5TJXA

Structure of human plasma kallikrein
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
236
structure length
231
Chain Sequence
IVGGTESSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILELSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLEYTEFQKPISLPSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Plasma kallikrein
publication title Structure-Guided Design of Novel, Potent, and Selective Macrocyclic Plasma Kallikrein Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 231
sequence length 236
ec nomenclature ec 3.4.21.34: Plasma kallikrein.
pdb deposition date 2016-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5tjxA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5tjxA01
1C2JA 3RXOA 4CRFA 2C8ZB 1OP2A 3MO3A 2FOEA 1THSH 2V0BA 2PSYA 6CHAC 1EXFA 4AOQA 1TWXB 1T31A 1ZSLA 2PWXA 2TGPZ 1EZXC 2HPPH 2QXIA 5LGOA 1AKSB 1FAXA 2WPMS 1GMHF 1A0LA 1YBWA 3GY4A 1P9UA 1PYTC 1PPCE 1TQ7B 3S9BA 2XBWA 1F92A 4IN2A 3STIA 4U32A 3QUMP 9LPRA 1O5AB 1O2GH 1TMUH 4ZH8A 1DPOA 4X1RU 2P94A 1AY6H 2XBYA 3LGUA 2G4TA 4DGJA 4Q7XA 2XBXA 1LQDB 3A7TA 3SBKA 3IWMA 2SGDE 4CREA 1DDJA 1LVMA 2HNTF 3EGKH 3S9AA 1O3GA 2ZHFH 1UTLM 4ABJA 4AYYB 1KLIH 3R3GB 1DX5M 2WUBA 3SUFA 1SHYA 3S69A 5A2MH 2G4UA 2I6QA 1UVPA 3RXBA 2XBVA 3TGJE 5EOKA 1AZ8A 1ZSKA 2ZPQA 1AVGH 3A84A 3QK1A 5G4BA 3SUGA 3LDXH 3BTFE 1GGDB 3CP7A 2ZTZA 2V3OH 1ZRBA 3JZ1B 1O34A 1AUJA 2VWNA 1VJ9U 4WWYA 2JETB 3ZZ8A 3MFJA 2OC7A 1OYTH 5F8TA 3ZVBA 1O5CB 1EASA 1HB0B 1O2TA 1VGCC 1PFXC 2ZDNA 3GY3A 4ZROA 1DSTA 1S0RA 4DCDA 5DPAA 6LPRA 5JB8S 3V7TA 4O97A 3ZZAA 1HDTH 1Y3XA 4Y11E 1GMDG 1ZRKA 5B6OA 1ELEE 1OOKB 1NRPH 2A4QA 4ISLA 3E0PB 1SGIB 1SMFE 3SI3H 3RM0H 5I46H 4ZKRU 2ZFQH 4ISHH 1ZJDA 2F9VA 1L4ZA 1K9OE 1JIMA 1O3FA 4NSYA 1C1VH 3F1SB 2A1DB 1QURH 1PYTD 1TGNA 2A32A 4UFGH 1Y59T 1CGHA 1GI2A 1NPMA 1QCPA 4IMZA 4RKOB 1CT0E 4A1TA 1PJPA 3MMGA 2QF3A 4KP0A 2EC9H 2J92A 4K60A 4MNVA 2GDDA 1TRYA 1T32A 5EXLA 2VINA 1XUGA 1MMJN 2J38A 4OGYA 1FZZA 1QL7A 1O2RA 1FN6A 4VGCB 1ZZZA 1VCPA 1Z6JH 2CMYA 2PSXA 5EODA 4IMQA 1VITG 4WXIA 3RM2H 1YKTA 3RMMH 4BXWA 1P2OA 1WOFA 1K1IA 3S7KB 1C5LH 3GY6A 1GHAF 4CBOA 1CT4E 4YZUA 1OP0A 4WMFA 1FDPA 1SB1H 2A7CA 1OWKA 2B5TB 1GJ9B 2BQWB 3JZ2B 2Q6GA 1XM1A 4OS7A 1D3QB 3MO6A 1AFQB 1BDAA 1TNHA 2ODPA 1ELGA 5AVDA 4ISOA 3TH3H 1DUEA 1NU9A 3UOPA 5DK1A 4CRBA 2UWOA 1UTKA 2PR3A 4GCHF 4XFQA 1ZTJA 1DSUA 1S0QA 1BHXB 2ZZUH 2GV6A 1Z1JA 3LGIA 4AORA 5CMXH 1A3BH 5EPYA 3ZZ6A 2G8TA 3SUDA 1F7ZA 1EATA 1ZR0A 2AGGX 1CO7E 1ZOMA 3HATH 3TITA 6GCHF 2ZU4A 1O2IA 1ARCA 1PPHE 5ESTE 1DLKB 2ZTYA 4BAMB 4I32A 3VFEA 1BBRE 1AVXA 1GVZA 3RXMA 1ZHRA 2G81E 2ZIQH 4DG4A 5A0BA 1Q31A 3SGQE 2KAIB 2OCVB 5DG6A 1DFPA 1L2EA 1S6FA 3ZZ7A 5LH8A 3D62A 1HFDA 1AFEH 1MKWK 3NK8A 3P70B 1W8BH 1J14A 5HYOA 2NU3E 2HLCA 1WU1A 5GCHG 3RLWH 1D9IA 2IPHA 2FO9A 2PUXB 1KXEA 3EYDA 2GCTC 3M5NA 1H9HE 3FFGA 4INKA 5GIBA 4KELA 3ZZCA 3P8FA 1Z1IA 4FU8A 1VZQH 3EAJA 2ZCHP 1C5MD 4H6TA 2R3YA 2GCHG 3P17H 1JXPA 1W3CA 3TIUA 1VJAU 3SQHE 2FDAA 3GY8A 2R2MB 4IC5A 1AQ7A 4UFFH 1BA8B 1O3KA 4K1TA 2UWPA 1EP5A 2PTNA 4GSOA 2RG3A 1O5EH 3M7QA 3GISB 1BMMH 1ETTH 7GCHG 1QHRB 1K1PA 1T8LA 3TJVA 2ZHWH 3BIVH 4RN6A 1EUFA 1C2FA 1O3IA 2OC8A 4YOJA 1GVKB 1O2VA 1TONA 2SGQE 1TIOA 2WPIS 2PV9B 1HLTH 2TRMA 4OGXA 5AFYH 2W3IA 3SJIA 5HGGA 1C5YB 2BLVA 1C4V2 1HAYB 2R9PA 1O2HA 3M7TA 1V6DA 1MBQA 4CHAB 2WV4A 1C5TA 2Y81A 2BVSH 1Q3XA 2WYGA 1PQ8A 3NZIA 1LKBA 1V2QT 3V12A 1GBHA 1FAKH 1G32B 2RA3A 1PPGE 3SQEE 1A2CH 2D1JA 1O39A 1HAGE 1O3AA 1HV7A 4X2XA 3ZZ5A 1G9IE 1SOTA 1CSOE 2SGAA 1ELAA 2ILNA 3GDVA 5FCKA 1BTUA 4U2WA 5E0GA 1HJAB 1GCTB 1ZHPA 3S0NA 1P02A 5I25A 4IW4E 1AWFH 3MTYA 2BX4A 2G5NA 1QJ7B 3BN9A 3TVJB 4MDSA 1C1TA 1AN1E 3SORA 6ESTA 3GCTG 1Z71A 2FX6A 2ZQ1A 1LMWB 1P9SA 1SL3A 3QGNB 1NY22 1C5WB 2GGVB 3SV9A 5DGJA 1TB6H 3PV4A 1NRQH 1EOJA 5A8XA 4Y8YA 4DY7B 3L6PA 1YPHE 1ELDE 3FP6E 2BDBA 1K21H 1SGTA 5HM2A 1F0SA 2ZHQH 4XBDA 1J8AA 1HGTH 1MZAA 1UTMA 2FWWA 1UCYE 2XNIA 2ZQ2A 3GCNA 3NUMA 4Z0KA 1NN6A 1TE0A 3SU2A 2P3FH 1CT2E 1HPGA 2H5DA 3UQOA 1F0TA 1D4PB 4JCNA 4OS2A 4B73A 2D26C 1NRSH 3SU4A 3N7OA 1E38B 1UHBA 1K2I1 5C2ZA 2FM2A 3MNSA 2BY9X 1HIAB 3MU1A 6CHAB 2AERH 3VXEH 2RCEA 4IBLH 1C5PA 1MUEB 5E8EH 3S7HB 1YC0A 3PTNA 2OQUA 3M3VA 1ELFA 1OS8A 1V3XA 3I78A 3MO9A 3O8BA 3PLPA 3E1XB 1OWHA 1DITH 1Y3YA 4NSVA 1EJNA 1ID5H 1ACBE 3EA7A 4E06H 2J9NA 1V2OT 1GHVH 3I77A 3F9GA 4XBCA 3PLBA 2A5KA 1C2EA 1V2ST 2QGRA 3PWCA 4A92A 2CF9H 5FX6A 3T2NA 1N8OB 4X0WU 2ZGCA 4ABHA 3ZVCA 2PGQB 1KY9A 1QBOA 4FUFA 1GMHG 1ZHMA 3AVZA 5K0HA 1UJ1A 1TX8A 1MTVA 1KSNA 3Q3XA 5ETXA 1TBZH 2PLXA 1GMCF 1CU1A 2J4IA 4FUHA 1OWJA 1O2WA 3AASA 2K1QA 3U1IB 1ZPCA 1CHOF 1LPGB 1AI8H 1IQHA 1SQTA 2QA9E 3MNXA 3QZQA 2W7SA 3U8OH 5C67A 5GXPA 1HAVA 1MAXA 4B2CA 1W2KH 4WMDA 1EZSC 1BTHH 1DUAA 1MTUA 3ZVEA 1VR1H 4YO9A 4E05H 1H8DH 2XC5A 4X6NA 1AU8A 4FUCA 2V3HH 2BDAA 1XKBC 1GJ8B 2ZDAH 1S82A 1TMBH 1AE8H 2BY5X 2JH5D 4Q7ZA 2D8WA 1TRMA 3K6ZA 1BRUP 4AYVB 3RXSA 1VGCB 4WH8A 4XE4A 4Q7YA 2ZPSA 1XVMA 1A5HA 3M35A 5SGAE 3VGCC 2ALVA 2QN5T 3MYWA 5EXMA 5FPTA 5E0HA 1PPFE 1GJCB 2YOLA 1TBRH 5JB9S 2FYQA 3PB1E 3ZZ4A 5DJ7A 3VPKA 1G3DA 1AB9C 1JBUH 1RIWB 4Y7AA 2Y80A 5F03A 4Y8ZA 5BRRE 2O8WA 2ZNKH 3VB3A 1O3EA 1SGEE 4D76A 3U69H 1A0HB 1G3EA 3KQEA 3SU0A 1F0UA 2BLOA 4FUEA 5DKMA 2FI3E 2BY6X 2ZO3H 3T25A 1G3BA 1YM0A 3GCOA 3TJNA 1BMAA 2VIDA 1ZTKA 1XUHA 3V0XA 1S83A 1ANBA 2H9TH 3ZVFA 1C1NA 2AH4X 1DLEA 5GPIB 5DP7A 1GHYH 4ISIH 1RS0A 3STJA 1ELVA 1LVYA 4A1VA 1GBJA 5JBTA 4MTBA 4Y71A 1QJ1B 3QLPH 1AMHA 3B23B 2FOFA 2BY7X 4H4FA 4AFSA 3A8DA 1GBDA 4HZHA 1W14U 3SU5A 2OINA 3BG4B 4R0IA 4AG2A 4LK4A 1C5NH 5FPSA 1EPTA 1CHGA 1SG8B 1KXFA 1Q2WA 1SC8U 2UUYA 1PPBH 1TGSZ 5HXFA 2Z9IA 1GI7B 1Z7KA 1DICA 3AW0A 4BXSA 2FS8A 4NWLA 2ZDLA 1E36B 2PGBB 3M3TA 1NZQH 2H9HA 5TCCA 1FJSA 3IG6B 2BM2A 4WVPE 2CHAC 1SVPA 3KHVA 3Q77A 1GBMA 2XCFA 3M61U 1GJ6A 2RDLA 4J1YA 3O8CA 4I31A 1LPKB 1GHAG 2ZU1A 1TOCB 1O2OA 4ZKNU 2VIOA 1U6QA 2O8MA 1MAYA 3A86A 4UE7H 1TPSA 1QB9A 1P2JA 3RXHA 2CGAA 1YYY1 2VH6A 1P0SH 5ESBA 1SR5C 1YPMH 2GD4B 2NU4E 2Z7FE 4K8YA 1XXDA 4JMYA 4GCHG 4TPYA 1RJXB 1ELBA 5AF9H 2Y7ZA 2XWAA 3RMLH 1QJ6B 4JYUH 2BOHB 2HWLB 1OWDA 5A8ZA 2DE8A 2P93A 1O2LA 6GCHG 4DT7B 2WV5A 3MU0A 1C5QA 3TJUA 3GY5A 1O2UA 2OUAA 3F68H 4KTSA 2WYJA 1SGDE 1KIGH 3A83A 4X8UH 2G51A 2ZHDA 1C2KA 1P3EA 2WPKS 4X2YA 4MLFB 1O3DA 3TH2H 5E0JA 5L30H 1L4DA 3BEIB 4B71A 1SLWB 2VIWA 2XCNA 4B74A 1QL8A 2DE9A 1LDTT 4JZEH 1QIXB 1ZGVA 1C2LA 3RP2A 5JPMH 5HMAA 4D7GA 1TGBA 2D2DA 3LGTA 1W0YH 2W5EA 2H5CA 4MNYA 4UFDH 3SJOA 2TGAA 4XSKU 1LKAA 1W13U 3T29A 4TWWA 1E0FD 1THRH 3URDA 1GL1A 3OY5U 1TNGA 5FCRA 2PW8H 2BHGA 1TX6A 4X1SU 5E2PA 4Y79A 4WH6A 5EGMA 3U98H 1BRBE 3DFJA 5FBEA 4BAHB 4NIXA 5EXNA 1YLCA 2G5VA 1J9CH 1DVAH 1DWDH 4CH2B 3UIRA 5DP6A 3DA9B 1TABE 1Y5AT 5FXLA 5GWZA 2W3KA 2ZEBA 2FOHA 2ZU2A 1CBWC 1V2KT 1SOZA 1C9TA 2JH0D 3U8RH 1A3EH 3W95A 2ZF0H 2O8LA 3UWIA 8GCHF 2OBOA 3DT0H 3C27B 3CS7A 4LXBH 3HGPA 2ZFSA 1RTFB 3SU1A 2OC0A 4ZXXH 2KAIA 1ANCA 3V3MA 1W11U 1O3BA 1IQLA 2BD2A 3I29A 2PKAB 1O3PB 1LCYA 5EQRA 2TPIZ 1MTNC 2CJIA 1OWIA 2FXRA 3EDXB 2Y7XA 4MPWA 2J94A 3UQVA 1V2MT 1O31A 4JZIA 5E2OA 1UTQA 4NA8A 4HFPB 2F83A 2DUCA 2BDIA 5EQSA 4K3JA 5L2ZH 1A4WH 1O2QA 2A45B 1O3LA 2EI6A 1DM4B 2THFB 4NWKA 1P57B 2TGDA 1SGFG 1GI0A 1MU8B 2BD7A 1KXCA 1EAXA 4MNWA 5L2YH 3RLYH 4UONA 2BDHA 2G55A 2P8OB 3LGYA 1TA6A 4O9VA 1RFNA 3RXAA 2FS9A 3F9HA 4XDEA 2ODQA 4J2YB 2HVXA 1QA7A 3RXUA 1QGFA 1KXBA 1C4Y2 1LVOA 2Y5FA 1YCPK 3FAOA 4AZ2B 3K2UA 1CA0B 1QY6A 3RC5A 3LOXA 3B9FH 1TAWA 1IQNA 3AAVA 4A5TS 1UVSH 3PO1C 2O8UA 2QYIA 1IOEA 2G52A 1YLDA 3PM3A 2C93B 3MOCA 3RC6A 3T5FH 4X8SH 1ZPBA 1BZXE 1C1OA 4FXGH 1NESE 1JMOH 3T27A 1A7SA 1TA2A 2BX3A 3IITA 3FANA 1AHTH 1A61H 1XKAC 3PMAB 3TK9A 4Y6DA 2AEIH 2Z9KA 3BSQA 4M7GA 3UOUA 1TBQH 3ZZ3A 1NO9H 2ZI2H 2FTLE 2WPHS 3HGNA 1IQEA 1TPPA 5LPEA 1ZSJA 4K69A 3Q3YA 1WBGB 3TGIE 3CENA 2ZDVH 2ANWA 3BEUA 4YTAA 2GV7A 3GCHC 1BIOA 1NFUA 1SFQB 1L1NA 3OX7U 4OS5A 4HGCA 4RKJB 4CRGA 2VH0A 1GJDB 1BTYA 1ESBA 2ALPA 8KME2 4GAWA 4CRCA 1WYKA 1TPOA 2GVFA 3ZZDA 4ISNA 1ZLRA 2W7UA 4AGJA 3E90B 2H1UA 1F5LA 1Y3WA 1J16A 1NM6A 2BD4A 1O3NA 2Q6DA 2QF0A 4TYDA 2ZDMA 2CN0H 1IQJA 1C2HA 3P6ZB 2FEQH 2ZCLP 1OX1A 1TNJA 1EAIA 7KMEH 3VB4A 7ESTE 1FY4A 3FZZA 4KKDA 1GMCG 1YCPH 3HPTB 4YESB 1FXYA 2VIPA 1N1LA 2BD5A 2HPQH 1INCA 1CHOG 1FPHH 1GWAA 1P06A 1QR3E 4NGAH 1NC6A 2ULLA 4PROA 5F8ZA 1MD7A 2HGTH 1A1RA 1T8OA 3ENSB 2UUFB 4BOHA 3KGPA 4JZDH 1WQSA 1O38A 1ZJKA 1DS2E 1QQUA 2C8YB 4ABFA 1HAIH 1HIAA 2A2XH 3RXQA 4NA7A 2BZAA 2ZC9H 2BDYA 3BTME 2BY8X 2OXSA 1EPTC 1SGNE 4X6OA 4DJZB 5LPFA 4ZKSU 2TIOA 1FY1A 1GGDC 3QZRA 2AMDA 4XOJA 5CHAB 2A4RA 3O8DA 1GDUA 3F9FA 3RMNH 3U1JB 1H4WA 3R0FA 1HNEE 1SSXA 3K9XB 3ZV9A 2GX4A 2P3TB 2JETC 4RSPA 1FNIA 1KXAA 1GI6A 2Q1JA 3GY2A 4Q2KA 4H42U 1TNKA 1HBTH 3NXPA 1IQIA 1GHWH 1SI5H 1SGYE 1PQ7A 3KIDU 1YF4A 1V2JT 1O5BB 1GBFA 1FIWA 3ATWA 2GZ8A 3H7OA 1S6HA 4THNH 5DP8A 2ZP0H 3LT3A 3ITIA 1O2XA 1KDQA 1SLUB 3PYHA 2NWNA 2SGPE 4CH8B 1JRTA 1DWCH 2AYWA 1RD3B 2ZWLH 3LH3A 4YT6H 3RXVA 3A7VA 2BXTH 2BD9A 2AGIX 4I8JA 4F49A 3SNAA 2UUJB 1P2QA 4FVDA 2YNAA 5DP4A 1P3CA 2QXHA 2EA3A 2AIPA 1FUJA 2QXJA 1GI1A 2AFQB 1O36A 1P2IA 1S5SA 1UVOA 2Z3DA 1X7AC 2CHAB 2ZDKA 3A81A 3SU3A 2A7HA 1HXEH 2B8OH 2FI5E 1FONA 2Z9LA 2BDCA 1DXPA 1GPZA 4MG3A 1QRZA 1W10U 3VXFH 4JYTA 3A88A 3RXIA 3TK5A 3FP7E 2VVVA 4K8BA 3KCGH 1C1RA 1UO6A 1K1OA 4BTTB 2JH6D 1CA8B 1ORFA 2EI7A 4NG9H 3RXPA 5ABWA 1SQAA 1SHHB 1GI3A 2IOTA 3E0NB 4WXVA 3DFLA 1LTOA 2WUCA 1H1BA 1UK3A 2PFEA 3BTHE 1C5SA 1P01A 2C3SA 1Z8RA 2A4GA 1MCVA 1UK2A 4X8TH 3RUOA 4I8KA 3SV2H 2Z9GA 1DE7H 1QB6A 4AFUA 3E6PH 1SGPE 1P2MA 3W94A 1K1MA 1TALA 3BTEE 1ZTLA 2BTCE 2HNTE 3T62A 2AGEX 4INHA 3RXCA 1RTKA 3KQDA 4JZ1A 4MPXA 2OC1A 1V2TT 1YPGH 3RXDA 1C1QA 1IAUA 3UNRA 1EKBB 5CE1A 1GJ4H 1FY8E 2BB4A 3F6UH 2VVUA 3RU4D 3A85A 1FIZA 1P09A 3P8NA 2VJ1A 4KTUA 3TPIZ 4AB9A 1S85A 3SOSA 3BIUH 1O5GH 2HALA 1LO6A 1ELTA 1S84A 1QFKH 4HI3A 1G3CA 2F9NA 3T28A 2LPRA 3ATKA 1AIXH 3E91A 4ZMAH 3UTUH 1WQVH 1GDQA 3K65B 1TQ0B 1O5FH 3ZYDA 1MQ6A 2A7JA 3TLOA 4YLUA 3A89A 3MHWU 1DWEH 3HK6B 1D6WA 2FMJA 2A5AA 1FY5A 3TJOA 1K1LA 1VITH 3BV9B 1SLXB 1Z6EA 2QXGA 1SGCA 1T4VH 1C9PA 4YT7H 1GHBF 1V2NT 1C5RA 2LNCA 1D3TB 3RXLA 2RA0A 1BTZA 1MQ5A 1RTLA 5H4IB 1GVLA 1GBEA 2FZZA 2NU1E 1AKSA 3P8OA 3A7ZA 1UHBB 1CBWB 1BBRK 1B5GH 1AO5A 4ABEA 4MPUA 1NT1A 1O33A 2ZFFH 3CS0A 1G30B 1PPEE 3FP8E 4GPGA 5C20A 2FESH 2H2ZA 1V2WT 3H5CB 3SV6A 2FX4A 2OTVA 1HAPH 1BTXA 4F4OC 2OD3B 1LHDH 2A2QH 2BVXH 1XMNB 2FOCA 3BTWE 3TK6A 3M5LA 1ELCA 1CGJE 1C1UH 2BQ7B 1S81A 5DP9A 3SV8A 4X1PU 1JOUB 2BVRH 4CR9A 5T3HA 4Y0YE 1GBIA 2Z3EA 5HM9A 2STBE 1GI9B 3A7YA 1DY9A 1NFYA 1QRXA 8GCHG 2FOGA 3RXJA 1P11E 3LPRA 1PPZA 1EJAA 1SPJA 1C2MA 3MH4A 3MH7A 1ZGIA 4X2WA 3QWCH 1BOQA 4IS5A 2PKSC 3LC5A 5L6NH 4KGAA 4Y76A 3SGAE 4B2AA 1YPKH 1GJAB 1GDNA 1HJAC 1GCTC 1LHEH 1F5RA 4LOYH 2UUKB 1A5IA 1BT7A 4K1EA 3RXGA 4B1TA 5JBCS 1GHXH 3SNDA 2XXLA 3BG8A 2C4FH 2ANKH 4JK5A 1EAWA 1MH0A 1O2JA 1TX7A 3QTVH 1E37B 1GJ5H 4ABBA 4WMEA 3WY8A 2NU0E 2GDEH 4AFQA 1TGCA 2YNBA 4IGDA 2PTCE 4AGKA 1F2SE 1BJVA 1FLEE 1BBRH 1UK4A 2BXUH 4UEHH 3LJOA 2XYAA 1NFXA 1BB0B 3ODFA 2ZA5A 5F8XA 5FBIA 2GMTC 2FP7B 1PQ5A 4X2VA 2ZGHA 1SLVB 3EA8A 3GY7A 4ABIA 2WPJS 5FAHA 1QRWA 2ZG0H 1WTGH 3GYMA 3RXRA 2B7DH 3GCHB 1WTHD 3K6YA 3RXEA 2XRCA 1GBBA 2O9QA 2O8TA 3V13A 1V2VT 1MD8A 1SBWA 1A0JA 2PKAA 1RXPA 1O0DH 4CRAA 3UPEA 3HKJB 1HAHH 1UVTH 3ATLA 2GTBA 4KTCA 3PLKA 5T6DA 1EZQA 4K1SA 1KYNA 1C2GA 5T6GA 1KTSB 4QT8C 4D7FA 1V2PT 5C1XA 1TYNA 1FPCH 3AW1A 1C1WH 3MI4A 4I7YH 1T8NA 1GL0E 1XUJA 2VIQA 2Z6BD 3QTOH 2PHBA 1UTNA 2GCTB 1OSSA 3L3TA 5AHGH 3DUXH 1UCYK 4NZQA 3M7UA 1OYQA 1RRKA 2CV3A 2CXVA 4B2BA 3QN7A 3ZVGA 4TY6A 1FI8A 1N8OC 2AS9A 1TNIA 4X6MA 3NKKA 1ESAA 1WUNH 3A7WA 4A1XA 3MU5A 2R2WU 3RC4A 1YPLH 2BLQA 1H9IE 1ARBA 3UR9A 5AFZH 1HJ9A 1O5DH 2VWMA 3GDUA 1TRNA 3A8CA 3UR6A 1Y5UT 2B0FA 2FODA 4ZHLU 2FLBH 3PROA 3SNCA 2BQ6B 1P05A 1HUTH 1EPTB 3EE0B 4NA9H 3H7TA 3KNXA 4BAKB 4FVBA 1G37A 4LZ4B 3UNQA 1B7XB 3GICB 3UFAA 1G36A 3RDZA 1K1JA 1LHFH 1DOJA 1YCPM 4B75A 3F9EA 5A8YA 2HRVA 3KN2A 1C1MA 1GG6C 1AZZA 1P2NA 1MTWA 3ATMA 1P2KA 2C8XB 1HXFH 5FX5A 2ZGXH 2TGTA 1QL9A 4OS6A 1Z8IB 1J17T 3SNEA 4NFFA 4OS1A 1YPHC 3TH4H 2G00A 4X8VH 2VNTA 3EA9A 4GUXA 1SFIA 4BAQB 4ZKOU 5TJXA 4NZLA 2SGFE 1UMAH 1TLDA 1RIWC 2ZFRH 1UCYH 2C8WB 1O3OA 7LPRA 1B0FA 1GBKA 1HJ8A 3FZDA 1C5UA 2F9PA 1NRNH 2A4OA 4I8LA 3C1KA 4YLQH 1CGIE 1SGFA 1DY8A 4UD9H 1O2PA 1BMNH 3VEQB 1LPZB 3M5OA 3NPSA 2SNWA 2AMPA 2F9BH 4MNXA 4SGBE 2GZ9A 8LPRA 1TPAE 3ATIA 2VWOA 3OYPA 3PTBA 2F91A 1TNLA 1E34B 3DHKH 1BJUA 2VGCC 3LKWA 4YOGA 5JBAS 5J4SA 4GLYA 4Y0ZE 5C1YA 4DOQA 5EW2H 4Z6AH 4BNRA 1LHGH 4Y10E 1GJBB 1WV7H 1GI4A 3KQCA 2BDGA 2Q6FA 4CBNA 2HNTC 3LGWA 1GHZA 3SU6A 3BG4C 4O3UA 1TGTA 3RXTA 3MU4A 1E35B 2ZGBH 1P8VC 1UTPA 4ABAA 1O2ZA 1WCZA 2OLGA 2QIQA 4WY3A 2QC2A 2WINI 4JYVH 3MNBA 3EQ0H 1T4UH 3UUZA 1M9UA 2F9OA 4A6LA 4MVNA 4H6SB 1UTOA 3SZNA 4ASHA 2ZHEH 1XUIA 3LJJA 3FVFB 1OKXA 1EQ9A 2A5IA 2QY0B 2ZECA 3GYLB 4INLA 2FOMB 1V2LT 4FUIA 1W0ZU 5DP3A 4D9RA 1FN8A 3P8GA 4FUGA 3UWJH 3NCLA 1WSSH 3TNTA 3LGVA 4YOIA 1IQKA 3A80A 1BTPA 2SFAA 1CVWH 2GP9B 3P92A 3D49H 4DVAU 2EI8A 2XTTB 3TU7H 2M5TA 1VCQA 4GHQA 1DT2A 2FIRH 2V35A 1QQ4A 3P95A 4O03A 4I8HA 2I6SA 1FQ3A 1DWBH 1D3PB 1HCGA 5DP5A 1H9LB 3BTQE 1AUTC 1THPB 1C1PA 3LONA 1NFWA 3UY9A 2ZFTA 1F0RA 1C5XB 1GI5A 2IJOB 3ESTA 9ESTA 1EB1H 3SGBE 3Q3KA 3UNSA 1GBAA 3MU8A 1C5OH 1O3CA 3KF2A 4HTCH 4U01A 1G2LA 1O2SA 2BD3A 1ZYOA 3GDSA 3NWUA 1O30A 4XBBA 1TFXA 4WF8A 1QB1A 3BTKE 1IQFA 1XUKA 3SJ9A 1YP9A 1ZPZA 4CRDA 3VGCB 3RU4T 1L1JA 1OPHB 1EX3A 1HAXB 3OSYA 1XXFA 3A8BA 3M3SA 1MBMA 1AB9B 2ZU5A 4R8TB 1UVUH 1Y5BT 2FOAA 2STAE 1Y3VA 1GMDF 1HYLA 1IHTH 1QTFA 2OBQA 1MTSA 1UTJA 3PMBB 2A0QB 4Y8XA 1BHXF 4JZFH 3E8LA 4TY7A 1AVWA 5JBBS 2R0KA 2GZ7A 4ZHMU 3KQBA 5EU8A 5EG4A 3SV7A 1GHBG 1L0ZA 1CQQA 2Z94A 2J34A 5FHTA 1LHCH 1TMTH 1LVBA 1IHSH 3U9AH 1N6YA 2SNVA 2Y5HA 3BTDE 1O2MA 5IYTA 2IN2A 3SN8A 1O2YA 3LH1A 1C1SA 2EEKA 3RXKA 2PUQH 3GOVB 3ZZ9A 4A7IB 2OP9A 2FTMA 4K2YA 4I33A 5IDKA 2P16A 1W7GH 2ZGJA 2UWLA 2ZCKP 4Q80A 5A0CA 1YGCH 2NU2E 2FI4E 5C1UA 1GBTA 4X1NU 3SJ8A 3ZV8A 1MKWH 4U30A 1AE5A 1BTWA 1VCWA 1VITF 2ANMH 2ASUB 2PKSB 3Q76A 4TPIZ 3TGKE 3SJKA 1NRRH 4ESTE 1C2DA 1ESTA 3HKIB 2Y82A 1HAZB 3TNSA 4WJG2 3PMHB 1MCTA 2P95A 5PTPA 1ABJH 2FYRA 1FY3A 1PQAA 4NIVA 3RMOH 4AFZA 1EOLA 2BMGB 3SNBA 1NROH 4AN7A 2ZFPH 4VGCC 1BMLA 1GJ7B 4SGAE 4ABDA 3PMJA 2P59A 2VU8E 1JRSA 1GBCA 2R0LA 4NIWA 5K7RA 1SQOA 1O2NA 3VB7A 1B0EA 3E16B 3DD2H 3SW2B 1F5KU 2GMTB 2P8OC 1XVOA 1FMGA 1BCUH 1C5ZB 1NS3A 1FV9A 4DURA 3OU0A 4AX9H 3OTJE 3ZVAA 1O3HA 2QAAA 3G01A 1EZUC 4FUJA 3BTGE 1C2IA 4Y7BA 5J4QA 1OXGA 4BANB 4ABGA 2H9EH 1CA0C 3ZZBA 1MZDA 1AFQC 1QA0A 1CE5A 3SO3A 1XX9A 1K28D 1H8IH 2TBSA 4UDWH 1AWHB 1P04A 2C90B 4LZ1H 1A5GH 3M37A 3QO6A 1YPJH 1GCDA 2AIQA 2W26A 1C4U2 2SGEE 2GT7A 4ZAEA 2WPLS 2ZKSA 1Y8TA 2VWLA 1BQYA 3MNCA 1V2UT 2ZTXA 5BPEA 8ESTE 2BOKA 1EJMA 1AD8H 4UFEH 5GCHF 1Z8JB 2ANYA 2FLRH 3BEFB 5EQQA 5C5OA 1ANEA 4K5ZA 3VB6A 2HOBA 3LIWA 5A09A 3D23A 2OQ5A 1TOMH 3ODDA 1G2MA 3SHCH 1HRTH 2J2UA 2B9LA 2GCHF 4D8NA 4NFEA 2QCYA 1QBNA 3QGJA 5EPNA 3S9CA 1DXWA 1OWEA 1P10A 4BTUB 1KDQB 1DANH 2J95A 2CF8H 1AGJA 3ZYEA 2A31A 3MWIU 4OS4A 2QV1A 3URCA 2Y6TA 1T7CA 5C5NA 1EB2A 3SI4H 4I8GA 1HAOH 1W7XH 2ODYB 7GCHF 5F6MA 2ZU3A 1BRAA 2VVCA 4AB8A 1KLTA 4MQAA 1JIRA 3SHAH 2BZ6H 3ELAH 1MKXK 4AG1A 2VB0A 1LQEA 1RGQA 4X6PA 1KTTB 5TCAA 3E3TA 5JDUB 4FUDA 3A87A 1IQGA 4NCYA 2F3CE 2BLWA 3KEEA 4YM9A 1GG6B 3L33A 1K1NA 2P3UB 1SGRE 3BF6H 3HK3B 4FU7A 3UREA 3A82A 5JYIA 1T8MA 3A7XA 3LC3A 1V2RT 1WAYB 2Z3CA 1EP6A 4ZXYH 3QDZB 1J15A 2XC0A 5T6FA 4GHTA 2R3UA 1P12E 3OY6U 3BTTE 1XUFA 2F9UA 3LU9B 5EW1H 1O37A 1O32A 1ZMNA 3PWBA 1D6RA 1SGQE 4GVUA 1KLJH 1QBVH 1JWTA 4O3TA 5CHAC 1MTNB 5LPRA 1KXDA 3SUEA 2AMQA 3M36A 4FUBA 4FU9A 3AAUA 4D9QA 1O35A 1ETRH 4CHAC 1MU6B 2FOBA 4ZUHA 3GCTF 3B8JA 4MPVA 2ESTE 3T26A 4CR5A 3U8TH 4X1QU 3ZVDA 4IC6A 3QX5H 1OP8A 1K22H 1QNJA 2FPZA 2BD8A 1BITA 5GDSH 1Y3UA 4DIHH 1Z8GA 5DO4H 4JK6A 2VGCB 4B76A 1ZMJA 3Q00A 2XW9A 3M5MA 5C3NA 2VIVA 2GKVE 4DIIH 4BAOB 1N6XA 4NIYA 4ZHAA 1ANDA 2V6NA 1YPEH 3MH5A 2BYAX 3A8AA 3RXFA 1O2KA 1ETSH 1A46H 1O3JA 1NU7B 1C5VA 1HAVB 4E7RG 3D65E 1D3DB 1EAUA 1MKXH 3VB5A 2H6MA 4TWYA 3MH6A 3PO1B 2XWBI 5FPYA 2XC4A 3RU4E 1BRCE 1IQMA 1ABIH 1GI8B 2GT8A 2Z9JA 4BTIB 4IN1A 1O3MA 1NTPA 1P03A 5GJ4B 2JKHA 2ZPRA 4E7NA 1ZMLA 4DW2U 5A0AE 3KL6A 3O8RA 2Y5GA 1BUIA 1GBLA 1W12U 1L1GA
chains in the Genus database with same CATH superfamily
1C2JA 3RXOA 4Q63A 4CRFA 1SKYE 2C8ZB 1OP2A 3MO3A 2FOEA 1THSH 2V0BA 2PSYA 6CHAC 1EXFA 4FETA 4AOQA 1TWXB 1T31A 1ZSLA 2PWXA 2TGPZ 1EZXC 2HPPH 2QXIA 5LGOA 1AKSB 1FAXA 2WPMS 1GMHF 1A0LA 1YBWA 3GY4A 1P9UA 1PYTC 1PPCE 1TQ7B 3S9BA 2XBWA 1F92A 4IN2A 3STIA 4U32A 3QUMP 9LPRA 1O5AB 1O2GH 1TMUH 4ZH8A 1DPOA 4X1RU 2P94A 1AY6H 2XBYA 3LGUA 2G4TA 4DGJA 3KQ5A 4Q7XA 2XBXA 1LQDB 3A7TA 3SBKA 3IWMA 2SGDE 4CREA 1DDJA 1LVMA 2HNTF 3EGKH 3S9AA 1O3GA 2ZHFH 1UTLM 4ABJA 4AYYB 1KLIH 3R3GB 1DX5M 2WUBA 3SUFA 1SHYA 3S69A 5A2MH 2G4UA 2I6QA 1UVPA 3RXBA 2LP6A 2XBVA 3TGJE 5EOKA 4P02A 1AZ8A 1ZSKA 2ZPQA 1AVGH 1NBME 3A84A 3QK1A 5G4BA 3SUGA 3LDXH 1W0KD 3BTFE 1GGDB 3CP7A 2KCOA 2ZTZA 2V3OH 1ZRBA 3JZ1B 1O34A 1AUJA 2VWNA 1VJ9U 4WWYA 2JETB 3ZZ8A 3MFJA 3OE7D 2OC7A 1OYTH 5F8TA 3ZVBA 1O5CB 1EASA 1HB0B 1O2TA 1VGCC 1PFXC 2ZDNA 4Q4LA 3GY3A 4ZROA 1DSTA 1S0RA 4DCDA 5DPAA 6LPRA 5JB8S 3V7TA 4O97A 3ZZAA 1HDTH 1Y3XA 4Y11E 1GMDG 1ZRKA 5B6OA 1ELEE 1OOKB 1NRPH 2A4QA 4ISLA 3E0PB 1SGIB 1SMFE 3SI3H 3RM0H 5C0TA 4ZKRU 2ZFQH 5I46H 4ISHH 1ZJDA 2F9VA 1L4ZA 1K9OE 1JIMA 1O3FA 4NSYA 1C1VH 3F1SB 2A1DB 1QURH 1PYTD 1TGNA 2A32A 4UFGH 1Y59T 1CGHA 1GI2A 5DSFA 1NPMA 1QCPA 4IMZA 4RKOB 1CT0E 4A1TA 1PJPA 3PRBA 3MMGA 2LELA 2QF3A 4KP0A 2EC9H 2J92A 4K60A 4MNVA 2GDDA 1TRYA 1T32A 5EXLA 2VINA 1XUGA 1MMJN 2J38A 4OGYA 1FZZA 1QL7A 2OK5A 4YXWD 1O2RA 1FN6A 4VGCB 1ZZZA 4RT1A 1VCPA 1Z6JH 2CMYA 2PSXA 5EODA 4IMQA 1VITG 4WXIA 3RM2H 1YKTA 3RMMH 3SZEA 4BXWA 1P2OA 1WOFA 5FL7D 1K1IA 3S7KB 3N99A 1C5LH 3GY6A 1GHAF 4CBOA 1CT4E 4YZUA 1OP0A 4WMFA 1FDPA 1SB1H 2A7CA 1OWKA 2B5TB 1GJ9B 2BQWB 3JZ2B 2Q6GA 1XM1A 4OS7A 1D3QB 3MO6A 1AFQB 1BDAA 1TNHA 2ODPA 1ELGA 5AVDA 4ISOA 3TH3H 1DUEA 1NU9A 3UOPA 5DK1A 4CRBA 2UWOA 1UTKA 2PR3A 4GCHF 4XFQA 1ZTJA 1DSUA 1S0QA 1BHXB 2ZZUH 2GV6A 1Z1JA 3LGIA 4AORA 5CMXH 1A3BH 5EPYA 2KX4A 3ZZ6A 2G8TA 3SUDA 1F7ZA 1EATA 1ZR0A 2AGGX 1CO7E 1ZOMA 3HATH 3TITA 6GCHF 2ZU4A 1O2IA 1ARCA 1PPHE 5ESTE 1DLKB 2ZTYA 4BAMB 4I32A 3VFEA 1BBRE 1AVXA 1GVZA 2EY4C 3RXMA 1ZHRA 2G81E 2ZIQH 4DG4A 1WDIA 5A0BA 1Q31A 3SGQE 2KAIB 2OCVB 5DG6A 1DFPA 4AC9A 1L2EA 1S6FA 3ZZ7A 5LH8A 3D62A 1HFDA 1AFEH 1MKWK 3NK8A 3P70B 1W8BH 1J14A 5HYOA 2NU3E 2HLCA 1WU1A 5GCHG 3RLWH 1D9IA 2IPHA 2FO9A 2PUXB 1KXEA 3MQKC 3EYDA 2GCTC 3M5NA 1H9HE 3N7EA 3FFGA 4INKA 5GIBA 4KELA 3ZZCA 3P8FA 1Z1IA 4FU8A 1VZQH 3EAJA 2ZCHP 1C5MD 4H6TA 3FO8D 2R3YA 2WHXA 2GCHG 3P17H 1JXPA 1W3CA 3TIUA 1VJAU 3SQHE 2FDAA 3GY8A 2R2MB 4IC5A 1AQ7A 4UFFH 1BA8B 1O3KA 4K1TA 2WSSD 5C0UA 2UWPA 1EP5A 3DSGA 2PTNA 4GSOA 2RG3A 1O5EH 3M7QA 3GISB 4RT0A 1BMMH 1ETTH 7GCHG 1QHRB 1K1PA 1T8LA 3OTPA 3TJVA 2V3MA 2ZHWH 3BIVH 4RN6A 1EUFA 1C2FA 1O3IA 2OC8A 4YOJA 1GVKB 1O2VA 1TONA 2SGQE 1TIOA 2WPIS 2PV9B 1HLTH 2TRMA 4OGXA 5AFYH 2W3IA 3SJIA 5HGGA 1C5YB 2BLVA 1C4V2 1HAYB 2R9PA 1O2HA 3M7TA 1V6DA 1MBQA 4CHAB 2WV4A 1C5TA 2Y81A 1KMHB 2BVSH 1Q3XA 2WYGA 1PQ8A 3NZIA 1LKBA 1V2QT 3V12A 2IPQX 1GBHA 1FAKH 1G32B 2RA3A 1PPGE 3SQEE 1A2CH 2D1JA 1O39A 1HAGE 5C94A 1O3AA 1HV7A 4X2XA 3ZZ5A 1G9IE 1SOTA 1CSOE 2SGAA 1ELAA 2ILNA 3GDVA 5FCKA 1BTUA 4U2WA 4HG6A 5E0GA 1HJAB 4RI0A 1GCTB 1ZHPA 3S0NA 1P02A 5I25A 4IW4E 1AWFH 3MTYA 2BX4A 2G5NA 1QJ7B 3BN9A 3TVJB 4MDSA 1C1TA 1AN1E 3SORA 6ESTA 3GCTG 1Z71A 2FX6A 2ZQ1A 1LMWB 1P9SA 1SL3A 3QGNB 1NY22 1C5WB 2GGVB 5C17A 3SV9A 5DGJA 1TB6H 3PV4A 1NRQH 1EOJA 5A8XA 4Y8YA 4DY7B 3L6PA 1YPHE 1ELDE 3FP6E 2BDBA 1K21H 1SGTA 5HM2A 1F0SA 2ZHQH 4XBDA 1J8AA 1HGTH 1MZAA 1UTMA 2FWWA 1UCYE 2XNIA 2ZQ2A 3GCNA 1E1QD 3NUMA 1NN6A 1TE0A 3SU2A 2P3FH 1CT2E 1HPGA 2H5DA 3UQOA 1F0TA 1D4PB 4JCNA 1WXRA 4OS2A 4B73A 2D26C 1NRSH 3N7DA 3SU4A 3N7OA 1E38B 3W1EA 1UHBA 1K2I1 5C2ZA 2FM2A 3MNSA 2BY9X 1HIAB 3MU1A 6CHAB 2AERH 3VXEH 2RCEA 4IBLH 1C5PA 1MUEB 5E8EH 3S7HB 1YC0A 3PTNA 2OQUA 3M3VA 1ELFA 1OS8A 1V3XA 3I78A 3MO9A 3O8BA 3PLPA 3E1XB 1OWHA 1DITH 1Y3YA 4NSVA 1EJNA 1ID5H 1ACBE 3EA7A 4E06H 2J9NA 1V2OT 1GHVH 3I77A 3F9GA 4XBCA 3PLBA 2A5KA 1C2EA 1V2ST 2QGRA 2KFWA 3PWCA 4A92A 2CF9H 2XOKD 5FX6A 3T2NA 1N8OB 4X0WU 5KEDA 2ZGCA 4ABHA 3ZVCA 2PGQB 1KY9A 1QBOA 4FUFA 1GMHG 1ZHMA 3AVZA 5K0HA 1UJ1A 1TX8A 1MTVA 1KSNA 3Q3XA 5ETXA 1TBZH 2PLXA 1GMCF 1CU1A 2J4IA 4FUHA 1OWJA 1O2WA 3AASA 2K1QA 3U1IB 1ZPCA 1CHOF 1LPGB 1AI8H 1IQHA 1SQTA 2QA9E 3MNXA 3QZQA 2W7SA 3U8OH 5C67A 5GXPA 1HAVA 1MAXA 4B2CA 1W2KH 4WMDA 1EZSC 1BTHH 1DUAA 1MTUA 3ZVEA 1VR1H 4YO9A 4E05H 1H8DH 2XC5A 3ZIAD 4X6NA 1AU8A 4FUCA 2V3HH 2BDAA 1XKBC 1GJ8B 2ZDAH 1S82A 1TMBH 1AE8H 2BY5X 2JH5D 4Q7ZA 2D8WA 1TRMA 3K6ZA 1BRUP 4AYVB 3RXSA 1VGCB 4WH8A 4XE4A 4Q7YA 2ZPSA 1XVMA 1A5HA 3M35A 5SGAE 3VGCC 2ALVA 2QN5T 3MYWA 5EXMA 5FPTA 5E0HA 1PPFE 1GJCB 2YOLA 4DT4A 1TBRH 5JB9S 2FYQA 3PB1E 3ZZ4A 5DJ7A 3VPKA 1G3DA 1AB9C 1JBUH 1RIWB 4Y7AA 2Y80A 5F03A 4Y8ZA 5BRRE 2O8WA 2ZNKH 3VB3A 1O3EA 4ASUD 1SGEE 4D76A 3DCLA 3U69H 1A0HB 1G3EA 3KQEA 3SU0A 1F0UA 2BLOA 4FUEA 5DKMA 2FI3E 2BY6X 2ZO3H 3T25A 1G3BA 1YM0A 3GCOA 3TJNA 1BMAA 2VIDA 1ZTKA 2QF5A 1XUHA 3V0XA 1S83A 1ANBA 2H9TH 3ZVFA 1C1NA 2AH4X 1DLEA 5GPIB 5DP7A 1GHYH 4ISIH 1RS0A 3STJA 1ELVA 1LVYA 4A1VA 1GBJA 5JBTA 4MTBA 4Y71A 1QJ1B 3QLPH 3UAIC 1AMHA 5HIYA 3B23B 2FOFA 2BY7X 4H4FA 4AFSA 3A8DA 1GBDA 4HZHA 1W14U 3SU5A 2OINA 3BG4B 4R0IA 4AG2A 4LK4A 1C5NH 5FPSA 3H09A 1EPTA 1CHGA 1SG8B 1KXFA 1Q2WA 1SC8U 2UUYA 1PPBH 1TGSZ 5HXFA 2Z9IA 1GI7B 1Z7KA 1DICA 3AW0A 4BXSA 2FS8A 4NWLA 2ZDLA 1E36B 2PGBB 3M3TA 1NZQH 1H8ED 2H9HA 5TCCA 1FJSA 3IG6B 2BM2A 4WVPE 2CHAC 3KYGA 1SVPA 3KHVA 3Q77A 1GBMA 2XCFA 3M61U 1GJ6A 2RDLA 2F43B 2K0QA 4J1YA 3O8CA 4I31A 1LPKB 1GHAG 2ZU1A 1TOCB 1O2OA 4ZKNU 2VIOA 1U6QA 2O8MA 1MAYA 3A86A 4UE7H 1TPSA 1QB9A 1P2JA 3RXHA 2CGAA 1YYY1 2VH6A 1P0SH 5ESBA 1SR5C 1YPMH 2GD4B 2NU4E 2Z7FE 4K8YA 1XXDA 2YMSC 4JMYA 4GCHG 4TPYA 1RJXB 1ELBA 5AF9H 2Y7ZA 3WW7A 2XWAA 3RMLH 1QJ6B 4JYUH 2BOHB 2HWLB 1OWDA 5A8ZA 2PP6A 2DE8A 2P93A 1O2LA 6GCHG 4DT7B 2WV5A 3FN8A 3MU0A 1C5QA 3TJUA 3GY5A 1O2UA 2OUAA 3F68H 4KTSA 2WYJA 1SGDE 1KIGH 3A83A 4X8UH 2G51A 2ZHDA 1C2KA 1P3EA 2WPKS 4X2YA 3GS9A 4MLFB 1O3DA 3TH2H 5E0JA 5L30H 1L4DA 3BEIB 4B71A 1SLWB 2VIWA 2XCNA 4B74A 1QL8A 2DE9A 1LDTT 4JZEH 1QIXB 1ZGVA 1C2LA 3RP2A 5JPMH 5HMAA 4D7GA 1TGBA 2D2DA 3LGTA 1W0YH 2W5EA 2H5CA 4MNYA 4UFDH 3SJOA 2TGAA 4XSKU 1LKAA 1W13U 3T29A 4TWWA 1E0FD 1THRH 3URDA 1GL1A 3OY5U 1TNGA 5FCRA 2PW8H 5T1VA 2BHGA 1TX6A 4X1SU 5E2PA 3WWBA 4Y79A 4WH6A 5EGMA 3U98H 1BRBE 3DFJA 5FBEA 4BAHB 4NIXA 5EXNA 2L74A 1YLCA 2G5VA 1J9CH 1DVAH 1DWDH 4CH2B 3UIRA 5DP6A 3DA9B 1TABE 1Y5AT 5FXLA 5EIYA 5GWZA 2W3KA 2ZEBA 2FOHA 2ZU2A 1CBWC 1V2KT 1SOZA 1C9TA 2JH0D 3U8RH 1A3EH 3W95A 2ZF0H 2O8LA 3UWIA 8GCHF 2OBOA 3DT0H 3C27B 3CS7A 5B6LA 4LXBH 3HGPA 2ZFSA 1RTFB 3SU1A 2OC0A 4ZXXH 2KAIA 1ANCA 3V3MA 1W11U 1O3BA 1IQLA 2BD2A 3I29A 2PKAB 1O3PB 4ZCNA 1LCYA 5EQRA 2TPIZ 2V7QD 1MTNC 2CJIA 1OWIA 2FXRA 3EDXB 2Y7XA 4MPWA 2J94A 3UQVA 1V2MT 1O31A 4JZIA 5E2OA 1UTQA 4NA8A 4HFPB 2F83A 2DUCA 2BDIA 5EQSA 4K3JA 5L2ZH 1A4WH 1O2QA 2A45B 1O3LA 2EI6A 1DM4B 2THFB 4NWKA 1P57B 2TGDA 1SGFG 1GI0A 1MU8B 2BD7A 1KXCA 1EAXA 4MNWA 5L2YH 3RLYH 4UONA 2BDHA 2G55A 2P8OB 3LGYA 1TA6A 4O9VA 1RFNA 3RXAA 2FS9A 3F9HA 1S6LA 4XDEA 2ODQA 4J2YB 2HVXA 1QA7A 3RXUA 1QGFA 1KXBA 1C4Y2 1LVOA 2Y5FA 1YCPK 3FAOA 4AZ2B 3K2UA 3PV5A 1CA0B 1QY6A 3RC5A 3LOXA 3B9FH 2JDID 1TAWA 1IQNA 3AAVA 4A5TS 1UVSH 3F3BA 3PO1C 2O8UA 2QYIA 1IOEA 2G52A 1YLDA 3PM3A 2C93B 3MOCA 3RC6A 3T5FH 1K0HA 4X8SH 1ZPBA 1BZXE 2KCPA 1C1OA 4Z1MD 4FXGH 1NESE 1JMOH 3T27A 1A7SA 1TA2A 2BX3A 3IITA 3FANA 1AHTH 1A61H 1XKAC 3PMAB 3TK9A 4Y6DA 2AEIH 2Z9KA 3BSQA 4M7GA 3UOUA 1TBQH 3ZZ3A 1NO9H 2ZI2H 2FTLE 2WPHS 3HGNA 1IQEA 1TPPA 5LPEA 1ZSJA 4K69A 3Q3YA 1WBGB 3TGIE 3CENA 2ZDVH 2ANWA 1E79D 3BEUA 4YTAA 2GV7A 3GCHC 1BIOA 1MABB 1NFUA 1SFQB 1L1NA 3OX7U 4OS5A 4HGCA 4RKJB 4CRGA 2VH0A 3F0PA 1GJDB 2CK3D 1BTYA 1ESBA 2ALPA 8KME2 4GAWA 4CRCA 1WYKA 1TPOA 2GVFA 3ZZDA 4ISNA 1ZLRA 2W7UA 4AGJA 3E90B 2H1UA 1F5LA 1Y3WA 1J16A 1NM6A 2BD4A 2AHME 1O3NA 1EFRD 2Q6DA 2QF0A 4TYDA 2ZDMA 2CN0H 1IQJA 1C2HA 3P6ZB 2FEQH 2ZCLP 1OX1A 1TNJA 1EAIA 7KMEH 3VB4A 7ESTE 1FY4A 3FZZA 4KKDA 1GMCG 1YCPH 3HPTB 4YESB 1FXYA 2VIPA 1N1LA 2BD5A 2HPQH 1INCA 2KR7A 1CHOG 1FPHH 1GWAA 1P06A 1QR3E 4NGAH 1NC6A 2ULLA 4PROA 5F8ZA 1MD7A 2HGTH 1A1RA 1T8OA 3ENSB 2UUFB 4BOHA 3U28C 3KGPA 4JZDH 1WQSA 1O38A 1ZJKA 1DS2E 1QQUA 2C8YB 4ABFA 2JJ1D 3KYFA 1HAIH 1HIAA 2A2XH 3RXQA 4NA7A 2BZAA 2ZC9H 5GNDA 2BDYA 3BTME 2BY8X 2OXSA 1EPTC 1SGNE 4X6OA 4DJZB 5LPFA 4ZKSU 2TIOA 1FY1A 1GGDC 3QZRA 2AMDA 4XOJA 5CHAB 5EJZA 2A4RA 3O8DA 1GDUA 3F9FA 3RMNH 3U1JB 1H4WA 3R0FA 1HNEE 1SSXA 3K9XB 3ZV9A 2GX4A 5F53A 2P3TB 2JETC 1H8HD 4RSPA 1FNIA 1KXAA 1GI6A 2Q1JA 3GY2A 4Q2KA 4H42U 1TNKA 1HBTH 3NXPA 1IQIA 1GHWH 1SI5H 1SGYE 1PQ7A 3KIDU 1YF4A 1V2JT 1O5BB 1GBFA 1FIWA 3ATWA 2GZ8A 3H7OA 4P00A 1S6HA 4THNH 5DP8A 2ZP0H 3LT3A 3ITIA 1O2XA 1KDQA 1SLUB 3PYHA 2NWNA 2SGPE 4CH8B 1JRTA 1DWCH 2AYWA 1RD3B 2ZWLH 3LH3A 4YT6H 3RXVA 3A7VA 2BXTH 2BD9A 2AGIX 4I8JA 4F49A 3SNAA 2UUJB 1P2QA 4FVDA 2YNAA 5DP4A 1P3CA 2QXHA 2EA3A 2AIPA 1FUJA 2QXJA 1GI1A 2AFQB 1O36A 1P2IA 1YWUA 1S5SA 1UVOA 2Z3DA 1X7AC 2CHAB 2ZDKA 3A81A 3SU3A 1UW7A 1HXEH 2A7HA 2B8OH 2FI5E 1FONA 2RDEA 2Z9LA 2BDCA 1DXPA 1GPZA 4MG3A 1QRZA 1W10U 3VXFH 4JYTA 3A88A 3RXIA 3TK5A 3FP7E 2VVVA 4K8BA 3KCGH 1C1RA 1UO6A 1K1OA 4BTTB 2JH6D 1CA8B 1ORFA 2EI7A 4NG9H 3RXPA 5ABWA 1SQAA 2M2AA 1SHHB 1GI3A 2IOTA 3E0NB 4WXVA 3DFLA 1LTOA 2WUCA 1H1BA 1UK3A 3F2HA 2PFEA 3BTHE 1C5SA 1P01A 2C3SA 1Z8RA 2A4GA 1MCVA 1UK2A 4X8TH 3RUOA 4I8KA 3SV2H 2Z9GA 1DE7H 1QB6A 4AFUA 3E6PH 1SGPE 1P2MA 3W94A 1K1MA 1TALA 3BTEE 1ZTLA 2BTCE 2HNTE 3T62A 2AGEX 4INHA 3RXCA 1RTKA 3KQDA 4JZ1A 4MPXA 2OC1A 1V2TT 3DSPA 1YPGH 3RXDA 1C1QA 1IAUA 1FX0B 3UNRA 1EKBB 5CE1A 1GJ4H 1FY8E 2BB4A 3F6UH 2VVUA 2W6JD 3RU4D 3A85A 1FIZA 1P09A 3P8NA 2VJ1A 4KTUA 3TPIZ 4AB9A 1S85A 3SOSA 3BIUH 5HKKD 1O5GH 2HALA 1LO6A 1ELTA 1S84A 1QFKH 4HI3A 1G3CA 2F9NA 3T28A 2LPRA 3ATKA 1AIXH 3E91A 2KCAA 4ZMAH 1VKYA 3UTUH 2J5UA 1WQVH 1GDQA 3K65B 1TQ0B 1O5FH 3ZYDA 1MQ6A 2A7JA 3TLOA 4YLUA 3A89A 3MHWU 1DWEH 3HK6B 1D6WA 2FMJA 2A5AA 1FY5A 3TJOA 1K1LA 1VITH 3BV9B 1SLXB 1Z6EA 2QXGA 3OFND 1SGCA 1T4VH 1C9PA 4YT7H 1GHBF 1V2NT 1C5RA 2LNCA 1D3TB 3RXLA 2RA0A 1BTZA 1MQ5A 1RTLA 5H4IB 1GVLA 1GBEA 2FZZA 2NU1E 1AKSA 3P8OA 3A7ZA 1UHBB 1CBWB 1BBRK 1B5GH 1AO5A 4ABEA 4MPUA 1NT1A 1O33A 2KZ4A 2ZFFH 3CS0A 1G30B 1PPEE 3FP8E 4GPGA 5C20A 2FESH 2H2ZA 1V2WT 3FOAA 3H5CB 3SV6A 2FX4A 2OTVA 1HAPH 1BTXA 4F4OC 2OD3B 3F2GA 1LHDH 2A2QH 2BVXH 1XMNB 2FOCA 3BTWE 3TK6A 3M5LA 1ELCA 1CGJE 1C1UH 2BQ7B 1S81A 1NBMD 5DP9A 3SV8A 4X1PU 1JOUB 2BVRH 4CR9A 5T3HA 4Y0YE 1GBIA 2Z3EA 5HM9A 2STBE 1GI9B 3A7YA 1DY9A 1NFYA 1QRXA 8GCHG 2FOGA 3RXJA 1P11E 3LPRA 1PPZA 1EJAA 1SPJA 1C2MA 3NRLA 3MH4A 3MH7A 1ZGIA 4X2WA 3QWCH 1BOQA 4IS5A 2PKSC 3LC5A 5L6NH 4KGAA 4Y76A 3SGAE 2QE7D 4B2AA 1YPKH 1GJAB 1GDNA 1HJAC 1GCTC 1LHEH 1F5RA 4LOYH 2UUKB 1A5IA 1BT7A 4FOUC 4K1EA 3RXGA 4B1TA 5JBCS 1GHXH 2J98B 3SNDA 2XXLA 3BG8A 2C4FH 2ANKH 2XNDD 4JK5A 1EAWA 1MH0A 1O2JA 1TX7A 3QTVH 1E37B 1GJ5H 4ABBA 4WMEA 3WY8A 2NU0E 2GDEH 4AFQA 1TGCA 2YNBA 4IGDA 2W6ID 2PTCE 5EJLA 4AGKA 5EJ1A 1F2SE 1BJVA 1FLEE 1BBRH 1UK4A 2BXUH 3EE7A 4UEHH 3LJOA 2XYAA 1NFXA 1BB0B 3ODFA 2ZA5A 5F8XA 5FBIA 2GJGA 2GMTC 2FP7B 1PQ5A 4X2VA 2ZGHA 1SLVB 3EA8A 3GY7A 4ABIA 2WPJS 5FAHA 1QRWA 2ZG0H 1WTGH 3GYMA 3RXRA 2B7DH 3GCHB 1WTHD 3K6YA 3RXEA 2XRCA 1GBBA 2O9QA 2O8TA 1QZ8A 3V13A 1V2VT 1MD8A 1YY3A 1SBWA 2JIZD 1A0JA 1RXPA 2PKAA 1O0DH 4CRAA 3UPEA 3HKJB 1HAHH 1UVTH 3ATLA 2GTBA 4KTCA 3PLKA 5T6DA 1EZQA 4K1SA 1KYNA 1C2GA 2JJ2D 1KTSB 4QT8C 5T6GA 4D7FA 1V2PT 5C1XA 1TYNA 1FPCH 3AW1A 1C1WH 3MI4A 4I7YH 1T8NA 1GL0E 1XUJA 2VIQA 2Z6BD 3QTOH 2PHBA 1UTNA 2GCTB 1OSSA 3L3TA 5AHGH 3DUXH 1UCYK 4NZQA 3M7UA 1OYQA 1RRKA 2CV3A 2CXVA 5CDFE 4B2BA 3QN7A 3ZVGA 4TY6A 1FI8A 1N8OC 1YLNA 2AS9A 1TNIA 4X6MA 3NKKA 1ESAA 1WUNH 3A7WA 4A1XA 3MU5A 2R2WU 3RC4A 1YPLH 2WV9A 2BLQA 1H9IE 1ARBA 3UR9A 5AFZH 1HJ9A 1O5DH 2VWMA 3GDUA 1TRNA 3A8CA 3UR6A 1Y5UT 2B0FA 2FODA 4ZHLU 2FLBH 3PROA 3SNCA 2BQ6B 1P05A 4F48B 1HUTH 1EPTB 3EE0B 4NA9H 3H7TA 3KNXA 4BAKB 4FVBA 1G37A 4LZ4B 3UNQA 1B7XB 3GICB 3UFAA 1G36A 3RDZA 1K1JA 1LHFH 1DOJA 3FKSD 1YCPM 4B75A 3F9EA 5A8YA 2HRVA 3KN2A 1C1MA 1OHHD 1GG6C 2QF4A 1AZZA 1P2NA 1MTWA 2KM0A 3ATMA 1P2KA 2C8XB 1HXFH 5FX5A 2ZGXH 2TGTA 1QL9A 4OS6A 1Z8IB 1J17T 3SNEA 4NFFA 4OS1A 1YPHC 3TH4H 2G00A 4X8VH 4ACBA 2VNTA 2YMSD 3EA9A 4GUXA 1SFIA 5CHBA 4BAQB 4ZKOU 3PRDA 4NZLA 2SGFE 5TJXA 1UMAH 1TLDA 1RIWC 2ZFRH 1UCYH 2C8WB 1O3OA 7LPRA 1B0FA 1GBKA 1HJ8A 3FZDA 1C5UA 2F9PA 1NRNH 2A4OA 2WPDD 4I8LA 2KCYA 3C1KA 4YLQH 1CGIE 1SGFA 1DY8A 4UD9H 1O2PA 1BMNH 3VEQB 1LPZB 3M5OA 3NPSA 2SNWA 2AMPA 2F9BH 4MNXA 4SGBE 4XRNA 2GZ9A 8LPRA 1TPAE 3ATIA 2VWOA 3OYPA 3PTBA 2F91A 1TNLA 1E34B 3DHKH 1BJUA 2VGCC 3LKWA 4YOGA 5JBAS 5J4SA 4GLYA 4Y0ZE 5C1YA 4DOQA 5EW2H 4Z6AH 4BNRA 5HIZA 1LHGH 4Y10E 1GJBB 1WV7H 3PV2A 1GI4A 3KQCA 2BDGA 2Q6FA 3SYJA 4CBNA 2HNTC 3LGWA 1GHZA 3SU6A 3BG4C 4O3UA 1TGTA 3RXTA 3MU4A 1E35B 2ZGBH 1P8VC 1UTPA 4ABAA 1O2ZA 1WCZA 2OLGA 2QIQA 4WY3A 2QC2A 2WINI 4JYVH 3MNBA 3EQ0H 1T4UH 3UUZA 1M9UA 2F9OA 4A6LA 4MVNA 4H6SB 4B6EA 1UTOA 3SZNA 4ASHA 2ZHEH 1XUIA 3LJJA 3FVFB 1OKXA 2RFKC 1EQ9A 2A5IA 2QY0B 2ZECA 3GYLB 4INLA 2FOMB 1V2LT 4FUIA 1W0ZU 5DP3A 4D9RA 1FN8A 3P8GA 4FUGA 3UWJH 3NCLA 1WSSH 3TNTA 3LGVA 4YOIA 1IQKA 3A80A 1BTPA 2SFAA 1CVWH 2GP9B 3P92A 3D49H 4DVAU 2EI8A 2XTTB 3TU7H 2M5TA 1VCQA 4GHQA 1DT2A 4I86A 2FIRH 2V35A 1QQ4A 3P95A 3F2FA 4O03A 4I8HA 2I6SA 1FQ3A 1DWBH 1D3PB 1HCGA 5DN6D 5DP5A 1H9LB 3BTQE 4TSFD 1AUTC 3WWFA 1THPB 1C1PA 3LONA 1NFWA 3UY9A 2ZFTA 1F0RA 1C5XB 1GI5A 3AK5A 2IJOB 3ESTA 9ESTA 1EB1H 2EQNA 3SGBE 3Q3KA 3UNSA 1GBAA 3MU8A 1C5OH 1O3CA 3KF2A 4HTCH 4U01A 1G2LA 1O2SA 2BD3A 1ZYOA 3GDSA 3NWUA 1O30A 4XBBA 1TFXA 4WF8A 1QB1A 3BTKE 1IQFA 1XUKA 3SJ9A 1YP9A 1ZPZA 4CRDA 3VGCB 3RU4T 1L1JA 1OPHB 1EX3A 1HAXB 3OSYA 1XXFA 3A8BA 3M3SA 1MBMA 1AB9B 2ZU5A 4R8TB 1UVUH 1Y5BT 2FOAA 2STAE 1Y3VA 1GMDF 1HYLA 1IHTH 1QTFA 2OBQA 1MTSA 1UTJA 3PMBB 2A0QB 4Y8XA 1BHXF 4JZFH 3E8LA 4TY7A 1AVWA 5JBBS 2R0KA 2GZ7A 4ZHMU 3KQBA 5EU8A 5EG4A 3UB0A 3SV7A 1GHBG 1L0ZA 1CQQA 2Z94A 2J34A 5FHTA 1LHCH 1TMTH 1LVBA 1IHSH 3U9AH 1N6YA 2SNVA 2Y5HA 3BTDE 2IJD1 1O2MA 5IYTA 2IN2A 3SN8A 1O2YA 3LH1A 2HVYB 1C1SA 2EEKA 3RXKA 2PUQH 3GOVB 3ZZ9A 4A7IB 2OP9A 3OAAD 2FTMA 4K2YA 4I33A 5IDKA 2P16A 1W7GH 2ZGJA 2UWLA 2ZCKP 4Q80A 5A0CA 1YGCH 2NU2E 2FI4E 5C1UA 1GBTA 4X1NU 3SJ8A 3ZV8A 1SQRA 1MKWH 4U30A 1AE5A 1BTWA 1VCWA 1VITF 2ANMH 2ASUB 2PKSB 3Q76A 4TPIZ 3TGKE 3SJKA 1NRRH 4ESTE 1C2DA 1ESTA 3VG8A 3HKIB 2Y82A 1HAZB 3TNSA 4WJG2 3PMHB 1MCTA 2P95A 3CNRA 1ABJH 5PTPA 2FYRA 1FY3A 1PQAA 4NIVA 3RMOH 4AFZA 1EOLA 4XD7D 1E1RD 2BMGB 3SNBA 1NROH 4AN7A 2ZFPH 4VGCC 1BMLA 1GJ7B 4SGAE 4ABDA 1COWD 2P59A 3PMJA 2VU8E 1JRSA 1GBCA 2R0LA 4NIWA 5K7RA 1SQOA 1O2NA 3VB7A 1B0EA 3E16B 3DD2H 3SW2B 1F5KU 2GMTB 2P8OC 1XVOA 1FMGA 1BCUH 1C5ZB 1NS3A 2VBCA 1FV9A 4DURA 3OU0A 4AX9H 3OTJE 3ZVAA 1O3HA 2QAAA 3G01A 1EZUC 4FUJA 3BTGE 1C2IA 4Y7BA 5J4QA 1OXGA 2YMSB 4BANB 4ABGA 2H9EH 1CA0C 2K8IA 3ZZBA 1MZDA 1AFQC 1QA0A 1CE5A 3SO3A 1XX9A 1K28D 1H8IH 2TBSA 4UDWH 1AWHB 1P04A 2C90B 4LZ1H 1A5GH 3M37A 3QO6A 1YPJH 5IK2D 1GCDA 2AIQA 2W26A 1C4U2 2SGEE 2GT7A 4ZAEA 4ACAA 2WPLS 2ZKSA 3F0OA 1Y8TA 2VWLA 4F55A 1BQYA 3MNCA 1V2UT 2ZTXA 5BPEA 8ESTE 2BOKA 1EJMA 1AD8H 4UFEH 5GCHF 1Z8JB 2ANYA 2FLRH 3BEFB 5EQQA 5C5OA 1ANEA 4K5ZA 4TT3D 3VB6A 2HOBA 3LIWA 5A09A 3D23A 5KGOA 2OQ5A 1TOMH 3ODDA 1G2MA 3SHCH 1HRTH 2J2UA 2B9LA 2GCHF 4D8NA 3DSOA 4NFEA 2QCYA 1QBNA 3QGJA 5EPNA 3S9CA 1DXWA 1OWEA 1P10A 4BTUB 1KDQB 1DANH 2J95A 2CF8H 1AGJA 3ZYEA 2A31A 2J98A 3MWIU 4OS4A 2QV1A 3URCA 2Y6TA 1T7CA 5C5NA 1EB2A 3SI4H 1BMFD 4I8GA 1HAOH 1W7XH 2ODYB 7GCHF 5F6MA 2ZU3A 4M9FA 1BRAA 2VVCA 4AB8A 4OM9A 1KLTA 4MQAA 1JIRA 3SHAH 2BZ6H 3ELAH 1MKXK 4AG1A 2VB0A 1LQEA 1RGQA 2F4LA 4X6PA 1KTTB 5TCAA 3E3TA 5JDUB 4FUDA 3A87A 1IQGA 4NCYA 2F3CE 2BLWA 3KEEA 4YM9A 1GG6B 3L33A 1K1NA 2P3UB 1SGRE 3BF6H 3HK3B 4FU7A 3UREA 3A82A 5JYIA 1T8MA 3A7XA 3LC3A 1V2RT 1WAYB 2HLDD 2Z3CA 1EP6A 4ZXYH 3QDZB 1J15A 1W0JD 2XC0A 5T6FA 4GHTA 2R3UA 5KECA 1P12E 3OY6U 3BTTE 1XUFA 2F9UA 3LU9B 5EW1H 1O37A 1O32A 1ZMNA 3PWBA 1D6RA 1SGQE 4GVUA 1KLJH 3OEHD 1QBVH 1JWTA 4O3TA 5CHAC 1MTNB 5LPRA 3OEED 1KXDA 3SUEA 2AMQA 3M36A 4FUBA 4FU9A 3AAUA 4D9QA 1O35A 1ETRH 4CHAC 1MU6B 2FOBA 4ZUHA 3GCTF 3B8JA 4MPVA 2ESTE 3T26A 4CR5A 4B6FA 3U8TH 4X1QU 3ZVDA 4IC6A 3QX5H 1OP8A 1K22H 1QNJA 2FPZA 2BD8A 2WZQA 1BITA 5GDSH 1Y3UA 4DIHH 1Z8GA 5DO4H 4JK6A 2VGCB 4B76A 1ZMJA 3Q00A 2J97A 4Z0KA 2XW9A 3M5MA 5C3NA 2VIVA 2GKVE 4DIIH 4BAOB 1N6XA 4NIYA 4ZHAA 1ANDA 2V6NA 1YPEH 3MH5A 2BYAX 3A8AA 3RXFA 1O2KA 1ETSH 1A46H 1O3JA 1NU7B 1C5VA 1HAVB 4E7RG 3D65E 1D3DB 1EAUA 1MKXH 3VB5A 2H6MA 4TWYA 3MH6A 3PO1B 2XWBI 5FPYA 2XC4A 3RU4E 1BRCE 1IQMA 1ABIH 1GI8B 2GT8A 2Z9JA 4BTIB 4IN1A 1O3MA 1NTPA 1P03A 5GJ4B 2JKHA 2ZPRA 4E7NA 2L6OA 1ZMLA 4DW2U 5A0AE 3KL6A 3O8RA 2Y5GA 1BUIA 1GBLA 1W12U 1L1GA
chains in the Genus database with same CATH topology
1C2JA 3RXOA 4CRFA 2C8ZB 1OP2A 3MO3A 2FOEA 1THSH 2V0BA 2PSYA 6CHAC 1EXFA 4AOQA 1TWXB 1T31A 1ZSLA 2PWXA 2TGPZ 1EZXC 2HPPH 2QXIA 5LGOA 1AKSB 1FAXA 2WPMS 1GMHF 1A0LA 1YBWA 3GY4A 1P9UA 1PYTC 1PPCE 1TQ7B 3S9BA 2XBWA 1F92A 4IN2A 3STIA 4U32A 3QUMP 9LPRA 1O5AB 1O2GH 1TMUH 4ZH8A 1DPOA 4X1RU 2P94A 1AY6H 2XBYA 3LGUA 2G4TA 4DGJA 4Q7XA 2XBXA 1LQDB 3A7TA 3SBKA 3IWMA 2SGDE 4CREA 1DDJA 1LVMA 2HNTF 3EGKH 3S9AA 1O3GA 2ZHFH 1UTLM 4ABJA 4AYYB 1KLIH 3R3GB 1DX5M 2WUBA 3SUFA 1SHYA 3S69A 5A2MH 2G4UA 2I6QA 1UVPA 3RXBA 2XBVA 3TGJE 5EOKA 1AZ8A 1ZSKA 2ZPQA 1AVGH 3A84A 3QK1A 5G4BA 3SUGA 3LDXH 3BTFE 1GGDB 3CP7A 2ZTZA 2V3OH 1ZRBA 3JZ1B 1O34A 1AUJA 2VWNA 1VJ9U 4WWYA 2JETB 3ZZ8A 3MFJA 2OC7A 1OYTH 5F8TA 3ZVBA 1O5CB 1EASA 1HB0B 1O2TA 1VGCC 1PFXC 2ZDNA 3GY3A 4ZROA 1DSTA 1S0RA 4DCDA 5DPAA 6LPRA 5JB8S 3V7TA 4O97A 3ZZAA 1HDTH 1Y3XA 4Y11E 1GMDG 1ZRKA 5B6OA 1ELEE 1OOKB 1NRPH 2A4QA 4ISLA 3E0PB 1SGIB 1SMFE 3SI3H 3RM0H 5I46H 4ZKRU 2ZFQH 4ISHH 1ZJDA 2F9VA 1L4ZA 1K9OE 1JIMA 1O3FA 4NSYA 1C1VH 3F1SB 2A1DB 1QURH 1PYTD 1TGNA 2A32A 4UFGH 1Y59T 1CGHA 1GI2A 1NPMA 1QCPA 4IMZA 4RKOB 1CT0E 4A1TA 1PJPA 3MMGA 2QF3A 4KP0A 2EC9H 2J92A 4K60A 4MNVA 2GDDA 1TRYA 1T32A 5EXLA 2VINA 1XUGA 1MMJN 2J38A 4OGYA 1FZZA 1QL7A 1O2RA 1FN6A 4VGCB 1ZZZA 1VCPA 1Z6JH 2CMYA 2PSXA 5EODA 4IMQA 1VITG 4WXIA 3RM2H 1YKTA 3RMMH 4BXWA 1P2OA 1WOFA 1K1IA 3S7KB 1C5LH 3GY6A 1GHAF 4CBOA 1CT4E 4YZUA 1OP0A 4WMFA 1FDPA 1SB1H 2A7CA 1OWKA 2B5TB 1GJ9B 2BQWB 3JZ2B 2Q6GA 1XM1A 4OS7A 1D3QB 3MO6A 1AFQB 1BDAA 1TNHA 2ODPA 1ELGA 5AVDA 4ISOA 3TH3H 1DUEA 1NU9A 3UOPA 5DK1A 4CRBA 2UWOA 1UTKA 2PR3A 4GCHF 4XFQA 1ZTJA 1DSUA 1S0QA 1BHXB 2ZZUH 2GV6A 1Z1JA 3LGIA 4AORA 5CMXH 1A3BH 5EPYA 3ZZ6A 2G8TA 3SUDA 1F7ZA 1EATA 1ZR0A 2AGGX 1CO7E 1ZOMA 3HATH 3TITA 6GCHF 2ZU4A 1O2IA 1ARCA 1PPHE 5ESTE 1DLKB 2ZTYA 4BAMB 4I32A 3VFEA 1BBRE 1AVXA 1GVZA 3RXMA 1ZHRA 2G81E 2ZIQH 4DG4A 5A0BA 1Q31A 3SGQE 2KAIB 2OCVB 5DG6A 1DFPA 1L2EA 1S6FA 3ZZ7A 5LH8A 3D62A 1HFDA 1AFEH 1MKWK 3NK8A 3P70B 1W8BH 1J14A 5HYOA 2NU3E 2HLCA 1WU1A 5GCHG 3RLWH 1D9IA 2IPHA 2FO9A 2PUXB 1KXEA 3EYDA 2GCTC 3M5NA 1H9HE 3FFGA 4INKA 5GIBA 4KELA 3ZZCA 3P8FA 1Z1IA 4FU8A 1VZQH 3EAJA 2ZCHP 1C5MD 4H6TA 2R3YA 2GCHG 3P17H 1JXPA 1W3CA 3TIUA 1VJAU 3SQHE 2FDAA 3GY8A 2R2MB 4IC5A 1AQ7A 4UFFH 1BA8B 1O3KA 4K1TA 2UWPA 1EP5A 2PTNA 4GSOA 2RG3A 1O5EH 3M7QA 3GISB 1BMMH 1ETTH 7GCHG 1QHRB 1K1PA 1T8LA 3TJVA 2ZHWH 3BIVH 4RN6A 1EUFA 1C2FA 1O3IA 2OC8A 4YOJA 1GVKB 1O2VA 1TONA 2SGQE 1TIOA 2WPIS 2PV9B 1HLTH 2TRMA 4OGXA 5AFYH 2W3IA 3SJIA 5HGGA 1C5YB 2BLVA 1C4V2 1HAYB 2R9PA 1O2HA 3M7TA 1V6DA 1MBQA 4CHAB 2WV4A 1C5TA 2Y81A 2BVSH 1Q3XA 2WYGA 1PQ8A 3NZIA 1LKBA 1V2QT 3V12A 1GBHA 1FAKH 1G32B 2RA3A 1PPGE 3SQEE 1A2CH 2D1JA 1O39A 1HAGE 1O3AA 1HV7A 4X2XA 3ZZ5A 1G9IE 1SOTA 1CSOE 2SGAA 1ELAA 2ILNA 3GDVA 5FCKA 1BTUA 4U2WA 5E0GA 1HJAB 1GCTB 1ZHPA 3S0NA 1P02A 5I25A 4IW4E 1AWFH 3MTYA 2BX4A 2G5NA 1QJ7B 3BN9A 3TVJB 4MDSA 1C1TA 1AN1E 3SORA 6ESTA 3GCTG 1Z71A 2FX6A 2ZQ1A 1LMWB 1P9SA 1SL3A 3QGNB 1NY22 1C5WB 2GGVB 3SV9A 5DGJA 1TB6H 3PV4A 1NRQH 1EOJA 5A8XA 4Y8YA 4DY7B 3L6PA 1YPHE 1ELDE 3FP6E 2BDBA 1K21H 1SGTA 5HM2A 1F0SA 2ZHQH 4XBDA 1J8AA 1HGTH 1MZAA 1UTMA 2FWWA 1UCYE 2XNIA 2ZQ2A 3GCNA 3NUMA 4Z0KA 1NN6A 1TE0A 3SU2A 2P3FH 1CT2E 1HPGA 2H5DA 3UQOA 1F0TA 1D4PB 4JCNA 4OS2A 4B73A 2D26C 1NRSH 3SU4A 3N7OA 1E38B 1UHBA 1K2I1 5C2ZA 2FM2A 3MNSA 2BY9X 1HIAB 3MU1A 6CHAB 2AERH 3VXEH 2RCEA 4IBLH 1C5PA 1MUEB 5E8EH 3S7HB 1YC0A 3PTNA 2OQUA 3M3VA 1ELFA 1OS8A 1V3XA 3I78A 3MO9A 3O8BA 3PLPA 3E1XB 1OWHA 1DITH 1Y3YA 4NSVA 1EJNA 1ID5H 1ACBE 3EA7A 4E06H 2J9NA 1V2OT 1GHVH 3I77A 3F9GA 4XBCA 3PLBA 2A5KA 1C2EA 1V2ST 2QGRA 3PWCA 4A92A 2CF9H 5FX6A 3T2NA 1N8OB 4X0WU 2ZGCA 4ABHA 3ZVCA 2PGQB 1KY9A 1QBOA 4FUFA 1GMHG 1ZHMA 3AVZA 5K0HA 1UJ1A 1TX8A 1MTVA 1KSNA 3Q3XA 5ETXA 1TBZH 2PLXA 1GMCF 1CU1A 2J4IA 4FUHA 1OWJA 1O2WA 3AASA 2K1QA 3U1IB 1ZPCA 1CHOF 1LPGB 1AI8H 1IQHA 1SQTA 2QA9E 3MNXA 3QZQA 2W7SA 3U8OH 5C67A 5GXPA 1HAVA 1MAXA 4B2CA 1W2KH 4WMDA 1EZSC 1BTHH 1DUAA 1MTUA 3ZVEA 1VR1H 4YO9A 4E05H 1H8DH 2XC5A 4X6NA 1AU8A 4FUCA 2V3HH 2BDAA 1XKBC 1GJ8B 2ZDAH 1S82A 1TMBH 1AE8H 2BY5X 2JH5D 4Q7ZA 2D8WA 1TRMA 3K6ZA 1BRUP 4AYVB 3RXSA 1VGCB 4WH8A 4XE4A 4Q7YA 2ZPSA 1XVMA 1A5HA 3M35A 5SGAE 3VGCC 2ALVA 2QN5T 3MYWA 5EXMA 5FPTA 5E0HA 1PPFE 1GJCB 2YOLA 1TBRH 5JB9S 2FYQA 3PB1E 3ZZ4A 5DJ7A 3VPKA 1G3DA 1AB9C 1JBUH 1RIWB 4Y7AA 2Y80A 5F03A 4Y8ZA 5BRRE 2O8WA 2ZNKH 3VB3A 1O3EA 1SGEE 4D76A 3U69H 1A0HB 1G3EA 3KQEA 3SU0A 1F0UA 2BLOA 4FUEA 5DKMA 2FI3E 2BY6X 2ZO3H 3T25A 1G3BA 1YM0A 3GCOA 3TJNA 1BMAA 2VIDA 1ZTKA 1XUHA 3V0XA 1S83A 1ANBA 2H9TH 3ZVFA 1C1NA 2AH4X 1DLEA 5GPIB 5DP7A 1GHYH 4ISIH 1RS0A 3STJA 1ELVA 1LVYA 4A1VA 1GBJA 5JBTA 4MTBA 4Y71A 1QJ1B 3QLPH 1AMHA 3B23B 2FOFA 2BY7X 4H4FA 4AFSA 3A8DA 1GBDA 4HZHA 1W14U 3SU5A 2OINA 3BG4B 4R0IA 4AG2A 4LK4A 1C5NH 5FPSA 1EPTA 1CHGA 1SG8B 1KXFA 1Q2WA 1SC8U 2UUYA 1PPBH 1TGSZ 5HXFA 2Z9IA 1GI7B 1Z7KA 1DICA 3AW0A 4BXSA 2FS8A 4NWLA 2ZDLA 1E36B 2PGBB 3M3TA 1NZQH 2H9HA 5TCCA 1FJSA 3IG6B 2BM2A 4WVPE 2CHAC 1SVPA 3KHVA 3Q77A 1GBMA 2XCFA 3M61U 1GJ6A 2RDLA 4J1YA 3O8CA 4I31A 1LPKB 1GHAG 2ZU1A 1TOCB 1O2OA 4ZKNU 2VIOA 1U6QA 2O8MA 1MAYA 3A86A 4UE7H 1TPSA 1QB9A 1P2JA 3RXHA 2CGAA 1YYY1 2VH6A 1P0SH 5ESBA 1SR5C 1YPMH 2GD4B 2NU4E 2Z7FE 4K8YA 1XXDA 4JMYA 4GCHG 4TPYA 1RJXB 1ELBA 5AF9H 2Y7ZA 2XWAA 3RMLH 1QJ6B 4JYUH 2BOHB 2HWLB 1OWDA 5A8ZA 2DE8A 2P93A 1O2LA 6GCHG 4DT7B 2WV5A 3MU0A 1C5QA 3TJUA 3GY5A 1O2UA 2OUAA 3F68H 4KTSA 2WYJA 1SGDE 1KIGH 3A83A 4X8UH 2G51A 2ZHDA 1C2KA 1P3EA 2WPKS 4X2YA 4MLFB 1O3DA 3TH2H 5E0JA 5L30H 1L4DA 3BEIB 4B71A 1SLWB 2VIWA 2XCNA 4B74A 1QL8A 2DE9A 1LDTT 4JZEH 1QIXB 1ZGVA 1C2LA 3RP2A 5JPMH 5HMAA 4D7GA 1TGBA 2D2DA 3LGTA 1W0YH 2W5EA 2H5CA 4MNYA 4UFDH 3SJOA 2TGAA 4XSKU 1LKAA 1W13U 3T29A 4TWWA 1E0FD 1THRH 3URDA 1GL1A 3OY5U 1TNGA 5FCRA 2PW8H 2BHGA 1TX6A 4X1SU 5E2PA 4Y79A 4WH6A 5EGMA 3U98H 1BRBE 3DFJA 5FBEA 4BAHB 4NIXA 5EXNA 1YLCA 2G5VA 1J9CH 1DVAH 1DWDH 4CH2B 3UIRA 5DP6A 3DA9B 1TABE 1Y5AT 5FXLA 5GWZA 2W3KA 2ZEBA 2FOHA 2ZU2A 1CBWC 1V2KT 1SOZA 1C9TA 2JH0D 3U8RH 1A3EH 3W95A 2ZF0H 2O8LA 3UWIA 8GCHF 2OBOA 3DT0H 3C27B 3CS7A 4LXBH 3HGPA 2ZFSA 1RTFB 3SU1A 2OC0A 4ZXXH 2KAIA 1ANCA 3V3MA 1W11U 1O3BA 1IQLA 2BD2A 3I29A 2PKAB 1O3PB 1LCYA 5EQRA 2TPIZ 1MTNC 2CJIA 1OWIA 2FXRA 3EDXB 2Y7XA 4MPWA 2J94A 3UQVA 1V2MT 1O31A 4JZIA 5E2OA 1UTQA 4NA8A 4HFPB 2F83A 2DUCA 2BDIA 5EQSA 4K3JA 5L2ZH 1A4WH 1O2QA 2A45B 1O3LA 2EI6A 1DM4B 2THFB 4NWKA 1P57B 2TGDA 1SGFG 1GI0A 1MU8B 2BD7A 1KXCA 1EAXA 4MNWA 5L2YH 3RLYH 4UONA 2BDHA 2G55A 2P8OB 3LGYA 1TA6A 4O9VA 1RFNA 3RXAA 2FS9A 3F9HA 4XDEA 2ODQA 4J2YB 2HVXA 1QA7A 3RXUA 1QGFA 1KXBA 1C4Y2 1LVOA 2Y5FA 1YCPK 3FAOA 4AZ2B 3K2UA 1CA0B 1QY6A 3RC5A 3LOXA 3B9FH 1TAWA 1IQNA 3AAVA 4A5TS 1UVSH 3PO1C 2O8UA 2QYIA 1IOEA 2G52A 1YLDA 3PM3A 2C93B 3MOCA 3RC6A 3T5FH 4X8SH 1ZPBA 1BZXE 1C1OA 4FXGH 1NESE 1JMOH 3T27A 1A7SA 1TA2A 2BX3A 3IITA 3FANA 1AHTH 1A61H 1XKAC 3PMAB 3TK9A 4Y6DA 2AEIH 2Z9KA 3BSQA 4M7GA 3UOUA 1TBQH 3ZZ3A 1NO9H 2ZI2H 2FTLE 2WPHS 3HGNA 1IQEA 1TPPA 5LPEA 1ZSJA 4K69A 3Q3YA 1WBGB 3TGIE 3CENA 2ZDVH 2ANWA 3BEUA 4YTAA 2GV7A 3GCHC 1BIOA 1NFUA 1SFQB 1L1NA 3OX7U 4OS5A 4HGCA 4RKJB 4CRGA 2VH0A 1GJDB 1BTYA 1ESBA 2ALPA 8KME2 4GAWA 4CRCA 1WYKA 1TPOA 2GVFA 3ZZDA 4ISNA 1ZLRA 2W7UA 4AGJA 3E90B 2H1UA 1F5LA 1Y3WA 1J16A 1NM6A 2BD4A 1O3NA 2Q6DA 2QF0A 4TYDA 2ZDMA 2CN0H 1IQJA 1C2HA 3P6ZB 2FEQH 2ZCLP 1OX1A 1TNJA 1EAIA 7KMEH 3VB4A 7ESTE 1FY4A 3FZZA 4KKDA 1GMCG 1YCPH 3HPTB 4YESB 1FXYA 2VIPA 1N1LA 2BD5A 2HPQH 1INCA 1CHOG 1FPHH 1GWAA 1P06A 1QR3E 4NGAH 1NC6A 2ULLA 4PROA 5F8ZA 1MD7A 2HGTH 1A1RA 1T8OA 3ENSB 2UUFB 4BOHA 3KGPA 4JZDH 1WQSA 1O38A 1ZJKA 1DS2E 1QQUA 2C8YB 4ABFA 1HAIH 1HIAA 2A2XH 3RXQA 4NA7A 2BZAA 2ZC9H 2BDYA 3BTME 2BY8X 2OXSA 1EPTC 1SGNE 4X6OA 4DJZB 5LPFA 4ZKSU 2TIOA 1FY1A 1GGDC 3QZRA 2AMDA 4XOJA 5CHAB 2A4RA 3O8DA 1GDUA 3F9FA 3RMNH 3U1JB 1H4WA 3R0FA 1HNEE 1SSXA 3K9XB 3ZV9A 2GX4A 2P3TB 2JETC 4RSPA 1FNIA 1KXAA 1GI6A 2Q1JA 3GY2A 4Q2KA 4H42U 1TNKA 1HBTH 3NXPA 1IQIA 1GHWH 1SI5H 1SGYE 1PQ7A 3KIDU 1YF4A 1V2JT 1O5BB 1GBFA 1FIWA