3BTFE

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btfE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btfE02
1Y3UA 2FODA 4NG9H 2UWLA 1W12U 4LXBH 3EDXB 4CRAA 3D49H 1MKWK 2WPLS 2ZKSA 5ETXA 1HPGA 3SBKA 4MPUA 3VGCC 1V2KT 1V2UT 3KIDU 2OXSA 3KEEA 4O9VA 4Q2KA 5LPEA 1EZXC 1QTFA 4SGAE 2ANMH 1O2IA 2Z3EA 1OWIA 2QXGA 2YOLA 4D76A 1PPGE 5TJXA 2BLVA 2ZFPH 1FI8A 4BAMB 2ZCKP 2ZP0H 1TBZH 3TVJB 4ISOA 1A5HA 1CBWB 1NT1A 1LTOA 2ZDVH 2ZDAH 3UQVA 2ZU2A 1TPAE 1NRSH 5PTPA 3TNSA 1C1MA 1YCPM 2OP9A 1C5QA 1XVOA 1LHDH 2PSXA 1GBLA 1VR1H 1MTNB 5A8XA 3U8OH 4A1TA 3B8JA 3F9FA 5C5OA 2AEIH 1FDPA 4D7GA 1KSNA 1FNIA 3FP8E 5LGOA 1C2HA 3EA9A 3SO3A 4JZ1A 1FUJA 2GGVB 4CHAC 2SGAA 2J92A 1DDJA 3MO3A 3RXVA 1VITG 2Q6GA 4B75A 5T6FA 2ANKH 3RXHA 2VGCC 4ZUHA 1TQ0B 4WF8A 3HK6B 2J95A 4Y0YE 2WINI 2H9HA 1BJVA 1KXCA 1DVAH 1TB6H 1UVUH 3LGUA 4Q7ZA 1GHZA 1GDNA 2VWMA 1SGEE 3ZZ6A 2OC1A 3MH5A 1YF4A 3LIWA 1T7CA 2FWWA 3K9XB 2FYRA 5CE1A 1AE5A 1Y59T 1F5LA 2NU1E 4JZFH 5J4SA 3EA8A 2VVCA 3PMAB 3UQOA 2EA3A 3WY8A 1LPGB 2EI6A 1P11E 1B0EA 2R3UA 3QX5H 1IQNA 4Y8YA 1GG6B 5GDSH 3M36A 3A7WA 1BT7A 3A7XA 1XUIA 3SU6A 4X8TH 3RP2A 2ZHFH 1JMOH 2GVFA 1ANEA 5HGGA 6ESTA 3FFGA 1SGDE 3MH6A 4MNWA 2W3KA 2WUBA 3FZDA 1GHBG 5JB9S 3LC5A 1O3DA 1GI9B 4ZXXH 4RKOB 2O8LA 1OS8A 1GJ4H 2FIRH 1A1RA 1GDUA 3M3SA 1GI6A 5C1UA 2FOMB 3AAUA 4BNRA 1V2ST 1AFEH 3KQEA 3NKKA 2F9UA 3BTEE 2B9LA 4H6SB 2DUCA 4O03A 1TALA 4DOQA 3ZVBA 1PPZA 2KAIA 3W94A 1GWAA 2JETB 3RU4T 1G32B 1MUEB 2ZQ2A 2R2WU 4CRFA 1J8AA 4BAQB 1FY1A 1H8IH 1A4WH 1GJ9B 2V0BA 1QL9A 1TBRH 1GMCF 3GCTG 5EPNA 1HAOH 5A0CA 1GI1A 4JZDH 3SW2B 3ZVFA 1O3GA 3P8OA 2ZFSA 1GVKB 4DURA 2B0FA 1CSOE 2VIDA 1GPZA 3GYLB 4GPGA 3GDUA 5DK1A 1O3EA 3ZZ3A 1SOZA 1HB0B 1TA2A 1C2EA 1C1NA 4UDWH 1RTFB 3RU4E 1C5LH 3Q3YA 4ABAA 4A6LA 1LVBA 1AZ8A 2A5KA 1QBOA 3I29A 5L2ZH 1CGJE 3M7QA 5FBEA 3P92A 3LKWA 3SZNA 3T2NA 1TOMH 3A8CA 3MNBA 5FX6A 3C1KA 1FONA 1EQ9A 4WXVA 4F4OC 1UTNA 1EAUA 1L1NA 1Y8TA 2BOKA 1NY22 2F9PA 1K1IA 3HGNA 3PM3A 1YPMH 2ANYA 2FO9A 4FUEA 1T31A 3GISB 3PWCA 7ESTE 3T62A 1HJAB 1VGCC 3V3MA 3A7ZA 1GBFA 3RXIA 4ABFA 2OBQA 6CHAB 3KF2A 3SV7A 2BD4A 2C93B 1O3KA 1GCDA 1Z8IB 3VPKA 1EB1H 3R3GB 2BDYA 1GVZA 1UK2A 2UUJB 3MU1A 2WPHS 5DP9A 5F8ZA 1C2IA 3V7TA 3L3TA 2GCTC 1AY6H 2PKSC 2Z3DA 3PMJA 1UTQA 1HUTH 2G5VA 2XYAA 5GWZA 3QGJA 1GMCG 2BZ6H 3PMHB 2PGBB 1GJ6A 3RLWH 1DITH 2ESTE 2R9PA 1EPTA 1IAUA 2XBWA 1KIGH 1UVTH 1XUJA 5TCCA 1Z7KA 1O3IA 2Q6DA 4OS7A 3TJOA 5BPEA 1Z8GA 3QWCH 1QA0A 2JH6D 2ZGJA 2HNTF 1QA7A 4K60A 3A88A 4FU9A 1QCPA 2Y6TA 4BAKB 1BHXF 3H7OA 3TGJE 3PTBA 1AUJA 4A5TS 2OC8A 2J94A 1AN1E 3MO9A 1AUTC 1MZAA 3BF6H 1Y5UT 1GI4A 1BBRE 1S0QA 1WAYB 4MVNA 4XDEA 3RMOH 3CS7A 1O2NA 4XBCA 1E0FD 1GBIA 1NU7B 4VGCB 1LCYA 7LPRA 5T6DA 1H9HE 1GJCB 2P59A 1EPTB 1TIOA 3LGVA 3N7OA 1D6WA 3UOPA 1AD8H 1HV7A 3BEUA 2FS8A 3QO6A 3UIRA 2VWOA 1TBQH 1SGIB 2YNAA 1GBJA 4I33A 1MD7A 3A8BA 1HDTH 3QTOH 3RXTA 4CREA 1SGYE 5E0HA 1C2MA 4GUXA 3GCNA 1EATA 1P0SH 4B1TA 2BLOA 2ZDLA 1RXPA 4UONA 1BMNH 3LC3A 1Y3YA 5DPAA 2Z3CA 1DUEA 5DP3A 1P03A 1H4WA 4X2YA 3F6UH 1C5TA 3M5OA 2TBSA 1C5ZB 1AIXH 3PMBB 2J4IA 5JDUB 5TCAA 1NC6A 2BQWB 2EEKA 1JXPA 3BIUH 4NIYA 3PLBA 2PV9B 3U1JB 1W7GH 4I8HA 1MCVA 3BIVH 3BG8A 4XBBA 4M7GA 4ZXYH 2NU0E 2ZA5A 1P57B 4NSVA 4Z0KA 5IYTA 1UHBA 1O2PA 1P2MA 2BD3A 2BY8X 1TNJA 3TNTA 1FMGA 2STAE 4CR9A 1LVYA 1MTWA 3TH4H 2BVSH 2AGGX 4TY7A 3SORA 5DP7A 1DFPA 1NZQH 3FVFB 1INCA 4A1VA 3K2UA 4D8NA 1SFQB 3NCLA 2Q6FA 1GHAG 1GHVH 1AB9C 1JIMA 4X1SU 1O2RA 4DCDA 2AS9A 2C8XB 1C1VH 1C5PA 1UVSH 1KXBA 4TYDA 1PQAA 5C67A 4ISNA 1SFIA 5A09A 2VIPA 1N8OB 5EODA 1ZHRA 1L4ZA 5H4IB 5LPRA 1EJAA 1SGFG 1WSSH 4R8TB 1TPSA 2SGEE 1V2LT 2ALVA 1UCYH 2WYJA 5CHAC 2C3SA 4ISHH 4FXGH 2XWAA 2J34A 1VCWA 1NFXA 2Y82A 3ZYDA 1D3QB 1O5FH 2LPRA 4O3UA 4BOHA 5FPTA 3IITA 4IS5A 1XVMA 2PTNA 1RTKA 2V3HH 2Z9KA 3V12A 1J9CH 2K1QA 4E7RG 2R3YA 1HAZB 4E7NA 4ZMAH 3DA9B 2ZTXA 3P8FA 5HM9A 1EP5A 1S81A 1ZPBA 1GMDF 1AU8A 2QF3A 2BB4A 3GICB 4Y0ZE 2W7UA 2HNTC 3UOUA 3GCHB 2G8TA 1ELDE 2PTCE 2WPIS 1P02A 1SBWA 2ANWA 1GBMA 3UWIA 3MH4A 1YLCA 1SGCA 5EXLA 3A81A 4YZUA 1JIRA 1PQ7A 1Z8JB 2OLGA 2V3OH 3MNXA 1IQMA 3PTNA 1TABE 1V2OT 1NO9H 3SJ9A 1O5CB 4BTUB 5FXLA 1HXFH 1TMBH 1T8OA 1YPJH 1DLEA 3A7TA 1LHEH 3VFEA 1ZTLA 3ZV8A 2TIOA 1BDAA 1OWDA 3TPIZ 3FZZA 2F9VA 1UK3A 2RA3A 5L30H 1O2QA 1O31A 2XBXA 3FP6E 3TK6A 1W13U 3K6YA 1WCZA 2A2XH 3QZRA 2AIPA 2I6QA 4WY3A 2SFAA 1A5GH 3QTVH 4X2XA 5DJ7A 2GCHG 1EUFA 2VVUA 1YCPH 1QHRB 5J4QA 2C8YB 4CRBA 2R2MB 4ZHLU 1O2HA 5G4BA 3OSYA 4INKA 1QJ7B 1NRQH 1LPKB 3E3TA 4CRDA 1CHOF 1C5WB 3BV9B 3ODFA 1DWCH 2OTVA 1K1NA 1P09A 4K8BA 4FUGA 1EJNA 1D4PB 2FI3E 1AGJA 1YPKH 3S9CA 1OWEA 5EG4A 1C5XB 1YPGH 2ZGCA 1W10U 4QT8C 2ZZUH 3MO6A 3SNCA 3QLPH 2FOEA 1HXEH 5GXPA 1BOQA 4YT7H 2XNIA 2Z9LA 1EB2A 1C5YB 1GI3A 5GJ4B 1ZRKA 1EAWA 1P06A 5DGJA 1A0HB 1HAIH 1SSXA 3PV4A 3SV2H 5A0BA 7GCHG 4YOJA 1VCQA 1P2JA 3RC5A 1FN6A 4WJG2 1YLDA 3RXMA 3V0XA 5AHGH 3RXFA 3SQHE 3TJUA 4D9QA 1ZRBA 3HATH 3KQBA 4CH2B 1ETSH 1V2MT 3STIA 2XBVA 2BD8A 4XBDA 4ISLA 5JB8S 5E2PA 1IQLA 1WUNH 1RIWB 3R0FA 3VB6A 1KXAA 2PLXA 3SJ8A 2PHBA 4ZKOU 3PO1B 1JBUH 4X6NA 1AE8H 3SOSA 1L4DA 2ZGHA 2FI4E 4YTAA 1A2CH 3RLYH 2QCYA 1HAGE 1K1MA 2CHAB 4NIVA 1A0JA 1QB1A 1UTOA 2G00A 4TPYA 2JKHA 2BDCA 2XRCA 3U1IB 1AFQC 1DANH 1E34B 3A8AA 3A82A 1ACBE 4WH6A 3E0PB 1G3EA 5JPMH 3D62A 1V2PT 3TITA 1EOLA 4ABIA 4HFPB 1LHGH 4Q7XA 3ZZDA 3ITIA 3TH3H 3SNDA 1V2QT 4K5ZA 3S69A 1HAPH 4IBLH 1C9TA 2RG3A 2RCEA 1SLXB 3E0NB 2UUYA 2NU3E 3UNRA 1EP6A 1SOTA 5GCHF 2A31A 5T6GA 3RXSA 2FYQA 3BTME 4AG1A 4FVDA 3QZQA 1UTLM 3ATKA 2IOTA 3EE0B 1B7XB 1AKSB 6GCHG 1SB1H 2Z9GA 4X2VA 3O8DA 1BBRH 1O3MA 4H6TA 3STJA 5HMAA 1P9UA 1F0TA 2NU4E 2ZFRH 3HPTB 4WXIA 1MQ5A 1F2SE 1WV7H 2GKVE 1GGDC 1O3JA 3UWJH 1UCYE 1TGTA 3CS0A 3S9BA 1CT2E 2FOGA 1A3EH 1KLTA 2Z6BD 3ZYEA 4Q80A 1AVWA 3SGAE 2Y5GA 3UR9A 3MYWA 1L0ZA 2ZU1A 1ZPCA 2OBOA 3BG4B 1F0UA 3MTYA 1XUFA 2QXIA 1O2UA 4ABGA 3LGWA 4AB9A 2ILNA 5L6NH 3BTWE 4TWYA 2FS9A 1QL7A 2VIVA 3PWBA 1CVWH 1BTZA 1T4UH 1OYQA 3LGIA 1DSTA 2BY5X 3BTQE 1A3BH 1L2EA 3GDVA 4U01A 2QA9E 3M37A 1ELGA 2FLRH 4B2AA 1SL3A 1ELFA 4RN6A 1IQFA 2C90B 3T25A 3LJJA 3TK5A 1TMTH 4K1EA 1LHFH 3SI4H 5DP4A 5EXNA 3RDZA 1GI8B 1FLEE 4MPWA 4GLYA 1PPFE 1KTTB 3JZ1B 4K1TA 4GAWA 1D3TB 3LT3A 4ABJA 2BQ7B 1QL8A 3IG6B 3O8CA 3RM2H 1TFXA 1ZLRA 1O32A 1O3CA 4U30A 1XKAC 1SQOA 1DUAA 1RJXB 4FUIA 1G3BA 2FZZA 4GCHF 3M5MA 3BN9A 1V2WT 1YPEH 2ZIQH 4UFDH 4AG2A 3GY3A 3NXPA 1ID5H 3RC6A 1RRKA 2H9TH 3RMLH 4F49A 4SGBE 5E8EH 3P70B 3G01A 1DM4B 1HNEE 4AOQA 1SGRE 1UTMA 1OPHB 1BRAA 3F9GA 1HFDA 1OWJA 3Q3XA 2BVRH 3SV8A 1O3AA 1W8BH 3U98H 2GDEH 1IQGA 1YGCH 1ZR0A 1VJAU 2W26A 1ZTKA 2GT7A 1NFWA 1TRYA 3FAOA 1P3CA 3OTJE 2FEQH 1O2LA 1EKBB 1D6RA 3M35A 3E8LA 1ZJDA 3UY9A 1THRH 1C2JA 1WQSA 2BLWA 1Z71A 3E90B 1SHYA 1T4VH 1GI0A 3RXBA 3ZZ9A 4JZEH 1V2RT 2P93A 1H8DH 1OSSA 1SC8U 3JZ2B 3F9EA 4O97A 5IDKA 1AQ7A 3VB4A 4IGDA 1GCTB 1P04A 4UD9H 2SGPE 3UREA 1IHTH 2W5EA 1VZQH 3ZZ5A 1DICA 1EAIA 1C2FA 1UTPA 3A84A 3SJKA 4X8SH 3DT0H 2JH0D 3LGTA 1T32A 3ODDA 2ZNKH 3MOCA 1AO5A 1ZSKA 1RTLA 4UEHH 1BUIA 4MTBA 3LONA 4OS5A 4OGYA 2BY9X 1O0DH 3KCGH 2G51A 4BXSA 1DWDH 1PPBH 3HGPA 2M5TA 1FIZA 1IQJA 1D3DB 2THFB 3K6ZA 5EQSA 1OXGA 4ISIH 1GBEA 1TNLA 2C4FH 1O5EH 2O9QA 1N8OC 1P2OA 1O2JA 1BIOA 1C1SA 2ZDNA 5C1XA 1ESBA 3P17H 1GHXH 1PJPA 2TGDA 1SGQE 3NPSA 1MAXA 1C5OH 1A46H 1XXFA 1GMHF 1L1JA 1KLJH 3BSQA 1NRRH 2IJOB 2I6SA 1SGNE 2GMTC 1ZTJA 3OU0A 3QGNB 3HK3B 1NS3A 1LQEA 3TIUA 1H9IE 2A5AA 2HNTE 2VJ1A 1MTSA 3SV9A 1QB6A 1G2MA 2BD7A 3P6ZB 1LVOA 4AFZA 1C1RA 2BXTH 1FJSA 2BDHA 3URDA 1AZZA 1ELTA 1TLDA 4FUDA 2O8WA 1IQKA 1F5RA 3RXQA 3T26A 1BMMH 1W0YH 3RMNH 2A32A 4J2YB 2BHGA 1YPHE 2F3CE 2FX6A 4NFEA 3B23B 1Q31A 4CRGA 1A0LA 1CT0E 3SUFA 2AMPA 4ZAEA 1BTUA 3TK9A 3E16B 4HI3A 1EZSC 1P8VC 3LH3A 4IMQA 5B6OA 2D1JA 1ORFA 1CO7E 1YKTA 3SNEA 2ZGXH 2WYGA 2TRMA 3A89A 1A61H 1TPPA 1TX6A 1V6DA 3M3TA 4YLQH 2Y80A 1BRCE 2ZFFH 2ZDKA 1DX5M 3VB3A 4JK6A 4FU8A 1KLIH 2HVXA 2QXHA 3EGKH 4TWWA 1YPLH 2HWLB 3MNCA 1O2YA 1BMAA 2QXJA 5I25A 2AMDA 1GMHG 1O3FA 1XMNB 1S84A 5HYOA 1IQHA 2EC9H 3I77A 2QV1A 3Q00A 3RXAA 2H9EH 1P01A 2ODPA 1J16A 2A7CA 1ETTH 2RDLA 1DE7H 1CA0C 2ZHWH 2B8OH 3RXJA 4ABEA 1TOCB 4HTCH 1XUHA 4BTIB 1G36A 3BTGE 3VB5A 1S5SA 1NRNH 5DP6A 2GDDA 1ABJH 1JWTA 1D9IA 3AW1A 3KL6A 2Z7FE 1KXFA 4CBOA 1Q2WA 2H6MA 2OC7A 2R0KA 1Z1IA 5DP5A 1FPCH 1KDQA 1W2KH 2P8OC 3UTUH 1GL0E 1HIAA 4CBNA 2ODQA 1FPHH 1O2ZA 1WBGB 3RC4A 3UFAA 1ANCA 5FBIA 2QC2A 1ARCA 1V2JT 2P3FH 2ZU3A 3TGKE 3TGIE 2CF9H 1O2MA 2BX4A 2GZ8A 4DIHH 5JBBS 3PLPA 2P16A 4Q7YA 1EX3A 2ZHEH 4TY6A 4PROA 3L33A 3ATIA 1LPZB 1O2WA 1BITA 2F9OA 2PWXA 1LVMA 2VVVA 5C2ZA 3RXGA 1Z6EA 1Y5AT 2G4TA 1O2KA 1Q3XA 2TPIZ 2VIOA 2Y5FA 2ZWLH 3DFLA 5FHTA 3SGQE 1P9SA 1SI5H 4HGCA 3TJNA 2BY7X 2GD4B 5GIBA 1EASA 2BDGA 4GHQA 4WH8A 1PPEE 5T3HA 3RXKA 4IMZA 2G81E 3FANA 1VGCB 3LJOA 1KDQB 5AF9H 4X2WA 4CR5A 1MKXH 1YM0A 1BMLA 3SGBE 1HIAB 3MHWU 5AFYH 4Y7AA 2ZHDA 3RXCA 1KTSB 4BXWA 2CHAC 1ZHPA 2PFEA 1NTPA 1OYTH 5EOKA 5EPYA 1MH0A 1O2VA 1AHTH 1ESAA 2Y7ZA 2GCTB 1PYTD 2BZAA 2PKSB 1TNKA 1QRWA 4CRCA 1THSH 4MG3A 4NWLA 1MD8A 1U6QA 4FVBA 1W7XH 1O2TA 1YBWA 1O5AB 3TLOA 2J9NA 2QAAA 1MU6B 1DSUA 2FOCA 3EAJA 1YPHC 1WYKA 2ODYB 4FUJA 1GBKA 1O37A 4YO9A 3DHKH 2TGTA 4H4FA 1ELBA 3S7KB 2QF0A 1CBWC 1K1OA 3RXPA 4I8JA 1AVXA 1IQIA 1NU9A 1Y3VA 3MH7A 2H5CA 1O5DH 2XCFA 2G55A 1XX9A 2Z94A 2BVXH 1OP8A 2ZCLP 1GDQA 1GI2A 1X7AC 2PW8H 4ZH8A 4D7FA 1MTNC 1LKAA 2O8TA 1GBCA 1ZMLA 1VJ9U 4DGJA 3SQEE 4ZKSU 5K0HA 4A92A 1O30A 1MKWH 4B73A 3DD2H 3CP7A 3GY6A 2OC0A 3E1XB 1RD3B 1HAVB 1UVOA 1F0SA 1OP0A 1GJ5H 3NZIA 3LDXH 1K1PA 4ZKNU 4DT7B 2FMJA 2J38A 3BG4C 3BTTE 1C2GA 1AI8H 1SLVB 4X1QU 1GMDG 2STBE 4R0IA 2XXLA 3D23A 1TPOA 2ZU5A 1O3HA 2VH6A 4MNXA 1W11U 2XC5A 2QY0B 2OQUA 5ESTE 1XUGA 3NK8A 5F03A 1CQQA 2WPMS 1K22H 2ZC9H 3T5FH 3MU0A 1TNHA 3BTHE 3T29A 1UVPA 5F8XA 4OS6A 3LH1A 1O3BA 2ZGBH 4KELA 3L6PA 3ESTA 1G30B 4YT6H 5EGMA 1K1JA 1ETRH 2DE8A 4YLUA 1TE0A 2CV3A 5L2YH 1AWFH 4AZ2B 3KHVA 1UCYK 1DWBH 1JRSA 2B5TB 2PUXB 4AGKA 1PFXC 1NM6A 2A4RA 1W14U 4ESTE 1GG6C 2JH5D 8LPRA 3CENA 3SHAH 1C5NH 1P12E 1PPCE 1QJ6B 4YOIA 1Z8RA 2FPZA 1LMWB 3ATMA 1ZHMA 2CN0H 2ZU4A 4LK4A 3ZVCA 4UE7H 1CHOG 5AFZH 1C2DA 1KYNA 1CHGA 3VB7A 3S7HB 5FPYA 2HLCA 1HYLA 1ABIH 4KP0A 2XC0A 1GJAB 1E38B 1QRXA 4OS1A 2ZFTA 2UWPA 2R0LA 1AKSA 1BQYA 4DIIH 5JBCS 3I78A 2QN5T 2JETC 4Y8XA 2A45B 4WMDA 1G9IE 1MMJN 4GHTA 4NZLA 4B76A 3OY5U 1J14A 2FOHA 2AH4X 4JYUH 4AFSA 5CHAB 5HM2A 1QBNA 2ZECA 3HKIB 3ZZAA 1DLKB 1M9UA 3GY2A 4K2YA 3SV6A 1TX7A 2P3TB 2W3IA 2GP9B 4ZHMU 2AGEX 1YP9A 1TRNA 1O3OA 2XCNA 1YCPK 2FTLE 5ABWA 1VCPA 5E0GA 1SGFA 4K1SA 3M5LA 2AMQA 3ZVDA 3ZVGA 2O8UA 1VITF 2PGQB 3SJOA 2LNCA 1A7SA 1GCTC 1F5KU 4XOJA 1S6HA 4X8VH 4YM9A 1BHXB 2SGFE 1FZZA 1NFYA 2A0QB 4MQAA 1QFKH 1ZGIA 4K8YA 3KNXA 1O2SA 2FOBA 1CA8B 1KY9A 1SGTA 2QIQA 2ALPA 1DXWA 5JYIA 1BA8B 2Z9JA 1NFUA 1BRUP 1XXDA 2G52A 4Y11E 1S83A 3EQ0H 1MTUA 1C5SA 1WTHD 5K7RA 4K69A 1SMFE 2ZDMA 1H9LB 1SVPA 2PKAB 5C5NA 1QRZA 4HZHA 2ZHQH 1HJAC 2ZCHP 3Q76A 1QQ4A 1NN6A 1UTJA 1XKBC 6CHAC 2O8MA 1K28D 1OWKA 3ZVEA 3QN7A 1ELVA 2TGPZ 1DPOA 3GY5A 1HCGA 3T28A 1BJUA 1CT4E 3FP7E 1Z6JH 5FPSA 1H1BA 4X6MA 2F91A 1TX8A 1SLWB 2UUFB 4NIWA 4WMFA 3TJVA 1O3PB 1ZZZA 1NESE 1CGIE 1GHBF 3GY4A 5FX5A 4A1XA 1AWHB 3MFJA 5DG6A 3SUDA 2D26C 3F1SB 2QGRA 1EJMA 3A7YA 3P95A 5LH8A 1ANDA 1NROH 5AVDA 2H5DA 4IN2A 2PSYA 2ZG0H 5C20A 1O38A 3MNSA 1THPB 4ZHAA 1MCTA 1FQ3A 1OOKB 1C1OA 3Q3KA 3SU4A 1GJ8B 3F9HA 1FY5A 3SN8A 5GCHG 3D65E 4ZROA 3UPEA 1C1UH 1FN8A 3GCTF 3AAVA 4LOYH 2Y81A 1TRMA 4JZIA 2CGAA 1SGPE 2A4GA 1LO6A 1UTKA 4FUCA 4KGAA 1E37B 1O2XA 1O39A 1RGQA 4FU7A 1L1GA 2AIQA 1UK4A 5ESBA 4YOGA 6LPRA 1K1LA 5EW2H 2SGQE 2OUAA 2Y7XA 1FAKH 4DY7B 2ZQ1A 4X0WU 3KQCA 2NU2E 3E91A 1EXFA 3C27B 1HRTH 4VGCC 2H1UA 3H5CB 3SU2A 2IPHA 1XUKA 1ANBA 1AMHA 2FM2A 2A5IA 1BCUH 2H2ZA 1QIXB 1EPTC 1O34A 2FI5E 3GOVB 4NZQA 2BDIA 1HAYB 1QB9A 1K21H 2G5NA 1YYY1 1FAXA 4DJZB 2XWBI 1S82A 2WV4A 4CH8B 8GCHF 5C3NA 4ABHA 1EOJA 2VWLA 3KGPA 7KMEH 1T8LA 2WPKS 3GDSA 1OX1A 2UUKB 2FOAA 1TAWA 1DT2A 4TPIZ 1C1TA 1BBRK 4WMEA 4AN7A 3UNSA 1HGTH 2CXVA 1CU1A 4MNYA 2GV6A 2ASUB 3OY6U 4KKDA 4DG4A 1PQ8A 3V13A 1GI5A 9ESTA 4THNH 1AFQB 2BDBA 2GV7A 5EQQA 3VGCB 3ZV9A 2BQ6B 1TQ7B 2PR3A 4IW4E 2FDAA 3UUZA 4AFQA 1SPJA 4AGJA 3P8GA 2OCVB 3DFJA 3UNQA 2AGIX 3ATWA 2PUQH 3KQDA 2VB0A 5E2OA 1P2NA 4GCHG 3PROA 1GL1A 1UO6A 3M5NA 1SG8B 4GSOA 1C1QA 4ZKRU 4RKJB 2SNWA 5LPFA 3OYPA 1TA6A 5HXFA 3ENSB 4INHA 3KN2A 1BTPA 1HAHH 2XBYA 3HKJB 2WPJS 3M7UA 4KTCA 2BY6X 4NA8A 1NRPH 1P2QA 3RXUA 3A80A 3K65B 2CJIA 1RFNA 1GJ7B 2HRVA 2KAIB 4X6PA 1LQDB 3MWIU 3MU5A 3A83A 5EQRA 4B74A 1DOJA 1ZSLA 1BTXA 3BEFB 4I8LA 3SNBA 8GCHG 2HPQH 2SNVA 1N1LA 1GGDB 1N6XA 2RA0A 3RMMH 3URCA 5FCKA 1WU1A 1BTHH 2CMYA 2P3UB 3F68H 3ZZBA 1G3DA 3TU7H 4INLA 4CHAB 1J15A 4X6OA 2OINA 4E06H 1QURH 4UFGH 2J2UA 1TWXB 3GCHC 4LZ1H 2F83A 3MI4A 1FY3A 2BD9A 3RXRA 2D8WA 3BTKE 4Y6DA 1SHHB 1HBTH 2VGCB 4O3TA 2BXUH 1TNGA 4MNVA 4FUHA 2ULLA 2WUCA 3VXEH 3SHCH 4Y10E 4AYVB 1QR3E 1QY6A 1O3LA 1IQEA 4IC6A 4DVAU 3U8RH 2A7JA 4NWKA 4UFEH 5DKMA 1TONA 1D3PB 1ZGVA 4Y71A 1JRTA 1V2NT 2AERH 4OS2A 8KME2 1V2VT 5E0JA 2Y5HA 1TGCA 1GHWH 2BOHB 1FIWA 2A1DB 3A87A 4MPXA 3BTDE 2FESH 1E36B 4K3JA 1N6YA 4MLFB 3M7TA 2FXRA 1ELCA 1Y3WA 1QJ1B 1ZOMA 4J1YA 1KXDA 1TGNA 2F9NA 1HAXB 1S85A 5JBTA 2ZO3H 1QBVH 1TGBA 4I7YH 2A4QA 1BZXE 3MU4A 2C8ZB 3SU5A 3U69H 2HPPH 1GBBA 1GHAF 4RSPA 4B71A 1QGFA 2Q1JA 3B9FH 1C5RA 1GBTA 1GBDA 2CF8H 1C2LA 4ABBA 1EAXA 1GBAA 1PYTC 2ZPSA 2VH0A 1TMUH 1MAYA 1VITH 2FP7B 3SU3A 4B2BA 4NFFA 1B0FA 3UR6A 3ZZCA 4KTUA 4JK5A 1WTGH 1P10A 1WQVH 2G4UA 1KXEA 1CE5A 1FV9A 1ESTA 2GT8A 4JMYA 4NA7A 4BANB 5A8ZA 1ZYOA 2GZ7A 5F6MA 1PPHE 2V6NA 2BTCE 1UMAH 4FUBA 1MQ6A 2AFQB 4Y79A 3RM0H 2EI8A 4AORA 3NUMA 3Q77A 3LOXA 3RXDA 1G2LA 4BAOB 5GPIB 2FOFA 4YESB 5SGAE 2HOBA 4U32A 2ZPRA 4GVUA 4NIXA 1F7ZA 4JYTA 3SUGA 3ZVAA 1O35A 1B5GH 5FCRA 2OD3B 1J17T 1ZMNA 1SLUB 1C1PA 4ASHA 1ARBA 3PYHA 1OP2A 2V35A 1F92A 3ZZ4A 3GYMA 1S0RA 1DXPA 2ZFQH 1RIWC 5EU8A 1V3XA 3SUEA 2OQ5A 5BRRE 3PO1C 4I8KA 2Z9IA 2GCHF 3RXLA 2AYWA 1C5MD 4XFQA 1QNJA 2IN2A 1P2IA 2W7SA 1TNIA 1OWHA 1C2KA 1GI7B 4KTSA 4OGXA 4X8UH 1S6FA 1GHYH 1LDTT 2EI7A 1W0ZU 1HAVA 1O33A 3M61U 2GMTB 2A4OA 1UHBB 2F9BH 1RS0A 1GBHA 2ZEBA 4Y8ZA 2XTTB 3AVZA 1AVGH 2HGTH 4B2CA 2ZTYA 4I31A 3AASA 3EYDA 2QYIA 3ATLA 1ZPZA 3LU9B 8ESTE 2P95A 1GJDB 1ELAA 4XE4A 4IC5A 3SJIA 3T27A 3ZZ8A 1BRBE 3GY7A 1C4Y2 1O3NA 2ZF0H 3LPRA 1P05A 4NA9H 2BD5A 4AX9H 5A0AE 2YNBA 2BLQA 2WV5A 3NWUA 1UJ1A 3E6PH 3SU1A 1WOFA 2BYAX 5DO4H 1O5BB 1MZDA 1FY8E 3ZZ7A 2FTMA 4OS4A 4BTTB 5DP8A 3MMGA 4H42U 1K9OE 3RU4D 4DW2U 1ZMJA 3SNAA 2BM2A 5FAHA 3VXFH 7GCHF 5JBAS 2VU8E 1MU8B 2GX4A 5CMXH 3TH2H 2ZI2H 2VIQA 4AB8A 1CGHA 1TGSZ 5EXMA 3RUOA 4NSYA 1LKBA 3SU0A 4I32A 3BEIB 1DS2E 3RXEA 3VEQB 1SR5C 3O8BA 2C8WB 3M3VA 2SGDE 1DY8A 4WWYA 3U8TH 1V2TT 2TGAA 4XSKU 3PLKA 3SI3H 4MDSA 1GVLA 3GCOA 1A5IA 5A8YA 1EZQA 1XM1A 3AW0A 1C9PA 1DY9A 4WVPE 4Z6AH 4NCYA 1O2OA 4D9RA 2BD2A 1P3EA 3DUXH 4X1PU 3QDZB 4JYVH 1Z1JA 2D2DA 1EZUC 2XW9A 2ZPQA 1O5GH 5I46H 3A85A 3S0NA 3U9AH 4I8GA 1C4V2 1CA0B 1FY4A 3O8RA 2VINA 3PB1E 3A8DA 2GZ9A 1C5VA 1IOEA 1E35B 2DE9A 1G3CA 2FX4A 2A2QH 3RXOA 1QQUA 3BTFE 3QK1A 2GTBA 4ABDA 1T8NA 1SQTA 5A2MH 2A7HA 1ELEE 4A7IB 5EW1H 1MBQA 1BB0B 1MKXK 1W3CA 4MPVA 1YC0A 2P8OB 2UWOA 1ZSJA 1O2GH 1HLTH 1Y3XA 3S9AA 3ELAH 2VWNA 1G37A 1JOUB 1T8MA 2ZTZA 1C4U2 1ZJKA 1MBMA 1DWEH 3W95A 3QUMP 3MU8A 4AFUA 2XC4A 1BTYA 1K2I1 1LHCH 1HJ9A 4X1NU 4E05H 4UFFH 5C1YA 4IN1A 2VNTA 2VIWA 3H7TA 2HALA 5F8TA 4LZ4B 1BTWA 3IWMA 2NWNA 1NPMA 1AB9B 2BDAA 3P8NA 2BMGB 3A7VA 1P2KA 4AYYB 6GCHF 4JCNA 9LPRA 3EA7A 4Y76A 1GJBB 1O36A 1C5UA 2P94A 2PKAA 1F0RA 1OKXA 1MTVA 1FXYA 4NGAH 1IHSH 4FUFA 1C1WH 4U2WA 4BAHB 1HJ8A 3GY8A 2FLBH 1PQ5A 4Y7BA 2B7DH 4X1RU 3OX7U 1SQAA 1Y5BT 1TYNA 3A86A 2BX3A 3LGYA
chains in the Genus database with same CATH superfamily
1Y3UA 2FODA 4NG9H 2UWLA 1W12U 4LXBH 3EDXB 4CRAA 3D49H 1MKWK 2WPLS 2ZKSA 5ETXA 1HPGA 5IK2D 3F0PA 3SBKA 4MPUA 3VGCC 1V2KT 1V2UT 3KIDU 2OXSA 3KEEA 4O9VA 4Q2KA 4ACBA 5LPEA 1EZXC 3U28C 1QTFA 4SGAE 2ANMH 1O2IA 2Z3EA 1OWIA 2QXGA 2YOLA 4D76A 1PPGE 5TJXA 2BLVA 2ZFPH 1FI8A 4BAMB 2ZCKP 2ZP0H 1TBZH 3TVJB 4ISOA 1A5HA 1CBWB 1NT1A 1LTOA 2ZDVH 2ZDAH 3UQVA 2ZU2A 1TPAE 1NRSH 5PTPA 3TNSA 1C1MA 1YCPM 2OP9A 1C5QA 1XVOA 1LHDH 2PSXA 1GBLA 1VR1H 1MTNB 5A8XA 3U8OH 4A1TA 3B8JA 3F9FA 5C5OA 2AEIH 1FDPA 4D7GA 1KSNA 1FNIA 3FP8E 1EFRD 5LGOA 1C2HA 4OM9A 3EA9A 3SO3A 4JZ1A 1FUJA 2GGVB 4CHAC 2SGAA 1NBMD 2J92A 1DDJA 3MO3A 3RXVA 1VITG 2Q6GA 4B75A 5T6FA 2ANKH 3RXHA 2VGCC 4ZUHA 1TQ0B 4WF8A 3HK6B 2J95A 4Y0YE 2WINI 2H9HA 1BJVA 1KXCA 1DVAH 1TB6H 1UVUH 3LGUA 5F53A 4Q7ZA 1GHZA 1GDNA 2VWMA 1SGEE 3ZZ6A 2OC1A 3MH5A 1YF4A 3LIWA 2KX4A 1T7CA 2FWWA 3K9XB 2FYRA 5CE1A 1AE5A 1Y59T 1F5LA 2NU1E 4JZFH 5J4SA 3EA8A 2VVCA 1W0JD 3PMAB 3UQOA 2EA3A 3WY8A 1LPGB 2EI6A 1P11E 1B0EA 3WWFA 1COWD 2R3UA 2KCYA 3QX5H 1IQNA 4Y8YA 1GG6B 5GDSH 3M36A 3A7WA 1BT7A 3A7XA 1XUIA 3SU6A 4X8TH 3RP2A 2ZHFH 1JMOH 2GVFA 1ANEA 5HGGA 6ESTA 3FFGA 1SGDE 3MH6A 4MNWA 2W3KA 2WUBA 3FZDA 1GHBG 5JB9S 3LC5A 1O3DA 1GI9B 4Q4LA 4ZXXH 4RKOB 2O8LA 1OS8A 2LELA 1GJ4H 2FIRH 1A1RA 2JJ2D 1GDUA 3M3SA 1GI6A 5C1UA 2FOMB 3AAUA 4BNRA 1V2ST 1AFEH 3KQEA 3NKKA 2F9UA 3BTEE 2B9LA 4H6SB 2DUCA 4O03A 1TALA 4DOQA 3ZVBA 1PPZA 2KAIA 3W94A 1GWAA 2JETB 3RU4T 1G32B 1MUEB 2ZQ2A 2R2WU 4CRFA 1J8AA 4BAQB 1FY1A 1H8IH 1A4WH 1GJ9B 2V0BA 1QL9A 1TBRH 1GMCF 3GCTG 5EPNA 1HAOH 5A0CA 1GI1A 4JZDH 3SW2B 3ZVFA 1O3GA 3P8OA 2ZFSA 1GVKB 4DURA 2B0FA 3WW7A 1CSOE 2VIDA 1GPZA 3GYLB 4GPGA 3GDUA 5DK1A 1O3EA 3ZZ3A 1SOZA 1HB0B 1TA2A 1C2EA 1C1NA 4UDWH 1RTFB 3RU4E 1C5LH 3Q3YA 4ABAA 4A6LA 1LVBA 1AZ8A 2A5KA 1QBOA 3I29A 5L2ZH 1CGJE 3M7QA 5FBEA 3P92A 3LKWA 3SZNA 1YWUA 3T2NA 1TOMH 3A8CA 3MNBA 5FX6A 3C1KA 1FONA 1EQ9A 4WXVA 4F4OC 1UTNA 1EAUA 1L1NA 1Y8TA 2BOKA 1NY22 2F9PA 1K1IA 3HGNA 3PM3A 1YPMH 2ANYA 2FO9A 4FUEA 1T31A 3GISB 3PWCA 7ESTE 3T62A 1HJAB 1VGCC 3V3MA 3A7ZA 1GBFA 3RXIA 4ABFA 2OBQA 6CHAB 3KF2A 3SV7A 2BD4A 2C93B 1O3KA 1GCDA 1Z8IB 3VPKA 1EB1H 3R3GB 2BDYA 1GVZA 1UK2A 2UUJB 3MU1A 2WPHS 5DP9A 5F8ZA 1C2IA 3V7TA 3L3TA 2GCTC 5EIYA 1AY6H 2PKSC 1WDIA 2Z3DA 3PMJA 1UTQA 1HUTH 2G5VA 2XYAA 5GWZA 2J98A 3QGJA 1GMCG 2BZ6H 3PMHB 2PGBB 1GJ6A 3RLWH 1DITH 2ESTE 2R9PA 1EPTA 1IAUA 2XBWA 1KIGH 1UVTH 1XUJA 5TCCA 1Z7KA 1O3IA 2Q6DA 4OS7A 3TJOA 5BPEA 1Z8GA 3QWCH 1QA0A 2JH6D 4HG6A 2ZGJA 2RFKC 2HNTF 1QA7A 4K60A 4FETA 3A88A 4FU9A 1QCPA 2Y6TA 4BAKB 1BHXF 3H7OA 3TGJE 3PTBA 1AUJA 4A5TS 2OC8A 2J94A 1AN1E 2W6ID 3MO9A 1AUTC 1MZAA 3BF6H 1Y5UT 1GI4A 1BBRE 1S0QA 1WAYB 4F55A 4MVNA 4XDEA 3RMOH 3CS7A 3PV2A 1O2NA 4XBCA 1E0FD 1GBIA 1NU7B 4VGCB 1LCYA 7LPRA 5T6DA 1H9HE 1GJCB 2P59A 1EPTB 1TIOA 3LGVA 3N7OA 1D6WA 3UOPA 1AD8H 1HV7A 3BEUA 2FS8A 3QO6A 3UIRA 2VWOA 1TBQH 1SGIB 2YNAA 1GBJA 4I33A 1MD7A 3A8BA 1HDTH 3QTOH 3RXTA 5FL7D 4CREA 1SGYE 5E0HA 1C2MA 4GUXA 3GCNA 1EATA 1P0SH 4B1TA 2BLOA 2ZDLA 1RXPA 4UONA 1BMNH 3LC3A 1Y3YA 5DPAA 2Z3CA 1DUEA 2VBCA 5DP3A 1P03A 1H4WA 4X2YA 3UAIC 3F6UH 1C5TA 3M5OA 2TBSA 1C5ZB 1AIXH 5KGOA 3PMBB 2J4IA 5JDUB 5TCAA 1NC6A 3KYFA 2BQWB 2EEKA 1JXPA 3BIUH 4NIYA 3PLBA 2PV9B 3U1JB 1W7GH 4I8HA 1MCVA 3BIVH 2KCOA 3BG8A 4XBBA 4M7GA 4ZXYH 2NU0E 2ZA5A 1P57B 4NSVA 4Z0KA 5EJLA 5IYTA 1UHBA 1O2PA 1P2MA 2BD3A 2BY8X 1TNJA 3TNTA 1FMGA 2STAE 4CR9A 1LVYA 1MTWA 3TH4H 2BVSH 2AGGX 4TY7A 3SORA 2GJGA 5DP7A 1DFPA 1NZQH 3FVFB 1INCA 4A1VA 1VKYA 3K2UA 4D8NA 1SFQB 3NCLA 2Q6FA 1GHAG 1GHVH 1AB9C 1JIMA 4X1SU 1O2RA 4DCDA 2AS9A 2C8XB 1C1VH 1C5PA 1UVSH 1KXBA 4TYDA 1PQAA 5C67A 4ISNA 1SFIA 5A09A 2VIPA 1N8OB 5EODA 1ZHRA 1L4ZA 5H4IB 5LPRA 1EJAA 1SGFG 1WSSH 4R8TB 1TPSA 2SGEE 1V2LT 2ALVA 1UCYH 2WYJA 5CHAC 2C3SA 4ISHH 4FXGH 2XWAA 2J34A 1VCWA 1NFXA 2Y82A 3ZYDA 1D3QB 1O5FH 2LPRA 4O3UA 4BOHA 5FPTA 3IITA 4IS5A 1XVMA 2PTNA 1RTKA 2V3HH 2Z9KA 3V12A 1J9CH 2K1QA 4E7RG 2R3YA 1HAZB 3KYGA 4E7NA 4ZMAH 3DA9B 1BMFD 2ZTXA 3P8FA 5HM9A 1EP5A 1S81A 1ZPBA 1GMDF 1AU8A 2QF3A 2BB4A 3GICB 4Y0ZE 2IJD1 2W7UA 2HNTC 3UOUA 3GCHB 2G8TA 1ELDE 2PTCE 2M2AA 2WPIS 1P02A 1SBWA 2ANWA 2V3MA 1GBMA 4ACAA 3UWIA 3MH4A 1YLCA 1SGCA 5EXLA 3A81A 4YZUA 1JIRA 1PQ7A 1Z8JB 2OLGA 1WXRA 2V3OH 3MNXA 1IQMA 3PTNA 1TABE 1V2OT 1NO9H 3SJ9A 1O5CB 4BTUB 5FXLA 1HXFH 1TMBH 1T8OA 1YPJH 1DLEA 3A7TA 1LHEH 3VFEA 1ZTLA 3ZV8A 2TIOA 1BDAA 1OWDA 3TPIZ 3FZZA 2F9VA 1UK3A 2RA3A 2YMSD 5L30H 1O2QA 1O31A 2XBXA 3FP6E 3TK6A 1W13U 3K6YA 1WCZA 2A2XH 3QZRA 2AIPA 2I6QA 4WY3A 2SFAA 1A5GH 3QTVH 4X2XA 5DJ7A 2GCHG 1EUFA 2VVUA 1YCPH 2WPDD 1QHRB 5J4QA 2C8YB 4CRBA 2R2MB 4ZHLU 3UB0A 1O2HA 5G4BA 3OSYA 4INKA 1QJ7B 1NRQH 1LPKB 3E3TA 4CRDA 1CHOF 1C5WB 3BV9B 3ODFA 3OFND 3SYJA 2K8IA 1DWCH 2OTVA 3H09A 1K1NA 1P09A 4K8BA 4FUGA 1EJNA 1D4PB 2FI3E 1AGJA 1YPKH 3S9CA 1OWEA 5EG4A 3NRLA 1C5XB 3FOAA 1YPGH 2ZGCA 1W10U 4QT8C 2ZZUH 3F2HA 2OK5A 3MO6A 3SNCA 3QLPH 2FOEA 1HXEH 5GXPA 1BOQA 4YT7H 2XNIA 2Z9LA 1EB2A 1C5YB 1GI3A 5GJ4B 1ZRKA 2AHME 1EAWA 1P06A 5DGJA 1A0HB 1HAIH 1SSXA 3PV4A 3SV2H 5A0BA 7GCHG 4YOJA 1VCQA 1P2JA 3RC5A 1FN6A 5C0TA 4WJG2 1YLDA 3RXMA 3V0XA 5AHGH 3RXFA 3SQHE 3TJUA 4D9QA 1ZRBA 3OE7D 3HATH 3KQBA 4CH2B 1ETSH 1W0KD 3PV5A 1V2MT 3STIA 2XBVA 2BD8A 4XBDA 4ISLA 5JB8S 5E2PA 1IQLA 1WUNH 1RIWB 3R0FA 3VB6A 1KXAA 2PLXA 3SJ8A 2PHBA 3F2GA 3PO1B 4ZKOU 1JBUH 4X6NA 4XRNA 1AE8H 3SOSA 1L4DA 2ZGHA 2FI4E 4YTAA 1A2CH 3RLYH 2QCYA 1HAGE 1K1MA 2CHAB 4NIVA 1A0JA 1QB1A 1UTOA 2G00A 4TPYA 2LP6A 2JKHA 2BDCA 2XRCA 3U1IB 1AFQC 1DANH 1E34B 3ZIAD 3A8AA 3A82A 1ACBE 4WH6A 3E0PB 1G3EA 5JPMH 3D62A 1V2PT 3TITA 1EOLA 4ABIA 1YLNA 4HFPB 1LHGH 4Q7XA 2L6OA 3ZZDA 3ITIA 3TH3H 3SNDA 1V2QT 4K5ZA 3S69A 1HAPH 4IBLH 1C9TA 2RG3A 2RCEA 1SLXB 3E0NB 2UUYA 4FOUC 2NU3E 3UNRA 1EP6A 1SOTA 2HVYB 5GCHF 2A31A 5T6GA 3RXSA 2FYQA 3BTME 4AG1A 4FVDA 3QZQA 1UTLM 1E79D 3ATKA 2IOTA 3EE0B 1B7XB 1AKSB 6GCHG 1SB1H 2Z9GA 4X2VA 3O8DA 1BBRH 1O3MA 4H6TA 3STJA 5HMAA 1P9UA 1F0TA 2NU4E 2ZFRH 3HPTB 4WXIA 1MQ5A 1F2SE 1WV7H 2GKVE 1GGDC 1O3JA 3UWJH 1UCYE 1TGTA 3CS0A 3S9BA 1CT2E 5C94A 2FOGA 1A3EH 1KLTA 2Z6BD 3ZYEA 4Q80A 1AVWA 3KQ5A 3SGAE 2Y5GA 3UR9A 3MYWA 1L0ZA 2ZU1A 1ZPCA 2OBOA 2L74A 3BG4B 1F0UA 3MTYA 1XUFA 2QXIA 1O2UA 4ABGA 3LGWA 4AB9A 2ILNA 5L6NH 3BTWE 4TWYA 2FS9A 1QL7A 2VIVA 3PWBA 4P00A 1CVWH 1BTZA 1T4UH 1OYQA 3LGIA 1DSTA 2BY5X 3BTQE 1A3BH 1L2EA 2JIZD 3GDVA 4U01A 2QA9E 3M37A 1ELGA 2FLRH 2QF4A 4B2AA 1SL3A 1ELFA 4RN6A 1IQFA 2KCPA 2C90B 3T25A 3LJJA 3TK5A 1TMTH 4K1EA 1LHFH 3SI4H 5DP4A 5EXNA 3RDZA 1GI8B 1FLEE 4MPWA 4GLYA 1PPFE 1KTTB 3JZ1B 4K1TA 4GAWA 1D3TB 3LT3A 4ABJA 2BQ7B 1QL8A 3IG6B 3O8CA 3RM2H 1TFXA 1ZLRA 1O32A 1O3CA 4U30A 1XKAC 1SQOA 3DCLA 1DUAA 1RJXB 4FUIA 1G3BA 2FZZA 4GCHF 3M5MA 3BN9A 1V2WT 1YPEH 2ZIQH 4UFDH 4AG2A 3GY3A 3NXPA 1ID5H 3RC6A 1RRKA 2H9TH 3RMLH 4F49A 4SGBE 5E8EH 3P70B 3G01A 1DM4B 1HNEE 4AOQA 1SGRE 1UTMA 1OPHB 1BRAA 3F9GA 1HFDA 1OWJA 3Q3XA 2BVRH 3SV8A 1O3AA 1W8BH 3U98H 2GDEH 1IQGA 1YGCH 1ZR0A 1VJAU 2W26A 1ZTKA 2GT7A 1NFWA 1TRYA 3FAOA 1P3CA 3OTJE 5KECA 2FEQH 1O2LA 1EKBB 1D6RA 2V7QD 3M35A 3E8LA 1ZJDA 4F48B 3UY9A 1THRH 1C2JA 1WQSA 2BLWA 1Z71A 3E90B 2KZ4A 1SHYA 1T4VH 1GI0A 3RXBA 3ZZ9A 4JZEH 1V2RT 2P93A 1H8DH 1OSSA 1SC8U 3JZ2B 3F9EA 4O97A 5IDKA 1AQ7A 3VB4A 4IGDA 1GCTB 1P04A 4UD9H 2SGPE 3UREA 1IHTH 2W5EA 1VZQH 3ZZ5A 1DICA 4I86A 1EAIA 1C2FA 1UTPA 3A84A 3SJKA 4X8SH 3DT0H 2JH0D 3LGTA 1T32A 3ODDA 2ZNKH 4ASUD 3MOCA 1AO5A 1ZSKA 1RTLA 4UEHH 1BUIA 4MTBA 3LONA 4OS5A 4OGYA 5B6LA 2BY9X 1O0DH 3KCGH 2G51A 4BXSA 1DWDH 1PPBH 3HGPA 2M5TA 1FIZA 1IQJA 1D3DB 2THFB 3K6ZA 5EQSA 1OXGA 2CK3D 1GBEA 4ISIH 1TNLA 2C4FH 1O5EH 2O9QA 1N8OC 5EJZA 1P2OA 1O2JA 1BIOA 1C1SA 2ZDNA 5C1XA 1ESBA 3P17H 1GHXH 1PJPA 2TGDA 1SGQE 3NPSA 1MAXA 1C5OH 1A46H 1XXFA 1GMHF 1L1JA 1KLJH 3BSQA 1NRRH 2IJOB 2I6SA 1SGNE 2GMTC 1ZTJA 3OU0A 3QGNB 3HK3B 1NS3A 1LQEA 3TIUA 1H9IE 2A5AA 2HNTE 2VJ1A 1MTSA 3SV9A 1QB6A 1G2MA 2BD7A 3P6ZB 1LVOA 4AFZA 1C1RA 2BXTH 1FJSA 2BDHA 3URDA 1AZZA 1ELTA 1TLDA 2PP6A 4FUDA 2O8WA 1IQKA 1F5RA 4RT1A 3RXQA 3T26A 1BMMH 1W0YH 3RMNH 2WHXA 2A32A 4J2YB 2BHGA 1YPHE 2F3CE 2FX6A 4NFEA 3B23B 1Q31A 4CRGA 1A0LA 1CT0E 3SUFA 2AMPA 4ZAEA 1BTUA 3TK9A 3E16B 4HI3A 1EZSC 2QE7D 1P8VC 3LH3A 4IMQA 5B6OA 4Q63A 2D1JA 1ORFA 1CO7E 1YKTA 3SNEA 2ZGXH 2WYGA 2TRMA 3A89A 1A61H 1TPPA 1TX6A 1V6DA 3M3TA 4YLQH 2Y80A 1E1RD 1BRCE 2ZFFH 2ZDKA 1DX5M 3VB3A 4JK6A 4FU8A 1KLIH 2HVXA 2QXHA 3EGKH 4TWWA 1YPLH 2HWLB 3MNCA 1O2YA 1BMAA 2QXJA 5I25A 2AMDA 1GMHG 1O3FA 1XMNB 1FX0B 1S84A 5HYOA 1IQHA 2EC9H 3I77A 2QV1A 3Q00A 3RXAA 2H9EH 1P01A 2ODPA 1J16A 2A7CA 1ETTH 2RDLA 1DE7H 1CA0C 2ZHWH 2B8OH 3RXJA 4ABEA 1TOCB 4HTCH 1XUHA 4BTIB 1G36A 3BTGE 3VB5A 1S5SA 1NRNH 5DP6A 2GDDA 1ABJH 1JWTA 1D9IA 3AW1A 3KL6A 2Z7FE 1KXFA 4CBOA 1Q2WA 2H6MA 2OC7A 2R0KA 1Z1IA 5DP5A 1FPCH 1KDQA 1W2KH 2P8OC 3UTUH 1GL0E 1HIAA 5EJ1A 4CBNA 2ODQA 2KM0A 1FPHH 1O2ZA 1WBGB 3RC4A 3UFAA 1ANCA 5FBIA 2QC2A 2YMSC 1ARCA 1V2JT 2P3FH 1E1QD 2ZU3A 3TGKE 3TGIE 2CF9H 1O2MA 2BX4A 2GZ8A 4DIHH 5JBBS 3PLPA 2P16A 4Q7YA 1EX3A 2ZHEH 4TY6A 4PROA 3L33A 3FO8D 3ATIA 1LPZB 1O2WA 1BITA 2F9OA 2PWXA 3SZEA 1LVMA 2VVVA 5C2ZA 3RXGA 1Z6EA 1Y5AT 2G4TA 1O2KA 1Q3XA 2TPIZ 2VIOA 2Y5FA 2ZWLH 3DFLA 5FHTA 3SGQE 1P9SA 1SI5H 1NBME 4HGCA 3TJNA 2BY7X 2GD4B 5GIBA 1EASA 2BDGA 4GHQA 4WH8A 1PPEE 5T3HA 3RXKA 4IMZA 2G81E 3FANA 1VGCB 3LJOA 1KDQB 5AF9H 4X2WA 4CR5A 1MKXH 1YM0A 1BMLA 3SGBE 1HIAB 3MHWU 5AFYH 4Y7AA 2ZHDA 3RXCA 1KTSB 4BXWA 2CHAC 1ZHPA 2PFEA 1NTPA 1OYTH 5EOKA 5EPYA 4B6EA 1MH0A 1O2VA 1AHTH 1ESAA 2Y7ZA 2GCTB 1MABB 1PYTD 2BZAA 2PKSB 1TNKA 1QRWA 4CRCA 1THSH 3N7DA 4MG3A 4NWLA 1MD8A 1U6QA 4FVBA 1W7XH 1O2TA 4AC9A 1YBWA 1O5AB 3TLOA 2J9NA 2QAAA 1MU6B 1DSUA 2FOCA 3EAJA 1YPHC 1WYKA 2ODYB 4FUJA 1GBKA 1O37A 4YO9A 3DHKH 2F4LA 2TGTA 4H4FA 1ELBA 3S7KB 2QF0A 1CBWC 1K1OA 3RXPA 4I8JA 1AVXA 1IQIA 1NU9A 1Y3VA 3MH7A 2H5CA 1O5DH 2XCFA 2G55A 1XX9A 2Z94A 2BVXH 1OP8A 2ZCLP 1GDQA 1GI2A 1X7AC 2PW8H 4ZH8A 4D7FA 1MTNC 1LKAA 2O8TA 1GBCA 1ZMLA 1VJ9U 4DGJA 3SQEE 2XOKD 4ZKSU 5K0HA 4A92A 1O30A 1MKWH 4B73A 3DD2H 3CP7A 3GY6A 2OC0A 3E1XB 1RD3B 1HAVB 1UVOA 1F0SA 1OP0A 1GJ5H 3NZIA 3LDXH 1K1PA 4ZKNU 4DT7B 2FMJA 2J38A 3BG4C 3BTTE 1C2GA 1AI8H 1SLVB 4X1QU 1GMDG 2STBE 4R0IA 2XXLA 3D23A 1TPOA 2ZU5A 1O3HA 2VH6A 4MNXA 1W11U 2XC5A 2QY0B 2OQUA 5ESTE 1XUGA 3NK8A 5F03A 1CQQA 2WPMS 1K22H 2ZC9H 3T5FH 3MU0A 1TNHA 3BTHE 3T29A 1UVPA 5F8XA 4OS6A 2KCAA 3LH1A 1O3BA 2ZGBH 4KELA 3L6PA 3ESTA 1G30B 4YT6H 5EGMA 1K1JA 1ETRH 2WV9A 2DE8A 4YLUA 5DN6D 1TE0A 2CV3A 5L2YH 1AWFH 4AZ2B 3KHVA 1UCYK 1DWBH 1JRSA 2B5TB 2PUXB 4AGKA 1PFXC 1NM6A 2A4RA 1W14U 4ESTE 1GG6C 2JH5D 8LPRA 3CENA 3SHAH 1C5NH 1P12E 1PPCE 1QJ6B 4YOIA 1Z8RA 2FPZA 1LMWB 3ATMA 1ZHMA 2CN0H 2ZU4A 4LK4A 3EE7A 3ZVCA 4UE7H 1CHOG 5AFZH 1C2DA 1KYNA 1CHGA 3VB7A 3S7HB 5FPYA 2HLCA 3VG8A 1HYLA 1ABIH 4KP0A 2XC0A 1GJAB 1E38B 1QRXA 4OS1A 2ZFTA 2UWPA 2R0LA 1AKSA 1BQYA 4DIIH 5JBCS 3I78A 2QN5T 3F2FA 2JETC 4Y8XA 2A45B 4WMDA 1G9IE 1MMJN 4GHTA 4NZLA 4B76A 3OY5U 1J14A 2FOHA 2AH4X 4JYUH 4AFSA 5CHAB 5HM2A 1QBNA 2ZECA 3HKIB 3ZZAA 1DLKB 1M9UA 3GY2A 4K2YA 3SV6A 1TX7A 2P3TB 2W3IA 2GP9B 4ZHMU 2AGEX 1YP9A 3AK5A 1TRNA 1O3OA 2XCNA 1YCPK 2FTLE 5ABWA 1VCPA 5E0GA 1SGFA 4K1SA 3M5LA 2AMQA 3ZVDA 3ZVGA 2O8UA 1VITF 2PGQB 4RT0A 3SJOA 2LNCA 1A7SA 2EY4C 1GCTC 1F5KU 4XOJA 1S6HA 4X8VH 4YM9A 2RDEA 1BHXB 2SGFE 1FZZA 1NFYA 2A0QB 4MQAA 1QFKH 1ZGIA 4K8YA 3KNXA 1O2SA 2FOBA 1CA8B 1KY9A 1SGTA 2QIQA 2ALPA 4ZCNA 1DXWA 5JYIA 1BA8B 2Z9JA 1NFUA 1BRUP 1S6LA 5CDFE 1XXDA 2G52A 4Y11E 1S83A 3EQ0H 1MTUA 1C5SA 1WTHD 5DSFA 5K7RA 4K69A 1SMFE 2ZDMA 1H9LB 1SVPA 2PKAB 5C5NA 1QRZA 4HZHA 2ZHQH 3MQKC 1HJAC 2ZCHP 3Q76A 1QQ4A 1NN6A 1UTJA 1XKBC 6CHAC 2O8MA 1K28D 1OWKA 3ZVEA 3QN7A 1ELVA 2TGPZ 3FN8A 1DPOA 3WWBA 3GY5A 1HCGA 3T28A 1BJUA 1CT4E 3FP7E 1Z6JH 5FPSA 1H1BA 4X6MA 2F91A 1TX8A 1SLWB 2UUFB 4NIWA 4WMFA 3TJVA 1O3PB 1ZZZA 2QF5A 3DSOA 1NESE 1CGIE 1GHBF 3GY4A 5FX5A 4A1XA 1AWHB 3MFJA 5DG6A 3SUDA 2D26C 3F1SB 2QGRA 1EJMA 3A7YA 5C0UA 2K0QA 3P95A 5LH8A 1ANDA 1NROH 5AVDA 2H5DA 4IN2A 2PSYA 2ZG0H 5C20A 1O38A 3MNSA 1THPB 4ZHAA 1MCTA 1FQ3A 1OOKB 1C1OA 3Q3KA 3SU4A 1GJ8B 3F9HA 3OTPA 1FY5A 3SN8A 5GCHG 3D65E 4ZROA 3UPEA 1C1UH 1FN8A 3GCTF 3AAVA 2JDID 4LOYH 2Y81A 1TRMA 4JZIA 2CGAA 1SGPE 2A4GA 1LO6A 1UTKA 4FUCA 4KGAA 1E37B 1O2XA 1O39A 1RGQA 4FU7A 1L1GA 5HKKD 2AIQA 1UK4A 5ESBA 4YOGA 6LPRA 1K1LA 5EW2H 2SGQE 2OUAA 2Y7XA 1FAKH 4DY7B 2ZQ1A 4X0WU 3KQCA 2NU2E 5GNDA 3E91A 1EXFA 3C27B 1HRTH 4VGCC 2H1UA 3H5CB 3SU2A 2IPHA 1XUKA 1ANBA 1AMHA 2FM2A 2A5IA 1BCUH 2H2ZA 4RI0A 1QIXB 1EPTC 1O34A 2FI5E 3GOVB 4NZQA 2BDIA 1HAYB 2IPQX 1QB9A 1K21H 2G5NA 1SKYE 1YYY1 1FAXA 3N7EA 4DJZB 2XWBI 1S82A 2WV4A 4CH8B 1H8HD 8GCHF 5C3NA 4ABHA 1EOJA 2VWLA 3KGPA 7KMEH 1T8LA 2WPKS 3GDSA 1OX1A 2UUKB 4Z1MD 2FOAA 1TAWA 1DT2A 4TPIZ 1C1TA 1BBRK 4WMEA 4AN7A 3UNSA 1HGTH 2CXVA 1CU1A 4MNYA 2GV6A 2ASUB 3OY6U 4KKDA 4DG4A 1PQ8A 5CHBA 3V13A 1GI5A 9ESTA 4THNH 3W1EA 1AFQB 2BDBA 2GV7A 5EQQA 3VGCB 3ZV9A 2BQ6B 1TQ7B 2PR3A 4IW4E 2FDAA 3UUZA 4AFQA 1SPJA 4AGJA 3P8GA 2OCVB 3DFJA 3UNQA 2AGIX 3ATWA 2PUQH 3KQDA 2VB0A 5E2OA 2J5UA 1P2NA 4GCHG 3PROA 1GL1A 1UO6A 3M5NA 3DSGA 1SG8B 4GSOA 1C1QA 2HLDD 4ZKRU 4RKJB 2SNWA 5LPFA 3OYPA 1TA6A 5HXFA 3ENSB 4INHA 3KN2A 1BTPA 1HAHH 2XBYA 3HKJB 2WPJS 3M7UA 4KTCA 2BY6X 4NA8A 1NRPH 1P2QA 3RXUA 3A80A 3K65B 2CJIA 1RFNA 1GJ7B 2HRVA 2KAIB 4X6PA 1LQDB 3MWIU 3MU5A 3A83A 5EQRA 4B74A 5C17A 1DOJA 1ZSLA 1BTXA 3BEFB 4I8LA 3SNBA 8GCHG 3GS9A 2HPQH 2SNVA 1N1LA 1GGDB 1N6XA 2RA0A 3RMMH 3URCA 5FCKA 1WU1A 1BTHH 5KEDA 2KR7A 2CMYA 2P3UB 3F68H 3ZZBA 1G3DA 3TU7H 1SQRA 4INLA 1J15A 4CHAB 4X6OA 2J97A 2OINA 4E06H 1QURH 4UFGH 2J2UA 1TWXB 3GCHC 3OEHD 4LZ1H 2F83A 3MI4A 1FY3A 2BD9A 3RXRA 2D8WA 3BTKE 4Y6DA 1SHHB 1HBTH 2VGCB 4O3TA 2BXUH 1TNGA 4MNVA 4FUHA 2ULLA 2WUCA 3VXEH 3SHCH 4Y10E 4AYVB 1QR3E 1QY6A 1O3LA 1IQEA 4IC6A 4DVAU 3U8RH 2A7JA 4NWKA 4UFEH 5DKMA 1TONA 1D3PB 1ZGVA 4Y71A 1JRTA 1V2NT 2AERH 4OS2A 8KME2 1V2VT 5E0JA 2Y5HA 1TGCA 1GHWH 2BOHB 1FIWA 2A1DB 3A87A 3N99A 4MPXA 3BTDE 2FESH 1E36B 4K3JA 1N6YA 4MLFB 3M7TA 2FXRA 1ELCA 1Y3WA 1QJ1B 1ZOMA 4J1YA 1KXDA 1TGNA 2F9NA 2JJ1D 1HAXB 1S85A 5JBTA 2ZO3H 1QBVH 1TGBA 2J98B 4I7YH 2A4QA 1BZXE 3MU4A 2C8ZB 3SU5A 3U69H 2HPPH 1GBBA 1GHAF 4RSPA 4B71A 1QGFA 2Q1JA 3B9FH 1C5RA 1GBTA 1GBDA 2CF8H 1C2LA 4ABBA 1EAXA 1GBAA 1PYTC 2ZPSA 2VH0A 1TMUH 1MAYA 1VITH 2FP7B 3SU3A 4B2BA 4NFFA 1B0FA 3UR6A 4P02A 3ZZCA 4KTUA 3FKSD 3PRDA 4JK5A 1WTGH 1P10A 1WQVH 2G4UA 1KXEA 1CE5A 1FV9A 1ESTA 2GT8A 4JMYA 4NA7A 4BANB 5A8ZA 1ZYOA 2GZ7A 5F6MA 1PPHE 2V6NA 2BTCE 1UMAH 4FUBA 1MQ6A 2AFQB 4Y79A 3RM0H 2EI8A 4AORA 3NUMA 3Q77A 3LOXA 3RXDA 1G2LA 4BAOB 5GPIB 2FOFA 4YESB 5SGAE 2HOBA 4U32A 2ZPRA 4GVUA 4NIXA 1F7ZA 4JYTA 3SUGA 3ZVAA 1O35A 1B5GH 5FCRA 3F0OA 2OD3B 1J17T 1ZMNA 1SLUB 1C1PA 4ASHA 1ARBA 3PYHA 1OP2A 2KFWA 2V35A 1F92A 3ZZ4A 3GYMA 1S0RA 1DXPA 2ZFQH 1RIWC 5EU8A 1V3XA 3SUEA 2OQ5A 5BRRE 3PO1C 4I8KA 2Z9IA 2GCHF 1UW7A 3CNRA 3RXLA 2AYWA 1C5MD 4XFQA 1QNJA 2IN2A 1P2IA 2W7SA 1TNIA 1OWHA 1C2KA 1GI7B 4KTSA 4OGXA 4X8UH 1S6FA 1GHYH 1LDTT 2EI7A 1W0ZU 1HAVA 1O33A 3M61U 2GMTB 2A4OA 1UHBB 2F9BH 1RS0A 1GBHA 2ZEBA 4Y8ZA 2XTTB 3AVZA 1KMHB 1AVGH 2HGTH 4B2CA 2ZTYA 4I31A 3AASA 2W6JD 3EYDA 2QYIA 3ATLA 1ZPZA 3LU9B 8ESTE 2P95A 1GJDB 1ELAA 4XE4A 4IC5A 3SJIA 3T27A 3ZZ8A 1BRBE 3GY7A 1C4Y2 1O3NA 2ZF0H 3LPRA 1P05A 4NA9H 2BD5A 4AX9H 5A0AE 2YNBA 2BLQA 2WV5A 3NWUA 4TSFD 1UJ1A 3E6PH 3SU1A 1WOFA 2BYAX 5DO4H 1O5BB 1MZDA 1FY8E 3ZZ7A 2FTMA 4OS4A 4BTTB 5DP8A 3MMGA 4H42U 1K9OE 3RU4D 1OHHD 4DW2U 1ZMJA 3SNAA 2BM2A 5FAHA 3VXFH 7GCHF 5JBAS 2VU8E 2GX4A 1MU8B 5CMXH 1QZ8A 3TH2H 2ZI2H 2VIQA 4AB8A 1CGHA 1TGSZ 5EXMA 5T1VA 4NSYA 3RUOA 1LKBA 3SU0A 4I32A 3BEIB 1DS2E 3RXEA 3VEQB 1SR5C 3O8BA 2C8WB 3M3VA 2SGDE 1DY8A 4WWYA 3U8TH 1H8ED 1V2TT 5HIYA 2TGAA 4XSKU 3PLKA 3SI3H 4MDSA 1GVLA 3GCOA 1A5IA 4XD7D 5A8YA 1EZQA 1XM1A 3AW0A 2F43B 1C9PA 1DY9A 4B6FA 4WVPE 4Z6AH 4NCYA 1O2OA 4D9RA 2BD2A 1P3EA 1K0HA 3DUXH 3PRBA 2WZQA 4X1PU 3QDZB 4JYVH 1Z1JA 2D2DA 1EZUC 2XW9A 2ZPQA 1O5GH 5I46H 3A85A 3S0NA 3U9AH 3OAAD 4I8GA 1C4V2 1CA0B 1FY4A 3O8RA 2VINA 3PB1E 3A8DA 2GZ9A 1C5VA 1IOEA 1E35B 4YXWD 2DE9A 3DSPA 1G3CA 2FX4A 2A2QH 2WSSD 3RXOA 1QQUA 3BTFE 3QK1A 2GTBA 4ABDA 1T8NA 1SQTA 5A2MH 2A7HA 2XNDD 1ELEE 4A7IB 5EW1H 1MBQA 1BB0B 1MKXK 1W3CA 4MPVA 1YC0A 2P8OB 2UWOA 1ZSJA 3F3BA 1O2GH 1HLTH 1Y3XA 3S9AA 3ELAH 2VWNA 1G37A 1JOUB 1T8MA 2ZTZA 5HIZA 1C4U2 1ZJKA 1MBMA 1DWEH 3W95A 3QUMP 2YMSB 3MU8A 4AFUA 2XC4A 1BTYA 1K2I1 1LHCH 1HJ9A 4X1NU 4E05H 4UFFH 5C1YA 4IN1A 2VNTA 2VIWA 3H7TA 2HALA 5F8TA 4LZ4B 1BTWA 3IWMA 2NWNA 1NPMA 1AB9B 2BDAA 3P8NA 2BMGB 3A7VA 1P2KA 4TT3D 4DT4A 4AYYB 1YY3A 4JCNA 6GCHF 9LPRA 3EA7A 4Y76A 1GJBB 1O36A 1C5UA 2P94A 2PKAA 1F0RA 1OKXA 2EQNA 1MTVA 1FXYA 4NGAH 1IHSH 4FUFA 1C1WH 4U2WA 4BAHB 1HJ8A 3GY8A 2FLBH 1PQ5A 4Y7BA 2B7DH 4M9FA 4X1RU 3OX7U 1SQAA 1Y5BT 1TYNA 3A86A 2BX3A 3OEED 3LGYA
chains in the Genus database with same CATH topology
1Y3UA 2FODA 4NG9H 2UWLA 1W12U 4LXBH 3EDXB 4CRAA 3D49H 1MKWK 2WPLS 2ZKSA 5ETXA 1HPGA 3SBKA 4MPUA 3VGCC 1V2KT 1V2UT 3KIDU 2OXSA 3KEEA 4O9VA 4Q2KA 5LPEA 1EZXC 1QTFA 4SGAE 2ANMH 1O2IA 2Z3EA 1OWIA 2QXGA 2YOLA 4D76A 1PPGE 5TJXA 2BLVA 2ZFPH 1FI8A 4BAMB 2ZCKP 2ZP0H 1TBZH 3TVJB 4ISOA 1A5HA 1CBWB 1NT1A 1LTOA 2ZDVH 2ZDAH 3UQVA 2ZU2A 1TPAE 1NRSH 5PTPA 3TNSA 1C1MA 1YCPM 2OP9A 1C5QA 1XVOA 1LHDH 2PSXA 1GBLA 1VR1H 1MTNB 5A8XA 3U8OH 4A1TA 3B8JA 3F9FA 5C5OA 2AEIH 1FDPA 4D7GA 1KSNA 1FNIA 3FP8E 5LGOA 1C2HA 3EA9A 3SO3A 4JZ1A 1FUJA 2GGVB 4CHAC 2SGAA 2J92A 1DDJA 3MO3A 3RXVA 1VITG 2Q6GA 4B75A 5T6FA 2ANKH 3RXHA 2VGCC 4ZUHA 1TQ0B 4WF8A 3HK6B 2J95A 4Y0YE 2WINI 2H9HA 1BJVA 1KXCA 1DVAH 1TB6H 1UVUH 3LGUA 4Q7ZA 1GHZA 1GDNA 2VWMA 1SGEE 3ZZ6A 2OC1A 3MH5A 1YF4A 3LIWA 1T7CA 2FWWA 3K9XB 2FYRA 5CE1A 1AE5A 1Y59T 1F5LA 2NU1E 4JZFH 5J4SA 3EA8A 2VVCA 3PMAB 3UQOA 2EA3A 3WY8A 1LPGB 2EI6A 1P11E 1B0EA 2R3UA 3QX5H 1IQNA 4Y8YA 1GG6B 5GDSH 3M36A 3A7WA 1BT7A 3A7XA 1XUIA 3SU6A 4X8TH 3RP2A 2ZHFH 1JMOH 2GVFA 1ANEA 5HGGA 6ESTA 3FFGA 1SGDE 3MH6A 4MNWA 2W3KA 2WUBA 3FZDA 1GHBG 5JB9S 3LC5A 1O3DA 1GI9B 4ZXXH 4RKOB 2O8LA 1OS8A 1GJ4H 2FIRH 1A1RA 1GDUA 3M3SA 1GI6A 5C1UA 2FOMB 3AAUA 4BNRA 1V2ST 1AFEH 3KQEA 3NKKA 2F9UA 3BTEE 2B9LA 4H6SB 2DUCA 4O03A 1TALA 4DOQA 3ZVBA 1PPZA 2KAIA 3W94A 1GWAA 2JETB 3RU4T 1G32B 1MUEB 2ZQ2A 2R2WU 4CRFA 1J8AA 4BAQB 1FY1A 1H8IH 1A4WH 1GJ9B 2V0BA 1QL9A 1TBRH 1GMCF 3GCTG 5EPNA 1HAOH 5A0CA 1GI1A 4JZDH 3SW2B 3ZVFA 1O3GA 3P8OA 2ZFSA 1GVKB 4DURA 2B0FA 1CSOE 2VIDA 1GPZA 3GYLB 4GPGA 3GDUA 5DK1A 1O3EA 3ZZ3A 1SOZA 1HB0B 1TA2A 1C2EA 1C1NA 4UDWH 1RTFB 3RU4E 1C5LH 3Q3YA 4ABAA 4A6LA 1LVBA 1AZ8A 2A5KA 1QBOA 3I29A 5L2ZH 1CGJE 3M7QA 5FBEA 3P92A 3LKWA 3SZNA 3T2NA 1TOMH 3A8CA 3MNBA 5FX6A 3C1KA 1FONA 1EQ9A 4WXVA 4F4OC 1UTNA 1EAUA 1L1NA 1Y8TA 2BOKA 1NY22 2F9PA 1K1IA 3HGNA 3PM3A 1YPMH 2ANYA 2FO9A 4FUEA 1T31A 3GISB 3PWCA 7ESTE 3T62A 1HJAB 1VGCC 3V3MA 3A7ZA 1GBFA 3RXIA 4ABFA 2OBQA 6CHAB 3KF2A 3SV7A 2BD4A 2C93B 1O3KA 1GCDA 1Z8IB 3VPKA 1EB1H 3R3GB 2BDYA 1GVZA 1UK2A 2UUJB 3MU1A 2WPHS 5DP9A 5F8ZA 1C2IA 3V7TA 3L3TA 2GCTC 1AY6H 2PKSC 2Z3DA 3PMJA 1UTQA 1HUTH 2G5VA 2XYAA 5GWZA 3QGJA 1GMCG 2BZ6H 3PMHB 2PGBB 1GJ6A 3RLWH 1DITH 2ESTE 2R9PA 1EPTA 1IAUA 2XBWA 1KIGH 1UVTH 1XUJA 5TCCA 1Z7KA 1O3IA 2Q6DA 4OS7A 3TJOA 5BPEA 1Z8GA 3QWCH 1QA0A 2JH6D 2ZGJA 2HNTF 1QA7A 4K60A 3A88A 4FU9A 1QCPA 2Y6TA 4BAKB 1BHXF 3H7OA 3TGJE 3PTBA 1AUJA 4A5TS 2OC8A 2J94A 1AN1E 3MO9A 1AUTC 1MZAA 3BF6H 1Y5UT 1GI4A 1BBRE 1S0QA 1WAYB 4MVNA 4XDEA 3RMOH 3CS7A 1O2NA 4XBCA 1E0FD 1GBIA 1NU7B 4VGCB 1LCYA 7LPRA 5T6DA 1H9HE 1GJCB 2P59A 1EPTB 1TIOA 3LGVA 3N7OA 1D6WA 3UOPA 1AD8H 1HV7A 3BEUA 2FS8A 3QO6A 3UIRA 2VWOA 1TBQH 1SGIB 2YNAA 1GBJA 4I33A 1MD7A 3A8BA 1HDTH 3QTOH 3RXTA 4CREA 1SGYE 5E0HA 1C2MA 4GUXA 3GCNA 1EATA 1P0SH 4B1TA 2BLOA 2ZDLA 1RXPA 4UONA 1BMNH 3LC3A 1Y3YA 5DPAA 2Z3CA 1DUEA 5DP3A 1P03A 1H4WA 4X2YA 3F6UH 1C5TA 3M5OA 2TBSA 1C5ZB 1AIXH 3PMBB 2J4IA 5JDUB 5TCAA 1NC6A 2BQWB 2EEKA 1JXPA 3BIUH 4NIYA 3PLBA 2PV9B 3U1JB 1W7GH 4I8HA 1MCVA 3BIVH 3BG8A 4XBBA 4M7GA 4ZXYH 2NU0E 2ZA5A 1P57B 4NSVA 4Z0KA 5IYTA 1UHBA 1O2PA 1P2MA 2BD3A 2BY8X 1TNJA 3TNTA 1FMGA 2STAE 4CR9A 1LVYA 1MTWA 3TH4H 2BVSH 2AGGX 4TY7A 3SORA 5DP7A 1DFPA 1NZQH 3FVFB 1INCA 4A1VA 3K2UA 4D8NA 1SFQB 3NCLA 2Q6FA 1GHAG 1GHVH 1AB9C 1JIMA 4X1SU 1O2RA 4DCDA 2AS9A 2C8XB 1C1VH 1C5PA 1UVSH 1KXBA 4TYDA 1PQAA 5C67A 4ISNA 1SFIA 5A09A 2VIPA 1N8OB 5EODA 1ZHRA 1L4ZA 5H4IB 5LPRA 1EJAA 1SGFG 1WSSH 4R8TB 1TPSA 2SGEE 1V2LT 2ALVA 1UCYH 2WYJA 5CHAC 2C3SA 4ISHH 4FXGH 2XWAA 2J34A 1VCWA 1NFXA 2Y82A 3ZYDA 1D3QB 1O5FH 2LPRA 4O3UA 4BOHA 5FPTA 3IITA 4IS5A 1XVMA 2PTNA 1RTKA 2V3HH 2Z9KA 3V12A 1J9CH 2K1QA 4E7RG 2R3YA 1HAZB 4E7NA 4ZMAH 3DA9B 2ZTXA 3P8FA 5HM9A 1EP5A 1S81A 1ZPBA 1GMDF 1AU8A 2QF3A 2BB4A 3GICB 4Y0ZE 2W7UA 2HNTC 3UOUA 3GCHB 2G8TA 1ELDE 2PTCE 2WPIS 1P02A 1SBWA 2ANWA 1GBMA 3UWIA 3MH4A 1YLCA 1SGCA 5EXLA 3A81A 4YZUA 1JIRA 1PQ7A 1Z8JB 2OLGA 2V3OH 3MNXA 1IQMA 3PTNA 1TABE 1V2OT 1NO9H 3SJ9A 1O5CB 4BTUB 5FXLA 1HXFH 1TMBH 1T8OA 1YPJH 1DLEA 3A7TA 1LHEH 3VFEA 1ZTLA 3ZV8A 2TIOA 1BDAA 1OWDA 3TPIZ 3FZZA 2F9VA 1UK3A 2RA3A 5L30H 1O2QA 1O31A 2XBXA 3FP6E 3TK6A 1W13U 3K6YA 1WCZA 2A2XH 3QZRA 2AIPA 2I6QA 4WY3A 2SFAA 1A5GH 3QTVH 4X2XA 5DJ7A 2GCHG 1EUFA 2VVUA 1YCPH 1QHRB 5J4QA 2C8YB 4CRBA 2R2MB 4ZHLU 1O2HA 5G4BA 3OSYA 4INKA 1QJ7B 1NRQH 1LPKB 3E3TA 4CRDA 1CHOF 1C5WB 3BV9B 3ODFA 1DWCH 2OTVA 1K1NA 1P09A 4K8BA 4FUGA 1EJNA 1D4PB 2FI3E 1AGJA 1YPKH 3S9CA 1OWEA 5EG4A 1C5XB 1YPGH 2ZGCA 1W10U 4QT8C 2ZZUH 3MO6A 3SNCA 3QLPH 2FOEA 1HXEH 5GXPA 1BOQA 4YT7H 2XNIA 2Z9LA 1EB2A 1C5YB 1GI3A 5GJ4B 1ZRKA 1EAWA 1P06A 5DGJA 1A0HB 1HAIH 1SSXA 3PV4A 3SV2H 5A0BA 7GCHG 4YOJA 1VCQA 1P2JA 3RC5A 1FN6A 4WJG2 1YLDA 3RXMA 3V0XA 5AHGH 3RXFA 3SQHE 3TJUA 4D9QA 1ZRBA 3HATH 3KQBA 4CH2B 1ETSH 1V2MT 3STIA 2XBVA 2BD8A 4XBDA 4ISLA 5JB8S 5E2PA 1IQLA 1WUNH 1RIWB 3R0FA 3VB6A 1KXAA 2PLXA 3SJ8A 2PHBA 4ZKOU 3PO1B 1JBUH 4X6NA 1AE8H 3SOSA 1L4DA 2ZGHA 2FI4E 4YTAA 1A2CH 3RLYH 2QCYA 1HAGE 1K1MA 2CHAB 4NIVA 1A0JA 1QB1A 1UTOA 2G00A 4TPYA 2JKHA 2BDCA 2XRCA 3U1IB 1AFQC 1DANH 1E34B 3A8AA 3A82A 1ACBE 4WH6A 3E0PB 1G3EA 5JPMH 3D62A 1V2PT 3TITA 1EOLA 4ABIA 4HFPB 1LHGH 4Q7XA 3ZZDA 3ITIA 3TH3H 3SNDA 1V2QT 4K5ZA 3S69A 1HAPH 4IBLH 1C9TA 2RG3A 2RCEA 1SLXB 3E0NB 2UUYA 2NU3E 3UNRA 1EP6A 1SOTA 5GCHF 2A31A 5T6GA 3RXSA 2FYQA 3BTME 4AG1A 4FVDA 3QZQA 1UTLM 3ATKA 2IOTA 3EE0B 1B7XB 1AKSB 6GCHG 1SB1H 2Z9GA 4X2VA 3O8DA 1BBRH 1O3MA 4H6TA 3STJA 5HMAA 1P9UA 1F0TA 2NU4E 2ZFRH 3HPTB 4WXIA 1MQ5A 1F2SE 1WV7H 2GKVE 1GGDC 1O3JA 3UWJH 1UCYE 1TGTA 3CS0A 3S9BA 1CT2E 2FOGA 1A3EH 1KLTA 2Z6BD 3ZYEA 4Q80A 1AVWA 3SGAE 2Y5GA 3UR9A 3MYWA 1L0ZA 2ZU1A 1ZPCA 2OBOA 3BG4B 1F0UA 3MTYA 1XUFA 2QXIA 1O2UA 4ABGA 3LGWA 4AB9A 2ILNA 5L6NH 3BTWE 4TWYA 2FS9A 1QL7A 2VIVA 3PWBA 1CVWH 1BTZA 1T4UH 1OYQA 3LGIA 1DSTA 2BY5X 3BTQE 1A3BH 1L2EA 3GDVA 4U01A 2QA9E 3M37A 1ELGA 2FLRH 4B2AA 1SL3A 1ELFA 4RN6A 1IQFA 2C90B 3T25A 3LJJA 3TK5A 1TMTH 4K1EA 1LHFH 3SI4H 5DP4A 5EXNA 3RDZA 1GI8B 1FLEE 4MPWA 4GLYA 1PPFE 1KTTB 3JZ1B 4K1TA 4GAWA 1D3TB 3LT3A 4ABJA 2BQ7B 1QL8A 3IG6B 3O8CA 3RM2H 1TFXA 1ZLRA 1O32A 1O3CA 4U30A 1XKAC 1SQOA 1DUAA 1RJXB 4FUIA 1G3BA 2FZZA 4GCHF 3M5MA 3BN9A 1V2WT 1YPEH 2ZIQH 4UFDH 4AG2A 3GY3A 3NXPA 1ID5H 3RC6A 1RRKA 2H9TH 3RMLH 4F49A 4SGBE 5E8EH 3P70B 3G01A 1DM4B 1HNEE 4AOQA 1SGRE 1UTMA 1OPHB 1BRAA 3F9GA 1HFDA 1OWJA 3Q3XA 2BVRH 3SV8A 1O3AA 1W8BH 3U98H 2GDEH 1IQGA 1YGCH 1ZR0A 1VJAU 2W26A 1ZTKA 2GT7A 1NFWA 1TRYA 3FAOA 1P3CA 3OTJE 2FEQH 1O2LA 1EKBB 1D6RA 3M35A 3E8LA 1ZJDA 3UY9A 1THRH 1C2JA 1WQSA 2BLWA 1Z71A 3E90B 1SHYA 1T4VH 1GI0A 3RXBA 3ZZ9A 4JZEH 1V2RT 2P93A 1H8DH 1OSSA 1SC8U 3JZ2B 3F9EA 4O97A 5IDKA 1AQ7A 3VB4A 4IGDA 1GCTB 1P04A 4UD9H 2SGPE 3UREA 1IHTH 2W5EA 1VZQH 3ZZ5A 1DICA 1EAIA 1C2FA 1UTPA 3A84A 3SJKA 4X8SH 3DT0H 2JH0D 3LGTA 1T32A 3ODDA 2ZNKH 3MOCA 1AO5A 1ZSKA 1RTLA 4UEHH 1BUIA 4MTBA 3LONA 4OS5A 4OGYA 2BY9X 1O0DH 3KCGH 2G51A 4BXSA 1DWDH 1PPBH 3HGPA 2M5TA 1FIZA 1IQJA 1D3DB 2THFB 3K6ZA 5EQSA 1OXGA 4ISIH 1GBEA 1TNLA 2C4FH 1O5EH 2O9QA 1N8OC 1P2OA 1O2JA 1BIOA 1C1SA 2ZDNA 5C1XA 1ESBA 3P17H 1GHXH 1PJPA 2TGDA 1SGQE 3NPSA 1MAXA 1C5OH 1A46H 1XXFA 1GMHF 1L1JA 1KLJH 3BSQA 1NRRH 2IJOB 2I6SA 1SGNE 2GMTC 1ZTJA 3OU0A 3QGNB 3HK3B 1NS3A 1LQEA 3TIUA 1H9IE 2A5AA 2HNTE 2VJ1A 1MTSA 3SV9A 1QB6A 1G2MA 2BD7A 3P6ZB 1LVOA 4AFZA 1C1RA 2BXTH 1FJSA 2BDHA 3URDA 1AZZA 1ELTA 1TLDA 4FUDA 2O8WA 1IQKA 1F5RA 3RXQA 3T26A 1BMMH 1W0YH 3RMNH 2A32A 4J2YB 2BHGA 1YPHE 2F3CE 2FX6A 4NFEA 3B23B 1Q31A 4CRGA 1A0LA 1CT0E 3SUFA 2AMPA 4ZAEA 1BTUA 3TK9A 3E16B 4HI3A 1EZSC 1P8VC 3LH3A 4IMQA 5B6OA 2D1JA 1ORFA 1CO7E 1YKTA 3SNEA 2ZGXH 2WYGA 2TRMA 3A89A 1A61H 1TPPA 1TX6A 1V6DA 3M3TA 4YLQH 2Y80A 1BRCE 2ZFFH 2ZDKA 1DX5M 3VB3A 4JK6A 4FU8A 1KLIH 2HVXA 2QXHA 3EGKH 4TWWA 1YPLH 2HWLB 3MNCA 1O2YA 1BMAA 2QXJA 5I25A 2AMDA 1GMHG 1O3FA 1XMNB 1S84A 5HYOA 1IQHA 2EC9H 3I77A 2QV1A 3Q00A 3RXAA 2H9EH 1P01A 2ODPA 1J16A 2A7CA 1ETTH 2RDLA