1OP0A

Crystal structure of aav-sp-i, a glycosylated snake venom serine proteinase from agkistrodon acutus
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
234
Chain Sequence
VIGGNECDINEHRFLVAFFNTTGFFCGGTLINPEWVVTAAHCDSTDFQMQLGVHSKKVLNEDEQTRNPKEKFICPNKNNNEVLDKDIMLIKLDKPISNSKHIAPLSLPSSPPSVGSVCRIMGWGSITPVKETFPDVPYCANINLLDHAVCQAGYPELLAEYRTLCAGIVQGGKDTCGGDSGGPLICNGQFQGIVSYGAHPCGQGPKPGIYTNVFDYTDWIQRNIAGNTDATCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Venom serine proteinase
publication title Crystal Structures and Amidolytic Activities of Two Glycosylated Snake Venom Serine Proteinases
pubmed doi rcsb
molecule tags Hydrolase
total genus 60
structure length 234
sequence length 234
ec nomenclature ec 3.4.21.-:
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op0A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op0A02
4AORA 2ZFQH 3TGIE 1UTLM 4ZXXH 4FUEA 1Z6EA 5GWZA 2VH6A 2CN0H 2H5CA 2FOHA 1P09A 5HMAA 1QL7A 2PSXA 2XC0A 5GXPA 1VITF 2HNTE 3T26A 3E90B 3URDA 1VITH 2ZZUH 2CHAC 3RMLH 1AHTH 1YCPM 4JYVH 5DGJA 1GJAB 3T28A 4JZ1A 3P6ZB 1C2HA 1QL9A 1PQ5A 1EAIA 1AU8A 2WPJS 1TPPA 2BY7X 1O2XA 1TOCB 4H42U 3SNEA 8GCHG 5LPRA 3DA9B 4Y7BA 4UFFH 5ABWA 1DX5M 4BAKB 1QQ4A 3STIA 2GDDA 2EA3A 2FS8A 2QIQA 4WXIA 1K1JA 1N1LA 1DUAA 1H9IE 1TOMH 2IOTA 3V12A 1V2WT 2TGAA 1KIGH 1C5NH 2A4RA 3VB3A 5JB9S 1J16A 1TGTA 1P02A 4MPVA 3S7KB 1TGNA 2P16A 4BTIB 5EXMA 1GHVH 2FLBH 2FOCA 1O2NA 4NA9H 3A8CA 1WOFA 1QQUA 1GMCF 1ZTKA 4MVNA 1A2CH 3KL6A 4VGCB 1BTZA 1F0SA 3TK9A 5FCRA 1MD8A 4I7YH 2YNBA 2GGVB 3RXEA 4OGYA 3HGNA 5F8XA 4CREA 3RU4D 4NIXA 2Z94A 1TBZH 1BBRK 4UONA 3QX5H 1NRQH 1O3HA 2IN2A 3TU7H 1EJNA 2NU1E 1GVZA 1ANEA 1C4U2 1RXPA 1BIOA 2A1DB 4A7IB 1SGNE 1TIOA 3M61U 1O3DA 2BDYA 3BTQE 3UTUH 3MNCA 2FI4E 2ZTZA 1FLEE 1NU7B 3LGWA 3KHVA 1E34B 4ABHA 1OPHB 5TJXA 4YOGA 1CU1A 4Y8ZA 2FP7B 2PLXA 1IQFA 2AS9A 4X8VH 4D8NA 4NG9H 1O37A 1KDQA 1SGRE 1ZPCA 1LVYA 1HJAC 1MBQA 1Z6JH 2BVRH 4INLA 1XMNB 1GVKB 2P3UB 3SJ8A 3A87A 3A86A 3MHWU 1QB6A 2O8TA 5JBAS 1GBBA 3A7VA 1AE8H 2W3IA 2P8OB 3EGKH 1GBLA 4IN2A 1O3BA 1UTKA 1AWHB 4ZXYH 4I8LA 1LHCH 1HJ9A 1SL3A 1YPHE 1WU1A 4I8KA 1HUTH 1TWXB 1EPTB 5ESBA 3F6UH 4H4FA 2A4OA 1THSH 1L1GA 3ZZ6A 2ZHEH 1S0RA 2W5EA 1UVSH 1HAPH 4DURA 5GCHG 1TYNA 1LKAA 1XUGA 4U01A 1H9HE 5ETXA 2VWLA 3S7HB 1IQMA 1UTPA 4A6LA 1GBFA 1EZQA 1DE7H 2UWOA 4GUXA 3QZRA 3Q3KA 2ZG0H 1W0ZU 4BAHB 2PKSC 3RXFA 1W0YH 1C1TA 4HFPB 3ZV9A 1GL0E 2VIWA 1P2IA 1CGIE 2KAIA 1HLTH 1SLXB 3MOCA 2ZHDA 1Y5BT 4JZEH 1NRSH 1THPB 2BVSH 1ZHPA 4NSVA 4B2CA 1DFPA 4YZUA 3SJKA 1HIAA 2QGRA 1SLWB 5C5NA 4K8BA 1O5CB 1S0QA 2BD9A 3O8DA 5TCAA 4UD9H 1ZLRA 2FOMB 3NUMA 4B73A 1LCYA 1C1VH 2F9BH 4HI3A 4WVPE 1SVPA 2VIDA 2RA3A 1ELAA 4K1EA 1KXEA 3LC3A 1ZSKA 3RP2A 1G2LA 4FUJA 2HRVA 1NFYA 4X1NU 1K1IA 5C67A 1ETRH 1QCPA 1UMAH 4U2WA 1B7XB 1TAWA 1TQ0B 1GDUA 4Z6AH 1OWEA 2A2XH 4DIIH 1DLKB 1VCPA 1DY8A 1KDQB 1GI7B 1O2KA 4NA8A 2Q6GA 4UE7H 1ELCA 1DT2A 2VGCC 3D62A 4KGAA 4KP0A 1B0EA 3R3GB 1GI0A 2VU8E 5EQQA 4O3UA 4ABGA 1EAUA 1OXGA 1A5GH 5BRRE 3O8RA 4ZKSU 4CR5A 2HLCA 5FPYA 2ZTYA 1AGJA 4WMEA 1P3EA 4TYDA 3ATLA 1F5RA 2HGTH 3NK8A 3SU4A 1UTOA 3B8JA 1JMOH 2RA0A 2G81E 1O0DH 1ABIH 4X2XA 4XDEA 2ZFPH 4Y10E 1KSNA 3PYHA 1MBMA 1O2VA 2BD7A 1V2LT 3FP6E 1SPJA 2BOKA 1A3BH 3BIVH 4JZDH 1C1RA 1GGDB 5K7RA 1SOTA 2ZECA 3SU3A 4NWLA 3RXAA 1UTJA 2UUJB 1BDAA 2ZGBH 1FI8A 1P2QA 2V6NA 2PGQB 2SNVA 5GDSH 1K21H 1IQKA 3SU5A 2FXRA 3KIDU 3CENA 1IQGA 3OTJE 5A8YA 1J15A 4YOIA 3L3TA 1JRTA 1K9OE 4AOQA 1FIWA 3RMNH 1IOEA 2F91A 5FHTA 3GICB 4X6MA 1GG6B 2FODA 1TA6A 1YKTA 6CHAB 1HIAB 4ISLA 5DP5A 3M5LA 3ODFA 3TH2H 1BA8B 1A4WH 3L6PA 3SU2A 3DFLA 3S69A 1BT7A 1DWDH 3NWUA 2HOBA 1C9TA 4B2AA 1GBDA 1JIRA 1IQHA 4FVBA 3PLPA 3RXPA 1NM6A 4DG4A 4UFDH 2ZGJA 1TGSZ 1UTMA 4MDSA 1HAIH 2I6QA 3MO6A 1LQEA 3T25A 4TY7A 8GCHF 4Y0YE 3SQHE 2ODPA 1HFDA 2FESH 4TWYA 3TGJE 1O31A 3C27B 3RXSA 1IQJA 1C1SA 4FUDA 2G8TA 2Z9JA 2BX3A 1RTFB 1ACBE 1C5VA 3HK3B 3LIWA 2BYAX 3U8OH 1RD3B 2Z9GA 4Y79A 3A82A 1F7ZA 1YP9A 3I77A 1W11U 3H7TA 1C4V2 1AB9B 2BLOA 4D9RA 5AFYH 3L33A 2VIPA 1G3DA 2F83A 3LJOA 3ZZBA 2XWAA 3IG6B 1ZMLA 2FZZA 2O9QA 1QGFA 1C1NA 1GI4A 2ODQA 3RXQA 5FPSA 1MTVA 3DD2H 2H9HA 2WPHS 3E6PH 1OP0A 1ZGVA 7LPRA 4X1QU 1LPGB 2Y7XA 2QC2A 1FNIA 1L4ZA 4AB9A 4Y76A 1P12E 1JRSA 2ANWA 2O8MA 3AW1A 1PPZA 3MNSA 5CE1A 1PJPA 1TONA 3QZQA 3RXOA 1DDJA 1O30A 3FZZA 1HAXB 1W2KH 3H7OA 2AGGX 3RUOA 3VXEH 4H6TA 3V13A 1GI3A 3P92A 3PB1E 4Q7ZA 1SG8B 5LGOA 2VWMA 3UPEA 2NWNA 5HXFA 1SMFE 2AMQA 1C5QA 5ESTE 4DGJA 1UTNA 3S9CA 3SJ9A 4XFQA 4NZLA 2FIRH 3PMJA 2HALA 2TGDA 1UVUH 4XSKU 3A89A 1GJDB 2XTTB 2K1QA 1O2QA 1C5TA 1O3IA 3SOSA 1YPKH 2ZWLH 2RCEA 1OYTH 3HGPA 3SV6A 4YLQH 3FP7E 4Y6DA 2PR3A 5TCCA 4E05H 4NZQA 2VNTA 3SN8A 1JOUB 1IHTH 2XRCA 3ZVCA 5C1YA 2ZDVH 1RJXB 2ZDAH 1YLDA 1GI8B 2SGDE 2BMGB 4VGCC 1XKBC 2Y7ZA 1FN6A 4WF8A 2J38A 1O5BB 1GCDA 3CS7A 2BZ6H 2ZQ1A 1MU8B 1RGQA 1AIXH 2GCHF 2VVUA 2VWNA 5GCHF 3MU4A 3SGBE 1FQ3A 5I46H 1PFXC 1V6DA 1XXFA 3K2UA 2LNCA 2CF9H 3MH4A 1ZPZA 3BEFB 1UVOA 3BTKE 2QXIA 3A7TA 4XBDA 1CT4E 1C1QA 5T3HA 1V2OT 1GDQA 1EUFA 2G51A 2Z9IA 1AI8H 3W94A 1CT0E 1GMDF 1O36A 1ANDA 4MTBA 1A0HB 3FANA 1ELGA 1ORFA 2OP9A 3EDXB 5A0BA 1W7GH 2H9TH 1DS2E 3ATIA 1MCVA 3K9XB 4CRAA 5HGGA 1JIMA 1LO6A 3P70B 4I31A 1RFNA 3QWCH 2Y81A 1FJSA 4K69A 4ABBA 4DCDA 2ZFFH 3LC5A 1RTKA 1ZJKA 3B23B 4X8TH 5I25A 1O3PB 2NU2E 1C5LH 5E8EH 1CSOE 2R9PA 1ZR0A 5PTPA 1FZZA 2P8OC 4D7GA 3MFJA 3QGJA 3SUFA 5L6NH 1Y8TA 1GBJA 1S5SA 3MU1A 4FUFA 1Z7KA 1XUIA 1YLCA 2I6SA 1WYKA 3RXKA 7GCHG 3MTYA 1QRXA 4TPYA 4JZFH 2SFAA 2BOHB 1EPTC 4AYVB 4LOYH 2FTMA 1K1PA 4ABJA 2WPIS 4X1SU 3FAOA 3UNQA 4BTUB 2BX4A 1VR1H 4NA7A 4OS5A 4O3TA 1YCPK 1QNJA 2NU3E 2J34A 2ZU3A 2J94A 4DVAU 1GPZA 3RXUA 1T4VH 3KF2A 1IQIA 3MH7A 1FY5A 1NFUA 3UOUA 1SQAA 1DVAH 1F0TA 1V2TT 2Y80A 2GV6A 1QHRB 1SGFA 2PWXA 3NXPA 1FV9A 4MPUA 2Y6TA 1EATA 3E3TA 1EOJA 1O2TA 5EW2H 1QA0A 1O5AB 1SGQE 2H1UA 1O5DH 1VJAU 3I78A 2HNTC 2AIPA 3M37A 5LPEA 1PPHE 1O33A 1Y59T 1YPJH 3RXGA 1XUJA 2BXTH 1AFQB 3HKJB 4ABFA 4D7FA 3KQCA 1GDNA 2D1JA 1EJMA 4I8HA 5DP9A 2FX6A 1NFXA 3A7WA 4THNH 3ZVDA 3T2NA 9LPRA 2XBXA 2WYGA 1UCYE 1TNGA 2PFEA 1RRKA 2UUKB 3S0NA 1BMNH 4BAQB 5E0GA 2P59A 3BF6H 4I32A 2G5NA 1AVXA 4B74A 1C5MD 3NCLA 5T6GA 1MQ5A 1ETSH 1O3OA 1W7XH 1Z8JB 3FFGA 2VINA 2BQWB 3RMMH 3SV8A 4AFZA 5LH8A 3T62A 2A0QB 3QUMP 4H6SB 2NU0E 4X2WA 5E0HA 1OSSA 1UCYH 2VVCA 4JZIA 3ZZ9A 1SGCA 1MKXK 1O39A 3LONA 1BHXF 2W26A 4DIHH 4I8GA 4LZ4B 4K1TA 2B7DH 3RXRA 3ZVEA 1ZOMA 1V2ST 2GD4B 1GHYH 4O9VA 3SQEE 1QJ1B 1SLUB 1EPTA 2Q6DA 1XX9A 1S81A 1QBOA 1WV7H 2D8WA 5A2MH 3LGVA 1GHWH 1NTPA 3MYWA 2J2UA 3M3VA 1GGDC 2OXSA 1TE0A 4DW2U 1FDPA 2F3CE 1HAHH 3DFJA 3K6YA 3RLYH 1IQEA 1V2MT 3TK5A 4K2YA 3RXDA 1MU6B 1NO9H 1A3EH 1SFIA 2QV1A 3M36A 3SNCA 2ZU4A 2GZ8A 1QTFA 3VB4A 1WQVH 1BMLA 1MH0A 1F92A 1DPOA 1T8LA 1YPEH 1LVBA 1GG6C 2PKAA 1G37A 2ZCLP 2OCVB 1C2EA 4MNWA 6CHAC 1ESTA 3RXJA 3LT3A 1AZZA 2AMDA 8KME2 3ZVBA 1GHBG 5C20A 1OWIA 3BV9B 2OD3B 3WY8A 1O3LA 5FAHA 1KLTA 5DP8A 2TGTA 2ZC9H 2XNIA 2EI7A 3BIUH 1HV7A 1V2RT 5EW1H 3A88A 1QA7A 2ALPA 4JYTA 1HBTH 2BD4A 1A5HA 5EXLA 1P9SA 4MPXA 1SQTA 4R8TB 2UWLA 2WV5A 1ABJH 4ZHLU 4KTUA 4ABDA 4WXVA 1Z71A 1Q3XA 2V3OH 3A80A 3C1KA 3PO1B 1GHAG 2ZHFH 1YPHC 2OLGA 3LU9B 5EG4A 1DLEA 3VFEA 1P11E 3SO3A 9ESTA 4UFEH 2ZU1A 4X2VA 3UREA 1E36B 4GHQA 1P01A 1XKAC 1LTOA 1T32A 4U32A 1ZHRA 1GBEA 1AB9C 1EKBB 2Y82A 4AGJA 1ZJDA 3D23A 4OGXA 4YO9A 1V2KT 2A5IA 1O2SA 4Y71A 1LHEH 1XXDA 1A46H 1DXPA 4B1TA 1IQNA 3ZZ4A 2FX4A 5FX5A 1BOQA 1TQ7B 1UK2A 3AW0A 4A92A 3ESTA 1NPMA 2XBYA 1K28D 5B6OA 1E35B 2DE9A 2Q1JA 2BB4A 1ZZZA 1ZSLA 2D2DA 6ESTA 1LMWB 3ATMA 2Z3CA 1BTYA 3MMGA 4GHTA 3F9FA 1C2LA 1MKWK 5EXNA 1P0SH 1N8OB 1TRYA 2R0LA 2ZKSA 4JYUH 4ZROA 3ZVFA 1W14U 1O2OA 1OP8A 4IMZA 1P2MA 4CRFA 1PYTC 1BTHH 4GCHG 4NFFA 5A0CA 3TJOA 2A7CA 2XC5A 1AMHA 3TJUA 1J17T 2M5TA 3LH3A 3E0PB 3NZIA 4X1RU 3QTOH 1OX1A 1G30B 4BNRA 4ISHH 3B9FH 2JETB 2PKAB 2VIQA 2ODYB 2GX4A 1YPLH 1G3CA 4Q7XA 3BTWE 2CJIA 2BDGA 1MUEB 2BXUH 2W3KA 2XBVA 4NFEA 2PV9B 2CXVA 3ENSB 1DOJA 3GCTG 4GSOA 1PPBH 1D9IA 4A1VA 1QB1A 2PTNA 4FUBA 3RM2H 1L2EA 3K6ZA 1ELFA 2GCTB 4ABAA 3ZZAA 5AFZH 2QXGA 1AUJA 5AVDA 3A84A 2OINA 3BG4B 3MU5A 4ZUHA 3ZZCA 4RKJB 1BZXE 3A85A 4ZAEA 1GJ5H 4CH8B 1SGFG 1XVOA 1ANCA 1K1LA 1C1UH 1CGJE 4HGCA 1SI5H 1VZQH 2C4FH 5JB8S 1GBCA 4D76A 2TRMA 3GY7A 1F5KU 3E8LA 2P95A 3RLWH 2R2WU 2ULLA 3PTNA 1MAYA 3MU8A 4ZHAA 3TLOA 4A1XA 1Y3WA 2AH4X 1C4Y2 4K5ZA 4F4OC 4IW4E 4CR9A 1TMUH 1O2IA 1Z1IA 1AQ7A 2ZEBA 5E2OA 2AFQB 1SSXA 2OQ5A 4ZKOU 1QJ6B 1J14A 1FY4A 2SGQE 1QRWA 1YPGH 6GCHF 1ZRBA 1H9LB 4X0WU 4ZKNU 4CHAB 1WCZA 3ITIA 1TMBH 2WV4A 4IMQA 4FU9A 1K1MA 4I8JA 2CF8H 1SOZA 3AAUA 1MKXH 3OY6U 3BTEE 2VIVA 4NSYA 3SU0A 2ZGHA 1LHFH 3LGTA 1J9CH 1NY22 1W8BH 3Q3YA 5HM2A 1BRUP 1NRNH 3E16B 3GY3A 3SUGA 2EI6A 5DP7A 1KXDA 4BTTB 3KQEA 1JBUH 1YGCH 1BRBE 2G55A 1G9IE 5J4QA 3LH1A 1ELDE 1C5WB 1GBAA 4TPIZ 2AGEX 3F9EA 3KNXA 1O3JA 3QGNB 1BBRE 1O2LA 3NKKA 1MTWA 2J4IA 1FUJA 3MNBA 1DM4B 2OC8A 1CHOG 3TH4H 5H4IB 3VB7A 3GDUA 4Q2KA 1MZAA 3UR9A 1WAYB 1DITH 2ZP0H 3MO3A 1EX3A 4KTCA 1A0LA 2UUYA 1L0ZA 1VGCB 5JBTA 1LPZB 2HPQH 4WMDA 4NIWA 5F8TA 1O2UA 2BD3A 2GMTB 3RM0H 4PROA 2FS9A 1BBRH 3QTVH 4CRCA 2EEKA 2J95A 1DSUA 1MAXA 3MO9A 5A8XA 5FXLA 1DY9A 3BTDE 4ISOA 4RN6A 1P9UA 3GISB 4NCYA 1PYTD 4X8SH 1AFQC 1A0JA 4GPGA 2CV3A 1O3CA 3SV9A 1LHDH 1O5FH 2ANYA 3E1XB 4Y11E 1P57B 3VB6A 3PMHB 1O2YA 3A7YA 2TIOA 2Z9KA 4DJZB 4WJG2 1QBVH 5AF9H 2DUCA 1BMMH 1Y3XA 5AHGH 2Y5FA 1HJ8A 2B9LA 3SJOA 1V2NT 1QL8A 4WH8A 3ZVAA 3BEUA 3QDZB 1V2QT 1O3AA 2ZPSA 1Y5AT 5T6FA 2RDLA 1CT2E 1GJ9B 3UQOA 4LZ1H 1G36A 8ESTE 1S83A 3MI4A 2V3HH 4UDWH 1IHSH 1S84A 1UHBA 1EP5A 1GI6A 2VVVA 1O2WA 3OY5U 2ZFSA 3GY5A 3CP7A 3RMOH 7ESTE 5L2ZH 1TX6A 1DUEA 1Z1JA 3SGAE 4OS2A 1GI5A 1ETTH 5A8ZA 2C8ZB 3LGIA 4X6OA 2RG3A 3F1SB 3SZNA 4YLUA 2QCYA 3HATH 1J8AA 2PSYA 2V35A 1TPAE 3KEEA 1PPFE 4JCNA 1WQSA 1CGHA 1P2NA 3BN9A 2QN5T 1XUKA 2A32A 3VB5A 3JZ1B 5J4SA 3F9GA 4CRDA 3SGQE 2QY0B 5BPEA 3HKIB 2P3TB 2ESTE 1ELTA 2F9VA 2OC0A 4INHA 5A0AE 4K8YA 1TA2A 1S85A 3D49H 3GCOA 1HGTH 1QJ7B 3O8CA 4B76A 1KLIH 1ELEE 3SNDA 1C2GA 3O8BA 1UO6A 1BJUA 2C8YB 5DP4A 1TRMA 1ZMNA 1NC6A 2BDBA 2XC4A 2WPLS 1NFWA 5FBIA 1YBWA 3EQ0H 3TVJB 2O8UA 1FXYA 1UJ1A 2WYJA 1EP6A 3RXBA 2CGAA 4LK4A 1HCGA 1GL1A 1GJ4H 4KELA 1RIWB 2FTLE 1L1JA 2IPHA 1GI2A 1IQLA 1SGPE 1SQOA 4DOQA 3SI4H 2GDEH 1A61H 3MH5A 2XWBI 1OOKB 2JH5D 2BDHA 2G4UA 5C1UA 1LVOA 2QXJA 2YNAA 4ESTE 2XYAA 3PO1C 1O2PA 2ILNA 2C8XB 3U1JB 3KGPA 1FPCH 1P2JA 2ZDKA 1OYQA 3QN7A 1AO5A 1MTSA 3BEIB 1O3MA 1WTHD 3E91A 3R0FA 4E06H 1D6RA 1O3FA 3AVZA 1AKSA 1UHBB 3LGUA 1A7SA 2QF3A 1TBRH 3UNRA 4FVDA 1P10A 4KTSA 3BTME 2ZCKP 3A7XA 3ZZDA 4YT6H 1H1BA 3GCTF 1CHGA 3VXFH 1YYY1 4E7RG 2BTCE 4B71A 2BDCA 4ZHMU 1KY9A 5T6DA 2VWOA 1O5GH 2XXLA 2Y5GA 3VGCB 1O2GH 1HRTH 2J9NA 2HPPH 1QBNA 4Y7AA 1O3NA 4ZMAH 1AY6H 3BTTE 1D3TB 3RC5A 5L30H 1ESBA 1C2JA 4FUGA 1N8OC 3LPRA 2G4TA 4OS1A 1TRNA 1P2KA 2BY9X 3M7QA 3QK1A 4IGDA 3GCHB 4CBOA 4GAWA 4YTAA 2AMPA 3PMAB 5FPTA 3A8AA 3SJIA 3TJVA 1BMAA 3LDXH 4MQAA 4CRGA 1LDTT 2HVXA 3M3SA 3T29A 1CA8B 2TPIZ 1E37B 1PPCE 3KCGH 3PROA 3GCNA 1TNIA 2JETC 3Q77A 4Y8XA 2BY6X 5FCKA 1GMHG 1U6QA 1IAUA 1TGBA 4A5TS 1EZXC 1TGCA 4JK6A 3GOVB 1SGDE 2GKVE 1AWFH 1EZSC 1RS0A 1SGYE 2Z9LA 2CMYA 1YC0A 2VIOA 4MNXA 1ZTLA 3MWIU 1GCTB 2ZPRA 3TNSA 2ZFRH 2J92A 5CHAB 2GCTC 1C2IA 1Z8RA 4E7NA 1M9UA 2QXHA 1T8OA 2AIQA 3BG4C 1GJ6A 1ID5H 1PPGE 2ASUB 1VCWA 4JMYA 1P03A 3U9AH 5GJ4B 2FYQA 1C5UA 1T7CA 3I29A 1BTPA 1YF4A 4NIVA 4CRBA 1FPHH 1PQ8A 1TNHA 1AKSB 3FVFB 3SNBA 1FAXA 1WTGH 6LPRA 1X7AC 1HAGE 1CBWB 1OWHA 4ASHA 1SGIB 2QYIA 1CHOF 2OBQA 5JPMH 2NU4E 4JK5A 1ZPBA 1QB9A 3GDSA 4Z0KA 1C2FA 1GJCB 1TPOA 2FM2A 2P94A 3P8OA 2OC1A 1NN6A 4Q7YA 2FYRA 4OS4A 1WUNH 3SUEA 1GJ7B 2B0FA 1LQDB 4CHAC 1V2PT 5EPYA 1KYNA 3P8GA 2FLRH 4XBCA 1KXBA 5C3NA 4TY6A 3PM3A 2A2QH 1GJ8B 2A45B 1MQ6A 3PV4A 4BANB 3LKWA 3E0NB 2BLQA 2ZI2H 1SR5C 3M5MA 4BAMB 3SU1A 1CQQA 4UFGH 1BUIA 3SORA 5DP3A 3TGKE 3EYDA 2R2MB 1Y3VA 5DG6A 4IC5A 2HNTF 1P04A 1O34A 3GY6A 2BZAA 3Q76A 2BQ7B 3T27A 4BXWA 3QLPH 1UTQA 2VB0A 1DICA 4MLFB 5EOKA 3M7TA 4AG2A 5DO4H 4LXBH 3MU0A 1Z8GA 3RC4A 1CA0B 1KXCA 4FUHA 3F9HA 2P3FH 1AD8H 1JXPA 1ELBA 3V0XA 1NZQH 3DHKH 4ABIA 2W7UA 3JZ2B 5E0JA 3FZDA 5GPIB 1G3EA 1VGCC 3ZZ3A 2PTCE 2GMTC 2PUQH 4B75A 3RDZA 2XCNA 4XOJA 1F0UA 1H8DH 1ARCA 2C8WB 1S6HA 4X6NA 2G00A 1AFEH 2JH0D 4YESB 2H5DA 1N6YA 1D3DB 2ZF0H 2ANKH 1PPEE 3DT0H 1P06A 3PLBA 4R0IA 3RXTA 2UUFB 3PWCA 4FUIA 1DANH 1NESE 2YOLA 1MTNB 4X6PA 1AUTC 3VPKA 3LJJA 2QA9E 2OQUA 4MPWA 3M35A 1NU9A 2GP9B 5FX6A 3LGYA 3ZZ7A 3GY4A 5JYIA 1TABE 2GT8A 2PUXB 2FEQH 2FI5E 2O8WA 4FXGH 4DY7B 3UY9A 3PMBB 5FBEA 3SNAA 2B5TB 1H4WA 2BVXH 5DJ7A 1XUFA 3TITA 2A4GA 1O3KA 3EE0B 1TMTH 2PHBA 1HAOH 2A4QA 5IDKA 5LPFA 3AAVA 4YOJA 1EAWA 1F2SE 2BD2A 1PQ7A 3GDVA 1FY1A 4ZH8A 1L1NA 1OWKA 5CMXH 2DE8A 1GBHA 3BTHE 3KQDA 1ZRKA 2BLWA 2ZFTA 3UFAA 1CVWH 1GI1A 4HZHA 1V3XA 1G3BA 1F0RA 1C5XB 2SNWA 4KKDA 1XM1A 2C90B 4BOHA 2ZGXH 4Y0ZE 1YPMH 1P05A 4O03A 3RXVA 1YCPH 2GCHG 5EU8A 3SU6A 1SGEE 3ZZ5A 1Z8IB 1PQAA 3OU0A 1DWEH 3Q00A 4F49A 3TIUA 3UOPA 1BHXB 2SGFE 1BQYA 3TNTA 3U1IB 3SHAH 4J2YB 1GMDG 1ESAA 2G52A 1C5RA 1NT1A 4X1PU 2ZA5A 1GJBB 4YT7H 7GCHF 2ZO3H 1C2KA 2FOAA 3TH3H 2GVFA 1EB2A 4K1SA 1C1MA 1SGTA 3EAJA 3A8BA 4AFSA 1GBTA 2BM2A 1SC8U 4OS6A 2BD5A 2AEIH 2PGBB 1TX7A 1Y5UT 3RC6A 4AYYB 1RIWC 2SGAA 1W12U 2WPKS 1INCA 2GT7A 3PLKA 1O2HA 1EB1H 4U30A 4AB8A 2Y5HA 3FP8E 3ZYEA 1D3PB 1P3CA 4ISIH 2BQ6B 1TB6H 1GHZA 3CS0A 4AFUA 3HPTB 3IITA 1HYLA 1O3EA 1ZGIA 2QF0A 3UIRA 3TPIZ 1SHHB 2STAE 4ISNA 1MZDA 5JBCS 1GMHF 1OP2A 1SBWA 3EA9A 3OX7U 3UWIA 1K1OA 1FN8A 1TNLA 1D6WA 1EAXA 2BDIA 4QT8C 1P2OA 2SGEE 5EPNA 3RXCA 1TNKA 2F9NA 1SHYA 1THRH 2ZTXA 2VH0A 1WBGB 1BRAA 2CHAB 1NS3A 3ZVGA 2FOBA 1S82A 1C5SA 1O3GA 3VGCC 2G5VA 1TNJA 2Z3DA 1BTXA 3OSYA 3W95A 2AYWA 1W13U 1F5LA 3A83A 2STBE 1HAVA 5F6MA 2OTVA 1E38B 1OS8A 5EGMA 1TLDA 1LPKB 3GCHC 1LKBA 4CBNA 3GY8A 3H5CB 1AE5A 1KTTB 1BITA 1LHGH 1ELVA 3M3TA 3ZV8A 1VJ9U 1FAKH 2BDAA 2ZCHP 1T31A 1TFXA 4K60A 8LPRA 4AZ2B 4WH6A 2O8LA 3RU4T 5JDUB 2KAIB 1BJVA 1UK3A 1OKXA 1DWCH 3ZYDA 1EASA 4MNVA 4AG1A 3UR6A 3A8DA 1KXAA 1B5GH 1HDTH 2UWPA 1ANBA 2Q6FA 3STJA 1S6FA 1D4PB 1VITG 1K1NA 1C5OH 1G32B 1QY6A 3BTFE 3SW2B 3Q3XA 2IJOB 4FU8A 1HPGA 4SGAE 1GCTC 3SV7A 1V2UT 3MH6A 5F03A 5CHAC 4RSPA 2Z7FE 1OWDA 1N6XA 2JH6D 5L2YH 1ZMJA 1KTSB 1JWTA 4I33A 3K65B 1A1RA 4FUCA 2WUBA 2Z3EA 1BRCE 4IN1A 1O38A 2GZ9A 2H6MA 1FMGA 3ZZ8A 1MD7A 3G01A 4IBLH 1D3QB 3P8NA 1O2MA 1O32A 1EXFA 2GTBA 2FOFA 1NROH 4D9QA 3RXMA 2OC7A 5EQSA 2FO9A 1HJAB 1C1PA 1SFQB 4XBBA 1CBWC 1C2MA 1CO7E 3UNSA 3ODDA 4OS7A 1GHBF 3GYLB 4O97A 3GY2A 4YM9A 1TALA 1O5EH 3UQVA 2AERH 3UWJH 3P17H 1GBMA 2ZNKH 2D26C 2FOGA 1EZUC 5SGAE 2VJ1A 1CE5A 1UCYK 2OUAA 1NRRH 7KMEH 4GLYA 1BTWA 1EJAA 2FDAA 2GV7A 3MNXA 1GMCG 1K22H 1O35A 4AN7A 3U98H 2FPZA 1GHAF 1TBQH 1TPSA 5E2PA 1MKWH 5DP6A 2ALVA 3ELAH 4B2BA 2F9PA 1HAVB 3V3MA 3VEQB 1HXEH 3KN2A 2WPMS 3AASA 1O2ZA 1ZHMA 3BSQA 1HNEE 2R0KA 2THFB 2ZPQA 4BXSA 1UVTH 1ARBA 1NRPH 1C9PA 2FOEA 3PTBA 3QO6A 3A7ZA 1WSSH 1SLVB 2AGIX 4DT7B 2TBSA 1C1WH 2PKSB 2BY8X 2ANMH 4GVUA 4FU7A 1W10U 4J1YA 4RKOB 5C5OA 1HAZB 1ZTJA 1SB1H 1XVMA 4K3JA 5C1XA 3D65E 5EODA 2GZ7A 3SBKA 4INKA 2A7JA 1Q2WA 1H8IH 1O2JA 2R3UA 1OWJA 3P8FA 1CA0C 5A09A 2A5AA 2BHGA 4AGKA 5HYOA 1P8VC 4GCHF 4WY3A 1A5IA 1EOLA 2BLVA 1TX8A 3S9BA 2ZDMA 2ZHWH 1AVGH 1QIXB 2FMJA 1B0FA 4ABEA 5K0HA 2EI8A 3ATWA 2SGPE 4NWKA 1C5YB 3HK6B 1GI9B 1ZSJA 2JKHA 3P95A 2TGPZ 4IS5A 1L4DA 1YM0A 4NIYA 2WINI 3SUDA 1KXFA 1MCTA 2VGCB 2XBWA 3N7OA 1GHXH 4XE4A 1QR3E 4BAOB 3F68H 3EA7A 5DK1A 2B8OH 3U8TH 1MTNC 5DPAA 2ZGCA 3IWMA 1O2RA 1HB0B 3NPSA 4X2YA 2Z6BD 3PWBA 1KLJH 1FY8E 2ZU2A 4AFQA 2A5KA 1V2VT 3M5NA 2EC9H 4MNYA 4UEHH 1C5ZB 2C93B 5IYTA 1DWBH 3DUXH 2H2ZA 1UK4A 1GVLA 5G4BA 1T8MA 1HAYB 1BCUH 2PW8H 1AVWA 4NGAH 1FIZA 1VCQA 3GYMA 2XCFA 4ZKRU 1Q31A 5C2ZA 5DKMA 1Y3YA 2F9OA 3M7UA 1BB0B 1DXWA 2ZHQH 4WMFA 2C3SA 1RTLA 4AX9H 2HWLB 3SHCH 3BTGE 3SV2H 5HM9A 2ZDLA 2FI3E 3S9AA 3UUZA 3RXIA 2ZU5A 1T8NA 1Y3UA 1ZYOA 1QFKH 1G2MA 3OYPA 2A7HA 1MTUA 4IC6A 4X8UH 2FWWA 3RXHA 3RU4E 3ATKA 3U8RH 4MG3A 1UVPA 2OBOA 3TJNA 3T5FH 1C5PA 1K2I1 1W3CA 3URCA 1AZ8A 1T4UH 3A81A 2LPRA 1FY3A 1AN1E 4Q80A 4A1TA 4TWWA 4WWYA 1QRZA 2BD8A 2W7SA 2V0BA 2WUCA 5F8ZA 3SI3H 3V7TA 1BTUA 3KQBA 3M5OA 1LVMA 2ZIQH 1GWAA 4Y8YA 1GBKA 1QURH 3EA8A 1DSTA 1V2JT 4SGBE 3LOXA 3RXLA 4HTCH 6GCHG 2QAAA 2XW9A 1XUHA 3U69H 2BY5X 1MMJN 2ZDNA 1C2DA 4CH2B 1GBIA 5JBBS 1EQ9A 2H9EH 2A31A 1C1OA 2ZQ2A 4M7GA 3TK6A 1E0FD 1FONA 5GIBA 2F9UA 1HXFH 2P93A 2R3YA 3BG8A 5EQRA
chains in the Genus database with same CATH superfamily
4AORA 2ZFQH 3TGIE 1UTLM 4ZXXH 4FUEA 1Z6EA 5GWZA 2VH6A 2CN0H 2H5CA 2FOHA 1P09A 5HMAA 1QL7A 5HIYA 2PSXA 2XC0A 4Q63A 5GXPA 1VITF 2HNTE 3T26A 3E90B 3URDA 1VITH 2ZZUH 4I86A 2CHAC 3RMLH 1AHTH 1YCPM 4JYVH 5DGJA 1GJAB 3T28A 4JZ1A 3P6ZB 1C2HA 1QL9A 1PQ5A 1EAIA 1AU8A 2WPJS 1TPPA 2BY7X 1O2XA 1TOCB 4H42U 3SNEA 8GCHG 5LPRA 3DA9B 4Y7BA 4UFFH 5ABWA 1DX5M 4BAKB 1QQ4A 3STIA 2GDDA 2EA3A 2FS8A 2QIQA 4WXIA 1K1JA 1N1LA 1DUAA 1H9IE 1TOMH 2IOTA 3V12A 1V2WT 2TGAA 1KIGH 1C5NH 2A4RA 3VB3A 5JB9S 1J16A 1TGTA 1P02A 4MPVA 3S7KB 1TGNA 2L6OA 2P16A 4BTIB 5EXMA 3FOAA 1GHVH 2FLBH 2FOCA 1O2NA 4NA9H 3A8CA 1WOFA 1QQUA 1GMCF 1ZTKA 4MVNA 1A2CH 3KL6A 4VGCB 1BTZA 1F0SA 3TK9A 5FCRA 1MD8A 2J97A 3OAAD 4I7YH 2YNBA 2GGVB 3RXEA 3GS9A 3HGNA 4OGYA 5F8XA 4CREA 3RU4D 4NIXA 2LP6A 2Z94A 1TBZH 1BBRK 2VBCA 4UONA 3QX5H 1NRQH 1O3HA 2IN2A 3TU7H 1EJNA 2NU1E 1GVZA 1ANEA 1C4U2 1RXPA 1BIOA 2A1DB 4A7IB 1SGNE 1TIOA 3M61U 1O3DA 2BDYA 3BTQE 3UTUH 3MNCA 2FI4E 2ZTZA 2HVYB 1FLEE 1NU7B 3LGWA 3KHVA 1E34B 4ABHA 1OPHB 5TJXA 4YOGA 4TT3D 1CU1A 4Y8ZA 2FP7B 2PLXA 1IQFA 2AS9A 4X8VH 4D8NA 4NG9H 1O37A 1KDQA 5C0TA 1SGRE 1ZPCA 1LVYA 1HJAC 3WWFA 1MBQA 4TSFD 1Z6JH 3NRLA 2BVRH 4INLA 5F53A 1XMNB 1GVKB 2P3UB 3SJ8A 3A87A 3A86A 3MHWU 5GNDA 1QB6A 2O8TA 5JBAS 1GBBA 3A7VA 1AE8H 2W3IA 2P8OB 3EGKH 1GBLA 4IN2A 4FOUC 1O3BA 1UTKA 1AWHB 4ZXYH 4I8LA 1LHCH 1HJ9A 1SL3A 1YPHE 5DSFA 1WU1A 3F0PA 4I8KA 1HUTH 1TWXB 1EPTB 5ESBA 3F6UH 4H4FA 2A4OA 1THSH 1L1GA 2IJD1 2ZHEH 3ZZ6A 1S0RA 2W5EA 1UVSH 2GJGA 1HAPH 4DURA 5GCHG 1TYNA 1LKAA 1XUGA 2JDID 4U01A 1H9HE 5ETXA 2VWLA 3S7HB 1IQMA 1UTPA 4A6LA 1GBFA 1EZQA 1DE7H 2UWOA 4GUXA 3QZRA 3Q3KA 2ZG0H 1W0ZU 4BAHB 2PKSC 3RXFA 1W0YH 1C1TA 4HFPB 3ZV9A 1GL0E 2VIWA 1P2IA 1CGIE 2KAIA 1HLTH 1SLXB 3MOCA 2ZHDA 1Y5BT 4JZEH 1NRSH 1THPB 2BVSH 1ZHPA 4NSVA 4B2CA 1DFPA 4YZUA 3SJKA 1HIAA 2QGRA 1SLWB 5C5NA 4K8BA 1O5CB 1S0QA 2BD9A 3O8DA 5TCAA 4UD9H 1ZLRA 2FOMB 3NUMA 4B73A 1LCYA 1C1VH 2F9BH 4HI3A 4WVPE 1SVPA 2VIDA 2RA3A 1ELAA 4K1EA 1KXEA 3LC3A 1ZSKA 3RP2A 1G2LA 4FUJA 2HRVA 1NFYA 4X1NU 1K1IA 5C67A 1ETRH 1QCPA 1UMAH 4U2WA 1B7XB 1TAWA 1TQ0B 1GDUA 2LELA 4Z6AH 1OWEA 2A2XH 4DIIH 1DLKB 1VCPA 1OHHD 1DY8A 1KDQB 1GI7B 1O2KA 4NA8A 2Q6GA 4UE7H 1ELCA 1DT2A 2VGCC 3D62A 4KGAA 4KP0A 3KQ5A 1B0EA 3R3GB 1GI0A 2VU8E 5EQQA 4O3UA 4ABGA 4B6EA 1EAUA 1OXGA 1A5GH 5BRRE 2PP6A 3O8RA 2WZQA 4ZKSU 4CR5A 2HLCA 5FPYA 2ZTYA 1AGJA 4WMEA 1P3EA 4TYDA 3ATLA 1F5RA 2HGTH 3NK8A 3SU4A 5C0UA 3N99A 4AC9A 1UTOA 3B8JA 1JMOH 2RA0A 2G81E 1O0DH 1ABIH 4X2XA 4XDEA 2ZFPH 4Y10E 4YXWD 1KSNA 3PYHA 1MBMA 2KM0A 1O2VA 2BD7A 1V2LT 3FP6E 1SPJA 2BOKA 1A3BH 3BIVH 4JZDH 1C1RA 1GGDB 5K7RA 1SOTA 2ZECA 3SU3A 4NWLA 3RXAA 1UTJA 2UUJB 1BDAA 2ZGBH 1FI8A 1P2QA 2V6NA 2PGQB 2SNVA 5GDSH 1K21H 1IQKA 5T1VA 3SU5A 2FXRA 3KIDU 3CENA 1IQGA 3OTJE 5A8YA 1J15A 4YOIA 3L3TA 1JRTA 1K9OE 4AOQA 1FIWA 3RMNH 1IOEA 2F91A 5FHTA 3GICB 4X6MA 1GG6B 2FODA 1TA6A 1YKTA 6CHAB 1HIAB 4ISLA 5DP5A 3M5LA 3ODFA 3TH2H 1BA8B 1A4WH 3L6PA 2W6ID 3SU2A 3DFLA 3S69A 1BT7A 1DWDH 3NWUA 2HOBA 1C9TA 4B2AA 1GBDA 1JIRA 1IQHA 4FVBA 2WSSD 3PLPA 3RXPA 1NM6A 4DG4A 4UFDH 2ZGJA 1TGSZ 1UTMA 4MDSA 1HAIH 2I6QA 3MO6A 1LQEA 3T25A 4TY7A 8GCHF 3H09A 4Y0YE 3SQHE 2ODPA 1HFDA 2FESH 4TWYA 3TGJE 1O31A 3C27B 3RXSA 1IQJA 1C1SA 2RDEA 4FUDA 2G8TA 1E1RD 2Z9JA 2BX3A 1RTFB 1ACBE 1C5VA 3HK3B 3LIWA 2BYAX 5CHBA 3U8OH 5EIYA 1RD3B 2Z9GA 4Y79A 3A82A 1F7ZA 1YP9A 3I77A 1W11U 3H7TA 1C4V2 1AB9B 2BLOA 4D9RA 5AFYH 3L33A 2VIPA 1G3DA 2F83A 3LJOA 3ZZBA 2XWAA 3IG6B 1ZMLA 2QF4A 2FZZA 2O9QA 1QGFA 1C1NA 2CK3D 1GI4A 2ODQA 3RXQA 5FPSA 1MTVA 3DD2H 2H9HA 2WPHS 3E6PH 1OP0A 1ZGVA 4B6FA 7LPRA 4X1QU 1LPGB 2Y7XA 2QC2A 1FNIA 1L4ZA 4AB9A 4Y76A 1P12E 1JRSA 2ANWA 2O8MA 3AW1A 1PPZA 3MNSA 5CE1A 1PJPA 1TONA 3QZQA 3RXOA 1DDJA 1O30A 3FZZA 1HAXB 1W2KH 3H7OA 2AGGX 3RUOA 3VXEH 4H6TA 3V13A 1GI3A 3P92A 3PB1E 4Q7ZA 1SG8B 5LGOA 2VWMA 3UPEA 2NWNA 5HXFA 1SMFE 2AMQA 1C5QA 5ESTE 2HLDD 4DGJA 1UTNA 3S9CA 3SJ9A 4XFQA 4NZLA 2FIRH 3PMJA 2HALA 2TGDA 2OK5A 1UVUH 4XSKU 3A89A 1GJDB 2RFKC 2XTTB 2K1QA 1O2QA 1C5TA 1O3IA 3SOSA 1YPKH 2ZWLH 3FKSD 2RCEA 1OYTH 3F0OA 3HGPA 3SV6A 4YLQH 3FP7E 4Y6DA 2PR3A 5TCCA 4E05H 4NZQA 2VNTA 3SN8A 1JOUB 1IHTH 2XRCA 3ZVCA 5C1YA 2ZDVH 1RJXB 2ZDAH 1YLDA 1GI8B 2SGDE 2BMGB 4VGCC 1XKBC 2Y7ZA 1FN6A 4WF8A 2J38A 1O5BB 1GCDA 3CS7A 2BZ6H 2ZQ1A 1MU8B 1RGQA 1AIXH 2GCHF 2VVUA 1E79D 2VWNA 5GCHF 3DSOA 3MU4A 3SGBE 1FQ3A 5I46H 1PFXC 1V6DA 1XXFA 3K2UA 2LNCA 2CF9H 3MH4A 1ZPZA 3BEFB 1UVOA 3BTKE 2QXIA 3A7TA 4XBDA 1CT4E 2XOKD 1C1QA 5T3HA 1V2OT 1GDQA 1EUFA 2G51A 2Z9IA 3PV2A 1AI8H 3W94A 1CT0E 1GMDF 1O36A 1ANDA 4MTBA 1A0HB 1NBMD 3FANA 1ELGA 1ORFA 2OP9A 3EDXB 5A0BA 1W7GH 2KCYA 2H9TH 1DS2E 3ATIA 1MCVA 3K9XB 4CRAA 5HGGA 1MABB 1JIMA 1LO6A 3P70B 4I31A 1RFNA 3QWCH 2Y81A 1FJSA 4K69A 4ABBA 4DCDA 2ZFFH 3LC5A 1RTKA 3CNRA 1ZJKA 3B23B 4X8TH 5I25A 1O3PB 2NU2E 1C5LH 5E8EH 1CSOE 2R9PA 1ZR0A 5PTPA 1FZZA 2P8OC 4D7GA 3MFJA 3QGJA 3SUFA 5L6NH 1Y8TA 1GBJA 1S5SA 3MU1A 4FUFA 4XD7D 1Z7KA 1XUIA 1YLCA 5KGOA 2I6SA 1WYKA 3RXKA 7GCHG 3MTYA 1QRXA 4TPYA 4JZFH 2SFAA 1H8HD 2BOHB 1EPTC 4AYVB 4LOYH 2FTMA 1K1PA 4ABJA 2WPIS 4X1SU 3FAOA 3UNQA 1WXRA 4BTUB 2BX4A 1VR1H 4NA7A 4OS5A 4O3TA 1YCPK 1QNJA 1YY3A 2NU3E 2J34A 2ZU3A 2J94A 4DVAU 1GPZA 3RXUA 1T4VH 3KF2A 3FN8A 1IQIA 2W6JD 3MH7A 1FY5A 1NFUA 3UOUA 1SQAA 1DVAH 1F0TA 1V2TT 2Y80A 1FX0B 2GV6A 1QHRB 1SGFA 2PWXA 3NXPA 1FV9A 4MPUA 2Y6TA 1COWD 1EATA 3E3TA 1EOJA 1O2TA 5EW2H 1QA0A 1O5AB 1SGQE 2H1UA 1O5DH 1VJAU 3I78A 3AK5A 2HNTC 2AIPA 3M37A 5LPEA 1PPHE 1O33A 1Y59T 1YPJH 3RXGA 1XUJA 2BXTH 1AFQB 3HKJB 4ABFA 4D7FA 3KQCA 1GDNA 2D1JA 1EJMA 4I8HA 5DP9A 2FX6A 1NFXA 3A7WA 4THNH 3ZVDA 3T2NA 9LPRA 2XBXA 2WYGA 1UCYE 1TNGA 2PFEA 1RRKA 2UUKB 3S0NA 1BMNH 4BAQB 5E0GA 5B6LA 2P59A 3BF6H 4I32A 2G5NA 1AVXA 4B74A 1C5MD 3NCLA 5T6GA 5IK2D 1MQ5A 1ETSH 1O3OA 2EQNA 1W7XH 1Z8JB 3FFGA 2VINA 2BQWB 3RMMH 3SV8A 4AFZA 5LH8A 3T62A 2A0QB 3QUMP 4H6SB 2NU0E 4X2WA 5E0HA 1OSSA 1UCYH 2VVCA 4JZIA 3ZZ9A 1SGCA 2KX4A 1MKXK 1O39A 3LONA 1BHXF 2W26A 4DIHH 4I8GA 4LZ4B 4K1TA 2B7DH 3RXRA 3ZVEA 1ZOMA 1V2ST 2GD4B 1GHYH 4O9VA 3SQEE 1QJ1B 1SLUB 1EPTA 2Q6DA 1XX9A 1S81A 1QBOA 1WV7H 2D8WA 5A2MH 3LGVA 1GHWH 1NTPA 3MYWA 2J2UA 3M3VA 1GGDC 2OXSA 3WWBA 1TE0A 4DW2U 1FDPA 2F3CE 1HAHH 3DFJA 3K6YA 3RLYH 3DCLA 1IQEA 1V2MT 3TK5A 4K2YA 3RXDA 1MU6B 1NO9H 1A3EH 1SFIA 2QV1A 2KFWA 3M36A 3SNCA 2ZU4A 2GZ8A 1QTFA 3VB4A 1YWUA 1WQVH 1BMLA 1MH0A 1F92A 1DPOA 1T8LA 1YPEH 1LVBA 1GG6C 2PKAA 3KYFA 1G37A 2ZCLP 2OCVB 1C2EA 4MNWA 6CHAC 1ESTA 3RXJA 3LT3A 1AZZA 2AMDA 8KME2 2M2AA 3ZVBA 1GHBG 5C20A 1OWIA 3BV9B 2OD3B 3WY8A 5DN6D 1O3LA 5FAHA 1KLTA 5DP8A 2TGTA 2ZC9H 2XNIA 2EI7A 3BIUH 1HV7A 1V2RT 5EW1H 3A88A 1QA7A 2ALPA 4JYTA 1HBTH 2BD4A 1A5HA 5EXLA 1P9SA 4MPXA 1SQTA 4R8TB 2UWLA 2WV5A 1ABJH 4ZHLU 4KTUA 4ABDA 4WXVA 1Z71A 1Q3XA 2V3OH 3A80A 3C1KA 3PO1B 1GHAG 2ZHFH 1YPHC 2OLGA 3LU9B 5EG4A 1DLEA 3VFEA 1P11E 3SO3A 9ESTA 4UFEH 1BMFD 2ZU1A 4X2VA 3UREA 1E36B 4GHQA 1P01A 1XKAC 1LTOA 1W0KD 5KEDA 1T32A 4U32A 1ZHRA 1GBEA 1AB9C 1EKBB 2Y82A 4AGJA 1ZJDA 3D23A 4OGXA 4YO9A 1V2KT 2A5IA 1O2SA 4Y71A 1LHEH 1XXDA 1A46H 1DXPA 4B1TA 2F4LA 1IQNA 3ZZ4A 2FX4A 5FX5A 1BOQA 3PRDA 2WPDD 1TQ7B 1UK2A 3AW0A 4A92A 3ESTA 1NPMA 2XBYA 1K28D 5B6OA 1E35B 2DE9A 2Q1JA 2BB4A 1ZZZA 1ZSLA 2D2DA 6ESTA 3OE7D 1LMWB 3ATMA 2Z3CA 1BTYA 3MMGA 4GHTA 3F9FA 1C2LA 1MKWK 5EXNA 1P0SH 1N8OB 1TRYA 2R0LA 2ZKSA 4JYUH 4ZROA 3ZVFA 1W14U 1O2OA 1OP8A 3OTPA 1P2MA 4IMZA 4CRFA 1PYTC 1BTHH 4GCHG 4NFFA 5A0CA 3TJOA 4P02A 1SQRA 2A7CA 2XC5A 1AMHA 3TJUA 1J17T 2M5TA 3LH3A 3E0PB 1SKYE 3NZIA 4X1RU 3QTOH 1OX1A 1G30B 4BNRA 4ISHH 3B9FH 2JETB 2PKAB 2VIQA 2ODYB 2GX4A 1YPLH 1K0HA 1G3CA 4Q7XA 3BTWE 2CJIA 2BDGA 1MUEB 2BXUH 2W3KA 2XBVA 4NFEA 2PV9B 2CXVA 3ENSB 1DOJA 3GCTG 4GSOA 1PPBH 1D9IA 4A1VA 1QB1A 2PTNA 4FUBA 3RM2H 1L2EA 3K6ZA 1ELFA 2GCTB 4ABAA 3ZZAA 5AFZH 2QXGA 1AUJA 5AVDA 3A84A 2OINA 3BG4B 3MU5A 4ZUHA 3ZZCA 2JJ2D 4RKJB 1BZXE 3A85A 4ZAEA 1GJ5H 4CH8B 1SGFG 1XVOA 1ANCA 1K1LA 1C1UH 1CGJE 4HGCA 1SI5H 1VZQH 2C4FH 2K8IA 5JB8S 1GBCA 4D76A 2TRMA 3GY7A 1F5KU 3E8LA 2P95A 3RLWH 2R2WU 2ULLA 3PTNA 1MAYA 3MU8A 4ZHAA 3TLOA 4A1XA 1Y3WA 2AH4X 1C4Y2 4K5ZA 4F4OC 4IW4E 4CR9A 1TMUH 1O2IA 1Z1IA 1AQ7A 2ZEBA 5E2OA 2AFQB 1SSXA 2OQ5A 4ZKOU 1QJ6B 1J14A 1FY4A 2SGQE 1QRWA 1YPGH 6GCHF 1ZRBA 1H9LB 2WHXA 4X0WU 4P00A 4ZKNU 1WCZA 4CHAB 3ITIA 1TMBH 2WV4A 4IMQA 4FU9A 1K1MA 4I8JA 2CF8H 1SOZA 3AAUA 1MKXH 3OY6U 3BTEE 1W0JD 2VIVA 4NSYA 3SU0A 2ZGHA 1LHFH 2AHME 3LGTA 1J9CH 1NY22 1W8BH 3Q3YA 2IPQX 5EJZA 5HM2A 1BRUP 1NRNH 3E16B 3GY3A 3SUGA 3WW7A 2EI6A 5DP7A 3KYGA 1KXDA 4BTTB 3KQEA 1E1QD 1JBUH 1BRBE 1YGCH 1G9IE 2G55A 5J4QA 3LH1A 1ELDE 1C5WB 1GBAA 4TPIZ 2AGEX 3F9EA 3KNXA 1O3JA 3QGNB 1BBRE 3SYJA 1O2LA 3NKKA 1S6LA 5CDFE 1MTWA 2J4IA 1FUJA 3MNBA 1DM4B 2J98A 2OC8A 1CHOG 3TH4H 5H4IB 3VB7A 3GDUA 4Q2KA 1MZAA 3UR9A 1WAYB 1DITH 2ZP0H 3MO3A 1EX3A 4KTCA 1A0LA 2UUYA 1L0ZA 1VGCB 5JBTA 1LPZB 2HPQH 4WMDA 4NIWA 5F8TA 1O2UA 2BD3A 2GMTB 3RM0H 4PROA 2FS9A 1BBRH 3QTVH 4CRCA 2EEKA 2J95A 1DSUA 1MAXA 2JIZD 3MO9A 5A8XA 5FXLA 1DY9A 3BTDE 4ISOA 4RN6A 1P9UA 3GISB 4NCYA 1PYTD 4X8SH 1AFQC 1A0JA 4GPGA 2CV3A 1O3CA 3SV9A 1LHDH 1O5FH 2ANYA 3E1XB 4Y11E 1P57B 3VB6A 3PMHB 1O2YA 3A7YA 2TIOA 2Z9KA 4DJZB 4WJG2 4FETA 1QBVH 5AF9H 2DUCA 1BMMH 1Y3XA 5AHGH 2Y5FA 1HJ8A 2B9LA 3SJOA 1V2NT 1QL8A 4WH8A 3ZVAA 3BEUA 3QDZB 1V2QT 1O3AA 2ZPSA 1Y5AT 5T6FA 2RDLA 1CT2E 1GJ9B 3UQOA 4LZ1H 1G36A 8ESTE 1S83A 3MI4A 2V3HH 4UDWH 1IHSH 1S84A 1UHBA 1EP5A 1GI6A 2VVVA 1O2WA 3OY5U 2ZFSA 2F43B 3GY5A 3CP7A 3RMOH 7ESTE 5L2ZH 1TX6A 1DUEA 1Z1JA 3SGAE 4OS2A 1GI5A 1ETTH 5A8ZA 2C8ZB 4M9FA 3LGIA 4X6OA 2RG3A 3F1SB 3SZNA 4YLUA 2QCYA 3HATH 1J8AA 2PSYA 2V35A 1TPAE 3KEEA 1PPFE 4JCNA 1WQSA 1CGHA 1P2NA 3BN9A 2QN5T 1XUKA 2A32A 3VB5A 3JZ1B 5J4SA 3F9GA 4CRDA 3SGQE 2QY0B 5BPEA 3HKIB 5C94A 2P3TB 2ESTE 1ELTA 2F9VA 2J98B 3EE7A 2OC0A 4INHA 5A0AE 4K8YA 1TA2A 1S85A 3D49H 3GCOA 1HGTH 1QJ7B 3O8CA 4B76A 1KLIH 1ELEE 3SNDA 1C2GA 3O8BA 3MQKC 1UO6A 1BJUA 2C8YB 5DP4A 1TRMA 1ZMNA 1NC6A 2BDBA 2XC4A 2WPLS 1NFWA 5FBIA 1YBWA 3EQ0H 3TVJB 2O8UA 1FXYA 1UJ1A 2L74A 2WYJA 1EP6A 3RXBA 2CGAA 4LK4A 1HCGA 1GL1A 1GJ4H 4KELA 1RIWB 2FTLE 1L1JA 2IPHA 1GI2A 1IQLA 3PV5A 1SGPE 1SQOA 4DOQA 3SI4H 2GDEH 1A61H 3MH5A 2XWBI 1OOKB 2JH5D 2BDHA 2G4UA 5C1UA 1LVOA 2QXJA 2YNAA 4ESTE 1UW7A 2XYAA 3PO1C 1O2PA 2ILNA 2C8XB 3U1JB 3KGPA 1FPCH 1P2JA 2ZDKA 1OYQA 3QN7A 1AO5A 1MTSA 3BEIB 1O3MA 1WTHD 3E91A 3R0FA 3UAIC 4E06H 1D6RA 1O3FA 3AVZA 1AKSA 1UHBB 3LGUA 1A7SA 2QF3A 1TBRH 3UNRA 4FVDA 1P10A 4KTSA 3BTME 2ZCKP 3A7XA 3ZZDA 4YT6H 1H1BA 3GCTF 1CHGA 3VXFH 2V3MA 1YYY1 4E7RG 2BTCE 4DT4A 4B71A 2BDCA 4ZHMU 1KY9A 5T6DA 2VWOA 1O5GH 2XXLA 2Y5GA 3VGCB 1O2GH 1HRTH 2J9NA 2HPPH 1QBNA 4Y7AA 1O3NA 4ZMAH 1AY6H 3BTTE 1D3TB 3RC5A 5L30H 1ESBA 1C2JA 4FUGA 1N8OC 3LPRA 2G4TA 4OS1A 1TRNA 1P2KA 2BY9X 3M7QA 3QK1A 1YLNA 4IGDA 3F2HA 3GCHB 2XNDD 4CBOA 4GAWA 4YTAA 2AMPA 3PMAB 5FPTA 3A8AA 3SJIA 3TJVA 1BMAA 3DSPA 3LDXH 4MQAA 4CRGA 1LDTT 2HVXA 3M3SA 3T29A 1CA8B 2TPIZ 1E37B 1PPCE 3KCGH 3PROA 3GCNA 1TNIA 2JETC 3Q77A 4Y8XA 2BY6X 5FCKA 1GMHG 2V7QD 1U6QA 1IAUA 1TGBA 4A5TS 1EZXC 1TGCA 4JK6A 3GOVB 1SGDE 2GKVE 1AWFH 1EZSC 1RS0A 1SGYE 2Z9LA 4Q4LA 2CMYA 1YC0A 2VIOA 4MNXA 1ZTLA 3MWIU 1GCTB 2ZPRA 3TNSA 3F2FA 2EY4C 2ZFRH 2J92A 5CHAB 2GCTC 1C2IA 1Z8RA 4E7NA 1M9UA 2QXHA 1T8OA 2AIQA 3BG4C 1GJ6A 1ID5H 1PPGE 2ASUB 1VCWA 4JMYA 1P03A 3U9AH 5GJ4B 2FYQA 1C5UA 1T7CA 3I29A 1BTPA 1YF4A 4NIVA 4CRBA 1FPHH 1PQ8A 3W1EA 1TNHA 1AKSB 3FVFB 3SNBA 1FAXA 1WTGH 6LPRA 1X7AC 1HAGE 1CBWB 1OWHA 4ASHA 3OEED 1SGIB 2QYIA 1CHOF 2OBQA 5JPMH 2NU4E 4JK5A 1ZPBA 1QB9A 3GDSA 4Z0KA 1C2FA 3VG8A 1GJCB 1TPOA 2FM2A 2P94A 3P8OA 2OC1A 1NN6A 4Q7YA 2FYRA 4OS4A 1WUNH 4ACAA 3SUEA 1GJ7B 2B0FA 1LQDB 1VKYA 4CHAC 1V2PT 5EPYA 1KYNA 3P8GA 2FLRH 4XBCA 1KXBA 5C3NA 4TY6A 3PM3A 2A2QH 2YMSB 1GJ8B 2A45B 1MQ6A 3PV4A 4BANB 3LKWA 3E0NB 5EJ1A 2BLQA 2ZI2H 1SR5C 3M5MA 4BAMB 3SU1A 1CQQA 4UFGH 1BUIA 3SORA 5DP3A 4RI0A 3TGKE 3EYDA 2R2MB 1Y3VA 5DG6A 4IC5A 2HNTF 1P04A 1O34A 2KCPA 3GY6A 2BZAA 3Q76A 2BQ7B 3T27A 4BXWA 3QLPH 1UTQA 2VB0A 1DICA 4MLFB 5EOKA 3M7TA 4AG2A 5DO4H 4LXBH 3MU0A 1Z8GA 3RC4A 1CA0B 1KXCA 4FUHA 3F9HA 4RT0A 2P3FH 1AD8H 1JXPA 1ELBA 3V0XA 1NZQH 3DHKH 4ABIA 2W7UA 3JZ2B 5E0JA 3FZDA 5GPIB 1G3EA 1VGCC 3ZZ3A 2PTCE 2GMTC 2PUQH 4B75A 3RDZA 2XCNA 4XOJA 1F0UA 1H8DH 1ARCA 5C17A 2C8WB 2JJ1D 1S6HA 4X6NA 2G00A 1AFEH 2JH0D 3OFND 4YESB 2H5DA 1N6YA 1D3DB 2ZF0H 2ANKH 1PPEE 3DT0H 1P06A 3PLBA 4R0IA 3RXTA 2UUFB 3PWCA 3FO8D 4FUIA 1DANH 1NESE 2YOLA 1MTNB 4X6PA 1AUTC 4ASUD 3VPKA 3LJJA 3F2GA 2QA9E 2OQUA 4OM9A 4MPWA 3M35A 1NU9A 2GP9B 3N7DA 5FX6A 3LGYA 3ZZ7A 3GY4A 5JYIA 1TABE 2GT8A 2PUXB 2FEQH 2FI5E 2O8WA 4FXGH 4Z1MD 4DY7B 3UY9A 3PMBB 5FBEA 3SNAA 2B5TB 3PRBA 1H4WA 2BVXH 5DJ7A 1XUFA 3TITA 2A4GA 1O3KA 3EE0B 1TMTH 2PHBA 1HAOH 2A4QA 5IDKA 5LPFA 3AAVA 4YOJA 1EAWA 1F2SE 2BD2A 1PQ7A 3GDVA 1FY1A 4ZH8A 1L1NA 1OWKA 5CMXH 2DE8A 1GBHA 3BTHE 3KQDA 1ZRKA 2BLWA 2ZFTA 3UFAA 1CVWH 1GI1A 4HZHA 1V3XA 1G3BA 1F0RA 1C5XB 2SNWA 4KKDA 1XM1A 2C90B 4BOHA 2ZGXH 4Y0ZE 1YPMH 1P05A 4O03A 3RXVA 1YCPH 2GCHG 5EU8A 3SU6A 1SGEE 3ZZ5A 1Z8IB 1PQAA 3OU0A 1DWEH 3Q00A 4F49A 3TIUA 3UOPA 1BHXB 2SGFE 1BQYA 3TNTA 3U1IB 3SHAH 4J2YB 1GMDG 1ESAA 2G52A 1C5RA 1NT1A 4HG6A 4X1PU 2ZA5A 5FL7D 1GJBB 4YT7H 5KECA 7GCHF 2ZO3H 1C2KA 2FOAA 3TH3H 2GVFA 1EB2A 4K1SA 1C1MA 1SGTA 3EAJA 3A8BA 4AFSA 1GBTA 2BM2A 1SC8U 4OS6A 2BD5A 2AEIH 2KCOA 2PGBB 1TX7A 1Y5UT 3RC6A 1KMHB 4AYYB 1RIWC 2SGAA 1W12U 2WPKS 1INCA 2GT7A 3PLKA 1O2HA 1EB1H 4U30A 4AB8A 2Y5HA 3FP8E 3ZYEA 1D3PB 1P3CA 4ISIH 2BQ6B 1TB6H 1GHZA 3CS0A 4AFUA 3HPTB 2KR7A 3IITA 1HYLA 1O3EA 1ZGIA 2QF0A 2KZ4A 3UIRA 3TPIZ 1SHHB 2STAE 4ISNA 1MZDA 5JBCS 1GMHF 1OP2A 1SBWA 3EA9A 3OX7U 3UWIA 1K1OA 1FN8A 1TNLA 1D6WA 1EAXA 2BDIA 4QT8C 1P2OA 2SGEE 5EPNA 3RXCA 1TNKA 2F9NA 1SHYA 1THRH 2ZTXA 2VH0A 1WBGB 1BRAA 2CHAB 1NS3A 3ZVGA 2FOBA 1S82A 1C5SA 1O3GA 3VGCC 2G5VA 1TNJA 5HKKD 2Z3DA 1BTXA 3OSYA 3W95A 2AYWA 1W13U 3ZIAD 1F5LA 1WDIA 3A83A 3UB0A 2STBE 1HAVA 5F6MA 2OTVA 1E38B 1OS8A 5EGMA 1TLDA 1LPKB 3GCHC 5HIZA 1LKBA 4CBNA 3GY8A 3H5CB 1AE5A 1KTTB 1BITA 1LHGH 1ELVA 3M3TA 3ZV8A 1VJ9U 1FAKH 2BDAA 4F48B 2ZCHP 1T31A 1TFXA 3DSGA 4K60A 8LPRA 4AZ2B 4WH6A 2O8LA 3RU4T 5JDUB 2KAIB 1BJVA 1UK3A 1OKXA 1DWCH 3ZYDA 1EASA 4MNVA 4AG1A 3UR6A 3A8DA 1KXAA 1B5GH 1HDTH 2UWPA 1ANBA 2Q6FA 3STJA 1S6FA 1D4PB 1VITG 1K1NA 1C5OH 1G32B 1QY6A 3BTFE 3SW2B 3Q3XA 2IJOB 4FU8A 1HPGA 4SGAE 1GCTC 3SV7A 1V2UT 3MH6A 5F03A 5CHAC 4RSPA 2Z7FE 1OWDA 1N6XA 2JH6D 5L2YH 1ZMJA 1KTSB 1JWTA 4I33A 3K65B 1A1RA 1NBME 4FUCA 2WUBA 2Z3EA 1BRCE 4IN1A 1O38A 2GZ9A 2H6MA 1FMGA 3ZZ8A 1MD7A 3G01A 4IBLH 1D3QB 3P8NA 1O2MA 1O32A 1EXFA 2GTBA 2FOFA 1NROH 4D9QA 3RXMA 2OC7A 5EQSA 2FO9A 1HJAB 1C1PA 1SFQB 2WV9A 4XBBA 4ZCNA 1CBWC 1C2MA 1CO7E 3UNSA 3ODDA 4OS7A 3N7EA 1GHBF 3GYLB 4O97A 3GY2A 4YM9A 1TALA 1O5EH 3UQVA 2AERH 3UWJH 3P17H 1GBMA 1QZ8A 2ZNKH 2D26C 2FOGA 1EZUC 5SGAE 2VJ1A 1CE5A 1UCYK 2OUAA 1EFRD 1NRRH 7KMEH 4GLYA 1BTWA 1EJAA 2FDAA 2GV7A 3MNXA 1GMCG 1K22H 1O35A 4AN7A 3U28C 3U98H 2FPZA 1GHAF 1TBQH 1TPSA 5E2PA 1MKWH 5DP6A 2ALVA 3ELAH 4B2BA 2F9PA 1HAVB 3V3MA 3VEQB 2YMSC 1HXEH 3KN2A 2WPMS 3AASA 3F3BA 1O2ZA 1ZHMA 3BSQA 1HNEE 2R0KA 2THFB 2ZPQA 4BXSA 1UVTH 1ARBA 1NRPH 1C9PA 2FOEA 3PTBA 1H8ED 3QO6A 3A7ZA 1WSSH 1SLVB 2AGIX 4DT7B 2TBSA 1C1WH 2PKSB 2BY8X 2ANMH 4GVUA 4FU7A 1W10U 4J1YA 4RKOB 5C5OA 1HAZB 1ZTJA 4RT1A 1SB1H 1XVMA 4K3JA 5C1XA 3D65E 5EODA 2GZ7A 3SBKA 4INKA 2A7JA 1Q2WA 1H8IH 1O2JA 2R3UA 1OWJA 3P8FA 3SZEA 1CA0C 5A09A 2A5AA 2BHGA 4AGKA 5HYOA 1P8VC 4GCHF 4WY3A 1A5IA 1EOLA 2BLVA 1TX8A 3S9BA 2ZDMA 2KCAA 2ZHWH 1AVGH 1QIXB 2FMJA 1B0FA 4ABEA 5K0HA 2EI8A 3ATWA 2SGPE 4NWKA 1C5YB 3HK6B 1GI9B 1ZSJA 2JKHA 3P95A 2TGPZ 4IS5A 1L4DA 1YM0A 4NIYA 2WINI 3SUDA 1KXFA 1MCTA 2VGCB 2XBWA 3N7OA 1GHXH 4XE4A 1QR3E 4BAOB 3F68H 3EA7A 5DK1A 2QF5A 2B8OH 3U8TH 1MTNC 5DPAA 2ZGCA 3IWMA 1O2RA 1HB0B 3NPSA 4X2YA 2Z6BD 2K0QA 3PWBA 1KLJH 1FY8E 2ZU2A 4F55A 4AFQA 2A5KA 1V2VT 3M5NA 2EC9H 4MNYA 4UEHH 1C5ZB 2C93B 5IYTA 1DWBH 5EJLA 3DUXH 2H2ZA 1UK4A 1GVLA 5G4BA 1T8MA 1HAYB 1BCUH 2PW8H 1AVWA 4NGAH 1FIZA 1VCQA 3GYMA 2XCFA 4ZKRU 1Q31A 5C2ZA 5DKMA 4XRNA 1Y3YA 2F9OA 3M7UA 1BB0B 1DXWA 2ZHQH 4WMFA 2C3SA 1RTLA 2QE7D 4AX9H 2HWLB 3SHCH 4ACBA 3BTGE 3SV2H 5HM9A 2ZDLA 2J5UA 2FI3E 3S9AA 3UUZA 3RXIA 2ZU5A 1T8NA 1Y3UA 1ZYOA 1QFKH 1G2MA 3OYPA 2A7HA 1MTUA 4IC6A 4X8UH 2FWWA 3RXHA 3RU4E 3ATKA 3U8RH 4MG3A 3OEHD 1UVPA 2OBOA 3TJNA 3T5FH 1C5PA 1K2I1 1W3CA 3URCA 1AZ8A 1T4UH 3A81A 2LPRA 1FY3A 1AN1E 4Q80A 4A1TA 4TWWA 4WWYA 1QRZA 2BD8A 2W7SA 2V0BA 2WUCA 5F8ZA 3SI3H 3V7TA 1BTUA 3KQBA 3M5OA 1LVMA 2ZIQH 1GWAA 4Y8YA 1GBKA 1QURH 3EA8A 1DSTA 1V2JT 4SGBE 3LOXA 3RXLA 4HTCH 6GCHG 2QAAA 2XW9A 1XUHA 3U69H 2BY5X 1MMJN 2ZDNA 1C2DA 2YMSD 4CH2B 1GBIA 5JBBS 1EQ9A 2H9EH 2A31A 1C1OA 2ZQ2A 4M7GA 3TK6A 1E0FD 1FONA 5GIBA 2F9UA 1HXFH 2P93A 2R3YA 3BG8A 5EQRA
chains in the Genus database with same CATH topology
4AORA 2ZFQH 3TGIE 1UTLM 4ZXXH 4FUEA 1Z6EA 5GWZA 2VH6A 2CN0H 2H5CA 2FOHA 1P09A 5HMAA 1QL7A 2PSXA 2XC0A 5GXPA 1VITF 2HNTE 3T26A 3E90B 3URDA 1VITH 2ZZUH 2CHAC 3RMLH 1AHTH 1YCPM 4JYVH 5DGJA 1GJAB 3T28A 4JZ1A 3P6ZB 1C2HA 1QL9A 1PQ5A 1EAIA 1AU8A 2WPJS 1TPPA 2BY7X 1O2XA 1TOCB 4H42U 3SNEA 8GCHG 5LPRA 3DA9B 4Y7BA 4UFFH 5ABWA 1DX5M 4BAKB 1QQ4A 3STIA 2GDDA 2EA3A 2FS8A 2QIQA 4WXIA 1K1JA 1N1LA 1DUAA 1H9IE 1TOMH 2IOTA 3V12A 1V2WT 2TGAA 1KIGH 1C5NH 2A4RA 3VB3A 5JB9S 1J16A 1TGTA 1P02A 4MPVA 3S7KB 1TGNA 2P16A 4BTIB 5EXMA 1GHVH 2FLBH 2FOCA 1O2NA 4NA9H 3A8CA 1WOFA 1QQUA 1GMCF 1ZTKA 4MVNA 1A2CH 3KL6A 4VGCB 1BTZA 1F0SA 3TK9A 5FCRA 1MD8A 4I7YH 2YNBA 2GGVB 3RXEA 4OGYA 3HGNA 5F8XA 4CREA 3RU4D 4NIXA 2Z94A 1TBZH 1BBRK 4UONA 3QX5H 1NRQH 1O3HA 2IN2A 3TU7H 1EJNA 2NU1E 1GVZA 1ANEA 1C4U2 1RXPA 1BIOA 2A1DB 4A7IB 1SGNE 1TIOA 3M61U 1O3DA 2BDYA 3BTQE 3UTUH 3MNCA 2FI4E 2ZTZA 1FLEE 1NU7B 3LGWA 3KHVA 1E34B 4ABHA 1OPHB 5TJXA 4YOGA 1CU1A 4Y8ZA 2FP7B 2PLXA 1IQFA 2AS9A 4X8VH 4D8NA 4NG9H 1O37A 1KDQA 1SGRE 1ZPCA 1LVYA 1HJAC 1MBQA 1Z6JH 2BVRH 4INLA 1XMNB 1GVKB 2P3UB 3SJ8A 3A87A 3A86A 3MHWU 1QB6A 2O8TA 5JBAS 1GBBA 3A7VA 1AE8H 2W3IA 2P8OB 3EGKH 1GBLA 4IN2A 1O3BA 1UTKA 1AWHB 4ZXYH 4I8LA 1LHCH 1HJ9A 1SL3A 1YPHE 1WU1A 4I8KA 1HUTH 1TWXB 1EPTB 5ESBA 3F6UH 4H4FA 2A4OA 1THSH 1L1GA 3ZZ6A 2ZHEH 1S0RA 2W5EA 1UVSH 1HAPH 4DURA 5GCHG 1TYNA 1LKAA 1XUGA 4U01A 1H9HE 5ETXA 2VWLA 3S7HB 1IQMA 1UTPA 4A6LA 1GBFA 1EZQA 1DE7H 2UWOA 4GUXA 3QZRA 3Q3KA 2ZG0H 1W0ZU 4BAHB 2PKSC 3RXFA 1W0YH 1C1TA 4HFPB 3ZV9A 1GL0E 2VIWA 1P2IA 1CGIE 2KAIA 1HLTH 1SLXB 3MOCA 2ZHDA 1Y5BT 4JZEH 1NRSH 1THPB 2BVSH 1ZHPA 4NSVA 4B2CA 1DFPA 4YZUA 3SJKA 1HIAA 2QGRA 1SLWB 5C5NA 4K8BA 1O5CB 1S0QA 2BD9A 3O8DA 5TCAA 4UD9H 1ZLRA 2FOMB 3NUMA 4B73A 1LCYA 1C1VH 2F9BH 4HI3A 4WVPE 1SVPA 2VIDA 2RA3A 1ELAA 4K1EA 1KXEA 3LC3A 1ZSKA 3RP2A 1G2LA 4FUJA 2HRVA 1NFYA 4X1NU 1K1IA 5C67A 1ETRH 1QCPA 1UMAH 4U2WA 1B7XB 1TAWA 1TQ0B 1GDUA 4Z6AH 1OWEA 2A2XH 4DIIH 1DLKB 1VCPA 1DY8A 1KDQB 1GI7B 1O2KA 4NA8A 2Q6GA 4UE7H 1ELCA 1DT2A 2VGCC 3D62A 4KGAA 4KP0A 1B0EA 3R3GB 1GI0A 2VU8E 5EQQA 4O3UA 4ABGA 1EAUA 1OXGA 1A5GH 5BRRE 3O8RA 4ZKSU 4CR5A 2HLCA 5FPYA 2ZTYA 1AGJA 4WMEA 1P3EA 4TYDA 3ATLA 1F5RA 2HGTH 3NK8A 3SU4A 1UTOA 3B8JA 1JMOH 2RA0A 2G81E 1O0DH 1ABIH 4X2XA 4XDEA 2ZFPH 4Y10E 1KSNA 3PYHA 1MBMA 1O2VA 2BD7A 1V2LT 3FP6E 1SPJA 2BOKA 1A3BH 3BIVH 4JZDH 1C1RA 1GGDB 5K7RA 1SOTA 2ZECA 3SU3A 4NWLA 3RXAA 1UTJA 2UUJB 1BDAA 2ZGBH 1FI8A 1P2QA 2V6NA 2PGQB 2SNVA 5GDSH 1K21H 1IQKA 3SU5A 2FXRA 3KIDU 3CENA 1IQGA 3OTJE 5A8YA 1J15A 4YOIA 3L3TA 1JRTA 1K9OE 4AOQA 1FIWA 3RMNH 1IOEA 2F91A 5FHTA 3GICB 4X6MA 1GG6B 2FODA 1TA6A 1YKTA 6CHAB 1HIAB 4ISLA 5DP5A 3M5LA 3ODFA 3TH2H 1BA8B 1A4WH 3L6PA 3SU2A 3DFLA 3S69A 1BT7A 1DWDH 3NWUA 2HOBA 1C9TA 4B2AA 1GBDA 1JIRA 1IQHA 4FVBA 3PLPA 3RXPA 1NM6A 4DG4A 4UFDH 2ZGJA 1TGSZ 1UTMA 4MDSA 1HAIH 2I6QA 3MO6A 1LQEA 3T25A 4TY7A 8GCHF 4Y0YE 3SQHE 2ODPA 1HFDA 2FESH 4TWYA 3TGJE 1O31A 3C27B 3RXSA 1IQJA 1C1SA 4FUDA 2G8TA 2Z9JA 2BX3A 1RTFB 1ACBE 1C5VA 3HK3B 3LIWA 2BYAX 3U8OH 1RD3B 2Z9GA 4Y79A 3A82A 1F7ZA 1YP9A 3I77A 1W11U 3H7TA 1C4V2 1AB9B 2BLOA 4D9RA 5AFYH 3L33A 2VIPA 1G3DA 2F83A 3LJOA 3ZZBA 2XWAA 3IG6B 1ZMLA 2FZZA 2O9QA 1QGFA 1C1NA 1GI4A 2ODQA 3RXQA 5FPSA 1MTVA 3DD2H 2H9HA 2WPHS 3E6PH 1OP0A 1ZGVA 7LPRA 4X1QU 1LPGB 2Y7XA 2QC2A 1FNIA 1L4ZA 4AB9A 4Y76A 1P12E 1JRSA 2ANWA 2O8MA 3AW1A 1PPZA 3MNSA 5CE1A 1PJPA 1TONA 3QZQA 3RXOA 1DDJA 1O30A 3FZZA 1HAXB 1W2KH 3H7OA 2AGGX 3RUOA 3VXEH 4H6TA 3V13A 1GI3A 3P92A 3PB1E 4Q7ZA 1SG8B 5LGOA 2VWMA 3UPEA 2NWNA 5HXFA 1SMFE 2AMQA 1C5QA 5ESTE 4DGJA 1UTNA 3S9CA 3SJ9A 4XFQA 4NZLA 2FIRH 3PMJA 2HALA 2TGDA 1UVUH 4XSKU 3A89A 1GJDB 2XTTB 2K1QA 1O2QA 1C5TA 1O3IA 3SOSA 1YPKH 2ZWLH 2RCEA 1OYTH 3HGPA 3SV6A 4YLQH 3FP7E 4Y6DA 2PR3A 5TCCA 4E05H 4NZQA 2VNTA 3SN8A 1JOUB 1IHTH 2XRCA 3ZVCA 5C1YA 2ZDVH 1RJXB 2ZDAH 1YLDA 1GI8B 2SGDE 2BMGB 4VGCC 1XKBC 2Y7ZA 1FN6A 4WF8A 2J38A 1O5BB 1GCDA 3CS7A 2BZ6H 2ZQ1A 1MU8B 1RGQA 1AIXH 2GCHF 2VVUA 2VWNA 5GCHF 3MU4A 3SGBE 1FQ3A 5I46H 1PFXC 1V6DA 1XXFA 3K2UA 2LNCA 2CF9H 3MH4A 1ZPZA 3BEFB 1UVOA 3BTKE 2QXIA 3A7TA 4XBDA 1CT4E 1C1QA 5T3HA 1V2OT 1GDQA 1EUFA 2G51A 2Z9IA 1AI8H 3W94A 1CT0E 1GMDF 1O36A 1ANDA 4MTBA 1A0HB 3FANA 1ELGA 1ORFA 2OP9A 3EDXB 5A0BA 1W7GH 2H9TH 1DS2E 3ATIA 1MCVA 3K9XB 4CRAA 5HGGA 1JIMA 1LO6A 3P70B 4I31A 1RFNA 3QWCH 2Y81A 1FJSA 4K69A 4ABBA 4DCDA 2ZFFH 3LC5A 1RTKA 1ZJKA 3B23B 4X8TH 5I25A 1O3PB 2NU2E 1C5LH 5E8EH 1CSOE 2R9PA 1ZR0A 5PTPA 1FZZA 2P8OC 4D7GA 3MFJA 3QGJA 3SUFA 5L6NH 1Y8TA 1GBJA 1S5SA 3MU1A 4FUFA 1Z7KA 1XUIA 1YLCA 2I6SA 1WYKA 3RXKA 7GCHG 3MTYA 1QRXA 4TPYA 4JZFH 2SFAA 2BOHB 1EPTC 4AYVB 4LOYH 2FTMA 1K1PA 4ABJA 2WPIS 4X1SU 3FAOA 3UNQA 4BTUB 2BX4A 1VR1H 4NA7A 4OS5A 4O3TA 1YCPK 1QNJA 2NU3E 2J34A 2ZU3A 2J94A 4DVAU 1GPZA 3RXUA 1T4VH 3KF2A 1IQIA 3MH7A 1FY5A 1NFUA 3UOUA 1SQAA 1DVAH 1F0TA 1V2TT 2Y80A 2GV6A 1QHRB 1SGFA 2PWXA 3NXPA 1FV9A 4MPUA 2Y6TA 1EATA 3E3TA 1EOJA 1O2TA 5EW2H 1QA0A 1O5AB 1SGQE 2H1UA 1O5DH 1VJAU 3I78A 2HNTC 2AIPA 3M37A 5LPEA 1PPHE 1O33A 1Y59T 1YPJH 3RXGA 1XUJA 2BXTH 1AFQB 3HKJB 4ABFA 4D7FA 3KQCA 1GDNA 2D1JA 1EJMA 4I8HA 5DP9A 2FX6A 1NFXA 3A7WA 4THNH 3ZVDA 3T2NA 9LPRA 2XBXA 2WYGA 1UCYE 1TNGA 2PFEA 1RRKA 2UUKB 3S0NA 1BMNH 4BAQB 5E0GA 2P59A 3BF6H 4I32A 2G5NA 1AVXA 4B74A 1C5MD 3NCLA 5T6GA 1MQ5A 1ETSH 1O3OA 1W7XH 1Z8JB 3FFGA 2VINA 2BQWB 3RMMH 3SV8A 4AFZA 5LH8A 3T62A 2A0QB 3QUMP 4H6SB 2NU0E 4X2WA 5E0HA 1OSSA 1UCYH 2VVCA 4JZIA 3ZZ9A 1SGCA 1MKXK 1O39A 3LONA 1BHXF 2W26A 4DIHH 4I8GA 4LZ4B 4K1TA 2B7DH 3RXRA 3ZVEA 1ZOMA 1V2ST 2GD4B 1GHYH 4O9VA 3SQEE 1QJ1B 1SLUB 1EPTA 2Q6DA 1XX9A 1S81A 1QBOA 1WV7H 2D8WA 5A2MH 3LGVA 1GHWH 1NTPA 3MYWA 2J2UA 3M3VA 1GGDC 2OXSA 1TE0A 4DW2U 1FDPA 2F3CE 1HAHH 3DFJA 3K6YA 3RLYH 1IQEA 1V2MT 3TK5A 4K2YA 3RXDA 1MU6B 1NO9H 1A3EH 1SFIA 2QV1A 3M36A 3SNCA 2ZU4A 2GZ8A 1QTFA 3VB4A 1WQVH 1BMLA 1MH0A 1F92A 1DPOA 1T8LA 1YPEH 1LVBA 1GG6C 2PKAA 1G37A 2ZCLP 2OCVB 1C2EA 4MNWA 6CHAC 1ESTA 3RXJA 3LT3A 1AZZA 2AMDA 8KME2 3ZVBA 1GHBG 5C20A 1OWIA 3BV9B 2OD3B 3WY8A 1O3LA 5FAHA 1KLTA 5DP8A 2TGTA 2ZC9H 2XNIA 2EI7A 3BIUH 1HV7A 1V2RT 5EW1H 3A88A 1QA7A 2ALPA 4JYTA 1HBTH 2BD4A 1A5HA 5EXLA 1P9SA 4MPXA 1SQTA 4R8TB 2UWLA 2WV5A 1ABJH 4ZHLU 4KTUA 4ABDA 4WXVA 1Z71A 1Q3XA 2V3OH 3A80A 3C1KA 3PO1B 1GHAG 2ZHFH 1YPHC 2OLGA 3LU9B 5EG4A 1DLEA 3VFEA 1P11E 3SO3A 9ESTA 4UFEH 2ZU1A 4X2VA 3UREA 1E36B 4GHQA 1P01A 1XKAC 1LTOA 1T32A 4U32A 1ZHRA 1GBEA 1AB9C 1EKBB 2Y82A 4AGJA 1ZJDA 3D23A 4OGXA 4YO9A 1V2KT 2A5IA 1O2SA 4Y71A 1LHEH 1XXDA 1A46H 1DXPA 4B1TA 1IQNA 3ZZ4A 2FX4A 5FX5A 1BOQA 1TQ7B 1UK2A 3AW0A 4A92A 3ESTA 1NPMA 2XBYA 1K28D 5B6OA 1E35B 2DE9A 2Q1JA 2BB4A 1ZZZA 1ZSLA 2D2DA 6ESTA 1LMWB 3ATMA 2Z3CA 1BTYA 3MMGA 4GHTA 3F9FA 1C2LA 1MKWK 5EXNA 1P0SH 1N8OB 1TRYA 2R0LA 2ZKSA 4JYUH 4ZROA 3ZVFA 1W14U 1O2OA 1OP8A 4IMZA 1P2MA 4CRFA 1PYTC 1BTHH 4GCHG 4NFFA 5A0CA 3TJOA 2A7CA 2XC5A 1AMHA 3TJUA 1J17T 2M5TA 3LH3A 3E0PB 3NZIA 4X1RU 3QTOH 1OX1A 1G30B 4BNRA 4ISHH 3B9FH 2JETB 2PKAB 2VIQA 2ODYB 2GX4A 1YPLH 1G3CA 4Q7XA 3BTWE 2CJIA 2BDGA 1MUEB 2BXUH 2W3KA 2XBVA 4NFEA 2PV9B 2CXVA 3ENSB 1DOJA 3GCTG 4GSOA 1PPBH 1D9IA 4A1VA 1QB1A 2PTNA 4FUBA 3RM2H 1L2EA 3K6ZA 1ELFA 2GCTB 4ABAA 3ZZAA 5AFZH 2QXGA 1AUJA 5AVDA 3A84A 2OINA 3BG4B 3MU5A 4ZUHA 3ZZCA 4RKJB 1BZXE 3A85A 4ZAEA 1GJ5H 4CH8B 1SGFG 1XVOA 1ANCA 1K1LA 1C1UH 1CGJE 4HGCA 1SI5H 1VZQH 2C4FH 5JB8S 1GBCA 4D76A 2TRMA 3GY7A 1F5KU 3E8LA 2P95A 3RLWH 2R2WU 2ULLA 3PTNA 1MAYA 3MU8A 4ZHAA 3TLOA 4A1XA 1Y3WA 2AH4X 1C4Y2 4K5ZA 4F4OC 4IW4E 4CR9A 1TMUH 1O2IA 1Z1IA 1AQ7A 2ZEBA 5E2OA 2AFQB 1SSXA 2OQ5A 4ZKOU 1QJ6B 1J14A 1FY4A 2SGQE 1QRWA 1YPGH 6GCHF 1ZRBA 1H9LB 4X0WU 4ZKNU 4CHAB 1WCZA 3ITIA 1TMBH 2WV4A 4IMQA 4FU9A 1K1MA 4I8JA 2CF8H 1SOZA 3AAUA 1MKXH 3OY6U 3BTEE 2VIVA 4NSYA 3SU0A 2ZGHA 1LHFH 3LGTA 1J9CH 1NY22 1W8BH 3Q3YA 5HM2A 1BRUP 1NRNH 3E16B 3GY3A 3SUGA 2EI6A 5DP7A 1KXDA 4BTTB 3KQEA 1JBUH 1YGCH 1BRBE 2G55A 1G9IE 5J4QA 3LH1A 1ELDE 1C5WB 1GBAA 4TPIZ 2AGEX 3F9EA 3KNXA 1O3JA