3BTFE

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btfE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btfE02
4AORA 2ESTE 3ZZAA 1A0HB 5A8YA 2BDAA 3RU4T 3MNCA 4NFFA 5ESBA 4IW4E 2PSXA 9LPRA 1O3EA 6GCHF 3NXPA 3GY7A 1S83A 3A86A 4FUCA 2VU8E 3RXGA 4I8HA 1NT1A 1O2IA 2YOLA 5C1UA 1GHXH 1XVMA 3F68H 1BMAA 1DFPA 1TGSZ 3P8FA 1F0SA 3VB5A 1TBQH 3A85A 3SJ8A 3S7KB 3VB6A 5LPEA 1ARBA 1BMNH 1C1NA 1V2ST 3E90B 1NESE 4FUHA 1CT2E 4XE4A 4OS4A 2AYWA 1ABJH 1LHDH 2V6NA 4A1XA 5I25A 3BTWE 4LK4A 1FY1A 4ZAEA 2PKAA 1NRSH 1UHBB 1S5SA 4X6PA 4UEHH 1MKXH 4IN2A 1O2LA 1L1NA 1H1BA 1EZQA 3SOSA 3NZIA 5C3NA 1YCPM 4WJG2 1JRSA 1D3TB 1C2DA 2ZFQH 4X8SH 2FOEA 1SGYE 3S0NA 4DG4A 1TONA 3TNTA 1GHVH 1EPTA 2P8OC 4BAHB 1QY6A 4MNWA 1DLEA 4K3JA 6CHAB 1QA7A 2GZ8A 4JZIA 3DHKH 5EU8A 4KTCA 4UONA 3MU5A 2OCVB 2GV6A 1P2MA 2QY0B 5F8ZA 2AMQA 5H4IB 1C4U2 3GCTF 3E6PH 4R0IA 4ZKRU 2ZFSA 3ZZBA 1H8DH 1Z6EA 3L6PA 3SV8A 1P2JA 2H6MA 1DT2A 3E8LA 1ZMJA 1C5ZB 1O2NA 2C8WB 2I6SA 3ITIA 2VGCB 1C5LH 1YPGH 1JWTA 1Z8JB 2WPLS 4Y71A 3EQ0H 2EC9H 1O5BB 2CJIA 1PPZA 3VPKA 1MQ6A 1QNJA 4OS7A 4Q80A 2ZNKH 3PO1B 1RTFB 1E36B 4ISIH 3KF2A 1C2IA 3SJIA 5HXFA 1WU1A 2ZIQH 1BA8B 4IC5A 1AUTC 3QTOH 1CQQA 3ZZDA 4KKDA 1OWDA 2XW9A 1IHTH 3MU8A 3MOCA 3SJKA 1YLCA 1VITH 1LQEA 1TBZH 2F3CE 1THSH 2FX6A 2IPHA 5EQRA 3RXDA 1TGNA 2BLQA 4ABDA 1KDQB 2Y7ZA 3SUFA 1RIWC 1O2GH 1S81A 3EE0B 3TVJB 4ISNA 1UVTH 1E0FD 2QIQA 4X6NA 2ZGHA 1C5VA 3PV4A 4ZH8A 4GPGA 1CA0B 2PSYA 4FU9A 1P57B 1GJ5H 1SGDE 3RXJA 3M5LA 1BTHH 2VWNA 4TWYA 1TNGA 1HIAA 1LO6A 3CS0A 3RMOH 2ZG0H 4JZ1A 2TRMA 5IDKA 1PQ7A 3ZZ8A 2W3KA 3T62A 2HWLB 2XC4A 1JOUB 4I33A 1IQGA 1QRWA 3SGQE 2ZHEH 5C5OA 1K21H 1AE5A 1IQIA 4Z6AH 2A32A 1QJ7B 2G81E 1YM0A 2Z9IA 3RM0H 3MH7A 1GBTA 3PWCA 4OS2A 4IS5A 2BQ7B 3LGYA 3GCHC 1AFEH 2OTVA 4UE7H 2O8WA 1BRBE 2FTLE 3FANA 1O5AB 1DITH 3E1XB 1AB9B 4ABHA 5JB9S 1TYNA 1BMMH 2G4TA 3P95A 2A4RA 3A7TA 1WOFA 1EB1H 2BY7X 4HGCA 1F0RA 2LNCA 3RMLH 8ESTE 1GJ4H 1K1LA 3VEQB 3GCOA 3UWIA 3HGPA 2ZKSA 1OOKB 1ZHMA 3SUGA 1HCGA 5F8XA 2ZO3H 1C9TA 1T4VH 1GMDF 1XXDA 1PQAA 2Z3EA 3U1IB 2HRVA 1HAHH 1SQAA 1XKAC 1ZTJA 2BZ6H 5AF9H 1TAWA 2ZFTA 1QB9A 3A7ZA 3F9FA 3SNBA 1O2JA 2GCTB 1KLIH 3M7QA 4RKOB 3ODFA 3V0XA 1GDUA 3SQHE 2AGGX 4X8UH 4RSPA 1KTTB 2BDIA 1GPZA 3D65E 4FXGH 1DLKB 1BJUA 1EB2A 4YOGA 4Q7XA 4X8VH 1F7ZA 1L1GA 5IYTA 1ELAA 3PMJA 2FI5E 3O8CA 4NIWA 1ESBA 2VWMA 4Y8YA 5DJ7A 1EUFA 1FI8A 1IHSH 1C1QA 3QZQA 3LGTA 4NCYA 3EAJA 1CBWC 1G2LA 1CVWH 5DK1A 1C2KA 2BY6X 1AE8H 2STBE 1P11E 2WPMS 2DUCA 2GMTB 2NU2E 1EAXA 1O2UA 1XKBC 1SGPE 1D3DB 1ESAA 3OSYA 4AG1A 1BCUH 4CRBA 3SUEA 4WH6A 3FZDA 3RXCA 1QGFA 1L1JA 3S9BA 1O3PB 5EODA 1HAVB 4O3TA 2R3UA 1EJNA 3MI4A 2BQ6B 1IQKA 4GLYA 3LC5A 5TCCA 3NPSA 1QIXB 1OWEA 3LOXA 4UD9H 1F2SE 5HM2A 1PQ5A 1H9HE 5C2ZA 2ZHFH 3V13A 1HAIH 1XX9A 3K65B 1BRAA 2H5CA 4UFFH 4MDSA 3U8OH 3LIWA 1LVBA 3SORA 2EEKA 1W11U 5L6NH 2W26A 1ZPBA 2Y5FA 1BTUA 4KTSA 3KQCA 2D1JA 3A81A 4UDWH 2EI6A 1J8AA 3TJUA 2ZWLH 1O33A 1KIGH 2J2UA 1V2KT 5F03A 3BEIB 3RXEA 1HIAB 1X7AC 1TPPA 3SBKA 3QX5H 1GBCA 4TY6A 1SGFG 4YOIA 3PLKA 1SPJA 3SU4A 1OP8A 2BDYA 4K69A 1AO5A 1T31A 2BDGA 4NZQA 1TGTA 4K2YA 4O97A 1TE0A 1F92A 1SGEE 3URDA 1GBBA 2BOKA 4Y8XA 3P6ZB 3U8RH 1RGQA 3VGCC 1QRZA 3H5CB 1HJAB 4O3UA 3RXVA 1EJAA 1BHXF 4OGYA 4B73A 3RXUA 1EZXC 1YYY1 4JK6A 1QCPA 1ELDE 2BLWA 2VIPA 2ANKH 1ZRBA 3IWMA 4DGJA 4GUXA 2WV5A 2O8LA 2FTMA 3OYPA 1HJ8A 2PHBA 5J4QA 1UK2A 1AVXA 4BTTB 5F6MA 1DM4B 1HGTH 1TMBH 4U32A 4Y76A 1NRQH 2RG3A 1CE5A 3RXIA 1LTOA 3TK9A 3GCNA 3SI4H 4CRAA 2Q1JA 1ZTLA 1SHHB 1AIXH 5GIBA 1SVPA 1VITG 2TGDA 4AGJA 3D23A 4HTCH 2RDLA 5EXNA 2C8ZB 1GHZA 5A09A 1BITA 5HM9A 1P3CA 5FHTA 3ELAH 3RU4D 3ODDA 3MU4A 4MG3A 1XUKA 4DURA 2QF3A 5BPEA 4D7FA 1C2MA 3ATMA 3MH4A 1DY9A 2GTBA 4B2AA 3TU7H 3QLPH 1Y8TA 1FY8E 3ATIA 4MLFB 1RD3B 1XUIA 4FU8A 3GCTG 3ZYEA 1TQ7B 4E06H 3R3GB 2XCFA 1O5EH 2Y5HA 2M5TA 1P02A 1G32B 3ZYDA 2H2ZA 1C5WB 1MKXK 2CV3A 1K1MA 2FLBH 4INLA 4NSVA 3KIDU 1GJDB 1AVGH 1UTKA 3LT3A 4ISLA 1GI9B 3SNAA 2GT7A 2AIQA 3A8CA 2ANWA 5GCHG 1GL1A 3M37A 2ZGBH 2A1DB 4JK5A 1LVYA 4AN7A 3UR9A 1E34B 2B8OH 1LQDB 3H7OA 1ZJDA 5LGOA 1CSOE 1YKTA 2W7UA 1N8OC 1BTWA 1XMNB 1C4V2 4ABFA 4I8KA 1O3MA 1W0YH 3LKWA 3BN9A 1LHCH 3PYHA 3VB3A 4NZLA 4F4OC 1RJXB 4M7GA 2PKSB 4B71A 4AYYB 2AMDA 2OD3B 3MTYA 3U1JB 1Y3XA 1O31A 1YPJH 1ARCA 2JETC 3UWJH 1OWKA 1O34A 1PPHE 1O2OA 3QTVH 2HVXA 2FM2A 4Q7ZA 5EQQA 1GBEA 1O2VA 2IOTA 3V12A 4YO9A 3ESTA 3FP6E 3UNRA 1T8NA 3BG4C 1PYTC 1XUFA 3UTUH 1MCTA 4RN6A 1QL8A 3NKKA 2J38A 8KME2 3RXTA 1QQ4A 1D4PB 1ZMNA 4NIXA 2ZU2A 1O2TA 5EW1H 1GI7B 2AEIH 3LONA 1GHBG 2VIOA 3KQBA 2BDBA 5JPMH 3GYMA 3FP8E 4NA8A 2BD2A 1FPHH 2P3FH 3TITA 4QT8C 1AGJA 1WQSA 4KTUA 2H9TH 3GY5A 1FN8A 2A5AA 3P8GA 1AKSA 1YF4A 1UTLM 4X1PU 1PPCE 2V35A 3A7WA 3FFGA 1GHWH 1SLUB 2ZHWH 2ZQ2A 1ETTH 1O2MA 3BTDE 1RTLA 1UK4A 5K7RA 2FZZA 2GVFA 1RIWB 4D9RA 3I77A 1KXCA 2FIRH 2G00A 3LGIA 1ELGA 4NG9H 1ANEA 3VB4A 4AGKA 1L2EA 4WVPE 2PFEA 1Y5UT 3DFJA 5EXMA 1TB6H 4FVDA 2FDAA 4B1TA 1B0EA 5ABWA 4IN1A 1C2GA 3TNSA 1GJ8B 2TPIZ 3NK8A 8GCHF 1U6QA 1TNKA 3PLBA 1YPKH 2XBVA 1QHRB 2P16A 1C2HA 1BQYA 4A7IB 1A3EH 3QO6A 1WV7H 1DUEA 1A0LA 2A5KA 1C5PA 1GMDG 5L2ZH 2VVVA 4BNRA 3RXLA 2FLRH 4U2WA 3VXFH 3U9AH 3RM2H 3GOVB 1K2I1 1YPMH 3E91A 3T28A 3DT0H 4F49A 4WXVA 4IMQA 1DSTA 2FOCA 1Z6JH 4YLQH 1TWXB 1LCYA 2Z9JA 1LHEH 1WQVH 3RXSA 3MNXA 1HJ9A 2VIVA 2CXVA 1KSNA 1VCQA 3GYLB 5A2MH 1TNIA 5HYOA 1FJSA 1TRMA 2QN5T 1D9IA 1FAKH 1O5FH 2RA3A 2JH5D 1NU9A 1BRUP 4ASHA 1XM1A 1TLDA 4JYVH 1TABE 2VNTA 2UUJB 4XOJA 2AH4X 1DDJA 1GGDB 2JH6D 3P8OA 3PWBA 3ZVCA 1ZGIA 2ZTXA 1V2LT 1HRTH 1QTFA 3GDUA 4TWWA 3A80A 1AZZA 1FUJA 1C5MD 4MPWA 5A8XA 2W7SA 3RMMH 1C5XB 1O3HA 1AVWA 4Y79A 2Z3CA 4HZHA 1HAGE 1YPLH 1Z8IB 3KGPA 5CHAB 5GDSH 3A87A 1SGTA 4BAKB 4H42U 3SNDA 4B2CA 1ZTKA 1T4UH 1P04A 1GI8B 3T5FH 4B74A 2J4IA 1CBWB 1LMWB 3A89A 4NSYA 1H4WA 1DSUA 1E35B 1GBFA 1C9PA 3TK5A 1IQEA 2HNTE 2W5EA 1C1MA 2V0BA 3W95A 1OSSA 3P92A 4D76A 1F5RA 4ABJA 1O3CA 1C1SA 3LGWA 1XXFA 3GDSA 4AB8A 1VITF 3AW1A 4D9QA 1O3KA 1O36A 3HKJB 3CP7A 1O2RA 1ETSH 2J94A 2J95A 3UNSA 3RP2A 2FEQH 4Y0YE 2BDHA 3RXKA 2RCEA 1GJBB 1TX8A 1MTVA 2VVCA 1T8LA 3D49H 1G30B 2O9QA 1AKSB 4DT7B 3ZZ9A 2XC5A 4XBDA 1TMUH 1DUAA 5T6DA 2JKHA 3SV9A 1O39A 1UO6A 1UVPA 2HNTF 1KY9A 1GI4A 4FUBA 1AFQC 1BZXE 1SLWB 2Y6TA 1DWBH 2F9UA 4WXIA 4I8GA 1FPCH 4O03A 3AAUA 1J16A 3BTQE 5JBCS 5C67A 1UTQA 1P01A 3RXRA 1GDNA 4I31A 5LPRA 1HV7A 3V3MA 1C5OH 2AS9A 1RFNA 1QFKH 5GCHF 5GWZA 1GI2A 3NUMA 8LPRA 2VWLA 4LOYH 3EA8A 1F0TA 3ENSB 1AHTH 3GY6A 1ELEE 1K1OA 1P2IA 1SLXB 2VINA 1OWIA 1GMCF 3P70B 2BD9A 2D2DA 1RTKA 2WPKS 4KELA 3A7YA 3E16B 4ABAA 1E38B 1UJ1A 3MU0A 5GJ4B 1BT7A 1F5LA 1YBWA 1NPMA 4OS1A 2OLGA 5DG6A 1TNHA 4RKJB 1WAYB 2WUBA 4FUIA 2BQWB 1ANDA 1P2KA 4H6SB 4YESB 1HAPH 3BF6H 1TPAE 1OKXA 7LPRA 3TH4H 4MTBA 5JBAS 2FS8A 2O8TA 3SI3H 3SO3A 1GBLA 2HPPH 4X1SU 4HI3A 2Y5GA 3F1SB 4O9VA 1GHYH 3RXFA 2V3OH 2FO9A 2NU0E 3R0FA 3MMGA 3T25A 2R3YA 2ILNA 1O0DH 2XBWA 4E05H 3A84A 5DPAA 1MAXA 4Y7AA 1V2NT 2R9PA 4MPUA 1OWHA 1ZPCA 3G01A 3GICB 1GHBF 3IG6B 3DD2H 3ZZ5A 5A0CA 1O5CB 2VB0A 5DGJA 5I46H 1ZLRA 2UWOA 3UPEA 4MNXA 2ZZUH 3KL6A 3M5NA 2QF0A 3W94A 2OC1A 2HGTH 2ZTYA 1IQHA 2C8YB 2F9VA 2GD4B 2Z94A 4K5ZA 1SI5H 4MVNA 2A5IA 5AFZH 2UUFB 4XFQA 1LPKB 1C5SA 1AUJA 1UK3A 3KN2A 3I78A 5LPFA 1FLEE 2PKAB 1D3QB 1NS3A 1TX6A 1KXDA 2SNVA 4YZUA 3BSQA 4NWKA 4A1VA 1A5IA 5K0HA 1M9UA 1UVUH 2BY8X 1Y59T 1S84A 3SV6A 4AX9H 4GHTA 2FODA 3STIA 4ABEA 4K1TA 4NIVA 4D7GA 3FZZA 1H9LB 3E0NB 5G4BA 1ZYOA 3UIRA 1CT4E 2W3IA 5JBBS 3S9CA 3F9EA 2P93A 1CU1A 1EPTB 1AZ8A 1MU8B 9ESTA 3OX7U 2PLXA 4VGCC 3UY9A 1T32A 3K9XB 1PPBH 1IQLA 2CF8H 3ATWA 1C1RA 1GBKA 1NM6A 2ZDAH 1YLDA 4MNVA 1EXFA 3TJNA 2BHGA 1IQNA 3L33A 1DWEH 2BX3A 5PTPA 1QA0A 1DVAH 1UTOA 3LH3A 5T3HA 1LKBA 2G4UA 3TPIZ 1GI5A 2VIQA 1YC0A 1HYLA 2ALPA 1V2PT 5LH8A 2YNAA 1FQ3A 1GBMA 3LGVA 1HXFH 4NGAH 1W12U 4JYTA 7GCHF 1P03A 1MTNB 2FOAA 2TGAA 2PV9B 4J1YA 4D8NA 3RXMA 2EI7A 1WYKA 2P59A 1OP2A 2AERH 1BB0B 2NU3E 3PTNA 1JBUH 1C1WH 1W0ZU 3A7VA 3V7TA 1FONA 3O8DA 1EAIA 3NWUA 1G36A 1LVOA 1SHYA 1MBMA 2OBQA 2B0FA 5L2YH 8GCHG 2O8UA 2Z9LA 2XYAA 3LJJA 3TGKE 4TPYA 2FX4A 1TPOA 1MMJN 3BIVH 1ELFA 2WYGA 4AG2A 3PMAB 3PM3A 2QXGA 3E0PB 1VCPA 1GVKB 2Y81A 2ZPRA 2J9NA 1FV9A 6CHAC 1HDTH 2QCYA 1A7SA 2FI4E 1OS8A 1O3IA 3NCLA 2VVUA 4I8LA 3MO3A 3JZ1B 1A0JA 1MQ5A 1THPB 5FBIA 1YP9A 3D62A 1C5RA 3RLWH 1S85A 1W7XH 2TBSA 2AMPA 1MBQA 5FX6A 1OXGA 1C2EA 1JIRA 5C1YA 5A8ZA 1P09A 1SGCA 2VGCC 2PUXB 1FY4A 2GDDA 2PW8H 2AFQB 4AFQA 3QZRA 4GSOA 3M5MA 1S6HA 4Y6DA 4X0WU 1SGNE 5A0AE 1WTHD 2FOHA 1BTXA 1FAXA 2ALVA 4MPXA 1HAYB 1C5TA 4A6LA 2J34A 1SGFA 4AZ2B 4XDEA 1Y3VA 1EZUC 1L4ZA 1O3LA 4BAMB 1O2XA 1UVOA 2FOMB 2DE9A 2GX4A 3HGNA 2BB4A 1ZR0A 1INCA 4ZKNU 4WMDA 1Q2WA 1SB1H 4UFGH 5EXLA 3MFJA 3SU6A 1K1NA 1GWAA 3TH2H 3GY2A 5CE1A 3BEFB 3RXAA 1P8VC 2FPZA 1O2QA 1THRH 5EG4A 3SJ9A 1TIOA 6LPRA 3SU1A 1CA0C 1WTGH 7ESTE 1AU8A 3SGBE 4CRCA 5SGAE 2ZEBA 3M3SA 5F8TA 2LPRA 3M7TA 4DIHH 1CGHA 3B9FH 3Q3YA 1O3JA 3VB7A 3LH1A 1TFXA 2Z6BD 1ABIH 4CH8B 2G52A 2F9OA 4ABBA 4Y8ZA 4ZHAA 3VXEH 1VGCC 1C5NH 2OC8A 3UQOA 1D3PB 1HNEE 1HB0B 1MD8A 2H9EH 1BTPA 5TCAA 2VWOA 4ZKSU 3Q76A 3SU3A 1K9OE 1P06A 1SQOA 1PJPA 3SV7A 2PUQH 2R0KA 5JB8S 2P8OB 4OS5A 1TPSA 4GCHF 4INHA 1DICA 1GDQA 2GCHG 1DOJA 1GMCG 2C90B 4GAWA 1TNJA 3Q77A 1A5HA 2BZAA 1YPHC 2BVXH 3S69A 3K6ZA 4FUFA 4Y11E 4TY7A 1V3XA 2ZECA 5DP7A 4UFDH 1NZQH 2BD5A 1LKAA 1Y3WA 1Z71A 1GBHA 2BVRH 1HAZB 3M3VA 1A4WH 3SV2H 2UUKB 1P2QA 2V3HH 1EASA 1ORFA 3SN8A 1TALA 2GZ7A 5C5NA 5CMXH 7KMEH 1NFYA 1DS2E 2XNIA 1CHOF 4AB9A 5A0BA 1SGIB 3RUOA 3BTTE 1KXAA 2SGFE 1ANCA 1GBIA 4YOJA 1IQJA 1ZHPA 1TGBA 3RC6A 4AFSA 2ZDMA 1ELVA 4WF8A 4H4FA 1GMHF 3ZVFA 1JXPA 1SL3A 3QDZB 3QUMP 1RS0A 1N1LA 4FUJA 1FZZA 1AQ7A 2ZA5A 1SMFE 2BY5X 3E3TA 1J9CH 3SW2B 4I7YH 3KQEA 2ULLA 1KLJH 4Y10E 2WV4A 2BD8A 1K1PA 1RRKA 4X2YA 1SLVB 5HGGA 2ZQ1A 3RU4E 5FXLA 1QJ1B 1YPEH 4E7RG 2BD3A 4TYDA 2I6QA 2SNWA 3CS7A 2ZHDA 5ESTE 1CHGA 1BTZA 1A1RA 3PROA 1NU7B 1BOQA 1Q31A 3LC3A 2C3SA 1V2WT 3RDZA 1EZSC 3M61U 1VJ9U 1C5QA 1C2JA 2G55A 1AWHB 2O8MA 1P2NA 2IJOB 1HFDA 2GKVE 2A7HA 1XUHA 3GCHB 3ATLA 1UTPA 2PR3A 1VR1H 2QXHA 3P8NA 1O38A 3SU2A 1H9IE 1GJCB 2Y82A 2PGBB 2ZFRH 3MYWA 4DVAU 1XUGA 4X6MA 1H8IH 2ANMH 1VCWA 4XBBA 1T8OA 1CGJE 3SHCH 1K1IA 5AVDA 1O2YA 1S6FA 3TH3H 1C1TA 3UOUA 1V2RT 3BG8A 5GPIB 1K28D 3AW0A 5E0HA 1P10A 4X1NU 1UMAH 1SSXA 2ZPSA 1OYTH 1Z8RA 4A92A 1PPEE 3KQDA 1UTMA 3SHAH 7GCHG 1MD7A 1J17T 2A2QH 2Y80A 3QGNB 4A5TS 4ZROA 2FOFA 1TA2A 4VGCB 3MH6A 2BYAX 1YGCH 1TOCB 4I32A 1GCDA 3SGAE 2R0LA 4K1SA 5T6FA 1W14U 1KDQA 1NROH 2GGVB 4Q7YA 4ABGA 1W2KH 2FYQA 2QC2A 5JBTA 1JIMA 4KP0A 3U69H 1MTSA 1O2HA 5B6OA 1EP5A 1BIOA 2FP7B 2ZU4A 5E2OA 4X1QU 1FY5A 3UUZA 4DIIH 2A7JA 2UWPA 3VFEA 3STJA 1ZJKA 1B7XB 2GP9B 2FI3E 4WH8A 3T29A 1YCPH 1O2SA 1Z1IA 3KEEA 4IMZA 2H5DA 1TRNA 2OC0A 1C1PA 1O2KA 1AI8H 1D6WA 1MKWH 1QBOA 2A31A 3A88A 3BTGE 4CBNA 3HKIB 1LHGH 4YLUA 4DCDA 5FX5A 2Z9GA 2CHAC 1FIWA 3A8DA 1B5GH 5DP6A 2FYRA 5EPYA 3S9AA 1SOZA 2DE8A 2ZDNA 3OTJE 5EQSA 4OS6A 4WWYA 1K1JA 1UCYE 3SJOA 2RA0A 2R2WU 2OQ5A 4B75A 2A0QB 1P9UA 3RC5A 4AYVB 1OWJA 3QGJA 2WYJA 3RMNH 4B2BA 3F9GA 1KXEA 2QYIA 3ZZ4A 4XSKU 1TRYA 3K2UA 1MAYA 3I29A 2Z3DA 1G3DA 2A4OA 1PPFE 4JYUH 4ZMAH 1ELBA 3K6YA 3SQEE 5E2PA 3B23B 1G37A 2HOBA 3ZVGA 5DP5A 1BRCE 1MH0A 1GI1A 2G51A 3Q00A 2OXSA 5DO4H 2OC7A 2ZP0H 1L0ZA 5E0GA 1FXYA 5E8EH 1O3DA 2BXUH 5FPYA 3MWIU 2PKSC 2VIDA 4X2XA 5AFYH 2CGAA 3Q3XA 3GY4A 1WCZA 4IC6A 3DA9B 2GCHF 3SU0A 3H7TA 4Q2KA 5FPTA 1CA8B 1Q3XA 1GCTC 2ZDKA 1ESTA 4CBOA 4ISOA 3DUXH 1BBRH 3OY6U 4GHQA 4J2YB 1A2CH 3DFLA 3VGCB 1GBAA 1GL0E 1ID5H 2SGQE 2CF9H 1EJMA 1OP0A 3ZVEA 4YTAA 2P3UB 2EI8A 2QXJA 3A82A 1C4Y2 2BTCE 2XBYA 1NY22 2EA3A 1ZHRA 3ZV8A 2TIOA 1GJ6A 4NA7A 1FN6A 3EA7A 1QBNA 1C2LA 1V2QT 1L4DA 1A3BH 1NO9H 2K1QA 1AMHA 4YT6H 2B5TB 3BTME 3ZZCA 4BANB 2QV1A 4MQAA 2ZGCA 4ZXXH 1V2OT 3L3TA 4IGDA 1HAVA 1LPZB 2NWNA 2WUCA 1C5YB 1HLTH 5FBEA 1TBRH 2Z7FE 2BLOA 1UTJA 3CENA 1AWFH 4R8TB 1GI0A 1V2MT 1QR3E 4Z0KA 4AOQA 3UFAA 1IAUA 2NU4E 4K1EA 1ZRKA 4TPIZ 2SGPE 1LVMA 1VZQH 2AGIX 4ZHMU 1AN1E 1Y3UA 1TMTH 3O8BA 1P0SH 5DKMA 3MHWU 5DP4A 3TJVA 1SOTA 3FAOA 1GJAB 2Z9KA 3RXPA 3SNCA 2ZGJA 2KAIA 5DP3A 4UFEH 4NIYA 1TGCA 4FU7A 1FDPA 3HPTB 2ZTZA 1UCYH 4GCHG 1W7GH 6ESTA 1PYTD 1C1UH 3O8RA 4AFUA 1HUTH 4NWLA 2G5NA 1GG6C 1JMOH 2BDCA 3ZZ6A 4ZXYH 2UUYA 4YM9A 2FOBA 2QXIA 1G2MA 2OBOA 1NFXA 1ZOMA 4CHAC 4BAOB 1PPGE 1VGCB 2D8WA 1C2FA 4BTIB 1ACBE 3M7UA 3BTEE 3M3TA 3MH5A 1QBVH 1Y3YA 1CHOG 1DXPA 5C1XA 2F91A 1EQ9A 1O3AA 5J4SA 2XRCA 3T2NA 1E37B 3MNSA 1EAUA 1DE7H 3LPRA 4CR5A 2FESH 1HPGA 4WMEA 1KYNA 1IOEA 1GJ9B 4NA9H 4BTUB 1P2OA 2R2MB 1N8OB 2H9HA 3EGKH 2FS9A 2Y7XA 1XVOA 2HNTC 2OQUA 1NRNH 1P3EA 2A45B 4FUEA 4ZUHA 1A46H 1GMHG 1T7CA 3FVFB 2XWBI 1O2PA 1V2VT 4BXSA 4CH2B 1GGDC 5FCRA 1V2TT 2A4GA 1GHAF 1J15A 2ODYB 4YT7H 1DY8A 1W3CA 2ZHQH 2JETB 4BOHA 3TGJE 1BJVA 1NRPH 2BOHB 1ZSKA 3LGUA 1QB6A 2OP9A 2ZU5A 3A8BA 1MZDA 3KHVA 2HALA 5CHAC 3BG4B 4X2VA 2B9LA 1Z1JA 1O2WA 2ZU3A 3HK6B 1AY6H 2BD4A 4ESTE 2ODPA 4JZFH 2TGTA 4Y0ZE 2F9NA 4K8BA 1TA6A 1LDTT 2ZDLA 1HXEH 2NU1E 2GT8A 2ZC9H 1QJ6B 1CGIE 1SQTA 1EOLA 1YPHE 1KXBA 5FPSA 3B8JA 3UOPA 1O2ZA 4INKA 1ZGVA 1BHXB 1MCVA 1O35A 2BVSH 3PLPA 3T27A 1GVLA 1BTYA 1A5GH 4MPVA 3RXOA 1LPGB 5BRRE 3AASA 4K8YA 1O5GH 1HAOH 4U30A 4A1TA 3A7XA 1W13U 4CRDA 4ZKOU 1MTWA 3WY8A 2A7CA 1EKBB 2ASUB 4HFPB 1WUNH 3ZVDA 1SBWA 1W10U 1ELCA 3RXHA 1O3BA 4DY7B 3OY5U 1OPHB 2B7DH 1AD8H 1HBTH 2CN0H 3PTBA 1SGQE 2FWWA 2FXRA 1NN6A 1T8MA 2BXTH 4ISHH 2CMYA 1O3OA 2XWAA 4OGXA 1GI6A 1S82A 2C8XB 4FVBA 3GDVA 2KAIB 1P9SA 4WMFA 1ETRH 1QB1A 3BEUA 2JH0D 1DPOA 3BIUH 1ZZZA 1NFWA 3A8AA 4JMYA 1DXWA 3PB1E 1P12E 1KXFA 1SGRE 3BTHE 2H1UA 3PO1C 1GBDA 2SGAA 3M5OA 3KNXA 3GY8A 1O3GA 2VH6A 3UNQA 2ZFFH 1SC8U 3IITA 2WPHS 1TX7A 1QQUA 2PTNA 1MTUA 5DP9A 1RXPA 6GCHG 3QWCH 1ZSJA 2BLVA 5EPNA 1O30A 2VIWA 4Y7BA 1ANBA 1DX5M 1SR5C 5HMAA 3MO9A 1C1VH 1G3EA 2J92A 4DW2U 3EDXB 1G3CA 2P95A 3HK3B 1GI3A 1A61H 2D26C 3LJOA 1B0FA 1IQFA 3UR6A 3TK6A 3LDXH 2PWXA 4DOQA 2THFB 5C20A 1EX3A 1GBJA 1O3FA 1UTNA 2ODQA 1ELTA 2ZI2H 2A4QA 1Y5BT 1OYQA 3U98H 1IQMA 1S0RA 4MNYA 4CREA 2YNBA 5T6GA 2XBXA 1XUJA 4X8TH 1KTSB 4XBCA 2QAAA 2HPQH 2QGRA 1Z7KA 3UQVA 1MU6B 1FMGA 2BM2A 1FY3A 1FIZA 3MO6A 2GDEH 3QN7A 5EGMA 3KCGH 2BD7A 2PGQB 5E0JA 4ABIA 3TLOA 2ZCHP 1AB9C 3GY3A 3M35A 4KGAA 2SFAA 4ZHLU 2CHAB 3T26A 5AHGH 1YCPK 1VJAU 2ZU1A 3ZV9A 3BTKE 3HATH 4BXWA 1Y5AT 1HAXB 1MKWK 1PFXC 5FAHA 3F9HA 4BAQB 1MZAA 1EATA 1DANH 1QURH 3SNEA 4WY3A 1D6RA 2WPJS 1TNLA 4X6OA 3F6UH 1J14A 1EPTC 1GJ7B 4LZ4B 4B76A 1SFIA 1F5KU 4JCNA 2BY9X 1AFQB 2F83A 1N6YA 2GCTC 1EAWA 1EOJA 3EA9A 3AVZA 2TGPZ 4X2WA 1QRXA 2SGEE 2FOGA 2Q6DA 2Q6FA 2GZ9A 3SUDA 3S7HB 1ZPZA 3ZVBA 4FUDA 2IN2A 2PTCE 5FCKA 1LHFH 4CRFA 2UWLA 3N7OA 4K60A 3RXBA 1DWCH 1PQ8A 2F9PA 1GCTB 4LZ1H 3RC4A 5TJXA 4SGBE 4E7NA 5GXPA 2GV7A 1EP6A 3TJOA 4THNH 1WSSH 4I8JA 2GMTC 1UHBA 3GISB 1MTNC 2VJ1A 1G3BA 2SGDE 1F0UA 1S0QA 3AAVA 1TQ0B 1OX1A 2F9BH 1CO7E 3A83A 3TIUA 1ZSLA 3P17H 3UREA 1BBRK 1QL9A 3QK1A 1ZMLA 1NRRH 2ZGXH 1KLTA 3C27B 2ZPQA 1DWDH 2C93B 1GVZA 2OUAA 4LXBH 3RXQA 3PMHB 4H6TA 3C1KA 2HLCA 3ATKA 2C4FH 1NTPA 1W8BH 4GVUA 1NC6A 2XC0A 3URCA 5JDUB 2STAE 3SU5A 1Z8GA 2FMJA 2A2XH 1G9IE 3TGIE 2VH0A 2P94A 3Q3KA 1O5DH 4PROA 1C1OA 2ZCLP 1K22H 4U01A 5L30H 2BMGB 2G5VA 5ETXA 1V2JT 3RLYH 2AIPA 1SG8B 1QL7A 3SZNA 2ZDVH 3BTFE 1BDAA 2WINI 4NFEA 1SFQB 1TOMH 3FP7E 2Q6GA 4CR9A 3MU1A 4AFZA 3EYDA 2XCNA 4CRGA 1JRTA 2G8TA 1GG6B 3M36A 1O3NA 1CT0E 4JZEH 1P05A 4X1RU 2ZCKP 2AGEX 5JYIA 3U8TH 1C5UA 3LU9B 4DJZB 3ZZ7A 5DP8A 1MUEB 1GHAG 1UCYK 4CHAB 2P3TB 2BX4A 4SGAE 2XTTB 4FUGA 4JZDH 5EOKA 1HJAC 3BV9B 1BMLA 2OINA 1N6XA 2WPIS 2XXLA 1BBRE 3ZVAA 1NFUA 1O37A 2ZF0H 3ZZ3A 2ZFPH 1V2UT 3MNBA 4IBLH 1BUIA 2ANYA 3JZ2B 3PMBB 1WBGB 1FNIA 5EW2H 1O32A 3OU0A 2QA9E 1UVSH 1V6DA
chains in the Genus database with same CATH superfamily
2V3MA 4AORA 2ESTE 4TT3D 3ZZAA 1A0HB 5A8YA 2BDAA 3RU4T 3MNCA 4NFFA 5ESBA 4IW4E 2PSXA 9LPRA 3N7EA 1O3EA 4RI0A 6GCHF 3NXPA 3GY7A 1S83A 3A86A 4FUCA 2VU8E 3RXGA 4I8HA 1NT1A 1O2IA 2YOLA 5C1UA 1GHXH 1XVMA 3F68H 1BMAA 1DFPA 1TGSZ 3P8FA 1F0SA 3VB5A 1TBQH 3N99A 3A85A 3SJ8A 3S7KB 3VB6A 5LPEA 4F48B 1ARBA 1BMNH 1C1NA 1V2ST 3E90B 1NESE 4FUHA 1CT2E 4XE4A 4OS4A 2AYWA 1ABJH 1LHDH 2V6NA 4A1XA 5I25A 4DT4A 3BTWE 4LK4A 1FY1A 4ZAEA 2PKAA 1NRSH 1UHBB 1S5SA 2K0QA 4X6PA 4UEHH 1MKXH 4IN2A 1O2LA 1L1NA 3NRLA 1H1BA 1EZQA 3SOSA 1MABB 3NZIA 5C3NA 1YCPM 4WJG2 1JRSA 3UB0A 1D3TB 1C2DA 2ZFQH 4X8SH 1W0KD 2FOEA 1SGYE 3S0NA 4DG4A 1TONA 2KCOA 3TNTA 1GHVH 1EPTA 2P8OC 4BAHB 1QY6A 4MNWA 1DLEA 4K3JA 6CHAB 1QA7A 2GZ8A 4JZIA 3DHKH 4Q4LA 5EU8A 5EJZA 4KTCA 4UONA 3MU5A 2OCVB 2GV6A 1P2MA 2QY0B 5F8ZA 2AMQA 5H4IB 1C4U2 3GCTF 3E6PH 4R0IA 4ZKRU 2ZFSA 3ZZBA 1H8DH 1Z6EA 3L6PA 3SV8A 1P2JA 2H6MA 1DT2A 3E8LA 1ZMJA 1C5ZB 1H8HD 1O2NA 2C8WB 2I6SA 3ITIA 2VGCB 1C5LH 1YPGH 1JWTA 1Z8JB 2WPLS 4Y71A 3EQ0H 2EC9H 1O5BB 2CJIA 1PPZA 3VPKA 1MQ6A 1QNJA 4OS7A 4Q80A 2ZNKH 3PO1B 1RTFB 1E36B 4ISIH 5C17A 3KF2A 1C2IA 3SJIA 5HXFA 1WU1A 2ZIQH 1BA8B 4IC5A 1AUTC 3QTOH 1CQQA 3ZZDA 4KKDA 4ZCNA 1OWDA 2XW9A 1IHTH 3MU8A 3MOCA 3SJKA 3GS9A 1YLCA 5EJLA 1VITH 1LQEA 1TBZH 2F3CE 1THSH 2KR7A 2FX6A 2IPHA 5EQRA 3RXDA 1TGNA 2BLQA 4ABDA 1KDQB 2Y7ZA 3SUFA 1RIWC 1O2GH 1S81A 3EE0B 3TVJB 2WV9A 1UVTH 4ISNA 1E0FD 2QIQA 4X6NA 2ZGHA 4FOUC 1C5VA 3PV4A 4ZH8A 4GPGA 1CA0B 2PSYA 4FU9A 1P57B 1GJ5H 1SGDE 3RXJA 3M5LA 1BTHH 2VWNA 4TWYA 1TNGA 1HIAA 1LO6A 3CS0A 3RMOH 2ZG0H 4JZ1A 2TRMA 5HIZA 5IDKA 1PQ7A 3ZZ8A 2W3KA 3T62A 2HWLB 2XC4A 1JOUB 4I33A 1IQGA 1QRWA 3SGQE 2ZHEH 5C5OA 1K21H 1AE5A 1IQIA 4Z6AH 2A32A 1QJ7B 2G81E 1YM0A 2Z9IA 3RM0H 3MH7A 1GBTA 3PWCA 4OS2A 4IS5A 2BQ7B 3LGYA 3GCHC 1AFEH 2OTVA 4UE7H 5KGOA 2O8WA 1BRBE 2FTLE 3FANA 1O5AB 1DITH 3E1XB 1AB9B 4ABHA 5JB9S 1TYNA 1BMMH 2G4TA 3P95A 2A4RA 3A7TA 1WOFA 1EB1H 2BY7X 4HGCA 1F0RA 2LNCA 3RMLH 8ESTE 1GJ4H 1K1LA 3VEQB 3GCOA 3UWIA 3HGPA 2ZKSA 1OOKB 1ZHMA 3SUGA 1HCGA 5F8XA 2ZO3H 1C9TA 1T4VH 1GMDF 1XXDA 1PQAA 5C0UA 2Z3EA 3U1IB 2HRVA 1HAHH 1SQAA 1XKAC 1ZTJA 2BZ6H 5AF9H 1TAWA 2ZFTA 1QB9A 3A7ZA 3F9FA 3SNBA 1O2JA 2GCTB 1KLIH 3M7QA 4RKOB 3ODFA 3V0XA 1GDUA 3SQHE 2AGGX 4X8UH 4RSPA 3CNRA 4ACAA 1KTTB 2BDIA 1GPZA 3D65E 4FXGH 1DLKB 5DN6D 1BJUA 1EB2A 4YOGA 4Q7XA 4X8VH 1F7ZA 1L1GA 5IYTA 1ELAA 2CK3D 3PMJA 2FI5E 3O8CA 4NIWA 1ESBA 2VWMA 4Y8YA 5DJ7A 1EUFA 1FI8A 1IHSH 1C1QA 3QZQA 3LGTA 4NCYA 3EAJA 1CBWC 1G2LA 1CVWH 5DK1A 1C2KA 2BY6X 1AE8H 2STBE 1P11E 2WPMS 2DUCA 2GMTB 2NU2E 1EAXA 1O2UA 2PP6A 2WHXA 3H09A 1XKBC 1SGPE 1D3DB 1ESAA 3OSYA 4AG1A 1BCUH 4CRBA 3SUEA 4WH6A 3FZDA 3RXCA 1QGFA 1L1JA 3S9BA 1O3PB 5EODA 1HAVB 4O3TA 2R3UA 1EJNA 3MI4A 2BQ6B 1IQKA 4GLYA 3LC5A 5TCCA 3NPSA 1QIXB 1OWEA 3LOXA 4UD9H 1F2SE 5HM2A 1PQ5A 1H9HE 5C2ZA 2ZHFH 3V13A 1HAIH 2IJD1 1XX9A 3K65B 1BRAA 2H5CA 4UFFH 4MDSA 3U8OH 3LIWA 1LVBA 3SORA 2EEKA 1W11U 5L6NH 2W26A 1ZPBA 2Y5FA 1KMHB 1BTUA 4KTSA 3KQCA 2D1JA 3A81A 4UDWH 2EI6A 1J8AA 3TJUA 2ZWLH 1O33A 1KIGH 2J2UA 1V2KT 5F03A 3BEIB 3RXEA 1HIAB 1X7AC 1TPPA 3SBKA 3QX5H 1GBCA 4TY6A 1SGFG 4YOIA 3PLKA 1SPJA 3SU4A 1OP8A 2BDYA 4K69A 1AO5A 1T31A 2BDGA 4NZQA 1TGTA 4K2YA 5F53A 4O97A 1TE0A 1F92A 1SGEE 3URDA 1GBBA 2BOKA 4Y8XA 3P6ZB 5IK2D 3U8RH 1RGQA 3VGCC 1QRZA 3H5CB 2JJ1D 1HJAB 3DSOA 4O3UA 3RXVA 1EJAA 1BHXF 4OGYA 4B73A 3RXUA 1EZXC 1YYY1 1BMFD 4JK6A 1QCPA 1ELDE 2BLWA 2VIPA 2ANKH 1ZRBA 3IWMA 4DGJA 4GUXA 2WV5A 2O8LA 2FTMA 3OYPA 3WWBA 1HJ8A 2PHBA 5J4QA 1UK2A 1AVXA 4BTTB 5F6MA 1DM4B 1HGTH 1TMBH 4U32A 4Y76A 1NRQH 2RG3A 1CE5A 3RXIA 1LTOA 3TK9A 3GCNA 3SI4H 4CRAA 2Q1JA 1ZTLA 1SHHB 1AIXH 5GIBA 1E79D 1SVPA 1VITG 2TGDA 4AGJA 3D23A 4HTCH 2RDLA 5EXNA 2C8ZB 3DSPA 1GHZA 5A09A 1BITA 5HM9A 2KM0A 1P3CA 5FHTA 1YLNA 3ELAH 3RU4D 3ODDA 3MU4A 4MG3A 1XUKA 4DURA 2QF3A 5BPEA 4D7FA 1C2MA 3ATMA 3MH4A 1DY9A 2GTBA 4B2AA 3TU7H 3QLPH 1Y8TA 1FY8E 3ATIA 4MLFB 3VG8A 1RD3B 4HG6A 1XUIA 4FU8A 3GCTG 3ZYEA 1TQ7B 4E06H 3R3GB 2XCFA 1O5EH 2Y5HA 2M5TA 1P02A 1G32B 3ZYDA 2H2ZA 1C5WB 1MKXK 2CV3A 1K1MA 2FLBH 4INLA 4NSVA 3KIDU 1GJDB 1AVGH 1UTKA 3LT3A 4ISLA 1GI9B 3SNAA 2GT7A 2AIQA 3A8CA 2ANWA 5GCHG 1GL1A 3M37A 2ZGBH 2A1DB 4JK5A 1LVYA 4AN7A 3UR9A 1E34B 1SQRA 2B8OH 1LQDB 3H7OA 1ZJDA 5LGOA 1CSOE 1YKTA 2W7UA 1N8OC 1BTWA 1XMNB 1C4V2 4ABFA 4I8KA 1O3MA 1W0YH 3LKWA 3BN9A 1LHCH 3PYHA 3VB3A 4NZLA 4Q63A 4F4OC 1RJXB 4M7GA 2PKSB 4B71A 4AYYB 2AMDA 2OD3B 3MTYA 3U1JB 1Y3XA 1O31A 1YPJH 1ARCA 2JETC 3UWJH 1OWKA 1O34A 1PPHE 1O2OA 3QTVH 2HVXA 2FM2A 4Q7ZA 5EQQA 1GBEA 1O2VA 2IOTA 3V12A 2VBCA 4YO9A 3ESTA 3FP6E 3UNRA 1T8NA 3BG4C 1PYTC 1XUFA 3UTUH 1MCTA 4RN6A 1QL8A 3NKKA 2J38A 8KME2 3RXTA 1QQ4A 1D4PB 1ZMNA 4NIXA 2ZU2A 1O2TA 2WZQA 3PRBA 5EW1H 1GI7B 2AEIH 3LONA 1GHBG 2VIOA 3KQBA 2BDBA 5JPMH 4XD7D 3GYMA 3FP8E 4NA8A 2BD2A 1FPHH 2P3FH 3TITA 4QT8C 1AGJA 1WQSA 4KTUA 2H9TH 3GY5A 1FN8A 2A5AA 3P8GA 1AKSA 1YF4A 1UTLM 4X1PU 1PPCE 2V35A 3A7WA 3FFGA 1GHWH 1SLUB 2ZHWH 2ZQ2A 3OAAD 1ETTH 1O2MA 3BTDE 1RTLA 1UK4A 5K7RA 2FZZA 2GVFA 1RIWB 4D9RA 3I77A 1KXCA 2FIRH 2G00A 3LGIA 1ELGA 4NG9H 3FN8A 1ANEA 2J5UA 3VB4A 4AGKA 1L2EA 4WVPE 2J98A 3FKSD 2PFEA 1Y5UT 3DFJA 5EXMA 1TB6H 4FVDA 2FDAA 4B1TA 1B0EA 5ABWA 4IN1A 1C2GA 3TNSA 1GJ8B 2TPIZ 3NK8A 8GCHF 1U6QA 1TNKA 3PLBA 1YPKH 2XBVA 1QHRB 2P16A 1C2HA 1BQYA 4A7IB 1A3EH 3QO6A 1WV7H 1DUEA 1A0LA 2A5KA 1C5PA 1GMDG 5L2ZH 2VVVA 4BNRA 3RXLA 2FLRH 4U2WA 3VXFH 3U9AH 3RM2H 3GOVB 1K2I1 1YPMH 3E91A 2GJGA 3T28A 3DT0H 4F49A 4WXVA 4IMQA 1DSTA 2FOCA 1Z6JH 4YLQH 1TWXB 1LCYA 2Z9JA 1LHEH 1WQVH 3RXSA 3AK5A 3MNXA 1HJ9A 2VIVA 2CXVA 1KSNA 1VCQA 3GYLB 5A2MH 1TNIA 5HYOA 1FJSA 1TRMA 2QN5T 1D9IA 1FAKH 1O5FH 1YWUA 2RA3A 2JH5D 1NU9A 5KEDA 1BRUP 4ASHA 1XM1A 1TLDA 4JYVH 1TABE 2VNTA 2UUJB 4XOJA 2AH4X 1DDJA 1GGDB 2JH6D 3P8OA 3PWBA 3ZVCA 1ZGIA 2ZTXA 1V2LT 1HRTH 1QTFA 3GDUA 4TWWA 3A80A 1AZZA 1FUJA 1C5MD 4MPWA 5A8XA 2W7SA 3RMMH 1C5XB 1O3HA 1AVWA 4Y79A 2Z3CA 4HZHA 1HAGE 1YPLH 1Z8IB 3KGPA 5CHAB 5GDSH 3A87A 1SGTA 4BAKB 4H42U 3SNDA 4B2CA 2K8IA 1ZTKA 1T4UH 1P04A 1GI8B 3T5FH 4B74A 1W0JD 2J4IA 1CBWB 1LMWB 2QE7D 1WDIA 3A89A 4NSYA 1H4WA 1DSUA 1E35B 1GBFA 1C9PA 3TK5A 1IQEA 2HNTE 2W5EA 1C1MA 2V0BA 2YMSC 3W95A 1OSSA 3P92A 4D76A 1F5RA 4ABJA 1O3CA 5HIYA 1C1SA 3LGWA 1XXFA 3GDSA 4AB8A 1VITF 3AW1A 4D9QA 1O3KA 1O36A 3HKJB 3CP7A 1O2RA 1ETSH 2J94A 2J95A 3UNSA 4M9FA 3RP2A 2FEQH 4Y0YE 2BDHA 3RXKA 2RCEA 1GJBB 1TX8A 1MTVA 2VVCA 1T8LA 3D49H 1G30B 2O9QA 1AKSB 4DT7B 3ZZ9A 2XC5A 4XBDA 4I86A 1TMUH 1DUAA 3PRDA 5T6DA 2JKHA 3SV9A 1O39A 1UO6A 1UVPA 2HNTF 1KY9A 1GI4A 2W6JD 1AFQC 4FUBA 1BZXE 1SLWB 2Y6TA 3OFND 1DWBH 2F9UA 4WXIA 4I8GA 1FPCH 4O03A 3AAUA 1J16A 2J98B 3BTQE 5JBCS 5C67A 1UTQA 1P01A 3RXRA 4P02A 1GDNA 4I31A 5LPRA 1HV7A 3V3MA 1C5OH 2AS9A 1RFNA 1QFKH 5GCHF 5GWZA 1GI2A 3NUMA 8LPRA 2VWLA 4LOYH 3EA8A 1F0TA 3ENSB 1AHTH 3GY6A 1ELEE 1K1OA 1P2IA 1SLXB 2VINA 1OWIA 1GMCF 3P70B 2BD9A 2D2DA 1RTKA 2WPKS 4KELA 3A7YA 3E16B 4ABAA 1E38B 1UJ1A 3MU0A 5GJ4B 1BT7A 1F5LA 1YBWA 1NPMA 4OS1A 2OLGA 5DG6A 1TNHA 4RKJB 1WAYB 2WUBA 4FUIA 2BQWB 1ANDA 1P2KA 4H6SB 4YESB 1HAPH 3BF6H 1H8ED 1TPAE 1OKXA 7LPRA 3TH4H 4MTBA 5JBAS 2FS8A 2O8TA 3SI3H 3SO3A 1GBLA 2HPPH 4X1SU 4HI3A 4ACBA 2Y5GA 3F1SB 4O9VA 1GHYH 3RXFA 2V3OH 5GNDA 2FO9A 2NU0E 3R0FA 3MMGA 3T25A 2R3YA 2ILNA 1O0DH 2XBWA 4E05H 3A84A 5DPAA 1MAXA 4Y7AA 1V2NT 2R9PA 4MPUA 1OWHA 1ZPCA 3G01A 3GICB 1GHBF 3IG6B 3DD2H 3ZZ5A 5A0CA 1O5CB 2VB0A 5DGJA 5I46H 1ZLRA 2QF4A 2UWOA 3UPEA 4MNXA 2ZZUH 3KL6A 1YY3A 3M5NA 2QF0A 3W94A 2OC1A 2HGTH 2ZTYA 1IQHA 2C8YB 2F9VA 2GD4B 2JIZD 2Z94A 4K5ZA 1SI5H 4MVNA 2A5IA 5AFZH 2UUFB 4XFQA 1LPKB 1C5SA 1AUJA 1UK3A 3KN2A 3I78A 5LPFA 1FLEE 1D3QB 1TX6A 1NS3A 2PKAB 1KXDA 2SNVA 4YZUA 3BSQA 4NWKA 4A1VA 1A5IA 4Z1MD 5K0HA 1M9UA 1UVUH 2BY8X 3OEED 1WXRA 1Y59T 1S84A 1K0HA 3SV6A 4AX9H 4GHTA 2FODA 3STIA 4ABEA 4K1TA 4NIVA 4D7GA 3OTPA 3FZZA 1H9LB 3E0NB 5G4BA 1ZYOA 4P00A 3UIRA 1CT4E 2W3IA 5JBBS 3S9CA 3F9EA 2P93A 1CU1A 1EPTB 1AZ8A 1MU8B 9ESTA 3OX7U 2PLXA 4VGCC 3UY9A 1T32A 3K9XB 1PPBH 1IQLA 2CF8H 3ATWA 1C1RA 1GBKA 1NM6A 2ZDAH 1YLDA 4MNVA 1EXFA 3TJNA 2BHGA 1IQNA 3L33A 1DWEH 2BX3A 5PTPA 1QA0A 1DVAH 1UTOA 3LH3A 5T3HA 1LKBA 2G4UA 3OE7D 3TPIZ 1GI5A 2VIQA 1YC0A 1HYLA 2ALPA 1V2PT 5LH8A 2YNAA 1FQ3A 1GBMA 3LGVA 1HXFH 4NGAH 1W12U 4JYTA 7GCHF 1P03A 1MTNB 2FOAA 2TGAA 2PV9B 4J1YA 2QF5A 4D8NA 5C0TA 3RXMA 2EI7A 1WYKA 2P59A 1OP2A 2AERH 1BB0B 2NU3E 3PTNA 1JBUH 1C1WH 1W0ZU 3A7VA 3V7TA 1FONA 3O8DA 1EAIA 3NWUA 1G36A 1LVOA 1SHYA 2EY4C 1MBMA 2OBQA 2B0FA 5L2YH 8GCHG 2O8UA 2Z9LA 2XYAA 3LJJA 3TGKE 4TPYA 2FX4A 1TPOA 1MMJN 3BIVH 1ELFA 2WYGA 4AG2A 3PMAB 3PM3A 2QXGA 3E0PB 1VCPA 3MQKC 1GVKB 2Y81A 2ZPRA 2J9NA 1FV9A 6CHAC 3F2HA 1HDTH 2QCYA 1A7SA 2LELA 2FI4E 1OS8A 1O3IA 3WWFA 3NCLA 2VVUA 4I8LA 3MO3A 3JZ1B 1A0JA 1MQ5A 1THPB 5FBIA 2WPDD 1YP9A 3D62A 2JDID 1C5RA 3RLWH 1S85A 1W7XH 2TBSA 2AMPA 1MBQA 5FX6A 1OXGA 1C2EA 1JIRA 5C1YA 5A8ZA 1P09A 1SGCA 2VGCC 2PUXB 1FY4A 2GDDA 2PW8H 2AFQB 4AFQA 3QZRA 4GSOA 2HVYB 2YMSD 3M5MA 1S6HA 4Y6DA 4X0WU 1SGNE 5A0AE 1WTHD 2FOHA 1BTXA 1FAXA 2ALVA 4MPXA 1HAYB 1C5TA 5CDFE 4A6LA 2J34A 1SGFA 4AZ2B 4XDEA 1Y3VA 1EZUC 5C94A 1L4ZA 2OK5A 1O3LA 4BAMB 1O2XA 1UVOA 2FOMB 2J97A 2DE9A 2GX4A 3HGNA 2BB4A 1ZR0A 1EFRD 1INCA 4ZKNU 4WMDA 1Q2WA 1SB1H 4UFGH 5EXLA 3MFJA 3SU6A 1K1NA 3KYGA 1GWAA 3TH2H 2RFKC 3GY2A 5CE1A 3BEFB 3RXAA 1P8VC 2FPZA 1O2QA 1THRH 3SYJA 5EG4A 3SJ9A 1TIOA 6LPRA 3SU1A 1CA0C 1WTGH 7ESTE 1AU8A 3SGBE 4CRCA 5SGAE 2ZEBA 3M3SA 5F8TA 2LPRA 3M7TA 4DIHH 1CGHA 3B9FH 3Q3YA 1O3JA 3VB7A 3LH1A 1TFXA 2Z6BD 1ABIH 4CH8B 2G52A 2F9OA 4ABBA 4Y8ZA 4ZHAA 3VXEH 2YMSB 1VGCC 1C5NH 2OC8A 3UQOA 1D3PB 1HNEE 1HB0B 1MD8A 2H9EH 1BTPA 5TCAA 2VWOA 4ZKSU 3Q76A 3SU3A 1K9OE 1P06A 4F55A 1SQOA 1PJPA 3SV7A 2PUQH 2R0KA 5JB8S 2P8OB 4XRNA 4OS5A 1TPSA 2V7QD 4GCHF 4INHA 1DICA 1GDQA 2GCHG 1DOJA 1GMCG 2C90B 4GAWA 1TNJA 3Q77A 1A5HA 2BZAA 1YPHC 2BVXH 3S69A 3K6ZA 4FUFA 4Y11E 4TY7A 1V3XA 2ZECA 5DP7A 4UFDH 1NZQH 3KQ5A 2BD5A 1LKAA 1Y3WA 1Z71A 1GBHA 2BVRH 1HAZB 3M3VA 1A4WH 3SV2H 2UUKB 1P2QA 2V3HH 1EASA 1ORFA 3SN8A 1TALA 2GZ7A 5C5NA 5CMXH 7KMEH 1NFYA 1DS2E 2XNIA 1CHOF 4AB9A 5A0BA 1SGIB 3RUOA 3BTTE 1KXAA 2SGFE 1ANCA 1GBIA 2JJ2D 4YOJA 1IQJA 1ZHPA 1TGBA 3RC6A 4AFSA 2ZDMA 4TSFD 1ELVA 4WF8A 4H4FA 1GMHF 3ZVFA 1JXPA 1SL3A 3QDZB 3QUMP 1RS0A 2XNDD 1N1LA 4FUJA 2L6OA 1FZZA 1AQ7A 2ZA5A 1SMFE 2BY5X 3E3TA 1J9CH 3SW2B 4I7YH 3KQEA 2ULLA 1KLJH 1E1RD 4Y10E 2WV4A 2BD8A 1K1PA 1RRKA 4X2YA 1SLVB 5HGGA 2ZQ1A 3RU4E 5FXLA 1QJ1B 1YPEH 4B6EA 4E7RG 2BD3A 4TYDA 2I6QA 2SNWA 3CS7A 5B6LA 2ZHDA 5ESTE 1CHGA 1BTZA 1A1RA 3PROA 1NU7B 1BOQA 3SZEA 1Q31A 3LC3A 2C3SA 1V2WT 3RDZA 1EZSC 3M61U 1VJ9U 1C5QA 1C2JA 2G55A 1AWHB 3OEHD 2O8MA 1P2NA 2IJOB 1HFDA 2GKVE 2A7HA 1XUHA 3GCHB 3ATLA 1UTPA 2PR3A 1VR1H 2QXHA 3P8NA 3PV2A 1O38A 3SU2A 1H9IE 1GJCB 2Y82A 2PGBB 2ZFRH 3MYWA 4DVAU 1XUGA 4X6MA 1H8IH 2ANMH 1VCWA 4XBBA 1T8OA 1CGJE 3SHCH 1K1IA 5AVDA 1O2YA 1S6FA 3TH3H 4YXWD 1C1TA 3UOUA 1V2RT 3BG8A 5GPIB 2XOKD 1K28D 3AW0A 5E0HA 1P10A 4X1NU 1UMAH 1SSXA 2ZPSA 1OYTH 1Z8RA 4A92A 1PPEE 3KQDA 1UTMA 3SHAH 7GCHG 1MD7A 1J17T 2A2QH 2Y80A 3QGNB 4A5TS 4ZROA 2FOFA 1TA2A 4VGCB 3MH6A 2BYAX 1YGCH 1TOCB 4I32A 1GCDA 3SGAE 3W1EA 2R0LA 4K1SA 5T6FA 1W14U 1KDQA 1NROH 2GGVB 4Q7YA 4ABGA 1W2KH 2FYQA 2QC2A 5JBTA 1OHHD 1JIMA 2KCPA 4KP0A 3U69H 1MTSA 1O2HA 5B6OA 1EP5A 1BIOA 2FP7B 2ZU4A 5E2OA 4X1QU 1FY5A 3UUZA 4DIIH 2A7JA 2UWPA 3VFEA 3STJA 1ZJKA 1B7XB 2GP9B 2FI3E 4WH8A 3T29A 1YCPH 1O2SA 1Z1IA 3KEEA 4IMZA 2H5DA 1TRNA 2OC0A 1C1PA 1O2KA 1AI8H 1D6WA 1MKWH 1QBOA 2A31A 3A88A 3BTGE 4CBNA 4OM9A 3HKIB 1LHGH 4YLUA 4DCDA 5FX5A 2Z9GA 2CHAC 1FIWA 3A8DA 1B5GH 5DP6A 2FYRA 5EPYA 3S9AA 1SOZA 2DE8A 2ZDNA 3OTJE 5EQSA 4OS6A 4WWYA 1K1JA 1UCYE 3SJOA 2RA0A 2R2WU 2OQ5A 4B75A 2A0QB 1P9UA 3RC5A 4AYVB 1OWJA 3QGJA 2WYJA 3RMNH 4B2BA 3F9GA 1KXEA 2QYIA 3ZZ4A 4XSKU 1TRYA 3K2UA 1MAYA 3I29A 2Z3DA 1G3DA 2A4OA 1PPFE 4JYUH 4ZMAH 1ELBA 3K6YA 3SQEE 2WSSD 5E2PA 3B23B 1G37A 2HOBA 3ZVGA 2EQNA 5DP5A 1BRCE 1MH0A 1GI1A 2G51A 3Q00A 2OXSA 5DO4H 2OC7A 2ZP0H 1L0ZA 5E0GA 4FETA 1FXYA 5E8EH 1O3DA 2BXUH 5FPYA 3ZIAD 3MWIU 2PKSC 2VIDA 4X2XA 2M2AA 5AFYH 2CGAA 2KZ4A 3Q3XA 3GY4A 1WCZA 4IC6A 3DA9B 1E1QD 2GCHF 3SU0A 3H7TA 4AC9A 4Q2KA 5FPTA 1CA8B 1Q3XA 1GCTC 2ZDKA 1ESTA 4CBOA 4ISOA 3DUXH 1BBRH 3OY6U 4GHQA 4J2YB 1A2CH 3DFLA 3VGCB 5CHBA 1GBAA 1GL0E 1ID5H 2KCYA 2KX4A 2SGQE 2CF9H 1EJMA 1OP0A 3DSGA 3ZVEA 4YTAA 2P3UB 2EI8A 2QXJA 3A82A 4ASUD 1C4Y2 2BTCE 2XBYA 1NY22 2EA3A 1ZHRA 3ZV8A 2TIOA 1GJ6A 4NA7A 1FN6A 2F4LA 3EA7A 1QBNA 1C2LA 1V2QT 1L4DA 1A3BH 1NO9H 2K1QA 1AMHA 4YT6H 2B5TB 3BTME 3ZZCA 4BANB 2QV1A 4MQAA 2ZGCA 2IPQX 4ZXXH 1V2OT 3L3TA 4IGDA 1HAVA 1LPZB 2NWNA 2WUCA 1C5YB 1HLTH 5FBEA 1TBRH 1VKYA 3KYFA 2Z7FE 2BLOA 1UTJA 3CENA 1AWFH 4R8TB 1GI0A 1V2MT 1QR3E 4Z0KA 4AOQA 3UFAA 1IAUA 3FO8D 2NU4E 4K1EA 5T1VA 1ZRKA 4TPIZ 2SGPE 1LVMA 1VZQH 2AGIX 4ZHMU 1AN1E 1Y3UA 1TMTH 3O8BA 1P0SH 5DKMA 3MHWU 5DP4A 3TJVA 1SOTA 3FAOA 1GJAB 2Z9KA 3RXPA 3SNCA 2ZGJA 2KAIA 5DP3A 4UFEH 4NIYA 1TGCA 4FU7A 1FDPA 3HPTB 2ZTZA 1UCYH 4GCHG 1W7GH 6ESTA 5KECA 1PYTD 1C1UH 3O8RA 4AFUA 1HUTH 4NWLA 2G5NA 1GG6C 1JMOH 2BDCA 3ZZ6A 3UAIC 3N7DA 4ZXYH 2UUYA 4YM9A 2FOBA 2QXIA 1G2MA 2OBOA 1NFXA 1ZOMA 4CHAC 4BAOB 1PPGE 1VGCB 2D8WA 1C2FA 4BTIB 1ACBE 3M7UA 4RT0A 3BTEE 3M3TA 3MH5A 1QBVH 1Y3YA 1CHOG 1DXPA 1S6LA 5C1XA 2F91A 1EQ9A 1O3AA 4RT1A 5J4SA 2XRCA 3T2NA 1E37B 3MNSA 1EAUA 1DE7H 3LPRA 4CR5A 2FESH 1HPGA 4WMEA 1KYNA 1IOEA 1GJ9B 4NA9H 4BTUB 1NBMD 1P2OA 2R2MB 1N8OB 2H9HA 3EGKH 2FS9A 2Y7XA 1XVOA 2HNTC 2OQUA 1NRNH 1P3EA 2A45B 4FUEA 4ZUHA 1A46H 1GMHG 1T7CA 3FVFB 2XWBI 1O2PA 1V2VT 4BXSA 4CH2B 1GGDC 5FCRA 1V2TT 2A4GA 1GHAF 1J15A 3F2GA 2ODYB 4YT7H 1DY8A 1W3CA 2ZHQH 2JETB 4BOHA 3TGJE 1BJVA 3EE7A 1NRPH 2BOHB 1ZSKA 3LGUA 1QB6A 2OP9A 2ZU5A 3A8BA 2HLDD 1MZDA 3KHVA 2HALA 5CHAC 3BG4B 4X2VA 2B9LA 1Z1JA 1O2WA 2F43B 2ZU3A 3HK6B 1AY6H 2BD4A 4ESTE 2ODPA 4JZFH 2TGTA 4Y0ZE 2F9NA 4K8BA 1TA6A 1LDTT 2ZDLA 1HXEH 2NU1E 2GT8A 2ZC9H 1QJ6B 1CGIE 1SQTA 1EOLA 1YPHE 1KXBA 5FPSA 3B8JA 3UOPA 1O2ZA 4INKA 3F2FA 2LP6A 1ZGVA 1BHXB 1MCVA 1O35A 2BVSH 3PLPA 3T27A 1GVLA 1BTYA 1A5GH 4MPVA 3RXOA 1LPGB 5BRRE 3AASA 4K8YA 1O5GH 1HAOH 4U30A 4A1TA 3A7XA 1W13U 4CRDA 4ZKOU 1MTWA 3WY8A 2A7CA 1EKBB 2ASUB 4HFPB 1FX0B 1WUNH 2KFWA 3ZVDA 1SBWA 1W10U 1ELCA 3RXHA 1O3BA 4DY7B 3OY5U 1OPHB 2B7DH 1AD8H 1HBTH 2CN0H 3PTBA 1SGQE 5DSFA 2FWWA 2FXRA 1NN6A 1T8MA 2BXTH 4ISHH 2CMYA 1O3OA 2XWAA 4OGXA 1GI6A 1S82A 2C8XB 4FVBA 3GDVA 2KAIB 1P9SA 4WMFA 1ETRH 1QB1A 3WW7A 3BEUA 2JH0D 1DPOA 3BIUH 1ZZZA 1NFWA 3A8AA 4JMYA 1DXWA 3PB1E 1P12E 1KXFA 1SGRE 3BTHE 2KCAA 2H1UA 3U28C 3PO1C 1GBDA 2SGAA 3M5OA 3KNXA 3GY8A 1NBME 1O3GA 2VH6A 3UNQA 2ZFFH 1SC8U 3IITA 2WPHS 1TX7A 1QQUA 2PTNA 1MTUA 3F3BA 5DP9A 1RXPA 6GCHG 3QWCH 1ZSJA 2BLVA 3F0OA 5EPNA 1O30A 2VIWA 4Y7BA 1ANBA 1DX5M 1SR5C 5HMAA 3MO9A 1C1VH 1G3EA 2J92A 4DW2U 3EDXB 1G3CA 2P95A 3HK3B 1GI3A 1A61H 2D26C 3LJOA 1B0FA 2AHME 1IQFA 3UR6A 3PV5A 3TK6A 3LDXH 1UW7A 2PWXA 4DOQA 2THFB 5C20A 1EX3A 1GBJA 1O3FA 1UTNA 1QZ8A 2ODQA 1ELTA 2ZI2H 2A4QA 1Y5BT 1OYQA 3U98H 1IQMA 1S0RA 4MNYA 4CREA 2YNBA 5T6GA 2XBXA 1XUJA 4X8TH 1KTSB 4XBCA 2QAAA 2HPQH 2QGRA 1Z7KA 3UQVA 1MU6B 1FMGA 2BM2A 1FY3A 1FIZA 3MO6A 2GDEH 3QN7A 5EGMA 3KCGH 2BD7A 2PGQB 5E0JA 4ABIA 3TLOA 2ZCHP 1AB9C 3GY3A 3M35A 4KGAA 2SFAA 4ZHLU 2CHAB 3T26A 5AHGH 1YCPK 1VJAU 2ZU1A 3ZV9A 3BTKE 3HATH 4BXWA 1Y5AT 1HAXB 3FOAA 1MKWK 1PFXC 5FAHA 3F9HA 4BAQB 1MZAA 1EATA 1DANH 2RDEA 1QURH 3SNEA 4WY3A 1D6RA 2WPJS 1TNLA 4X6OA 3F6UH 1J14A 1EPTC 1GJ7B 4LZ4B 4B76A 1SFIA 1F5KU 4JCNA 2BY9X 1AFQB 2F83A 1N6YA 2GCTC 5EIYA 5FL7D 1EAWA 1EOJA 3EA9A 3AVZA 2TGPZ 4X2WA 1QRXA 1SKYE 2SGEE 2FOGA 2Q6DA 2Q6FA 2GZ9A 3SUDA 4B6FA 1ZPZA 3S7HB 3ZVBA 4FUDA 2IN2A 2PTCE 5HKKD 5FCKA 1LHFH 4CRFA 2UWLA 3N7OA 4K60A 3RXBA 1DWCH 1PQ8A 2F9PA 1GCTB 4LZ1H 3RC4A 5TJXA 4SGBE 4E7NA 5GXPA 2GV7A 1EP6A 3TJOA 4THNH 1WSSH 4I8JA 2GMTC 1UHBA 3GISB 1MTNC 2VJ1A 1G3BA 2SGDE 1F0UA 3F0PA 1S0QA 3AAVA 1TQ0B 1OX1A 2F9BH 1CO7E 3A83A 3TIUA 1ZSLA 3P17H 3UREA 1BBRK 1QL9A 3QK1A 1ZMLA 1NRRH 2ZGXH 1KLTA 3C27B 2ZPQA 1DWDH 2C93B 1GVZA 2OUAA 4LXBH 3RXQA 3PMHB 4H6TA 3C1KA 2HLCA 3ATKA 2C4FH 2W6ID 1NTPA 1W8BH 4GVUA 1NC6A 2XC0A 3URCA 5JDUB 2STAE 3SU5A 1Z8GA 2FMJA 2A2XH 1G9IE 3TGIE 5EJ1A 2VH0A 2P94A 3Q3KA 1O5DH 4PROA 1C1OA 2ZCLP 1K22H 4U01A 5L30H 2BMGB 2G5VA 5ETXA 1V2JT 3RLYH 2AIPA 1SG8B 1QL7A 3DCLA 3SZNA 2ZDVH 3BTFE 1BDAA 2WINI 4NFEA 1SFQB 1TOMH 3FP7E 2Q6GA 4CR9A 3MU1A 4AFZA 3EYDA 2XCNA 4CRGA 1JRTA 2G8TA 1GG6B 3M36A 1O3NA 1CT0E 4JZEH 1P05A 4X1RU 2ZCKP 2AGEX 5JYIA 3U8TH 1C5UA 3LU9B 4DJZB 3ZZ7A 5DP8A 1MUEB 1GHAG 1UCYK 4CHAB 2P3TB 2L74A 1COWD 2BX4A 4SGAE 2XTTB 4FUGA 4JZDH 5EOKA 1HJAC 3BV9B 1BMLA 2OINA 1N6XA 2WPIS 2XXLA 1BBRE 3ZVAA 1NFUA 1O37A 2ZF0H 3ZZ3A 2ZFPH 1V2UT 3MNBA 4IBLH 1BUIA 2ANYA 3JZ2B 3PMBB 1WBGB 1FNIA 5EW2H 1O32A 3OU0A 2QA9E 1UVSH 1V6DA
chains in the Genus database with same CATH topology
4AORA 2ESTE 3ZZAA 1A0HB 5A8YA 2BDAA 3RU4T 3MNCA 4NFFA 5ESBA 4IW4E 2PSXA 9LPRA 1O3EA 6GCHF 3NXPA 3GY7A 1S83A 3A86A 4FUCA 2VU8E 3RXGA 4I8HA 1NT1A 1O2IA 2YOLA 5C1UA 1GHXH 1XVMA 3F68H 1BMAA 1DFPA 1TGSZ 3P8FA 1F0SA 3VB5A 1TBQH 3A85A 3SJ8A 3S7KB 3VB6A 5LPEA 1ARBA 1BMNH 1C1NA 1V2ST 3E90B 1NESE 4FUHA 1CT2E 4XE4A 4OS4A 2AYWA 1ABJH 1LHDH 2V6NA 4A1XA 5I25A 3BTWE 4LK4A 1FY1A 4ZAEA 2PKAA 1NRSH 1UHBB 1S5SA 4X6PA 4UEHH 1MKXH 4IN2A 1O2LA 1L1NA 1H1BA 1EZQA 3SOSA 3NZIA 5C3NA 1YCPM 4WJG2 1JRSA 1D3TB 1C2DA 2ZFQH 4X8SH 2FOEA 1SGYE 3S0NA 4DG4A 1TONA 3TNTA 1GHVH 1EPTA 2P8OC 4BAHB 1QY6A 4MNWA 1DLEA 4K3JA 6CHAB 1QA7A 2GZ8A 4JZIA 3DHKH 5EU8A 4KTCA 4UONA 3MU5A 2OCVB 2GV6A 1P2MA 2QY0B 5F8ZA 2AMQA 5H4IB 1C4U2 3GCTF 3E6PH 4R0IA 4ZKRU 2ZFSA 3ZZBA 1H8DH 1Z6EA 3L6PA 3SV8A 1P2JA 2H6MA 1DT2A 3E8LA 1ZMJA 1C5ZB 1O2NA 2C8WB 2I6SA 3ITIA 2VGCB 1C5LH 1YPGH 1JWTA 1Z8JB 2WPLS 4Y71A 3EQ0H 2EC9H 1O5BB 2CJIA 1PPZA 3VPKA 1MQ6A 1QNJA 4OS7A 4Q80A 2ZNKH 3PO1B 1RTFB 1E36B 4ISIH 3KF2A 1C2IA 3SJIA 5HXFA 1WU1A 2ZIQH 1BA8B 4IC5A 1AUTC 3QTOH 1CQQA 3ZZDA 4KKDA 1OWDA 2XW9A 1IHTH 3MU8A 3MOCA 3SJKA 1YLCA 1VITH 1LQEA 1TBZH 2F3CE 1THSH 2FX6A 2IPHA 5EQRA 3RXDA 1TGNA 2BLQA 4ABDA 1KDQB 2Y7ZA 3SUFA 1RIWC 1O2GH 1S81A 3EE0B 3TVJB 4ISNA 1UVTH 1E0FD 2QIQA 4X6NA 2ZGHA 1C5VA 3PV4A 4ZH8A 4GPGA 1CA0B 2PSYA 4FU9A 1P57B 1GJ5H 1SGDE 3RXJA 3M5LA 1BTHH 2VWNA 4TWYA 1TNGA 1HIAA 1LO6A 3CS0A 3RMOH 2ZG0H 4JZ1A 2TRMA 5IDKA 1PQ7A 3ZZ8A 2W3KA 3T62A 2HWLB 2XC4A 1JOUB 4I33A 1IQGA 1QRWA 3SGQE 2ZHEH 5C5OA 1K21H 1AE5A 1IQIA 4Z6AH 2A32A 1QJ7B 2G81E 1YM0A 2Z9IA 3RM0H 3MH7A 1GBTA 3PWCA 4OS2A 4IS5A 2BQ7B 3LGYA 3GCHC 1AFEH 2OTVA 4UE7H 2O8WA 1BRBE 2FTLE 3FANA 1O5AB 1DITH 3E1XB 1AB9B 4ABHA 5JB9S 1TYNA 1BMMH 2G4TA 3P95A 2A4RA 3A7TA 1WOFA 1EB1H 2BY7X 4HGCA 1F0RA 2LNCA 3RMLH 8ESTE 1GJ4H 1K1LA 3VEQB 3GCOA 3UWIA 3HGPA 2ZKSA 1OOKB 1ZHMA 3SUGA 1HCGA 5F8XA 2ZO3H 1C9TA 1T4VH 1GMDF 1XXDA 1PQAA 2Z3EA 3U1IB 2HRVA 1HAHH 1SQAA 1XKAC 1ZTJA 2BZ6H 5AF9H 1TAWA 2ZFTA 1QB9A 3A7ZA 3F9FA 3SNBA 1O2JA 2GCTB 1KLIH 3M7QA 4RKOB 3ODFA 3V0XA 1GDUA 3SQHE 2AGGX 4X8UH 4RSPA 1KTTB 2BDIA 1GPZA 3D65E 4FXGH 1DLKB 1BJUA 1EB2A 4YOGA 4Q7XA 4X8VH 1F7ZA 1L1GA 5IYTA 1ELAA 3PMJA 2FI5E 3O8CA 4NIWA 1ESBA 2VWMA 4Y8YA 5DJ7A 1EUFA 1FI8A 1IHSH 1C1QA 3QZQA 3LGTA 4NCYA 3EAJA 1CBWC 1G2LA 1CVWH 5DK1A 1C2KA 2BY6X 1AE8H 2STBE 1P11E 2WPMS 2DUCA 2GMTB 2NU2E 1EAXA 1O2UA 1XKBC 1SGPE 1D3DB 1ESAA 3OSYA 4AG1A 1BCUH 4CRBA 3SUEA 4WH6A 3FZDA 3RXCA 1QGFA 1L1JA 3S9BA 1O3PB 5EODA 1HAVB 4O3TA 2R3UA 1EJNA 3MI4A 2BQ6B 1IQKA 4GLYA 3LC5A 5TCCA 3NPSA 1QIXB 1OWEA 3LOXA 4UD9H 1F2SE 5HM2A 1PQ5A 1H9HE 5C2ZA 2ZHFH 3V13A 1HAIH 1XX9A 3K65B 1BRAA 2H5CA 4UFFH 4MDSA 3U8OH 3LIWA 1LVBA 3SORA 2EEKA 1W11U 5L6NH 2W26A 1ZPBA 2Y5FA 1BTUA 4KTSA 3KQCA 2D1JA 3A81A 4UDWH 2EI6A 1J8AA 3TJUA 2ZWLH 1O33A 1KIGH 2J2UA 1V2KT 5F03A 3BEIB 3RXEA 1HIAB 1X7AC 1TPPA 3SBKA 3QX5H 1GBCA 4TY6A 1SGFG 4YOIA 3PLKA 1SPJA 3SU4A 1OP8A 2BDYA 4K69A 1AO5A 1T31A 2BDGA 4NZQA 1TGTA 4K2YA 4O97A 1TE0A 1F92A 1SGEE 3URDA 1GBBA 2BOKA 4Y8XA 3P6ZB 3U8RH 1RGQA 3VGCC 1QRZA 3H5CB 1HJAB 4O3UA 3RXVA 1EJAA 1BHXF 4OGYA 4B73A 3RXUA 1EZXC 1YYY1 4JK6A 1QCPA 1ELDE 2BLWA 2VIPA 2ANKH 1ZRBA 3IWMA 4DGJA 4GUXA 2WV5A 2O8LA 2FTMA 3OYPA 1HJ8A 2PHBA 5J4QA 1UK2A 1AVXA 4BTTB 5F6MA 1DM4B 1HGTH 1TMBH 4U32A 4Y76A 1NRQH 2RG3A 1CE5A 3RXIA 1LTOA 3TK9A 3GCNA 3SI4H 4CRAA 2Q1JA 1ZTLA 1SHHB 1AIXH 5GIBA 1SVPA 1VITG 2TGDA 4AGJA 3D23A 4HTCH 2RDLA 5EXNA 2C8ZB 1GHZA 5A09A 1BITA 5HM9A 1P3CA 5FHTA 3ELAH 3RU4D 3ODDA 3MU4A 4MG3A 1XUKA 4DURA 2QF3A 5BPEA 4D7FA 1C2MA 3ATMA 3MH4A 1DY9A 2GTBA 4B2AA 3TU7H 3QLPH 1Y8TA 1FY8E 3ATIA 4MLFB 1RD3B 1XUIA 4FU8A 3GCTG 3ZYEA 1TQ7B 4E06H 3R3GB 2XCFA 1O5EH 2Y5HA 2M5TA 1P02A 1G32B 3ZYDA 2H2ZA 1C5WB 1MKXK 2CV3A 1K1MA 2FLBH 4INLA 4NSVA 3KIDU 1GJDB 1AVGH 1UTKA 3LT3A 4ISLA 1GI9B 3SNAA 2GT7A 2AIQA 3A8CA 2ANWA 5GCHG 1GL1A 3M37A 2ZGBH 2A1DB 4JK5A 1LVYA 4AN7A 3UR9A 1E34B 2B8OH 1LQDB 3H7OA 1ZJDA 5LGOA 1CSOE 1YKTA 2W7UA 1N8OC 1BTWA 1XMNB 1C4V2 4ABFA 4I8KA 1O3MA 1W0YH 3LKWA 3BN9A 1LHCH 3PYHA 3VB3A 4NZLA 4F4OC 1RJXB 4M7GA 2PKSB 4B71A 4AYYB 2AMDA 2OD3B 3MTYA 3U1JB 1Y3XA 1O31A 1YPJH 1ARCA 2JETC 3UWJH 1OWKA 1O34A 1PPHE 1O2OA 3QTVH 2HVXA 2FM2A 4Q7ZA 5EQQA 1GBEA 1O2VA 2IOTA 3V12A 4YO9A 3ESTA 3FP6E 3UNRA 1T8NA 3BG4C 1PYTC 1XUFA 3UTUH 1MCTA 4RN6A 1QL8A 3NKKA 2J38A 8KME2 3RXTA 1QQ4A 1D4PB 1ZMNA 4NIXA 2ZU2A 1O2TA 5EW1H 1GI7B 2AEIH 3LONA 1GHBG 2VIOA 3KQBA 2BDBA 5JPMH 3GYMA 3FP8E 4NA8A 2BD2A 1FPHH 2P3FH 3TITA 4QT8C 1AGJA 1WQSA 4KTUA 2H9TH 3GY5A 1FN8A 2A5AA 3P8GA 1AKSA 1YF4A 1UTLM 4X1PU 1PPCE 2V35A 3A7WA 3FFGA 1GHWH 1SLUB 2ZHWH 2ZQ2A 1ETTH 1O2MA 3BTDE 1RTLA 1UK4A 5K7RA 2FZZA 2GVFA 1RIWB 4D9RA 3I77A 1KXCA 2FIRH 2G00A 3LGIA 1ELGA 4NG9H 1ANEA 3VB4A 4AGKA 1L2EA 4WVPE 2PFEA 1Y5UT 3DFJA 5EXMA 1TB6H 4FVDA 2FDAA 4B1TA 1B0EA 5ABWA 4IN1A 1C2GA 3TNSA 1GJ8B 2TPIZ 3NK8A 8GCHF 1U6QA 1TNKA 3PLBA 1YPKH 2XBVA 1QHRB 2P16A 1C2HA 1BQYA 4A7IB 1A3EH 3QO6A 1WV7H 1DUEA 1A0LA 2A5KA 1C5PA 1GMDG 5L2ZH 2VVVA 4BNRA 3RXLA 2FLRH 4U2WA 3VXFH 3U9AH 3RM2H 3GOVB 1K2I1 1YPMH 3E91A 3T28A 3DT0H 4F49A 4WXVA 4IMQA 1DSTA 2FOCA 1Z6JH 4YLQH 1TWXB 1LCYA 2Z9JA 1LHEH 1WQVH 3RXSA 3MNXA 1HJ9A 2VIVA 2CXVA 1KSNA 1VCQA 3GYLB 5A2MH 1TNIA 5HYOA 1FJSA 1TRMA 2QN5T 1D9IA 1FAKH 1O5FH 2RA3A 2JH5D 1NU9A 1BRUP 4ASHA 1XM1A 1TLDA 4JYVH 1TABE 2VNTA 2UUJB 4XOJA 2AH4X 1DDJA 1GGDB 2JH6D 3P8OA 3PWBA 3ZVCA 1ZGIA 2ZTXA 1V2LT 1HRTH 1QTFA 3GDUA 4TWWA 3A80A 1AZZA 1FUJA 1C5MD 4MPWA 5A8XA 2W7SA 3RMMH 1C5XB 1O3HA 1AVWA 4Y79A 2Z3CA 4HZHA 1HAGE 1YPLH 1Z8IB 3KGPA 5CHAB 5GDSH 3A87A 1SGTA 4BAKB 4H42U 3SNDA 4B2CA 1ZTKA 1T4UH 1P04A 1GI8B 3T5FH 4B74A 2J4IA 1CBWB 1LMWB 3A89A 4NSYA 1H4WA 1DSUA 1E35B 1GBFA 1C9PA 3TK5A 1IQEA 2HNTE 2W5EA 1C1MA 2V0BA 3W95A 1OSSA 3P92A 4D76A 1F5RA 4ABJA 1O3CA 1C1SA 3LGWA 1XXFA 3GDSA 4AB8A 1VITF 3AW1A 4D9QA 1O3KA 1O36A 3HKJB 3CP7A 1O2RA 1ETSH 2J94A 2J95A 3UNSA 3RP2A 2FEQH 4Y0YE 2BDHA 3RXKA 2RCEA 1GJBB 1TX8A 1MTVA 2VVCA 1T8LA 3D49H 1G30B 2O9QA 1AKSB 4DT7B 3ZZ9A 2XC5A 4XBDA 1TMUH 1DUAA 5T6DA 2JKHA 3SV9A 1O39A 1UO6A 1UVPA 2HNTF 1KY9A 1GI4A 4FUBA 1AFQC 1BZXE 1SLWB 2Y6TA 1DWBH 2F9UA 4WXIA 4I8GA 1FPCH 4O03A 3AAUA 1J16A 3BTQE 5JBCS 5C67A 1UTQA 1P01A 3RXRA 1GDNA 4I31A 5LPRA 1HV7A 3V3MA 1C5OH 2AS9A 1RFNA 1QFKH 5GCHF 5GWZA 1GI2A 3NUMA 8LPRA 2VWLA 4LOYH 3EA8A 1F0TA 3ENSB 1AHTH 3GY6A 1ELEE 1K1OA 1P2IA 1SLXB 2VINA 1OWIA 1GMCF 3P70B 2BD9A 2D2DA 1RTKA 2WPKS 4KELA 3A7YA 3E16B 4ABAA 1E38B 1UJ1A 3MU0A 5GJ4B 1BT7A 1F5LA 1YBWA 1NPMA 4OS1A 2OLGA 5DG6A 1TNHA 4RKJB 1WAYB 2WUBA 4FUIA 2BQWB 1ANDA 1P2KA 4H6SB 4YESB 1HAPH 3BF6H 1TPAE 1OKXA 7LPRA 3TH4H 4MTBA 5JBAS 2FS8A 2O8TA 3SI3H 3SO3A 1GBLA 2HPPH 4X1SU 4HI3A 2Y5GA 3F1SB 4O9VA 1GHYH 3RXFA 2V3OH 2FO9A 2NU0E 3R0FA 3MMGA 3T25A 2R3YA 2ILNA 1O0DH 2XBWA 4E05H 3A84A 5DPAA 1MAXA 4Y7AA 1V2NT 2R9PA 4MPUA 1OWHA 1ZPCA 3G01A 3GICB 1GHBF 3IG6B 3DD2H 3ZZ5A 5A0CA 1O5CB 2VB0A 5DGJA 5I46H 1ZLRA 2UWOA 3UPEA 4MNXA 2ZZUH 3KL6A 3M5NA 2QF0A 3W94A 2OC1A 2HGTH 2ZTYA 1IQHA 2C8YB 2F9VA 2GD4B 2Z94A 4K5ZA 1SI5H 4MVNA 2A5IA 5AFZH 2UUFB 4XFQA 1LPKB 1C5SA 1AUJA 1UK3A 3KN2A 3I78A 5LPFA 1FLEE 2PKAB 1D3QB 1NS3A 1TX6A 1KXDA 2SNVA 4YZUA 3BSQA 4NWKA 4A1VA 1A5IA 5K0HA 1M9UA 1UVUH 2BY8X 1Y59T 1S84A 3SV6A 4AX9H 4GHTA 2FODA 3STIA 4ABEA 4K1TA 4NIVA 4D7GA 3FZZA 1H9LB 3E0NB 5G4BA 1ZYOA 3UIRA 1CT4E 2W3IA 5JBBS 3S9CA 3F9EA 2P93A 1CU1A 1EPTB 1AZ8A 1MU8B 9ESTA 3OX7U 2PLXA 4VGCC 3UY9A 1T32A 3K9XB 1PPBH 1IQLA 2CF8H 3ATWA 1C1RA 1GBKA 1NM6A 2ZDAH 1YLDA 4MNVA 1EXFA 3TJNA 2BHGA 1IQNA 3L33A 1DWEH 2BX3A 5PTPA 1QA0A 1DVAH 1UTOA 3LH3A 5T3HA 1LKBA 2G4UA 3TPIZ 1GI5A 2VIQA 1YC0A 1HYLA 2ALPA 1V2PT 5LH8A 2YNAA 1FQ3A 1GBMA 3LGVA 1HXFH 4NGAH 1W12U 4JYTA 7GCHF 1P03A 1MTNB 2FOAA 2TGAA 2PV9B 4J1YA 4D8NA 3RXMA 2EI7A 1WYKA 2P59A 1OP2A 2AERH 1BB0B 2NU3E 3PTNA 1JBUH 1C1WH 1W0ZU 3A7VA 3V7TA 1FONA 3O8DA 1EAIA 3NWUA 1G36A 1LVOA 1SHYA 1MBMA 2OBQA 2B0FA 5L2YH 8GCHG 2O8UA 2Z9LA 2XYAA 3LJJA 3TGKE 4TPYA 2FX4A 1TPOA