WA 2PWXA 2VWOA 1C5NH 1ZTKA 1HAIH 1HYLA 5F8XA 4ABIA 5I46H 2VNTA 3RXVA 1QB6A 1NFUA 1TGTA 2ZHDA 1C5ZB 3RXTA 1C2LA 1C1OA 1ESTA 1PYTC 4M7GA 2AGGX 4CREA 2HVXA 2WPHS 2UUFB 3OSYA 5ESTE 2G8TA 1Y3XA 3BIVH 2R3UA 1MTUA 1MZAA 2WPKS 4X8VH 1WUNH 1JIMA 3MTYA 2FYRA 4B2AA 1CQQA 4YZUA 4AOQA 3ZZ9A 1AFEH 1VJAU 3LGUA 2BD7A 2CXVA 2ZTXA 3SQHE 1SLVB 1Z8IB 4X2XA 2THFB 1S0QA 2VJ1A 3ZVEA 1TPOA 2BXUH 2WYJA 2ZFTA 1C4V2 1HIAB 4MNWA 5A2MH 3LJOA 1TLDA 4X0WU 2VINA 1YBWA 2VIOA 2ZHWH 1S82A 4X1SU 5GPIB 2FOEA 2VIDA 3UIRA 4AFUA 2VVUA 2DE8A 2A5KA 3PWCA 3GY3A 4H42U 2A5AA 2GDEH 3DUXH 4BTTB 1OP8A 1EKBB 3TK9A 1P10A 3TPIZ 3KQCA 4NWKA 4R0IA 1L1JA 2ZU4A 4XE4A 3RU4T 5DP7A 1ELGA 2VB0A 1AKSB 2J95A 1D6WA 3BTFE 3MWIU 3RXDA 3TIUA 3SUGA 2C8ZB 1CHGA 1ABIH 1NU9A 2NU3E 1A5GH 3JZ2B 4AB8A 2BLVA 4TPYA 5EGMA 2SNVA 1TRNA 2IJOB 5FHTA 1XUJA 1O2PA 5FPTA 1SGDE 3BG4B 4Y8YA 1IQEA 4IW4E 3GICB 1YPMH 3PROA 1C5VA 2VGCC 2VGCB 3FAOA 1THPB 1P02A 3K6YA 1UCYE 1RTKA 4B75A 3PWBA 1E36B 2PV9B 4THNH 1Z1IA 1Y8TA 1UHBA 1FDPA 1HV7A 1K2I1 1NT1A 1XUKA 2BDIA 1C2KA 4INKA 2GZ8A 3RXSA 1C5RA 2AS9A 3TK6A 3SV8A 4A1XA 2QC2A 3FANA 1HJAC 3ZZ4A 1YGCH 4DJZB 3GOVB 4CR5A 1CA8B 1D3DB 3N7OA 3QZQA 3I78A 2Q6GA 4MPXA 1EJNA 1VGCB 3DT0H 1BBRH 3BEUA 2A4RA 2P93A 3SOSA 1C5MD 1W3CA 1A1RA 1S84A 1K9OE 4AX9H 2WPIS 3TLOA 1V2QT 2TGPZ 4UONA 1GHWH 1LVMA 3SN8A 5IYTA 1MD7A 3LH1A 4WH8A 4ABBA 3M5MA 1B7XB 3S7HB 1RXPA 1NU7B 1NTPA 1O3EA 3SQEE 4X6MA 2PKAA 2XTTB 3RLWH 2FDAA 2RDLA 2A0QB 3KF2A 1K1OA 3QGNB 5BPEA 2FEQH 1J9CH 4JYVH 3GDVA 3RXBA 3T25A 1LVOA 3TITA 1GBLA 4GCHG 2FTLE 4DT7B 1NFXA 1TNJA 1Y59T 1WBGB 2BDAA 1Y5UT 1QJ1B 2O8MA 1DWDH 2Y5FA 4TWWA 4BXWA 4MG3A 3RXAA 3SNEA 1UMAH 1BMLA 1T8LA 3GDSA 4YT7H 1FY8E 1AB9C 1AB9B 3KN2A 1XVMA 1LHGH 3T62A 5EOKA 2H1UA 3T29A 1OXGA 1XUFA 1SOTA 2KAIB 2Z94A 1SGPE 3HATH 1ARBA 2ULLA 3VB6A 4AGJA 1CBWB 2GKVE 4OS7A 1MTWA 5DO4H 4DIIH 1NN6A 3R3GB 1CGIE 2F9OA 3NKKA 2I6QA 3TK5A 3GY2A 5FCKA 3M3SA 2P94A 1TBZH 2YNAA 3EA9A 1P8VC 2ZDVH 1XVOA 1GPZA 3UY9A 1GMDG 5C2ZA 5HXFA 4YOGA 3WY8A 2PGBB 1MU8B 1C2MA 2ZIQH 5A09A 1TABE 3MMGA 3A86A 3MNSA 1ZPBA 2AGEX 2VWNA 1P2OA 1NRNH 1NRPH 2OP9A 1GBMA 2RG3A 2BY6X 1TQ0B 1Y5BT 1BHXB 3QTOH 4CRAA 3ZYDA 3RC4A 5LH8A 1WTGH 4DY7B 1BOQA 1NM6A 1ETSH 2VIVA 2ZZUH 1CSOE 2C8YB 1ELDE 1CA0C 3LGVA 3KEEA 1C5LH 2EI6A 4BAOB 2ODPA 4UFDH 3TGKE 1Z71A 1ACBE 1SQAA 4TY7A 2V6NA 2F9UA 3GY8A 1ESBA 1WQSA 5C5OA 1SGIB 4FVBA 1B5GH 2BXTH 1LHEH 1SC8U 5AVDA 1W12U 1GDUA 4FUIA 3TH4H 1PYTD 3SGAE 1DDJA 1GHBG 2BOKA 2CGAA 4B73A 1WSSH 1QBOA 4K69A 4O3UA 2ZGHA 1EOLA 1UVPA 1IQMA 3RP2A 3GY5A 4E7NA 1GBKA 5JBCS 5EQQA 1D3TB 3MO9A 1ZRBA 3M5NA 1CGHA 1C1UH 1KDQA 3EYDA 3OY5U 4NG9H 1YPHE 4GCHF 1WV7H 4NIYA 3U69H 1E38B 1IQGA 4Y7BA 3RXRA 1SSXA 1GG6C 3TGIE 3RXQA 2BYAX 1IQLA 2C90B 5EPYA 1O2TA 3A8AA 3BG8A 1FY3A 2PKSC 3K2UA 1NESE 4YTAA 5T6FA 5J4QA 3UOUA 5FAHA 1UTQA 3OY6U 4YM9A 1H8DH 1MMJN 1SOZA 2OBOA 4ISHH 5E2PA 2F9PA 3ZVAA 2AERH 3RLYH 1IOEA 1W13U 3SNCA 1ZGIA 1EOJA 3BN9A 1D6RA 4AGKA 1VCPA 3MH6A 3LGIA 1GL1A 1HXFH 1SGNE 4Y11E 3A80A 1SVPA 4DIHH 1TNHA 1MBQA 4O9VA 5DGJA 1GMDF 1HPGA 3LU9B 3MU1A 1H9LB 1O2RA 1L1NA 1O3LA 1DUAA 5GJ4B 3LIWA 1C1MA 6LPRA 3U8OH 2Z9JA 4NZQA 2GCTB 1GDQA 3UR6A 1C2JA 1JRSA 2B8OH 1RRKA 4B76A 1SHYA 1IQIA 4NWLA 2BMGB 5E0GA 3A7XA 2EEKA 1ELBA 1GJAB 2GT7A 3GDUA 1H4WA 1TBRH 2ZCKP 1Y3VA 2R0LA 1MH0A 1KXCA 4SGAE 1QRXA 4IN2A 2G81E 4FUFA 1OSSA 1MU6B 3KL6A 1MTVA 2W3KA 1O3JA 1HAVA 2AEIH 3M5OA 2ZGBH 3P8FA 1ELCA 1O2WA 3I29A 3ZZ7A 1CE5A 1SLUB 2PSXA 1O3CA 1Z8RA 2ZPSA 3ZZCA 1GHBF 1H9IE 4NGAH 1RJXB 2Z7FE 3EA8A 2EI7A 2G4TA 4I8GA 1DE7H 1DY9A 1EAIA 2HNTC 1EP5A 3GCTF 1Y3UA 1LQEA 1F7ZA 1FXYA 3RXJA 3UUZA 3U1IB 1UK3A 4MPUA 2YOLA 3SU3A 3KIDU 3ZZBA 5FXLA 3FVFB 1P2QA 1HAYB 2F9NA 4E06H 1HAPH 2W3IA 2AYWA 4HFPB 4I31A 5HGGA 3TJOA 2FP7B 2XCFA 3I77A 1AMHA 5IDKA 1UCYK 2OC7A 4WY3A 2AH4X 1MCTA 2B7DH
chains in the Genus database with same CATH superfamily
3U8RH 1C2DA 2PTCE 1BRAA 1AZ8A 3IITA 2GZ7A 2KCYA 3LGWA 1GI8B 1T8NA 4I86A 5C94A 2XWAA 3IG6B 4YT6H 3FO8D 3HPTB 4JZIA 2IN2A 1ZHRA 3NZIA 1MKXH 3RM0H 3RUOA 1UW7A 3SUDA 4X1RU 3RC6A 1THRH 3URDA 2BOHB 3QO6A 5HYOA 4GAWA 1ELFA 1O3GA 3A89A 3KCGH 4HI3A 1HFDA 3SV7A 2ZGXH 3T26A 1K28D 2QYIA 1ZPCA 1MZDA 1E1QD 2A4QA 3VXFH 3GISB 4JCNA 1DXWA 1C2IA 1D3PB 2IPHA 1G30B 5F03A 3SU6A 2K8IA 3H09A 1PJPA 1F5LA 2BQ7B 2G4UA 2ZDNA 4CHAB 2PHBA 1HBTH 2F91A 1XM1A 2ANYA 2AMPA 4WWYA 1WQVH 1ZLRA 1AN1E 1GI5A 1O2YA 2C8XB 2XOKD 3FZZA 3SNBA 2VIQA 1GHYH 1GJ4H 3GCHC 1SPJA 1BB0B 4ZUHA 4JYUH 1QZ8A 1E0FD 4MTBA 1A46H 1ZTJA 5C17A 1EPTB 5EQSA 3E3TA 1F2SE 4CRBA 1FAXA 1WXRA 1YPKH 1ELAA 4HTCH 4KELA 4UFFH 1HRTH 3G01A 1C2EA 1L0ZA 1C1QA 1AE8H 2OD3B 5CHAB 2ZFSA 2GP9B 4DG4A 1C1WH 2D8WA 2PP6A 4MPVA 2H6MA 1SFQB 3M7UA 1O3AA 1XUIA 2BD5A 1FN6A 2DUCA 4KTUA 3TJVA 2M5TA 2Y82A 1M9UA 3UAIC 1P03A 1WU1A 5FCRA 4MQAA 4HZHA 3GYMA 2H9TH 1A3BH 3A84A 3RMLH 4VGCB 3UQVA 1K1LA 1AWFH 1TAWA 2YNBA 5T3HA 2ZCLP 3U28C 4Z1MD 3VB7A 3WWFA 2XRCA 4X2WA 1V6DA 3DCLA 3STIA 5SGAE 2F4LA 1RS0A 1BJVA 1NC6A 3DFJA 1NFWA 1A4WH 4IMQA 2TGAA 1PPCE 1YF4A 5AHGH 1L1GA 5DP6A 1O2MA 3MU8A 2Z3CA 2STAE 4K1EA 1KXEA 5HMAA 2PUXB 2G00A 1O5GH 3HK3B 1Z7KA 2ANWA 9LPRA 3MYWA 2GT8A 1HDTH 2CMYA 1QR3E 2ZO3H 5AFYH 1WCZA 2A2XH 1GMCG 1DT2A 2GCHF 4NSVA 2HLCA 3NPSA 2JDID 3N7DA 1GI9B 1JRTA 1TGSZ 3GS9A 1AZZA 1AFQB 1OPHB 2BDYA 5TCCA 1QBNA 3MNCA 1NZQH 1GWAA 4Y71A 2JKHA 2BDHA 1V2PT 3PV5A 1C4Y2 2BB4A 1YYY1 4FU7A 2AIPA 1D3QB 1J15A 1O3PB 4GVUA 4Z6AH 4YLQH 4YOJA 4KP0A 1RIWB 1GJ8B 3U1JB 2EC9H 4U32A 1BRUP 1Z1JA 1HAOH 4R8TB 1EZXC 3PO1C 3PO1B 4ZMAH 1GBFA 1W8BH 3CS7A 5ESBA 3SJOA 5B6LA 3UWJH 4OS5A 1O31A 1SL3A 3HGNA 4ZXXH 5L2YH 2UUYA 3E16B 1BHXF 3RMMH 3D49H 1ZYOA 1GGDC 1GHAG 4YOIA 1HAGE 1DOJA 2OXSA 1OWIA 1TIOA 1V2ST 2ZU5A 2BY8X 1THSH 2BDGA 3URCA 1G37A 1DY8A 1QTFA 2XBWA 3PMBB 1Z8GA 4NA9H 2H5CA 1W7GH 3OX7U 4FUJA 4SGBE 4B2BA 4E05H 1SFIA 1GI7B 2B5TB 1OOKB 3SUFA 1PPEE 1LKBA 5JB8S 1HUTH 4LZ1H 4ACAA 2L6OA 1OWEA 1V2RT 1SBWA 1GJDB 1UTLM 1BRCE 2YMSC 3P17H 3CS0A 5I25A 1HIAA 5DN6D 1TGCA 1DWCH 1UTNA 5A8ZA 1AI8H 3P70B 1EJMA 2VIWA 3F0OA 1RTFB 3PYHA 1RGQA 1V2TT 3E8LA 4OS2A 1Q3XA 2FI3E 3SI4H 1BCUH 1E79D 2JIZD 2TGTA 4DCDA 4RKOB 5EXLA 2VBCA 1ID5H 1LVYA 3LC5A 1T8OA 1GBAA 2QXIA 4KKDA 1AHTH 1S6LA 3RXOA 3VG8A 3VGCC 3KYGA 3F3BA 2FESH 1YCPH 1V2LT 1TA6A 2ZFQH 3PLKA 1O3HA 4ISIH 3QWCH 3GCNA 1AKSA 7KMEH 4BAKB 1H8ED 1AVGH 3RXHA 1GMCF 1UTOA 5C1YA 1PPBH 2V3MA 2PTNA 1C5TA 2WPDD 2GZ9A 1EZSC 3E0NB 1T32A 2AMDA 1MBMA 1YC0A 1O2SA 1UHBB 1F5RA 1GBEA 3E1XB 1HJAB 1HLTH 2K1QA 1EJAA 4WVPE 4K60A 1JWTA 5HIYA 2QXHA 4XD7D 5DP4A 4A1VA 1PQ7A 1SGRE 3KHVA 1MQ6A 3WW7A 2FO9A 4WF8A 5TCAA 4BTUB 2Z9KA 5TJXA 3ZYEA 4AB9A 1EZQA 3SJ8A 2BVRH 1MAYA 2AGIX 1ANCA 9ESTA 2OQ5A 4Q7YA 1C1SA 2W5EA 2P3FH 1C1VH 1C5XB 1CT0E 1GI0A 3BTGE 2VWLA 4FETA 1GHAF 1QJ6B 1TX6A 2XC0A 3A8CA 3ELAH 3UPEA 1AY6H 4ZROA 1GBCA 2O9QA 2RA0A 3SU5A 3LGTA 3SJKA 5A0BA 2FYQA 1PPHE 4X2YA 1AQ7A 2FODA 2P8OC 2P8OB 4OS1A 1P11E 4ISNA 4ABGA 2W7SA 2G5NA 4ABAA 1YPGH 4BANB 1TALA 3A87A 3E6PH 3ZVGA 2CF8H 1B0FA 1OX1A 2HGTH 3FN8A 1EZUC 2HNTE 1O30A 1P05A 2Z9IA 5LGOA 2DE9A 4AN7A 3U8TH 1HXEH 3RC5A 3S9CA 2FOBA 2G5VA 8KME2 1JBUH 1O32A 3B8JA 2C8WB 3E91A 1RFNA 1O5EH 1H9HE 1LDTT 1SB1H 4F48B 2ZCHP 1H8IH 2Y7ZA 1IHSH 4OM9A 4FUBA 1TB6H 3V7TA 4NA8A 2GDDA 5J4SA 3FP7E 1EUFA 3CP7A 1FZZA 1HGTH 4TWYA 3UWIA 2BVSH 3A8DA 1OHHD 2JH6D 3SNAA 4ZHLU 3TH3H 3DA9B 4F4OC 3RXLA 3KQ5A 2BY7X 1QIXB 1A7SA 1TX7A 2ZHFH 3SUEA 5L6NH 4A7IB 1O34A 1WTHD 4YLUA 5EG4A 2A1DB 3HKIB 5C20A 2QXGA 4NIWA 3C1KA 3EAJA 1CT2E 3VFEA 3STJA 3LKWA 4Y76A 2BZAA 1L4DA 1WYKA 4MLFB 5HM9A 4DT4A 5AFZH 2SGAA 5E0HA 1KXFA 1VZQH 3Q76A 2J34A 1MTNC 2BX3A 1OWKA 3F9EA 3SU1A 1G3CA 1BIOA 1KY9A 2QF5A 1GI3A 1JMOH 1DPOA 2ZDAH 1GI1A 1P04A 1W2KH 1BBRE 2XCNA 1CA0B 3MO6A 4AORA 5JBBS 2J94A 3RXIA 3A82A 1A3EH 2FZZA 2FOAA 2WPLS 2ZGJA 5F53A 1C5QA 1BMNH 1GJCB 1Z6JH 4DVAU 2GX4A 2A2QH 2A4OA 1TPPA 5A8XA 4FUCA 1K1PA 3PV4A 3BTDE 3TNTA 3SZNA 3NCLA 1OYTH 1LHCH 3ODDA 1SLWB 4HGCA 1P01A 3P8NA 4LZ4B 1YWUA 1UK2A 4NFEA 4YESB 3F6UH 3GCTG 2UUKB 1VITG 2Y5GA 1UTMA 2P59A 1T31A 1P12E 2HOBA 2QA9E 2V0BA 4UDWH 5FX6A 3ZZDA 1XUGA 1QA0A 2FMJA 2Y6TA 4A1TA 3GY4A 2H2ZA 1BZXE 1S0RA 1GG6B 5EXNA 5L30H 4TPIZ 1HB0B 3RM2H 2BD3A 3M7QA 2LPRA 3QGJA 4K1TA 4XBBA 3S0NA 1Z6EA 1V2MT 4X1PU 2PKSB 1QRZA 2EY4C 4H4FA 1TWXB 1FONA 2H9HA 2R2WU 1PQAA 1P2KA 3SO3A 2ZGCA 1UVTH 4OGXA 5GWZA 3SV9A 3M61U 4QT8C 1NRQH 2F9VA 1MKWK 1P9UA 4FXGH 4J1YA 4LXBH 1LPZB 1O2QA 1K1IA 3V13A 3UQOA 3BF6H 5CE1A 2ANMH 8ESTE 6GCHG 4Q80A 2J92A 3KQEA 4Y7AA 1G36A 5DG6A 3CENA 1O38A 3QN7A 3LH3A 3BV9B 2G55A 1V2VT 4B2CA 1FI8A 2WSSD 1BT7A 1DM4B 2XWBI 3ZZAA 1D4PB 2ZPRA 1ZMJA 4K8YA 1O3MA 2ZC9H 1ZZZA 1HNEE 1T7CA 3MNBA 4FVDA 2AIQA 4LOYH 1FNIA 1ANEA 3Q3KA 1GI4A 3UREA 2STBE 3UNQA 1O3IA 3K9XB 1A0JA 3MU5A 1T4VH 1ZR0A 3NRLA 3HK6B 1QCPA 4J2YB 3BTTE 3VB5A 1O2XA 2Q1JA 5FPSA 2BVXH 4OGYA 5FX5A 3SV2H 3ZZ5A 1YP9A 5AF9H 3MNXA 2RA3A 4IC5A 1DITH 4RT0A 3KYFA 3Q77A 1AE5A 2QF3A 4OS4A 1KTSB 1AD8H 2QN5T 1CVWH 5KEDA 4ASHA 1S6HA 3PV2A 4WMDA 3E0PB 1A0HB 2R2MB 1QFKH 1BTXA 1KXAA 1FIWA 2SFAA 1QL9A 4RKJB 1VITF 2HRVA 2FTMA 1BJUA 4TSFD 3L33A 3P6ZB 4IC6A 2C3SA 1AVXA 1FIZA 3T5FH 1SQRA 3EA7A 1GJ6A 1Q2WA 1TMTH 1KIGH 1OS8A 1G32B 2ZECA 2CHAC 2CHAB 4JYTA 3SORA 3HGPA 1W0YH 3A7ZA 3SU0A 1O5FH 1KYNA 1JXPA 3UNSA 4P00A 1TBQH 2ZDLA 4IMZA 2LNCA 2ZP0H 1EAUA 1O2HA 4U01A 2OBQA 1Z8JB 2ZEBA 3UR9A 1FY1A 1SGFG 3DFLA 5GCHG 3T2NA 1INCA 3F1SB 6CHAC 2FM2A 2ODQA 4O97A 2ZKSA 2TIOA 1W0ZU 1TONA 3ZZ8A 1QB1A 5DP3A 3GY6A 4ESTE 3F9GA 3EDXB 6GCHF 1O3OA 3O8DA 4WXIA 3W95A 4NFFA 1UTKA 1GI6A 1O3KA 3SHCH 3UFAA 2FOCA 1ZMLA 2UUJB 4B71A 5C1UA 1C2GA 2Q6FA 3F68H 2Z3EA 2V3OH 1C9PA 2GCHG 5DP8A 1L4ZA 4ZAEA 3GY7A 3S7KB 3JZ1B 1EX3A 4Z0KA 2KX4A 1V2KT 3H7OA 2WUBA 5GDSH 5F8TA 1E35B 1SI5H 1W0KD 3A7YA 4UD9H 1HAHH 2FOHA 3KQDA 1IQKA 4NSYA 2XBXA 5CHBA 2A32A 2ANKH 2WV5A 2BDCA 1LVBA 5EODA 1X7AC 5JBAS 5A0CA 4K5ZA 2HWLB 1BMFD 4TT3D 4DURA 1SGEE 3GCHB 2ZA5A 1N8OC 1N8OB 3EGKH 2QE7D 3PMHB 4I33A 1BTHH 4I8HA 4FUDA 1C1PA 1NFYA 1EXFA 3M5LA 3BTKE 5ETXA 1TNIA 1TMBH 2XYAA 3MO3A 1O2LA 3BSQA 1XKBC 7GCHG 1E37B 2QGRA 1S5SA 2GV7A 4ZCNA 3OYPA 4Y0YE 3ZVFA 2V7QD 1GMHG 3TJNA 1GJBB 3HKJB 3D62A 3A7VA 4JZDH 2WINI 1IAUA 3U98H 1YKTA 2GD4B 5EU8A 3EE0B 1CO7E 2VWMA 3F2FA 3ENSB 1TNGA 1P3EA 1J14A 1HCGA 1HAZB 2SGDE 1FV9A 1O5CB 3T28A 3A8BA 3RXEA 3P92A 5C3NA 1C1NA 5EXMA 1BTUA 1J8AA 1OKXA 3L6PA 4NCYA 5T1VA 1XXDA 1HJ8A 2QIQA 4MPWA 3FOAA 2FOFA 1YLCA 3UB0A 1G3EA 1LMWB 4D7GA 3LOXA 4BTIB 2WPJS 3QUMP 1LHFH 2ZQ2A 2KCAA 1C5PA 1GL0E 3LPRA 1LKAA 1DFPA 3M3TA 4FOUC 4JZ1A 2F9BH 1BBRK 5GCHF 2GV6A 2PGQB 4Y8XA 1S6FA 3S9AA 5C67A 4ABDA 2V3HH 1O36A 1MQ5A 2BLOA 2FX6A 2JETC 2TGDA 1QL7A 1BTPA 2K0QA 2WZQA 4UEHH 1FQ3A 1DWBH 1KXBA 2Y5HA 1ZJDA 4CR9A 4ZHAA 3BEIB 1ZJKA 2BTCE 2BM2A 3RMNH 1QY6A 1A5HA 1LPGB 4IS5A 2QV1A 2NU4E 5JB9S 2GMTC 1P09A 1HJ9A 4ACBA 1ETRH 2FWWA 2FXRA 5LPFA 1ESAA 4FUEA 1IQNA 1XKAC 2VU8E 2B0FA 1P9SA 4WJG2 1BTZA 4A6LA 2UWLA 3GYLB 3B9FH 4FU8A 3NUMA 4X1QU 1MCVA 3OEHD 3RXUA 3BTEE 2OC8A 1O2NA 1CU1A 4RSPA 3ZV8A 2EQNA 5LPEA 3V12A 4AG1A 2QCYA 2ZHQH 2JH0D 1G3BA 1YLDA 1OYQA 1O2IA 2GJGA 5HIZA 3SBKA 3ATIA 1GHXH 1C2HA 2TPIZ 2B9LA 5T6GA 1GGDB 1TGNA 5E8EH 7GCHF 2UWOA 4PROA 3SNDA 2ZG0H 2W6ID 3IWMA 1GMHF 4JK5A 2C93B 4BAQB 2BQ6B 1S83A 1SR5C 3RU4D 3SHAH 1AWHB 2BLQA 1BTWA 3DD2H 5C5NA 1FY4A 4RI0A 2CN0H 3O8RA 1OWHA 3OEED 1BMAA 4Q63A 3B23B 3RDZA 3KQBA 1F0UA 1F0RA 1P57B 3LDXH 1A0LA 1F0TA 3ATWA 1A61H 1C4U2 1XX9A 4CBOA 1SGYE 1C5YB 1O5AB 2YMSB 1C1TA 3BEFB 2O8WA 4U30A 4OS6A 2H9EH 3F0PA 1ANBA 3H7TA 5DP5A 1ZSKA 1ZTLA 4D8NA 2ZHEH 3TU7H 4NIVA 1RTLA 1RD3B 2BX4A 1EQ9A 2ILNA 4JZFH 1HAXB 1DS2E 1PPGE 1L2EA 1GCTC 1GCTB 4FUHA 1ETTH 1BRBE 5E0JA 4BAMB 1CGJE 1UVSH 3BTQE 1P3CA 2TBSA 5C1XA 4Y79A 2A31A 1O2VA 3D23A 3QTVH 2WYGA 3VGCB 2ZTZA 4YO9A 1F5KU 1ELEE 3F2HA 2C4FH 1G2MA 1VCWA 7LPRA 1QQUA 1QRWA 4P02A 1EATA 1MABB 3SV6A 1SQOA 4CH8B 1SGQE 3U9AH 8LPRA 1O5BB 3NWUA 1DUEA 4NA7A 1FN8A 1BDAA 1CHOG 1DWEH 1W7XH 5L2ZH 1N6XA 4INHA 1NRRH 3ESTA 1FMGA 4GSOA 3PMJA 1O2KA 2R0KA 2BD4A 2VIPA 1C5OH 3BG4C 5K0HA 4D9QA 1DXPA 2XBYA 1OP0A 3A83A 1TPAE 4D7FA 3UOPA 5F6MA 1LPKB 1Y3YA 1WDIA 3BTHE 2Y80A 1ZHPA 3D65E 3PRBA 2ZNKH 2ZF0H 3MH7A 4CBNA 2F3CE 4K3JA 5DPAA 1O2GH 1DANH 1PQ5A 1C5SA 1YCPM 3P8GA 1OWDA 4I7YH 4O3TA 1VGCC 2GTBA 3BTWE 4XFQA 1O0DH 3P95A 5BRRE 4I8JA 2ZU3A 2AHME 2PKAB 2KFWA 2HPPH 4ISOA 1LQDB 3OE7D 2BHGA 3KGPA 4LK4A 1P2MA 2A7CA 5FBEA 3RU4E 3W94A 5A8YA 2IPQX 1K21H 3GCOA 3NXPA 2ZDMA 2XNDD 1ARCA 4AFSA 5K7RA 3SGBE 2OK5A 2BD9A 2FS8A 4Y0ZE 5FBIA 1TGBA 1BITA 2Q6DA 1SGCA 4H6TA 5HM2A 1A2CH 5JPMH 1DVAH 2SGEE 4XBCA 2HNTF 3VB3A 5EQRA 4ABJA 4Q7ZA 1UO6A 1QQ4A 1O2UA 4AFZA 1V2UT 1GBHA 1SGFA 1LTOA 1SKYE 1H1BA 4FUGA 2J9NA 4AG2A 1TFXA 4UFGH 3ATKA 3ITIA 1O2ZA 2NWNA 2ZQ1A 3SJ9A 2AMQA 2NU2E 1UVUH 2ODYB 4BAHB 4ZKRU 1YY3A 2NU1E 4CRFA 5C0UA 5C0TA 1QBVH 1GBJA 1MTSA 1TRMA 4ISLA 2KAIA 4I32A 4BOHA 1ORFA 2FPZA 3F9FA 3MFJA 3LONA 1O2OA 2A7HA 5PTPA 3VB4A 1A5IA 1CBWC 3ATMA 1J17T 1QGFA 5GNDA 1CT4E 5DKMA 1GJ7B 1UJ1A 2ZFFH 4GUXA 1CHOF 1EAXA 3BIUH 3SU4A 2A7JA 1BUIA 2HVYB 3AW1A 4ABHA 1IQJA 1C5WB 2KR7A 1NROH 1TOMH 1P0SH 1MTNB 3TJUA 1EAWA 2I6SA 2P3TB 3KNXA 5H4IB 4FU9A 1K1MA 1B0EA 1QNJA 2ASUB 3M7TA 4X6NA 1NO9H 3MU0A 1BMMH 2ZFPH 7ESTE 1TPSA 1GCDA 3MH5A 5FL7D 3N7EA 4CH2B 2Z9LA 3PLBA 2J4IA 1GBBA 4NZLA 3AVZA 1C9TA 1XXFA 2RCEA 4A92A 2CJIA 2W6JD 3SI3H 1N1LA 1KLIH 2A45B 2Z3DA 1PPZA 4JMYA 4ABFA 4IGDA 4ZXYH 2V35A 1TNLA 1YPLH 4KTCA 4RN6A 2ZU1A 5LPRA 2A4GA 1PQ8A 1QJ7B 1K0HA 2XXLA 4Y10E 1MKXK 4ZKNU 2D26C 4ASUD 1IQHA 2OQUA 2R9PA 3QK1A 2R3YA 2BZ6H 3NK8A 1W11U 1EP6A 4GHQA 2FX4A 4BNRA 4XOJA 1KLJH 1LCYA 3FP6E 1P2IA 2OC0A 2PSYA 4X6OA 4Y8ZA 5DP9A 1KDQB 1TRYA 1N6YA 1GJ9B 4ZKSU 3TVJB 4I8LA 4DGJA 2ZU2A 1VITH 3E90B 2NU0E 3LT3A 1NS3A 1TYNA 2A5IA 2YMSD 3ZZ6A 1GI2A 1O2JA 1O5DH 4IBLH 3K6ZA 1G3DA 1UK4A 4MDSA 1NPMA 4WXVA 4X6PA 1PFXC 1OWJA 3M35A 2H5DA 1O33A 1KXDA 1G9IE 1IQFA 1V2JT 5F8ZA 3A85A 3MH4A 4MVNA 1K22H 4ZH8A 3C27B 2PUQH 3PM3A 1K1JA 2HALA 2HLDD 4XBDA 1GVLA 5GIBA 2BY5X 3FFGA 1DLEA 4K8BA 4TYDA 1AUJA 4JZEH 2D2DA 2LP6A 5JBTA 4MNYA 8GCHG 1AO5A 2FLBH 2ZTYA 4K2YA 3PTNA 2J2UA 4AFQA 2W26A 3VEQB 2VH6A 2XW9A 1V2OT 1ANDA 1GHZA 4DOQA 1GDNA 1DLKB 1ZHMA 3Q3YA 2Y81A 4Q4LA 5DJ7A 1DX5M 2BQWB 1TNKA 4B74A 3ZZ3A 1ZOMA 2ALPA 3T27A 4ZHMU 3OU0A 1SQTA 2GCTC 1W0JD 1E34B 3QX5H 4ABEA 2J98A 1VR1H 1AIXH 2M2AA 2J97A 1FY5A 3VPKA 2PLXA 1O35A 1FJSA 3QZRA 1EASA 1LHDH 3MU4A 4Q2KA 4D76A 1HAVB 1S85A 3F9HA 1KTTB 3TNSA 2VVVA 1ZPZA 4AYVB 3CNRA 2F83A 2SGPE 3EE7A 2O8LA 2FI5E 4YXWD 4O03A 2BD8A 3MI4A 2OCVB 1C1RA 2WUCA 4A5TS 3F2GA 1FPCH 2UWPA 1U6QA 1QL8A 4X2VA 3S69A 1VKYA 2KCOA 3MOCA 1QURH 1FLEE 4CRCA 1FAKH 4KTSA 3ZVCA 2GGVB 2HPQH 1W10U 2OINA 2XC4A 2ZPQA 2FOGA 4B6FA 1UVOA 2QY0B 2P95A 2QF4A 3SJIA 4BXSA 2G51A 1F0SA 3ZVDA 3ODFA 4NIXA 1EFRD 1P2JA 1DSUA 1NBMD 4K1SA 3S9BA 3FZDA 3AASA 6CHAB 3O8BA 1EB2A 2TRMA 2BD2A 3A7TA 2KM0A 3EQ0H 5A0AE 1F92A 1AVWA 3RXMA 4WMEA 2BLWA 2ESTE 4GHTA 2QF0A 2Y7XA 4X1NU 3PLPA 3QLPH 2EI8A 1V3XA 4MNVA 3O8CA 1O3NA 3H5CB 1TMUH 5EPNA 1TA2A 4H6SB 1BA8B 3UTUH 3FP8E 4E7RG 8GCHF 1AUTC 1G2LA 5B6OA 2OUAA 4KGAA 1C2FA 3Q3XA 5GXPA 3P8OA 1GBDA 2BDBA 3PB1E 3RXFA 1S81A 2P16A 4M9FA 1MAXA 3RXKA 1O3DA 3TGJE 1QB9A 2OLGA 2Z6BD 2CV3A 1EB1H 1ZGVA 1O3FA 1ELTA 5ABWA 1W14U 5KECA 2ZDKA 4I8KA 3RXGA 1K1NA 1ZSJA 2ZI2H 2PFEA 3ZV9A 3SU2A 4XSKU 3N99A 2Z9GA 4Y6DA 2EA3A 1T4UH 1KLTA 1SLXB 2SNWA 2JH5D 2P3UB 2IOTA 4WMFA 1LO6A 4UFEH 1UTJA 1D9IA 4TY6A 3SYJA 4ZKOU 1YPEH 4DW2U 4CHAC 1NRSH 3MQKC 2O8TA 3BTME 4INLA 1NY22 2ZFRH 2FS9A 4U2WA 4XDEA 1TE0A 3SGQE 2PR3A 1MKWH 3LJJA 1GJ5H 1T8MA 4X8SH 1V2NT 2AFQB 1J16A 1QHRB 1Y5AT 1AU8A 1EPTA 3K65B 5EW1H 2QAAA 1YCPK 2FLRH 2QXJA 3AAVA 1EPTC 3M37A 3LC3A 3QDZB 3Q00A 1OP2A 4B1TA 2D1JA 2CF9H 1MD8A 3L3TA 1FPHH 1V2WT 2ALVA 1TX8A 1DICA 1ZSLA 4GPGA 3ZVBA 5CHAC 1UTPA 2J38A 1GVZA 1YPHC 1WAYB 1TQ7B 5FPYA 1SMFE 3AAUA 2CK3D 2OC1A 3MHWU 1KSNA 1GBIA 4AYYB 1DSTA 4CRDA 2J5UA 1FUJA 2FI4E 1ELVA 1SG8B 2BY9X 5JDUB 1C5UA 4UE7H 1GVKB 3R0FA 3ATLA 1JIRA 1YM0A 3TH2H 3M36A 1O3BA 4VGCC 2SGQE 1IHTH 2W7UA 1NBME 1COWD 1GHVH 4IN1A 2JETB 1ZMNA 3V3MA 1JOUB 1SGTA 2OTVA 2ZWLH 3RMOH 3SW2B 3A81A 4X8TH 3A88A 2G52A 3AW0A 1VCQA 3OTJE 4F49A 4D9RA 1XUHA 1SHHB 4AZ2B 4WH6A 3V0XA 3M3VA 3DHKH 1BTYA 1ABJH 1TOCB 3PMAB 2GMTB 3UNRA 1O39A 2VH0A 4GLYA 4Q7XA 1ZRKA 2JJ2D 2XC5A 3A7WA 5JYIA 2FIRH 5T6DA 2WV9A 3VXEH 1PPFE 5G4BA 4CRGA 5EW2H 1YPJH 2WV4A 1WOFA 2FOMB 1GBTA 2XBVA 5E2OA 2GVFA 1P06A 4JK6A 1MUEB 6ESTA 3LGYA 1AGJA 3PTBA 1Q31A 3RXCA 5CMXH 2SGFE 1VJ9U 1UCYH 1AFQC 4MNXA 2XNIA 1P2NA 2WPMS 4X8UH 3RXPA 1BQYA 1QA7A 1XMNB 1O37A 5DK1A 2PW8H 4XRNA 2VVCA 1RIWC 2O8UA 1Y3WA 3W1EA 2PWXA 2VWOA 1C5NH 1ZTKA 1HAIH 1HYLA 5F8XA 4ABIA 5I46H 2VNTA 3RXVA 1QB6A 1NFUA 1TGTA 2ZHDA 1C5ZB 3RXTA 1C2LA 1C1OA 1ESTA 1PYTC 4M7GA 2AGGX 4CREA 3AK5A 2HVXA 2WPHS 2UUFB 3OSYA 3ZIAD 5ESTE 2G8TA 1Y3XA 3BIVH 2R3UA 1MTUA 1MZAA 2WPKS 4X8VH 1WUNH 1JIMA 3MTYA 2FYRA 4B2AA 1CQQA 4YZUA 4AOQA 5IK2D 3ZZ9A 1AFEH 1VJAU 3LGUA 2BD7A 2CXVA 2ZTXA 3SQHE 1SLVB 1Z8IB 4X2XA 2THFB 1S0QA 2VJ1A 3ZVEA 1TPOA 2BXUH 2WYJA 2ZFTA 1C4V2 1HIAB 4MNWA 5A2MH 3LJOA 1TLDA 4X0WU 2VINA 1YBWA 2VIOA 2ZHWH 1S82A 4X1SU 5GPIB 2FOEA 2VIDA 3UIRA 4AFUA 2VVUA 2DE8A 2A5KA 3PWCA 3GY3A 5EJ1A 4H42U 2A5AA 2GDEH 3DUXH 4BTTB 1OP8A 1EKBB 3TK9A 1P10A 3TPIZ 3KQCA 4NWKA 4R0IA 1L1JA 2ZU4A 4XE4A 3RU4T 4B6EA 5DP7A 1ELGA 2VB0A 1AKSB 2J95A 1D6WA 3BTFE 3MWIU 3RXDA 3TIUA 3SUGA 2C8ZB 1CHGA 1ABIH 1NU9A 2NU3E 3OFND 1A5GH 3JZ2B 4AB8A 2BLVA 4TPYA 5EGMA 2SNVA 1TRNA 2IJOB 5FHTA 1XUJA 1O2PA 5FPTA 1SGDE 3BG4B 2JJ1D 3DSPA 4Y8YA 1IQEA 4IW4E 3GICB 3OTPA 1YPMH 3PROA 1C5VA 2VGCC 2VGCB 3FAOA 1THPB 1P02A 3DSOA 3K6YA 1UCYE 1RTKA 4B75A 3PWBA 3SZEA 1E36B 2PV9B 4THNH 1Z1IA 1Y8TA 1UHBA 1FDPA 1HV7A 1K2I1 1NT1A 1XUKA 2BDIA 1C2KA 4INKA 2GZ8A 3RXSA 1C5RA 2AS9A 3TK6A 3SV8A 4A1XA 2QC2A 3FANA 1HJAC 5KGOA 3ZZ4A 1YGCH 4DJZB 3DSGA 3GOVB 4CR5A 1CA8B 1D3DB 3N7OA 3QZQA 3I78A 2Q6GA 3FKSD 4MPXA 1EJNA 1VGCB 3DT0H 1BBRH 3BEUA 2A4RA 2P93A 3SOSA 1C5MD 1W3CA 1A1RA 1S84A 1K9OE 4AX9H 2WPIS 3TLOA 1V2QT 2TGPZ 4UONA 1GHWH 1LVMA 3SN8A 5IYTA 1MD7A 3LH1A 4WH8A 4ABBA 3M5MA 1B7XB 3PRDA 3S7HB 1RXPA 1NU7B 1NTPA 1O3EA 3SQEE 4X6MA 2PKAA 2XTTB 3RLWH 2FDAA 2RDLA 2A0QB 3KF2A 1K1OA 3QGNB 5BPEA 2FEQH 1J9CH 4JYVH 3GDVA 3RXBA 3T25A 1LVOA 3TITA 1GBLA 4GCHG 2FTLE 4DT7B 1NFXA 1TNJA 1Y59T 1WBGB 2BDAA 1Y5UT 1QJ1B 2O8MA 1DWDH 2Y5FA 4TWWA 4BXWA 4MG3A 3RXAA 3SNEA 1UMAH 1BMLA 1T8LA 3GDSA 4YT7H 1FY8E 1AB9C 1AB9B 3KN2A 1XVMA 1LHGH 3T62A 5EOKA 2H1UA 3T29A 1OXGA 1XUFA 1SOTA 2KAIB 1KMHB 2Z94A 1SGPE 3HATH 1ARBA 2ULLA 3VB6A 4AGJA 1CBWB 2GKVE 3WWBA 4OS7A 1MTWA 2L74A 5DO4H 4DIIH 1NN6A 3R3GB 1CGIE 2F9OA 3NKKA 2I6QA 3TK5A 3GY2A 5FCKA 3M3SA 2P94A 1TBZH 2YNAA 3EA9A 1P8VC 2ZDVH 1XVOA 1GPZA 3UY9A 1GMDG 5C2ZA 5HXFA 4YOGA 3WY8A 2PGBB 1MU8B 1C2MA 2ZIQH 4HG6A 5A09A 1TABE 3MMGA 3A86A 3MNSA 1ZPBA 2AGEX 2VWNA 1P2OA 1NRNH 1NRPH 5EIYA 2OP9A 2IJD1 1GBMA 2RG3A 2BY6X 1TQ0B 1Y5BT 1BHXB 3QTOH 4CRAA 4F55A 3ZYDA 3RC4A 5LH8A 1WTGH 4DY7B 1BOQA 1NM6A 4AC9A 1ETSH 2VIVA 2ZZUH 1CSOE 2C8YB 1ELDE 1CA0C 3LGVA 3KEEA 1C5LH 2EI6A 4BAOB 2ODPA 4UFDH 3TGKE 1Z71A 1ACBE 1SQAA 4TY7A 2V6NA 2F9UA 3GY8A 1ESBA 1WQSA 5C5OA 1SGIB 4FVBA 1B5GH 2BXTH 1LHEH 1SC8U 5AVDA 1W12U 1GDUA 4FUIA 3TH4H 1PYTD 2WHXA 3SGAE 1DDJA 1GHBG 2BOKA 2KZ4A 2CGAA 4B73A 2RFKC 1WSSH 1YLNA 1QBOA 4K69A 4O3UA 2ZGHA 1EOLA 1UVPA 1IQMA 3RP2A 3GY5A 4E7NA 1GBKA 5JBCS 5EQQA 1D3TB 3MO9A 1ZRBA 3M5NA 2KCPA 1CGHA 1C1UH 1KDQA 3EYDA 3OY5U 4NG9H 1YPHE 4GCHF 1WV7H 4NIYA 3U69H 1E38B 1IQGA 4Y7BA 3RXRA 1SSXA 1GG6C 3TGIE 3RXQA 2BYAX 1IQLA 2C90B 5EPYA 1O2TA 3A8AA 3BG8A 1FY3A 2PKSC 3K2UA 1NESE 4YTAA 5T6FA 5J4QA 3UOUA 5FAHA 1UTQA 3OY6U 4YM9A 1H8DH 1MMJN 1SOZA 2OBOA 4ISHH 5E2PA 2F9PA 3ZVAA 2AERH 3RLYH 1IOEA 1W13U 3SNCA 1ZGIA 1EOJA 3BN9A 1D6RA 4AGKA 1VCPA 3MH6A 3LGIA 1GL1A 1HXFH 1SGNE 4Y11E 3A80A 1SVPA 4DIHH 1TNHA 1MBQA 4O9VA 5DGJA 1GMDF 1HPGA 3LU9B 3MU1A 1H9LB 1O2RA 1L1NA 1O3LA 1DUAA 5GJ4B 3LIWA 1C1MA 6LPRA 3U8OH 2Z9JA 4NZQA 2GCTB 1GDQA 3UR6A 1C2JA 1JRSA 2B8OH 2F43B 1RRKA 5CDFE 4B76A 1SHYA 1IQIA 2J98B 4NWLA 2BMGB 5E0GA 3A7XA 2EEKA 1ELBA 1GJAB 2GT7A 3GDUA 1H4WA 1TBRH 2ZCKP 1Y3VA 2R0LA 1MH0A 1H8HD 1KXCA 4SGAE 1QRXA 4IN2A 2G81E 4FUFA 2LELA 1OSSA 1FX0B 1MU6B 1MTVA 2W3KA 3KL6A 1O3JA 1HAVA 2AEIH 3M5OA 2ZGBH 3P8FA 1ELCA 1O2WA 5EJLA 5DSFA 1E1RD 3I29A 2RDEA 3ZZ7A 1CE5A 1SLUB 2PSXA 5EJZA 1O3CA 1Z8RA 2ZPSA 3ZZCA 1GHBF 1H9IE 4NGAH 1RJXB 2Z7FE 3EA8A 2EI7A 2G4TA 4I8GA 1DE7H 1DY9A 1EAIA 2HNTC 1EP5A 3GCTF 1Y3UA 1LQEA 1F7ZA 1FXYA 3RXJA 3UUZA 3U1IB 1UK3A 4MPUA 2YOLA 3SU3A 3KIDU 3ZZBA 5FXLA 3FVFB 3OAAD 1P2QA 5HKKD 1HAYB 2F9NA 4E06H 1HAPH 2W3IA 2AYWA 4HFPB 4I31A 5HGGA 3TJOA 2FP7B 2XCFA 4RT1A 3I77A 1AMHA 5IDKA 1UCYK 2OC7A 4WY3A 2AH4X 1MCTA 2B7DH
chains in the Genus database with same CATH topology
3U8RH 1C2DA 2PTCE 1BRAA 1AZ8A 3IITA 2GZ7A 3LGWA 1GI8B 1T8NA 2XWAA 3IG6B 4YT6H 3HPTB 4JZIA 2IN2A 1ZHRA 3NZIA 1MKXH 3RM0H 3RUOA 3SUDA 4X1RU 3RC6A 1THRH 3URDA 2BOHB 3QO6A 5HYOA 4GAWA 1ELFA 1O3GA 3A89A 3KCGH 4HI3A 1HFDA 3SV7A 2ZGXH 3T26A 1K28D 2QYIA 1ZPCA 1MZDA 2A4QA 3VXFH 3GISB 4JCNA 1DXWA 1C2IA 1D3PB 2IPHA 1G30B 5F03A 3SU6A 1PJPA 1F5LA 2BQ7B 2G4UA 2ZDNA 4CHAB 2PHBA 1HBTH 2F91A 1XM1A 2ANYA 2AMPA 4WWYA 1WQVH 1ZLRA 1AN1E 1GI5A 1O2YA 2C8XB 3FZZA 3SNBA 2VIQA 1GHYH 1GJ4H 3GCHC 1SPJA 1BB0B 4ZUHA 4JYUH 4MTBA 1E0FD 1A46H 1ZTJA 1EPTB 5EQSA 3E3TA 1F2SE 4CRBA 1FAXA 1YPKH 1ELAA 4HTCH 4KELA 4UFFH 1HRTH 3G01A 1C2EA 1L0ZA 1C1QA 1AE8H 2OD3B 5CHAB 2ZFSA 2GP9B 4DG4A 1C1WH 2D8WA 4MPVA 2H6MA 1SFQB 3M7UA 1O3AA 1XUIA 2BD5A 1FN6A 2DUCA 4KTUA 3TJVA 2M5TA 2Y82A 1M9UA 1P03A 1WU1A 5FCRA 4MQAA 4HZHA 3GYMA 2H9TH 1A3BH 3A84A 3RMLH 4VGCB 3UQVA 1K1LA 1AWFH 1TAWA 2YNBA 5T3HA 2ZCLP 3VB7A 2XRCA 4X2WA 1V6DA 3STIA 5SGAE 1RS0A 1BJVA 1NC6A 3DFJA 1NFWA 1A4WH 4IMQA 2TGAA 1PPCE 1YF4A 5AHGH 1L1GA 5DP6A 1O2MA 3MU8A 2Z3CA 2STAE 4K1EA 1KXEA 5HMAA 2PUXB 2G00A 1O5GH 3HK3B 1Z7KA 2ANWA 9LPRA 3MYWA 2GT8A 1HDTH 2CMYA 1QR3E 2ZO3H 5AFYH 1WCZA 2A2XH 1GMCG 1DT2A 2GCHF 4NSVA 2HLCA 3NPSA 1GI9B 1JRTA 1TGSZ 1AZZA 1AFQB 1OPHB 2BDYA 5TCCA 1QBNA 3MNCA 1NZQH 1GWAA 4Y71A 2JKHA 2BDHA 1V2PT 1C4Y2 2BB4A 1YYY1 4FU7A 2AIPA 1D3QB 1J15A 1O3PB 4GVUA 4Z6AH 4YLQH 4YOJA 4KP0A 1RIWB 1GJ8B 3U1JB 2EC9H 4U32A 1BRUP 1Z1JA 1HAOH 4R8TB 1EZXC 3PO1C 3PO1B 4ZMAH 1GBFA 1W8BH 3CS7A 5ESBA 3SJOA 3UWJH 4OS5A 1O31A 1SL3A 3HGNA 4ZXXH 5L2YH 2UUYA 3E16B 1BHXF 3RMMH 3D49H 1ZYOA 1GGDC 1GHAG 4YOIA 1HAGE 1DOJA 2OXSA 1OWIA 1TIOA 1V2ST 2ZU5A 2BY8X 1THSH 2BDGA 3URCA 1G37A 1DY8A 1QTFA 2XBWA 3PMBB 1Z8GA 4NA9H 2H5CA 1W7GH 3OX7U 4FUJA 4SGBE 4B2BA 4E05H 1SFIA 1GI7B 2B5TB 1OOKB 3SUFA 1PPEE 1LKBA 5JB8S 1HUTH 4LZ1H 1OWEA 1V2RT 1SBWA 1GJDB 1UTLM 1BRCE 3P17H 3CS0A 5I25A 1HIAA 1TGCA 1DWCH 1UTNA 5A8ZA 1AI8H 3P70B 1EJMA 2VIWA 1RTFB 3PYHA 1RGQA 1V2TT 3E8LA 4OS2A 1Q3XA 2FI3E 3SI4H 1BCUH 2TGTA 4DCDA 4RKOB 5EXLA 1ID5H 1LVYA 3LC5A 1T8OA 1GBAA 2QXIA 4KKDA 1AHTH 3RXOA 3VGCC 2FESH 1YCPH 1V2LT 1TA6A 2ZFQH 3PLKA 1O3HA 4ISIH 3QWCH 3GCNA 1AKSA 7KMEH 4BAKB 1AVGH 3RXHA 1GMCF 1UTOA 5C1YA 1PPBH 2PTNA 1C5TA 2GZ9A 1EZSC 3E0NB 1T32A 2AMDA 1MBMA 1YC0A 1O2SA 1UHBB 1F5RA 1GBEA 3E1XB 1HJAB 1HLTH 2K1QA 1EJAA 4WVPE 4K60A 1JWTA 2QXHA 5DP4A 4A1VA 1PQ7A 1SGRE 3KHVA 1MQ6A 2FO9A 4WF8A 5TCAA 4BTUB 2Z9KA 5TJXA 3ZYEA 4AB9A 1EZQA 3SJ8A 2BVRH 1MAYA 2AGIX 1ANCA 9ESTA 2OQ5A 4Q7YA 1C1SA 2W5EA 2P3FH 1C1VH 1C5XB 1CT0E 1GI0A 3BTGE 2VWLA 1GHAF 1QJ6B 1TX6A 2XC0A 3A8CA 3ELAH 3UPEA 1AY6H 4ZROA 1GBCA 2O9QA 2RA0A 3SU5A 3LGTA 3SJKA 5A0BA 2FYQA 1PPHE 4X2YA 1AQ7A 2FODA 2P8OC 2P8OB 4OS1A 1P11E 4ISNA 4ABGA 2W7SA 2G5NA 4ABAA 1YPGH 4BANB 1TALA 3A87A 3E6PH 3ZVGA 2CF8H 1B0FA 1OX1A 2HGTH 1EZUC 2HNTE 1O30A 1P05A 2Z9IA 5LGOA 2DE9A 4AN7A 3U8TH 1HXEH 3RC5A 3S9CA 2FOBA 2G5VA 8KME2 1JBUH 1O32A 3B8JA 2C8WB 3E91A 1RFNA 1O5EH 1H9HE 1LDTT 1SB1H 2ZCHP 1H8IH 2Y7ZA 1IHSH 4FUBA 1TB6H 3V7TA 4NA8A 2GDDA 5J4SA 3FP7E 1EUFA 3CP7A 1FZZA 1HGTH 4TWYA 3UWIA 2BVSH 3A8DA 2JH6D 3SNAA 4ZHLU 3TH3H 3DA9B 4F4OC 3RXLA 2BY7X 1QIXB 1A7SA 1TX7A 2ZHFH 3SUEA 5L6NH 4A7IB 1O34A 1WTHD 4YLUA 5EG4A 2A1DB 3HKIB 5C20A 2QXGA 4NIWA 3C1KA 3EAJA 1CT2E 3VFEA 3STJA 3LKWA 4Y76A 2BZAA 1L4DA 1WYKA 4MLFB 5HM9A 5AFZH 2SGAA 5E0HA 1KXFA 1VZQH 3Q76A 2J34A 1MTNC 2BX3A 1OWKA 3F9EA 3SU1A 1G3CA 1BIOA 1KY9A 1GI3A 1JMOH 1DPOA 2ZDAH 1GI1A 1P04A 1W2KH 1BBRE 2XCNA 1CA0B 3MO6A 4AORA 5JBBS 2J94A 3RXIA 3A82A 1A3EH 2FZZA 2FOAA 2WPLS 2ZGJA 1C5QA 1BMNH 1GJCB 1Z6JH 4DVAU 2GX4A 2A2QH 2A4OA 1TPPA 5A8XA 4FUCA 1K1PA 3PV4A 3BTDE 3TNTA 3SZNA 3NCLA 1OYTH 1LHCH 3ODDA 1SLWB 4HGCA 1P01A 3P8NA 4LZ4B 1UK2A 4NFEA 4YESB 3F6UH 3GCTG 2UUKB 1VITG 2Y5GA 1UTMA 2P59A 1T31A 1P12E 2HOBA 2QA9E 2V0BA 4UDWH 5FX6A 3ZZDA 1XUGA 1QA0A 2FMJA 2Y6TA 4A1TA 3GY4A 2H2ZA 1BZXE 1S0RA 1GG6B 5EXNA 5L30H 4TPIZ 1HB0B 3RM2H 2BD3A 3M7QA 2LPRA 3QGJA 4K1TA 4XBBA 3S0NA 1Z6EA 1V2MT 4X1PU 2PKSB 1QRZA 4H4FA 1TWXB 1FONA 2H9HA 2R2WU 1PQAA 1P2KA 3SO3A 2ZGCA 1UVTH 4OGXA 5GWZA 3SV9A 3M61U 4QT8C 1NRQH 2F9VA 1MKWK 1P9UA 4FXGH 4J1YA 4LXBH 1LPZB 1O2QA 1K1IA 3V13A 3UQOA 3BF6H 5CE1A 2ANMH 8ESTE 6GCHG 4Q80A 2J92A 3KQEA 4Y7AA 1G36A 5DG6A 3CENA 1O38A 3QN7A 3LH3A 3BV9B 2G55A 1V2VT 4B2CA 1FI8A 1BT7A 1DM4B 2XWBI 3ZZAA 1D4PB 2ZPRA 1ZMJA 4K8YA 1O3MA 2ZC9H 1ZZZA 1HNEE 1T7CA 3MNBA 4FVDA 2AIQA 4LOYH 1FNIA 1ANEA 3Q3KA 1GI4A 3UREA 2STBE 3UNQA 1O3IA 3K9XB 1A0JA 3MU5A 1T4VH 1ZR0A 3HK6B 1QCPA 4J2YB 3BTTE 3VB5A 1O2XA 2Q1JA 5FPSA 2BVXH 4OGYA 5FX5A 3SV2H 3ZZ5A 1YP9A 5AF9H 3MNXA 2RA3A 4IC5A 1DITH 3Q77A 1AE5A 2QF3A 4OS4A 1KTSB 1AD8H 2QN5T 1CVWH 4ASHA 1S6HA 4WMDA 3E0PB 1A0HB 2R2MB 1QFKH 1BTXA 1KXAA 1FIWA 2SFAA 1QL9A 4RKJB 1VITF 2HRVA 2FTMA 1BJUA 3L33A 3P6ZB 4IC6A 2C3SA 1AVXA 1FIZA 3T5FH 3EA7A 1GJ6A 1Q2WA 1TMTH 1KIGH 1OS8A 1G32B 2ZECA 2CHAC 2CHAB 4JYTA 3SORA 3HGPA 1W0YH 3A7ZA 3SU0A 1O5FH 1KYNA 1JXPA 3UNSA 1TBQH 2ZDLA 4IMZA 2LNCA 2ZP0H 1EAUA 1O2HA 4U01A 2OBQA 1Z8JB 2ZEBA 3UR9A 1FY1A 1SGFG 3DFLA 5GCHG 3T2NA 1INCA 3F1SB 6CHAC 2FM2A 2ODQA 4O97A 2ZKSA 2TIOA 1W0ZU 1TONA 3ZZ8A 1QB1A 5DP3A 3GY6A 4ESTE 3F9GA 3EDXB 6GCHF 1O3OA 3O8DA 4WXIA 3W95A 4NFFA 1UTKA 1GI6A 1O3KA 3SHCH 3UFAA 2FOCA 1ZMLA 2UUJB 4B71A 5C1UA 1C2GA 2Q6FA 3F68H 2Z3EA 2V3OH 1C9PA 2GCHG 5DP8A 1L4ZA 4ZAEA 3GY7A 3S7KB 3JZ1B 1EX3A 4Z0KA 1V2KT 3H7OA 2WUBA 5GDSH 5F8TA 1E35B 1SI5H 3A7YA 4UD9H 1HAHH 2FOHA 3KQDA 1IQKA 4NSYA 2XBXA 2A32A 2ANKH 2WV5A 2BDCA 1LVBA 5EODA 1X7AC 5JBAS 5A0CA 4K5ZA 2HWLB 4DURA 1SGEE 3GCHB 2ZA5A 1N8OC 1N8OB 3EGKH 3PMHB 4I33A 1BTHH 4I8HA 4FUDA 1C1PA 1NFYA 1EXFA 3M5LA 3BTKE 5ETXA 1TNIA 1TMBH 2XYAA 3MO3A 1O2LA 3BSQA 1XKBC 7GCHG 1E37B 2QGRA 1S5SA 2GV7A 3OYPA 4Y0YE 3ZVFA 3TJNA 1GMHG 1GJBB 3HKJB 3D62A 3A7VA 4JZDH 2WINI 1IAUA 3U98H 1YKTA 2GD4B 5EU8A 3EE0B 1CO7E 2VWMA 3ENSB 1TNGA 1P3EA 1J14A 1HCGA 1HAZB 2SGDE 1FV9A 1O5CB 3T28A 3A8BA 3RXEA 3P92A 5C3NA 1C1NA 5EXMA 1BTUA 1J8AA 1OKXA 3L6PA 4NCYA 1XXDA 1HJ8A 2QIQA 4MPWA 2FOFA 1YLCA 1G3EA 1LMWB 4D7GA 3LOXA 4BTIB 2WPJS 3QUMP 1LHFH 2ZQ2A 1C5PA 1GL0E 3LPRA 1LKAA 1DFPA 3M3TA 4JZ1A 2F9BH 1BBRK 5GCHF 2GV6A 2PGQB 4Y8XA 1S6FA 3S9AA 5C67A 4ABDA 2V3HH 1O36A 1MQ5A 2BLOA 2FX6A 2JETC 2TGDA 1QL7A 1BTPA 4UEHH 1FQ3A 1DWBH 1KXBA 2Y5HA 1ZJDA 4CR9A 4ZHAA 3BEIB 1ZJKA 2BTCE 2BM2A 3RMNH 1QY6A 1A5HA 1LPGB 4IS5A 2QV1A 2NU4E 5JB9S 2GMTC 1P09A 1HJ9A 1ETRH 2FWWA 2FXRA 5LPFA 1ESAA 4FUEA 1IQNA 1XKAC 2VU8E 2B0FA 1P9SA 4WJG2 1BTZA 4A6LA 2UWLA 3GYLB 3B9FH 4FU8A 3NUMA 4X1QU 1MCVA 3RXUA 3BTEE 2OC8A 1O2NA 1CU1A 4RSPA 3ZV8A 5LPEA 3V12A 4AG1A 2QCYA 2ZHQH 2JH0D 1G3BA 1YLDA 1OYQA 1O2IA 3SBKA 3ATIA 1GHXH 1C2HA 2TPIZ 2B9LA 5T6GA 1GGDB 1TGNA 5E8EH 7GCHF 2UWOA 4PROA 3SNDA 2ZG0H 3IWMA 1GMHF 4JK5A 2C93B 4BAQB 2BQ6B 1S83A 1SR5C 3RU4D 3SHAH 1AWHB 2BLQA 1BTWA 3DD2H 5C5NA 1FY4A 3O8RA 2CN0H 1OWHA 1BMAA 3B23B 3RDZA 3KQBA 1F0UA 1F0RA 1P57B 3LDXH 1A0LA 1F0TA 3ATWA 1A61H 1C4U2 1XX9A 4CBOA 1SGYE 1C5YB 1O5AB 1C1TA 3BEFB 2O8WA 4U30A 4OS6A 2H9EH 1ANBA 3H7TA 5DP5A 1ZSKA 1ZTLA 4D8NA 2ZHEH 3TU7H 4NIVA 1RTLA 1RD3B 2BX4A 1EQ9A 2ILNA 4JZFH 1HAXB 1DS2E 1PPGE 1L2EA 1GCTC 1GCTB 4FUHA 1ETTH 1BRBE 5E0JA 4BAMB 1CGJE 1UVSH 3BTQE 1P3CA 2TBSA 5C1XA 4Y79A 2A31A 1O2VA 3D23A 3QTVH 2WYGA 3VGCB 2ZTZA 4YO9A 1F5KU 1ELEE 2C4FH 1G2MA 1VCWA 7LPRA 1QQUA 1QRWA 1EATA 3SV6A 1SQOA 4CH8B 1SGQE 3U9AH 8LPRA 1O5BB 3NWUA 1DUEA 4NA7A 1FN8A 1BDAA 1CHOG 1DWEH 1W7XH 5L2ZH 1N6XA 4INHA 1NRRH 3ESTA 1FMGA 4GSOA 3PMJA 1O2KA 2R0KA 2BD4A 2VIPA 1C5OH 3BG4C 5K0HA 4D9QA 1DXPA 2XBYA 1OP0A 3A83A 1TPAE 4D7FA 3UOPA 5F6MA 1LPKB 1Y3YA 3BTHE 2Y80A 1ZHPA 3D65E 2ZNKH 2ZF0H 3MH7A 4CBNA 2F3CE 4K3JA 5DPAA 1O2GH 1DANH 1PQ5A 1C5SA 1YCPM 3P8GA 1OWDA 4I7YH 4O3TA 1VGCC 2GTBA 3BTWE 4XFQA 1O0DH 3P95A 5BRRE 4I8JA 2ZU3A 2PKAB 2HPPH 4ISOA 1LQDB 2BHGA 3KGPA 4LK4A 1P2MA 2A7CA 5FBEA 3RU4E 3W94A 5A8YA 1K21H 3GCOA 3NXPA 2ZDMA 1ARCA 4AFSA 5K7RA 3SGBE 2BD9A 2FS8A 4Y0ZE 5FBIA 1TGBA 1BITA 2Q6DA 1SGCA 4H6TA 5HM2A 1A2CH 5JPMH 1DVAH