1MCVA

Crystal structure analysis of a hybrid squash inhibitor in complex with porcine pancreatic elastase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Elastase 1
publication title Structure of a hybrid squash inhibitor in complex with porcine pancreatic elastase at 1.8 A resolution.
pubmed doi rcsb
total genus 58
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2002-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mcvA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mcvA01
1D3PB 1SGFG 3S9BA 5CMXH 3EA9A 1ESAA 4LK4A 4YLUA 3M5OA 2VWMA 1OWDA 1RJXB 1SGPE 2ODQA 2AERH 2FI4E 1LO6A 4NIWA 1O3IA 3GCTG 3RXGA 1EAUA 1Y59T 3T62A 4YOJA 3M7TA 3ZZ9A 1GVZA 5CHAB 2W26A 4ISOA 1FMGA 2VWNA 1HJAC 2FPZA 2ZEBA 4BANB 3RC4A 2TRMA 3BEFB 5C5NA 1D6RA 2GV7A 1C1NA 4I7YH 1EOJA 1SSXA 4ZXXH 3LGIA 2GCTC 1P04A 1C1UH 1YF4A 3A7ZA 2BD5A 2BXUH 5GJ4B 4WXIA 1LHEH 4JZEH 1NFXA 2VIVA 1O37A 1SLWB 1O2PA 4U32A 2J95A 5GXPA 4DVAU 2C8XB 1CA0B 1MTNC 5HYOA 1EXFA 3NKKA 4WH8A 1HAGE 2ALPA 1O2YA 1LPZB 2FOEA 1ZJDA 3D65E 5E8EH 2VINA 3A84A 4J1YA 1K22H 1P06A 4RKJB 3ITIA 1TRYA 1GI0A 1QJ7B 1KYNA 4ABGA 3K6ZA 4ZROA 2YNBA 3RU4T 2VWLA 2HLCA 3Q77A 1TMBH 3A7TA 2R2MB 4B2CA 1L1NA 4Y7BA 1GDUA 2GZ8A 2CHAC 2ZNKH 1OX1A 4DIIH 4HTCH 5DG6A 2VIWA 5T6DA 1FV9A 3GCHC 3W95A 1YPHE 1SMFE 1BBRK 3GCOA 5FX6A 1HFDA 2BDBA 3SV9A 3E6PH 1K1JA 3IG6B 5C1XA 3ZZ8A 1ZJKA 3KCGH 4MPUA 2ANMH 3AAVA 1YPGH 3O8DA 2Z3EA 2VIOA 1V6DA 2Z94A 2BDGA 4Q7ZA 3PMBB 3M7QA 3MU1A 1W13U 1T8OA 3KNXA 3KL6A 2GMTC 2GGVB 1C2JA 1FNIA 1CGIE 4NWLA 1SC8U 1NN6A 3BG4C 3SGQE 2G5NA 1EX3A 2BLVA 2ASUB 2QA9E 2VGCC 1PJPA 2VVCA 4NSVA 4AGJA 2WPKS 3RLYH 1CSOE 1O2RA 4ISIH 1T4UH 1O3KA 2B7DH 1LVOA 2TGAA 2BX3A 3ZVFA 5DK1A 5A0AE 1TNHA 2OP9A 1V2OT 2FS8A 1ABJH 2FTMA 3MO3A 4Y10E 2FOGA 3ATWA 3V0XA 1O5DH 5FPTA 4TYDA 2JKHA 3LPRA 2JH0D 1C5VA 1K21H 2F9OA 3B23B 2O8LA 1GMCF 1W12U 4IN1A 1ELEE 1NRSH 2VU8E 4FUJA 1GJ7B 1WU1A 3F9EA 4CH2B 3ATLA 3STIA 1P2QA 2G4UA 5E0HA 1K1NA 1HYLA 1ANDA 1OP0A 6CHAB 1LHGH 1DVAH 1GVLA 1HXFH 1SBWA 3TGKE 3GCTF 2P8OC 2QN5T 3LH1A 3HKIB 5EODA 1OYTH 4IC6A 3ZVGA 1JWTA 2ZWLH 3PROA 4BAOB 5AF9H 1O5EH 1G3DA 4OS7A 1CHOF 1GVKB 1P0SH 3FANA 1KIGH 5HGGA 1GJ9B 2BDYA 1CHGA 3Q3YA 2NU0E 4NA9H 1O36A 1QR3E 2QGRA 1NO9H 3GDSA 4FUGA 4UFDH 1C1PA 1UTNA 1S5SA 1BIOA 1G3EA 2ZHFH 2ZC9H 1O3EA 2QXGA 1LHFH 4O9VA 3TNSA 2Y5GA 2FZZA 3PLBA 2FODA 3IWMA 2FS9A 5E0GA 4CHAB 3NUMA 4TY7A 3RXEA 1BRBE 3RXUA 2GVFA 1DWCH 1NFWA 2BZAA 1NU7B 3MMGA 2EA3A 5EQRA 1VJAU 4NIYA 2A4RA 1TGCA 2GV6A 2W7SA 1C1WH 3TGJE 2BX4A 1NRPH 2B9LA 2HNTF 5TCAA 3AVZA 4LOYH 3T28A 1ZRBA 4D9RA 3SUFA 1ELVA 2BY8X 4X8UH 2FYRA 1O2LA 3MYWA 1DWDH 4GAWA 2BYAX 1L1GA 5L2YH 3SGAE 4Y0ZE 1C1TA 2ZZUH 2ZPSA 1GL1A 3U8RH 3KEEA 4Y0YE 4X6MA 1RFNA 1FY4A 2FLRH 1TNGA 1TOMH 3SI3H 2ZG0H 1V2UT 2OC1A 3RXOA 1VCWA 3C1KA 4Y8ZA 1GI1A 3SNDA 3FAOA 3TPIZ 2VIDA 2WUBA 2FXRA 5FCKA 3ATKA 4Z6AH 3CP7A 4ZHMU 1HJAB 1BQYA 3M7UA 4K1TA 1PYTD 2Y6TA 3D49H 4B1TA 1GBLA 1H4WA 2GCTB 1ELFA 1GDQA 1GI4A 1C5QA 3URDA 1GDNA 1P05A 1JOUB 2BTCE 1AO5A 3HATH 2GDEH 2C8WB 5F8ZA 3GISB 4K8YA 2PSXA 3LDXH 3SJ8A 1O2TA 1SFQB 2M5TA 2BY9X 1O31A 2WPIS 2R3YA 5G4BA 1UK3A 2BOHB 1MZAA 4ZAEA 2TIOA 1HJ9A 2P93A 3QO6A 4H6SB 4AZ2B 3A80A 2O8WA 3M3VA 2BLOA 3A85A 3SHAH 2W3KA 4I8KA 3SQHE 2QAAA 4DOQA 1O3NA 2UWOA 3KQBA 1WQVH 3NWUA 1O3LA 4MLFB 3RDZA 2AMPA 1MCTA 4U30A 4GCHF 3SNBA 4BOHA 1QBOA 2ZDVH 2F9VA 1XMNB 2PTCE 3RXCA 5F8TA 5FPSA 1YCPM 1LPKB 3OY5U 1EAWA 1SGRE 1DWBH 3QX5H 4WMDA 4CBNA 2ZIQH 4ISLA 3AAUA 4GHTA 1SGTA 1W2KH 3V13A 1TABE 3Q3XA 1O3DA 1NRNH 1ELCA 4AFQA 3TJUA 1UTPA 3H7OA 5LPRA 1BTZA 2Z9JA 1C2LA 1C9TA 1HIAA 3RXFA 1ETTH 2SGDE 1UTMA 3MWIU 2ZFQH 2PUXB 1AI8H 2LPRA 4MPVA 2QY0B 1C1RA 1DSUA 1HIAB 1QRZA 2ZPQA 1C9PA 1KY9A 2IN2A 4GLYA 1SLUB 1XX9A 8LPRA 4CRDA 3A88A 3D23A 2Q1JA 5GIBA 1J17T 1CA0C 1C2EA 3UREA 1ZZZA 3JZ2B 2CGAA 1ZTJA 1SGEE 3BN9A 4FU8A 2GMTB 2F3CE 2BD4A 2QXHA 1YC0A 3NZIA 4CR9A 1GI5A 4ABIA 3HK6B 2CXVA 1NESE 4O3TA 8GCHF 3SV8A 3UQOA 4NFFA 4TWWA 1SLXB 1GJAB 3DD2H 4JZ1A 2SGFE 4B76A 4NZLA 1GBDA 2OINA 1FZZA 3T29A 1C5MD 4BXSA 3K65B 1SGIB 2FDAA 1CO7E 2YOLA 7LPRA 2P3TB 1TIOA 1G2MA 2HVXA 4XFQA 4CRBA 3E8LA 3QDZB 3QWCH 1IOEA 4FU7A 2TGPZ 2J4IA 1H8DH 3EQ0H 4XBDA 1QL7A 4GHQA 4X1PU 3QTVH 1TE0A 3UTUH 2H6MA 3E1XB 4LZ1H 1G30B 1O2WA 1Z7KA 4AFUA 3ZVBA 2Z9IA 3BSQA 1A0HB 3SJ9A 4AYVB 1P8VC 3GICB 1N6YA 2ZHEH 1O2HA 3GYLB 2SGPE 2SNWA 1B0FA 3ODDA 3MH5A 4NSYA 1LVBA 1FPCH 1DUAA 3QGJA 2Z3DA 2XBYA 3SI4H 4THNH 2H5CA 3VB7A 3RM0H 3A89A 4KELA 2CJIA 1QRXA 1EJAA 3M3SA 1KDQA 1MBMA 5HMAA 1ZLRA 4Q2KA 1C2GA 1TGBA 1ZSKA 2PR3A 3P8FA 2QV1A 1S6FA 1MAXA 2IOTA 1FONA 3OY6U 1OYQA 1HUTH 1KDQB 2A4QA 1XXDA 5JPMH 2TBSA 4MVNA 2SGQE 1RS0A 1QQ4A 3KF2A 4WH6A 1L2EA 2CF9H 3ZV9A 1LDTT 1CGHA 1O35A 4WVPE 1KTTB 3P70B 1YM0A 2NU2E 4KKDA 1NRQH 2WUCA 2BZ6H 4UD9H 2HALA 1Z71A 5JBTA 3SV6A 1MTWA 3MU8A 1TGSZ 3ZZ3A 1ZPCA 1VITF 5AFYH 1HAXB 1C5TA 4MNXA 2Q6DA 3GYMA 1KSNA 1N8OB 2C93B 3P8GA 1EJNA 3VGCB 2ZGXH 1GJ5H 1KLIH 1PPFE 4IN2A 1DPOA 2F9BH 8ESTE 2EC9H 3SJKA 1UVPA 1GI3A 3A8DA 2C90B 1K1MA 1RTFB 4RN6A 4A7IB 1ABIH 1IQLA 3GY5A 3I29A 2ZU1A 4BTTB 3KGPA 4UFGH 2ILNA 1GMHF 1RXPA 2BQ6B 4JK6A 5E2OA 2IPHA 1ARCA 2J94A 1GJ6A 3MU0A 1F0SA 1O5BB 4Q80A 2ZDNA 1IQEA 5A2MH 3FZDA 4NA7A 4FUDA 1BHXB 1C2IA 4NFEA 4IBLH 3UIRA 4BAHB 1HAYB 1O30A 2FM2A 2G00A 3SOSA 1Q2WA 2O8UA 1C5YB 3SQEE 4Y8YA 5A8XA 1XKBC 1JIMA 4AYYB 2D8WA 1UK4A 3I77A 2BVSH 1UTQA 3PWBA 3PMAB 1TPOA 1C2HA 1SPJA 2FOFA 4O03A 3ZV8A 7KMEH 4RKOB 3ZVAA 1HLTH 3M37A 1LKBA 1SI5H 3PTNA 1BRUP 2ZDAH 2BY5X 2AYWA 1JRSA 5JB9S 1HPGA 4LZ4B 1P2IA 1W7XH 1OPHB 3P17H 2Z3CA 3ZZAA 1C4U2 2JETB 2ANWA 3MO9A 4XE4A 3RUOA 2G8TA 3DA9B 1YBWA 1GMCG 2QF3A 3L6PA 1Z8GA 2FOBA 3FP6E 1AMHA 3SU6A 2B0FA 1QTFA 1O39A 1QY6A 1OWJA 3LT3A 1GJDB 2ZF0H 1K2I1 2BOKA 2J34A 2EEKA 4D76A 1C2KA 2K1QA 2FEQH 4OS5A 1A5GH 1P9SA 1FAKH 2ANYA 4ABDA 3O8CA 4DCDA 5F8XA 1GHBG 1L0ZA 1LVYA 1WTHD 4XOJA 3RMOH 1UCYK 4NIXA 1PPHE 3ODFA 1HV7A 1XVOA 3F9GA 4X6NA 1O2KA 1A3EH 3PO1B 4B75A 1CHOG 4FUFA 2NU4E 2BDAA 4FVBA 5GDSH 4UFEH 1GI9B 4ISHH 4CREA 5EXMA 1ELTA 1XUKA 1O38A 1O2GH 1P2JA 2QIQA 3RP2A 4A1VA 4WWYA 1O3OA 3RC6A 1ORFA 5A09A 1C1OA 1W14U 2P94A 2F9UA 4ZKOU 1UJ1A 2GZ7A 3T5FH 1L1JA 2AGGX 3TJVA 4B74A 1TMTH 2STAE 1ZHPA 1OKXA 2NWNA 5EGMA 1CU1A 1SGCA 2BQ7B 1OWEA 1RIWB 4UE7H 1TRNA 1AU8A 1ZHMA 1PFXC 1IQIA 3EAJA 3V7TA 2RA3A 1CGJE 2A1DB 1BTHH 3QZRA 1CE5A 4K2YA 4ABEA 4IC5A 1BDAA 1K1LA 4UDWH 2EI6A 3Q00A 2H9TH 2OC0A 4NIVA 4R8TB 2DE8A 1O3GA 1AN1E 3LOXA 1TA2A 1P3EA 5I46H 2HRVA 2ULLA 2BVXH 1IHTH 3PB1E 1DT2A 5EQQA 2OC8A 1SHYA 3GY6A 2V6NA 2V3OH 3GCNA 2NU3E 5GPIB 2GDDA 2VIQA 3N7OA 1VR1H 4DURA 4IGDA 1TNIA 1T32A 2ZGJA 3FZZA 1K9OE 1FI8A 1PPZA 1OXGA 1XVMA 1V2RT 4D9QA 1UTLM 1ELGA 2RG3A 2I6QA 1O3JA 1WOFA 1HAPH 3BTDE 2F9NA 4AB8A 2FLBH 1SGYE 2H9EH 3MNBA 5FCRA 5B6OA 3RXQA 5SGAE 4R0IA 1DICA 1HB0B 1GBHA 1S82A 3ELAH 3SU1A 1UO6A 1WYKA 4F49A 4ZMAH 1GJ4H 1V2WT 1IQFA 1BBRE 2PV9B 1FIWA 4E7RG 2XCNA 1BT7A 2TPIZ 3TVJB 1ZTLA 2A5IA 5AFZH 3UWIA 1C5PA 1O32A 2ZFTA 2BD2A 3BTME 4MNWA 2QYIA 1MAYA 2FTLE 4NGAH 1RTLA 1MCVA 1ZHRA 3TJNA 3LKWA 2A0QB 5EOKA 1B0EA 2STBE 4CR5A 4GCHG 1B7XB 4X1SU 2FESH 4KTSA 3RXIA 1PQ7A 4AFSA 4WJG2 4ZXYH 1YPEH 3BEUA 3A87A 3MO6A 2PTNA 2OQUA 1PPEE 2XW9A 1IHSH 4KP0A 5DKMA 1C5OH 3M5LA 1TBZH 2FX4A 2VH6A 1IQGA 4SGBE 1ELAA 2PHBA 1TYNA 1CVWH 1GHBF 4ABHA 4I8HA 1LMWB 2FMJA 2NU1E 2VB0A 1BZXE 1O3PB 1EUFA 3LGTA 4CRCA 3Q3KA 1AFQB 1KLJH 5DP9A 3F9HA 1LTOA 1B5GH 2Y82A 3RXPA 5C67A 1C2DA 4JCNA 1AY6H 1CQQA 1EB2A 2AGIX 5JB8S 3HK3B 1TX8A 3GY8A 3SU2A 3L3TA 4Y6DA 3UUZA 3SORA 1TPSA 3ZVCA 3KQDA 4Y11E 3LJJA 2V0BA 5GCHG 1AD8H 1YLDA 4WY3A 3TNTA 5TJXA 1HXEH 2XTTB 4GSOA 4YT6H 1DXWA 1FPHH 1VJ9U 2OBOA 1GHYH 3KHVA 5DP4A 5C2ZA 1C5ZB 1FY1A 1Y5AT 1SFIA 1DOJA 2FP7B 2V3HH 1FY5A 4X2XA 4I33A 8GCHG 4Y79A 1C5UA 1ZR0A 1F5RA 3SJOA 1UMAH 1FN8A 1QJ6B 3QLPH 2BD7A 1NROH 2GCHF 1HGTH 1P10A 4GPGA 2WPJS 1N8OC 1F92A 2H1UA 5J4QA 3VGCC 1YPHC 1WBGB 2ZQ2A 4DG4A 3UY9A 2FI3E 1O2VA 1QJ1B 3OU0A 1XUIA 4YESB 2CN0H 3B9FH 2BDCA 4A92A 1O33A 2P3UB 3QUMP 2FO9A 1T8LA 1GCTB 1G9IE 2PFEA 6ESTA 3T25A 1THRH 2IJOB 4YTAA 1H9LB 1QA7A 3UWJH 3O8BA 1F2SE 3P6ZB 3QGNB 1NC6A 2ZA5A 1GBBA 1BJUA 4TY6A 1MZDA 5ABWA 3ZZBA 1F0RA 5JBAS 3IITA 1ZGIA 4D7GA 5L6NH 2PLXA 1SQTA 1E34B 1OOKB 1JMOH 2ZGCA 3KQCA 2UUYA 1GBMA 2A5AA 3RXTA 1FLEE 2KAIA 3PM3A 4H6TA 3SUDA 1Y3VA 8KME2 3S69A 1HAOH 2ESTE 1YP9A 1AE8H 4K3JA 1CT4E 2KAIB 4TPIZ 3EGKH 1P2MA 3HGNA 1OWHA 1L4ZA 1P12E 1Y5UT 1MTVA 2SFAA 2C8ZB 1TBRH 3ZVEA 2BD3A 2FOMB 2ZECA 1QA0A 2ALVA 5FBIA 2F91A 2JETC 3A83A 1O5AB 2PW8H 1MKWK 1G37A 1G36A 3ENSB 4JYTA 4H4FA 4JZFH 3TH3H 4NWKA 3NCLA 1DSTA 1DXPA 3ESTA 1VITG 1V2NT 4KTCA 5LGOA 2HNTE 3TK6A 3QTOH 3RC5A 2ZCLP 5F03A 4DJZB 4HGCA 4J2YB 4A1XA 2PWXA 2RA0A 4UEHH 1BBRH 1ACBE 1WTGH 1GBEA 1OP2A 1OWIA 2GZ9A 3PO1C 5FPYA 1EASA 2AEIH 1O2UA 2WYGA 1OWKA 1GMHG 3JZ1B 3AW1A 1O2JA 3K2UA 1AVXA 1C5LH 1V2VT 2ZQ1A 1SVPA 1KXEA 4DW2U 5AHGH 3RU4D 3SO3A 2VVVA 1CBWB 4Q7XA 1MD8A 1V2PT 2A45B 1QCPA 1TONA 1KLTA 2ZCHP 2BHGA 5GCHF 4FUEA 3BTTE 1DE7H 1NY22 4ASHA 3K9XB 1TBQH 2ZGHA 5FXLA 3UQVA 2ZKSA 3EYDA 5JYIA 1TAWA 3KQEA 2GT8A 2P95A 1P2OA 1ZSLA 1RIWC 2R0KA 3NK8A 3GOVB 2ZDLA 3DT0H 3LC3A 1O3HA 1MQ6A 1VCPA 4QT8C 3SNCA 3LH3A 1O5GH 3M5NA 2ZDKA 1D9IA 1A7SA 1C1QA 3P8NA 1HAVA 2VNTA 1XUJA 1K1PA 2FI5E 5CE1A 1W0ZU 3U8OH 1TFXA 1AHTH 3S0NA 2OUAA 1HAVB 5T6FA 2G55A 2WPMS 1P03A 3M5MA 1FUJA 3GY3A 5ESTE 1GHWH 9ESTA 1ZGVA 1RTKA 1T31A 3BV9B 1FAXA 2PKSB 1LKAA 1J14A 3BIVH 2BD8A 3TITA 4GUXA 4OGYA 1IQHA 5BPEA 1UVUH 2QXJA 3RLWH 1GBJA 1TALA 3RXVA 1F7ZA 3QN7A 1SQAA 1ANEA 3UNRA 4FUIA 4X1QU 1C4Y2 1BMNH 1DLEA 1ELDE 2G81E 5EU8A 3GY4A 2O9QA 3BIUH 1O3BA 1ESBA 1BTXA 3RU4E 1AGJA 3LGWA 3UR6A 6GCHF 5I25A 3SUGA 2UWPA 4OS6A 1BITA 3FFGA 3OX7U 1EP5A 1MU8B 2EI7A 4YZUA 1QRWA 1BMMH 1DFPA 2P3FH 3MI4A 3RXMA 2VJ1A 3WY8A 7ESTE 2A7CA 1L4DA 2XC4A 5DO4H 3I78A 2O8TA 1XXFA 4WXVA 1XUFA 1TNKA 2ZP0H 3TIUA 2JH6D 1MH0A 2H5DA 3BTFE 1M9UA 1E38B 1JIRA 1ZPBA 5DP5A 1WV7H 3ZZ5A 2ANKH 4U01A 3DHKH 4TPYA 5T3HA 1V2ST 2C3SA 4IMZA 1OS8A 1C4V2 1O2ZA 1GJBB 2HPQH 2H9HA 2XC5A 4DT7B 1BTWA 3V3MA 3TLOA 1S84A 2AGEX 4Z0KA 3O8RA 4BAMB 1F0UA 1YYY1 3EE0B 1AFQC 1RRKA 4FXGH 3ZZCA 4AN7A 5DP6A 1SR5C 4WMEA 2ZI2H 3SN8A 5C1YA 1W3CA 1PYTC 2ZFRH 1TOCB 3PWCA 4D7FA 1GHAF 1RD3B 2XCFA 4CBOA 1J16A 1AKSA 1QURH 4K8BA 3RXBA 1YCPK 3A8BA 1A1RA 1HNEE 2Q6FA 3MOCA 2RCEA 3P8OA 1ETRH 1AKSB 3BTQE 4BAQB 5L30H 3F68H 4CH8B 1UK2A 4ZH8A 4X1RU 4OGXA 1G2LA 2P16A 3A81A 4E06H 3KIDU 2FOCA 2ZHQH 1DITH 2BD9A 4K1SA 1PPGE 1DDJA 1GI6A 1K1OA 1V2JT 2C4FH 1ZOMA 1LHCH 3G01A 4Y8XA 6LPRA 1GMDF 4RSPA 5AVDA 2OTVA 1A46H 3A7XA 5E2PA 1E0FD 1DY9A 4CRFA 1G3BA 4BXWA 2Q6GA 1GGDB 4CRAA 1KXCA 3LIWA 5J4SA 4NZQA 1GWAA 1DM4B 1O3CA 4HZHA 3ZZ7A 3B8JA 1JXPA 2OBQA 1GCTC 3E90B 3QK1A 1NU9A 1O2XA 2ZTYA 2D26C 4AORA 4JZDH 1C5XB 2J9NA 1T8NA 1BTPA 2ZHDA 2PGBB 1LHDH 5GWZA 2ZGBH 2PSYA 5DGJA 5LH8A 1TX6A 3ATIA 3ZVDA 2ZTXA 5DPAA 1EB1H 3ZZ6A 5FX5A 3UOUA 4AG2A 1T4VH 2XC0A 1UHBA 3F6UH 3MNCA 4JK5A 4BNRA 4DY7B 1Q31A 1SGDE 1XM1A 4X0WU 1YKTA 1GI8B 1UHBB 1IQNA 1BUIA 5EW1H 1TRMA 2WINI 5EQSA 5DP7A 3MH7A 1CT0E 5EW2H 3F1SB 4K1EA 2BQWB 4ABJA 1Q3XA 3GDVA 1K28D 3VB6A 1SL3A 3A7VA 3S7HB 3C27B 1A5IA 1E35B 4VGCB 2SGEE 2ZU5A 1DWEH 3RXAA 1PQ5A 3RXRA 1O5CB 1OSSA 3F9FA 4D8NA 2ZU4A 2A2QH 1TNJA 1SGFA 1GI2A 1P57B 2XWAA 3MTYA 1UCYE 2GCHG 1Y3YA 1ZSJA 1EZSC 3P92A 2XNIA 4F4OC 1JBUH 2ZFFH 2Y7ZA 1AZZA 1HAZB 3TU7H 1DY8A 1FXYA 2UUJB 1TB6H 1J9CH 3DUXH 4ABFA 2J92A 2P59A 4JZIA 1GHVH 2F9PA 5C1UA 2UUKB 3NPSA 1A3BH 1NFUA 2YNAA 3MH6A 1BHXF 1E37B 5HM2A 4A1TA 2EI8A 2A31A 3SU4A 3GY2A 3VB3A 4TWYA 2SGAA 3HKJB 1THSH 1BRAA 4K60A 1SHHB 3S9AA 1P2NA 4AGKA 3DFLA 7GCHF 1LCYA 1BB0B 1O0DH 2CMYA 4XDEA 2BDIA 1Z6JH 4AFZA 4FU9A 3BF6H 1CBWC 1TNLA 3SBKA 1GJ8B 1GBAA 2VVUA 1EZUC 1GL0E 4AX9H 2UUFB 4LXBH 3SV2H 1UTKA 3NXPA 5T6GA 4I8GA 3A8CA 2J38A 4YT7H 1WSSH 1ZPZA 2AIQA 3L33A 2VIPA 1EAIA 2QXIA 4O97A 3UPEA 1ZYOA 1GCDA 3E16B 1ANBA 1WAYB 3SU0A 3RXSA 3LGVA 1ARBA 1O2IA 2VH0A 1EJMA 3T26A 5E0JA 1Y8TA 1UVOA 2DUCA 4X1NU 5JDUB 4OS2A 2Z9GA 1HRTH 5LPFA 2AFQB 1FJSA 1AWFH 1KXAA 1GG6C 2WYJA 1YPKH 5A0BA 4CRGA 2A4GA 5L2ZH 1THPB 4YO9A 3M35A 2WV4A 1NTPA 3BTKE 4JYVH 2XYAA 1WQSA 3MH4A 4YM9A 4YLQH 4XSKU 2I6SA 1W0YH 2PKSC 2XBXA 3VB5A 1EP6A 3EA7A 5C3NA 2BMGB 1BTYA 1QNJA 2ZU2A 2XRCA 3RXDA 1O3FA 2BLWA 4INLA 2AMDA 2THFB 2Y81A 3M61U 1W8BH 1S0RA 3PYHA 2R0LA 9LPRA 1NFYA 4A6LA 2TGTA 1TX7A 1C2MA 1V2MT 4X6OA 1NZQH 1C2FA 1O3MA 2AIPA 3E91A 5DJ7A 1GHZA 1ZMNA 2Y80A 4B2BA 1O34A 1H9IE 1O5FH 1VITH 1YCPH 3A7WA 3W94A 3VXEH 5HXFA 2Y5HA 1DANH 3ZZDA 5FHTA 2R3UA 1EPTC 1NS3A 1P3CA 1KXBA 1VGCB 2HGTH 1QBVH 1Y3WA 2ZFSA 1PPBH 4O3UA 3S9CA 3RMLH 2QCYA 1FY3A 4AB9A 1U6QA 4GVUA 1DLKB 1S6HA 1P9UA 1JRTA 2ZDMA 4NG9H 1MTUA 4Y7AA 1NPMA 3GY7A 1X7AC 1QB6A 2GP9B 3MU4A 5K7RA 3CS0A 1Z1IA 1T7CA 2A32A 3D62A 4FUBA 3OYPA 4BTIB 2OD3B 3M3TA 5A8ZA 1TGTA 1TQ7B 5ETXA 2D1JA 5BRRE 1TMUH 4UFFH 2G4TA 1AVGH 2XWBI 1GBFA 4FUHA 3MNXA 2F83A 1IQJA 4SGAE 1VZQH 2W3IA 3PLPA 4I31A 1H8IH 1Y3UA 4AOQA 1O2MA 4FUCA 2BLQA 4MNYA 1P2KA 1W7GH 4INHA 5TCCA 4MDSA 1ANCA 1V2KT 3RMMH 1IAUA 2BY6X 1V2QT 2QF0A 5ESBA 1OP8A 3LJOA 1UCYH 4KTUA 5PTPA 1A2CH 1BTUA 1GHXH 1A4WH 3PTBA 3TH2H 2R2WU 3A8AA 4YOGA 1HDTH 1V2LT 1GI7B 1MD7A 1Z8JB 3SGBE 1YPJH 1P11E 1ETSH 1PPCE 1GBIA 3MU5A 2BB4A 4XBBA 4A5TS 1LQDB 1HJ8A 3EDXB 2A7JA 3URCA 1AB9C 2H2ZA 5EPYA 4Y76A 5A0CA 1FN6A 3FVFB 6GCHG 2QC2A 3RXKA 1C1VH 1TWXB 2G51A 4NCYA 4OS4A 2LNCA 3SV7A 3R3GB 1EOLA 2GX4A 4B2AA 1SG8B 1YLCA 3CENA 2XBVA 4M7GA 2BDHA 2ZHWH 1PQ8A 1GGDC 3ZYDA 2A2XH 1HAHH 5JBBS 5FBEA 4IW4E 2GT7A 3BG8A 1C1SA 2W5EA 4IMQA 4JYUH 1BA8B 1AIXH 1AFEH 1Z8RA 1ZRKA 4FVDA 1W11U 3T2NA 2ODPA 1G3CA 4X2YA 3E0NB 3SHCH 4B73A 1A61H 4AG1A 1V3XA 2ZTZA 1TLDA 2Z6BD 1V2TT 1MKXK 3OSYA 2DE9A 3TGIE 5EXLA 1DS2E 1NRRH 2O8MA 1QB1A 5H4IB 2FYQA 4INKA 1A0LA 3BEIB 3S7KB 1YGCH 4PROA 3UNSA 1GBTA 1S85A 3FP7E 3BTEE 3U8TH 1XKAC 1AE5A 1MTNB 3RXHA 1BMAA 1KXDA 1H1BA 1O2QA 1TPPA 2BVRH 1GBCA 5DP3A 3SJIA 5K0HA 2AH4X 1FDPA 2G5VA 3SU3A 3PV4A 1EQ9A 2AS9A 1HBTH 2J2UA 3SU5A 1GHAG 1A5HA 1O2OA 1D6WA 1S83A 1F0TA 1D4PB 5C20A 3U1IB 4E05H 2WV5A 2FWWA 1MTSA 3RMNH 2HOBA 1TGNA 1DUEA 4WMFA 4VGCC 5CHAC 1EATA 1NM6A 1HCGA 1EKBB 2CHAB 3UNQA 4ISNA 5F6MA 2ODYB 1BOQA 5LPEA 4X6PA 1EZQA 3LU9B 3VPKA 2W7UA 3R0FA 3GCHB 4ABAA 1AUTC 1TQ0B 4Q7YA 4X2VA 1GMDG 4X8SH 3MNSA 3ATMA 1BJVA 3U69H 3A82A 3UR9A 4I32A 1AQ7A 1VCQA 4X2WA 1Z1JA 1EAXA 3EA8A 1H9HE 2BM2A 4MPXA 3Q76A 1S81A 3ZYEA 4MTBA 2Z9KA 4ESTE 1MQ5A 1AUJA 1SOZA 1UVSH 4UONA 1O3AA 4DIHH 1QQUA 1FY8E 2Z9LA 5IYTA 5C5OA 3RM2H 2ZPRA 1GG6B 3VEQB 1ESTA 3BG4B 1N1LA 1P01A 1F5KU 2ZFPH 1KXFA 3MFJA 2VGCB 2GKVE 1SB1H 1W10U 3T27A 1D3TB 2CV3A 1C5WB 1UTJA 4I8LA 1UVTH 4I8JA 1SGQE 3MHWU 4ZKNU 2A4OA 4X8TH 2PGQB 4BTUB 2RDLA 2VWOA 3LGYA 4X8VH 4Y71A 1PQAA 3SNEA 1BRCE 1O2SA 1GJCB 1EPTA 1C5RA 1O2NA 2D2DA 1SQOA 4K69A 1SOTA 2B5TB 4HI3A 2OXSA 1EPTB 4JMYA 3HPTB 3H5CB 1MBQA 4MQAA 2HNTC 1RGQA 1J8AA 5HM9A 2P8OB 3STJA 5A8YA 1C5SA 1AZ8A 1WCZA 2JH5D 1SGNE 2UWLA 1QL9A 5IDKA 4KGAA 2HWLB 1BCUH 2XBWA 2Z7FE 1ZMJA 4ZHLU 1QBNA 2BY7X 5EG4A 1EZXC 1D3QB 4K5ZA 1XUGA 4OS1A 3U9AH 3A86A 4YOIA 1GPZA 1WUNH 1C1MA 1SLVB 1MU6B 1LVMA 3UOPA 1INCA 2HPPH 2PKAA 2R9PA 3U1JB 3A7YA 3TH4H 3SW2B 1P09A 2G52A 4HFPB 2PKAB 1AVWA 1TA6A 2OC7A 1MMJN 3BTHE 2PUQH 1Y5BT 3SUEA 1Y3XA 3GDUA 3P95A 3UFAA 7GCHG 1GBKA 3K6YA 1CA8B 3TK5A 1UTOA 1FIZA 1P02A 1VGCC 4BAKB 2Y7XA 6CHAC 3VB4A 2FX6A 3TJOA 2BXTH 2OQ5A 5EPNA 2AMQA 2GTBA 2FIRH 3RXLA 1NT1A 1QFKH 3E3TA 1FQ3A 4XBCA 3QZQA 4B71A 2FOAA 1QGFA 3V12A 4MNVA 2OLGA 2WPLS 1QIXB 2ZU3A 5JBCS 1G32B 4ABBA 3TK9A 5FAHA 3BTGE 2FOHA 3U98H 3ZZ4A 3PMHB 4MG3A 1Z6EA 1T8MA 1J15A 3E0PB 3LC5A 3SZNA 1AB9B 1IQKA 1F5LA 1QHRB 2B8OH 3DFJA 3FP8E 3AW0A 3LONA 1S0QA 5EXNA 2SNVA 5DP8A 2WPHS 3KN2A 4NA8A 1MKWH 4IS5A 1ZMLA 1QB9A 1ZTKA 2ZCKP 2ZO3H 3VXFH 3AASA 2TGDA 3PMJA 3BTWE 1MKXH 2A5KA 2C8YB 2Y5FA 1TPAE 4U2WA 3CS7A 4CHAC 1LQEA 3M36A 1YPLH 1N6XA 3VFEA 3SNAA 3H7TA 1CT2E 2GD4B 3PLKA 1A0JA 1IQMA 4ZKSU 4DGJA 1XUHA 2A7HA 1HAIH 1Z8IB 1C5NH 3LGUA 4ZHAA 1E36B 1MUEB 1AWHB 4WF8A 1BMLA 4MPWA 1LPGB 4ZUHA 3HGPA 2OCVB 4E7NA 2CF8H 1D3DB 1ELBA 4H42U 2XXLA 1QL8A 2V35A 1KTSB 4ZKRU 1YPMH 1ID5H 3RXJA 1K1IA 1DX5M 3OTJE
chains in the Genus database with same CATH superfamily
1D3PB 1SGFG 3S9BA 5CMXH 3EA9A 1ESAA 3F2HA 4LK4A 4YLUA 3M5OA 2VWMA 1OWDA 1RJXB 1SGPE 2ODQA 2AERH 2FI4E 1LO6A 4NIWA 1O3IA 3GCTG 3RXGA 1EAUA 1Y59T 3T62A 2IPQX 4YOJA 3M7TA 3ZZ9A 1GVZA 5CHAB 2W26A 4ISOA 1FMGA 2VWNA 1HJAC 2FPZA 2ZEBA 4BANB 3RC4A 2TRMA 3BEFB 5C5NA 1D6RA 2GV7A 1C1NA 4I7YH 1EOJA 1SSXA 4ZXXH 4YXWD 3LGIA 2GCTC 1P04A 1C1UH 1YF4A 5EJLA 3A7ZA 2BD5A 2BXUH 5GJ4B 4WXIA 2HVYB 1LHEH 4JZEH 1NFXA 2VIVA 1O37A 1SLWB 1O2PA 4U32A 2J95A 5GXPA 4DVAU 2C8XB 1CA0B 1MTNC 5HYOA 1EXFA 3NKKA 2KFWA 4WH8A 1HAGE 2ALPA 3NRLA 1O2YA 1LPZB 2FOEA 1ZJDA 3D65E 5E8EH 2VINA 3A84A 4J1YA 1K22H 1P06A 4RKJB 3ITIA 1TRYA 3GS9A 3DSGA 1GI0A 1QJ7B 1KYNA 4ABGA 3K6ZA 1W0KD 3SZEA 4ZROA 2YNBA 3RU4T 2VWLA 2HLCA 3Q77A 1TMBH 3A7TA 2JDID 2R2MB 4B2CA 1L1NA 4Y7BA 1GDUA 2GZ8A 2CHAC 2ZNKH 1OX1A 4DIIH 4HTCH 5DG6A 2QF5A 2VIWA 5T6DA 1FV9A 2VBCA 3GCHC 3W95A 1YPHE 1SMFE 1BBRK 3GCOA 5FX6A 1HFDA 2BDBA 3SV9A 3E6PH 1K1JA 3IG6B 5C1XA 2IJD1 4FOUC 3ZZ8A 1ZJKA 3KCGH 4MPUA 2ANMH 3AAVA 1YPGH 3O8DA 2Z3EA 2VIOA 1V6DA 1OHHD 2Z94A 2BDGA 1QZ8A 4Q7ZA 3PMBB 3M7QA 3WWFA 2XOKD 3MU1A 1W13U 1T8OA 3KNXA 3KL6A 2GMTC 2GGVB 1C2JA 1FNIA 1CGIE 4NWLA 1SC8U 1NN6A 3BG4C 3SGQE 2G5NA 1EX3A 2BLVA 2ASUB 2QA9E 2VGCC 1PJPA 2VVCA 4NSVA 4AGJA 2WPKS 3RLYH 1CSOE 1O2RA 4ISIH 1T4UH 1O3KA 2B7DH 1LVOA 2TGAA 2BX3A 3ZVFA 1EFRD 5DK1A 5A0AE 1TNHA 2OP9A 1V2OT 2FS8A 1ABJH 2FTMA 3MO3A 4Y10E 2FOGA 3ATWA 3V0XA 1O5DH 5FPTA 4TYDA 2JKHA 3LPRA 2JH0D 1C5VA 1K21H 2F9OA 3B23B 2O8LA 1GMCF 1W12U 4IN1A 1ELEE 1NRSH 2VU8E 4FUJA 1GJ7B 1WU1A 3F9EA 4CH2B 3ATLA 3STIA 1P2QA 4HG6A 2G4UA 5E0HA 1K1NA 1HYLA 1ANDA 1OP0A 6CHAB 1LHGH 1DVAH 1GVLA 2YMSC 1HXFH 1SBWA 3TGKE 4Z1MD 4RT1A 3GCTF 2P8OC 2QN5T 3LH1A 3HKIB 5EODA 1OYTH 4IC6A 3ZVGA 1JWTA 2ZWLH 3PROA 4BAOB 5AF9H 1O5EH 1G3DA 4OS7A 1CHOF 4XD7D 1GVKB 1P0SH 3FANA 1KIGH 5HGGA 2HLDD 1GJ9B 2BDYA 1CHGA 3Q3YA 2NU0E 4NA9H 5DN6D 1O36A 1QR3E 2QGRA 1NO9H 3GDSA 4FUGA 4UFDH 1C1PA 1UTNA 1S5SA 1BIOA 1G3EA 2ZHFH 2ZC9H 1O3EA 2QXGA 1LHFH 4O9VA 3TNSA 2Y5GA 2FZZA 3PLBA 2FODA 3IWMA 2FS9A 5E0GA 4CHAB 3NUMA 4TY7A 3KQ5A 3RXEA 1BRBE 2WPDD 3RXUA 1S6LA 2GVFA 1DWCH 1NFWA 4FETA 2BZAA 1NU7B 3MMGA 2EA3A 5EQRA 1VJAU 4NIYA 2A4RA 4RI0A 1TGCA 2GV6A 2W7SA 1C1WH 3TGJE 2BX4A 1NRPH 2B9LA 2HNTF 5TCAA 3AVZA 4LOYH 3T28A 1ZRBA 4D9RA 3SUFA 1ELVA 2BY8X 4X8UH 2FYRA 1O2LA 3MYWA 1DWDH 4GAWA 2BYAX 1L1GA 5L2YH 3SGAE 4Y0ZE 1C1TA 2ZZUH 2ZPSA 1GL1A 3U8RH 3OTPA 3KEEA 4Y0YE 4X6MA 1RFNA 1FY4A 2FLRH 1TNGA 1TOMH 3SI3H 2ZG0H 1V2UT 2OC1A 3RXOA 1VCWA 3C1KA 4Y8ZA 1GI1A 3SNDA 3FAOA 3TPIZ 2VIDA 2WUBA 2FXRA 5FCKA 3ATKA 5EIYA 4Z6AH 3CP7A 4ZHMU 1HJAB 1BQYA 2V7QD 3M7UA 4K1TA 1PYTD 2Y6TA 3D49H 4B1TA 1GBLA 1H4WA 3H09A 2LP6A 2GCTB 1ELFA 1GDQA 1GI4A 1C5QA 3URDA 1GDNA 1P05A 1JOUB 2BTCE 1AO5A 3HATH 2GDEH 2C8WB 5F8ZA 3GISB 4K8YA 2PSXA 3LDXH 3SJ8A 1O2TA 1SFQB 2M5TA 2BY9X 1O31A 2WPIS 2R3YA 5G4BA 1UK3A 2BOHB 1MZAA 4ZAEA 2TIOA 1HJ9A 2P93A 3QO6A 4H6SB 4AZ2B 2WZQA 2O8WA 3A80A 3M3VA 2BLOA 2QE7D 3A85A 3SHAH 2W3KA 4I8KA 3SQHE 2QAAA 4DOQA 1O3NA 2UWOA 3KQBA 1WQVH 3NWUA 1O3LA 4MLFB 3RDZA 2AMPA 1MCTA 2KCYA 4U30A 4GCHF 3SNBA 4BOHA 1QBOA 3OAAD 2ZDVH 2F9VA 1XMNB 2PTCE 3RXCA 5F8TA 5FPSA 1YCPM 1LPKB 3OY5U 1EAWA 1SGRE 1DWBH 3QX5H 4WMDA 2L6OA 2ZIQH 4CBNA 4ISLA 3AAUA 4GHTA 1SGTA 1W2KH 3V13A 1TABE 3Q3XA 1O3DA 1NRNH 1ELCA 4AFQA 3TJUA 1UTPA 3H7OA 5IK2D 5LPRA 1BTZA 2Z9JA 1C2LA 1C9TA 1HIAA 3RXFA 1ETTH 2SGDE 1UTMA 3MWIU 2ZFQH 2PUXB 1AI8H 2LPRA 4MPVA 2QY0B 1C1RA 1DSUA 1HIAB 1QRZA 2ZPQA 1C9PA 1KY9A 3F0PA 2IN2A 4GLYA 1SLUB 1FX0B 1XX9A 8LPRA 4CRDA 3A88A 3D23A 2Q1JA 5GIBA 1J17T 1CA0C 1C2EA 3UREA 1ZZZA 3JZ2B 2CGAA 1ZTJA 1SGEE 3BN9A 4FU8A 2EQNA 2GMTB 2F3CE 2BD4A 2QXHA 1YC0A 3NZIA 4CR9A 1GI5A 4ABIA 3HK6B 2CXVA 1NESE 4O3TA 8GCHF 3SV8A 3UQOA 4NFFA 4TWWA 1SLXB 1GJAB 3DD2H 4JZ1A 2SGFE 4B76A 4F48B 4NZLA 1GBDA 2OINA 1FZZA 3T29A 1C5MD 4BXSA 3K65B 1SGIB 2FDAA 1CO7E 2YOLA 7LPRA 2P3TB 1TIOA 1G2MA 2HVXA 4XFQA 4CRBA 3E8LA 3QDZB 3QWCH 3CNRA 1IOEA 4FU7A 2TGPZ 2J4IA 1H8DH 3EQ0H 4XBDA 1QL7A 4GHQA 4X1PU 3QTVH 1TE0A 3UTUH 2H6MA 3E1XB 4LZ1H 1G30B 1O2WA 1Z7KA 4AFUA 3ZVBA 2Z9IA 3BSQA 1A0HB 3SJ9A 4AYVB 1P8VC 3GICB 1N6YA 2ZHEH 1O2HA 3GYLB 2SGPE 3WW7A 2SNWA 1B0FA 3ODDA 3MH5A 4NSYA 1LVBA 1FPCH 1DUAA 3QGJA 2Z3DA 2XBYA 3SI4H 4THNH 2H5CA 3VB7A 3RM0H 3A89A 4KELA 2AHME 2CJIA 1QRXA 1EJAA 3M3SA 1KDQA 1MBMA 5HMAA 1ZLRA 4Q2KA 1C2GA 1TGBA 1ZSKA 2PR3A 3P8FA 2QV1A 1S6FA 1MAXA 2IOTA 1FONA 3OY6U 1OYQA 1HUTH 1KDQB 2A4QA 1XXDA 5JPMH 2TBSA 4MVNA 2SGQE 1RS0A 1QQ4A 3KF2A 4WH6A 1L2EA 2CF9H 3ZV9A 1LDTT 1CGHA 1O35A 4WVPE 1KTTB 3P70B 1YM0A 2NU2E 1YY3A 4KKDA 1NRQH 2WUCA 2BZ6H 4UD9H 2HALA 1Z71A 5JBTA 3SV6A 1MTWA 3MU8A 1TGSZ 3ZZ3A 1ZPCA 1VITF 5AFYH 1HAXB 1C5TA 3OEED 4MNXA 2Q6DA 3GYMA 2JJ1D 1KSNA 1N8OB 2C93B 3DSPA 3P8GA 1EJNA 3VGCB 2ZGXH 1GJ5H 1KLIH 1PPFE 5KEDA 4IN2A 1DPOA 2F9BH 8ESTE 2EC9H 3SJKA 1UVPA 1GI3A 3A8DA 2C90B 1K1MA 1RTFB 4RN6A 4A7IB 1ABIH 1IQLA 3GY5A 3I29A 2ZU1A 4BTTB 3MQKC 3KGPA 4UFGH 2ILNA 1GMHF 1RXPA 2BQ6B 4JK6A 5E2OA 2IPHA 1ARCA 2J94A 1GJ6A 3MU0A 1H8HD 1F0SA 1O5BB 4Q80A 2ZDNA 1IQEA 5A2MH 3FZDA 4NA7A 4FUDA 1BHXB 1C2IA 4NFEA 4IBLH 3UIRA 4BAHB 1HAYB 1O30A 3OE7D 2FM2A 2G00A 3SOSA 1Q2WA 2O8UA 1C5YB 3SQEE 4Y8YA 5A8XA 1XKBC 1JIMA 4AYYB 2D8WA 1UK4A 4DT4A 3I77A 2BVSH 1UTQA 3PWBA 5HIYA 3PMAB 2J97A 1TPOA 1C2HA 1SPJA 2FOFA 4O03A 3ZV8A 7KMEH 4RKOB 3ZVAA 1HLTH 3M37A 1LKBA 1SI5H 3PTNA 1BRUP 2ZDAH 2BY5X 2AYWA 1JRSA 5JB9S 1HPGA 4LZ4B 1P2IA 1W7XH 5CDFE 1OPHB 3P17H 2Z3CA 3ZZAA 1C4U2 2JETB 2ANWA 3MO9A 4XE4A 3RUOA 2G8TA 3DA9B 5HIZA 1YBWA 1GMCG 2QF3A 3L6PA 1Z8GA 2FOBA 3FP6E 1AMHA 3SU6A 2B0FA 1QTFA 1O39A 1QY6A 1OWJA 1SQRA 1GJDB 2ZF0H 1K2I1 2BOKA 3LT3A 2J34A 2EEKA 4D76A 1C2KA 2K1QA 2FEQH 4OS5A 1A5GH 1P9SA 1FAKH 2ANYA 4ABDA 3O8CA 4DCDA 5F8XA 1SKYE 1GHBG 1L0ZA 1LVYA 1WTHD 4XOJA 3RMOH 1UCYK 4NIXA 1PPHE 3ODFA 1HV7A 1XVOA 3F9GA 4X6NA 1O2KA 1A3EH 3PO1B 4B75A 1CHOG 4FUFA 2NU4E 2BDAA 4FVBA 5GDSH 4UFEH 1GI9B 4ISHH 4CREA 5EXMA 1ELTA 1XUKA 1O38A 1O2GH 1P2JA 2QIQA 3RP2A 4A1VA 4WWYA 1O3OA 3RC6A 1ORFA 1W0JD 5A09A 1C1OA 1W14U 2P94A 2F9UA 4ZKOU 4M9FA 3UB0A 1UJ1A 2GZ7A 3T5FH 1L1JA 2AGGX 3TJVA 4B74A 1TMTH 2STAE 1ZHPA 1OKXA 2NWNA 2K0QA 5EGMA 1CU1A 1SGCA 2BQ7B 1OWEA 1E1RD 1RIWB 4UE7H 1TRNA 1AU8A 1ZHMA 1PFXC 1IQIA 3EAJA 3V7TA 2RA3A 1CGJE 2A1DB 2KR7A 1BTHH 3QZRA 1CE5A 4K2YA 4ABEA 4IC5A 1BDAA 1K1LA 4UDWH 2EI6A 3Q00A 2H9TH 2OC0A 4NIVA 4R8TB 2DE8A 1O3GA 1AN1E 3LOXA 1TA2A 1P3EA 5I46H 2HRVA 2ULLA 2BVXH 1IHTH 3PB1E 1DT2A 5EQQA 2OC8A 1SHYA 3GY6A 2V6NA 2V3OH 3GCNA 2NU3E 5B6LA 5GPIB 2GDDA 2VIQA 3N7OA 1VR1H 4DURA 4IGDA 1TNIA 1T32A 2ZGJA 3FZZA 1K9OE 1FI8A 1PPZA 1OXGA 1XVMA 1V2RT 4D9QA 1UTLM 1ELGA 2RG3A 2I6QA 1O3JA 1WOFA 1HAPH 3BTDE 2F9NA 4AB8A 2FLBH 1SGYE 2H9EH 3MNBA 5FCRA 5B6OA 3RXQA 5SGAE 4R0IA 1DICA 2F4LA 1HB0B 1GBHA 1S82A 3ELAH 1BMFD 3SU1A 1UO6A 1WYKA 4F49A 4ZMAH 3AK5A 1GJ4H 1V2WT 2K8IA 1IQFA 1BBRE 2PV9B 1FIWA 4E7RG 2XCNA 1BT7A 2TPIZ 3TVJB 1ZTLA 2A5IA 5AFZH 3UAIC 3UWIA 1C5PA 1O32A 2ZFTA 2BD2A 3BTME 4MNWA 5C17A 2QYIA 1MAYA 4TSFD 3F2FA 1E1QD 2FTLE 4NGAH 1RTLA 1MCVA 1ZHRA 3TJNA 3LKWA 2A0QB 5EOKA 1B0EA 2STBE 4CR5A 4GCHG 1B7XB 4X1SU 2FESH 4KTSA 3F3BA 1PQ7A 3RXIA 4AFSA 4WJG2 4ZXYH 1YPEH 3BEUA 3FOAA 3A87A 3KYFA 3MO6A 5C94A 1YLNA 2OQUA 2PTNA 1PPEE 2XW9A 1VKYA 1IHSH 4KP0A 5DKMA 1C5OH 3M5LA 1TBZH 2FX4A 2VH6A 1IQGA 4SGBE 1ELAA 2PHBA 1TYNA 1CVWH 1GHBF 4ABHA 4I8HA 1LMWB 2FMJA 2NU1E 2VB0A 1BZXE 1O3PB 1EUFA 3LGTA 4CRCA 3Q3KA 1AFQB 1KLJH 5DP9A 3F9HA 1LTOA 1B5GH 2Y82A 3RXPA 5C67A 1C2DA 4JCNA 1AY6H 1CQQA 1EB2A 2AGIX 5JB8S 3HK3B 1TX8A 3GY8A 3SU2A 2M2AA 3L3TA 4Y6DA 3UUZA 3SORA 1TPSA 3ZVCA 3KQDA 4Y11E 3LJJA 2V0BA 5GCHG 1AD8H 1YLDA 4WY3A 3TNTA 5TJXA 1HXEH 2XTTB 4GSOA 4YT6H 1DXWA 1FPHH 1VJ9U 2OBOA 1GHYH 3KHVA 5DP4A 5C2ZA 1C5ZB 1FY1A 1Y5AT 1SFIA 1DOJA 2FP7B 2V3HH 1FY5A 4X2XA 4I33A 8GCHG 4Y79A 2J98A 1C5UA 1ZR0A 1F5RA 3SJOA 1UMAH 1FN8A 1QJ6B 3QLPH 2BD7A 1NROH 2GCHF 2J98B 1HGTH 1P10A 4GPGA 2WPJS 1N8OC 1F92A 2H1UA 5J4QA 3VGCC 3F0OA 1YPHC 1WBGB 2ZQ2A 4DG4A 3UY9A 2FI3E 1O2VA 1QJ1B 3OU0A 1XUIA 4YESB 2CN0H 3B9FH 2BDCA 4A92A 1O33A 2P3UB 3QUMP 2FO9A 1T8LA 1WDIA 1GCTB 1G9IE 5F53A 2PFEA 6ESTA 3T25A 1THRH 2IJOB 4YTAA 1H9LB 1QA7A 3UWJH 3O8BA 2KCOA 1F2SE 3P6ZB 3QGNB 1NC6A 2ZA5A 1GBBA 1BJUA 2WV9A 4TY6A 1MZDA 3FKSD 5ABWA 3ZZBA 1F0RA 5JBAS 3IITA 1ZGIA 4D7GA 5L6NH 2PLXA 1SQTA 1E34B 2W6JD 1OOKB 1JMOH 2ZGCA 3KQCA 2UUYA 1GBMA 2A5AA 3RXTA 1FLEE 2KAIA 3PM3A 4H6TA 3SUDA 1Y3VA 8KME2 3S69A 1HAOH 3PRDA 2ESTE 1YP9A 1AE8H 4K3JA 1CT4E 2KAIB 4TPIZ 3EGKH 1P2MA 3HGNA 1OWHA 1L4ZA 1P12E 1Y5UT 1MTVA 2SFAA 2C8ZB 1TBRH 3ZVEA 2BD3A 2FOMB 2ZECA 5T1VA 1QA0A 2ALVA 5FBIA 2F91A 2JETC 3A83A 1O5AB 2PW8H 2KZ4A 1MKWK 1G37A 1G36A 3ENSB 4JYTA 4H4FA 4JZFH 3TH3H 4NWKA 3NCLA 1DSTA 1DXPA 3ESTA 1VITG 1V2NT 4KTCA 5LGOA 2HNTE 3TK6A 3QTOH 3N7DA 3RC5A 2ZCLP 5F03A 4DJZB 4HGCA 2RDEA 4J2YB 4A1XA 3PV5A 2PWXA 2RA0A 4UEHH 1BBRH 1ACBE 1WTGH 1GBEA 1OP2A 2GZ9A 1OWIA 3PO1C 5FPYA 1EASA 2AEIH 1O2UA 2WYGA 1OWKA 1GMHG 3JZ1B 3AW1A 1O2JA 3K2UA 3OFND 1AVXA 1C5LH 1V2VT 2ZQ1A 1SVPA 1KXEA 4DW2U 5AHGH 3RU4D 3SO3A 2VVVA 1CBWB 4Q7XA 3KYGA 1MD8A 1V2PT 2A45B 1QCPA 1TONA 1KLTA 2ZCHP 2BHGA 4ACBA 5GCHF 4FUEA 1KMHB 3BTTE 1DE7H 1NY22 4ASHA 3K9XB 1TBQH 2ZGHA 5FXLA 3UQVA 2ZKSA 3EYDA 4I86A 1TAWA 5JYIA 3KQEA 2GT8A 2P95A 1P2OA 1ZSLA 1RIWC 2R0KA 3NK8A 3GOVB 2ZDLA 3DT0H 3LC3A 1O3HA 1MQ6A 1VCPA 4QT8C 3SNCA 3OEHD 3LH3A 1O5GH 3M5NA 2ZDKA 1D9IA 1A7SA 1C1QA 3P8NA 1HAVA 2VNTA 1XUJA 1K1PA 3U28C 2FI5E 5CE1A 1W0ZU 3U8OH 1TFXA 1AHTH 3S0NA 2OUAA 1HAVB 5T6FA 2G55A 2WPMS 1P03A 3M5MA 1FUJA 1NBMD 3VG8A 3GY3A 5ESTE 1GHWH 9ESTA 1ZGVA 1RTKA 1T31A 4Q63A 3BV9B 1FAXA 2PKSB 1LKAA 1J14A 3BIVH 2BD8A 3TITA 4GUXA 4OGYA 1IQHA 5BPEA 1UVUH 2QXJA 3RLWH 1GBJA 1TALA 3RXVA 1F7ZA 2W6ID 3QN7A 1SQAA 1ANEA 3UNRA 4FUIA 4X1QU 1C4Y2 1BMNH 1DLEA 1ELDE 2G81E 5EU8A 3GY4A 2O9QA 3BIUH 1O3BA 1ESBA 1BTXA 3RU4E 1AGJA 3LGWA 3UR6A 2F43B 6GCHF 5I25A 3SUGA 2UWPA 4OS6A 1UW7A 1BITA 3FFGA 3OX7U 1EP5A 1MU8B 2EI7A 4YZUA 1QRWA 1BMMH 1DFPA 2P3FH 3MI4A 3RXMA 2VJ1A 3WY8A 7ESTE 2A7CA 1L4DA 2XC4A 2KCAA 5DO4H 3I78A 2O8TA 1XXFA 4WXVA 1XUFA 1TNKA 2ZP0H 3TIUA 2JH6D 1MH0A 2H5DA 3BTFE 1M9UA 1E38B 1JIRA 1ZPBA 5DP5A 1WV7H 3ZZ5A 2ANKH 4U01A 3DHKH 4TPYA 5T3HA 1V2ST 2C3SA 4IMZA 1OS8A 1C4V2 2JJ2D 1O2ZA 4ACAA 1GJBB 2HPQH 2H9HA 2XC5A 4DT7B 1BTWA 3V3MA 3TLOA 1S84A 2WSSD 2AGEX 4Z0KA 3O8RA 4BAMB 1F0UA 1YYY1 3EE0B 1AFQC 1RRKA 4FXGH 3ZZCA 4AN7A 5DP6A 1SR5C 4WMEA 2ZI2H 3SN8A 2JIZD 5C1YA 1W3CA 1PYTC 3FO8D 2ZFRH 1TOCB 3PWCA 4D7FA 1GHAF 1RD3B 3DCLA 2XCFA 4CBOA 1J16A 1AKSA 1QURH 4K8BA 3RXBA 1YCPK 3A8BA 1K0HA 1A1RA 2LELA 1HNEE 2Q6FA 3MOCA 2RCEA 3P8OA 1ETRH 1AKSB 3BTQE 4BAQB 5L30H 3FN8A 3F68H 4CH8B 1UK2A 4ZH8A 4X1RU 4OGXA 1G2LA 2OK5A 2P16A 3A81A 4E06H 3KIDU 2FOCA 5HKKD 2ZHQH 1DITH 2BD9A 4K1SA 1PPGE 1DDJA 1GI6A 1K1OA 1V2JT 2C4FH 1ZOMA 1LHCH 3G01A 4Y8XA 6LPRA 1GMDF 4RSPA 5AVDA 2OTVA 1A46H 3A7XA 5E2PA 1E0FD 1DY9A 4CRFA 1G3BA 4BXWA 2Q6GA 1GGDB 2GJGA 2YMSD 4CRAA 1KXCA 3LIWA 5J4SA 4NZQA 1GWAA 1DM4B 1O3CA 4HZHA 3ZZ7A 3B8JA 1JXPA 2OBQA 1GCTC 3E90B 3QK1A 1NU9A 1O2XA 2ZTYA 2D26C 4AORA 4JZDH 1C5XB 2J9NA 1T8NA 1BTPA 2ZHDA 2PGBB 1LHDH 5GWZA 2ZGBH 2PSYA 5DGJA 5LH8A 1TX6A 3ATIA 3ZVDA 2ZTXA 5DPAA 1EB1H 2L74A 3ZZ6A 5FX5A 3UOUA 4AG2A 1T4VH 2XC0A 1UHBA 3F6UH 3EE7A 3MNCA 4JK5A 4BNRA 4DY7B 1Q31A 1SGDE 1XM1A 4X0WU 1YKTA 1GI8B 1UHBB 1IQNA 1BUIA 5EW1H 1TRMA 2WINI 5EQSA 5DP7A 3MH7A 1CT0E 5EW2H 3F1SB 4K1EA 2BQWB 4ABJA 1Q3XA 3GDVA 1K28D 3VB6A 1SL3A 3A7VA 3S7HB 3C27B 1A5IA 1E35B 4VGCB 2SGEE 2ZU5A 1DWEH 4P00A 2QF4A 3RXAA 1PQ5A 3RXRA 5EJ1A 1O5CB 1OSSA 3F9FA 4D8NA 2ZU4A 2A2QH 1TNJA 1SGFA 1GI2A 1P57B 2XWAA 3MTYA 4P02A 1UCYE 2XNDD 2GCHG 1Y3YA 1ZSJA 1EZSC 3N99A 3P92A 2XNIA 4F4OC 1JBUH 2ZFFH 2Y7ZA 1AZZA 1HAZB 3TU7H 1DY8A 1FXYA 2UUJB 1TB6H 1J9CH 3DUXH 4ABFA 2J92A 2CK3D 2P59A 4JZIA 1GHVH 2F9PA 5C1UA 2UUKB 3NPSA 1A3BH 1NFUA 4XRNA 3ZIAD 2YNAA 3MH6A 1BHXF 1E37B 5HM2A 4A1TA 2EI8A 2A31A 3SU4A 3GY2A 3VB3A 4TWYA 2SGAA 3HKJB 1THSH 1BRAA 4K60A 1SHHB 3S9AA 2V3MA 1P2NA 4AGKA 3DFLA 7GCHF 1LCYA 1BB0B 1O0DH 2CMYA 4XDEA 2BDIA 1Z6JH 4AFZA 4AC9A 3DSOA 4FU9A 3BF6H 1CBWC 1TNLA 3SBKA 1GJ8B 1GBAA 2VVUA 1EZUC 1GL0E 4AX9H 2UUFB 4LXBH 3SV2H 1UTKA 3NXPA 4F55A 5T6GA 4I8GA 3A8CA 2J38A 4YT7H 1WSSH 1ZPZA 2AIQA 2WHXA 3L33A 2VIPA 1EAIA 2QXIA 4O97A 3UPEA 1ZYOA 1GCDA 3E16B 1ANBA 1WAYB 3SU0A 3RXSA 3LGVA 1ARBA 1O2IA 2VH0A 1EJMA 3T26A 5E0JA 1Y8TA 1UVOA 2DUCA 4X1NU 4ASUD 5JDUB 4OS2A 2Z9GA 1HRTH 5LPFA 2AFQB 1FJSA 1AWFH 1KXAA 1GG6C 2WYJA 1YPKH 5A0BA 4CRGA 2A4GA 5L2ZH 3SYJA 1THPB 4YO9A 3M35A 2WV4A 1NTPA 3BTKE 4JYVH 2XYAA 1WQSA 3MH4A 4YM9A 4YLQH 4XSKU 2I6SA 1W0YH 2PKSC 2XBXA 3VB5A 1EP6A 3EA7A 5C3NA 2BMGB 1BTYA 1QNJA 2ZU2A 2XRCA 3RXDA 1O3FA 2BLWA 4INLA 2AMDA 2THFB 2Y81A 3M61U 1W8BH 1S0RA 3PYHA 2R0LA 9LPRA 1NFYA 4A6LA 2TGTA 1TX7A 4B6EA 1C2MA 1V2MT 4X6OA 1NZQH 1C2FA 1H8ED 1O3MA 2AIPA 3E91A 5DJ7A 1GHZA 1ZMNA 2Y80A 4B2BA 1O34A 1H9IE 1O5FH 1VITH 1YCPH 3A7WA 3W94A 3VXEH 5HXFA 2Y5HA 1DANH 3ZZDA 5FHTA 2R3UA 2RFKC 1EPTC 1NS3A 1P3CA 1KXBA 1VGCB 2HGTH 1QBVH 1Y3WA 2ZFSA 1PPBH 4O3UA 3S9CA 3RMLH 2QCYA 1FY3A 4AB9A 1U6QA 4GVUA 1DLKB 1S6HA 1P9UA 1JRTA 2ZDMA 4NG9H 1MTUA 4Y7AA 1NPMA 3GY7A 1X7AC 1QB6A 2GP9B 3MU4A 5K7RA 3CS0A 1Z1IA 1T7CA 2A32A 3D62A 1WXRA 4ZCNA 4FUBA 3OYPA 4BTIB 2OD3B 3M3TA 5A8ZA 1TGTA 5KECA 1TQ7B 5ETXA 2D1JA 5BRRE 1TMUH 4UFFH 2G4TA 1AVGH 2XWBI 1GBFA 4FUHA 3MNXA 2F83A 1IQJA 4SGAE 1VZQH 2W3IA 3PLPA 4I31A 1H8IH 1Y3UA 2KX4A 4AOQA 1O2MA 4FUCA 2BLQA 4MNYA 1P2KA 1W7GH 4INHA 5TCCA 4MDSA 1ANCA 1V2KT 3RMMH 1IAUA 2BY6X 1V2QT 2QF0A 5ESBA 1OP8A 3LJOA 1UCYH 4KTUA 5PTPA 1A2CH 1BTUA 1GHXH 1A4WH 3PTBA 3TH2H 2R2WU 3A8AA 4YOGA 1HDTH 1V2LT 1GI7B 1MD7A 1Z8JB 3SGBE 1YPJH 1P11E 1ETSH 1PPCE 1GBIA 3MU5A 2BB4A 4XBBA 4A5TS 5FL7D 1LQDB 1HJ8A 3EDXB 2A7JA 3URCA 1AB9C 2H2ZA 5EPYA 4Y76A 5A0CA 1FN6A 3FVFB 6GCHG 2QC2A 3RXKA 1C1VH 1TWXB 2G51A 4NCYA 4OS4A 2LNCA 3SV7A 3R3GB 1EOLA 2GX4A 4B2AA 1SG8B 1YLCA 3CENA 2XBVA 4M7GA 2BDHA 2ZHWH 1PQ8A 1GGDC 3ZYDA 2A2XH 1HAHH 5JBBS 5FBEA 4IW4E 2GT7A 3BG8A 1C1SA 2W5EA 1MABB 4IMQA 4JYUH 1BA8B 1AIXH 1AFEH 1Z8RA 1ZRKA 4FVDA 1W11U 3T2NA 2ODPA 1G3CA 4X2YA 3E0NB 3SHCH 4RT0A 4B73A 1A61H 4AG1A 1V3XA 2ZTZA 5C0TA 1TLDA 2Z6BD 1V2TT 1MKXK 3OSYA 2DE9A 3TGIE 4Q4LA 5EXLA 1DS2E 1NRRH 2O8MA 1QB1A 5H4IB 2FYQA 3N7EA 1A0LA 3BEIB 4INKA 1YGCH 4PROA 3S7KB 3UNSA 1GBTA 1S85A 3FP7E 3BTEE 3U8TH 1XKAC 1AE5A 1MTNB 2KCPA 3RXHA 1BMAA 1KXDA 1H1BA 1O2QA 1TPPA 2BVRH 1GBCA 5DP3A 3SJIA 5K0HA 2AH4X 1FDPA 2G5VA 3SU3A 3PV4A 1EQ9A 2AS9A 1HBTH 2J2UA 3SU5A 1GHAG 1A5HA 1O2OA 1D6WA 4B6FA 1S83A 1F0TA 1D4PB 5C20A 3U1IB 4E05H 2WV5A 2FWWA 1MTSA 3RMNH 2HOBA 1TGNA 1DUEA 4WMFA 4VGCC 5CHAC 1EATA 1NM6A 1HCGA 1EKBB 2CHAB 3UNQA 4ISNA 5F6MA 2ODYB 1BOQA 5LPEA 4X6PA 1EZQA 3LU9B 3VPKA 2W7UA 3R0FA 3GCHB 4ABAA 1YWUA 1AUTC 1TQ0B 4Q7YA 4X2VA 1GMDG 4X8SH 3MNSA 3F2GA 3ATMA 4OM9A 1BJVA 3U69H 3A82A 3UR9A 4I32A 1AQ7A 1VCQA 4X2WA 1Z1JA 1EAXA 3EA8A 1H9HE 2BM2A 4MPXA 3Q76A 1S81A 3ZYEA 4MTBA 2Z9KA 4ESTE 1MQ5A 1AUJA 1SOZA 1UVSH 4UONA 1O3AA 4DIHH 1QQUA 1FY8E 2Z9LA 5IYTA 5C5OA 3RM2H 2ZPRA 1GG6B 3VEQB 1ESTA 3BG4B 1N1LA 1P01A 1F5KU 2ZFPH 1KXFA 3MFJA 2VGCB 2GKVE 1SB1H 1W10U 3T27A 1D3TB 2CV3A 1C5WB 1UTJA 4I8LA 1UVTH 4I8JA 1SGQE 3MHWU 4ZKNU 2A4OA 4X8TH 2PGQB 4BTUB 2RDLA 2VWOA 3LGYA 4X8VH 4Y71A 1PQAA 3SNEA 1BRCE 1O2SA 1GJCB 5C0UA 3W1EA 1EPTA 1C5RA 1O2NA 3PV2A 2D2DA 1SQOA 4K69A 1SOTA 2B5TB 4HI3A 2OXSA 1EPTB 4JMYA 1COWD 3HPTB 3H5CB 1MBQA 4MQAA 2HNTC 2YMSB 1RGQA 1J8AA 5HM9A 2P8OB 3STJA 5A8YA 1C5SA 1AZ8A 1WCZA 2JH5D 1SGNE 2UWLA 1QL9A 5IDKA 4KGAA 2HWLB 1BCUH 2XBWA 2Z7FE 1ZMJA 4ZHLU 1QBNA 2BY7X 5EG4A 1EZXC 1D3QB 4K5ZA 1XUGA 4OS1A 3U9AH 3A86A 4YOIA 5GNDA 1GPZA 1WUNH 1C1MA 1SLVB 1MU6B 1LVMA 3UOPA 1INCA 2HPPH 2PKAA 2R9PA 1NBME 3U1JB 3A7YA 3TH4H 3SW2B 1P09A 2G52A 4HFPB 2PKAB 1AVWA 1TA6A 2OC7A 1MMJN 3BTHE 2PUQH 1Y5BT 2EY4C 1Y3XA 3GDUA 3P95A 3SUEA 3UFAA 7GCHG 1GBKA 3PRBA 3K6YA 5CHBA 3WWBA 1CA8B 3TK5A 1UTOA 1FIZA 1P02A 1VGCC 4BAKB 2Y7XA 6CHAC 3VB4A 2FX6A 3TJOA 2PP6A 2BXTH 2OQ5A 5EPNA 2AMQA 2GTBA 2FIRH 3RXLA 1NT1A 1QFKH 3E3TA 2KM0A 1FQ3A 4XBCA 3QZQA 4B71A 2FOAA 1QGFA 3V12A 4MNVA 2OLGA 2WPLS 1QIXB 2ZU3A 5JBCS 1G32B 4ABBA 3TK9A 5FAHA 3BTGE 2FOHA 3U98H 3ZZ4A 3PMHB 4MG3A 1Z6EA 1T8MA 1J15A 3E0PB 3LC5A 3SZNA 1AB9B 1IQKA 1F5LA 1QHRB 2B8OH 3DFJA 3FP8E 3AW0A 3LONA 1S0QA 5EXNA 2SNVA 5DP8A 2WPHS 3KN2A 4NA8A 1MKWH 4IS5A 1ZMLA 1QB9A 1ZTKA 2ZCKP 1E79D 2ZO3H 3VXFH 3AASA 2TGDA 3PMJA 3BTWE 1MKXH 2A5KA 2C8YB 2Y5FA 1TPAE 4U2WA 3CS7A 2J5UA 4CHAC 1LQEA 3M36A 1YPLH 1N6XA 3VFEA 3SNAA 3H7TA 1CT2E 2GD4B 3PLKA 1A0JA 1IQMA 4ZKSU 4DGJA 1XUHA 2A7HA 1HAIH 5EJZA 1Z8IB 1C5NH 3LGUA 4ZHAA 1E36B 1MUEB 5DSFA 1AWHB 4WF8A 1BMLA 4MPWA 1LPGB 4ZUHA 3HGPA 2OCVB 5KGOA 4E7NA 2CF8H 4TT3D 1D3DB 1ELBA 4H42U 2XXLA 1QL8A 2V35A 1KTSB 4ZKRU 1YPMH 1ID5H 3RXJA 1K1IA 1DX5M 3OTJE
chains in the Genus database with same CATH topology
1D3PB 1SGFG 3S9BA 5CMXH 3EA9A 1ESAA 4LK4A 4YLUA 3M5OA 2VWMA 1OWDA 1RJXB 1SGPE 2ODQA 2AERH 2FI4E 1LO6A 4NIWA 1O3IA 3GCTG 3RXGA 1EAUA 1Y59T 3T62A 4YOJA 3M7TA 3ZZ9A 1GVZA 5CHAB 2W26A 4ISOA 1FMGA 2VWNA 1HJAC 2FPZA 2ZEBA 4BANB 3RC4A 2TRMA 3BEFB 5C5NA 1D6RA 2GV7A 1C1NA 4I7YH 1EOJA 1SSXA 4ZXXH 3LGIA 2GCTC 1P04A 1C1UH 1YF4A 3A7ZA 2BD5A 2BXUH 5GJ4B 4WXIA 1LHEH 4JZEH 1NFXA 2VIVA 1O37A 1SLWB 1O2PA 4U32A 2J95A 5GXPA 4DVAU 2C8XB 1CA0B 1MTNC 5HYOA 1EXFA 3NKKA 4WH8A 1HAGE 2ALPA 1O2YA 1LPZB 2FOEA 1ZJDA 3D65E 5E8EH 2VINA 3A84A 4J1YA 1K22H 1P06A 4RKJB 3ITIA 1TRYA 1GI0A 1QJ7B 1KYNA 4ABGA 3K6ZA 4ZROA 2YNBA 3RU4T 2VWLA 2HLCA 3Q77A 1TMBH 3A7TA 2R2MB 4B2CA 1L1NA 4Y7BA 1GDUA 2GZ8A 2CHAC 2ZNKH 1OX1A 4DIIH 4HTCH 5DG6A 2VIWA 5T6DA 1FV9A 3GCHC 3W95A 1YPHE 1SMFE 1BBRK 3GCOA 5FX6A 1HFDA 2BDBA 3SV9A 3E6PH 1K1JA 3IG6B 5C1XA 3ZZ8A 1ZJKA 3KCGH 4MPUA 2ANMH 3AAVA 1YPGH 3O8DA 2Z3EA 2VIOA 1V6DA 2Z94A 2BDGA 4Q7ZA 3PMBB 3M7QA 3MU1A 1W13U 1T8OA 3KNXA 3KL6A 2GMTC 2GGVB 1C2JA 1FNIA 1CGIE 4NWLA 1SC8U 1NN6A 3BG4C 3SGQE 2G5NA 1EX3A 2BLVA 2ASUB 2QA9E 2VGCC 1PJPA 2VVCA 4NSVA 4AGJA 2WPKS 3RLYH 1CSOE 1O2RA 4ISIH 1T4UH 1O3KA 2B7DH 1LVOA 2TGAA 2BX3A 3ZVFA 5DK1A 5A0AE 1TNHA 2OP9A 1V2OT 2FS8A 1ABJH 2FTMA 3MO3A 4Y10E 2FOGA 3ATWA 3V0XA 1O5DH 5FPTA 4TYDA 2JKHA 3LPRA 2JH0D 1C5VA 1K21H 2F9OA 3B23B 2O8LA 1GMCF 1W12U 4IN1A 1ELEE 1NRSH 2VU8E 4FUJA 1GJ7B 1WU1A 3F9EA 4CH2B 3ATLA 3STIA 1P2QA 2G4UA 5E0HA 1K1NA 1HYLA 1ANDA 1OP0A 6CHAB 1LHGH 1DVAH 1GVLA 1HXFH 1SBWA 3TGKE 3GCTF 2P8OC 2QN5T 3LH1A 3HKIB 5EODA 1OYTH 4IC6A 3ZVGA 1JWTA 2ZWLH 3PROA 4BAOB 5AF9H 1O5EH 1G3DA 4OS7A 1CHOF 1GVKB 1P0SH 3FANA 1KIGH 5HGGA 1GJ9B 2BDYA 1CHGA 3Q3YA 2NU0E 4NA9H 1O36A 1QR3E 2QGRA 1NO9H 3GDSA 4FUGA 4UFDH 1C1PA 1UTNA 1S5SA 1BIOA 1G3EA 2ZHFH 2ZC9H 1O3EA 2QXGA 1LHFH 4O9VA 3TNSA 2Y5GA 2FZZA 3PLBA 2FODA 3IWMA 2FS9A 5E0GA 4CHAB 3NUMA 4TY7A 3RXEA 1BRBE 3RXUA 2GVFA 1DWCH 1NFWA 2BZAA 1NU7B 3MMGA 2EA3A 5EQRA 1VJAU 4NIYA 2A4RA 1TGCA 2GV6A 2W7SA 1C1WH 3TGJE 2BX4A 1NRPH 2B9LA 2HNTF 5TCAA 3AVZA 4LOYH 3T28A 1ZRBA 4D9RA 3SUFA 1ELVA 2BY8X 4X8UH 2FYRA 1O2LA 3MYWA 1DWDH 4GAWA 2BYAX 1L1GA 5L2YH 3SGAE 4Y0ZE 1C1TA 2ZZUH 2ZPSA 1GL1A 3U8RH 3KEEA 4Y0YE 4X6MA 1RFNA 1FY4A 2FLRH 1TNGA 1TOMH 3SI3H 2ZG0H 1V2UT 2OC1A 3RXOA 1VCWA 3C1KA 4Y8ZA 1GI1A 3SNDA 3FAOA 3TPIZ 2VIDA 2WUBA 2FXRA 5FCKA 3ATKA 4Z6AH 3CP7A 4ZHMU 1HJAB 1BQYA 3M7UA 4K1TA 1PYTD 2Y6TA 3D49H 4B1TA 1GBLA 1H4WA 2GCTB 1ELFA 1GDQA 1GI4A 1C5QA 3URDA 1GDNA 1P05A 1JOUB 2BTCE 1AO5A 3HATH 2GDEH 2C8WB 5F8ZA 3GISB 4K8YA 2PSXA 3LDXH 3SJ8A 1O2TA 1SFQB 2M5TA 2BY9X 1O31A 2WPIS 2R3YA 5G4BA 1UK3A 2BOHB 1MZAA 4ZAEA 2TIOA 1HJ9A 2P93A 3QO6A 4H6SB 4AZ2B 3A80A 2O8WA 3M3VA 2BLOA 3A85A 3SHAH 2W3KA 4I8KA 3SQHE 2QAAA 4DOQA 1O3NA 2UWOA 3KQBA 1WQVH 3NWUA 1O3LA 4MLFB 3RDZA 2AMPA 1MCTA 4U30A 4GCHF 3SNBA 4BOHA 1QBOA 2ZDVH 2F9VA 1XMNB 2PTCE 3RXCA 5F8TA 5FPSA 1YCPM 1LPKB 3OY5U 1EAWA 1SGRE 1DWBH 3QX5H 4WMDA 4CBNA 2ZIQH 4ISLA 3AAUA 4GHTA 1SGTA 1W2KH 3V13A 1TABE 3Q3XA 1O3DA 1NRNH 1ELCA 4AFQA 3TJUA 1UTPA 3H7OA 5LPRA 1BTZA 2Z9JA 1C2LA 1C9TA 1HIAA 3RXFA 1ETTH 2SGDE 1UTMA 3MWIU 2ZFQH 2PUXB 1AI8H 2LPRA 4MPVA 2QY0B 1C1RA 1DSUA 1HIAB 1QRZA 2ZPQA 1C9PA 1KY9A 2IN2A 4GLYA 1SLUB 1XX9A 8LPRA 4CRDA 3A88A 3D23A 2Q1JA 5GIBA 1J17T 1CA0C 1C2EA 3UREA 1ZZZA 3JZ2B 2CGAA 1ZTJA 1SGEE 3BN9A 4FU8A 2GMTB 2F3CE 2BD4A 2QXHA 1YC0A 3NZIA 4CR9A 1GI5A 4ABIA 3HK6B 2CXVA 1NESE 4O3TA 8GCHF 3SV8A 3UQOA 4NFFA 4TWWA 1SLXB 1GJAB 3DD2H 4JZ1A 2SGFE 4B76A 4NZLA 1GBDA 2OINA 1FZZA 3T29A 1C5MD 4BXSA 3K65B 1SGIB 2FDAA 1CO7E 2YOLA 7LPRA 2P3TB 1TIOA 1G2MA 2HVXA 4XFQA 4CRBA 3E8LA 3QDZB 3QWCH 1IOEA 4FU7A 2TGPZ 2J4IA 1H8DH 3EQ0H 4XBDA 1QL7A 4GHQA 4X1PU 3QTVH 1TE0A 3UTUH 2H6MA 3E1XB 4LZ1H 1G30B 1O2WA 1Z7KA 4AFUA 3ZVBA 2Z9IA 3BSQA 1A0HB 3SJ9A 4AYVB 1P8VC 3GICB 1N6YA 2ZHEH 1O2HA 3GYLB 2SGPE 2SNWA 1B0FA 3ODDA 3MH5A 4NSYA 1LVBA 1FPCH 1DUAA 3QGJA 2Z3DA 2XBYA 3SI4H 4THNH 2H5CA 3VB7A 3RM0H 3A89A 4KELA 2CJIA 1QRXA 1EJAA 3M3SA 1KDQA 1MBMA 5HMAA 1ZLRA 4Q2KA 1C2GA 1TGBA 1ZSKA 2PR3A 3P8FA 2QV1A 1S6FA 1MAXA 2IOTA 1FONA 3OY6U 1OYQA 1HUTH 1KDQB 2A4QA 1XXDA 5JPMH 2TBSA 4MVNA 2SGQE 1RS0A 1QQ4A 3KF2A 4WH6A 1L2EA 2CF9H 3ZV9A 1LDTT 1CGHA 1O35A 4WVPE 1KTTB 3P70B 1YM0A 2NU2E 4KKDA 1NRQH 2WUCA 2BZ6H 4UD9H 2HALA 1Z71A 5JBTA 3SV6A 1MTWA 3MU8A 1TGSZ 3ZZ3A 1ZPCA 1VITF 5AFYH 1HAXB 1C5TA 4MNXA 2Q6DA 3GYMA 1KSNA 1N8OB 2C93B 3P8GA 1EJNA 3VGCB 2ZGXH 1GJ5H 1KLIH 1PPFE 4IN2A 1DPOA 2F9BH 8ESTE 2EC9H 3SJKA 1UVPA 1GI3A 3A8DA 2C90B 1K1MA 1RTFB 4RN6A 4A7IB 1ABIH 1IQLA 3GY5A 3I29A 2ZU1A 4BTTB 3KGPA 4UFGH 2ILNA 1GMHF 1RXPA 2BQ6B 4JK6A 5E2OA 2IPHA 1ARCA 2J94A 1GJ6A 3MU0A 1F0SA 1O5BB 4Q80A 2ZDNA 1IQEA 5A2MH 3FZDA 4NA7A 4FUDA 1BHXB 1C2IA 4NFEA 4IBLH 3UIRA 4BAHB 1HAYB 1O30A 2FM2A 2G00A 3SOSA 1Q2WA 2O8UA 1C5YB 3SQEE 4Y8YA 5A8XA 1XKBC 1JIMA 4AYYB 2D8WA 1UK4A 3I77A 2BVSH 1UTQA 3PWBA 3PMAB 1TPOA 1C2HA 1SPJA 2FOFA 4O03A 3ZV8A 7KMEH 4RKOB 3ZVAA 1HLTH 3M37A 1LKBA 1SI5H 3PTNA 1BRUP 2ZDAH 2BY5X 2AYWA 1JRSA 5JB9S 1HPGA 4LZ4B 1P2IA 1W7XH 1OPHB 3P17H 2Z3CA 3ZZAA 1C4U2 2JETB 2ANWA 3MO9A 4XE4A 3RUOA 2G8TA 3DA9B 1YBWA 1GMCG 2QF3A 3L6PA 1Z8GA 2FOBA 3FP6E 1AMHA 3SU6A 2B0FA 1QTFA 1O39A 1QY6A 1OWJA 3LT3A 1GJDB 2ZF0H 1K2I1 2BOKA 2J34A 2EEKA 4D76A 1C2KA 2K1QA 2FEQH 4OS5A 1A5GH 1P9SA 1FAKH 2ANYA 4ABDA 3O8CA 4DCDA 5F8XA 1GHBG 1L0ZA 1LVYA 1WTHD 4XOJA 3RMOH 1UCYK 4NIXA 1PPHE 3ODFA 1HV7A 1XVOA 3F9GA 4X6NA 1O2KA 1A3EH 3PO1B 4B75A 1CHOG 4FUFA 2NU4E 2BDAA 4FVBA 5GDSH 4UFEH 1GI9B 4ISHH 4CREA 5EXMA 1ELTA 1XUKA 1O38A 1O2GH 1P2JA 2QIQA 3RP2A 4A1VA 4WWYA 1O3OA 3RC6A 1ORFA 5A09A 1C1OA 1W14U 2P94A 2F9UA 4ZKOU 1UJ1A 2GZ7A 3T5FH 1L1JA 2AGGX 3TJVA 4B74A 1TMTH 2STAE 1ZHPA 1OKXA 2NWNA 5EGMA 1CU1A 1SGCA 2BQ7B 1OWEA 1RIWB 4UE7H 1TRNA 1AU8A 1ZHMA 1PFXC 1IQIA 3EAJA 3V7TA 2RA3A 1CGJE 2A1DB 1BTHH 3QZRA 1CE5A 4K2YA 4ABEA 4IC5A 1BDAA 1K1LA 4UDWH 2EI6A 3Q00A 2H9TH 2OC0A 4NIVA 4R8TB 2DE8A 1O3GA 1AN1E 3LOXA 1TA2A 1P3EA 5I46H 2HRVA 2ULLA 2BVXH 1IHTH 3PB1E 1DT2A 5EQQA 2OC8A 1SHYA 3GY6A 2V6NA 2V3OH 3GCNA 2NU3E 5GPIB 2GDDA 2VIQA 3N7OA 1VR1H 4DURA 4IGDA 1TNIA 1T32A 2ZGJA 3FZZA 1K9OE 1FI8A 1PPZA 1OXGA 1XVMA 1V2RT 4D9QA 1UTLM 1ELGA 2RG3A 2I6QA 1O3JA 1WOFA 1HAPH 3BTDE 2F9NA 4AB8A 2FLBH 1SGYE 2H9EH 3MNBA 5FCRA 5B6OA 3RXQA 5SGAE 4R0IA 1DICA 1HB0B 1GBHA 1S82A 3ELAH 3SU1A 1UO6A 1WYKA 4F49A 4ZMAH 1GJ4H 1V2WT 1IQFA 1BBRE 2PV9B 1FIWA 4E7RG 2XCNA 1BT7A 2TPIZ 3TVJB 1ZTLA 2A5IA 5AFZH 3UWIA 1C5PA 1O32A 2ZFTA 2BD2A 3BTME 4MNWA 2QYIA 1MAYA 2FTLE 4NGAH 1RTLA 1MCVA 1ZHRA 3TJNA 3LKWA 2A0QB 5EOKA 1B0EA 2STBE 4CR5A 4GCHG 1B7XB 4X1SU 2FESH 4KTSA 3RXIA 1PQ7A 4AFSA 4WJG2 4ZXYH 1YPEH 3BEUA 3A87A 3MO6A 2PTNA 2OQUA 1PPEE 2XW9A 1IHSH 4KP0A 5DKMA 1C5OH 3M5LA 1TBZH 2FX4A 2VH6A 1IQGA 4SGBE 1ELAA 2PHBA 1TYNA 1CVWH 1GHBF 4ABHA 4I8HA 1LMWB 2FMJA 2NU1E 2VB0A 1BZXE 1O3PB 1EUFA 3LGTA 4CRCA 3Q3KA 1AFQB 1KLJH 5DP9A 3F9HA 1LTOA 1B5GH 2Y82A 3RXPA 5C67A 1C2DA 4JCNA 1AY6H 1CQQA 1EB2A 2AGIX 5JB8S 3HK3B 1TX8A 3GY8A 3SU2A 3L3TA 4Y6DA 3UUZA 3SORA 1TPSA 3ZVCA 3KQDA 4Y11E 3LJJA 2V0BA 5GCHG 1AD8H 1YLDA 4WY3A 3TNTA 5TJXA 1HXEH 2XTTB 4GSOA 4YT6H 1DXWA 1FPHH 1VJ9U 2OBOA 1GHYH 3KHVA 5DP4A 5C2ZA 1C5ZB 1FY1A 1Y5AT 1SFIA 1DOJA 2FP7B 2V3HH 1FY5A 4X2XA 4I33A 8GCHG 4Y79A 1C5UA 1ZR0A 1F5RA 3SJOA 1UMAH 1FN8A 1QJ6B 3QLPH 2BD7A 1NROH 2GCHF 1HGTH 1P10A 4GPGA 2WPJS 1N8OC 1F92A 2H1UA 5J4QA 3VGCC 1YPHC 1WBGB 2ZQ2A 4DG4A 3UY9A 2FI3E 1O2VA 1QJ1B 3OU0A 1XUIA 4YESB 2CN0H 3B9FH 2BDCA 4A92A 1O33A 2P3UB 3QUMP 2FO9A 1T8LA 1GCTB 1G9IE 2PFEA 6ESTA 3T25A 1THRH 2IJOB 4YTAA 1H9LB 1QA7A 3UWJH 3O8BA 1F2SE 3P6ZB 3QGNB 1NC6A 2ZA5A 1GBBA 1BJUA 4TY6A 1MZDA 5ABWA 3ZZBA 1F0RA 5JBAS 3IITA 1ZGIA 4D7GA 5L6NH 2PLXA 1SQTA 1E34B 1OOKB 1JMOH 2ZGCA 3KQCA 2UUYA 1GBMA 2A5AA 3RXTA 1FLEE 2KAIA 3PM3A 4H6TA 3SUDA 1Y3VA 8KME2 3S69A 1HAOH 2ESTE 1YP9A 1AE8H 4K3JA 1CT4E 2KAIB 4TPIZ 3EGKH 1P2MA 3HGNA 1OWHA 1L4ZA 1P12E 1Y5UT 1MTVA 2SFAA 2C8ZB 1TBRH 3ZVEA 2BD3A 2FOMB 2ZECA 1QA0A 2ALVA 5FBIA 2F91A 2JETC 3A83A 1O5AB