1OP0A

Crystal structure of aav-sp-i, a glycosylated snake venom serine proteinase from agkistrodon acutus
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
234
Chain Sequence
b'VIGGNECDINEHRFLVAFFNTTGFFCGGTLINPEWVVTAAHCDSTDFQMQLGVHSKKVLNEDEQTRNPKEKFICPNKNNNEVLDKDIMLIKLDKPISNSKHIAPLSLPSSPPSVGSVCRIMGWGSITPVKETFPDVPYCANINLLDHAVCQAGYPELLAEYRTLCAGIVQGGKDTCGGDSGGPLICNGQFQGIVSYGAHPCGQGPKPGIYTNVFDYTDWIQRNIAGNTDATCPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Venom serine proteinase
publication title Crystal Structures and Amidolytic Activities of Two Glycosylated Snake Venom Serine Proteinases
pubmed doi rcsb
molecule tags Hydrolase
total genus 60
structure length 234
sequence length 234
ec nomenclature ec 3.4.21.-:
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op0A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op0A02
1UHBA 2F9VA 4M7GA 2JETB 5CHAC 1P09A 5SGAE 2C4FH 1LCYA 1C5PA 2IOTA 4X1RU 4A7IB 3TH4H 2OBQA 3RU4D 1IQFA 2HOBA 2FESH 3NWUA 2GDDA 1JMOH 4K8YA 2FLBH 3MTYA 3QK1A 1GBLA 1NM6A 1P04A 1FY4A 1GBKA 1O2YA 2ZGCA 3B9FH 3ATLA 4TPIZ 3M7TA 3A8CA 4NFFA 5EXNA 2HNTC 3P6ZB 4TY7A 3U8TH 4K1TA 3A7ZA 5HM9A 3TJNA 2STBE 4MTBA 4OS7A 2J95A 1C5YB 3MU8A 1YGCH 3SO3A 1RRKA 1WOFA 4R0IA 1BRCE 1UVPA 2D8WA 1C2HA 2VIOA 2OC8A 2WPHS 2XYAA 2ZWLH 4CRBA 5CMXH 3L33A 1O2XA 3V0XA 1RS0A 1FN8A 2CV3A 1V2UT 3KHVA 4KKDA 2J38A 1BTXA 3GYMA 2Y80A 1O0DH 4QT8C 3BTME 3D49H 5C2ZA 1ANEA 3LH1A 2D26C 3KL6A 1GBMA 1GJ9B 1TFXA 1GHAG 1V2QT 3C27B 4JYTA 1HRTH 4NIWA 2GCHG 2Z7FE 3M3SA 1TBZH 5GCHF 2J94A 4ASHA 3MU0A 2OCVB 2R0LA 1TQ0B 1L2EA 1GGDB 1C1MA 1UVTH 2HALA 4ABFA 2F9PA 4FUHA 1GI6A 1VJ9U 1XUFA 1AVXA 4MLFB 3MNSA 3N7OA 4CBNA 3M3TA 3A87A 3SJ8A 1C5UA 1EJAA 3LGVA 1O2PA 3ZZAA 1S5SA 3URDA 3SU2A 2FYRA 1UVUH 3B8JA 2BY8X 3LC3A 5HXFA 1MMJN 3MO6A 4CREA 1YKTA 1EPTB 5FX6A 4X2YA 4K8BA 8GCHF 2QY0B 1C2JA 2Y7ZA 1KDQB 1AU8A 1HAOH 1BZXE 4Y8XA 1VCWA 1Y3WA 1CO7E 4ABAA 1V2OT 4ZXXH 2PV9B 3SJOA 1CQQA 1Z71A 4LZ1H 1BB0B 1O2UA 4UFDH 1NFUA 1TRNA 3M5MA 1AD8H 3ZZ9A 3F9GA 2FX6A 1GCTB 4DJZB 1GMHF 3RXIA 1MTVA 2PKSB 1BTZA 2STAE 4MPXA 1N8OB 1W7GH 2BD5A 4B2AA 1GG6B 1QA0A 4ZKNU 4CR5A 1ESTA 4KTUA 1SGTA 1BHXB 3GY7A 3R3GB 1QNJA 2FPZA 4O03A 1GPZA 1MBQA 1ANDA 3VB3A 3M3VA 5CHAB 3SNDA 1KXDA 1WYKA 3TH2H 4DIHH 2FI5E 1BTUA 1GDUA 3E6PH 3KEEA 2JH5D 3ZVFA 4JK6A 1UTOA 4UFEH 1EAWA 1SC8U 1GBJA 4A1XA 1BJUA 1GHXH 2G00A 1HAIH 1AWHB 1JBUH 1V2TT 1MU8B 1V2MT 1WAYB 3KQBA 3RXJA 3NK8A 1OWHA 1HAGE 2WPKS 4YLQH 1VGCC 1EATA 1ELVA 4IC5A 5FHTA 4MNWA 3RLWH 4AYVB 2G51A 1RXPA 2QF0A 5EGMA 4K60A 1C4U2 2AIPA 2Q6FA 3GCHC 1UHBB 1EJNA 1DLKB 4YZUA 3TK6A 3OYPA 2ZFFH 3Q77A 4UE7H 5GIBA 3HKJB 1KSNA 5L6NH 2H5CA 2GZ9A 1VITH 4D76A 2P93A 4DGJA 3CENA 5DK1A 1ESBA 1HGTH 2M5TA 2WUCA 2ZHQH 1MQ5A 4J1YA 1C9PA 4JZEH 5FCRA 5GXPA 2C8YB 2FOMB 1LDTT 1NT1A 4X1PU 3RXGA 4I31A 2QXGA 4CRFA 3U1JB 2OQUA 3URCA 3MFJA 1T4UH 3EYDA 1O3NA 1GHWH 1TABE 2VWMA 4ABHA 1EJMA 1GBCA 2B9LA 1L1GA 1O3LA 1TGBA 2CHAC 2VWLA 1ETRH 5AVDA 1PPBH 1NN6A 1PFXC 4RKJB 1C1TA 3V7TA 1BTHH 4H6TA 1GHBF 1DY8A 4MNYA 2PFEA 1YLDA 1YLCA 2UWLA 1ZHPA 3BN9A 3PB1E 1Y59T 3H7OA 4DOQA 3RXHA 2BOKA 4PROA 3S7HB 2EI6A 2NU3E 2A5AA 2CXVA 3SNBA 3SN8A 3T26A 3RXKA 4CH8B 2GD4B 1PQ5A 1P2QA 3F9HA 1ZPCA 2VNTA 5PTPA 2XBVA 1T32A 2V3OH 2A32A 1C1SA 7KMEH 2BOHB 4Y6DA 4GCHF 2ZFQH 1O5DH 1MD7A 1EKBB 2ZHFH 1AFEH 3MOCA 1K1MA 1HAVA 4J2YB 1DSTA 3V3MA 1B0EA 2VB0A 3L3TA 5DGJA 3HGNA 4DT7B 1MZDA 4WH8A 1TA6A 1SHHB 3GDSA 2VU8E 1LHCH 1G3DA 2ZHWH 3OX7U 3ENSB 3Q00A 4ABEA 2ZFSA 3W95A 1CU1A 2FEQH 3EAJA 1K22H 4BXSA 4INHA 1NO9H 1QL8A 1GMCF 1HJ9A 5AHGH 1RIWC 3GISB 3DHKH 3B23B 1MKXK 3NUMA 2J4IA 2UUJB 3P8OA 1GI8B 4TYDA 4ZHMU 4ABIA 4FUBA 3GCTF 1DWEH 3MMGA 2ZG0H 2Y5FA 5E2PA 1PPGE 1PYTD 2OTVA 3QX5H 4ISOA 2WV5A 1OS8A 1LO6A 1WQSA 5E0GA 1EX3A 1P0SH 1GL0E 3ATIA 2ZHEH 3STIA 2FTMA 1JRSA 2O8MA 5GCHG 1AKSA 1A5IA 1ETTH 4LZ4B 1L4ZA 3BIUH 1QIXB 1IQMA 3VPKA 1ZJKA 4U2WA 4XBDA 1CHOG 2ANKH 5AFYH 1TNGA 3GCHB 1SB1H 1TQ7B 3CS7A 3CS0A 1LHEH 1Y5AT 4NIYA 1F0TA 1QB1A 3GOVB 1ZHRA 4ZKRU 4AFQA 1IQIA 1LKBA 1KY9A 5F6MA 4Y11E 1CT4E 1C2KA 2OXSA 1AUJA 1SOTA 1P12E 1QR3E 1ZOMA 2BD4A 1T7CA 2WPJS 3QLPH 1EB1H 1O36A 1EAUA 1Y5BT 5GDSH 1O2TA 3I77A 2A2QH 1MUEB 5A8YA 1BTYA 2ZC9H 1XKBC 4GVUA 1FMGA 1F5RA 4TPYA 1JOUB 2ZECA 3PMBB 1X7AC 1UTKA 5F8XA 2H5DA 2Z3CA 2H1UA 1P2KA 3O8BA 3BEUA 2ZCLP 4K2YA 1GHAF 1O31A 1G36A 1QRZA 1FJSA 1YF4A 3ZZ8A 2CHAB 2GCHF 2JH6D 3HGPA 4Z0KA 1OWIA 1DWBH 3RMOH 4AG2A 1V2VT 2VIPA 1C1RA 3NPSA 1TPSA 1WTHD 1BA8B 3LGYA 2Z6BD 1ZLRA 3P8GA 1TWXB 1NC6A 2YOLA 1TNLA 4ESTE 3VFEA 4FU9A 1WUNH 1T4VH 4E7NA 4KELA 2J92A 4K5ZA 1KXFA 1DE7H 3MH5A 4XBCA 4CH2B 2JH0D 4ZHAA 1U6QA 1GI1A 1TPOA 2BDAA 8LPRA 1D9IA 2A2XH 1C2MA 4NZQA 1K28D 5EPNA 3SV2H 1UK4A 1DS2E 4FU7A 1ZYOA 2R3YA 1ABJH 3PWCA 1UTLM 2Y6TA 1UTJA 1FY1A 4XOJA 1C5TA 1EP6A 2ZFPH 3RXRA 4ABBA 1YCPM 4X8UH 2BD3A 4B2BA 2XC4A 3A83A 3P8NA 4WY3A 4B74A 4Y0ZE 1YPHC 4BTIB 2AERH 1L1NA 1QB9A 1O32A 1RIWB 1O30A 2H9EH 5F03A 3A8DA 4X8SH 4B76A 3TJOA 4H4FA 1AZ8A 3EA8A 2PW8H 3IITA 4MNXA 1D3QB 1O5AB 2ULLA 4AOQA 4AYYB 4BTUB 1PPHE 1UK3A 1HAVB 1Y8TA 2P94A 2W5EA 1K1NA 1EOJA 1THRH 1O33A 1BITA 2GCTB 2P95A 1PQ7A 2GV6A 3SI3H 4NGAH 4A92A 3BG4C 1ZPZA 1S81A 1PJPA 3LGUA 5EU8A 3PLBA 3ZYDA 1Y3XA 1P8VC 2P8OB 2VIVA 3PTNA 1TBRH 1SGNE 1QCPA 5JDUB 1VJAU 2FOHA 1O5CB 1KDQA 1GBAA 9ESTA 1PYTC 1GHBG 1O3AA 1P9UA 2BY5X 3ELAH 1FONA 2BDHA 4KTCA 3RXOA 1XX9A 3P8FA 1C2GA 1GBEA 2Y7XA 1YPKH 4K69A 1EP5A 1CA0C 1ANCA 3U69H 1QJ1B 1ZTJA 3HK6B 2B8OH 1O2HA 1PPCE 5A8XA 1QL9A 3RXQA 1O2RA 1DPOA 1SLXB 1GI2A 1HAHH 1O34A 2EC9H 1IQNA 2J2UA 1AKSB 3MO3A 4IGDA 4I8HA 4FXGH 3RXTA 4CR9A 4NIXA 5I46H 4GCHG 2XCFA 3D62A 2P16A 3E0NB 4JZ1A 5C3NA 4YOJA 3S9AA 3UIRA 1A3BH 3PTBA 5A2MH 4IC6A 1C2IA 1GJ8B 1SGFG 4CBOA 2BY7X 5IYTA 4E05H 1HLTH 1O3IA 2BYAX 3M7UA 4WF8A 3FVFB 1QJ7B 2W7UA 1YCPH 3S7KB 1CGHA 1Z8JB 3E91A 1IOEA 3QUMP 1O35A 5FAHA 4FU8A 1O2SA 3F9EA 1D3TB 1DLEA 2TPIZ 4X6MA 1C1QA 1N8OC 2C90B 1TPAE 1LPKB 4YT6H 1YCPK 2ZDAH 3MU4A 4D7FA 1C5LH 1HXFH 2H2ZA 2BD8A 1JIRA 3A88A 3SU3A 1JWTA 1FUJA 3ESTA 4A1TA 1DDJA 1KXAA 4O97A 3KGPA 1C1PA 2SGDE 3AAUA 4DCDA 1A61H 2AEIH 1KLIH 2ZPQA 2B7DH 1UCYE 3LIWA 2PR3A 4DIIH 5E0HA 5JPMH 2A1DB 4YTAA 2ZDNA 1HYLA 4BAHB 4AFZA 1O39A 1DY9A 3RC5A 4D8NA 5C5OA 2F9UA 1V2NT 3LJJA 1OP8A 2HWLB 2AGEX 2F9NA 4U01A 2FODA 1OXGA 1OWDA 4X6OA 1DFPA 4LXBH 1ZTLA 3AW0A 3FP7E 2GT7A 3QN7A 2BDIA 1XXFA 2VGCC 5C5NA 5JYIA 1C2LA 5C20A 5E2OA 2THFB 1HJAC 4JZIA 1HFDA 1K9OE 3SORA 2AMQA 2XBYA 1HCGA 3ZVAA 1FY5A 1TMUH 1LTOA 5TCAA 3RM2H 4ISHH 4IW4E 1BTWA 1YPMH 3V12A 1TX7A 3MH6A 1MQ6A 1ZMLA 3RXUA 4Y0YE 3RM0H 3BG4B 2CN0H 1AY6H 1F92A 2FX4A 1V2ST 1GBBA 1DUAA 1SHYA 4WJG2 5EQRA 2R2WU 2PHBA 4NG9H 3UWJH 3GY2A 1UCYK 4A6LA 2PTCE 1LHGH 1YPHE 1UTNA 2QIQA 2LNCA 4JYVH 1DT2A 2ZA5A 1IQEA 3TH3H 1IQHA 1YPEH 2OC1A 3QO6A 1CHOF 4I32A 1EZUC 1IQGA 2FS9A 3BTGE 3KIDU 1DXWA 2ZDVH 4UD9H 2AS9A 4FVBA 1W12U 1FZZA 1CA0B 2ZP0H 1Z8IB 3UR6A 4X2XA 1EZSC 4AB9A 2XNIA 4IMQA 3VB4A 2O8TA 2LPRA 3PWBA 2VWNA 4BANB 1Z6EA 3LPRA 3TNTA 3RXPA 4LK4A 1AO5A 2ASUB 3OU0A 1Q31A 3SGAE 2Z9LA 4THNH 3M35A 4D9QA 2ZU5A 4I8LA 3SU1A 2V35A 1ZR0A 1H9IE 2V6NA 5LGOA 1K21H 1BRAA 5B6OA 1OWJA 2CF8H 2SGAA 2QA9E 2ZDKA 1DXPA 3QGNB 1P57B 3HATH 4BAQB 1GI0A 5EXLA 2QXIA 2FOEA 4YO9A 1LPZB 1E35B 1RTFB 3QZQA 2TIOA 5DP4A 3R0FA 2ZCHP 1P2NA 2G4UA 1GDNA 1GI4A 5C1XA 1TALA 1UO6A 4RKOB 1TMTH 1GCDA 1C5OH 2A31A 5DJ7A 3SUGA 1HJ8A 1EB2A 3A8BA 3A84A 1V3XA 1TGCA 5JBTA 1H1BA 1A4WH 1W8BH 4CRGA 1H8IH 3VB6A 2OINA 1G3CA 5DP7A 3RP2A 1DX5M 1O2MA 3SU5A 4AX9H 2SGQE 1AB9B 1A5GH 4BXWA 1XUKA 1FN6A 1GVKB 3UNSA 6ESTA 2PGQB 1TX8A 1HAXB 3UUZA 3RXMA 1SGDE 3ATWA 3BIVH 2D2DA 1T31A 1TE0A 3ZV8A 1O3HA 3FZDA 3RXVA 1ELTA 4B1TA 1DUEA 4HZHA 1OWEA 1DVAH 1GBHA 2ODQA 1ARCA 1UMAH 2FS8A 1E36B 2BY6X 1LPGB 4Z6AH 1HAYB 1IHSH 1TRYA 2OLGA 3A80A 1SGCA 2FTLE 4AB8A 2ILNA 1A3EH 3ATMA 3A7VA 3OTJE 3ODFA 2WINI 1PQAA 4I33A 1TB6H 4Y7AA 2VGCB 2A0QB 4X6PA 3MNXA 1QFKH 2ANMH 1HJAB 2HPPH 2O8UA 3OSYA 4AGJA 3ZZ3A 1VCPA 1O2IA 1CSOE 1TLDA 2QGRA 3MH7A 1TX6A 2GZ7A 2FYQA 1ZRKA 3KN2A 2FI4E 3ITIA 5GJ4B 4FUCA 3MWIU 2AMPA 5I25A 1B7XB 1O2NA 2GTBA 1LMWB 3M61U 3MU1A 1ELBA 3T27A 4ZKSU 1BIOA 2BLWA 1C2DA 2FO9A 5F8TA 2BMGB 4HTCH 3FFGA 1QTFA 2HNTE 3JZ1B 4X2VA 2P59A 2Z94A 2SGPE 1ZSJA 3K6YA 5DPAA 4O9VA 3QTVH 4ZROA 3MO9A 1WV7H 1L4DA 1O5FH 3Q3XA 4B73A 4MNVA 4I8KA 1DM4B 3FP6E 3T29A 3QTOH 2I6QA 3DT0H 1M9UA 1ZGIA 2EI8A 3LGTA 1W0YH 2FLRH 1V2JT 1P3CA 1C5ZB 2ALVA 4CRCA 1O5BB 2TGDA 1DOJA 6GCHG 1S6FA 4X1QU 1ELCA 4D7GA 2RA0A 3P92A 1C4Y2 1MTSA 1VCQA 3L6PA 4SGAE 3UNRA 3QZRA 1SFIA 4I7YH 4JZDH 4DW2U 1GI3A 4DURA 1ZJDA 1CBWB 1UTQA 2BTCE 1NU9A 2FWWA 2GP9B 3SU6A 2ZO3H 4XDEA 1KIGH 1MKXH 2XC5A 3SJIA 1W11U 3TVJB 1NRQH 2GX4A 3H7TA 3TIUA 1GJBB 4IBLH 1OSSA 1GL1A 1AGJA 1B0FA 1ZPBA 2ZFTA 4XSKU 1VZQH 4X0WU 4E7RG 1MD8A 3TK9A 1GVLA 2OUAA 2ZDLA 2GT8A 1KTTB 1T8NA 4FVDA 2PKAB 1H4WA 1HDTH 2GZ8A 5DP9A 2BHGA 3SV8A 1N1LA 2ZQ2A 1SI5H 1ID5H 1UTPA 4X6NA 3VEQB 1MTWA 4NIVA 1FV9A 2GCTC 5K7RA 3LC5A 1BRUP 1NS3A 1UTMA 3E90B 5FCKA 1E0FD 1UVSH 2AIQA 2PLXA 1QBVH 1SLUB 1XUGA 2P8OC 2P3UB 1Z6JH 2C8ZB 1GJ4H 1LVYA 1SQAA 2BDBA 4FUFA 1THSH 4BNRA 5L2ZH 4MQAA 2DE8A 4ABGA 1XUHA 2Y5HA 3U8RH 3SHAH 3K65B 1AE5A 1Q3XA 2ZDMA 6LPRA 1FXYA 3A7TA 1PQ8A 1MCTA 2PWXA 2ANWA 1C2FA 1P10A 1OP0A 1E34B 3EA7A 5A0AE 3BTQE 3PLKA 1P2JA 1AI8H 1HV7A 1WCZA 1YP9A 2BDCA 3IG6B 4WWYA 4FUIA 2BM2A 1TBQH 4H6SB 4OS5A 3VGCB 1LHFH 1OOKB 5HM2A 1BUIA 2A5IA 1A46H 1DWDH 1SLWB 4NWKA 4NA7A 3RU4E 1VR1H 1O38A 1RJXB 3BTEE 1MTUA 4MPVA 1O3JA 3ZZ6A 4ZUHA 4UFFH 4K1EA 1C9TA 1BHXF 4FUGA 3SUFA 1KLJH 3RLYH 3MH4A 1W7XH 1GI9B 1GHVH 1ETSH 4F4OC 1J17T 2H6MA 2O8WA 2P3TB 1AIXH 2HLCA 1EAIA 2R3UA 4WVPE 5BPEA 2RCEA 4ZXYH 1C5WB 2GDEH 2OP9A 5AFZH 1SGEE 3H5CB 1K1LA 1QBOA 3LGWA 2B0FA 3KNXA 4NFEA 3U9AH 3VB5A 2BLQA 3AASA 4DY7B 1GBDA 1D6WA 4BAMB 2ZTXA 1C1WH 1O2OA 1NESE 1WU1A 2QXHA 3SGQE 3PO1C 2YNBA 4GHQA 3EQ0H 3MHWU 3BTKE 1EAXA 2A4GA 1G3EA 2FOCA 3NZIA 1G32B 2O9QA 3A7XA 3V13A 2HNTF 1IAUA 4X8VH 1CE5A 4JYUH 1XUJA 1LQDB 3TNSA 3GY6A 1Y3YA 1EUFA 1TNJA 1AWFH 5E8EH 2RDLA 5JBBS 1WBGB 1EOLA 1HB0B 1Q2WA 1KXEA 2XWAA 1KXBA 1L1JA 3GY8A 3RXLA 2BLVA 1C5RA 3DD2H 3A86A 1QRWA 1L0ZA 1JRTA 1BMNH 2FOFA 3U1IB 1Y3UA 1Z8GA 1LHDH 1P3EA 3TJUA 3GCNA 1GWAA 2BVSH 4BAOB 1AHTH 1QURH 2GMTC 3E8LA 2QN5T 2FMJA 5AF9H 1DITH 3A89A 3A7WA 1S85A 3KQCA 2IN2A 1TAWA 3QWCH 4JZFH 4O3UA 1C4V2 3I29A 1TONA 3BTTE 1CT2E 2BB4A 4VGCC 2BZAA 1QJ6B 1YPJH 2ZGXH 1W3CA 3RXAA 3BTHE 1QHRB 3RMMH 4HI3A 1OYTH 3SUDA 1GBTA 1O3KA 1S0QA 1SPJA 8KME2 2ZHDA 2F3CE 3NXPA 3RXEA 1NFXA 5EQSA 1HXEH 1QQUA 2WPIS 2RG3A 2A45B 4ISNA 2VVCA 1QA7A 3AVZA 1K2I1 1TGTA 2FOGA 2AGIX 3TK5A 2ZNKH 5EW1H 5CE1A 4ZHLU 1UVOA 2Q6DA 5JB9S 2AYWA 2QV1A 3EE0B 3MU5A 3VXFH 1MTNC 2AH4X 2HVXA 1QBNA 5DP8A 1P9SA 4A1VA 5C67A 2FDAA 1TRMA 1SFQB 1SR5C 2NU0E 1OKXA 2A5KA 2SNVA 1C1VH 1SVPA 2WUBA 4YOIA 5FPTA 3GY3A 5C1YA 1AQ7A 1HNEE 2BX4A 5HYOA 2Y5GA 1CA8B 3PMHB 2BXTH 1LVBA 1G37A 1O3CA 1YBWA 4MPWA 2Q6GA 1MZAA 2ODYB 4B2CA 2KAIA 2BD9A 2RA3A 2EEKA 1XXDA 3RDZA 3RU4T 4IN2A 2FXRA 2GGVB 1NRNH 1WSSH 1SMFE 1F0UA 2D1JA 3SJKA 3O8RA 3FANA 1XM1A 3LDXH 1O2JA 3DUXH 2VVVA 3M5NA 3MNBA 3SV9A 3RC4A 2XWBI 1SGYE 3RMLH 1G9IE 3W94A 1GJCB 4NSVA 1F5KU 1EZXC 1S6HA 1C5VA 1K1OA 1O3BA 2ZF0H 1SQTA 1TGSZ 3RXCA 7ESTE 3KQDA 4GUXA 4HFPB 2QXJA 6GCHF 3PO1B 4X1NU 1AB9C 4ZH8A 7GCHG 2SGEE 9LPRA 3K9XB 1G30B 1GJDB 2G55A 3SNCA 1ZRBA 4BAKB 3LOXA 2B5TB 1A0HB 1C5SA 1QQ4A 2ZQ1A 1ZMJA 1CVWH 4GAWA 2BD7A 2Z9JA 1H9LB 3A7YA 3M5LA 1NFYA 1O2GH 1P2MA 2BZ6H 4YESB 3NCLA 4NSYA 2AMDA 3F68H 3I78A 3A82A 1E37B 4NZLA 1S83A 1IQKA 2ZEBA 2XCNA 1BQYA 3TPIZ 3UOUA 3SI4H 3UR9A 3FAOA 1K1PA 1MAXA 5T6FA 3AAVA 2VIWA 3LU9B 3ZZDA 3RXSA 1C1NA 5T6GA 2GMTB 3PV4A 4Q2KA 5GPIB 2Z3DA 1NRRH 1UCYH 4ABJA 1ARBA 2FZZA 5DO4H 2XRCA 3TU7H 3BSQA 1BBRE 1H9HE 1SL3A 1FI8A 1O2LA 1BRBE 2PUQH 2PSXA 3GICB 2BDYA 2A7HA 1S84A 3Q76A 4VGCB 1VITG 1XUIA 2TRMA 1MH0A 2EA3A 1ZHMA 2VIDA 3VXEH 5FXLA 5EG4A 3ZVGA 1W14U 3SHCH 1A0JA 1GDQA 2ZIQH 1FY8E 3T62A 2H9TH 3QDZB 4I8JA 1J16A 1H8DH 1TYNA 1J9CH 2VJ1A 2VINA 3E1XB 4ZKOU 2VH0A 1OPHB 4CHAC 2ZI2H 3SJ9A 1NFWA 1LKAA 1MTNB 2BQWB 1ELFA 1RGQA 1CGIE 4NWLA 1BBRH 2WYGA 1P05A 3OY6U 1AFQC 1TA2A 2Z9GA 1XKAC 3M36A 3DFJA 2V3HH 2C8WB 2HGTH 4YM9A 2NU2E 1D3DB 2W3IA 4E06H 1GBIA 2PKAA 5FPSA 2ODPA 1BBRK 1GJ7B 3MNCA 1FIZA 4GLYA 1CHGA 1F0SA 1G2MA 1CBWC 2A4OA 2FM2A 3M5OA 3P17H 2OQ5A 2BD2A 4TY6A 3E16B 3A81A 4FUJA 2BDGA 1MKWH 2F9OA 4NA8A 2O8LA 2UWPA 1KTSB 4AFSA 1LVOA 2XXLA 4WH6A 1TNHA 3M37A 1NROH 1SG8B 4NA9H 2GV7A 4X8TH 2TGPZ 4OS1A 4IMZA 1Z1JA 2ZU2A 1C1OA 1MKWK 1QGFA 5A0BA 4OS6A 3T2NA 4AGKA 3ZZBA 2OC7A 1ACBE 4AORA 1BMLA 1F0RA 3S9CA 4F49A 5LPRA 5FBEA 5EW2H 1NRSH 2KAIB 4AZ2B 1S0RA 1GMDG 2WPLS 4CRAA 1O5EH 1IHTH 5FX5A 2ZFRH 3TITA 2PTNA 4OS4A 6CHAB 1OYQA 1GJ6A 2FOBA 2ZPRA 1P03A 3SZNA 3T28A 3UWIA 1KLTA 1C1UH 1YM0A 3ZVEA 3TGIE 1W13U 1ZZZA 1RD3B 1FNIA 5FPYA 1HBTH 1T8OA 4I8GA 1ELDE 3HKIB 4NCYA 2CJIA 1V6DA 1YYY1 3GY4A 3C1KA 1BDAA 5ESTE 3RXBA 3STJA 5A8ZA 2SNWA 3E3TA 3UFAA 1Y5UT 3G01A 1C5XB 5A09A 2XC0A 4RN6A 3P95A 3PMAB 1C5MD 3GYLB 4JK5A 3UNQA 4JMYA 4Y8YA 3ZVCA 3TGJE 1LQEA 3MI4A 1PPZA 2FP7B 2QF3A 4Y71A 1HIAA 2F91A 3SQEE 1F2SE 2G5VA 3DFLA 1P06A 4YT7H 1J14A 2FI3E 4U32A 4CRDA 2XTTB 1KXCA 2VH6A 1QB6A 1DANH 1MU6B 3SU0A 1FDPA 3VGCC 2A4QA 1P2OA 1SGQE 4JCNA 3LKWA 2WV4A 1FPCH 1V2WT 2ZTZA 1GI5A 4GPGA 4TWWA 3ZV9A 1K1JA 2QC2A 3EDXB 3ZYEA 2J34A 3UPEA 3F6UH 5K0HA 1BTPA 5JBAS 4OGXA 1P2IA 4Y79A 3RXDA 2A7JA 5DG6A 2F9BH 3QGJA 1IQJA 5HMAA 2ANYA 2K1QA 1ZSLA 4Y7BA 2OD3B 3RUOA 2VIQA 1GVZA 1SBWA 4CHAB 1SGPE 4FUEA 1TPPA 2C93B 2WPMS 2XW9A 5EODA 3ATKA 2UUKB 1AFQB 1FAXA 2NWNA 1K1IA 4GSOA 2QAAA 1ZMNA 1EASA 2HRVA 4LOYH 1AMHA 3DA9B 2OBOA 5J4QA 2TBSA 4RSPA 5JB8S 2BLOA 3SBKA 1PPEE 1INCA 4Q7YA 3D65E 4BOHA 1O2WA 5JBCS 4INLA 4YLUA 8ESTE 1SLVB 1TOMH 2ZU1A 2SGFE 3ZZ5A 1AUTC 4GHTA 2Z9IA 3BF6H 1MAYA 5FBIA 3ZZ4A 2PSYA 4OS2A 3BEIB 5L30H 4YOGA 5TCCA 1V2PT 2HPQH 1A7SA 2BVXH 3U8OH 3O8DA 1NU7B 2P3FH 1J15A 5IDKA 1THPB 3VB7A 3SGBE 3BG8A 2Z3EA 3FZZA 1V2KT 1Z8RA 2BQ7B 4ZMAH 1HUTH 3SW2B 3TLOA 4XE4A 3EGKH 3S9BA 2F83A 3FP8E 2QYIA 1TIOA 3LT3A 1O2QA 1ESAA 3PLPA 3BV9B 2CMYA 3K6ZA 2TGTA 5EPYA 1DICA 5ESBA 1SOZA 5DP3A 3Q3YA 1WTGH 4D9RA 7GCHF 2ZU4A 1P02A 1JXPA 2ZKSA 1SSXA 1XVOA 4KTSA 1OWKA 1WQVH 3SU4A 3MYWA 2GVFA 2ZCKP 1AZZA 1PPFE 1CT0E 1UJ1A 1AVWA 1C5NH 5F8ZA 2ZPSA 2W3KA 2CGAA 1O2ZA 2ZZUH 1CGJE 4DVAU 2EI7A 2BQ6B 2FOAA 1HAZB 3RC6A 2XBXA 1NRPH 1VGCB 3BEFB 1QRXA 3UTUH 1TMBH 1QY6A 1DWCH 2ZU3A 1ELAA 1AVGH 1W10U 4UDWH 3ZVDA 1S82A 3KCGH 1FIWA 1EQ9A 3UQOA 1JIMA 1O3GA 1OP2A 1FPHH 1A2CH 1ELEE 2GKVE 3K2UA 1MCVA 4MDSA 2NU4E 5LH8A 3A85A 5E0JA 1W2KH 4DG4A 2AGGX 1BT7A 1BJVA 1O3EA 3SV6A 1QL7A 1ZSKA 5BRRE 1BMAA 1VITF 4WMFA 3F1SB 4U30A 1RFNA 2UWOA 8GCHG 1SGRE 2WYJA 3BTDE 2R0KA 5EOKA 7LPRA 2ESTE 4O3TA 4HGCA 1P11E 1W0ZU 1HIAB 1KYNA 1YPLH 3JZ2B 5EQQA 1AN1E 1O3PB 2UUFB 2SFAA 2A4RA 5J4SA 3ZVBA 1GJ5H 2Q1JA 4INKA 3HK3B 1BCUH 1D6RA 3GDUA 4ISIH 3LGIA 2ZTYA 1O37A 4Q7ZA 3SUEA 5C1UA 1MBMA 1SQOA 2TGAA 3RXFA 1GMHG 3T5FH 5DKMA 2W7SA 3TGKE 5H4IB 1TGNA 4AN7A 3P70B 4KGAA 1SGIB 1E38B 3UY9A 1BOQA 4WMEA 4KP0A 3BTWE 2QCYA 2IJOB 1SGFA 2BXUH 3TJVA 2JETC 1P01A 3LJOA 5ETXA 2IPHA 1UK2A 1C2EA 4K1SA 3D23A 4Q7XA 2I6SA 1NY22 1A1RA 2BY9X 1GBFA 1T8LA 4ISLA 2ZGBH 3KF2A 1LVMA 1NZQH 1O3MA 3UQVA 1AE8H 5T6DA 3HPTB 4IS5A 2VVUA 1XVMA 3S0NA 1FY3A 1Y3VA 3CP7A 1EZQA 1ANBA 4XFQA 1V2LT 1EXFA 2G4TA 3Q3KA 1ZTKA 3ODDA 1O3FA 1TNKA 4X2WA 2ZGJA 4AG1A 5EXMA 1G3BA 4AFUA 1Z7KA 4H42U 2W26A 1NTPA 5DP5A 1GMDF 3KQEA 1N6YA 3SV7A 1O2KA 1O3OA 3GCOA 4B75A 2R9PA 4TWYA 5LPFA 3ZZ7A 5L2YH 3SNEA 4XBBA 1A5HA 1YPGH 1T8MA 3E0PB 3WY8A 1D3PB 5G4BA 1C5QA 5T3HA 4UEHH 2H9HA 5HGGA 4ABDA 5ABWA 4BTTB 2C3SA 1BMMH 3UREA 4X1SU 2CF9H 1B5GH 1EPTA 3LH3A 3AW1A 4WXVA 4WMDA 1HAPH 3T25A 1FAKH 3OY5U 2R2MB 2C8XB 2DUCA 3S69A 4B71A 3PROA 2PUXB 3PM3A 4R8TB 2G81E 1GGDC 1J8AA 4K3JA 1GI7B 1XMNB 3PYHA 2VWOA 3PMJA 4MPUA 4MVNA 1N6XA 1OX1A 1V2RT 1NPMA 4UFGH 1GJAB 1ABIH 2FIRH 2JKHA 3ZZCA 4IN1A 1HPGA 1ORFA 1ELGA 3SNAA 4Y8ZA 1TOCB 2YNAA 2Y81A 1D4PB 1GHZA 1RTLA 3M7QA 2NU1E 1EPTC 2PGBB 3U98H 2UUYA 1FLEE 4FUDA 1A0LA 4ZAEA 2XBWA 5TJXA 2Y82A 2J9NA 1G2LA 1F7ZA 2A7CA 2Z9KA 1FQ3A 1GHYH 1RTKA 2ZGHA 4Q80A 4WXIA 5DP6A 3SQHE 1F5LA 3IWMA 3NKKA 2G5NA 3O8CA 2BX3A 1DSUA 4SGBE 5A0CA 3SOSA 1O3DA 4UONA 3F9FA 2OC0A 2ALPA 2G8TA 3LONA 4A5TS 3GDVA 3EA9A 2DE9A 2BVRH 1O5GH 3GY5A 1GMCG 3RMNH 2V0BA 1GCTC 4Y76A 2PKSC 1YC0A 2G52A 4OGYA 3UOPA 1IQLA 1TNIA 1Z1IA 4MG3A 1GG6C 5LPEA 1O2VA 3A8AA 1ZGVA 6CHAC 2AFQB 3GCTG 4Y10E 3BTFE 5GWZA
chains in the Genus database with same CATH superfamily
1UHBA 2F9VA 4M7GA 2JETB 5CHAC 1P09A 5SGAE 2C4FH 1LCYA 1C5PA 2IOTA 1VKYA 4X1RU 4A7IB 3TH4H 2OBQA 3RU4D 1IQFA 2HOBA 2FESH 3NWUA 2GDDA 1JMOH 4K8YA 2FLBH 3MTYA 5KEDA 3QK1A 1GBLA 1NM6A 1P04A 1FY4A 1GBKA 1O2YA 2ZGCA 3B9FH 3ATLA 4TPIZ 3M7TA 3A8CA 4NFFA 5EXNA 2HNTC 3P6ZB 4TY7A 3U8TH 4K1TA 3A7ZA 5HM9A 3TJNA 3GS9A 2STBE 4MTBA 5T1VA 2F43B 2J95A 4OS7A 1C5YB 4OM9A 3MU8A 1YGCH 3SO3A 1RRKA 2JIZD 1WOFA 4R0IA 1BRCE 1UVPA 2D8WA 1C2HA 2VIOA 2OC8A 2WPHS 2XYAA 2ZWLH 4CRBA 5CMXH 3L33A 4Q63A 1O2XA 3V0XA 1RS0A 1FN8A 2CV3A 1V2UT 3KHVA 4KKDA 2J38A 1BTXA 3GYMA 2Y80A 1O0DH 4QT8C 1E1RD 3BTME 3D49H 5C2ZA 1ANEA 3LH1A 2D26C 3KL6A 1GBMA 1GJ9B 2CK3D 2YMSB 1TFXA 1GHAG 1V2QT 3C27B 4JYTA 1HRTH 4NIWA 2GCHG 2Z7FE 3M3SA 1TBZH 5GCHF 2J94A 4ASHA 3MU0A 2OCVB 2R0LA 1TQ0B 1L2EA 1GGDB 1C1MA 2K0QA 1UVTH 2HALA 4ABFA 2F9PA 4FUHA 1GI6A 1VJ9U 1XUFA 1AVXA 4MLFB 3MNSA 3N7OA 4CBNA 3M3TA 3A87A 3SJ8A 1C5UA 1EJAA 3LGVA 1O2PA 3ZZAA 1S5SA 3URDA 3SU2A 2FYRA 1UVUH 3B8JA 2BY8X 3LC3A 5HXFA 1MMJN 3MO6A 1H8ED 4CREA 1YKTA 1EPTB 5FX6A 4X2YA 4K8BA 8GCHF 2L6OA 1C2JA 2QY0B 2Y7ZA 1KDQB 1AU8A 1HAOH 1BZXE 4Y8XA 1VCWA 1Y3WA 1CO7E 4ABAA 1V2OT 4ZXXH 2KFWA 2PV9B 3SJOA 1CQQA 1Z71A 4LZ1H 1BB0B 1O2UA 4UFDH 5CDFE 1NFUA 1TRNA 3M5MA 5KGOA 1AD8H 3ZZ9A 3OEED 3F9GA 2FX6A 1GCTB 4DJZB 1GMHF 3RXIA 1MTVA 2PKSB 1BTZA 2STAE 4MPXA 1N8OB 1W7GH 2BD5A 4B2AA 1GG6B 1QA0A 4ZKNU 4CR5A 1ESTA 4KTUA 1SGTA 1BHXB 3GY7A 3R3GB 1QNJA 2FPZA 4O03A 1GPZA 1MBQA 1ANDA 3VB3A 3M3VA 5HKKD 5CHAB 3SNDA 1KXDA 1WYKA 3TH2H 4DIHH 2FI5E 1BTUA 1GDUA 3E6PH 3KEEA 2JH5D 3ZVFA 2LP6A 4JK6A 1UTOA 4UFEH 1EAWA 5B6LA 1SC8U 1GBJA 4A1XA 1BJUA 1GHXH 2G00A 1HAIH 1AWHB 1JBUH 1V2TT 1MU8B 1V2MT 1WAYB 3KQBA 3RXJA 3NK8A 1OWHA 1HAGE 5EJ1A 2WPKS 4YLQH 1VGCC 1EATA 1ELVA 4IC5A 5FHTA 4MNWA 3RLWH 2KM0A 4Z1MD 4AYVB 2G51A 1RXPA 2QF0A 5EGMA 4K60A 1C4U2 2AIPA 2Q6FA 3GCHC 1UHBB 1EJNA 2HVYB 1DLKB 4YZUA 3TK6A 3OYPA 2ZFFH 3Q77A 4UE7H 5GIBA 3HKJB 1KSNA 5L6NH 2H5CA 2GZ9A 1VITH 4D76A 2P93A 4DGJA 3CENA 5DK1A 1ESBA 1HGTH 2M5TA 2WUCA 2ZHQH 1MQ5A 4J1YA 1C9PA 4JZEH 5FCRA 5GXPA 2C8YB 2FOMB 1QZ8A 1LDTT 1NT1A 4X1PU 3RXGA 4I31A 2QXGA 4CRFA 3U1JB 2OQUA 5HIZA 3URCA 3MFJA 1T4UH 3EYDA 1O3NA 1GHWH 1TABE 2VWMA 4ABHA 2W6JD 1EJMA 1GBCA 2B9LA 1L1GA 1O3LA 1TGBA 2CHAC 2VWLA 1ETRH 5AVDA 1PPBH 1NN6A 1PFXC 4RKJB 5GNDA 1C1TA 3V7TA 1BTHH 4H6TA 1GHBF 1DY8A 4MNYA 2PFEA 2EQNA 1YLDA 1YLCA 2UWLA 1ZHPA 2M2AA 3BN9A 3PB1E 1Y59T 3H7OA 4DOQA 3RXHA 2BOKA 1S6LA 4PROA 3S7HB 2EI6A 2NU3E 2A5AA 2CXVA 2KR7A 3SNBA 3SN8A 3T26A 3DSGA 3RXKA 4CH8B 2GD4B 1PQ5A 1P2QA 3F9HA 1ZPCA 2VNTA 5GWZA 5PTPA 2XBVA 1T32A 2V3OH 2A32A 1C1SA 7KMEH 2BOHB 4Y6DA 1YWUA 4GCHF 2ZFQH 1O5DH 1MD7A 1EKBB 2ZHFH 1AFEH 3MOCA 1K1MA 1HAVA 4J2YB 1DSTA 3V3MA 1B0EA 2VB0A 3L3TA 5DGJA 3HGNA 4DT7B 1MZDA 4WH8A 1TA6A 1SHHB 3GDSA 2VU8E 1LHCH 1G3DA 2ZHWH 3OX7U 3ENSB 3Q00A 4ABEA 2F4LA 2ZFSA 3W95A 1CU1A 2FEQH 4ACAA 3EAJA 1K22H 4BXSA 2EY4C 4INHA 1NO9H 5C0UA 1QL8A 1GMCF 1HJ9A 5AHGH 1RIWC 1NBME 3GISB 3DHKH 3B23B 1MKXK 3NUMA 2J4IA 2UUJB 3P8OA 1GI8B 3FKSD 4TYDA 4ZHMU 4ABIA 4FUBA 3GCTF 1DWEH 4RT1A 3MMGA 2ZG0H 2Y5FA 5E2PA 1PPGE 1PYTD 2OTVA 3QX5H 4ISOA 2WV5A 1OS8A 1LO6A 1WQSA 5E0GA 1EX3A 1P0SH 1GL0E 3ATIA 2ZHEH 3STIA 2FTMA 1JRSA 2KX4A 2KCOA 2O8MA 5GCHG 1AKSA 1A5IA 1ETTH 4LZ4B 1L4ZA 3BIUH 1QIXB 1IQMA 3DCLA 3VPKA 1ZJKA 4U2WA 4XBDA 1CHOG 2ANKH 5AFYH 1TNGA 3GCHB 1SB1H 1TQ7B 3CS7A 3CS0A 1LHEH 1Y5AT 4NIYA 1F0TA 1QB1A 3GOVB 1ZHRA 4ZKRU 4AFQA 1IQIA 1LKBA 1KY9A 5F6MA 4Y11E 1CT4E 1C2KA 2OXSA 1AUJA 1SOTA 1P12E 1QR3E 1ZOMA 2BD4A 1T7CA 2WPJS 3QLPH 4M9FA 1EB1H 1O36A 1EAUA 1Y5BT 5GDSH 1O2TA 3I77A 2A2QH 1MUEB 5A8YA 1BTYA 2KCPA 2ZC9H 1XKBC 4GVUA 1FMGA 1F5RA 4TPYA 1JOUB 2ZECA 3PMBB 1X7AC 1UTKA 5F8XA 2H5DA 2Z3CA 2H1UA 1P2KA 3O8BA 3BEUA 2ZCLP 4K2YA 1GHAF 1O31A 1G36A 1QRZA 1FJSA 1YF4A 3ZZ8A 2CHAB 2GCHF 2JH6D 3HGPA 4Z0KA 1OWIA 1DWBH 3RMOH 4AG2A 1V2VT 2VIPA 1C1RA 3NPSA 1TPSA 1WTHD 1BA8B 3LGYA 2Z6BD 1ZLRA 3P8GA 1TWXB 1NC6A 2YOLA 1TNLA 4ESTE 3VFEA 4FU9A 1WUNH 1T4VH 4E7NA 4KELA 5EJZA 2J92A 4K5ZA 1KXFA 1DE7H 4P00A 1COWD 3MH5A 4XBCA 4CH2B 2JH0D 4RT0A 4ZHAA 1U6QA 1GI1A 1TPOA 2BDAA 8LPRA 1D9IA 2A2XH 1C2MA 4NZQA 1K28D 5EPNA 3SV2H 1UK4A 1DS2E 4FU7A 1ZYOA 2R3YA 1ABJH 3PWCA 1UTLM 2Y6TA 1UTJA 1FY1A 4XOJA 1C5TA 1EP6A 2ZFPH 3RXRA 4ABBA 1YCPM 4X8UH 2BD3A 4B2BA 2XC4A 3A83A 3P8NA 4WY3A 4B74A 4Y0ZE 1YPHC 4BTIB 2AERH 1L1NA 1QB9A 1O32A 1RIWB 1O30A 2H9EH 5F03A 2WSSD 3A8DA 2J97A 4X8SH 4B76A 2JJ1D 3TJOA 4H4FA 1AZ8A 3EA8A 2PW8H 3IITA 4MNXA 1D3QB 1O5AB 2ULLA 4AOQA 4AYYB 4BTUB 1PPHE 1UK3A 1HAVB 1Y8TA 2P94A 2W5EA 1K1NA 1EOJA 4AC9A 1THRH 1O33A 1BITA 2GCTB 2P95A 1PQ7A 2GV6A 3SI3H 4NGAH 4A92A 3BG4C 1ZPZA 1S81A 1PJPA 3LGUA 5EU8A 3PLBA 3ZYDA 1Y3XA 1P8VC 2P8OB 2VIVA 3PTNA 1TBRH 1SGNE 1QCPA 5JDUB 1VJAU 2FOHA 1O5CB 1KDQA 1GBAA 9ESTA 1PYTC 1GHBG 1O3AA 1P9UA 4TT3D 2BY5X 3ELAH 1FONA 1FX0B 1W0JD 2BDHA 4KTCA 3RXOA 1XX9A 3P8FA 1C2GA 1GBEA 2Y7XA 1YPKH 4K69A 1EP5A 1CA0C 1ANCA 3U69H 1QJ1B 1ZTJA 3HK6B 2B8OH 1O2HA 1PPCE 5A8XA 1QL9A 2OK5A 3RXQA 1O2RA 1DPOA 1SLXB 1GI2A 1SQRA 1HAHH 1O34A 2EC9H 1IQNA 2J2UA 1AKSB 3MO3A 4IGDA 4I8HA 4FXGH 3RXTA 4CR9A 1NBMD 4NIXA 5I46H 4GCHG 2XCFA 3D62A 2P16A 3E0NB 4JZ1A 5C3NA 4YOJA 3S9AA 3UIRA 1A3BH 3PTBA 2QF4A 5A2MH 4IC6A 1C2IA 1GJ8B 1SGFG 4CBOA 2BY7X 5IYTA 4E05H 1HLTH 1O3IA 2BYAX 3M7UA 4WF8A 3FVFB 1QJ7B 2W7UA 1YCPH 3S7KB 1CGHA 1Z8JB 3E91A 1IOEA 3QUMP 1O35A 5FAHA 4FU8A 1O2SA 3F9EA 1YY3A 1D3TB 1DLEA 2TPIZ 4X6MA 1C1QA 1N8OC 2C90B 1TPAE 1LPKB 4YT6H 1YCPK 2ZDAH 3MU4A 4D7FA 1C5LH 1HXFH 2H2ZA 2BD8A 1JIRA 3A88A 3SU3A 1JWTA 3PRDA 1FUJA 3ESTA 4A1TA 1DDJA 1KXAA 4O97A 3KGPA 1C1PA 2SGDE 3AAUA 4DCDA 1A61H 2AEIH 4P02A 1KLIH 2ZPQA 2B7DH 1UCYE 3LIWA 2PR3A 5C17A 4DIIH 5E0HA 5JPMH 2A1DB 4YTAA 2ZDNA 1HYLA 4BAHB 4AFZA 1O39A 1DY9A 3RC5A 4D8NA 5C5OA 2F9UA 1V2NT 3LJJA 1OP8A 2HWLB 2AGEX 2F9NA 4U01A 2FODA 1OXGA 1OWDA 4X6OA 1DFPA 4LXBH 1ZTLA 3AW0A 3FP7E 5KECA 2GT7A 3QN7A 2BDIA 1XXFA 2VGCC 5C5NA 3OAAD 5JYIA 1C2LA 3ZIAD 5C20A 5E2OA 2THFB 1HJAC 4JZIA 1HFDA 1K9OE 3SORA 2AMQA 2XBYA 1HCGA 3ZVAA 1FY5A 1TMUH 1LTOA 5TCAA 3RM2H 4ISHH 4IW4E 1BTWA 1YPMH 3V12A 1TX7A 3MH6A 1MQ6A 1ZMLA 3RXUA 4Y0YE 3RM0H 3BG4B 2CN0H 1AY6H 1F92A 2FX4A 3F2FA 4FOUC 1V2ST 1GBBA 1DUAA 1SHYA 4WJG2 5EQRA 2R2WU 2PHBA 4NG9H 3UWJH 3GY2A 1UCYK 4A6LA 2PTCE 1LHGH 1YPHE 1UTNA 2QIQA 2LNCA 4JYVH 1DT2A 2ZA5A 1IQEA 3TH3H 1IQHA 1YPEH 2OC1A 3QO6A 1CHOF 4I32A 1EZUC 1IQGA 2FS9A 3BTGE 3KIDU 1DXWA 2ZDVH 4UD9H 2AS9A 4FVBA 1W12U 1FZZA 1CA0B 2ZP0H 1Z8IB 3UR6A 4X2XA 1EZSC 4AB9A 2XNIA 4IMQA 3VB4A 2LPRA 2O8TA 3PWBA 2VWNA 2LELA 4BANB 1Z6EA 3LPRA 3TNTA 3RXPA 4LK4A 1AO5A 2ASUB 3OU0A 1Q31A 3SGAE 2J98A 2Z9LA 4THNH 3M35A 3CNRA 2ZU5A 4I8LA 4D9QA 3SU1A 2V35A 1ZR0A 1H9IE 2V6NA 5LGOA 4FETA 1K21H 1BRAA 5B6OA 1OWJA 2CF8H 2SGAA 2QA9E 2ZDKA 1DXPA 2HLDD 3QGNB 1P57B 3HATH 4BAQB 1GI0A 5EXLA 2QXIA 2FOEA 4YO9A 1LPZB 1E35B 1RTFB 3QZQA 2TIOA 5DP4A 3R0FA 2ZCHP 1P2NA 2G4UA 1GDNA 1GI4A 5C1XA 1TALA 1UO6A 4RKOB 1TMTH 1GCDA 1C5OH 2A31A 5DJ7A 3SUGA 1HJ8A 1EB2A 1MABB 3A8BA 3A84A 1V3XA 1TGCA 5JBTA 1H1BA 1A4WH 1W8BH 4CRGA 1H8IH 3VB6A 2OINA 1G3CA 5DP7A 3RP2A 1DX5M 1O2MA 4RI0A 3SU5A 4AX9H 2SGQE 1AB9B 1A5GH 3OEHD 1XUKA 4BXWA 1FN6A 1GVKB 3UNSA 6ESTA 2PGQB 1TX8A 1HAXB 3UUZA 3RXMA 1SGDE 3ATWA 3BIVH 2D2DA 1T31A 1TE0A 3ZV8A 1O3HA 3FZDA 3RXVA 1ELTA 4B1TA 1DUEA 4HZHA 1OWEA 1DVAH 1GBHA 2ODQA 1ARCA 1UMAH 2FS8A 1E36B 2BY6X 1LPGB 4Z6AH 1HAYB 1IHSH 1TRYA 2OLGA 2IPQX 3A80A 1WDIA 1SGCA 2FTLE 2K8IA 4AB8A 2ILNA 1A3EH 3ATMA 3A7VA 3OTJE 3ODFA 2WINI 1PQAA 4I33A 1TB6H 4Y7AA 3UB0A 2VGCB 2A0QB 2QF5A 4X6PA 3MNXA 1QFKH 2ANMH 1HJAB 2HPPH 2O8UA 3OSYA 4AGJA 3ZZ3A 1VCPA 1O2IA 1CSOE 1TLDA 2QGRA 3MH7A 1TX6A 2GZ7A 2FYQA 1ZRKA 3KN2A 2FI4E 3ITIA 5GJ4B 4FUCA 3MWIU 2AMPA 5I25A 1B7XB 1O2NA 2GTBA 1LMWB 3M61U 3MU1A 1ELBA 3T27A 4ZKSU 1BIOA 2BLWA 1C2DA 2FO9A 5F8TA 2BMGB 4HTCH 3FFGA 1QTFA 2HNTE 3JZ1B 4X2VA 2P59A 2Z94A 2SGPE 4F48B 1ZSJA 3K6YA 5DPAA 4O9VA 3QTVH 4ZROA 3FO8D 3MO9A 1WV7H 1L4DA 1O5FH 3Q3XA 4B73A 4MNVA 4I8KA 1DM4B 3FP6E 3T29A 3QTOH 2I6QA 3DT0H 4YXWD 3PRBA 1M9UA 2PP6A 4XD7D 1ZGIA 2EI8A 3LGTA 3DSOA 1W0YH 2FLRH 1V2JT 1P3CA 1C5ZB 2ALVA 4CRCA 1O5BB 2TGDA 1DOJA 6GCHG 1S6FA 4X1QU 1ELCA 4D7GA 2RA0A 3P92A 1C4Y2 1MTSA 1VCQA 3L6PA 4SGAE 3UNRA 3QZRA 3N7DA 1SFIA 4I7YH 4JZDH 4DW2U 1GI3A 4DURA 1ZJDA 1CBWB 1UTQA 2BTCE 1NU9A 3F2GA 2FWWA 2GP9B 3SU6A 2ZO3H 4XDEA 1KIGH 1MKXH 2XC5A 3SJIA 1W11U 3TVJB 1NRQH 2GX4A 3H7TA 3TIUA 1GJBB 4IBLH 1OSSA 1GL1A 1AGJA 1B0FA 2J98B 1ZPBA 2ZFTA 4XSKU 1VZQH 4X0WU 4E7RG 1MD8A 2WHXA 1GVLA 2OUAA 3TK9A 2ZDLA 2GT8A 4F55A 1KTTB 1T8NA 4FVDA 2PKAB 1H4WA 1HDTH 2GZ8A 5DP9A 2BHGA 3SV8A 1N1LA 2ZQ2A 1SI5H 1ID5H 1UTPA 4X6NA 3VEQB 1MTWA 4NIVA 1FV9A 2GCTC 5K7RA 3LC5A 1BRUP 1NS3A 1UTMA 3E90B 5FCKA 1E0FD 1UVSH 2AIQA 2PLXA 4HG6A 1QBVH 1SLUB 1XUGA 2P8OC 2P3UB 1Z6JH 2C8ZB 1GJ4H 1LVYA 1SQAA 2BDBA 2YMSD 4FUFA 1THSH 4BNRA 5L2ZH 3F2HA 4MQAA 2DE8A 4ABGA 1XUHA 2Y5HA 3U8RH 3SHAH 3K65B 1AE5A 1Q3XA 2ZDMA 3W1EA 6LPRA 5EIYA 3VG8A 1FXYA 3A7TA 1PQ8A 1MCTA 2PWXA 2ANWA 1C2FA 1P10A 1OP0A 1E34B 3EA7A 5A0AE 3BTQE 3PLKA 1P2JA 1AI8H 1HV7A 1WCZA 1YP9A 2BDCA 5DN6D 3IG6B 4WWYA 4FUIA 2BM2A 1TBQH 4H6SB 4OS5A 3VGCB 1LHFH 1OOKB 5HM2A 3WWBA 1BUIA 2A5IA 1A46H 1DWDH 1SLWB 4NWKA 4NA7A 3RU4E 1VR1H 1O38A 2KCAA 1RJXB 3BTEE 1MTUA 4MPVA 1K0HA 1O3JA 3ZZ6A 4ZUHA 4UFFH 4K1EA 1C9TA 1BHXF 4FUGA 3SUFA 1KLJH 3RLYH 3MH4A 1W7XH 1GI9B 1GHVH 1ETSH 4F4OC 1J17T 2H6MA 2O8WA 2P3TB 1AIXH 2HLCA 1EAIA 2R3UA 4WVPE 5BPEA 2RCEA 4ZXYH 1C5WB 2GDEH 2OP9A 5AFZH 1SGEE 3H5CB 1K1LA 1QBOA 3LGWA 2B0FA 3KNXA 4NFEA 3U9AH 3VB5A 2BLQA 3WWFA 3AASA 4DY7B 1GBDA 1D6WA 4BAMB 2ZTXA 1C1WH 1O2OA 3U28C 1NESE 1WU1A 2QXHA 3SGQE 3PO1C 2YNBA 4GHQA 3EQ0H 3MHWU 3F0PA 3BTKE 1EAXA 2A4GA 1G3EA 2FOCA 3NZIA 1G32B 2O9QA 3A7XA 3V13A 2HNTF 2QE7D 1IAUA 4X8VH 1CE5A 4JYUH 1XUJA 1LQDB 3TNSA 3GY6A 1Y3YA 1EUFA 1TNJA 1AWFH 5E8EH 3KYGA 2RDLA 5JBBS 1WBGB 1EOLA 1HB0B 1Q2WA 1KXEA 2XWAA 1KXBA 1L1JA 3GY8A 3RXLA 2BLVA 1C5RA 3DD2H 3A86A 1QRWA 1L0ZA 3AK5A 1JRTA 1BMNH 2FOFA 3U1IB 1Y3UA 1Z8GA 4TSFD 5HIYA 1LHDH 1P3EA 3TJUA 3GCNA 1GWAA 2BVSH 4BAOB 1AHTH 1QURH 2GMTC 3E8LA 2QN5T 2FMJA 5AF9H 1DITH 3A89A 3A7WA 1S85A 3KQCA 2IN2A 4ZCNA 1TAWA 3KYFA 3QWCH 3NRLA 4JZFH 4O3UA 1C4V2 3I29A 1TONA 3BTTE 1CT2E 2BB4A 4VGCC 2BZAA 1QJ6B 1YPJH 2ZGXH 5IK2D 2KZ4A 1W3CA 3RXAA 3BTHE 1QHRB 3RMMH 4HI3A 1OYTH 3SUDA 1GBTA 1O3KA 1S0QA 1SPJA 8KME2 3F0OA 2ZHDA 2F3CE 2GJGA 3NXPA 3RXEA 1NFXA 5EQSA 1HXEH 1QQUA 2WPIS 2RG3A 2A45B 4ISNA 3N99A 2VVCA 1QA7A 3AVZA 1K2I1 1TGTA 2FOGA 2AGIX 3TK5A 2ZNKH 5EW1H 5CE1A 4ZHLU 1UVOA 2Q6DA 5JB9S 2AYWA 2QV1A 3EE0B 3MU5A 3VXFH 1MTNC 2AH4X 2HVXA 1QBNA 5DP8A 1P9SA 4A1VA 5C67A 2FDAA 1TRMA 1SFQB 1SR5C 2NU0E 4ACBA 1OKXA 2A5KA 2SNVA 1C1VH 1SVPA 2WUBA 4YOIA 5FPTA 3GY3A 5C1YA 1AQ7A 1HNEE 2BX4A 5HYOA 1KMHB 2Y5GA 3OE7D 1CA8B 3PMHB 2BXTH 1LVBA 1G37A 1O3CA 1YBWA 4MPWA 2Q6GA 1MZAA 2ODYB 4B2CA 2KAIA 2BD9A 2RA3A 2EEKA 1WXRA 1XXDA 1H8HD 3RDZA 3RU4T 4IN2A 2FXRA 2GGVB 1NRNH 1WSSH 1SMFE 1F0UA 2D1JA 3SJKA 3O8RA 3FANA 1XM1A 3LDXH 1O2JA 3DUXH 2VVVA 3M5NA 3MNBA 3SV9A 3RC4A 2XWBI 1SGYE 1BMFD 3RMLH 1G9IE 3W94A 1GJCB 4NSVA 1F5KU 1EZXC 1S6HA 1C5VA 1K1OA 1O3BA 2ZF0H 1SQTA 1TGSZ 3RXCA 7ESTE 3KQDA 5C0TA 4GUXA 4HFPB 2QXJA 6GCHF 3PO1B 4X1NU 1AB9C 4ZH8A 7GCHG 2SGEE 9LPRA 3MQKC 3K9XB 1G30B 1GJDB 2G55A 3SNCA 1ZRBA 4BAKB 3LOXA 2B5TB 1A0HB 1C5SA 1QQ4A 2ZQ1A 3SYJA 1ZMJA 1CVWH 4GAWA 2BD7A 2Z9JA 1H9LB 3A7YA 3M5LA 3KQ5A 1NFYA 1O2GH 1P2MA 2BZ6H 4YESB 3NCLA 4NSYA 2AMDA 3F68H 3I78A 3A82A 1E37B 4NZLA 1S83A 1IQKA 2ZEBA 2XCNA 1BQYA 3TPIZ 3UOUA 3SI4H 3UR9A 3FAOA 1K1PA 1MAXA 5T6FA 3AAVA 2VIWA 3LU9B 3ZZDA 5FL7D 3RXSA 1C1NA 5T6GA 2GMTB 3PV4A 4Q2KA 5GPIB 2Z3DA 3SZEA 1NRRH 1UCYH 4ABJA 1ARBA 2FZZA 3FOAA 1EFRD 2XRCA 3TU7H 5DO4H 3BSQA 1BBRE 1H9HE 4B6FA 1SL3A 1FI8A 1O2LA 1BRBE 2PUQH 2PSXA 3GICB 2BDYA 2A7HA 1W0KD 1S84A 3Q76A 4VGCB 1VITG 1XUIA 2TRMA 1MH0A 2EA3A 1ZHMA 2VIDA 3VXEH 5FXLA 5EG4A 1YLNA 3ZVGA 1W14U 3SHCH 1A0JA 1GDQA 2ZIQH 1FY8E 3T62A 2H9TH 3QDZB 4I8JA 1J16A 1H8DH 1TYNA 1J9CH 4I86A 2VJ1A 2VINA 3E1XB 4ZKOU 2VH0A 1OPHB 4CHAC 2ZI2H 3SJ9A 1NFWA 1LKAA 1MTNB 2BQWB 1ELFA 1RGQA 1CGIE 4NWLA 1BBRH 2WYGA 1P05A 3OY6U 1AFQC 1TA2A 2Z9GA 1XKAC 3M36A 3DFJA 2V3HH 2C8WB 2HGTH 4YM9A 2NU2E 1D3DB 2W3IA 4E06H 1GBIA 2PKAA 5FPSA 2ODPA 1BBRK 1GJ7B 3MNCA 1FIZA 4GLYA 1CHGA 1F0SA 1G2MA 1CBWC 2A4OA 2FM2A 3M5OA 3P17H 2OQ5A 2BD2A 4TY6A 3E16B 3A81A 4FUJA 2BDGA 1MKWH 2F9OA 4NA8A 2O8LA 2UWPA 5EJLA 1KTSB 4AFSA 1UW7A 1LVOA 2XXLA 4WH6A 1TNHA 3M37A 1NROH 1SG8B 4NA9H 2GV7A 4X8TH 2TGPZ 4OS1A 4IMZA 1Z1JA 2ZU2A 1C1OA 1MKWK 1QGFA 5A0BA 4OS6A 3T2NA 4AGKA 3ZZBA 1ACBE 2OC7A 4AORA 1BMLA 1F0RA 3S9CA 4F49A 5LPRA 5FBEA 3F3BA 5EW2H 1NRSH 2KAIB 4AZ2B 1S0RA 1GMDG 2WPLS 4ASUD 4CRAA 1O5EH 3EE7A 1IHTH 5FX5A 2ZFRH 3TITA 2PTNA 4OS4A 6CHAB 1OYQA 1GJ6A 2FOBA 2ZPRA 1P03A 3SZNA 3T28A 3UWIA 1KLTA 1C1UH 1YM0A 3ZVEA 3TGIE 1W13U 1ZZZA 1RD3B 1FNIA 5FPYA 3FN8A 1HBTH 1T8OA 2V3MA 4I8GA 1ELDE 3HKIB 4NCYA 2CJIA 1V6DA 2J5UA 1YYY1 3GY4A 3C1KA 1BDAA 5ESTE 3RXBA 3STJA 5A8ZA 2SNWA 3E3TA 3UFAA 1Y5UT 3G01A 1C5XB 5A09A 2XC0A 4RN6A 3P95A 3PV5A 3PMAB 1C5MD 3GYLB 4JK5A 3UNQA 4JMYA 4Y8YA 3ZVCA 3TGJE 1LQEA 3MI4A 1PPZA 2FP7B 2QF3A 4Y71A 1HIAA 2F91A 3SQEE 1F2SE 2G5VA 3DFLA 1P06A 2RFKC 4YT7H 1J14A 2FI3E 4U32A 4CRDA 2XTTB 1KXCA 2VH6A 1QB6A 1DANH 1MU6B 3SU0A 1FDPA 3VGCC 2A4QA 1P2OA 1SGQE 5F53A 4JCNA 3LKWA 2WV4A 1FPCH 1V2WT 2ZTZA 1GI5A 4GPGA 4TWWA 3ZV9A 1K1JA 2QC2A 3EDXB 3ZYEA 2J34A 3UPEA 3F6UH 5K0HA 1BTPA 1SKYE 5JBAS 4OGXA 1P2IA 4Y79A 3RXDA 2A7JA 5DG6A 2F9BH 3QGJA 1IQJA 5HMAA 2ANYA 2K1QA 1ZSLA 4Y7BA 2OD3B 3RUOA 2VIQA 1GVZA 1SBWA 4CHAB 1SGPE 4FUEA 1TPPA 2L74A 2C93B 2WPMS 2XW9A 5EODA 2JJ2D 3ATKA 2UUKB 1AFQB 1FAXA 2NWNA 1K1IA 4GSOA 2QAAA 1ZMNA 3WW7A 2W6ID 1EASA 2AHME 2HRVA 4LOYH 1AMHA 3DA9B 2OBOA 5J4QA 2TBSA 4RSPA 5JB8S 2WV9A 2BLOA 3SBKA 2KCYA 1PPEE 1INCA 4Q7YA 3D65E 4BOHA 1O2WA 5JBCS 4INLA 4YLUA 2WZQA 8ESTE 5C94A 1SLVB 1TOMH 2ZU1A 2SGFE 3ZZ5A 1AUTC 4GHTA 2Z9IA 3BF6H 1MAYA 5FBIA 3ZZ4A 2PSYA 4OS2A 3BEIB 5L30H 2XNDD 4YOGA 5TCCA 1V2PT 2HPQH 1A7SA 2BVXH 3U8OH 3O8DA 1NU7B 2P3FH 1J15A 5IDKA 1THPB 3VB7A 3SGBE 3BG8A 2Z3EA 3FZZA 1V2KT 1Z8RA 2BQ7B 4ZMAH 1HUTH 3SW2B 3TLOA 4XE4A 3EGKH 3S9BA 2F83A 3FP8E 2QYIA 1TIOA 3LT3A 1O2QA 1ESAA 3PLPA 3BV9B 2CMYA 3K6ZA 2TGTA 5EPYA 1DICA 1E79D 5ESBA 1SOZA 5DP3A 3Q3YA 1WTGH 4D9RA 7GCHF 2ZU4A 1P02A 1JXPA 2ZKSA 1SSXA 1XVOA 4KTSA 1OWKA 1WQVH 3SU4A 3MYWA 2GVFA 2ZCKP 1AZZA 1PPFE 1CT0E 1UJ1A 1AVWA 1C5NH 5F8ZA 2ZPSA 2W3KA 2CGAA 1O2ZA 2ZZUH 1CGJE 4DVAU 2EI7A 2BQ6B 2FOAA 1HAZB 3RC6A 2XBXA 1NRPH 1VGCB 3BEFB 1QRXA 3UTUH 1TMBH 1QY6A 1DWCH 2ZU3A 1ELAA 1AVGH 1W10U 4UDWH 3ZVDA 1S82A 3KCGH 1FIWA 1EQ9A 3UQOA 1JIMA 1O3GA 1OP2A 1FPHH 1A2CH 1OHHD 1ELEE 2GKVE 3K2UA 1MCVA 4MDSA 2NU4E 5LH8A 3A85A 5E0JA 3H09A 1W2KH 4DG4A 2AGGX 1BT7A 1BJVA 1O3EA 3SV6A 1QL7A 1ZSKA 5BRRE 1BMAA 1VITF 4WMFA 3F1SB 4XRNA 4U30A 1RFNA 2UWOA 8GCHG 1SGRE 2WYJA 3BTDE 2R0KA 2IJD1 5EOKA 2RDEA 7LPRA 2ESTE 4O3TA 4HGCA 1P11E 1W0ZU 1HIAB 1KYNA 1YPLH 3JZ2B 3PV2A 5EQQA 1AN1E 1O3PB 2UUFB 2SFAA 2A4RA 5J4SA 3ZVBA 1GJ5H 2Q1JA 4INKA 3HK3B 1BCUH 1D6RA 3GDUA 4ISIH 3LGIA 2ZTYA 1O37A 4Q7ZA 3SUEA 5C1UA 1MBMA 1SQOA 2TGAA 3RXFA 1GMHG 3T5FH 5DKMA 2W7SA 3TGKE 5H4IB 1TGNA 4AN7A 3P70B 4KGAA 1SGIB 1E38B 3UY9A 1BOQA 4WMEA 4KP0A 3BTWE 2QCYA 2IJOB 1SGFA 2BXUH 3TJVA 2JETC 1P01A 3LJOA 5ETXA 2IPHA 1UK2A 1C2EA 4K1SA 3D23A 4Q7XA 2I6SA 1NY22 1A1RA 2BY9X 1GBFA 5CHBA 4B6EA 1T8LA 4ISLA 2ZGBH 3KF2A 1LVMA 1NZQH 1O3MA 3UQVA 1AE8H 2WPDD 5T6DA 3HPTB 4IS5A 2VVUA 1XVMA 3N7EA 3S0NA 1FY3A 4Q4LA 1Y3VA 3CP7A 1EZQA 1ANBA 4XFQA 1V2LT 1EXFA 2G4TA 3Q3KA 2V7QD 1ZTKA 3ODDA 1O3FA 1TNKA 4X2WA 2ZGJA 4AG1A 5EXMA 1G3BA 4AFUA 1Z7KA 4H42U 2W26A 1NTPA 5DP5A 1GMDF 3KQEA 1N6YA 4DT4A 3SV7A 1O2KA 1O3OA 3GCOA 4B75A 2R9PA 4TWYA 5LPFA 3ZZ7A 5L2YH 3SNEA 4XBBA 1A5HA 1YPGH 1T8MA 3E0PB 3WY8A 1D3PB 5G4BA 1C5QA 5T3HA 4UEHH 2H9HA 5HGGA 4ABDA 5ABWA 4BTTB 2C3SA 1BMMH 3UREA 2YMSC 4X1SU 2CF9H 1B5GH 1EPTA 3LH3A 3AW1A 4WXVA 4WMDA 1HAPH 3T25A 1FAKH 3OY5U 2R2MB 2C8XB 2DUCA 3S69A 4B71A 3PROA 2PUXB 3PM3A 5DSFA 4R8TB 2G81E 1GGDC 1J8AA 4K3JA 1GI7B 1XMNB 3PYHA 2VWOA 3PMJA 4MPUA 3OFND 4MVNA 1N6XA 1OX1A 1V2RT 1NPMA 4UFGH 1GJAB 1ABIH 2FIRH 2JKHA 3ZZCA 4IN1A 1HPGA 1ORFA 1ELGA 2XOKD 3SNAA 4Y8ZA 1TOCB 1E1QD 2YNAA 2Y81A 1D4PB 1GHZA 1RTLA 3M7QA 2NU1E 3DSPA 1EPTC 2PGBB 3U98H 2UUYA 1FLEE 4FUDA 1A0LA 4ZAEA 2XBWA 5TJXA 2Y82A 2J9NA 1G2LA 1F7ZA 2A7CA 2Z9KA 1FQ3A 1GHYH 1RTKA 2JDID 2ZGHA 4Q80A 4WXIA 5DP6A 3SQHE 1F5LA 3IWMA 3NKKA 2G5NA 3O8CA 2BX3A 1DSUA 2VBCA 4SGBE 5A0CA 3SOSA 1O3DA 4UONA 3F9FA 2OC0A 2ALPA 2G8TA 3LONA 4A5TS 3GDVA 3EA9A 2DE9A 2BVRH 1O5GH 3GY5A 1GMCG 3RMNH 2V0BA 1GCTC 4Y76A 2PKSC 1YC0A 2G52A 4OGYA 3UOPA 1IQLA 1TNIA 1Z1IA 3UAIC 4MG3A 1GG6C 5LPEA 1O2VA 3A8AA 1ZGVA 6CHAC 2AFQB 3GCTG 4Y10E 3BTFE 3OTPA
chains in the Genus database with same CATH topology
1UHBA 2F9VA 4M7GA 2JETB 5CHAC 1P09A 5SGAE 2C4FH 1LCYA 1C5PA 2IOTA 4X1RU 4A7IB 3TH4H 2OBQA 3RU4D 1IQFA 2HOBA 2FESH 3NWUA 2GDDA 1JMOH 4K8YA 2FLBH 3MTYA 3QK1A 1GBLA 1NM6A 1P04A 1FY4A 1GBKA 1O2YA 2ZGCA 3B9FH 3ATLA 4TPIZ 3M7TA 3A8CA 4NFFA 5EXNA 2HNTC 3P6ZB 4TY7A 3U8TH 4K1TA 3A7ZA 5HM9A 3TJNA 2STBE 4MTBA 4OS7A 2J95A 1C5YB 3MU8A 1YGCH 3SO3A 1RRKA 1WOFA 4R0IA 1BRCE 1UVPA 2D8WA 1C2HA 2VIOA 2OC8A 2WPHS 2XYAA 2ZWLH 4CRBA 5CMXH 3L33A 1O2XA 3V0XA 1RS0A 1FN8A 2CV3A 1V2UT 3KHVA 4KKDA 2J38A 1BTXA 3GYMA 2Y80A 1O0DH 4QT8C 3BTME 3D49H 5C2ZA 1ANEA 3LH1A 2D26C 3KL6A 1GBMA 1GJ9B 1TFXA 1GHAG 1V2QT 3C27B 4JYTA 1HRTH 4NIWA 2GCHG 2Z7FE 3M3SA 1TBZH 5GCHF 2J94A 4ASHA 3MU0A 2OCVB 2R0LA 1TQ0B 1L2EA 1GGDB 1C1MA 1UVTH 2HALA 4ABFA 2F9PA 4FUHA 1GI6A 1VJ9U 1XUFA 1AVXA 4MLFB 3MNSA 3N7OA 4CBNA 3M3TA 3A87A 3SJ8A 1C5UA 1EJAA 3LGVA 1O2PA 3ZZAA 1S5SA 3URDA 3SU2A 2FYRA 1UVUH 3B8JA 2BY8X 3LC3A 5HXFA 1MMJN 3MO6A 4CREA 1YKTA 1EPTB 5FX6A 4X2YA 4K8BA 8GCHF 2QY0B 1C2JA 2Y7ZA 1KDQB 1AU8A 1HAOH 1BZXE 4Y8XA 1VCWA 1Y3WA 1CO7E 4ABAA 1V2OT 4ZXXH 2PV9B 3SJOA 1CQQA 1Z71A 4LZ1H 1BB0B 1O2UA 4UFDH 1NFUA 1TRNA 3M5MA 1AD8H 3ZZ9A 3F9GA 2FX6A 1GCTB 4DJZB 1GMHF 3RXIA 1MTVA 2PKSB 1BTZA 2STAE 4MPXA 1N8OB 1W7GH 2BD5A 4B2AA 1GG6B 1QA0A 4ZKNU 4CR5A 1ESTA 4KTUA 1SGTA 1BHXB 3GY7A 3R3GB 1QNJA 2FPZA 4O03A 1GPZA 1MBQA 1ANDA 3VB3A 3M3VA 5CHAB 3SNDA 1KXDA 1WYKA 3TH2H 4DIHH 2FI5E 1BTUA 1GDUA 3E6PH 3KEEA 2JH5D 3ZVFA 4JK6A 1UTOA 4UFEH 1EAWA 1SC8U 1GBJA 4A1XA 1BJUA 1GHXH 2G00A 1HAIH 1AWHB 1JBUH 1V2TT 1MU8B 1V2MT 1WAYB 3KQBA 3RXJA 3NK8A 1OWHA 1HAGE 2WPKS 4YLQH 1VGCC 1EATA 1ELVA 4IC5A 5FHTA 4MNWA 3RLWH 4AYVB 2G51A 1RXPA 2QF0A 5EGMA 4K60A 1C4U2 2AIPA 2Q6FA 3GCHC 1UHBB 1EJNA 1DLKB 4YZUA 3TK6A 3OYPA 2ZFFH 3Q77A 4UE7H 5GIBA 3HKJB 1KSNA 5L6NH 2H5CA 2GZ9A 1VITH 4D76A 2P93A 4DGJA 3CENA 5DK1A 1ESBA 1HGTH 2M5TA 2WUCA 2ZHQH 1MQ5A 4J1YA 1C9PA 4JZEH 5FCRA 5GXPA 2C8YB 2FOMB 1LDTT 1NT1A 4X1PU 3RXGA 4I31A 2QXGA 4CRFA 3U1JB 2OQUA 3URCA 3MFJA 1T4UH 3EYDA 1O3NA 1GHWH 1TABE 2VWMA 4ABHA 1EJMA 1GBCA 2B9LA 1L1GA 1O3LA 1TGBA 2CHAC 2VWLA 1ETRH 5AVDA 1PPBH 1NN6A 1PFXC 4RKJB 1C1TA 3V7TA 1BTHH 4H6TA 1GHBF 1DY8A 4MNYA 2PFEA 1YLDA 1YLCA 2UWLA 1ZHPA 3BN9A 3PB1E 1Y59T 3H7OA 4DOQA 3RXHA 2BOKA 4PROA 3S7HB 2EI6A 2NU3E 2A5AA 2CXVA 3SNBA 3SN8A 3T26A 3RXKA 4CH8B 2GD4B 1PQ5A 1P2QA 3F9HA 1ZPCA 2VNTA 5PTPA 2XBVA 1T32A 2V3OH 2A32A 1C1SA 7KMEH 2BOHB 4Y6DA 4GCHF 2ZFQH 1O5DH 1MD7A 1EKBB 2ZHFH 1AFEH 3MOCA 1K1MA 1HAVA 4J2YB 1DSTA 3V3MA 1B0EA 2VB0A 3L3TA 5DGJA 3HGNA 4DT7B 1MZDA 4WH8A 1TA6A 1SHHB 3GDSA 2VU8E 1LHCH 1G3DA 2ZHWH 3OX7U 3ENSB 3Q00A 4ABEA 2ZFSA 3W95A 1CU1A 2FEQH 3EAJA 1K22H 4BXSA 4INHA 1NO9H 1QL8A 1GMCF 1HJ9A 5AHGH 1RIWC 3GISB 3DHKH 3B23B 1MKXK 3NUMA 2J4IA 2UUJB 3P8OA 1GI8B 4TYDA 4ZHMU 4ABIA 4FUBA 3GCTF 1DWEH 3MMGA 2ZG0H 2Y5FA 5E2PA 1PPGE 1PYTD 2OTVA 3QX5H 4ISOA 2WV5A 1OS8A 1LO6A 1WQSA 5E0GA 1EX3A 1P0SH 1GL0E 3ATIA 2ZHEH 3STIA 2FTMA 1JRSA 2O8MA 5GCHG 1AKSA 1A5IA 1ETTH 4LZ4B 1L4ZA 3BIUH 1QIXB 1IQMA 3VPKA 1ZJKA 4U2WA 4XBDA 1CHOG 2ANKH 5AFYH 1TNGA 3GCHB 1SB1H 1TQ7B 3CS7A 3CS0A 1LHEH 1Y5AT 4NIYA 1F0TA 1QB1A 3GOVB 1ZHRA 4ZKRU 4AFQA 1IQIA 1LKBA 1KY9A 5F6MA 4Y11E 1CT4E 1C2KA 2OXSA 1AUJA 1SOTA 1P12E 1QR3E 1ZOMA 2BD4A 1T7CA 2WPJS 3QLPH 1EB1H 1O36A 1EAUA 1Y5BT 5GDSH 1O2TA 3I77A 2A2QH 1MUEB 5A8YA 1BTYA 2ZC9H 1XKBC 4GVUA 1FMGA 1F5RA 4TPYA 1JOUB 2ZECA 3PMBB 1X7AC 1UTKA 5F8XA 2H5DA 2Z3CA 2H1UA 1P2KA 3O8BA 3BEUA 2ZCLP 4K2YA 1GHAF 1O31A 1G36A 1QRZA 1FJSA 1YF4A 3ZZ8A 2CHAB 2GCHF 2JH6D 3HGPA 4Z0KA 1OWIA 1DWBH 3RMOH 4AG2A 1V2VT 2VIPA 1C1RA 3NPSA 1TPSA 1WTHD 1BA8B 3LGYA 2Z6BD 1ZLRA 3P8GA 1TWXB 1NC6A 2YOLA 1TNLA 4ESTE 3VFEA 4FU9A 1WUNH 1T4VH 4E7NA 4KELA 2J92A 4K5ZA 1KXFA 1DE7H 3MH5A 4XBCA 4CH2B 2JH0D 4ZHAA 1U6QA 1GI1A 1TPOA 2BDAA 8LPRA 1D9IA 2A2XH 1C2MA 4NZQA 1K28D 5EPNA 3SV2H 1UK4A 1DS2E 4FU7A 1ZYOA 2R3YA 1ABJH 3PWCA 1UTLM 2Y6TA 1UTJA 1FY1A 4XOJA 1C5TA 1EP6A 2ZFPH 3RXRA 4ABBA 1YCPM 4X8UH 2BD3A 4B2BA 2XC4A 3A83A 3P8NA 4WY3A 4B74A 4Y0ZE 1YPHC 4BTIB 2AERH 1L1NA 1QB9A 1O32A 1RIWB 1O30A 2H9EH 5F03A 3A8DA 4X8SH 4B76A 3TJOA 4H4FA 1AZ8A 3EA8A 2PW8H 3IITA 4MNXA 1D3QB 1O5AB 2ULLA 4AOQA 4AYYB 4BTUB 1PPHE 1UK3A 1HAVB 1Y8TA 2P94A 2W5EA 1K1NA 1EOJA 1THRH 1O33A 1BITA 2GCTB 2P95A 1PQ7A 2GV6A 3SI3H 4NGAH 4A92A 3BG4C 1ZPZA 1S81A 1PJPA 3LGUA 5EU8A 3PLBA 3ZYDA 1Y3XA 1P8VC 2P8OB 2VIVA 3PTNA 1TBRH 1SGNE 1QCPA 5JDUB 1VJAU 2FOHA 1O5CB 1KDQA 1GBAA 9ESTA 1PYTC 1GHBG 1O3AA 1P9UA 2BY5X 3ELAH 1FONA 2BDHA 4KTCA 3RXOA 1XX9A 3P8FA 1C2GA 1GBEA 2Y7XA 1YPKH 4K69A 1EP5A 1CA0C 1ANCA 3U69H 1QJ1B 1ZTJA 3HK6B 2B8OH 1O2HA 1PPCE 5A8XA 1QL9A 3RXQA 1O2RA 1DPOA 1SLXB 1GI2A 1HAHH 1O34A 2EC9H 1IQNA 2J2UA 1AKSB 3MO3A 4IGDA 4I8HA 4FXGH 3RXTA 4CR9A 4NIXA 5I46H 4GCHG 2XCFA 3D62A 2P16A 3E0NB 4JZ1A 5C3NA 4YOJA 3S9AA 3UIRA 1A3BH 3PTBA 5A2MH 4IC6A 1C2IA 1GJ8B 1SGFG 4CBOA 2BY7X 5IYTA 4E05H 1HLTH 1O3IA 2BYAX 3M7UA 4WF8A 3FVFB 1QJ7B 2W7UA 1YCPH 3S7KB 1CGHA 1Z8JB 3E91A 1IOEA 3QUMP 1O35A 5FAHA 4FU8A 1O2SA 3F9EA 1D3TB 1DLEA 2TPIZ 4X6MA 1C1QA 1N8OC 2C90B 1TPAE 1LPKB 4YT6H 1YCPK 2ZDAH 3MU4A 4D7FA 1C5LH 1HXFH 2H2ZA 2BD8A 1JIRA 3A88A 3SU3A 1JWTA 1FUJA 3ESTA 4A1TA 1DDJA 1KXAA 4O97A 3KGPA 1C1PA 2SGDE 3AAUA 4DCDA 1A61H 2AEIH 1KLIH 2ZPQA 2B7DH 1UCYE 3LIWA 2PR3A 4DIIH 5E0HA 5JPMH 2A1DB 4YTAA 2ZDNA 1HYLA 4BAHB 4AFZA 1O39A 1DY9A 3RC5A 4D8NA 5C5OA 2F9UA 1V2NT 3LJJA 1OP8A 2HWLB 2AGEX 2F9NA 4U01A 2FODA 1OXGA 1OWDA 4X6OA 1DFPA 4LXBH 1ZTLA 3AW0A 3FP7E 2GT7A 3QN7A 2BDIA 1XXFA 2VGCC 5C5NA 5JYIA 1C2LA 5C20A 5E2OA 2THFB 1HJAC 4JZIA 1HFDA 1K9OE 3SORA 2AMQA 2XBYA 1HCGA 3ZVAA 1FY5A 1TMUH 1LTOA 5TCAA 3RM2H 4ISHH 4IW4E 1BTWA 1YPMH 3V12A 1TX7A 3MH6A 1MQ6A 1ZMLA 3RXUA 4Y0YE 3RM0H 3BG4B 2CN0H 1AY6H 1F92A 2FX4A 1V2ST 1GBBA 1DUAA 1SHYA 4WJG2 5EQRA 2R2WU 2PHBA 4NG9H 3UWJH 3GY2A 1UCYK 4A6LA 2PTCE 1LHGH 1YPHE 1UTNA 2QIQA 2LNCA 4JYVH 1DT2A 2ZA5A 1IQEA 3TH3H 1IQHA 1YPEH 2OC1A 3QO6A 1CHOF 4I32A 1EZUC 1IQGA 2FS9A 3BTGE 3KIDU 1DXWA 2ZDVH 4UD9H 2AS9A 4FVBA 1W12U 1FZZA 1CA0B 2ZP0H 1Z8IB 3UR6A 4X2XA 1EZSC 4AB9A 2XNIA 4IMQA 3VB4A 2O8TA 2LPRA 3PWBA 2VWNA 4BANB 1Z6EA 3LPRA 3TNTA 3RXPA 4LK4A 1AO5A 2ASUB 3OU0A 1Q31A 3SGAE 2Z9LA 4THNH 3M35A 4D9QA 2ZU5A 4I8LA 3SU1A 2V35A 1ZR0A 1H9IE 2V6NA 5LGOA 1K21H 1BRAA 5B6OA 1OWJA 2CF8H 2SGAA 2QA9E 2ZDKA 1DXPA 3QGNB 1P57B 3HATH 4BAQB 1GI0A 5EXLA 2QXIA 2FOEA 4YO9A 1LPZB 1E35B 1RTFB 3QZQA 2TIOA 5DP4A 3R0FA 2ZCHP 1P2NA 2G4UA 1GDNA 1GI4A 5C1XA 1TALA 1UO6A 4RKOB 1TMTH 1GCDA 1C5OH 2A31A 5DJ7A 3SUGA 1HJ8A 1EB2A 3A8BA 3A84A 1V3XA 1TGCA 5JBTA 1H1BA 1A4WH 1W8BH 4CRGA 1H8IH 3VB6A 2OINA 1G3CA 5DP7A 3RP2A 1DX5M 1O2MA 3SU5A 4AX9H 2SGQE 1AB9B 1A5GH 4BXWA 1XUKA 1FN6A 1GVKB 3UNSA 6ESTA 2PGQB 1TX8A 1HAXB 3UUZA 3RXMA 1SGDE 3ATWA 3BIVH 2D2DA 1T31A 1TE0A 3ZV8A 1O3HA 3FZDA 3RXVA 1ELTA 4B1TA 1DUEA 4HZHA 1OWEA 1DVAH 1GBHA 2ODQA 1ARCA 1UMAH 2FS8A 1E36B 2BY6X 1LPGB 4Z6AH 1HAYB 1IHSH 1TRYA 2OLGA 3A80A 1SGCA 2FTLE 4AB8A 2ILNA 1A3EH 3ATMA 3A7VA 3OTJE 3ODFA 2WINI 1PQAA 4I33A 1TB6H 4Y7AA 2VGCB 2A0QB 4X6PA 3MNXA 1QFKH 2ANMH 1HJAB 2HPPH 2O8UA 3OSYA 4AGJA 3ZZ3A 1VCPA 1O2IA 1CSOE 1TLDA 2QGRA 3MH7A 1TX6A 2GZ7A 2FYQA 1ZRKA 3KN2A 2FI4E 3ITIA 5GJ4B 4FUCA 3MWIU 2AMPA 5I25A 1B7XB 1O2NA 2GTBA 1LMWB 3M61U 3MU1A 1ELBA 3T27A 4ZKSU 1BIOA 2BLWA 1C2DA 2FO9A 5F8TA 2BMGB 4HTCH 3FFGA 1QTFA 2HNTE 3JZ1B 4X2VA 2P59A 2Z94A 2SGPE 1ZSJA 3K6YA 5DPAA 4O9VA 3QTVH 4ZROA 3MO9A 1WV7H 1L4DA 1O5FH 3Q3XA 4B73A 4MNVA 4I8KA 1DM4B 3FP6E 3T29A 3QTOH 2I6QA 3DT0H 1M9UA 1ZGIA 2EI8A 3LGTA 1W0YH 2FLRH 1V2JT 1P3CA 1C5ZB 2ALVA 4CRCA 1O5BB 2TGDA 1DOJA 6GCHG 1S6FA 4X1QU 1ELCA 4D7GA 2RA0A 3P92A 1C4Y2 1MTSA 1VCQA 3L6PA 4SGAE 3UNRA 3QZRA 1SFIA 4I7YH 4JZDH 4DW2U 1GI3A 4DURA 1ZJDA 1CBWB 1UTQA 2BTCE 1NU9A 2FWWA 2GP9B 3SU6A 2ZO3H 4XDEA 1KIGH 1MKXH 2XC5A 3SJIA 1W11U 3TVJB 1NRQH 2GX4A 3H7TA 3TIUA 1GJBB 4IBLH 1OSSA 1GL1A 1AGJA 1B0FA 1ZPBA 2ZFTA 4XSKU 1VZQH 4X0WU 4E7RG 1MD8A 3TK9A 1GVLA 2OUAA 2ZDLA 2GT8A 1KTTB 1T8NA 4FVDA 2PKAB 1H4WA 1HDTH 2GZ8A 5DP9A 2BHGA