2EQNA

Solution structure of the naf1 domain of hypothetical protein bc008207 [homo sapiens]
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
103
structure length
103
Chain Sequence
GSSGSSGELPSVEELTIILPEDIELKPLGMVSSIIEQLVIIESMTNLPPVNEETVIFKSDRQAAGKIFEIFGPVAHPFYVLRFNSSDHIESKGIKIKETMYFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Hypothetical protein LOC92345
publication title Solution structure of the NAF1 domain of Hypothetical protein BC008207 [Homo sapiens]
rcsb
source organism Homo sapiens
total genus 11
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.230 Mainly Beta Beta Barrel Thrombin, subunit H Probable tRNA pseudouridine synthase domain 2eqnA01
2V3MA 3UAIC 3MQKC 2EQNA 2EY4C 3U28C 2RFKC 2HVYB
chains in the Genus database with same CATH superfamily
4FU9A 3FP7E 4WF8A 2A7HA 2IJOB 5E0JA 3HK6B 2IPHA 3TK6A 5EXMA 2O8WA 1WAYB 3VB6A 2RFKC 1YKTA 3KL6A 1HB0B 1GJ7B 2F9OA 2XC5A 1OYQA 1KMHB 1O5EH 1LVBA 1BBRE 3BSQA 4O97A 5C5NA 1LCYA 2FMJA 2PKAB 3T26A 5T1VA 2L6OA 3T29A 1P2NA 1E1RD 1A5IA 4B2BA 4YTAA 2FI5E 1F0SA 1TPOA 3Q76A 1BMAA 1G3CA 1O2YA 2FLBH 4O9VA 4AORA 5FPTA 4HG6A 4CRCA 3E0NB 1ZJKA 4YOJA 1SR5C 3KCGH 4CR9A 4LZ1H 3TH3H 3EE7A 1HLTH 4RI0A 3T62A 2ZHQH 4X2YA 2CJIA 1ZRKA 4WMEA 1HIAB 3TK5A 2ZHDA 4WMFA 1O2LA 1EP6A 4JMYA 2C8XB 2ZTXA 3KF2A 3N7DA 3UREA 5KGOA 4B76A 3MQKC 3TK9A 2I6SA 2WPHS 2J95A 2F3CE 1DFPA 4ZMAH 2CHAB 2VBCA 1ABJH 1QURH 1EXFA 3RXAA 1ELVA 1GJBB 1O3PB 3CP7A 2O8LA 3RDZA 2FOBA 4DW2U 5LPFA 4ABIA 1K2I1 2GDDA 2F91A 2QXGA 3LH1A 1GHWH 1OWJA 3OE7D 2XW9A 5JBBS 5KECA 1YY3A 3P70B 4CRFA 1TBRH 2H6MA 3LGIA 1RIWB 5DP7A 4FUIA 3IG6B 2VIPA 3BTEE 1OXGA 1CA8B 4ABEA 3KQDA 1TQ7B 1UTQA 2ZQ2A 1IHSH 2ZDNA 2VU8E 4JYUH 4JYTA 2ZF0H 5GCHG 2UUYA 3PLPA 1V2MT 2QF4A 5EXNA 1C1OA 1C1UH 2GZ9A 3ZVAA 2QXHA 4KTSA 3MO9A 1J8AA 1Y3WA 1W2KH 4DVAU 3ATKA 3KQEA 2WYGA 5DG6A 2F9NA 1O5FH 2G5NA 1O34A 1QRWA 2V3OH 2ZEBA 1HYLA 2BXUH 3MU0A 1S0QA 1SQTA 1YPLH 1NPMA 4X1QU 3SI4H 4CR5A 3ZVDA 1Y5BT 1C5NH 1UK3A 1NRRH 2AYWA 1O5AB 2FYRA 2SGEE 2ZDLA 1SVPA 2Q6GA 4A1XA 4AFZA 2VIVA 3CS0A 1NC6A 2FP7B 3M7UA 2ASUB 1O2ZA 3WWFA 3T27A 2VJ1A 2EEKA 3RU4D 2ZFFH 3UR6A 3GY2A 4MVNA 2UUFB 2JH0D 3PLBA 4FOUC 3TVJB 3LOXA 4D8NA 1IAUA 1S6LA 1W0KD 3GICB 1FN6A 1QR3E 3QDZB 5DJ7A 1XUIA 2VWLA 1BUIA 5T6DA 3NKKA 2LELA 5EXLA 1UTJA 1OP0A 1T32A 1GBIA 1O3GA 2B8OH 2P16A 1HCGA 1O3HA 3EGKH 5C67A 3KIDU 3UOUA 3MI4A 1MTSA 1QL8A 1W12U 2OINA 3GCHB 2OC7A 4INHA 1WYKA 3ZZ6A 4B6FA 2EY4C 3DUXH 4ABGA 4KTUA 1A61H 2A7CA 1XKBC 2KCPA 1CHOF 2V6NA 2GKVE 3L3TA 3PMHB 4DT7B 1KXDA 1SGRE 1OWIA 5FX5A 3PV2A 5JBAS 2VGCC 3RU4T 1O32A 1N6YA 1VITH 1WTGH 4BAOB 2FOGA 2BOKA 4AC9A 4ZHMU 1GL1A 1EZSC 4NSVA 4X8UH 3MNCA 2FPZA 1S0RA 1DVAH 8LPRA 2ZPQA 4Y76A 2W26A 1D6RA 2WZQA 3UQOA 4CH8B 3A87A 4FUHA 1GBCA 1ESAA 3FP8E 3WWBA 1VITG 5C0UA 2CV3A 4NIYA 3MFJA 5FPYA 5JBTA 1ANBA 1BMLA 3Q3KA 3DSPA 1AMHA 1CBWC 2WUCA 2ZU2A 3UB0A 1PPCE 1HXFH 1GBFA 4D9RA 1L2EA 1GBMA 1GBTA 1C5SA 2TGTA 1GBJA 2RDEA 3VB5A 3PWCA 1S6FA 3BN9A 2ZFQH 3B23B 4ISOA 2TRMA 2PKAA 1V2PT 1A3BH 3PO1B 4ZKSU 1AIXH 1GWAA 3LT3A 1VCPA 1YWUA 1G3EA 1DWBH 2WPMS 2W7UA 3QUMP 1K1NA 4WVPE 1P8VC 4E05H 1G32B 5F6MA 3HK3B 1UW7A 3SV7A 1CGIE 1G2LA 2G51A 2OQUA 3FVFB 2VVUA 4ZXYH 1NRNH 5JPMH 1XUHA 3PTBA 1W0YH 1MTNB 1MMJN 4DIHH 1TRYA 4FUCA 1Z1JA 1O2QA 3SU6A 6ESTA 3NPSA 4NFFA 1O2RA 5FHTA 1GHAG 1CBWB 1TMBH 2ZCKP 4ESTE 1UK2A 1HIAA 1J15A 4JK6A 3A7ZA 1C5LH 1DLKB 2BY8X 1P06A 1W3CA 5FXLA 3ZZ4A 5B6OA 7KMEH 1SGFA 4NG9H 3E91A 1BOQA 4DIIH 2CN0H 2ZGBH 3E8LA 3TH2H 3S7KB 1HAXB 1FY8E 1F0RA 3EAJA 1CGJE 2H2ZA 1THPB 1LPZB 3K65B 4K1EA 1O30A 5AHGH 1ESTA 3AW0A 2DE9A 5A8YA 9LPRA 2PW8H 1FJSA 4INKA 1GMHF 1XM1A 2UWOA 1NFWA 3ESTA 4FXGH 2G81E 2BY6X 1O2KA 3VGCB 5F03A 4F4OC 1IQIA 3SBKA 1OHHD 1C1WH 3A7TA 1CQQA 2ULLA 1F5RA 1SKYE 2WHXA 5DSFA 5SGAE 3FANA 1COWD 4BXSA 1O0DH 4NZLA 1UK4A 1KTSB 5JBCS 3MU5A 2XC0A 4PROA 2FI3E 3AAVA 1O3IA 2H5DA 2LPRA 2L74A 3I29A 3OYPA 4IBLH 3SU4A 1HAYB 4JK5A 2GZ7A 1TONA 1NZQH 1Z8JB 5C1XA 4I7YH 2ZFRH 2WV5A 1TGSZ 4X8VH 1LHDH 3I78A 1WUNH 4Q7XA 2OC8A 1SGFG 1MBQA 2XCNA 3FOAA 3PV5A 2BDYA 2BYAX 3A80A 5FBEA 3U8OH 1MTWA 1G3DA 1P04A 1QB9A 3OX7U 2R2MB 2ODQA 1H8HD 4TWWA 5F53A 2OBOA 1P02A 3SN8A 1LQDB 1C1SA 1BMMH 1GVLA 1LHEH 2WUBA 3KN2A 2ZWLH 2OQ5A 3GY6A 4FUBA 2P3TB 3BF6H 1AWHB 5ESBA 2J98B 1C1TA 1U6QA 1PYTD 2VIWA 3FFGA 1FONA 3U28C 2ALVA 1QFKH 2ZA5A 1DM4B 3MH7A 1ANEA 5EW2H 3OSYA 4WXVA 2RDLA 2AHME 4BTTB 1O2VA 1BA8B 1O2HA 4UDWH 2KR7A 3AW1A 2ZDKA 4MPWA 2XNDD 4ZAEA 1GHBF 3SUFA 3UY9A 3F68H 1E38B 3SV6A 2JJ1D 1UJ1A 2C4FH 3V12A 3ZIAD 3SNBA 4DOQA 3TNTA 5EJ1A 3QTOH 3P8GA 4D7GA 2ZP0H 5ESTE 2QXJA 1A3EH 3RXUA 1BRAA 1DS2E 4E7RG 2C8WB 4UFGH 1CSOE 1TOMH 3VXFH 3FO8D 2FIRH 8GCHF 4GUXA 1TB6H 2GJGA 1DWEH 4WY3A 1DITH 2V35A 4XOJA 2AIQA 4YOGA 1LHGH 3TJUA 2B5TB 5HYOA 1JMOH 1HJAB 1OWEA 1HBTH 3HKJB 1WTHD 2BDBA 4K8YA 3SJ8A 1EFRD 1DUAA 1AE5A 2XBVA 2QYIA 2P3UB 1XX9A 3MHWU 1GI4A 5EQQA 4RN6A 1GBHA 3RXBA 2BY9X 4IC6A 2OUAA 2V3MA 2QC2A 1A1RA 1ELBA 3STJA 3F3BA 1V2QT 4Y0YE 2D8WA 3I77A 3UWJH 5E8EH 2AERH 1IQGA 1TLDA 1W0ZU 4Y11E 1RTKA 4ASHA 1LVMA 1TNHA 2C3SA 1LPKB 1EP5A 3SNAA 1OPHB 3A7XA 3H7OA 5DGJA 1NBMD 2UWPA 3DD2H 8ESTE 1QHRB 2A4GA 1VZQH 3KEEA 1C1QA 2FX6A 1DUEA 1BITA 2BQ6B 3QGNB 1XUJA 1AO5A 2EI6A 4K1TA 1THSH 1BJUA 3OAAD 1EX3A 4KGAA 3SJ9A 1ZYOA 1O3KA 1LTOA 1SOZA 2ZHEH 1XUFA 3SNDA 3PV4A 4CREA 3OFND 1NS3A 4GLYA 3TIUA 2W6ID 2GVFA 1FDPA 3TGJE 3TLOA 2Q6FA 2F83A 1S81A 1Z6JH 2QF5A 1D6WA 3F6UH 1AB9C 4GCHG 1LQEA 1PPFE 3SUEA 3A83A 1W13U 3VB7A 4YO9A 3LGVA 5DP4A 1LKBA 1TWXB 3LIWA 1ANDA 4I8HA 1T31A 3BEUA 1KDQB 2OC0A 1FAKH 4CRGA 3UQVA 1JBUH 2ZC9H 1MBMA 1DWCH 5L30H 5LGOA 2A0QB 2GMTB 1Z8IB 1EAXA 3RMNH 1UCYH 3O8DA 1O3EA 4TT3D 3RXVA 1ZOMA 1W8BH 2OCVB 1JIRA 4HZHA 4Y0ZE 4GSOA 1ZSKA 2LNCA 4JCNA 1E34B 1VCQA 2KZ4A 1Y3YA 2A5KA 5CDFE 1FQ3A 4BAMB 3S0NA 2VIQA 1KY9A 7GCHF 1ID5H 1CHGA 1AB9B 1SLUB 3SGQE 2Y81A 4YESB 1V2VT 2K8IA 5DKMA 3STIA 3W1EA 1C4U2 4K5ZA 1C2IA 1HXEH 4JZFH 1CE5A 2A5AA 1KXCA 2GCHG 2P59A 4NA7A 2FESH 4K1SA 4BTUB 5AVDA 1YF4A 1Z6EA 3P6ZB 3GCOA 2ZI2H 4AFQA 3ZVFA 3URDA 4D7FA 1BQYA 3D49H 3SQHE 3HKIB 4LXBH 7ESTE 4XDEA 2P3FH 1NROH 1EOJA 3RXOA 3VFEA 2CF9H 3S69A 3URCA 4GPGA 2J98A 4AX9H 2GP9B 2HGTH 3RXRA 4CHAC 4ZKOU 1WXRA 2A2QH 2A1DB 2WINI 5GCHF 4NIXA 4FUJA 1V2WT 1SFQB 5T3HA 4U2WA 1PQ7A 4ISLA 4TYDA 5J4QA 3C27B 1KLJH 1GJDB 1SOTA 1C2EA 1PYTC 2BVRH 2F9VA 3EDXB 4Q7YA 1L1JA 2F43B 1TGCA 2FOMB 3F9GA 5L6NH 3GY5A 2TPIZ 1EUFA 2KCYA 3GDSA 1HNEE 4J2YB 1VJAU 3RXHA 2TIOA 3F2FA 1Y3VA 1LVYA 3RP2A 1KXAA 1FY5A 1O2NA 4IMQA 2KAIB 2XCFA 1YPHC 2CHAC 3D65E 4X6MA 2HALA 1QY6A 2J5UA 4KTCA 4OS6A 1NRQH 4ACBA 4CHAB 1ZPZA 3F0OA 1GHVH 1Z8GA 3LDXH 3K9XB 3U8RH 1QB1A 3NCLA 3DSGA 2FX4A 3T25A 1QL9A 3KQCA 4MG3A 1O3AA 1RIWC 1V2OT 3FKSD 2FOAA 3B8JA 3QWCH 2WV9A 5TCAA 1GBDA 1MKWH 1O2IA 1OS8A 2GV6A 2XYAA 1H8ED 5A09A 1QIXB 1B0FA 3RXIA 1MCTA 1AUJA 2Z7FE 1HAGE 3GYLB 5ABWA 1QL7A 1GPZA 1SGIB 1YGCH 3SV9A 1UTMA 4AGKA 1YCPK 4MLFB 1UVUH 4MPXA 5EJZA 2RCEA 1G3BA 1WOFA 3UFAA 3NUMA 1HAHH 1SGQE 1BT7A 1AI8H 4NIWA 3JZ2B 4TSFD 1D9IA 1J9CH 2F9PA 5JB8S 1MU6B 2G52A 4Y8YA 4WH8A 5DP3A 3ZV8A 3M5OA 2Z94A 3N99A 1HV7A 1TOCB 2DUCA 2PKSB 1VITF 1FY4A 5HGGA 3BTTE 5EU8A 2ZFPH 3RMMH 1O3DA 1CT2E 1P9SA 1DSTA 3MH5A 1NFUA 1SB1H 3VG8A 2AIPA 4YLQH 1C9PA 1O3OA 1GBKA 1VKYA 4OS7A 4X1PU 3K6ZA 1A0JA 3QO6A 2Z6BD 3A7VA 3BEFB 1PQAA 4JZIA 4WMDA 5HKKD 2FXRA 3TNSA 3M5MA 2CXVA 4ISHH 5DP5A 1GVZA 3M3SA 3A89A 1TAWA 3A82A 3GYMA 4B1TA 2H9TH 3EA7A 3GCTG 1GI7B 4DY7B 1ELCA 1RTLA 1H4WA 3GCHC 1O2GH 2CK3D 3SI3H 1O3JA 4U01A 4A1TA 3ODFA 1D4PB 4IN2A 4MNYA 1MZDA 3W95A 1O3FA 1AU8A 2ZHFH 5EOKA 1OX1A 1KDQA 2XNIA 2ZECA 3H7TA 2BM2A 2IPQX 5ETXA 1MUEB 2THFB 4B73A 4OS4A 2A4RA 4BOHA 1HGTH 1ZPCA 1MKXH 3QLPH 2QAAA 1Z8RA 4ASUD 3A84A 4X2XA 4UFFH 1EJAA 4IN1A 1ZHRA 5IYTA 3S9CA 1XUKA 1MTUA 1E79D 1MAYA 1C5YB 3QK1A 3M5LA 2TGPZ 1BBRK 1GI5A 2C93B 4X8SH 2BLQA 1Y59T 2ZNKH 3F2GA 2OP9A 5C1YA 4ZUHA 2VIDA 3RXGA 2VWNA 1FZZA 5DP9A 3BTWE 2BX4A 2G55A 2Z3DA 1MD7A 2O8MA 3AVZA 4DJZB 1GG6B 4UFEH 1KYNA 2SNVA 1UTLM 1FY1A 1TRNA 1SGEE 2VH6A 3V3MA 1SQRA 3L33A 3M61U 5C94A 1MQ6A 1IOEA 1XVOA 1C2JA 1GI2A 3UNSA 3LGUA 2FOCA 2QN5T 2BDGA 3QX5H 3PO1C 3D23A 2RA0A 1ZR0A 4AZ2B 4I8LA 1IQEA 2KCAA 3U1IB 2SNWA 1ETTH 4JZDH 5HM2A 3FZDA 3TPIZ 2BB4A 1P03A 2WSSD 5FX6A 1DPOA 1GL0E 3PB1E 2XBYA 4OS1A 1MTNC 3M7QA 2XBXA 4IC5A 1GMDG 1S5SA 2HNTC 4Y7BA 1O38A 4TWYA 1C4V2 4B6EA 3ZYEA 3GDVA 4HFPB 3RM0H 3DFJA 5LH8A 1WDIA 5GIBA 1BDAA 1P2KA 3ZZ3A 1L1GA 5FL7D 2KAIA 3NK8A 2ZCLP 1TE0A 3KYGA 1AFEH 2GCTC 3T5FH 1ZJDA 1V2RT 3H09A 2J2UA 1EOLA 1FY3A 2BDHA 2LP6A 3R0FA 1D3QB 2GDEH 2HLCA 2BLOA 1W11U 4OGYA 4MNVA 4SGAE 2UUKB 1K1MA 1QJ7B 3IWMA 3RC5A 3UAIC 5CE1A 1TNJA 2KCOA 3VGCC 1CT4E 1AVWA 5FBIA 4ISIH 1SGPE 5JYIA 1MTVA 3PMBB 2KM0A 4WJG2 3A86A 1C2KA 1C2LA 1BHXB 1Y5UT 1HAPH 1BB0B 4I8JA 3RC4A 5HM9A 2W3IA 1UHBB 1E35B 4ZHAA 4FUDA 1PQ8A 1OP2A 1SHHB 2PWXA 3PROA 1OKXA 2OBQA 1SFIA 2GT8A 1KLIH 4UEHH 5K0HA 4Q7ZA 1C5WB 1F0TA 4THNH 1GI8B 1P2MA 3A8BA 2OD3B 1V2TT 3GS9A 1Y3UA 2R0KA 4X0WU 1N8OB 3KNXA 2GCTB 3RLYH 4BTIB 4Y10E 3R3GB 1TGTA 3P8NA 4MPUA 4GAWA 3TH4H 1P2OA 5GDSH 3TITA 4K3JA 1MCVA 2J9NA 2PSYA 2GZ8A 5FCRA 4GVUA 1YLDA 2BX3A 2SGDE 3ZVGA 2A4QA 2ZQ1A 2B7DH 2R9PA 3U9AH 3OTPA 2P8OB 1V2JT 3SU1A 1BTYA 1GJCB 1LPGB 2P93A 3VB3A 5F8XA 1S84A 2ANMH 5A0CA 2TGAA 3LGYA 5C2ZA 3MO6A 1CHOG 5HMAA 4DT4A 4FUGA 3RXTA 1YYY1 1BTXA 2VH0A 1O2TA 1KXEA 2Y80A 1SGDE 2W6JD 4DURA 1TNKA 3EQ0H 2GD4B 1F2SE 3A8DA 2WYJA 3RXKA 2BTCE 4GHTA 3QZQA 2NU4E 1C5UA 5F8ZA 1HJ9A 1K9OE 3MH6A 2HPQH 2VVVA 2Z3CA 1C2HA 1O36A 4H6TA 1S82A 2QGRA 2HVXA 1G30B 1AKSB 4E7NA 1SGTA 2EQNA 2BY7X 4UONA 1HJAC 3RXEA 1TMUH 1ZTKA 4UD9H 4ZCNA 1NT1A 2XWBI 1FIWA 4GCHF 4FUFA 4X2VA 1AN1E 3HGNA 1C5MD 1O3LA 4I86A 1FLEE 5C0TA 1O2UA 2G8TA 2PHBA 1UVSH 3BTGE 4CRBA 3SORA 1P01A 1BTWA 1H9HE 1NM6A 2TGDA 1J14A 2JIZD 4AG2A 4MPVA 4Y79A 2ZPRA 3MU1A 1UTNA 2ANKH 1AE8H 2D2DA 1UVPA 3O8RA 2Z9GA 5FAHA 2QXIA 2FDAA 1SQAA 4O3UA 4TPIZ 2PFEA 4FVBA 1XXDA 1SL3A 1UTPA 1XXFA 1DT2A 1PPGE 1ZZZA 2ZZUH 4O3TA 3D62A 4CBNA 2BLVA 1WSSH 3PRDA 4XBDA 1K0HA 2BD8A 3ELAH 4ABDA 1GGDC 6LPRA 1QJ6B 1AZZA 2HNTF 4SGBE 2R3YA 2Q6DA 1ZHPA 2SFAA 5CHAC 1YPMH 1GBAA 4VGCC 5EQSA 3LPRA 3BTQE 3M35A 3SV2H 1SC8U 2XRCA 3ZVBA 1KXFA 4BANB 2OC1A 3ZZBA 1EAWA 1C1PA 1YLCA 3TJOA 4I32A 1MZAA 2SGFE 2GCHF 2CMYA 1BMNH 1BRBE 1JXPA 3OY6U 3MNXA 2KFWA 2A45B 1MH0A 2C8YB 2J34A 4Y8XA 1BJVA 4YM9A 1FI8A 4NGAH 1TBQH 3MO3A 1CGHA 4IS5A 4Z6AH 3MU4A 4RKJB 1F5KU 1ZRBA 1ZSLA 4FU7A 1ETSH 1W7GH 4UE7H 4ZXXH 1YLNA 2NU3E 1NRSH 1GGDB 1GI9B 2VB0A 3GY7A 1IQNA 3DCLA 4X1SU 2AFQB 5CHAB 4ABBA 1C1NA 1HAVB 4VGCB 1K28D 1TYNA 1A2CH 1V2UT 3LONA 2GTBA 3DFLA 2A2XH 1GCDA 2QCYA 3BTME 2Y82A 3SJIA 3OEHD 3LKWA 2FOEA 1GI6A 1TMTH 1C5RA 1INCA 2ZKSA 4LK4A 5A8ZA 2NU2E 1G37A 2ODPA 1NRPH 3MYWA 1TGNA 4JYVH 1EASA 2V3HH 2BQ7B 2GMTC 2M2AA 2Y7XA 4H6SB 5EPNA 1G36A 3WW7A 1ZGIA 1XMNB 2GT7A 3BTHE 1FUJA 3SHCH 2VVCA 2ZU5A 2SGAA 3OU0A 4NFEA 4BAKB 3S7HB 2EA3A 4I31A 4ZROA 1UHBA 3LC5A 3RXLA 4NWLA 3A7WA 4AOQA 3OEED 1A7SA 3BG4B 1TRMA 1AZ8A 5CHBA 3VB4A 2J4IA 3SU5A 2ZTZA 3BIVH 2NU1E 1CO7E 4X6OA 1AQ7A 3NXPA 1C5TA 1ELAA 2V0BA 1EAIA 1JWTA 1WV7H 2BLWA 2JJ2D 1Z7KA 3S9AA 1TX6A 3U8TH 3F2HA 1GJ9B 2FEQH 1YPJH 1V3XA 3LJJA 1AGJA 2ANWA 5I25A 1IQLA 3LH3A 3H5CB 1HRTH 1ZLRA 4B71A 1Y5AT 1DANH 2F9UA 5A2MH 2C8ZB 3GOVB 1KXBA 1Q31A 4WXIA 2DE8A 1XUGA 5T6FA 1GMCG 1O31A 3SV8A 1J17T 3RU4E 3SZEA 1O3BA 4NSYA 3VEQB 1P2QA 1ZPBA 1FN8A 5EPYA 1GDQA 4X8TH 1ZTLA 1L0ZA 4TY6A 2F9BH 2GGVB 1RXPA 1DY8A 1C2FA 1P9UA 1FAXA 1O2MA 1AD8H 2BD2A 6GCHG 4YXWD 1ZSJA 1GCTC 4ABHA 3AAUA 3KGPA 3N7EA 1MD8A 1ETRH 4GHQA 1O3CA 3RXJA 1PPZA 1TNGA 1O3NA 1TBZH 3RC6A 4AYYB 2FM2A 3EYDA 1DICA 2ZGJA 3W94A 3AASA 1KLTA 9ESTA 4AFSA 3ZZAA 1K1PA 5KEDA 1NU7B 3RUOA 2K0QA 4HI3A 2ZPSA 4NWKA 1HFDA 1RRKA 1FNIA 2WPKS 2BD9A 2FS8A 1AKSA 4YT7H 4KP0A 4ABAA 1T8LA 1TALA 2ZTYA 3RLWH 4F48B 1TQ0B 1RJXB 5DO4H 1V2KT 5I46H 4K8BA 3GCTF 3RXQA 1MABB 1FIZA 3MNSA 1Z71A 3SU0A 1GCTB 1S83A 4UFDH 1GBLA 1ELEE 1ELGA 2ZHWH 3RXMA 5DN6D 1AUTC 3WY8A 5IK2D 2Z9LA 2ANYA 2W5EA 4E06H 1GHXH 1NTPA 3ENSB 1QCPA 2G5VA 3F9HA 1JRSA 4X6PA 1RGQA 4H4FA 1F0UA 1O2SA 2V7QD 3TJNA 1O5CB 3UWIA 3E1XB 4A1VA 1GVKB 2BVXH 5C3NA 5GXPA 2ZFSA 4AN7A 2FWWA 3KQBA 3SYJA 4Q63A 1SLXB 1UVOA 4FVDA 2PKSC 3UNQA 2KX4A 1H8DH 5L2YH 1ARCA 1LVOA 3ZZ8A 1A0LA 5E2OA 4ABJA 3SNEA 3KYFA 1EZQA 1MKWK 2Z3EA 4ZHLU 1QA7A 1V2NT 4AFUA 1SHYA 2PR3A 1YPKH 2BMGB 1W7XH 1ORFA 5HIYA 5EQRA 4CBOA 1LHCH 1W14U 4IGDA 3RXDA 3QTVH 3MMGA 4FETA 4AYVB 2J94A 3RXPA 5PTPA 1YBWA 1PQ5A 1QA0A 1ZGVA 4DG4A 1K1IA 3U1JB 3BTDE 3RXCA 4RT1A 1NU9A 2BZ6H 3DT0H 5LPRA 3BTKE 5DPAA 3SZNA 1OWDA 4CRDA 1C1RA 1HAVA 5EW1H 3RMLH 1W10U 4CRAA 1AY6H 2J97A 2Y5GA 1MU8B 3GY8A 2WPDD 5E0HA 1C9TA 3JZ1B 1HJ8A 1GMDF 1YCPH 1DY9A 4MNXA 2M5TA 3K6YA 2UUJB 3P8OA 4MDSA 7GCHG 1DWDH 1GJ5H 1BMFD 4A5TS 5H4IB 4ZH8A 2OXSA 1HDTH 1K21H 3F1SB 3PM3A 1GDUA 2HRVA 4Y6DA 4Z1MD 1TIOA 1PJPA 2G4UA 1FPHH 1SGCA 1HAOH 2NU0E 1PPHE 1VR1H 1P57B 4DGJA 4HGCA 3FN8A 5E0GA 1GI3A 1B0EA 2K1QA 2ODYB 3MWIU 4NZQA 1P11E 2WPIS 2PP6A 5C1UA 4BXWA 1O39A 1FMGA 4F49A 4ACAA 1GJAB 3UPEA 1A0HB 3MNBA 1NESE 1IQFA 2H9EH 2ILNA 2RA3A 2Y5HA 2ZGHA 2R2WU 3ATLA 4IMZA 3K2UA 3CENA 2BVSH 3Q00A 1GG6C 4A7IB 5LPEA 1EQ9A 1MQ5A 2BHGA 1M9UA 1FXYA 3PMJA 1DLEA 1UO6A 3T28A 2AH4X 1BCUH 7LPRA 1GHAF 3O8CA 5AFYH 1H9IE 4Y7AA 1MKXK 1C5PA 1DDJA 1BTUA 3P8FA 1LO6A 1KIGH 1SBWA 2O8TA 3M5NA 3A8AA 1OYTH 2ZDAH 1P10A 4Y8ZA 1P0SH 1T4UH 1EB2A 3SU2A 5EIYA 1DOJA 1IQJA 2AGEX 2XWAA 3V13A 4YZUA 4I33A 2HLDD 1JOUB 3IITA 1ELDE 3ODDA 4XFQA 3NWUA 5A0AE 1YPHE 1LKAA 1O2OA 4B75A 5GNDA 2AS9A 4Q4LA 4AB9A 2SGPE 4JZ1A 1UVTH 1IHTH 2YNBA 1WU1A 3DA9B 5CMXH 3BEIB 2ZDVH 3QN7A 3ZVCA 3ITIA 2J92A 2FS9A 1BBRH 2GX4A 1VCWA 1F92A 4O03A 2IOTA 2Z9JA 5BRRE 2JH6D 1BTZA 1D3DB 2Z9KA 2CF8H 2FLRH 3BG8A 4NCYA 3SGAE 2YMSD 1BZXE 1ELFA 2JETC 1SPJA 5JB9S 3MH4A 3FP6E 1H9LB 2XTTB 1AHTH 2C90B 4HTCH 1HUTH 3TJVA 3GISB 4JZEH 3CS7A 3MOCA 4KELA 2FYQA 5TJXA 1NY22 3UR9A 1QNJA 1TPSA 1WBGB 1O2JA 3EA8A 2QF0A 1QBVH 1RS0A 4OS5A 3L6PA 2Y6TA 5B6LA 1UMAH 4X2WA 1V2LT 1C5ZB 1QQUA 3BIUH 1KTTB 4RT0A 2IN2A 1GJ8B 4BAHB 2QF3A 1QQ4A 3Q3YA 2G4TA 1KSNA 3NZIA 4Z0KA 3UIRA 4AG1A 2VINA 3LGTA 3EA9A 3O8BA 1N8OC 2BZAA 3ZZ5A 4QT8C 1IQMA 5DP8A 1SQOA 1T8NA 2AMPA 2JETB 2QIQA 4FUEA 1GDNA 3M36A 1NBME 3FAOA 3LU9B 2PGQB 1DXWA 1JRTA 5A8XA 1OSSA 1PPBH 1UTOA 4YLUA 4AGJA 1SLWB 1SI5H 2BD3A 2ZCHP 1ZMNA 3F9EA 3Q77A 3E0PB 3GCNA 2J38A 1QRZA 3MTYA 1F5LA 3GY4A 1Z1IA 4Q80A 4P02A 2BD5A 2VGCB 5HIZA 1G9IE 4XE4A 2HWLB 5GJ4B 4NA8A 1O5DH 4LZ4B 5C17A 1EPTC 1PPEE 4RKOB 2P8OC 1C5QA 1O5GH 3ZZCA 1GHYH 3SOSA 2AMDA 4R8TB 4TY7A 2R0LA 1GI1A 1SLVB 1VGCC 3S9BA 5HXFA 1BTHH 1NN6A 3GDUA 4K60A 1ZMLA 4A6LA 1A46H 1EKBB 3ZV9A 3LGWA 4BAQB 3N7OA 2JDID 5FPSA 5E2PA 4CH2B 1QTFA 2FTLE 1P12E 5TCCA 1K1JA 3ZZ7A 4ZKRU 1T8MA 2ZGXH 2IJD1 5C20A 1LHFH 3TGIE 5AFZH 3ZZ9A 1Y8TA 1C5XB 4K69A 4X1NU 1YPEH 3MU8A 4IW4E 2W3KA 5L2ZH 3PLKA 1C1MA 4X6NA 2STAE 1Q2WA 1BTPA 1E36B 3E3TA 2HPPH 3A8CA 2ZU4A 1EPTB 1L4DA 1E37B 1H1BA 3KHVA 2OTVA 2G00A 2D26C 2PTCE 2FODA 1YPGH 3DSOA 3V0XA 3ATIA 4ABFA 4YOIA 1K1LA 4LOYH 1W0JD 1P3EA 4A92A 1VGCB 2Y7ZA 2OK5A 1A5HA 1HPGA 3M3TA 3A7YA 3HPTB 2AGIX 2ZO3H 3HATH 2GV7A 4M7GA 3FZZA 1P09A 2QA9E 3T2NA 2ZU1A 2PLXA 4H42U 3QGJA 2WPJS 4I8KA 3E90B 1EJMA 5F8TA 1QBOA 1MAXA 1J16A 4P00A 3PWBA 1OP8A 2PV9B 4NA9H 4MQAA 1ANCA 3U69H 4WWYA 1TA6A 2H9HA 4U30A 2PSXA 2RG3A 3GY3A 2D1JA 2VNTA 1WCZA 1BRCE 2W7SA 1ZMJA 3UUZA 3E16B 1YP9A 3F0PA 4AB8A 1T4VH 1V6DA 2HNTE 4Y71A 3AK5A 2ZU3A 3E6PH 4R0IA 1B7XB 3SJOA 1SSXA 2H1UA 3QZRA 3ZZDA 4KKDA 2FOFA 1IQHA 1N6XA 1UCYE 1F7ZA 4M9FA 2FOHA 2Z9IA 1LMWB 1FX0B 1CVWH 1EB1H 2BXTH 2I6QA 2YOLA 2P94A 5C5OA 6CHAC 2Q1JA 2ZFTA 3SQEE 1GHZA 1K22H 1AWFH 1P05A 1V2ST 1C2MA 1Q3XA 2WPLS 3P17H 5EJLA 5AF9H 3UOPA 1B5GH 5T6GA 1BHXF 1GMCF 1O3MA 1C5VA 1TNIA 4FU8A 3ZYDA 2H5CA 1D3PB 2JH5D 2VWOA 2A32A 4B74A 1O2PA 2XBWA 4OM9A 3ZVEA 1C2DA 1O2WA 4BNRA 1D3TB 6GCHF 1GJ4H 3PYHA 3P95A 1GBBA 3TU7H 2B0FA 1DX5M 2NWNA 4XRNA 5EGMA 2YMSC 3B9FH 4TPYA 1SG8B 4XD7D 3BV9B 1O2XA 2FI4E 2VIOA 6CHAB 1QZ8A 1XKAC 2BDCA 4B2CA 1GI0A 3ATMA 3SNCA 2QY0B 2EC9H 3A85A 3P92A 5GWZA 1LDTT 1TPAE 1YC0A 4F55A 3BG4C 3BTFE 5FCKA 3HGPA 1NO9H 1GMHG 1TNLA 1FPCH 4XSKU 1DSUA 3VXEH 1S6HA 3M37A 1YM0A 1TGBA 3A81A 3DHKH 5EODA 2BDAA 1N1LA 5J4SA 4NIVA 4D76A 2ESTE 1P2JA 1JIMA 1L4ZA 1ACBE 1TPPA 3C1KA 2BQWB 2SGQE 3F9FA 1QRXA 1QGFA 1C2GA 3M3VA 3SU3A 3EE0B 1RTFB 1GBEA 1SMFE 3A88A 2BD4A 3RXFA 1RFNA 2BOHB 1GJ6A 3OTJE 1O37A 2ZGCA 2FTMA 3Q3XA 2EI8A 1QJ1B 2YMSB 2CGAA 2VWMA 1CT0E 1THRH 1T8OA 1A5GH 2EI7A 2XOKD 1PFXC 1DXPA 2XC4A 4DCDA 5A0BA 1ARBA 4I8GA 1ZTJA 1HAZB 4INLA 4OS2A 1WQSA 3CNRA 2R3UA 2PUXB 4XBCA 3LJOA 1EJNA 1WQVH 3PTNA 3RXSA 1P2IA 1VJ9U 2PUQH 1K1OA 2XXLA 4MTBA 3V7TA 2YNAA 2HOBA 1X7AC 4X1RU 1BIOA 1EZUC 1AVXA 1ELTA 2F4LA 1QB6A 3SUGA 4J1YA 1TA2A 2AMQA 2ZG0H 2AEIH 2PGBB 1C4Y2 4D9QA 1E1QD 1UCYK 3UTUH 1T7CA 1Y3XA 3VPKA 1GHBG 4YT6H 2BD7A 1G2MA 1HAIH 1EPTA 2STBE 2Y5FA 1TFXA 1CU1A 1O35A 5EG4A 1AVGH 1E0FD 3SUDA 1UTKA 4RSPA 1SGYE 3LC3A 2QV1A 3G01A 2ALPA 3PRBA 1CA0C 3TGKE 2A31A 2B9LA 3SO3A 8GCHG 5GPIB 3KQ5A 1RD3B 1ABIH 1FV9A 3PMAB 2ZIQH 1ESBA 1OWKA 2ZDMA 2WV4A 4WH6A 1TX8A 3NRLA 1O33A 4B2AA 1BRUP 1AFQC 3SW2B 1TX7A 2AGGX 5DP6A 1C1VH 1NFXA 1EAUA 2FZZA 1A4WH 3OY5U 2BDIA 1C5OH 4Q2KA 3RMOH 5JDUB 1IQKA 1O5BB 3U98H 3M7TA 1TABE 2A4OA 1P3CA 5IDKA 1H8IH 5BPEA 1L1NA 4MNWA 2BY5X 2O8UA 4K2YA 4XBBA 1OOKB 1XVMA 1EZXC 1S85A 1OWHA 1CA0B 3ATWA 1SGNE 2P95A 4OGXA 1ZHMA 3SGBE 2PTNA 1NFYA 5G4BA 2A7JA 2OLGA 8KME2 4ISNA 5K7RA 3RM2H 2A5IA 1YCPM 4U32A 1EATA 3UNRA 2HVYB 3SHAH 2UWLA 2QE7D 1DE7H 5DK1A 2TBSA 1AFQB 2O9QA 4ZKNU 3SJKA 1QBNA 2JKHA 2FO9A
chains in the Genus database with same CATH topology
2V3MA 3UAIC 3MQKC 2EQNA 2EY4C 3U28C 2RFKC 2HVYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V3M A;  3UAI C;  3MQK C;  2EQN A;  2EY4 C;  3U28 C;  2RFK C;  2HVY B; 
#chains in the Genus database with same CATH topology
 4FU9 A;  3FP7 E;  4WF8 A;  2A7H A;  2IJO B;  5E0J A;  3HK6 B;  2IPH A;  3TK6 A;  5EXM A;  2O8W A;  1WAY B;  3VB6 A;  2RFK C;  1YKT A;  3KL6 A;  1HB0 B;  1GJ7 B;  2F9O A;  2XC5 A;  1OYQ A;  1KMH B;  1O5E H;  1LVB A;  1BBR E;  3BSQ A;  4O97 A;  5C5N A;  1LCY A;  2FMJ A;  2PKA B;  3T26 A;  5T1V A;  2L6O A;  3T29 A;  1P2N A;  1E1R D;  1A5I A;  4B2B A;  4YTA A;  2FI5 E;  1F0S A;  1TPO A;  3Q76 A;  1BMA A;  1G3C A;  1O2Y A;  2FLB H;  4O9V A;  4AOR A;  5FPT A;  4HG6 A;  4CRC A;  3E0N B;  1ZJK A;  4YOJ A;  1SR5 C;  3KCG H;  4CR9 A;  4LZ1 H;  3TH3 H;  3EE7 A;  1HLT H;  4RI0 A;  3T62 A;  2ZHQ H;  4X2Y A;  2CJI A;  1ZRK A;  4WME A;  1HIA B;  3TK5 A;  2ZHD A;  4WMF A;  1O2L A;  1EP6 A;  4JMY A;  2C8X B;  2ZTX A;  3KF2 A;  3N7D A;  3URE A;  5KGO A;  4B76 A;  3MQK C;  3TK9 A;  2I6S A;  2WPH S;  2J95 A;  2F3C E;  1DFP A;  4ZMA H;  2CHA B;  2VBC A;  1ABJ H;  1QUR H;  1EXF A;  3RXA A;  1ELV A;  1GJB B;  1O3P B;  3CP7 A;  2O8L A;  3RDZ A;  2FOB A;  4DW2 U;  5LPF A;  4ABI A;  1K2I 1;  2GDD A;  2F91 A;  2QXG A;  3LH1 A;  1GHW H;  1OWJ A;  3OE7 D;  2XW9 A;  5JBB S;  5KEC A;  1YY3 A;  3P70 B;  4CRF A;  1TBR H;  2H6M A;  3LGI A;  1RIW B;  5DP7 A;  4FUI A;  3IG6 B;  2VIP A;  3BTE E;  1OXG A;  1CA8 B;  4ABE A;  3KQD A;  1TQ7 B;  1UTQ A;  2ZQ2 A;  1IHS H;  2ZDN A;  2VU8 E;  4JYU H;  4JYT A;  2ZF0 H;  5GCH G;  2UUY A;  3PLP A;  1V2M T;  2QF4 A;  5EXN A;  1C1O A;  1C1U H;  2GZ9 A;  3ZVA A;  2QXH A;  4KTS A;  3MO9 A;  1J8A A;  1Y3W A;  1W2K H;  4DVA U;  3ATK A;  3KQE A;  2WYG A;  5DG6 A;  2F9N A;  1O5F H;  2G5N A;  1O34 A;  1QRW A;  2V3O H;  2ZEB A;  1HYL A;  2BXU H;  3MU0 A;  1S0Q A;  1SQT A;  1YPL H;  1NPM A;  4X1Q U;  3SI4 H;  4CR5 A;  3ZVD A;  1Y5B T;  1C5N H;  1UK3 A;  1NRR H;  2AYW A;  1O5A B;  2FYR A;  2SGE E;  2ZDL A;  1SVP A;  2Q6G A;  4A1X A;  4AFZ A;  2VIV A;  3CS0 A;  1NC6 A;  2FP7 B;  3M7U A;  2ASU B;  1O2Z A;  3WWF A;  3T27 A;  2VJ1 A;  2EEK A;  3RU4 D;  2ZFF H;  3UR6 A;  3GY2 A;  4MVN A;  2UUF B;  2JH0 D;  3PLB A;  4FOU C;  3TVJ B;  3LOX A;  4D8N A;  1IAU A;  1S6L A;  1W0K D;  3GIC B;  1FN6 A;  1QR3 E;  3QDZ B;  5DJ7 A;  1XUI A;  2VWL A;  1BUI A;  5T6D A;  3NKK A;  2LEL A;  5EXL A;  1UTJ A;  1OP0 A;  1T32 A;  1GBI A;  1O3G A;  2B8O H;  2P16 A;  1HCG A;  1O3H A;  3EGK H;  5C67 A;  3KID U;  3UOU A;  3MI4 A;  1MTS A;  1QL8 A;  1W12 U;  2OIN A;  3GCH B;  2OC7 A;  4INH A;  1WYK A;  3ZZ6 A;  4B6F A;  2EY4 C;  3DUX H;  4ABG A;  4KTU A;  1A61 H;  2A7C A;  1XKB C;  2KCP A;  1CHO F;  2V6N A;  2GKV E;  3L3T A;  3PMH B;  4DT7 B;  1KXD A;  1SGR E;  1OWI A;  5FX5 A;  3PV2 A;  5JBA S;  2VGC C;  3RU4 T;  1O32 A;  1N6Y A;  1VIT H;  1WTG H;  4BAO B;  2FOG A;  2BOK A;  4AC9 A;  4ZHM U;  1GL1 A;  1EZS C;  4NSV A;  4X8U H;  3MNC A;  2FPZ A;  1S0R A;  1DVA H;  8LPR A;  2ZPQ A;  4Y76 A;  2W26 A;  1D6R A;  2WZQ A;  3UQO A;  4CH8 B;  3A87 A;  4FUH A;  1GBC A;  1ESA A;  3FP8 E;  3WWB A;  1VIT G;  5C0U A;  2CV3 A;  4NIY A;  3MFJ A;  5FPY A;  5JBT A;  1ANB A;  1BML A;  3Q3K A;  3DSP A;  1AMH A;  1CBW C;  2WUC A;  2ZU2 A;  3UB0 A;  1PPC E;  1HXF H;  1GBF A;  4D9R A;  1L2E A;  1GBM A;  1GBT A;  1C5S A;  2TGT A;  1GBJ A;  2RDE A;  3VB5 A;  3PWC A;  1S6F A;  3BN9 A;  2ZFQ H;  3B23 B;  4ISO A;  2TRM A;  2PKA A;  1V2P T;  1A3B H;  3PO1 B;  4ZKS U;  1AIX H;  1GWA A;  3LT3 A;  1VCP A;  1YWU A;  1G3E A;  1DWB H;  2WPM S;  2W7U A;  3QUM P;  1K1N A;  4WVP E;  1P8V C;  4E05 H;  1G32 B;  5F6M A;  3HK3 B;  1UW7 A;  3SV7 A;  1CGI E;  1G2L A;  2G51 A;  2OQU A;  3FVF B;  2VVU A;  4ZXY H;  1NRN H;  5JPM H;  1XUH A;  3PTB A;  1W0Y H;  1MTN B;  1MMJ N;  4DIH H;  1TRY A;  4FUC A;  1Z1J A;  1O2Q A;  3SU6 A;  6EST A;  3NPS A;  4NFF A;  1O2R A;  5FHT A;  1GHA G;  1CBW B;  1TMB H;  2ZCK P;  4EST E;  1UK2 A;  1HIA A;  1J15 A;  4JK6 A;  3A7Z A;  1C5L H;  1DLK B;  2BY8 X;  1P06 A;  1W3C A;  5FXL A;  3ZZ4 A;  5B6O A;  7KME H;  1SGF A;  4NG9 H;  3E91 A;  1BOQ A;  4DII H;  2CN0 H;  2ZGB H;  3E8L A;  3TH2 H;  3S7K B;  1HAX B;  1FY8 E;  1F0R A;  3EAJ A;  1CGJ E;  2H2Z A;  1THP B;  1LPZ B;  3K65 B;  4K1E A;  1O30 A;  5AHG H;  1EST A;  3AW0 A;  2DE9 A;  5A8Y A;  9LPR A;  2PW8 H;  1FJS A;  4INK A;  1GMH F;  1XM1 A;  2UWO A;  1NFW A;  3EST A;  4FXG H;  2G81 E;  2BY6 X;  1O2K A;  3VGC B;  5F03 A;  4F4O C;  1IQI A;  3SBK A;  1OHH D;  1C1W H;  3A7T A;  1CQQ A;  2ULL A;  1F5R A;  1SKY E;  2WHX A;  5DSF A;  5SGA E;  3FAN A;  1COW D;  4BXS A;  1O0D H;  4NZL A;  1UK4 A;  1KTS B;  5JBC S;  3MU5 A;  2XC0 A;  4PRO A;  2FI3 E;  3AAV A;  1O3I A;  2H5D A;  2LPR A;  2L74 A;  3I29 A;  3OYP A;  4IBL H;  3SU4 A;  1HAY B;  4JK5 A;  2GZ7 A;  1TON A;  1NZQ H;  1Z8J B;  5C1X A;  4I7Y H;  2ZFR H;  2WV5 A;  1TGS Z;  4X8V H;  1LHD H;  3I78 A;  1WUN H;  4Q7X A;  2OC8 A;  1SGF G;  1MBQ A;  2XCN A;  3FOA A;  3PV5 A;  2BDY A;  2BYA X;  3A80 A;  5FBE A;  3U8O H;  1MTW A;  1G3D A;  1P04 A;  1QB9 A;  3OX7 U;  2R2M B;  2ODQ A;  1H8H D;  4TWW A;  5F53 A;  2OBO A;  1P02 A;  3SN8 A;  1LQD B;  1C1S A;  1BMM H;  1GVL A;  1LHE H;  2WUB A;  3KN2 A;  2ZWL H;  2OQ5 A;  3GY6 A;  4FUB A;  2P3T B;  3BF6 H;  1AWH B;  5ESB A;  2J98 B;  1C1T A;  1U6Q A;  1PYT D;  2VIW A;  3FFG A;  1FON A;  3U28 C;  2ALV A;  1QFK H;  2ZA5 A;  1DM4 B;  3MH7 A;  1ANE A;  5EW2 H;  3OSY A;  4WXV A;  2RDL A;  2AHM E;  4BTT B;  1O2V A;  1BA8 B;  1O2H A;  4UDW H;  2KR7 A;  3AW1 A;  2ZDK A;  4MPW A;  2XND D;  4ZAE A;  1GHB F;  3SUF A;  3UY9 A;  3F68 H;  1E38 B;  3SV6 A;  2JJ1 D;  1UJ1 A;  2C4F H;  3V12 A;  3ZIA D;  3SNB A;  4DOQ A;  3TNT A;  5EJ1 A;  3QTO H;  3P8G A;  4D7G A;  2ZP0 H;  5EST E;  2QXJ A;  1A3E H;  3RXU A;  1BRA A;  1DS2 E;  4E7R G;  2C8W B;  4UFG H;  1CSO E;  1TOM H;  3VXF H;  3FO8 D;  2FIR H;  8GCH F;  4GUX A;  1TB6 H;  2GJG A;  1DWE H;  4WY3 A;  1DIT H;  2V35 A;  4XOJ A;  2AIQ A;  4YOG A;  1LHG H;  3TJU A;  2B5T B;  5HYO A;  1JMO H;  1HJA B;  1OWE A;  1HBT H;  3HKJ B;  1WTH D;  2BDB A;  4K8Y A;  3SJ8 A;  1EFR D;  1DUA A;  1AE5 A;  2XBV A;  2QYI A;  2P3U B;  1XX9 A;  3MHW U;  1GI4 A;  5EQQ A;  4RN6 A;  1GBH A;  3RXB A;  2BY9 X;  4IC6 A;  2OUA A;  2V3M A;  2QC2 A;  1A1R A;  1ELB A;  3STJ A;  3F3B A;  1V2Q T;  4Y0Y E;  2D8W A;  3I77 A;  3UWJ H;  5E8E H;  2AER H;  1IQG A;  1TLD A;  1W0Z U;  4Y11 E;  1RTK A;  4ASH A;  1LVM A;  1TNH A;  2C3S A;  1LPK B;  1EP5 A;  3SNA A;  1OPH B;  3A7X A;  3H7O A;  5DGJ A;  1NBM D;  2UWP A;  3DD2 H;  8EST E;  1QHR B;  2A4G A;  1VZQ H;  3KEE A;  1C1Q A;  2FX6 A;  1DUE A;  1BIT A;  2BQ6 B;  3QGN B;  1XUJ A;  1AO5 A;  2EI6 A;  4K1T A;  1THS H;  1BJU A;  3OAA D;  1EX3 A;  4KGA A;  3SJ9 A;  1ZYO A;  1O3K A;  1LTO A;  1SOZ A;  2ZHE H;  1XUF A;  3SND A;  3PV4 A;  4CRE A;  3OFN D;  1NS3 A;  4GLY A;  3TIU A;  2W6I D;  2GVF A;  1FDP A;  3TGJ E;  3TLO A;  2Q6F A;  2F83 A;  1S81 A;  1Z6J H;  2QF5 A;  1D6W A;  3F6U H;  1AB9 C;  4GCH G;  1LQE A;  1PPF E;  3SUE A;  3A83 A;  1W13 U;  3VB7 A;  4YO9 A;  3LGV A;  5DP4 A;  1LKB A;  1TWX B;  3LIW A;  1AND A;  4I8H A;  1T31 A;  3BEU A;  1KDQ B;  2OC0 A;  1FAK H;  4CRG A;  3UQV A;  1JBU H;  2ZC9 H;  1MBM A;  1DWC H;  5L30 H;  5LGO A;  2A0Q B;  2GMT B;  1Z8I B;  1EAX A;  3RMN H;  1UCY H;  3O8D A;  1O3E A;  4TT3 D;  3RXV A;  1ZOM A;  1W8B H;  2OCV B;  1JIR A;  4HZH A;  4Y0Z E;  4GSO A;  1ZSK A;  2LNC A;  4JCN A;  1E34 B;  1VCQ A;  2KZ4 A;  1Y3Y A;  2A5K A;  5CDF E;  1FQ3 A;  4BAM B;  3S0N A;  2VIQ A;  1KY9 A;  7GCH F;  1ID5 H;  1CHG A;  1AB9 B;  1SLU B;  3SGQ E;  2Y81 A;  4YES B;  1V2V T;  2K8I A;  5DKM A;  3STI A;  3W1E A;  1C4U 2;  4K5Z A;  1C2I A;  1HXE H;  4JZF H;  1CE5 A;  2A5A A;  1KXC A;  2GCH G;  2P59 A;  4NA7 A;  2FES H;  4K1S A;  4BTU B;  5AVD A;  1YF4 A;  1Z6E A;  3P6Z B;  3GCO A;  2ZI2 H;  4AFQ A;  3ZVF A;  3URD A;  4D7F A;  1BQY A;  3D49 H;  3SQH E;  3HKI B;  4LXB H;  7EST E;  4XDE A;  2P3F H;  1NRO H;  1EOJ A;  3RXO A;  3VFE A;  2CF9 H;  3S69 A;  3URC A;  4GPG A;  2J98 A;  4AX9 H;  2GP9 B;  2HGT H;  3RXR A;  4CHA C;  4ZKO U;  1WXR A;  2A2Q H;  2A1D B;  2WIN I;  5GCH F;  4NIX A;  4FUJ A;  1V2W T;  1SFQ B;  5T3H A;  4U2W A;  1PQ7 A;  4ISL A;  4TYD A;  5J4Q A;  3C27 B;  1KLJ H;  1GJD B;  1SOT A;  1C2E A;  1PYT C;  2BVR H;  2F9V A;  3EDX B;  4Q7Y A;  1L1J A;  2F43 B;  1TGC A;  2FOM B;  3F9G A;  5L6N H;  3GY5 A;  2TPI Z;  1EUF A;  2KCY A;  3GDS A;  1HNE E;  4J2Y B;  1VJA U;  3RXH A;  2TIO A;  3F2F A;  1Y3V A;  1LVY A;  3RP2 A;  1KXA A;  1FY5 A;  1O2N A;  4IMQ A;  2KAI B;  2XCF A;  1YPH C;  2CHA C;  3D65 E;  4X6M A;  2HAL A;  1QY6 A;  2J5U A;  4KTC A;  4OS6 A;  1NRQ H;  4ACB A;  4CHA B;  1ZPZ A;  3F0O A;  1GHV H;  1Z8G A;  3LDX H;  3K9X B;  3U8R H;  1QB1 A;  3NCL A;  3DSG A;  2FX4 A;  3T25 A;  1QL9 A;  3KQC A;  4MG3 A;  1O3A A;  1RIW C;  1V2O T;  3FKS D;  2FOA A;  3B8J A;  3QWC H;  2WV9 A;  5TCA A;  1GBD A;  1MKW H;  1O2I A;  1OS8 A;  2GV6 A;  2XYA A;  1H8E D;  5A09 A;  1QIX B;  1B0F A;  3RXI A;  1MCT A;  1AUJ A;  2Z7F E;  1HAG E;  3GYL B;  5ABW A;  1QL7 A;  1GPZ A;  1SGI B;  1YGC H;  3SV9 A;  1UTM A;  4AGK A;  1YCP K;  4MLF B;  1UVU H;  4MPX A;  5EJZ A;  2RCE A;  1G3B A;  1WOF A;  3UFA A;  3NUM A;  1HAH H;  1SGQ E;  1BT7 A;  1AI8 H;  4NIW A;  3JZ2 B;  4TSF D;  1D9I A;  1J9C H;  2F9P A;  5JB8 S;  1MU6 B;  2G52 A;  4Y8Y A;  4WH8 A;  5DP3 A;  3ZV8 A;  3M5O A;  2Z94 A;  3N99 A;  1HV7 A;  1TOC B;  2DUC A;  2PKS B;  1VIT F;  1FY4 A;  5HGG A;  3BTT E;  5EU8 A;  2ZFP H;  3RMM H;  1O3D A;  1CT2 E;  1P9S A;  1DST A;  3MH5 A;  1NFU A;  1SB1 H;  3VG8 A;  2AIP A;  4YLQ H;  1C9P A;  1O3O A;  1GBK A;  1VKY A;  4OS7 A;  4X1P U;  3K6Z A;  1A0J A;  3QO6 A;  2Z6B D;  3A7V A;  3BEF B;  1PQA A;  4JZI A;  4WMD A;  5HKK D;  2FXR A;  3TNS A;  3M5M A;  2CXV A;  4ISH H;  5DP5 A;  1GVZ A;  3M3S A;  3A89 A;  1TAW A;  3A82 A;  3GYM A;  4B1T A;  2H9T H;  3EA7 A;  3GCT G;  1GI7 B;  4DY7 B;  1ELC A;  1RTL A;  1H4W A;  3GCH C;  1O2G H;  2CK3 D;  3SI3 H;  1O3J A;  4U01 A;  4A1T A;  3ODF A;  1D4P B;  4IN2 A;  4MNY A;  1MZD A;  3W95 A;  1O3F A;  1AU8 A;  2ZHF H;  5EOK A;  1OX1 A;  1KDQ A;  2XNI A;  2ZEC A;  3H7T A;  2BM2 A;  2IPQ X;  5ETX A;  1MUE B;  2THF B;  4B73 A;  4OS4 A;  2A4R A;  4BOH A;  1HGT H;  1ZPC A;  1MKX H;  3QLP H;  2QAA A;  1Z8R A;  4ASU D;  3A84 A;  4X2X A;  4UFF H;  1EJA A;  4IN1 A;  1ZHR A;  5IYT A;  3S9C A;  1XUK A;  1MTU A;  1E79 D;  1MAY A;  1C5Y B;  3QK1 A;  3M5L A;  2TGP Z;  1BBR K;  1GI5 A;  2C93 B;  4X8S H;  2BLQ A;  1Y59 T;  2ZNK H;  3F2G A;  2OP9 A;  5C1Y A;  4ZUH A;  2VID A;  3RXG A;  2VWN A;  1FZZ A;  5DP9 A;  3BTW E;  2BX4 A;  2G55 A;  2Z3D A;  1MD7 A;  2O8M A;  3AVZ A;  4DJZ B;  1GG6 B;  4UFE H;  1KYN A;  2SNV A;  1UTL M;  1FY1 A;  1TRN A;  1SGE E;  2VH6 A;  3V3M A;  1SQR A;  3L33 A;  3M61 U;  5C94 A;  1MQ6 A;  1IOE A;  1XVO A;  1C2J A;  1GI2 A;  3UNS A;  3LGU A;  2FOC A;  2QN5 T;  2BDG A;  3QX5 H;  3PO1 C;  3D23 A;  2RA0 A;  1ZR0 A;  4AZ2 B;  4I8L A;  1IQE A;  2KCA A;  3U1I B;  2SNW A;  1ETT H;  4JZD H;  5HM2 A;  3FZD A;  3TPI Z;  2BB4 A;  1P03 A;  2WSS D;  5FX6 A;  1DPO A;  1GL0 E;  3PB1 E;  2XBY A;  4OS1 A;  1MTN C;  3M7Q A;  2XBX A;  4IC5 A;  1GMD G;  1S5S A;  2HNT C;  4Y7B A;  1O38 A;  4TWY A;  1C4V 2;  4B6E A;  3ZYE A;  3GDV A;  4HFP B;  3RM0 H;  3DFJ A;  5LH8 A;  1WDI A;  5GIB A;  1BDA A;  1P2K A;  3ZZ3 A;  1L1G A;  5FL7 D;  2KAI A;  3NK8 A;  2ZCL P;  1TE0 A;  3KYG A;  1AFE H;  2GCT C;  3T5F H;  1ZJD A;  1V2R T;  3H09 A;  2J2U A;  1EOL A;  1FY3 A;  2BDH A;  2LP6 A;  3R0F A;  1D3Q B;  2GDE H;  2HLC A;  2BLO A;  1W11 U;  4OGY A;  4MNV A;  4SGA E;  2UUK B;  1K1M A;  1QJ7 B;  3IWM A;  3RC5 A;  3UAI C;  5CE1 A;  1TNJ A;  2KCO A;  3VGC C;  1CT4 E;  1AVW A;  5FBI A;  4ISI H;  1SGP E;  5JYI A;  1MTV A;  3PMB B;  2KM0 A;  4WJG 2;  3A86 A;  1C2K A;  1C2L A;  1BHX B;  1Y5U T;  1HAP H;  1BB0 B;  4I8J A;  3RC4 A;  5HM9 A;  2W3I A;  1UHB B;  1E35 B;  4ZHA A;  4FUD A;  1PQ8 A;  1OP2 A;  1SHH B;  2PWX A;  3PRO A;  1OKX A;  2OBQ A;  1SFI A;  2GT8 A;  1KLI H;  4UEH H;  5K0H A;  4Q7Z A;  1C5W B;  1F0T A;  4THN H;  1GI8 B;  1P2M A;  3A8B A;  2OD3 B;  1V2T T;  3GS9 A;  1Y3U A;  2R0K A;  4X0W U;  1N8O B;  3KNX A;  2GCT B;  3RLY H;  4BTI B;  4Y10 E;  3R3G B;  1TGT A;  3P8N A;  4MPU A;  4GAW A;  3TH4 H;  1P2O A;  5GDS H;  3TIT A;  4K3J A;  1MCV A;  2J9N A;  2PSY A;  2GZ8 A;  5FCR A;  4GVU A;  1YLD A;  2BX3 A;  2SGD E;  3ZVG A;  2A4Q A;  2ZQ1 A;  2B7D H;  2R9P A;  3U9A H;  3OTP A;  2P8O B;  1V2J T;  3SU1 A;  1BTY A;  1GJC B;  1LPG B;  2P93 A;  3VB3 A;  5F8X A;  1S84 A;  2ANM H;  5A0C A;  2TGA A;  3LGY A;  5C2Z A;  3MO6 A;  1CHO G;  5HMA A;  4DT4 A;  4FUG A;  3RXT A;  1YYY 1;  1BTX A;  2VH0 A;  1O2T A;  1KXE A;  2Y80 A;  1SGD E;  2W6J D;  4DUR A;  1TNK A;  3EQ0 H;  2GD4 B;  1F2S E;  3A8D A;  2WYJ A;  3RXK A;  2BTC E;  4GHT A;  3QZQ A;  2NU4 E;  1C5U A;  5F8Z A;  1HJ9 A;  1K9O E;  3MH6 A;  2HPQ H;  2VVV A;  2Z3C A;  1C2H A;  1O36 A;  4H6T A;  1S82 A;  2QGR A;  2HVX A;  1G30 B;  1AKS B;  4E7N A;  1SGT A;  2EQN A;  2BY7 X;  4UON A;  1HJA C;  3RXE A;  1TMU H;  1ZTK A;  4UD9 H;  4ZCN A;  1NT1 A;  2XWB I;  1FIW A;  4GCH F;  4FUF A;  4X2V A;  1AN1 E;  3HGN A;  1C5M D;  1O3L A;  4I86 A;  1FLE E;  5C0T A;  1O2U A;  2G8T A;  2PHB A;  1UVS H;  3BTG E;  4CRB A;  3SOR A;  1P01 A;  1BTW A;  1H9H E;  1NM6 A;  2TGD A;  1J14 A;  2JIZ D;  4AG2 A;  4MPV A;  4Y79 A;  2ZPR A;  3MU1 A;  1UTN A;  2ANK H;  1AE8 H;  2D2D A;  1UVP A;  3O8R A;  2Z9G A;  5FAH A;  2QXI A;  2FDA A;  1SQA A;  4O3U A;  4TPI Z;  2PFE A;  4FVB A;  1XXD A;  1SL3 A;  1UTP A;  1XXF A;  1DT2 A;  1PPG E;  1ZZZ A;  2ZZU H;  4O3T A;  3D62 A;  4CBN A;  2BLV A;  1WSS H;  3PRD A;  4XBD A;  1K0H A;  2BD8 A;  3ELA H;  4ABD A;  1GGD C;  6LPR A;  1QJ6 B;  1AZZ A;  2HNT F;  4SGB E;  2R3Y A;  2Q6D A;  1ZHP A;  2SFA A;  5CHA C;  1YPM H;  1GBA A;  4VGC C;  5EQS A;  3LPR A;  3BTQ E;  3M35 A;  3SV2 H;  1SC8 U;  2XRC A;  3ZVB A;  1KXF A;  4BAN B;  2OC1 A;  3ZZB A;  1EAW A;  1C1P A;  1YLC A;  3TJO A;  4I32 A;  1MZA A;  2SGF E;  2GCH F;  2CMY A;  1BMN H;  1BRB E;  1JXP A;  3OY6 U;  3MNX A;  2KFW A;  2A45 B;  1MH0 A;  2C8Y B;  2J34 A;  4Y8X A;  1BJV A;  4YM9 A;  1FI8 A;  4NGA H;  1TBQ H;  3MO3 A;  1CGH A;  4IS5 A;  4Z6A H;  3MU4 A;  4RKJ B;  1F5K U;  1ZRB A;  1ZSL A;  4FU7 A;  1ETS H;  1W7G H;  4UE7 H;  4ZXX H;  1YLN A;  2NU3 E;  1NRS H;  1GGD B;  1GI9 B;  2VB0 A;  3GY7 A;  1IQN A;  3DCL A;  4X1S U;  2AFQ B;  5CHA B;  4ABB A;  1C1N A;  1HAV B;  4VGC B;  1K28 D;  1TYN A;  1A2C H;  1V2U T;  3LON A;  2GTB A;  3DFL A;  2A2X H;  1GCD A;  2QCY A;  3BTM E;  2Y82 A;  3SJI A;  3OEH D;  3LKW A;  2FOE A;  1GI6 A;  1TMT H;  1C5R A;  1INC A;  2ZKS A;  4LK4 A;  5A8Z A;  2NU2 E;  1G37 A;  2ODP A;  1NRP H;  3MYW A;  1TGN A;  4JYV H;  1EAS A;  2V3H H;  2BQ7 B;  2GMT C;  2M2A A;  2Y7X A;  4H6S B;  5EPN A;  1G36 A;  3WW7 A;  1ZGI A;  1XMN B;  2GT7 A;  3BTH E;  1FUJ A;  3SHC H;  2VVC A;  2ZU5 A;  2SGA A;  3OU0 A;  4NFE A;  4BAK B;  3S7H B;  2EA3 A;  4I31 A;  4ZRO A;  1UHB A;  3LC5 A;  3RXL A;  4NWL A;  3A7W A;  4AOQ A;  3OEE D;  1A7S A;  3BG4 B;  1TRM A;  1AZ8 A;  5CHB A;  3VB4 A;  2J4I A;  3SU5 A;  2ZTZ A;  3BIV H;  2NU1 E;  1CO7 E;  4X6O A;  1AQ7 A;  3NXP A;  1C5T A;  1ELA A;  2V0B A;  1EAI A;  1JWT A;  1WV7 H;  2BLW A;  2JJ2 D;  1Z7K A;  3S9A A;  1TX6 A;  3U8T H;  3F2H A;  1GJ9 B;  2FEQ H;  1YPJ H;  1V3X A;  3LJJ A;  1AGJ A;  2ANW A;  5I25 A;  1IQL A;  3LH3 A;  3H5C B;  1HRT H;  1ZLR A;  4B71 A;  1Y5A T;  1DAN H;  2F9U A;  5A2M H;  2C8Z B;  3GOV B;  1KXB A;  1Q31 A;  4WXI A;  2DE8 A;  1XUG A;  5T6F A;  1GMC G;  1O31 A;  3SV8 A;  1J17 T;  3RU4 E;  3SZE A;  1O3B A;  4NSY A;  3VEQ B;  1P2Q A;  1ZPB A;  1FN8 A;  5EPY A;  1GDQ A;  4X8T H;  1ZTL A;  1L0Z A;  4TY6 A;  2F9B H;  2GGV B;  1RXP A;  1DY8 A;  1C2F A;  1P9U A;  1FAX A;  1O2M A;  1AD8 H;  2BD2 A;  6GCH G;  4YXW D;  1ZSJ A;  1GCT C;  4ABH A;  3AAU A;  3KGP A;  3N7E A;  1MD8 A;  1ETR H;  4GHQ A;  1O3C A;  3RXJ A;  1PPZ A;  1TNG A;  1O3N A;  1TBZ H;  3RC6 A;  4AYY B;  2FM2 A;  3EYD A;  1DIC A;  2ZGJ A;  3W94 A;  3AAS A;  1KLT A;  9EST A;  4AFS A;  3ZZA A;  1K1P A;  5KED A;  1NU7 B;  3RUO A;  2K0Q A;  4HI3 A;  2ZPS A;  4NWK A;  1HFD A;  1RRK A;  1FNI A;  2WPK S;  2BD9 A;  2FS8 A;  1AKS A;  4YT7 H;  4KP0 A;  4ABA A;  1T8L A;  1TAL A;  2ZTY A;  3RLW H;  4F48 B;  1TQ0 B;  1RJX B;  5DO4 H;  1V2K T;  5I46 H;  4K8B A;  3GCT F;  3RXQ A;  1MAB B;  1FIZ A;  3MNS A;  1Z71 A;  3SU0 A;  1GCT B;  1S83 A;  4UFD H;  1GBL A;  1ELE E;  1ELG A;  2ZHW H;  3RXM A;  5DN6 D;  1AUT C;  3WY8 A;  5IK2 D;  2Z9L A;  2ANY A;  2W5E A;  4E06 H;  1GHX H;  1NTP A;  3ENS B;  1QCP A;  2G5V A;  3F9H A;  1JRS A;  4X6P A;  1RGQ A;  4H4F A;  1F0U A;  1O2S A;  2V7Q D;  3TJN A;  1O5C B;  3UWI A;  3E1X B;  4A1V A;  1GVK B;  2BVX H;  5C3N A;  5GXP A;  2ZFS A;  4AN7 A;  2FWW A;  3KQB A;  3SYJ A;  4Q63 A;  1SLX B;  1UVO A;  4FVD A;  2PKS C;  3UNQ A;  2KX4 A;  1H8D H;  5L2Y H;  1ARC A;  1LVO A;  3ZZ8 A;  1A0L A;  5E2O A;  4ABJ A;  3SNE A;  3KYF A;  1EZQ A;  1MKW K;  2Z3E A;  4ZHL U;  1QA7 A;  1V2N T;  4AFU A;  1SHY A;  2PR3 A;  1YPK H;  2BMG B;  1W7X H;  1ORF A;  5HIY A;  5EQR A;  4CBO A;  1LHC H;  1W14 U;  4IGD A;  3RXD A;  3QTV H;  3MMG A;  4FET A;  4AYV B;  2J94 A;  3RXP A;  5PTP A;  1YBW A;  1PQ5 A;  1QA0 A;  1ZGV A;  4DG4 A;  1K1I A;  3U1J B;  3BTD E;  3RXC A;  4RT1 A;  1NU9 A;  2BZ6 H;  3DT0 H;  5LPR A;  3BTK E;  5DPA A;  3SZN A;  1OWD A;  4CRD A;  1C1R A;  1HAV A;  5EW1 H;  3RML H;  1W10 U;  4CRA A;  1AY6 H;  2J97 A;  2Y5G A;  1MU8 B;  3GY8 A;  2WPD D;  5E0H A;  1C9T A;  3JZ1 B;  1HJ8 A;  1GMD F;  1YCP H;  1DY9 A;  4MNX A;  2M5T A;  3K6Y A;  2UUJ B;  3P8O A;  4MDS A;  7GCH G;  1DWD H;  1GJ5 H;  1BMF D;  4A5T S;  5H4I B;  4ZH8 A;  2OXS A;  1HDT H;  1K21 H;  3F1S B;  3PM3 A;  1GDU A;  2HRV A;  4Y6D A;  4Z1M D;  1TIO A;  1PJP A;  2G4U A;  1FPH H;  1SGC A;  1HAO H;  2NU0 E;  1PPH E;  1VR1 H;  1P57 B;  4DGJ A;  4HGC A;  3FN8 A;  5E0G A;  1GI3 A;  1B0E A;  2K1Q A;  2ODY B;  3MWI U;  4NZQ A;  1P11 E;  2WPI S;  2PP6 A;  5C1U A;  4BXW A;  1O39 A;  1FMG A;  4F49 A;  4ACA A;  1GJA B;  3UPE A;  1A0H B;  3MNB A;  1NES E;  1IQF A;  2H9E H;  2ILN A;  2RA3 A;  2Y5H A;  2ZGH A;  2R2W U;  3ATL A;  4IMZ A;  3K2U A;  3CEN A;  2BVS H;  3Q00 A;  1GG6 C;  4A7I B;  5LPE A;  1EQ9 A;  1MQ5 A;  2BHG A;  1M9U A;  1FXY A;  3PMJ A;  1DLE A;  1UO6 A;  3T28 A;  2AH4 X;  1BCU H;  7LPR A;  1GHA F;  3O8C A;  5AFY H;  1H9I E;  4Y7A A;  1MKX K;  1C5P A;  1DDJ A;  1BTU A;  3P8F A;  1LO6 A;  1KIG H;  1SBW A;  2O8T A;  3M5N A;  3A8A A;  1OYT H;  2ZDA H;  1P10 A;  4Y8Z A;  1P0S H;  1T4U H;  1EB2 A;  3SU2 A;  5EIY A;  1DOJ A;  1IQJ A;  2AGE X;  2XWA A;  3V13 A;  4YZU A;  4I33 A;  2HLD D;  1JOU B;  3IIT A;  1ELD E;  3ODD A;  4XFQ A;  3NWU A;  5A0A E;  1YPH E;  1LKA A;  1O2O A;  4B75 A;  5GND A;  2AS9 A;  4Q4L A;  4AB9 A;  2SGP E;  4JZ1 A;  1UVT H;  1IHT H;  2YNB A;  1WU1 A;  3DA9 B;  5CMX H;  3BEI B;  2ZDV H;  3QN7 A;  3ZVC A;  3ITI A;  2J92 A;  2FS9 A;  1BBR H;  2GX4 A;  1VCW A;  1F92 A;  4O03 A;  2IOT A;  2Z9J A;  5BRR E;  2JH6 D;  1BTZ A;  1D3D B;  2Z9K A;  2CF8 H;  2FLR H;  3BG8 A;  4NCY A;  3SGA E;  2YMS D;  1BZX E;  1ELF A;  2JET C;  1SPJ A;  5JB9 S;  3MH4 A;  3FP6 E;  1H9L B;  2XTT B;  1AHT H;  2C90 B;  4HTC H;  1HUT H;  3TJV A;  3GIS B;  4JZE H;  3CS7 A;  3MOC A;  4KEL A;  2FYQ A;  5TJX A;  1NY2 2;  3UR9 A;  1QNJ A;  1TPS A;  1WBG B;  1O2J A;  3EA8 A;  2QF0 A;  1QBV H;  1RS0 A;  4OS5 A;  3L6P A;  2Y6T A;  5B6L A;  1UMA H;  4X2W A;  1V2L T;  1C5Z B;  1QQU A;  3BIU H;  1KTT B;  4RT0 A;  2IN2 A;  1GJ8 B;  4BAH B;  2QF3 A;  1QQ4 A;  3Q3Y A;  2G4T A;  1KSN A;  3NZI A;  4Z0K A;  3UIR A;  4AG1 A;  2VIN A;  3LGT A;  3EA9 A;  3O8B A;  1N8O C;  2BZA A;  3ZZ5 A;  4QT8 C;  1IQM A;  5DP8 A;  1SQO A;  1T8N A;  2AMP A;  2JET B;  2QIQ A;  4FUE A;  1GDN A;  3M36 A;  1NBM E;  3FAO A;  3LU9 B;  2PGQ B;  1DXW A;  1JRT A;  5A8X A;  1OSS A;  1PPB H;  1UTO A;  4YLU A;  4AGJ A;  1SLW B;  1SI5 H;  2BD3 A;  2ZCH P;  1ZMN A;  3F9E A;  3Q77 A;  3E0P B;  3GCN A;  2J38 A;  1QRZ A;  3MTY A;  1F5L A;  3GY4 A;  1Z1I A;  4Q80 A;  4P02 A;  2BD5 A;  2VGC B;  5HIZ A;  1G9I E;  4XE4 A;  2HWL B;  5GJ4 B;  4NA8 A;  1O5D H;  4LZ4 B;  5C17 A;  1EPT C;  1PPE E;  4RKO B;  2P8O C;  1C5Q A;  1O5G H;  3ZZC A;  1GHY H;  3SOS A;  2AMD A;  4R8T B;  4TY7 A;  2R0L A;  1GI1 A;  1SLV B;  1VGC C;  3S9B A;  5HXF A;  1BTH H;  1NN6 A;  3GDU A;  4K60 A;  1ZML A;  4A6L A;  1A46 H;  1EKB B;  3ZV9 A;  3LGW A;  4BAQ B;  3N7O A;  2JDI D;  5FPS A;  5E2P A;  4CH2 B;  1QTF A;  2FTL E;  1P12 E;  5TCC A;  1K1J A;  3ZZ7 A;  4ZKR U;  1T8M A;  2ZGX H;  2IJD 1;  5C20 A;  1LHF H;  3TGI E;  5AFZ H;  3ZZ9 A;  1Y8T A;  1C5X B;  4K69 A;  4X1N U;  1YPE H;  3MU8 A;  4IW4 E;  2W3K A;  5L2Z H;  3PLK A;  1C1M A;  4X6N A;  2STA E;  1Q2W A;  1BTP A;  1E36 B;  3E3T A;  2HPP H;  3A8C A;  2ZU4 A;  1EPT B;  1L4D A;  1E37 B;  1H1B A;  3KHV A;  2OTV A;  2G00 A;  2D26 C;  2PTC E;  2FOD A;  1YPG H;  3DSO A;  3V0X A;  3ATI A;  4ABF A;  4YOI A;  1K1L A;  4LOY H;  1W0J D;  1P3E A;  4A92 A;  1VGC B;  2Y7Z A;  2OK5 A;  1A5H A;  1HPG A;  3M3T A;  3A7Y A;  3HPT B;  2AGI X;  2ZO3 H;  3HAT H;  2GV7 A;  4M7G A;  3FZZ A;  1P09 A;  2QA9 E;  3T2N A;  2ZU1 A;  2PLX A;  4H42 U;  3QGJ A;  2WPJ S;  4I8K A;  3E90 B;  1EJM A;  5F8T A;  1QBO A;  1MAX A;  1J16 A;  4P00 A;  3PWB A;  1OP8 A;  2PV9 B;  4NA9 H;  4MQA A;  1ANC A;  3U69 H;  4WWY A;  1TA6 A;  2H9H A;  4U30 A;  2PSX A;  2RG3 A;  3GY3 A;  2D1J A;  2VNT A;  1WCZ A;  1BRC E;  2W7S A;  1ZMJ A;  3UUZ A;  3E16 B;  1YP9 A;  3F0P A;  4AB8 A;  1T4V H;  1V6D A;  2HNT E;  4Y71 A;  3AK5 A;  2ZU3 A;  3E6P H;  4R0I A;  1B7X B;  3SJO A;  1SSX A;  2H1U A;  3QZR A;  3ZZD A;  4KKD A;  2FOF A;  1IQH A;  1N6X A;  1UCY E;  1F7Z A;  4M9F A;  2FOH A;  2Z9I A;  1LMW B;  1FX0 B;  1CVW H;  1EB1 H;  2BXT H;  2I6Q A;  2YOL A;  2P94 A;  5C5O A;  6CHA C;  2Q1J A;  2ZFT A;  3SQE E;  1GHZ A;  1K22 H;  1AWF H;  1P05 A;  1V2S T;  1C2M A;  1Q3X A;  2WPL S;  3P17 H;  5EJL A;  5AF9 H;  3UOP A;  1B5G H;  5T6G A;  1BHX F;  1GMC F;  1O3M A;  1C5V A;  1TNI A;  4FU8 A;  3ZYD A;  2H5C A;  1D3P B;  2JH5 D;  2VWO A;  2A32 A;  4B74 A;  1O2P A;  2XBW A;  4OM9 A;  3ZVE A;  1C2D A;  1O2W A;  4BNR A;  1D3T B;  6GCH F;  1GJ4 H;  3PYH A;  3P95 A;  1GBB A;  3TU7 H;  2B0F A;  1DX5 M;  2NWN A;  4XRN A;  5EGM A;  2YMS C;  3B9F H;  4TPY A;  1SG8 B;  4XD7 D;  3BV9 B;  1O2X A;  2FI4 E;  2VIO A;  6CHA B;  1QZ8 A;  1XKA C;  2BDC A;  4B2C A;  1GI0 A;  3ATM A;  3SNC A;  2QY0 B;  2EC9 H;  3A85 A;  3P92 A;  5GWZ A;  1LDT T;  1TPA E;  1YC0 A;  4F55 A;  3BG4 C;  3BTF E;  5FCK A;  3HGP A;  1NO9 H;  1GMH G;  1TNL A;  1FPC H;  4XSK U;  1DSU A;  3VXE H;  1S6H A;  3M37 A;  1YM0 A;  1TGB A;  3A81 A;  3DHK H;  5EOD A;  2BDA A;  1N1L A;  5J4S A;  4NIV A;  4D76 A;  2EST E;  1P2J A;  1JIM A;  1L4Z A;  1ACB E;  1TPP A;  3C1K A;  2BQW B;  2SGQ E;  3F9F A;  1QRX A;  1QGF A;  1C2G A;  3M3V A;  3SU3 A;  3EE0 B;  1RTF B;  1GBE A;  1SMF E;  3A88 A;  2BD4 A;  3RXF A;  1RFN A;  2BOH B;  1GJ6 A;  3OTJ E;  1O37 A;  2ZGC A;  2FTM A;  3Q3X A;  2EI8 A;  1QJ1 B;  2YMS B;  2CGA A;  2VWM A;  1CT0 E;  1THR H;  1T8O A;  1A5G H;  2EI7 A;  2XOK D;  1PFX C;  1DXP A;  2XC4 A;  4DCD A;  5A0B A;  1ARB A;  4I8G A;  1ZTJ A;  1HAZ B;  4INL A;  4OS2 A;  1WQS A;  3CNR A;  2R3U A;  2PUX B;  4XBC A;  3LJO A;  1EJN A;  1WQV H;  3PTN A;  3RXS A;  1P2I A;  1VJ9 U;  2PUQ H;  1K1O A;  2XXL A;  4MTB A;  3V7T A;  2YNA A;  2HOB A;  1X7A C;  4X1R U;  1BIO A;  1EZU C;  1AVX A;  1ELT A;  2F4L A;  1QB6 A;  3SUG A;  4J1Y A;  1TA2 A;  2AMQ A;  2ZG0 H;  2AEI H;  2PGB B;  1C4Y 2;  4D9Q A;  1E1Q D;  1UCY K;  3UTU H;  1T7C A;  1Y3X A;  3VPK A;  1GHB G;  4YT6 H;  2BD7 A;  1G2M A;  1HAI H;  1EPT A;  2STB E;  2Y5F A;  1TFX A;  1CU1 A;  1O35 A;  5EG4 A;  1AVG H;  1E0F D;  3SUD A;  1UTK A;  4RSP A;  1SGY E;  3LC3 A;  2QV1 A;  3G01 A;  2ALP A;  3PRB A;  1CA0 C;  3TGK E;  2A31 A;  2B9L A;  3SO3 A;  8GCH G;  5GPI B;  3KQ5 A;  1RD3 B;  1ABI H;  1FV9 A;  3PMA B;  2ZIQ H;  1ESB A;  1OWK A;  2ZDM A;  2WV4 A;  4WH6 A;  1TX8 A;  3NRL A;  1O33 A;  4B2A A;  1BRU P;  1AFQ C;  3SW2 B;  1TX7 A;  2AGG X;  5DP6 A;  1C1V H;  1NFX A;  1EAU A;  2FZZ A;  1A4W H;  3OY5 U;  2BDI A;  1C5O H;  4Q2K A;  3RMO H;  5JDU B;  1IQK A;  1O5B B;  3U98 H;  3M7T A;  1TAB E;  2A4O A;  1P3C A;  5IDK A;  1H8I H;  5BPE A;  1L1N A;  4MNW A;  2BY5 X;  2O8U A;  4K2Y A;  4XBB A;  1OOK B;  1XVM A;  1EZX C;  1S85 A;  1OWH A;  1CA0 B;  3ATW A;  1SGN E;  2P95 A;  4OGX A;  1ZHM A;  3SGB E;  2PTN A;  1NFY A;  5G4B A;  2A7J A;  2OLG A;  8KME 2;  4ISN A;  5K7R A;  3RM2 H;  2A5I A;  1YCP M;  4U32 A;  1EAT A;  3UNR A;  2HVY B;  3SHA H;  2UWL A;  2QE7 D;  1DE7 H;  5DK1 A;  2TBS A;  1AFQ B;  2O9Q A;  4ZKN U;  3SJK A;  1QBN A;  2JKH A;  2FO9 A; 
#chains in the Genus database with same CATH homology
 2V3M A;  3UAI C;  3MQK C;  2EQN A;  2EY4 C;  3U28 C;  2RFK C;  2HVY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...