3BTFE

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (TRYPSIN)
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btfE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btfE02
1P06A 3QUMP 4B1TA 2SNWA 2NU2E 2TGDA 1AVXA 1UTNA 1IQEA 2UWLA 1MBQA 1QL7A 2XWBI 1Q2WA 3NPSA 3RXEA 3O8DA 1SGDE 3UR6A 2GDDA 3F1SB 1OPHB 2EA3A 3MH5A 3BEIB 3M7UA 1TNIA 5J4QA 4K3JA 1F2SE 3DA9B 5DP5A 1O2QA 1QL9A 2VGCC 1AUTC 1BRAA 1CA0C 1K1OA 3MFJA 1EAWA 5AHGH 1DXPA 1FMGA 1KTSB 4DW2U 2BVSH 3SJOA 3BEFB 2GD4B 1ZRKA 4AYVB 3PWBA 2XCNA 2Q6DA 1CHGA 1K21H 1GJ7B 2ALVA 2BMGB 2DE9A 2QXGA 1WV7H 2W26A 1XMNB 1XUGA 6ESTA 2CHAC 1UTLM 1JBUH 5EXNA 6GCHF 3A7XA 1O3DA 5GCHG 1HCGA 2VVUA 5DP6A 1RTKA 2ULLA 3LC5A 4ZHLU 1G3EA 1ELFA 2D1JA 4HFPB 2C8XB 1TRMA 4D76A 2BB4A 3SUGA 4JZEH 1K1LA 3NK8A 5JPMH 1A0JA 2ZPQA 1FNIA 2OQ5A 2P95A 1P01A 3M5NA 1FY5A 3LGWA 1GBIA 3LGUA 1GI9B 2W7SA 2V0BA 3KNXA 1ETTH 1O3PB 1S84A 1ETRH 1SLXB 2FOAA 3ODDA 2SGDE 3ZZ4A 1PQ8A 2AMQA 2BLQA 2GVFA 1IQIA 5JYIA 1FV9A 5GXPA 4XBBA 2ZKSA 1XKBC 3A82A 2WUCA 1GVLA 1UCYH 2H2ZA 2SGPE 2BDIA 1EZQA 2C8ZB 1ZPBA 1C5RA 1EAUA 3RU4T 3SUFA 2GCHG 3HK6B 3E6PH 2JETC 1PYTD 3I29A 1TOMH 1AY6H 1HRTH 1C1WH 7ESTE 4MQAA 1NFUA 1XUFA 4IS5A 1JRSA 2OBQA 3P95A 1CQQA 2QCYA 1V2ST 3ZZ9A 2Y5GA 1MBMA 1KIGH 3ATIA 1SQAA 2Z3DA 3RU4D 1DY8A 2J9NA 3VEQB 1AZ8A 3RU4E 1L1JA 1IQLA 3OY6U 2B0FA 2ZU2A 4Y71A 1SGFG 1QJ6B 4YOIA 1T7CA 3LKWA 4CREA 5AF9H 2PSXA 1U6QA 3VXFH 1MTNB 1SGNE 4Y8YA 1WU1A 3SV8A 3U1JB 2PGQB 1O3GA 4ABAA 2O8TA 3TK5A 1O2OA 3S0NA 2C8YB 1ETSH 3S7HB 1CGHA 1C2HA 2C90B 4MNXA 1KTTB 2P8OC 1O3HA 3S9BA 4XBCA 4CRBA 3KEEA 1EASA 4KGAA 2BQWB 3M37A 1GJ5H 4YM9A 1FAKH 2G4TA 1L4DA 3D49H 4CR5A 3ZV9A 3ZVBA 1AE8H 8KME2 1AI8H 1C1SA 2P16A 1BBRE 1T31A 3A8CA 3R0FA 1HAVA 4K8YA 3BTFE 2V3OH 3BIUH 4LZ1H 3ITIA 4QT8C 4X1QU 2H9EH 1QRZA 3E90B 5L6NH 3TNSA 1ZRBA 4MLFB 3PTBA 4X2VA 2CN0H 1C2JA 4YT6H 1A61H 5A8YA 1V2VT 2OBOA 3M3VA 3G01A 1QY6A 1SGYE 7LPRA 3QO6A 4H6SB 4IC5A 3UNSA 4A1TA 5EOKA 4XSKU 1O30A 1H8IH 4BAQB 2YNAA 1TGBA 3VB4A 3ZVGA 1GBAA 1LVBA 5H4IB 2Z3EA 4TWWA 1GL0E 1LDTT 1O2YA 1SBWA 4YT7H 1ACBE 3EE0B 3RXAA 2PR3A 1CT4E 3MTYA 2BY5X 4JMYA 1V2MT 1UTOA 1AZZA 2XC5A 2AFQB 4ZKNU 2WPMS 2EI8A 5JBBS 3Q3KA 1IHTH 4FUDA 3ZZBA 1GDQA 1W8BH 2VH0A 1UVTH 1C2DA 3FP7E 4X8VH 1Y5BT 3ZVFA 5A0CA 1OP8A 2Z9KA 5C20A 3AAUA 2THFB 5L2YH 3RDZA 2QGRA 4MTBA 2W7UA 4I8JA 2G5NA 5E0GA 3SNCA 5A0AE 2ZFSA 1QL8A 2FLRH 1SVPA 1GJ4H 1TA2A 1K1NA 3S9CA 1ZMNA 4ISOA 4CH2B 4K1EA 3PB1E 4RSPA 3QK1A 1MAYA 2VINA 1OXGA 5F6MA 2PWXA 2A4RA 2Y5HA 3ZVCA 2BD2A 1VCWA 1Z6EA 4A6LA 4F4OC 4OS4A 5DP4A 1ANCA 1AHTH 1YPMH 3QZRA 3Q76A 9LPRA 1SLWB 5FPTA 3HGPA 3VB7A 1O2NA 2SGFE 3T2NA 1FLEE 3ESTA 1S85A 3RXHA 2UWPA 2Z9LA 1TX6A 3M36A 3SNDA 1V2LT 1LVOA 1S6FA 2H9TH 2W5EA 3LC3A 2FDAA 3BIVH 3TGIE 1QBVH 3E91A 2A5AA 2ZDNA 4D9RA 2ZFFH 3KQCA 4E7RG 1HFDA 4X6OA 1HXEH 4FUCA 1GHBG 1G3BA 2G51A 3F9HA 1DITH 3V7TA 3T25A 1O2ZA 2UUKB 1DPOA 2ZGHA 1TBZH 5FCRA 3A80A 3LDXH 4XOJA 5DO4H 1QBOA 2GT7A 2BLOA 2XYAA 4YO9A 3LJJA 1LQEA 3MMGA 2VIWA 2XC4A 3O8CA 4AYYB 1CSOE 1SG8B 1CHOG 2SGEE 2P3UB 2Z6BD 1A5GH 3SU2A 3VGCB 1EOJA 4B2AA 1DY9A 1AFQB 2VVVA 3TJUA 2D2DA 3BG4B 1GG6B 1WAYB 1MTNC 3PROA 3SO3A 3T26A 5HM9A 1ZMLA 4DOQA 5E2OA 1F5LA 3BTTE 2ZP0H 2M5TA 4ISHH 3IITA 3SHCH 5C67A 3GYMA 3FZDA 5C1UA 2EEKA 2ZEBA 1V2OT 1P2MA 3SU1A 1P09A 4JK5A 3NUMA 1LVMA 2BVRH 1ZSJA 1S6HA 2BD8A 3M5MA 4OGXA 1EX3A 2VWNA 2G4UA 4AFUA 4OGYA 1BOQA 1HNEE 3BTQE 1GVKB 1MCTA 2BX3A 1BRCE 2HPPH 2O9QA 4TY7A 5EU8A 1EQ9A 1VR1H 4WH8A 3RC6A 3SJ9A 2OXSA 3PMBB 4D9QA 1TNKA 1O2TA 3TJNA 4MNVA 4ABFA 4TPYA 1Y3WA 1Y5UT 2BY9X 1HAPH 1CA8B 1C5SA 2SGAA 2H5CA 5HM2A 1QTFA 2C93B 1T32A 3MU1A 2F9VA 1AD8H 1O3EA 2GDEH 3A83A 2FI5E 4IW4E 2ZGCA 1GJ6A 5EPYA 3SU5A 3TPIZ 1HIAA 3T5FH 4B74A 1F0UA 4VGCB 2V3HH 3BEUA 4CRFA 1QFKH 3U8RH 1BMAA 3SQEE 3QTOH 5JBAS 5BRRE 2BHGA 7KMEH 2B8OH 1YPKH 2ZC9H 1TRNA 4X6PA 1ARCA 1G9IE 1O0DH 2F9PA 1FIZA 1UHBB 1DX5M 2GZ9A 1F0SA 1JIMA 2VWMA 6GCHG 2FWWA 1HJ8A 3PMJA 4LK4A 1TGTA 1WYKA 1ZR0A 1QNJA 1SHHB 2ZHDA 2J4IA 2QIQA 2ZGXH 4TY6A 4GHQA 1G2LA 3O8BA 4JCNA 1LTOA 1IOEA 1ZSLA 5FXLA 1EJMA 1THSH 8LPRA 2Z9JA 3U1IB 5LGOA 1ABIH 2A4OA 2AH4X 5AFZH 1GDUA 2BD5A 2AGGX 1GHVH 1JOUB 2STBE 1C5YB 1TAWA 4NIVA 1SL3A 1THRH 1P3EA 3QN7A 4ISLA 1NU7B 2BX4A 2G52A 2O8MA 3A89A 1PPZA 5GJ4B 3KQEA 5EXMA 4J1YA 1LVYA 1F92A 2JH5D 1SOZA 1YM0A 5C1XA 1JXPA 1Z71A 4DGJA 4JZFH 3A85A 1MKXK 5DG6A 1O2JA 5TCCA 3M3SA 8GCHF 2Z9IA 5ESBA 4WMDA 4WXVA 1YPGH 3RLYH 1D3TB 3GICB 3K9XB 1EATA 4MDSA 4XFQA 3TH4H 2ZFTA 1E36B 2B9LA 1RTFB 3V3MA 2FX6A 1O3NA 3ATMA 3H5CB 1AUJA 3DUXH 2BZ6H 2R0KA 1K1JA 1F5RA 1WOFA 1UO6A 3BG8A 2GZ7A 1A0HB 1VJAU 1ELCA 2RDLA 1FI8A 4K2YA 4YESB 4I7YH 3MH4A 3V13A 4X1SU 5C2ZA 1GBTA 1G3CA 2ZCLP 1HAZB 2BYAX 4WMEA 2O8UA 2RG3A 2HLCA 1TONA 1ZYOA 4WWYA 1O5DH 1V2TT 3E0PB 1GMDF 2GKVE 1F5KU 2ZGBH 2CV3A 3Q00A 2ODPA 3MNBA 4NSYA 3QX5H 3VGCC 1ANBA 1AFQC 1C1OA 3F9GA 2DE8A 3BG4C 1CT2E 1GG6C 1V2KT 1IQKA 4I8KA 1O37A 1YPEH 2F9OA 1OX1A 1W3CA 5B6OA 4OS6A 1W13U 2BD9A 1O2VA 2W3KA 5EODA 4X8TH 1E37B 1T8MA 5EXLA 1MKWK 4FUGA 1D3PB 2A7CA 2ZIQH 2UUYA 3GY6A 5E2PA 1LPKB 4BXWA 3EQ0H 1GCDA 1A46H 1O2IA 2C8WB 1J16A 1MU6B 1IQHA 4K69A 4MPUA 1A2CH 3DT0H 1T4VH 1SPJA 3SQHE 4NA8A 5L2ZH 3B23B 2WPLS 1LO6A 2FX4A 1NRRH 4INLA 1KLIH 1HAHH 1AIXH 2UWOA 4Y7BA 4MVNA 1S82A 2XBXA 5T6DA 2W3IA 4K1SA 2ZDVH 3TLOA 1EB1H 1QB9A 1BTXA 2NU3E 1NTPA 1JIRA 1MUEB 1UTJA 1C5OH 1ESAA 1THPB 4HGCA 4Y79A 3MO3A 4NSVA 4M7GA 1O5FH 3PTNA 1KLTA 8ESTE 1M9UA 2BDYA 4FUJA 5A8XA 1ZJDA 2BD7A 2CJIA 3QDZB 4ZXXH 1LKBA 2WUBA 4VGCC 1LKAA 2FEQH 3ZZAA 2H9HA 1GBFA 1WQSA 3RXUA 5HMAA 3ATKA 4OS2A 1J14A 4Y8XA 4PROA 1V2RT 2FYRA 4DVAU 1EXFA 4ABDA 2D8WA 4X1NU 2F3CE 5JB8S 1O3BA 1RD3B 1ELTA 1L1NA 2AMPA 3U8OH 1N8OB 3LU9B 1QR3E 1EZUC 2A2QH 4NGAH 2ANWA 1BJUA 2WPIS 2GT8A 1DUAA 3TJOA 2BD3A 2FYQA 1HDTH 2R9PA 1OWEA 3SJKA 2WPJS 4IGDA 2HALA 1GJCB 2FOEA 1UK4A 1ELAA 3GCHB 4IBLH 1GJAB 4NIXA 1YP9A 5EQQA 1G2MA 1KXAA 1TE0A 2VWOA 4Y0ZE 3SHAH 2O8LA 3KF2A 1OWHA 1P3CA 1O2HA 1H4WA 3KQBA 3MU0A 1NO9H 4NWKA 1LQDB 2AGIX 1TPAE 1QCPA 4NCYA 4A1XA 1EAIA 1HAVB 1UCYK 1AWHB 4DCDA 4ASHA 2IN2A 2ALPA 1QIXB 4GAWA 1TMTH 5CE1A 3BF6H 2J92A 1YF4A 5FAHA 1NY22 1BTZA 2QY0B 5DKMA 1NPMA 1UTPA 1O2RA 4XBDA 3SV7A 1D3DB 1GHZA 4INHA 4CRCA 5FPYA 1E38B 1DWDH 1NS3A 3UIRA 1BTYA 1C1PA 1WUNH 1TABE 2ZQ2A 2WPHS 1LHCH 1TPOA 1VITF 1PQ5A 1VITH 2TIOA 3IG6B 1K28D 3T28A 5IYTA 4CR9A 1O3AA 5AFYH 1ESBA 1J17T 3E8LA 4AG1A 3GYLB 4Y10E 5DP7A 1FUJA 3UOPA 1O34A 4FXGH 1C1MA 1C1VH 1DFPA 1OS8A 1EAXA 1G37A 4Q80A 5DGJA 3ZZ6A 3MI4A 1ANDA 1F0TA 1G32B 1QHRB 2F9UA 1MCVA 2FOHA 1KXEA 3SGQE 3EDXB 2ODYB 2A1DB 1V2WT 3K2UA 1C2MA 1A4WH 4AOQA 1GI1A 1ZJKA 3RXKA 3ZV8A 3M35A 2AIPA 1ZTJA 1HAXB 3AVZA 4KP0A 3RXJA 3A81A 3N7OA 3E16B 1AB9B 2TGAA 2BY6X 2EI7A 4D7FA 4IC6A 1NZQH 1P03A 3A8DA 3RXDA 3D65E 4AZ2B 1OP0A 1SQOA 1MTVA 1K9OE 4UFDH 2FI4E 1DSUA 3VXEH 3RMNH 1WQVH 1LMWB 1TYNA 1KYNA 2ZFPH 3VB3A 2OUAA 4MG3A 4JZ1A 4A92A 1BBRH 1YLCA 2ZDMA 1TFXA 4BAMB 1OYTH 3BTHE 4SGAE 4B2BA 2ZNKH 1ZHMA 4DURA 1DS2E 5ABWA 3TIUA 1TX8A 3RXGA 5FCKA 1TNJA 4DJZB 3A87A 1GBBA 3Q77A 6CHAB 2FI3E 1XVOA 1C2EA 4CBNA 3GDUA 2BVXH 3UREA 2BDGA 3RXIA 4YOJA 3RXQA 5BPEA 1MD7A 4Y6DA 5LPEA 3TNTA 1UK2A 2FM2A 1P2IA 2O8WA 1NN6A 2Z3CA 4CRGA 1A1RA 1FY3A 3BSQA 1Q3XA 2G00A 4ZHAA 3PMHB 1SGIB 3AW1A 1DUEA 2FESH 3FANA 3A7VA 1TMBH 3LGVA 1B7XB 2AMDA 3VPKA 4JYVH 1JWTA 1Y5AT 2R2MB 3UNRA 2Z94A 4D7GA 1EPTB 4IMZA 1T8NA 1ZHRA 1PYTC 4H42U 5G4BA 3RXSA 1BCUH 1XUHA 3ZZ3A 1SI5H 2Q6FA 3MH6A 1SLUB 2I6QA 2A7HA 1WTHD 2XRCA 4ZROA 1YPLH 1O33A 1T8OA 4X2YA 4GSOA 1GBJA 1B0FA 1QA7A 1TIOA 1A0LA 1FPCH 1GBDA 1ELEE 1N8OC 1S81A 2SGQE 3OY5U 3P92A 4ZAEA 1O2GH 3LONA 5ESTE 3STIA 2FIRH 1G3DA 1CGIE 4I33A 1ANEA 1BB0B 1Z1JA 2OC7A 5T3HA 2F9NA 2SFAA 1W7XH 1BZXE 1ORFA 2Y82A 4THNH 5DP9A 3LGTA 1YKTA 1O32A 5EQRA 4YLUA 1RIWB 1NFXA 3QGJA 1Y3YA 3GCHC 8GCHG 1Z8JB 2ZDKA 3CS7A 3GY7A 4OS7A 3KHVA 3LH1A 1NRSH 3OYPA 4E05H 2G81E 1PPFE 2STAE 1SGCA 2VB0A 3NXPA 4INKA 3K6YA 1RRKA 2CGAA 2ZF0H 1C9PA 3TH3H 1QA0A 2ZHWH 1EPTA 1F7ZA 1OSSA 3AASA 1SQTA 1Y3VA 3OX7U 4YTAA 3U69H 4E06H 4WMFA 3L33A 4NA7A 2P3TB 5I25A 1KXCA 2FMJA 4DG4A 4IN2A 1V6DA 2ZPSA 4X1PU 1SSXA 1WTGH 1AWFH 3CP7A 2ZDLA 3GCNA 1GMCF 3KN2A 2QN5T 1CE5A 2JH0D 1GMDG 3NZIA 4B2CA 4ZKSU 1V2NT 3U98H 2R3YA 3ZVDA 1W2KH 2ZWLH 3LPRA 2G5VA 1HIAB 3EAJA 1XM1A 4X8UH 3GY5A 4ISIH 1AO5A 1SGFA 1SGPE 1GI0A 1O5GH 2HGTH 2WPKS 3SNBA 3SZNA 2HVXA 3K6ZA 1E0FD 1FAXA 1GI6A 3RXRA 1OP2A 2GP9B 2G55A 5T6GA 4I31A 4K8BA 4GPGA 5F8XA 1ZTKA 1O3FA 1DOJA 1C5PA 4WH6A 2CMYA 1K22H 1NFWA 4FUFA 4LXBH 5FBEA 1AB9C 5F8TA 2XWAA 3MU4A 3A88A 2C3SA 1A7SA 3MNCA 3RMMH 3M7QA 4UD9H 1PPBH 2GV7A 1W10U 1XUJA 1KXDA 3RXVA 1QQUA 1A3EH 1FQ3A 2OINA 2JKHA 1RTLA 4UEHH 2VIQA 2Z7FE 2ZO3H 1YGCH 4ABEA 1C5QA 5LPFA 2WYGA 3H7OA 1FIWA 4FUEA 2PUXB 3JZ2B 3M5LA 5FX5A 4AG2A 1SOTA 1XXDA 3EA8A 1P57B 3BN9A 4ABJA 4JK6A 1DE7H 1RFNA 1CBWB 1D6WA 2PUQH 4NA9H 2HPQH 2ZU1A 1UK3A 2FOBA 2ESTE 2XXLA 3A8BA 3BV9B 4AFZA 2QA9E 2QV1A 4LOYH 3TJVA 4Y8ZA 1O36A 2AERH 3A7TA 1L0ZA 3VFEA 1YLDA 3F6UH 1GPZA 3FP8E 1HBTH 3UPEA 2PKAA 1HV7A 1ELDE 4U30A 1BRBE 2VGCB 5EG4A 4TPIZ 2R2WU 1BHXB 5TJXA 1S0RA 1KXFA 1MAXA 1SFIA 1O3OA 3QWCH 3P17H 5A8ZA 1S0QA 3UWJH 1GBLA 2QAAA 4I8LA 3TITA 3PLBA 2FS9A 1L2EA 1SHYA 1TGCA 1D9IA 2G8TA 1C5LH 3SU0A 5A0BA 1C2FA 1PFXC 3GDVA 3EGKH 3KQDA 3SN8A 1SR5C 3RXFA 3ZVEA 1QB1A 1Z1IA 1OKXA 4U01A 5GWZA 4FU7A 3URCA 2FOMB 4IMQA 1O3CA 3KCGH 1HLTH 1TGNA 4E7NA 1O5CB 3I78A 3MYWA 4BOHA 1P9SA 1O39A 1DICA 1A5HA 2H1UA 3L3TA 1RIWC 3TK9A 4GUXA 3BTEE 3MHWU 4HZHA 1NROH 4AB8A 1WSSH 3FP6E 4YLQH 4KELA 2OLGA 4Z0KA 1C4V2 4UFGH 1KDQA 3SW2B 3IWMA 1IQFA 2QC2A 1C5ZB 2J34A 2XTTB 1IQNA 1O5AB 2FODA 1E34B 1GVZA 4D8NA 3M5OA 4JZDH 2Y80A 5AVDA 1J9CH 1LHEH 1N6XA 4X0WU 1QBNA 3BTDE 1VITG 3E3TA 2A4GA 1HJ9A 1UTQA 2BM2A 1RXPA 4B76A 3UQOA 5C5NA 4HI3A 3SBKA 5SGAE 1AKSA 1DWCH 3SV2H 4O3TA 1C1QA 1NRQH 2JH6D 2OTVA 2PKSB 1YYY1 3U8TH 1KXBA 9ESTA 3MOCA 1PJPA 1AU8A 1BHXF 3GY4A 2ZGJA 3R3GB 4ZH8A 3RXTA 4AFSA 2IJOB 2PTCE 2VNTA 3D23A 2F83A 1MTWA 3TH2H 2R3UA 1FZZA 2KAIA 1SGQE 1PQ7A 1A5IA 3GCTF 1ARBA 1HXFH 1P12E 1C2LA 1TBRH 1UVUH 3PO1B 2J95A 4MNWA 2ZTXA 1J15A 1VZQH 1CHOF 1QRWA 3A7ZA 1BRUP 2GV6A 4X2WA 1T4UH 1XX9A 3M61U 4O03A 5HGGA 5F03A 3ENSB 2NWNA 3P70B 5JB9S 2J94A 1MZDA 2WV4A 2J38A 5GIBA 1TOCB 1SB1H 1FONA 5HYOA 5CMXH 1MTSA 1W0YH 1L1GA 1G36A 1ZPZA 1BTPA 5EGMA 2QF0A 3GDSA 1X7AC 4DY7B 1W14U 2HOBA 5CHAB 4A7IB 4ZXYH 3HATH 1O5BB 3AAVA 4CH8B 3CENA 1D3QB 3SNAA 1AVGH 1DVAH 3T62A 1HGTH 3MO9A 1O2MA 3RC5A 1C1UH 1C2IA 2OP9A 1XUIA 3TVJB 1W12U 1DM4B 3AW0A 1GJ9B 1BDAA 1O2KA 4RKJB 2A45B 4I32A 5JBCS 2F9BH 2ZHQH 4I8GA 1NM6A 6LPRA 2XBWA 1HB0B 1CBWC 1QB6A 1ZZZA 1W0ZU 1O3IA 2BQ6B 1EJNA 1Z7KA 2BDBA 2FS8A 3B9FH 3MWIU 3RXBA 1KSNA 1OWIA 1GJDB 1K1PA 4B75A 3ZYEA 1YC0A 1V2QT 1BQYA 1KLJH 4MPWA 2ZTZA 3F9EA 3SI4H 1EP5A 2GMTB 2ZI2H 1C5WB 2B5TB 2A5IA 2OCVB 1JRTA 1GJBB 1QQ4A 3SI3H 2B7DH 3QZQA 4IN1A 5PTPA 3ZZ8A 5T6FA 3UWIA 5A2MH 5J4SA 2ZU5A 4TWYA 1HAIH 5F8ZA 1ZTLA 1QGFA 2ZHFH 4ISNA 3DD2H 2GZ8A 1O2PA 1C1TA 1DLKB 2OQUA 2BY8X 3TU7H 4B73A 4WVPE 1FY4A 1TB6H 3GY3A 3HKIB 2ZDAH 2Q6GA 2BXUH 2XNIA 4FU8A 1CVWH 4BAOB 1FPHH 1LCYA 1MU8B 3SJ8A 3ATWA 1GHAF 1C5UA 1H1BA 3EA7A 3L6PA 1AFEH 2VIOA 1TNGA 2TGTA 5FHTA 3DFJA 3FFGA 1NT1A 3W95A 1EP6A 1XXFA 1VCQA 1GGDB 1BIOA 1RGQA 2ANYA 2BDAA 4NFEA 3A8AA 5I46H 2BLVA 3SGAE 3QLPH 3PM3A 4O3UA 1NRNH 1RJXB 1UCYE 3SJIA 1BTHH 1P8VC 2J2UA 3HKJB 4RKOB 1DSTA 4DT7B 4NFFA 2VIDA 2LNCA 1IQGA 1LPZB 5DJ7A 3UFAA 2GCTB 2HRVA 1GMCG 7GCHF 1BT7A 3F68H 4X2XA 1GCTB 2FTLE 5FX6A 2ASUB 5EW1H 3T27A 2ZECA 1BTWA 2QXIA 4CHAB 1ZGIA 2PV9B 1O2LA 1NFYA 2PKSC 3M7TA 4UFEH 4U2WA 2QXHA 3SNEA 3ZZ5A 1C5NH 3UTUH 3A84A 2NU1E 1GBHA 2CXVA 1GHYH 3LT3A 1ZLRA 2BD4A 2AIQA 5DP8A 1V2JT 2QXJA 3SV6A 2AS9A 3GY2A 2FOFA 4KTCA 2CF8H 1OYQA 2ZHEH 1TQ0B 4GCHF 1C5XB 1C2KA 2YOLA 2A2XH 1EZXC 1CU1A 4BTUB 1O2UA 1P04A 4Y11E 3PO1C 2ZQ1A 1GMHF 2FLBH 3HK3B 3RXLA 1H9LB 4UE7H 1IQMA 3U9AH 1AE5A 1P9UA 2IOTA 2XC0A 4AGJA 2OC8A 2RA0A 4O97A 1BBRK 1C1NA 4GHTA 4FUHA 5FPSA 3RMLH 3UNQA 1LHFH 1NRPH 5LPRA 1P2OA 4MPXA 1O38A 2RCEA 1GBKA 2FP7B 2K1QA 3S69A 1DT2A 2VIPA 5E0JA 4BNRA 3QGNB 3TGJE 5CHAC 4FVDA 5EPNA 3SU6A 2XBVA 2OD3B 1TRYA 3SOSA 2GTBA 1YPHE 1AGJA 4AFQA 2HNTE 3VB5A 1ZSKA 4UONA 3EYDA 3URDA 1BMMH 3OU0A 4K60A 2XCFA 3RLWH 1TX7A 1MH0A 4KKDA 2Q1JA 3M3TA 2A4QA 3NKKA 1GBMA 2UUFB 1C5MD 2HNTF 1YPJH 3P8OA 2ANMH 1P2QA 1Q31A 1FY1A 3RC4A 1XVMA 1BTUA 4X8SH 3A86A 1O3MA 3BTGE 1MZAA 4WXIA 1MQ6A 2NU0E 4JZIA 4X6NA 2AEIH 5DK1A 2H5DA 2GMTC 2EI6A 4AB9A 1P11E 3MO6A 3SUDA 1OWJA 3ZZ7A 1YCPH 4J2YB 1YCPM 3ODFA 1TALA 4HTCH 1FN8A 1YCPK 2ODQA 1O3KA 1DDJA 3RM2H 1YBWA 1SFQB 4Q2KA 2R0LA 1ZMJA 3RP2A 2UUJB 2FZZA 4RN6A 1C5VA 1NC6A 1SLVB 2AYWA 1EKBB 4NWLA 2BZAA 1Z6JH 1FJSA 1LPGB 5L30H 1ESTA 4UFFH 1V3XA 2ZU4A 3RM0H 3LGYA 1H9HE 1GI5A 1ZOMA 2ILNA 5GCHF 4FUIA 3FAOA 3MH7A 3BTME 4JYTA 3PYHA 1W7GH 3C27B 4CRAA 3DHKH 1GI3A 2PLXA 2EC9H 1GI7B 2HWLB 2ZCHP 3RMOH 1BITA 1C5TA 3C1KA 4AGKA 4AORA 1GGDC 1VGCB 4BAKB 1LHGH 1ABJH 3GISB 3STJA 3PMAB 5GPIB 2A5KA 4BXSA 3S7KB 2WINI 5DPAA 1C2GA 2RA3A 1XUKA 3P6ZB 4CRDA 3I77A 3PV4A 1Z8RA 4AN7A 1O35A 3V0XA 4ABIA 1GWAA 3WY8A 2BOKA 1GHWH 1FY8E 1KY9A 1HYLA 1L4ZA 4CBOA 1VJ9U 4ZKOU 1H9IE 4YOGA 2ZU3A 1NU9A 2GCTC 2FXRA 4NG9H 1GCTC 1Y3XA 1BJVA 1ELBA 2A0QB 1IHSH 1EOLA 1MD8A 2Y7XA 4CHAC 1YPHC 1GBEA 3P8FA 2C4FH 2GCHF 3GOVB 1OWKA 1GI8B 1K2I1 2HNTC 1EZSC 5EQSA 3RUOA 1HJAB 1DLEA 4UDWH 2ZA5A 4Q7YA 3UY9A 3GCTG 4Y7AA 3MNSA 1TPSA 1P0SH 3VB6A 5C5OA 5K7RA 2Y81A 2PKAB 4NIYA 3Q3YA 1OWDA 4Y76A 1GHXH 2FTMA 1P05A 3P8NA 1CGJE 3PWCA 1HAOH 3FVFB 1INCA 1T8LA 2ZZUH 2H6MA 4B71A 5TCAA 1RS0A 3ZZDA 1QURH 2ZFQH 3EA9A 3T29A 1OOKB 2LPRA 1A3BH 1UTMA 1K1MA 2V6NA 4OS1A 1QJ1B 3NWUA 3ELAH 1JMOH 3HGNA 1SMFE 2TBSA 1MMJN 1ELGA 4DIIH 1O3LA 4Y0YE 1EB2A 3LJOA 1UMAH 2BDHA 3TK6A 1HAGE 4BAHB 5DP3A 1TQ7B 1UVPA 4K5ZA 1O2SA 2D26C 2BTCE 4FVBA 3W94A 3TGKE 4LZ4B 2A7JA 3GY8A 1GJ8B 2VIVA 2ZPRA 4BANB 4BTIB 5EW2H 1C4Y2 1QJ7B 1EJAA 3UUZA 6CHAC 1O2XA 4Q7ZA 1QRXA 2ZTYA 2NU4E 1D4PB 2TGPZ 1FDPA 1MQ5A 3F9FA 1UJ1A 3RXCA 1B5GH 4X1RU 1BMLA 1HAYB 1KDQB 5JDUB 4MPVA 3UR9A 3SGBE 1O5EH 2VU8E 1ZGVA 3RXPA 5HXFA 2BY7X 1GL1A 1HPGA 3O8RA 1FN6A 1WCZA 2A31A 2VWLA 1CA0B 3UOUA 2VVCA 2Y6TA 1EPTC 4KTSA 1GI4A 1AN1E 2FOGA 4H6TA 1P2JA 2BXTH 1AKSB 3S9AA 2WYJA 4Z6AH 4R8TB 1ZPCA 3SU3A 3ZYDA 4ABGA 3PLKA 1E35B 1C4U2 1S5SA 4GLYA 1P02A 1SC8U 2BLWA 3MU5A 2PSYA 4FUBA 4XDEA 1EUFA 3BTWE 4GVUA 2V35A 3KL6A 1P2KA 1XKAC 1PPCE 2CHAB 3ZZCA 3E0NB 5E8EH 4YZUA 1TBQH 1AVWA 3LIWA 2XBYA 1FXYA 5FBIA 2YNBA 4U32A 1GHAG 2A32A 3Q3XA 1TGSZ 1CO7E 3GCOA 1IAUA 2KAIB 1G30B 2TRMA 2FOCA 1D6RA 3JZ1B 4SGBE 1AMHA 3MNXA 4NZQA 4TYDA 5IDKA 3P8GA 4ZHMU 3UQVA 1TLDA 5ETXA 2P3FH 1F0RA 1SGTA 2SNVA 1V2PT 4H4FA 4ESTE 4NZLA 4O9VA 1GDNA 4XE4A 4R0IA 1N6YA 1ID5H 1VGCC 1CT0E 1PPHE 1TPPA 2OC0A 1O31A 5A09A 1Z8IB 2P94A 4ABHA 2AGEX 4NIWA 7GCHG 1MTUA 2QF3A 3H7TA 1V2UT 4ZKRU 1DWBH 1MKXH 4MNYA 2ZFRH 1Y59T 4ZMAH 4A1VA 2PW8H 1O2WA 3V12A 3B8JA 2FO9A 3LH3A 2JETB 1PQAA 5LH8A 1UVOA 1S83A 1HUTH 1GBCA 5GDSH 3SV9A 2VH6A 2Y5FA 1VCPA 2FPZA 4WJG2 2VJ1A 1J8AA 2CF9H 1Y8TA 4JYUH 5C1YA 2QYIA 1UHBA 1BMNH 3NCLA 1W11U 3OSYA 3LGIA 1SGEE 3SUEA 4Q7XA 3RXMA 4DIHH 1UVSH 2DUCA 3E1XB 5E0HA 2GX4A 4GCHG 1HJAC 1GHBF 2F91A 2PHBA 1C1RA 1ZHPA 1WBGB 2OC1A 2ZCKP 2GGVB 5C3NA 4F49A 1DWEH 3MU8A 1TNLA 1P10A 3LOXA 3ATLA 3DFLA 1GMHG 3SU4A 2P59A 1TWXB 4FU9A 3PLPA 1TA6A 3BTKE 3RXOA 4A5TS 1LHDH 1Y3UA 2I6SA 1Z8GA 3A7YA 1NESE 1P2NA 2P8OB 4X6MA 2Y7ZA 1N1LA 1PPEE 3HPTB 1DXWA 4OS5A 2WV5A 2BDCA 3SORA 3ZVAA 2PFEA 1IQJA 4WF8A 3KGPA 4WY3A 2BQ7B 1BA8B 4ZUHA 2ANKH 3KIDU 1PPGE 3A7WA 4I8HA 4K1TA 1MKWH 4KTUA 4ABBA 3D62A 1BUIA 3QTVH 4AX9H 1SGRE 1TNHA 3FZZA 1H8DH 1K1IA 5K0HA 2Z9GA 1AQ7A 2BOHB 2ZG0H 1DANH 5JBTA 2IPHA 3K65B 1GI2A 3OTJE 2P93A 1ELVA 1C9TA 2XW9A 2TPIZ 2PGBB 1UTKA 3CS0A 1B0EA 1O3JA 2PTNA 1TMUH 4BTTB
chains in the Genus database with same CATH superfamily
1P06A 3QUMP 4B1TA 2SNWA 2NU2E 2TGDA 1AVXA 1UTNA 4XD7D 2F43B 1IQEA 2UWLA 1MBQA 1QL7A 2XWBI 1Q2WA 3NPSA 3RXEA 3O8DA 1SGDE 3UR6A 2GDDA 3F1SB 1OPHB 2EA3A 3MH5A 3BEIB 3M7UA 1TNIA 5J4QA 4K3JA 1F2SE 3DA9B 5DP5A 1O2QA 1QL9A 2VGCC 1AUTC 1BRAA 1CA0C 1K1OA 3MFJA 1EAWA 5AHGH 1DXPA 1FMGA 1KTSB 4DW2U 2BVSH 3SJOA 3BEFB 2GD4B 1ZRKA 4AYVB 3PWBA 2XCNA 2Q6DA 1CHGA 1K21H 1GJ7B 3OTPA 2ALVA 2BMGB 2DE9A 4AC9A 2QXGA 1WV7H 2W26A 1XMNB 1XUGA 6ESTA 2CHAC 1UTLM 1JBUH 5EXNA 6GCHF 3A7XA 1O3DA 5GCHG 1HCGA 2VVUA 5DP6A 1RTKA 2ULLA 3LC5A 4ZHLU 1G3EA 1ELFA 2D1JA 4HFPB 2C8XB 1TRMA 4D76A 2BB4A 3SUGA 4JZEH 1K1LA 5KECA 3NK8A 5JPMH 1A0JA 2ZPQA 1FNIA 2OQ5A 2P95A 1P01A 3M5NA 1FY5A 3LGWA 1GBIA 2KFWA 3LGUA 1GI9B 3N99A 2W7SA 2V0BA 3KNXA 1ETTH 1O3PB 1S84A 1ETRH 1SLXB 2FOAA 3ODDA 2SGDE 3WWBA 3ZZ4A 1PQ8A 2AMQA 2BLQA 2GVFA 2YMSC 1IQIA 5JYIA 1FV9A 5GXPA 4XBBA 2ZKSA 1XKBC 3A82A 2WUCA 1GVLA 1UCYH 2H2ZA 2SGPE 2BDIA 1EZQA 2C8ZB 1ZPBA 1FX0B 1C5RA 1EAUA 4ACBA 3RU4T 3SUFA 2GCHG 3HK6B 3E6PH 2JETC 1PYTD 3I29A 1TOMH 1AY6H 1HRTH 1C1WH 7ESTE 4MQAA 1NFUA 1XUFA 4IS5A 1JRSA 2OBQA 3P95A 1CQQA 2QCYA 1V2ST 3ZZ9A 2HLDD 2Y5GA 1MBMA 1KIGH 3ATIA 1SQAA 2Z3DA 3RU4D 1DY8A 2J9NA 3VEQB 1AZ8A 3RU4E 1WDIA 1L1JA 1IQLA 3OY6U 2B0FA 2ZU2A 4Y71A 1SGFG 1QJ6B 4YOIA 1T7CA 3LKWA 4CREA 5AF9H 2PSXA 1NBME 1U6QA 3VXFH 1MTNB 1E1RD 1SGNE 1WU1A 4XRNA 4Y8YA 3SV8A 3U1JB 2PGQB 1O3GA 4ABAA 2O8TA 3TK5A 1O2OA 3S0NA 2C8YB 1ETSH 3S7HB 1CGHA 1C2HA 2C90B 4MNXA 1KTTB 2P8OC 1O3HA 3S9BA 4XBCA 4CRBA 3KEEA 1EASA 4KGAA 2BQWB 3M37A 1GJ5H 4YM9A 1FAKH 2G4TA 1L4DA 3D49H 4CR5A 3ZV9A 3ZVBA 1AE8H 8KME2 1AI8H 1C1SA 2P16A 1BBRE 1T31A 3A8CA 3GS9A 3R0FA 1HAVA 4K8YA 2K8IA 3BTFE 2V3OH 3BIUH 4LZ1H 3ITIA 4QT8C 4X1QU 2H9EH 1QRZA 3E90B 5L6NH 3TNSA 1ZRBA 4MLFB 3PTBA 4X2VA 2CN0H 1C2JA 5CHBA 4YT6H 1A61H 5A8YA 1V2VT 2OBOA 3M3VA 3G01A 1QY6A 1SGYE 7LPRA 3QO6A 4H6SB 4IC5A 3UNSA 4A1TA 5EOKA 4XSKU 1O30A 1H8IH 4BAQB 2YNAA 1TGBA 3VB4A 3ZVGA 1GBAA 1LVBA 4ACAA 5H4IB 2Z3EA 4TWWA 1GL0E 1LDTT 1O2YA 1SBWA 4YT7H 5C17A 1ACBE 3EE0B 3RXAA 2PR3A 1CT4E 3MTYA 2BY5X 4JMYA 1V2MT 1UTOA 1AZZA 2XC5A 2AFQB 2QF5A 4ZKNU 2WPMS 5KGOA 2EI8A 5JBBS 3Q3KA 2KCPA 1IHTH 4FUDA 2WHXA 3ZZBA 1GDQA 1W8BH 2VH0A 1UVTH 1C2DA 3FP7E 4X8VH 1Y5BT 3ZVFA 5A0CA 1OP8A 2Z9KA 5C20A 3AAUA 2THFB 1EFRD 5L2YH 3RDZA 2QGRA 4MTBA 2W7UA 4I8JA 2G5NA 5E0GA 3SNCA 5A0AE 2ZFSA 1QL8A 2FLRH 1SVPA 1GJ4H 4M9FA 1TA2A 1K1NA 3S9CA 1ZMNA 4ISOA 4CH2B 4K1EA 3PB1E 1MABB 4RSPA 3QK1A 3FKSD 1MAYA 2VINA 3WW7A 1OXGA 3AK5A 5F6MA 2PWXA 2A4RA 2Y5HA 3ZVCA 2BD2A 1VCWA 1Z6EA 4A6LA 4F4OC 4OS4A 5DP4A 1ANCA 1AHTH 1YPMH 3QZRA 3Q76A 9LPRA 3UB0A 1SLWB 3N7EA 5FPTA 3HGPA 3VB7A 1O2NA 2SGFE 3T2NA 1FLEE 3ESTA 1S85A 3RXHA 2UWPA 2Z9LA 1TX6A 3M36A 3SNDA 1V2LT 1LVOA 1S6FA 2H9TH 2W5EA 3LC3A 2FDAA 3BIVH 3TGIE 1QBVH 1YLNA 3E91A 2A5AA 2ZDNA 4D9RA 2ZFFH 3KQCA 4E7RG 1HFDA 4X6OA 1HXEH 4FUCA 1GHBG 1G3BA 2G51A 3F9HA 1DITH 3V7TA 3T25A 1O2ZA 2UUKB 1DPOA 2ZGHA 1TBZH 5FCRA 3A80A 3LDXH 4XOJA 5DO4H 1QBOA 2GT7A 2BLOA 4B6EA 2XYAA 4YO9A 3LJJA 1LQEA 3MMGA 2VIWA 2XC4A 3O8CA 4AYYB 1CSOE 3MQKC 1SG8B 1CHOG 2SGEE 2P3UB 2Z6BD 1A5GH 3SU2A 3VGCB 1EOJA 4B2AA 1DY9A 1AFQB 2VVVA 3TJUA 2D2DA 3BG4B 1GG6B 1WAYB 1MTNC 3PROA 3SO3A 3T26A 5HM9A 1ZMLA 4DOQA 5E2OA 1F5LA 3BTTE 4OM9A 2L6OA 2ZP0H 2M5TA 4ISHH 3IITA 3SHCH 5C67A 3GYMA 3FZDA 2K0QA 5C1UA 2EEKA 5EJ1A 2ZEBA 1V2OT 1P2MA 3SU1A 1P09A 4JK5A 3NUMA 1LVMA 2BVRH 1ZSJA 1S6HA 2BD8A 3M5MA 4OGXA 1EX3A 2VWNA 2G4UA 4AFUA 4OGYA 1BOQA 1HNEE 3BTQE 1GVKB 1MCTA 2BX3A 1BRCE 2HPPH 2O9QA 4TY7A 5EU8A 1EQ9A 1VR1H 4WH8A 3RC6A 3SJ9A 2OXSA 3PMBB 4D9QA 1TNKA 1O2TA 3TJNA 4MNVA 4ABFA 4TPYA 1Y3WA 1Y5UT 2BY9X 1HAPH 1CA8B 1C5SA 2SGAA 2H5CA 5HM2A 1QTFA 2C93B 1T32A 3MU1A 2F9VA 1AD8H 1O3EA 2GDEH 3A83A 2FI5E 4IW4E 2ZGCA 1GJ6A 5EPYA 5DN6D 3SU5A 3TPIZ 1HIAA 3T5FH 4B74A 1F0UA 4VGCB 1VKYA 2V3HH 3BEUA 4CRFA 1QFKH 3U8RH 1BMAA 3SQEE 3QTOH 5JBAS 5BRRE 2BHGA 7KMEH 2B8OH 1YPKH 3SYJA 2ZC9H 1TRNA 4X6PA 3WWFA 1ARCA 1G9IE 1O0DH 2F9PA 1FIZA 1UHBB 1DX5M 2GZ9A 1F0SA 1JIMA 2VWMA 6GCHG 2FWWA 1HJ8A 3PMJA 4LK4A 1TGTA 1WYKA 1ZR0A 2JDID 1QNJA 1SHHB 2ZHDA 2J4IA 2QIQA 2ZGXH 4TY6A 4GHQA 1G2LA 3O8BA 4JCNA 1LTOA 1IOEA 1ZSLA 5C94A 5FXLA 1EJMA 1THSH 8LPRA 2Z9JA 3U1IB 5LGOA 1ABIH 2A4OA 2AH4X 5AFZH 1GDUA 2BD5A 2AGGX 1GHVH 3FOAA 1JOUB 2STBE 1C5YB 1TAWA 4NIVA 1SL3A 1THRH 1P3EA 3QN7A 4ISLA 1NU7B 2BX4A 2G52A 2O8MA 3A89A 1PPZA 5GJ4B 2LELA 3KQEA 5EXMA 4J1YA 1LVYA 1F92A 2JH5D 1SOZA 1YM0A 5C1XA 1JXPA 1Z71A 4DGJA 4JZFH 3A85A 1MKXK 5DG6A 1O2JA 5TCCA 3M3SA 8GCHF 2Z9IA 5ESBA 4ZCNA 4WMDA 4WXVA 1YPGH 3RLYH 1D3TB 3GICB 3K9XB 1EATA 4MDSA 4XFQA 3TH4H 2ZFTA 1E36B 2B9LA 1RTFB 3V3MA 2FX6A 1O3NA 3ATMA 3H5CB 1AUJA 3DUXH 2BZ6H 2R0KA 1K1JA 1F5RA 1WOFA 1UO6A 3BG8A 2GZ7A 1A0HB 1VJAU 1ELCA 2RDLA 1FI8A 4K2YA 4YESB 4I7YH 3MH4A 3V13A 4RT1A 4X1SU 5C2ZA 1GBTA 1G3CA 2ZCLP 1HAZB 2BYAX 4WMEA 2O8UA 2RG3A 2HLCA 2LP6A 1TONA 1ZYOA 4WWYA 1O5DH 1V2TT 3E0PB 1GMDF 2GKVE 5F53A 1F5KU 2ZGBH 2CV3A 3Q00A 2ODPA 3MNBA 4NSYA 3QX5H 3VGCC 1ANBA 1AFQC 1C1OA 3F9GA 2DE8A 3BG4C 1CT2E 1GG6C 1V2KT 1IQKA 4I8KA 1O37A 1YPEH 2F9OA 1OX1A 1W3CA 5B6OA 4OS6A 1W13U 2BD9A 1O2VA 2W3KA 5EODA 4X8TH 1E37B 1T8MA 5EXLA 1MKWK 4FUGA 1D3PB 2A7CA 2ZIQH 2UUYA 3GY6A 5E2PA 1LPKB 4BXWA 3EQ0H 1GCDA 1A46H 1O2IA 2C8WB 1J16A 1MU6B 2F4LA 1IQHA 4K69A 4MPUA 4I86A 1A2CH 3DT0H 1T4VH 1SPJA 3SQHE 4NA8A 2PP6A 3B23B 5L2ZH 2WPLS 4RI0A 1LO6A 2FX4A 1NRRH 4INLA 1KLIH 1HAHH 1AIXH 2UWOA 4Y7BA 4MVNA 1S82A 2XBXA 5T6DA 2W3IA 4K1SA 2ZDVH 3TLOA 1EB1H 1QB9A 1BTXA 2NU3E 1NTPA 2J97A 1JIRA 1MUEB 1UTJA 1C5OH 1ESAA 1THPB 4HGCA 4Y79A 3MO3A 4NSVA 4M7GA 1O5FH 3PTNA 1KLTA 8ESTE 1M9UA 2BDYA 4FUJA 5B6LA 5A8XA 3PV5A 1ZJDA 2BD7A 2CJIA 3QDZB 4ZXXH 1LKBA 2WUBA 4VGCC 1LKAA 1W0KD 2FEQH 3ZZAA 2H9HA 1GBFA 1WQSA 3RXUA 5HMAA 3ATKA 4OS2A 1J14A 4Y8XA 4PROA 1V2RT 2FYRA 4DVAU 1EXFA 4ABDA 2D8WA 4X1NU 2F3CE 5JB8S 1O3BA 1RD3B 1ELTA 1L1NA 2AMPA 3U8OH 1N8OB 3LU9B 1QR3E 1EZUC 2A2QH 4NGAH 4HG6A 2ANWA 1BJUA 2WPIS 2GT8A 1DUAA 4Q4LA 3TJOA 2BD3A 2FYQA 1HDTH 2R9PA 1OWEA 3SJKA 2WPJS 4IGDA 2HALA 1GJCB 2FOEA 5IK2D 1UK4A 3PRBA 1ELAA 3GCHB 4IBLH 1GJAB 4NIXA 1YP9A 2L74A 5EQQA 1G2MA 1KXAA 1TE0A 2VWOA 4Y0ZE 3SHAH 2O8LA 3KF2A 1OWHA 1P3CA 1O2HA 1H4WA 3KQBA 3MU0A 1NO9H 3OAAD 4NWKA 1LQDB 2AGIX 1TPAE 1QCPA 4NCYA 4A1XA 1EAIA 3DSGA 1HAVB 1UCYK 1AWHB 4DCDA 4ASHA 2IN2A 2ALPA 1QIXB 4GAWA 1TMTH 5CE1A 3BF6H 2J92A 1YF4A 5FAHA 1NY22 1BTZA 2QY0B 5DKMA 1NPMA 1UTPA 1O2RA 4XBDA 3SV7A 1D3DB 1GHZA 3OEED 4INHA 4CRCA 5FPYA 1E38B 1DWDH 1NS3A 3UIRA 1BTYA 1C1PA 1WUNH 1TABE 2ZQ2A 2WPHS 1LHCH 1TPOA 1VITF 1PQ5A 1VITH 2TIOA 3IG6B 1K28D 3T28A 4FETA 5IYTA 4CR9A 1O3AA 5AFYH 2W6ID 1ESBA 1J17T 3E8LA 4AG1A 3GYLB 4Y10E 5DP7A 1FUJA 3UOPA 1O34A 4FXGH 1C1MA 1C1VH 1DFPA 1OS8A 1EAXA 1G37A 4Q80A 5DGJA 3ZZ6A 3MI4A 1ANDA 1F0TA 1G32B 1QHRB 2F9UA 1MCVA 2FOHA 1KXEA 3SGQE 3EDXB 2ODYB 2A1DB 1V2WT 3K2UA 1C2MA 1A4WH 4AOQA 1GI1A 1ZJKA 3RXKA 3ZV8A 3M35A 2AIPA 1ZTJA 1HAXB 3AVZA 4KP0A 3RXJA 3A81A 3N7OA 3E16B 1AB9B 2TGAA 2BY6X 2EI7A 4D7FA 4IC6A 1NZQH 1P03A 3A8DA 3RXDA 3D65E 4AZ2B 1OP0A 1SQOA 1MTVA 1K9OE 4UFDH 2FI4E 1DSUA 3VXEH 3RMNH 1WQVH 1LMWB 1TYNA 1KYNA 2ZFPH 3VB3A 2OUAA 4MG3A 4JZ1A 4A92A 1BBRH 4F48B 1YLCA 2ZDMA 1TFXA 4BAMB 1OYTH 3BTHE 4SGAE 4B2BA 2ZNKH 1ZHMA 4DURA 1DS2E 5ABWA 3TIUA 1TX8A 3RXGA 5FCKA 2WPDD 2XOKD 1TNJA 4DJZB 3A87A 1GBBA 3Q77A 6CHAB 2FI3E 1XVOA 1C2EA 4CBNA 1H8ED 3GDUA 2BVXH 3UREA 2BDGA 3RXIA 4YOJA 3RXQA 5BPEA 1MD7A 4Y6DA 5LPEA 3TNTA 1UK2A 2FM2A 1P2IA 2O8WA 1NN6A 2Z3CA 4CRGA 2RFKC 1A1RA 1FY3A 1H8HD 1Q3XA 3BSQA 2G00A 4ZHAA 3PMHB 1SGIB 3AW1A 1DUEA 2FESH 3FANA 3A7VA 1TMBH 2M2AA 3LGVA 1B7XB 2AMDA 3VPKA 4JYVH 1JWTA 1Y5AT 2R2MB 3UNRA 2Z94A 4D7GA 1EPTB 4IMZA 1T8NA 1ZHRA 1PYTC 4H42U 5G4BA 3RXSA 1BCUH 1XUHA 3ZZ3A 1SI5H 2Q6FA 3MH6A 1SLUB 2I6QA 2A7HA 1WTHD 2XRCA 4ZROA 5CDFE 1YPLH 1O33A 2KCYA 1T8OA 2KCAA 4X2YA 4GSOA 1GBJA 2JJ2D 1B0FA 1QA7A 1TIOA 1A0LA 1FPCH 1GBDA 1ELEE 1N8OC 1S81A 2SGQE 3OY5U 3P92A 4ZAEA 1O2GH 3LONA 5ESTE 3STIA 2FIRH 1G3DA 1CGIE 1E1QD 3FO8D 4I33A 1ANEA 1BB0B 2WZQA 1Z1JA 2OC7A 5T3HA 2F9NA 4F55A 2SFAA 1W7XH 1BZXE 1ORFA 2Y82A 4THNH 3KQ5A 2CK3D 5DP9A 3LGTA 1YKTA 1O32A 5EQRA 4YLUA 1RIWB 1NFXA 3QGJA 1Y3YA 3GCHC 8GCHG 1Z8JB 2ZDKA 3CS7A 3GY7A 4OS7A 3KHVA 3LH1A 1NRSH 3OYPA 4E05H 3F0OA 2G81E 3KYFA 1PPFE 2STAE 1SGCA 2VB0A 3NXPA 4INKA 2KX4A 3K6YA 1RRKA 2CGAA 2ZF0H 1C9PA 3TH3H 1QA0A 2ZHWH 1EPTA 1F7ZA 1OSSA 3OE7D 3AASA 1SQTA 1Y3VA 3OX7U 4YTAA 3U69H 4E06H 4WMFA 3L33A 4NA7A 2P3TB 5I25A 1KXCA 2FMJA 4DG4A 4IN2A 1V6DA 2ZPSA 4X1PU 1SSXA 1WTGH 1AWFH 3CP7A 2ZDLA 3GCNA 1GMCF 3KN2A 4P02A 2QN5T 3SZEA 1CE5A 2JH0D 1GMDG 3NZIA 4B2CA 4ZKSU 1V2NT 3U98H 2R3YA 3ZVDA 4TT3D 1WXRA 1W2KH 2ZWLH 3LPRA 2G5VA 1HIAB 3EAJA 1XM1A 2W6JD 5T1VA 4X8UH 3GY5A 4ISIH 1AO5A 1SGFA 1SGPE 1GI0A 1O5GH 2HGTH 2WPKS 3SNBA 3SZNA 2HVXA 3K6ZA 1E0FD 1FAXA 1GI6A 3RXRA 1OP2A 2GP9B 2WSSD 2G55A 5T6GA 4I31A 4K8BA 4GPGA 5F8XA 2JIZD 1ZTKA 1O3FA 1DOJA 2KM0A 1C5PA 5EIYA 4WH6A 2CMYA 1K22H 1NFWA 4FUFA 1E79D 4LXBH 5FBEA 1AB9C 5F8TA 2XWAA 3MU4A 3A88A 2C3SA 2IPQX 1A7SA 3MNCA 3RMMH 3M7QA 4UD9H 1PPBH 2GV7A 1W10U 1XUJA 3OEHD 3F2FA 1KXDA 3RXVA 1QQUA 1A3EH 1FQ3A 2OINA 2JKHA 5GNDA 1RTLA 4UEHH 2VIQA 2Z7FE 2ZO3H 1YGCH 4ABEA 1C5QA 5LPFA 2WYGA 2VBCA 3H7OA 1FIWA 4FUEA 2PUXB 3JZ2B 3M5LA 5FX5A 4AG2A 1SOTA 1XXDA 3EA8A 1P57B 3BN9A 4ABJA 4JK6A 1DE7H 1RFNA 1CBWB 1D6WA 1BMFD 2PUQH 4NA9H 2HPQH 2ZU1A 1UK3A 2FOBA 1OHHD 2ESTE 2XXLA 3A8BA 3BV9B 4AFZA 2QA9E 2QV1A 4LOYH 3TJVA 4Y8ZA 1O36A 2AERH 3A7TA 1L0ZA 3VFEA 1YLDA 3F6UH 1GPZA 3FP8E 1HBTH 3UPEA 2PKAA 1HV7A 1ELDE 4U30A 1BRBE 2VGCB 5EG4A 3KYGA 4TPIZ 2R2WU 1BHXB 5TJXA 1S0RA 1KXFA 5C0TA 1MAXA 1SFIA 1O3OA 3QWCH 3P17H 5A8ZA 1S0QA 3UWJH 1GBLA 2QAAA 4I8LA 3TITA 3PLBA 2FS9A 1L2EA 1SHYA 1TGCA 1D9IA 2KZ4A 2G8TA 1C5LH 1SQRA 3SU0A 5A0BA 1C2FA 1PFXC 3GDVA 3EGKH 3KQDA 3SN8A 1SR5C 3RXFA 3ZVEA 1QB1A 1Z1IA 1OKXA 4U01A 5GWZA 4FU7A 3URCA 2FOMB 4IMQA 1O3CA 3KCGH 1HLTH 1TGNA 4E7NA 1O5CB 2IJD1 3I78A 3MYWA 4BOHA 1P9SA 1O39A 1DICA 1A5HA 2H1UA 5HIYA 3L3TA 1RIWC 3TK9A 4GUXA 3BTEE 3MHWU 4HZHA 1NROH 4AB8A 1WSSH 3FP6E 4YLQH 4KELA 2OLGA 4Z0KA 1C4V2 4UFGH 1KDQA 3SW2B 3F3BA 1IQFA 2QC2A 3IWMA 1C5ZB 2J34A 2XTTB 1IQNA 1O5AB 2FODA 1E34B 1GVZA 4D8NA 3M5OA 4JZDH 2Y80A 5AVDA 1J9CH 1LHEH 1N6XA 4X0WU 1QBNA 3BTDE 1VITG 3E3TA 2A4GA 1HJ9A 1UTQA 2BM2A 1RXPA 4B76A 3UQOA 5C5NA 4HI3A 3SBKA 5SGAE 1AKSA 1DWCH 3SV2H 4O3TA 1C1QA 1NRQH 2JH6D 2OTVA 2PKSB 1YYY1 3U8TH 1KXBA 9ESTA 3MOCA 1PJPA 1AU8A 1BHXF 3GY4A 2ZGJA 3R3GB 4ZH8A 3RXTA 4AFSA 2IJOB 2PTCE 2VNTA 3D23A 2F83A 1MTWA 5DSFA 3TH2H 2R3UA 1FZZA 2KAIA 1SGQE 1PQ7A 1A5IA 3GCTF 1ARBA 1HXFH 1P12E 1C2LA 1TBRH 1UVUH 3PO1B 2J95A 4MNWA 2ZTXA 1J15A 2KR7A 1VZQH 1CHOF 1QRWA 3A7ZA 1BRUP 2GV6A 2JJ1D 4X2WA 1T4UH 4FOUC 1XX9A 3M61U 2EQNA 4O03A 5HGGA 5F03A 3ENSB 2NWNA 3P70B 5JB9S 2J94A 1MZDA 2WV4A 2J38A 5GIBA 1TOCB 1SB1H 1FONA 5HYOA 5CMXH 1MTSA 1W0YH 1L1GA 4P00A 1G36A 1ZPZA 1BTPA 3NRLA 2QF0A 3GDSA 1X7AC 5EGMA 4DY7B 1W14U 2HOBA 5CHAB 4A7IB 4ZXYH 3HATH 1O5BB 3AAVA 4CH8B 3CENA 2J98A 1D3QB 3SNAA 1AVGH 1DVAH 3T62A 1HGTH 3MO9A 1O2MA 3RC5A 1C1UH 1C2IA 2OP9A 1XUIA 3TVJB 1W12U 1DM4B 3AW0A 1GJ9B 1BDAA 1O2KA 4RKJB 2A45B 4I32A 5EJZA 5JBCS 2F9BH 2ZHQH 4I8GA 1NM6A 6LPRA 2XBWA 1HB0B 1CBWC 1QB6A 1ZZZA 1W0ZU 1O3IA 2BQ6B 1EJNA 1Z7KA 2BDBA 2FS8A 3B9FH 3MWIU 3RXBA 1KSNA 1OWIA 1GJDB 2V7QD 1K1PA 4B75A 3ZYEA 1YC0A 1V2QT 1BQYA 1KLJH 4MPWA 2ZTZA 3F9EA 3SI4H 1EP5A 2GMTB 2ZI2H 1C5WB 2B5TB 2A5IA 2OCVB 1JRTA 1GJBB 1QQ4A 3SI3H 2B7DH 3QZQA 4IN1A 5PTPA 3ZZ8A 5T6FA 3UWIA 5A2MH 5J4SA 3EE7A 2ZU5A 4TWYA 1HAIH 5F8ZA 1ZTLA 1QGFA 2ZHFH 4ISNA 3DD2H 2GZ8A 1O2PA 1C1TA 1DLKB 2OQUA 1UW7A 2BY8X 3TU7H 4B73A 4WVPE 1FY4A 1TB6H 3GY3A 3HKIB 2ZDAH 2Q6GA 2BXUH 2XNIA 4FU8A 1CVWH 4BAOB 1FPHH 1LCYA 1MU8B 3SJ8A 3ATWA 1GHAF 1C5UA 1H1BA 3EA7A 1KMHB 1AFEH 2RDEA 2VIOA 3L6PA 1TNGA 2TGTA 5FHTA 3DFJA 3FFGA 1NT1A 3W95A 1EP6A 1COWD 1XXFA 1VCQA 1GGDB 1BIOA 1RGQA 2ANYA 2BDAA 4NFEA 3A8AA 5I46H 2BLVA 3SGAE 3FN8A 3QLPH 3PM3A 4O3UA 1NRNH 1RJXB 1UCYE 3SJIA 4YXWD 1BTHH 1P8VC 2J2UA 3HKJB 4RKOB 1DSTA 4DT7B 4NFFA 2VIDA 1QZ8A 2LNCA 1IQGA 1LPZB 5DJ7A 3UFAA 2GCTB 2HRVA 4ASUD 1GMCG 7GCHF 1BT7A 3F68H 4X2XA 1GCTB 2FTLE 5FX6A 2ASUB 5EW1H 3T27A 2ZECA 1BTWA 2QXIA 4CHAB 1ZGIA 2PV9B 2J5UA 1O2LA 1NFYA 2PKSC 3M7TA 4UFEH 4U2WA 2QXHA 3SNEA 3ZZ5A 1C5NH 3UTUH 3A84A 2NU1E 1GBHA 2CXVA 1GHYH 3LT3A 1ZLRA 2BD4A 1SKYE 2AIQA 5DP8A 1V2JT 2QXJA 3SV6A 2AS9A 3GY2A 2FOFA 4KTCA 2CF8H 1OYQA 2ZHEH 3F2GA 1TQ0B 4GCHF 1C5XB 1NBMD 1C2KA 2YOLA 2A2XH 1EZXC 1CU1A 4BTUB 3N7DA 1O2UA 1P04A 4Y11E 3PO1C 2ZQ1A 1GMHF 2FLBH 3HK3B 3RXLA 1H9LB 2GJGA 4UE7H 1IQMA 3U9AH 1AE5A 1P9UA 5HIZA 2IOTA 2XC0A 4AGJA 2OC8A 2RA0A 4O97A 1BBRK 1C1NA 4GHTA 4FUHA 5FPSA 3RMLH 3UNQA 1LHFH 1NRPH 5LPRA 1P2OA 4MPXA 1O38A 2RCEA 1GBKA 2FP7B 2K1QA 3S69A 1DT2A 2VIPA 5E0JA 4BNRA 3QGNB 3TGJE 5CHAC 4FVDA 5EPNA 3SU6A 2XBVA 2OD3B 1TRYA 3SOSA 2GTBA 1YPHE 1AGJA 4AFQA 2HNTE 3VB5A 1ZSKA 4UONA 3EYDA 3URDA 1BMMH 3OU0A 4K60A 2XCFA 3RLWH 1TX7A 1MH0A 4KKDA 2Q1JA 3M3TA 2A4QA 3NKKA 1GBMA 2UUFB 1C5MD 2HNTF 1YPJH 3P8OA 2ANMH 1P2QA 1Q31A 1FY1A 3RC4A 1XVMA 1BTUA 4X8SH 3A86A 1O3MA 3F2HA 3BTGE 1MZAA 4WXIA 1MQ6A 2NU0E 4JZIA 3DSPA 4X6NA 2AEIH 5DK1A 2H5DA 2GMTC 2EI6A 4AB9A 1P11E 3MO6A 3SUDA 1OWJA 3ZZ7A 1YCPH 4J2YB 1YCPM 3ODFA 1TALA 4HTCH 1FN8A 1YCPK 2ODQA 5KEDA 1O3KA 1DDJA 3RM2H 1YBWA 1SFQB 4Q2KA 2R0LA 1ZMJA 2KCOA 3RP2A 2UUJB 2FZZA 4RN6A 1C5VA 1NC6A 1SLVB 2AYWA 1EKBB 4NWLA 4B6FA 2BZAA 1Z6JH 1FJSA 1LPGB 5L30H 1ESTA 4UFFH 1V3XA 2ZU4A 3RM0H 3LGYA 1H9HE 1GI5A 1ZOMA 2ILNA 5GCHF 4FUIA 3FAOA 3MH7A 3BTME 4JYTA 3PYHA 1W7GH 3C27B 4CRAA 3DHKH 1GI3A 2PLXA 2EC9H 1GI7B 2HWLB 2ZCHP 3RMOH 1BITA 1C5TA 3C1KA 4AGKA 4AORA 1GGDC 1VGCB 4BAKB 1LHGH 1ABJH 2V3MA 3GISB 3STJA 3PMAB 5GPIB 2A5KA 4BXSA 3S7KB 2WINI 5DPAA 1C2GA 2RA3A 1XUKA 3P6ZB 4CRDA 3I77A 3PV4A 1Z8RA 4AN7A 1O35A 3V0XA 4ABIA 1GWAA 3WY8A 2BOKA 1GHWH 1FY8E 1KY9A 3CNRA 1HYLA 1L4ZA 3VG8A 4CBOA 1VJ9U 3UAIC 4ZKOU 1H9IE 4YOGA 2ZU3A 1NU9A 2GCTC 2FXRA 4NG9H 1GCTC 1Y3XA 1BJVA 1ELBA 2A0QB 1IHSH 1EOLA 1MD8A 2Y7XA 4CHAC 1YPHC 1GBEA 3P8FA 3W1EA 2C4FH 2GCHF 3GOVB 1OWKA 1GI8B 1K2I1 2HNTC 1EZSC 5EQSA 3RUOA 1HJAB 1DLEA 3H09A 4UDWH 4DT4A 2ZA5A 4Q7YA 3UY9A 3GCTG 4Y7AA 3MNSA 1TPSA 1P0SH 3VB6A 5C5OA 5K7RA 2Y81A 3ZIAD 2PKAB 4NIYA 3Q3YA 1OWDA 2AHME 1GHXH 2FTMA 1P05A 4Y76A 3P8NA 1CGJE 3PWCA 1HAOH 3FVFB 1INCA 1T8LA 2ZZUH 2H6MA 4B71A 5TCAA 1RS0A 3ZZDA 3OFND 1QURH 2ZFQH 3EA9A 3T29A 1OOKB 2LPRA 1A3BH 1UTMA 1K1MA 2V6NA 4OS1A 1QJ1B 3NWUA 3ELAH 1JMOH 3HGNA 1SMFE 2TBSA 1MMJN 1ELGA 4DIIH 1O3LA 4Y0YE 1EB2A 3LJOA 1UMAH 2BDHA 3TK6A 1YWUA 1HAGE 4BAHB 5DP3A 1TQ7B 4RT0A 1UVPA 4K5ZA 1O2SA 2D26C 2BTCE 4FVBA 3W94A 3TGKE 4LZ4B 2A7JA 3GY8A 1GJ8B 2VIVA 2ZPRA 4BANB 4BTIB 5EW2H 1C4Y2 1QJ7B 1EJAA 3UUZA 6CHAC 1O2XA 4Q7ZA 1QRXA 3DCLA 2ZTYA 2NU4E 1D4PB 2TGPZ 1FDPA 1MQ5A 3F9FA 1UJ1A 3RXCA 1B5GH 4X1RU 1BMLA 1HAYB 1KDQB 5JDUB 4MPVA 3UR9A 3SGBE 1O5EH 2VU8E 1ZGVA 3RXPA 5HXFA 2BY7X 1GL1A 1HPGA 3O8RA 1FN6A 3F0PA 1WCZA 2A31A 2VWLA 1CA0B 3UOUA 2VVCA 5HKKD 2Y6TA 1EPTC 4KTSA 1GI4A 1AN1E 2FOGA 4H6TA 1P2JA 2BXTH 1AKSB 3S9AA 2WYJA 4Z6AH 4R8TB 1ZPCA 3SU3A 3ZYDA 4ABGA 3PLKA 1E35B 1C4U2 1S5SA 4GLYA 1P02A 1SC8U 2BLWA 3MU5A 2PSYA 4FUBA 4XDEA 1EUFA 3BTWE 4GVUA 2V35A 3KL6A 1P2KA 1XKAC 1PPCE 2CHAB 3ZZCA 3E0NB 5E8EH 4YZUA 1TBQH 1AVWA 3LIWA 2XBYA 1FXYA 5FBIA 2YNBA 4U32A 1GHAG 2A32A 3Q3XA 1TGSZ 1CO7E 3GCOA 1IAUA 2KAIB 1G30B 2TRMA 2FOCA 1D6RA 3JZ1B 4SGBE 1AMHA 3MNXA 4NZQA 4Z1MD 4TYDA 5IDKA 3P8GA 4ZHMU 4TSFD 3UQVA 1TLDA 5ETXA 2P3FH 1F0RA 1SGTA 2SNVA 1V2PT 4H4FA 4ESTE 4NZLA 4O9VA 1GDNA 4XE4A 4R0IA 1N6YA 1ID5H 2YMSB 1VGCC 1CT0E 1PPHE 5EJLA 1TPPA 2OC0A 1W0JD 1O31A 5A09A 1Z8IB 2P94A 4ABHA 2AGEX 4NIWA 7GCHG 1MTUA 2QF3A 3H7TA 1V2UT 4ZKRU 1DWBH 1MKXH 4MNYA 2ZFRH 1Y59T 4ZMAH 4A1VA 2PW8H 1O2WA 3V12A 3B8JA 2FO9A 3LH3A 3PV2A 1K0HA 2JETB 1YY3A 1PQAA 5LH8A 1UVOA 1S83A 1HUTH 1GBCA 2J98B 5GDSH 3SV9A 2VH6A 2Y5FA 1VCPA 2FPZA 4WJG2 2VJ1A 1J8AA 1S6LA 2CF9H 1Y8TA 4JYUH 5C1YA 2QYIA 1UHBA 1BMNH 3NCLA 1W11U 3OSYA 3LGIA 1SGEE 3SUEA 4Q7XA 3U28C 3RXMA 4DIHH 2DUCA 1UVSH 3E1XB 5FL7D 5E0HA 2GX4A 4GCHG 1HJAC 1GHBF 2F91A 2PHBA 1C1RA 1ZHPA 2OK5A 1WBGB 2OC1A 2ZCKP 2GGVB 5C3NA 4F49A 1DWEH 3PRDA 3MU8A 1TNLA 5C0UA 1P10A 3LOXA 3ATLA 3DFLA 1GMHG 3SU4A 2P59A 1TWXB 4FU9A 3PLPA 1TA6A 3BTKE 3RXOA 4A5TS 1LHDH 1Y3UA 2I6SA 2HVYB 1Z8GA 3A7YA 1NESE 1P2NA 2EY4C 2P8OB 2Y7ZA 4X6MA 1N1LA 1PPEE 2QE7D 3HPTB 3DSOA 1DXWA 2QF4A 4OS5A 2WV5A 2BDCA 3SORA 3ZVAA 2PFEA 1IQJA 2YMSD 4WF8A 3KGPA 4WY3A 2BQ7B 1BA8B 4ZUHA 2ANKH 4Q63A 3KIDU 1PPGE 3A7WA 4I8HA 4K1TA 1MKWH 4KTUA 4ABBA 3D62A 1BUIA 3QTVH 4AX9H 1SGRE 1TNHA 3FZZA 1H8DH 1K1IA 2XNDD 5K0HA 2WV9A 2Z9GA 1AQ7A 2BOHB 2ZG0H 1DANH 5JBTA 2IPHA 3K65B 1GI2A 3OTJE 2P93A 1ELVA 1C9TA 2XW9A 2TPIZ 2PGBB 1UTKA 3CS0A 1B0EA 1O3JA 2PTNA 1TMUH 4BTTB
chains in the Genus database with same CATH topology
1P06A 3QUMP 4B1TA 2SNWA 2NU2E 2TGDA 1AVXA 1UTNA 1IQEA 2UWLA 1MBQA 1QL7A 2XWBI 1Q2WA 3NPSA 3RXEA 3O8DA 1SGDE 3UR6A 2GDDA 3F1SB 1OPHB 2EA3A 3MH5A 3BEIB 3M7UA 1TNIA 5J4QA 4K3JA 1F2SE 3DA9B 5DP5A 1O2QA 1QL9A 2VGCC 1AUTC 1BRAA 1CA0C 1K1OA 3MFJA 1EAWA 5AHGH 1DXPA 1FMGA 1KTSB 4DW2U 2BVSH 3SJOA 3BEFB 2GD4B 1ZRKA 4AYVB 3PWBA 2XCNA 2Q6DA 1CHGA 1K21H 1GJ7B 2ALVA 2BMGB 2DE9A 2QXGA 1WV7H 2W26A 1XMNB 1XUGA 6ESTA 2CHAC 1UTLM 1JBUH 5EXNA 6GCHF 3A7XA 1O3DA 5GCHG 1HCGA 2VVUA 5DP6A 1RTKA 2ULLA 3LC5A 4ZHLU 1G3EA 1ELFA 2D1JA 4HFPB 2C8XB 1TRMA 4D76A 2BB4A 3SUGA 4JZEH 1K1LA 3NK8A 5JPMH 1A0JA 2ZPQA 1FNIA 2OQ5A 2P95A 1P01A 3M5NA 1FY5A 3LGWA 1GBIA 3LGUA 1GI9B 2W7SA 2V0BA 3KNXA 1ETTH 1O3PB 1S84A 1ETRH 1SLXB 2FOAA 3ODDA 2SGDE 3ZZ4A 1PQ8A 2AMQA 2BLQA 2GVFA 1IQIA 5JYIA 1FV9A 5GXPA 4XBBA 2ZKSA 1XKBC 3A82A 2WUCA 1GVLA 1UCYH 2H2ZA 2SGPE 2BDIA 1EZQA 2C8ZB 1ZPBA 1C5RA 1EAUA 3RU4T 3SUFA 2GCHG 3HK6B 3E6PH 2JETC 1PYTD 3I29A 1TOMH 1AY6H 1HRTH 1C1WH 7ESTE 4MQAA 1NFUA 1XUFA 4IS5A 1JRSA 2OBQA 3P95A 1CQQA 2QCYA 1V2ST 3ZZ9A 2Y5GA 1MBMA 1KIGH 3ATIA 1SQAA 2Z3DA 3RU4D 1DY8A 2J9NA 3VEQB 1AZ8A 3RU4E 1L1JA 1IQLA 3OY6U 2B0FA 2ZU2A 4Y71A 1SGFG 1QJ6B 4YOIA 1T7CA 3LKWA 4CREA 5AF9H 2PSXA 1U6QA 3VXFH 1MTNB 1SGNE 4Y8YA 1WU1A 3SV8A 3U1JB 2PGQB 1O3GA 4ABAA 2O8TA 3TK5A 1O2OA 3S0NA 2C8YB 1ETSH 3S7HB 1CGHA 1C2HA 2C90B 4MNXA 1KTTB 2P8OC 1O3HA 3S9BA 4XBCA 4CRBA 3KEEA 1EASA 4KGAA 2BQWB 3M37A 1GJ5H 4YM9A 1FAKH 2G4TA 1L4DA 3D49H 4CR5A 3ZV9A 3ZVBA 1AE8H 8KME2 1AI8H 1C1SA 2P16A 1BBRE 1T31A 3A8CA 3R0FA 1HAVA 4K8YA 3BTFE 2V3OH 3BIUH 4LZ1H 3ITIA 4QT8C 4X1QU 2H9EH 1QRZA 3E90B 5L6NH 3TNSA 1ZRBA 4MLFB 3PTBA 4X2VA 2CN0H 1C2JA 4YT6H 1A61H 5A8YA 1V2VT 2OBOA 3M3VA 3G01A 1QY6A 1SGYE 7LPRA 3QO6A 4H6SB 4IC5A 3UNSA 4A1TA 5EOKA 4XSKU 1O30A 1H8IH 4BAQB 2YNAA 1TGBA 3VB4A 3ZVGA 1GBAA 1LVBA 5H4IB 2Z3EA 4TWWA 1GL0E 1LDTT 1O2YA 1SBWA 4YT7H 1ACBE 3EE0B 3RXAA 2PR3A 1CT4E 3MTYA 2BY5X 4JMYA 1V2MT 1UTOA 1AZZA 2XC5A 2AFQB 4ZKNU 2WPMS 2EI8A 5JBBS 3Q3KA 1IHTH 4FUDA 3ZZBA 1GDQA 1W8BH 2VH0A 1UVTH 1C2DA 3FP7E 4X8VH 1Y5BT 3ZVFA 5A0CA 1OP8A 2Z9KA 5C20A 3AAUA 2THFB 5L2YH 3RDZA 2QGRA 4MTBA 2W7UA 4I8JA 2G5NA 5E0GA 3SNCA 5A0AE 2ZFSA 1QL8A 2FLRH 1SVPA 1GJ4H 1TA2A 1K1NA 3S9CA 1ZMNA 4ISOA 4CH2B 4K1EA 3PB1E 4RSPA 3QK1A 1MAYA 2VINA 1OXGA 5F6MA 2PWXA 2A4RA 2Y5HA 3ZVCA 2BD2A 1VCWA 1Z6EA 4A6LA 4F4OC 4OS4A 5DP4A 1ANCA 1AHTH 1YPMH 3QZRA 3Q76A 9LPRA 1SLWB 5FPTA 3HGPA 3VB7A 1O2NA 2SGFE 3T2NA 1FLEE 3ESTA 1S85A 3RXHA 2UWPA 2Z9LA 1TX6A 3M36A 3SNDA 1V2LT 1LVOA 1S6FA 2H9TH 2W5EA 3LC3A 2FDAA 3BIVH 3TGIE 1QBVH 3E91A 2A5AA 2ZDNA 4D9RA 2ZFFH 3KQCA 4E7RG 1HFDA 4X6OA 1HXEH 4FUCA 1GHBG 1G3BA 2G51A 3F9HA 1DITH 3V7TA 3T25A 1O2ZA 2UUKB 1DPOA 2ZGHA 1TBZH 5FCRA 3A80A 3LDXH 4XOJA 5DO4H 1QBOA 2GT7A 2BLOA 2XYAA 4YO9A 3LJJA 1LQEA 3MMGA 2VIWA 2XC4A 3O8CA 4AYYB 1CSOE 1SG8B 1CHOG 2SGEE 2P3UB 2Z6BD 1A5GH 3SU2A 3VGCB 1EOJA 4B2AA 1DY9A 1AFQB 2VVVA 3TJUA 2D2DA 3BG4B 1GG6B 1WAYB 1MTNC 3PROA 3SO3A 3T26A 5HM9A 1ZMLA 4DOQA 5E2OA 1F5LA 3BTTE 2ZP0H 2M5TA 4ISHH 3IITA 3SHCH 5C67A 3GYMA 3FZDA 5C1UA 2EEKA 2ZEBA 1V2OT 1P2MA 3SU1A 1P09A 4JK5A 3NUMA 1LVMA 2BVRH 1ZSJA 1S6HA 2BD8A 3M5MA 4OGXA 1EX3A 2VWNA 2G4UA 4AFUA 4OGYA 1BOQA 1HNEE 3BTQE 1GVKB 1MCTA 2BX3A 1BRCE 2HPPH 2O9QA 4TY7A 5EU8A 1EQ9A 1VR1H 4WH8A 3RC6A 3SJ9A 2OXSA 3PMBB 4D9QA 1TNKA 1O2TA 3TJNA 4MNVA 4ABFA 4TPYA 1Y3WA 1Y5UT 2BY9X 1HAPH 1CA8B 1C5SA 2SGAA 2H5CA 5HM2A 1QTFA 2C93B 1T32A 3MU1A 2F9VA 1AD8H 1O3EA 2GDEH 3A83A 2FI5E 4IW4E 2ZGCA 1GJ6A 5EPYA 3SU5A 3TPIZ 1HIAA 3T5FH 4B74A 1F0UA 4VGCB 2V3HH 3BEUA 4CRFA 1QFKH 3U8RH 1BMAA 3SQEE 3QTOH 5JBAS 5BRRE 2BHGA 7KMEH 2B8OH 1YPKH 2ZC9H 1TRNA 4X6PA 1ARCA 1G9IE 1O0DH 2F9PA 1FIZA 1UHBB 1DX5M 2GZ9A 1F0SA 1JIMA 2VWMA 6GCHG 2FWWA 1HJ8A 3PMJA 4LK4A 1TGTA 1WYKA 1ZR0A 1QNJA 1SHHB 2ZHDA 2J4IA 2QIQA 2ZGXH 4TY6A 4GHQA 1G2LA 3O8BA 4JCNA 1LTOA 1IOEA 1ZSLA 5FXLA 1EJMA 1THSH 8LPRA 2Z9JA 3U1IB 5LGOA 1ABIH 2A4OA 2AH4X 5AFZH 1GDUA 2BD5A 2AGGX 1GHVH 1JOUB 2STBE 1C5YB 1TAWA 4NIVA 1SL3A 1THRH 1P3EA 3QN7A 4ISLA 1NU7B 2BX4A 2G52A 2O8MA 3A89A 1PPZA 5GJ4B 3KQEA 5EXMA 4J1YA 1LVYA 1F92A 2JH5D 1SOZA 1YM0A 5C1XA 1JXPA 1Z71A 4DGJA 4JZFH 3A85A 1MKXK 5DG6A 1O2JA 5TCCA 3M3SA 8GCHF 2Z9IA 5ESBA 4WMDA 4WXVA 1YPGH 3RLYH 1D3TB 3GICB 3K9XB 1EATA 4MDSA 4XFQA 3TH4H 2ZFTA 1E36B 2B9LA 1RTFB 3V3MA 2FX6A 1O3NA 3ATMA 3H5CB 1AUJA 3DUXH 2BZ6H 2R0KA 1K1JA 1F5RA 1WOFA 1UO6A 3BG8A 2GZ7A 1A0HB 1VJAU 1ELCA 2RDLA 1FI8A 4K2YA 4YESB 4I7YH 3MH4A 3V13A 4X1SU 5C2ZA 1GBTA 1G3CA 2ZCLP 1HAZB 2BYAX 4WMEA 2O8UA 2RG3A 2HLCA 1TONA 1ZYOA 4WWYA 1O5DH 1V2TT 3E0PB 1GMDF 2GKVE 1F5KU 2ZGBH 2CV3A 3Q00A 2ODPA 3MNBA 4NSYA 3QX5H 3VGCC 1ANBA 1AFQC 1C1OA 3F9GA 2DE8A 3BG4C 1CT2E 1GG6C 1V2KT 1IQKA 4I8KA 1O37A 1YPEH 2F9OA 1OX1A 1W3CA 5B6OA 4OS6A 1W13U 2BD9A 1O2VA 2W3KA 5EODA 4X8TH 1E37B 1T8MA 5EXLA 1MKWK 4FUGA 1D3PB 2A7CA 2ZIQH 2UUYA 3GY6A 5E2PA 1LPKB 4BXWA 3EQ0H 1GCDA 1A46H 1O2IA 2C8WB 1J16A 1MU6B 1IQHA 4K69A 4MPUA 1A2CH 3DT0H 1T4VH 1SPJA 3SQHE 4NA8A 5L2ZH 3B23B 2WPLS 1LO6A 2FX4A 1NRRH 4INLA 1KLIH 1HAHH 1AIXH 2UWOA 4Y7BA 4MVNA 1S82A 2XBXA 5T6DA 2W3IA 4K1SA 2ZDVH 3TLOA 1EB1H 1QB9A 1BTXA 2NU3E 1NTPA 1JIRA 1MUEB 1UTJA 1C5OH 1ESAA 1THPB 4HGCA 4Y79A 3MO3A 4NSVA 4M7GA 1O5FH 3PTNA 1KLTA 8ESTE 1M9UA 2BDYA 4FUJA 5A8XA 1ZJDA 2BD7A 2CJIA 3QDZB 4ZXXH 1LKBA 2WUBA 4VGCC 1LKAA 2FEQH 3ZZAA 2H9HA 1GBFA 1WQSA 3RXUA 5HMAA 3ATKA 4OS2A 1J14A 4Y8XA 4PROA 1V2RT 2FYRA 4DVAU 1EXFA 4ABDA 2D8WA 4X1NU 2F3CE 5JB8S 1O3BA 1RD3B 1ELTA 1L1NA 2AMPA 3U8OH 1N8OB 3LU9B 1QR3E 1EZUC 2A2QH 4NGAH 2ANWA 1BJUA 2WPIS 2GT8A 1DUAA 3TJOA 2BD3A 2FYQA 1HDTH 2R9PA 1OWEA 3SJKA 2WPJS 4IGDA 2HALA 1GJCB 2FOEA 1UK4A 1ELAA 3GCHB 4IBLH 1GJAB 4NIXA 1YP9A 5EQQA 1G2MA 1KXAA 1TE0A 2VWOA 4Y0ZE 3SHAH 2O8LA 3KF2A 1OWHA 1P3CA 1O2HA 1H4WA 3KQBA 3MU0A 1NO9H 4NWKA 1LQDB 2AGIX 1TPAE 1QCPA 4NCYA 4A1XA 1EAIA 1HAVB 1UCYK 1AWHB 4DCDA 4ASHA 2IN2A 2ALPA 1QIXB 4GAWA 1TMTH 5CE1A 3BF6H 2J92A 1YF4A 5FAHA 1NY22 1BTZA 2QY0B 5DKMA 1NPMA 1UTPA 1O2RA 4XBDA 3SV7A 1D3DB 1GHZA 4INHA 4CRCA 5FPYA 1E38B 1DWDH 1NS3A 3UIRA 1BTYA 1C1PA 1WUNH 1TABE 2ZQ2A 2WPHS 1LHCH 1TPOA 1VITF 1PQ5A 1VITH 2TIOA 3IG6B 1K28D 3T28A 5IYTA 4CR9A 1O3AA 5AFYH 1ESBA 1J17T 3E8LA 4AG1A 3GYLB 4Y10E 5DP7A 1FUJA 3UOPA 1O34A 4FXGH 1C1MA 1C1VH 1DFPA 1OS8A 1EAXA 1G37A 4Q80A 5DGJA 3ZZ6A 3MI4A 1ANDA 1F0TA 1G32B 1QHRB 2F9UA 1MCVA 2FOHA 1KXEA 3SGQE 3EDXB 2ODYB 2A1DB 1V2WT 3K2UA 1C2MA 1A4WH 4AOQA 1GI1A 1ZJKA 3RXKA 3ZV8A 3M35A 2AIPA 1ZTJA 1HAXB 3AVZA 4KP0A 3RXJA 3A81A 3N7OA 3E16B 1AB9B 2TGAA 2BY6X 2EI7A 4D7FA 4IC6A 1NZQH 1P03A 3A8DA 3RXDA 3D65E 4AZ2B 1OP0A 1SQOA 1MTVA 1K9OE 4UFDH 2FI4E 1DSUA 3VXEH 3RMNH 1WQVH 1LMWB 1TYNA 1KYNA 2ZFPH 3VB3A 2OUAA 4MG3A 4JZ1A 4A92A 1BBRH 1YLCA 2ZDMA 1TFXA 4BAMB 1OYTH 3BTHE 4SGAE 4B2BA 2ZNKH 1ZHMA 4DURA 1DS2E 5ABWA 3TIUA 1TX8A 3RXGA 5FCKA 1TNJA 4DJZB 3A87A 1GBBA 3Q77A 6CHAB 2FI3E 1XVOA 1C2EA 4CBNA 3GDUA 2BVXH 3UREA 2BDGA 3RXIA 4YOJA 3RXQA 5BPEA 1MD7A 4Y6DA 5LPEA 3TNTA 1UK2A 2FM2A 1P2IA 2O8WA 1NN6A 2Z3CA 4CRGA 1A1RA 1FY3A 3BSQA 1Q3XA 2G00A 4ZHAA 3PMHB 1SGIB 3AW1A 1DUEA 2FESH 3FANA 3A7VA 1TMBH 3LGVA 1B7XB 2AMDA 3VPKA 4JYVH 1JWTA 1Y5AT 2R2MB 3UNRA 2Z94A 4D7GA 1EPTB 4IMZA 1T8NA 1ZHRA 1PYTC 4H42U 5G4BA 3RXSA 1BCUH 1XUHA 3ZZ3A 1SI5H 2Q6FA 3MH6A 1SLUB 2I6QA 2A7HA 1WTHD 2XRCA 4ZROA 1YPLH 1O33A 1T8OA 4X2YA 4GSOA 1GBJA 1B0FA 1QA7A 1TIOA 1A0LA 1FPCH 1GBDA 1ELEE 1N8OC 1S81A 2SGQE 3OY5U 3P92A 4ZAEA 1O2GH 3LONA 5ESTE 3STIA 2FIRH 1G3DA 1CGIE 4I33A 1ANEA 1BB0B 1Z1JA 2OC7A 5T3HA 2F9NA 2SFAA 1W7XH 1BZXE 1ORFA 2Y82A 4THNH 5DP9A 3LGTA 1YKTA 1O32A 5EQRA 4YLUA 1RIWB 1NFXA 3QGJA 1Y3YA 3GCHC 8GCHG 1Z8JB 2ZDKA 3CS7A 3GY7A 4OS7A 3KHVA 3LH1A 1NRSH 3OYPA 4E05H 2G81E 1PPFE 2STAE 1SGCA 2VB0A 3NXPA 4INKA 3K6YA 1RRKA 2CGAA 2ZF0H 1C9PA 3TH3H 1QA0A 2ZHWH 1EPTA 1F7ZA 1OSSA 3AASA 1SQTA 1Y3VA 3OX7U 4YTAA 3U69H 4E06H 4WMFA 3L33A 4NA7A 2P3TB 5I25A 1KXCA 2FMJA 4DG4A 4IN2A 1V6DA 2ZPSA 4X1PU 1SSXA 1WTGH 1AWFH 3CP7A 2ZDLA 3GCNA