1OP0A

Crystal structure of aav-sp-i, a glycosylated snake venom serine proteinase from agkistrodon acutus
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
234
Chain Sequence
VIGGNECDINEHRFLVAFFNTTGFFCGGTLINPEWVVTAAHCDSTDFQMQLGVHSKKVLNEDEQTRNPKEKFICPNKNNNEVLDKDIMLIKLDKPISNSKHIAPLSLPSSPPSVGSVCRIMGWGSITPVKETFPDVPYCANINLLDHAVCQAGYPELLAEYRTLCAGIVQGGKDTCGGDSGGPLICNGQFQGIVSYGAHPCGQGPKPGIYTNVFDYTDWIQRNIAGNTDATCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures and Amidolytic Activities of Two Glycosylated Snake Venom Serine Proteinases
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Venom serine proteinase
total genus 60
structure length 234
sequence length 234
ec nomenclature ec 3.4.21.-:
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op0A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op0A02
3JZ1B 1V2VT 1O2OA 4SGAE 3BG4C 4IN2A 5FPSA 3RM0H 1PPEE 1T4VH 2TRMA 3CS7A 5CE1A 2AGEX 2BHGA 5HGGA 1XXFA 2W7UA 3SBKA 2B9LA 2GTBA 5EG4A 5GWZA 5EXMA 1P3CA 4UFDH 3RXIA 4GSOA 1TGNA 3GY8A 4FVDA 1C5OH 3GY3A 1V2QT 3ZZBA 5ESBA 1LPKB 4E05H 1SOZA 1GGDC 3T28A 1PPZA 3Q00A 3RLYH 1YC0A 4NA9H 3LC5A 1DXPA 3RU4D 1OWKA 4MNYA 4X6NA 1GBBA 1GI9B 1SGEE 1VCQA 1L1GA 2FLRH 1DDJA 3SO3A 2FS8A 2WPHS 4CREA 1P2QA 3TK5A 3KF2A 4H6SB 4A6LA 1W3CA 3M5LA 3ODDA 2AFQB 1WOFA 1SPJA 1XVMA 1ID5H 2OC8A 3RXHA 1LQDB 1K1PA 4JK5A 1HYLA 1UTPA 4AZ2B 2SGPE 3EGKH 2A4RA 3ZVCA 1F5RA 2ALVA 3M7QA 3I78A 1CGJE 2JH0D 2P8OC 3UOPA 4X8UH 4MPXA 1O5GH 1C5XB 1GJ6A 1VR1H 2ODQA 4ZXYH 2R2MB 3NWUA 1NFWA 3HGNA 1Y59T 4VGCB 2OCVB 1JIMA 1ZJDA 1Y3XA 2Q1JA 1MAXA 1C2MA 1ZPCA 2HPPH 1GMCF 3H7TA 3DHKH 4NIVA 3SQHE 1XUKA 3RM2H 4LZ1H 1PQ7A 1ELCA 2P93A 4RN6A 3UOUA 3RC4A 3SJ9A 3A8AA 3ATLA 3PM3A 2ZA5A 3SUGA 2Q6GA 1KY9A 1FQ3A 3BTHE 1ACBE 3TH2H 2XC0A 4BAQB 3M5NA 4CHAC 4DJZB 5F8TA 1ZHMA 2CV3A 2HRVA 3UQOA 1E38B 3BTTE 1RXPA 1TGTA 5E0GA 3TGJE 1O37A 2SFAA 3RXUA 5L30H 1Z8IB 1AN1E 3ZZAA 4Y0YE 1GL0E 1G36A 3LC3A 2A5KA 4ISIH 4K5ZA 1GPZA 4B71A 1QL9A 6ESTA 1TOMH 1GHVH 4YESB 4BXSA 1DWCH 3SNEA 1SGTA 1SLXB 2XBWA 1OX1A 1IQEA 3A87A 5EGMA 3MO9A 1AZZA 3A85A 1LCYA 5EQRA 4R0IA 4A1TA 2A4QA 2J95A 4IBLH 1O2GH 1TPAE 1K1IA 4JZEH 3M7TA 1K2I1 4MVNA 3D65E 1QA0A 2H5CA 2NWNA 2GX4A 1P9UA 1RTFB 1BT7A 1KYNA 4WF8A 1TBZH 5DGJA 5JBBS 1DT2A 3K2UA 1EQ9A 1UO6A 1TFXA 2Z9LA 3ATMA 4Q7XA 4FU9A 3TLOA 4AFZA 4FUJA 3MO6A 4BANB 1GL1A 1QRZA 4NWKA 3NXPA 4AOQA 1SFIA 4E7NA 1K1LA 1O39A 3ENSB 5JPMH 1FUJA 1QJ6B 3GYLB 5HYOA 1QB6A 2XW9A 1FXYA 5EU8A 1DE7H 1Z71A 4I8JA 1NZQH 1F0RA 1SG8B 2PUQH 3HATH 1V2NT 5GDSH 1NRNH 3ZZ8A 4BXWA 5TJXA 3ZZ6A 1KXAA 3P17H 3QWCH 5CHAB 4X8TH 3SV9A 1P03A 3RXQA 1O2JA 8GCHF 5JBAS 3Q77A 1BTZA 4LK4A 1QQ4A 1YGCH 1W14U 3ZZCA 1O2IA 2ZGJA 1MH0A 2R2WU 1OWJA 6GCHF 4OS5A 1ZPZA 5AFYH 4B75A 2XCNA 2ZPQA 1C2IA 3O8RA 1V6DA 4AFSA 1CVWH 4YLQH 1SGPE 2QXJA 5LPFA 3GDSA 1TMTH 1GDUA 2R9PA 2V0BA 1WBGB 2FOBA 3FFGA 1TMUH 2B7DH 4MPUA 4CRCA 2TBSA 1O31A 1QR3E 1KTTB 1TIOA 3F9FA 6GCHG 4YZUA 3SV6A 1UJ1A 2ZFTA 1IQJA 5AF9H 1GCDA 1SSXA 3Q76A 4Y71A 4K8BA 1ZHPA 4DT7B 1BCUH 4HTCH 1O2YA 1E35B 1ZHRA 2YNBA 1O3CA 6CHAC 3EA9A 1BA8B 2FO9A 1OS8A 3RXDA 2BY8X 3BTGE 3QLPH 1OYTH 2FLBH 4CRFA 3HKJB 4WXVA 1ZRBA 3VB4A 4NCYA 1C5QA 4A1VA 3KN2A 4FUHA 2FESH 4JZ1A 1Y5UT 4AGJA 1NESE 4NWLA 9ESTA 4GUXA 1TWXB 5T6DA 3KQCA 4U2WA 1ZMJA 3T27A 2NU1E 1GVKB 1RTKA 2OBQA 4J2YB 2H9TH 4K60A 1K1NA 1GBAA 1D9IA 2OC0A 1AU8A 1C1NA 3E1XB 1MQ5A 1HV7A 3VPKA 4X8SH 1HAZB 2NU3E 2O8WA 3HGPA 2C8ZB 2VINA 3P8FA 3S9BA 5JB9S 2AIQA 1BRCE 2XWAA 2SGQE 1Z8JB 2HNTE 3GCTF 2ZG0H 2ZTXA 3DUXH 3V0XA 2ZCHP 1Z1IA 3KIDU 1GI5A 5T6FA 4CRGA 2GP9B 3Q3XA 4FVBA 1ELFA 1EAWA 4GAWA 4ZXXH 2IOTA 1QGFA 2OXSA 3KEEA 1C5VA 2BZ6H 3W94A 5EOKA 1AY6H 1A0LA 2FOHA 1EZSC 3P70B 2PWXA 5FX6A 1EJMA 1O2TA 1EUFA 2V3HH 1DUAA 4MNVA 1PPBH 1TABE 1PQ5A 2A7JA 4ZHAA 3GDVA 1MMJN 2BLOA 1XUFA 3A88A 1H9IE 1GJBB 3LH1A 4K1TA 1HB0B 2BQWB 4NZLA 1BTXA 2ZDVH 5F8XA 2BOKA 1EZUC 1S85A 1KTSB 1W0ZU 1IQHA 3PB1E 1LHFH 2AMDA 1YM0A 1L2EA 1OWIA 2ILNA 5DP6A 5L2ZH 4GVUA 1J16A 1IQIA 1ZR0A 1SQAA 1CE5A 1NM6A 1L4ZA 3UPEA 2OD3B 3BTDE 4AG1A 4M7GA 4MNWA 1EZXC 1ZMLA 1O3DA 1EAIA 2BY9X 3LJOA 2CXVA 1DY9A 3F68H 1BQYA 3P8NA 2GCHF 1XMNB 3E90B 2O8UA 1CGHA 3BTQE 3HKIB 1Z8RA 2WYGA 2FM2A 2PTCE 3MU8A 4MLFB 5EPYA 2UUJB 1LO6A 1O3BA 4X1NU 2PW8H 1C2EA 5A8YA 2B5TB 3UR9A 3SV8A 4XE4A 1J17T 1ZGVA 1UTQA 2A4OA 1ELEE 1L1JA 3SI4H 1F2SE 1O30A 5A8XA 1GHWH 3KHVA 2PHBA 3RXVA 3SNBA 1RRKA 4ABIA 1T8MA 1HUTH 3B23B 4NIWA 1THSH 1D3DB 1SOTA 1O2VA 3E8LA 2XBYA 1H9LB 1XXDA 2C3SA 1S81A 1C1VH 4OS6A 1C5RA 5C3NA 2D1JA 3RLWH 5K0HA 1FONA 1P3EA 3KGPA 2ZQ2A 4U01A 2G5VA 3A82A 1EPTC 5B6OA 1TPOA 2QN5T 3T2NA 3RXGA 4RKJB 1UVOA 3BTEE 3LIWA 1DUEA 1FLEE 3LONA 3NKKA 4MDSA 4OS7A 3TGKE 1TQ7B 3QTVH 1KLJH 1YYY1 3ZZ3A 3A89A 2F9UA 2BD2A 1VITH 3KCGH 1DVAH 1TNGA 3MOCA 2JH5D 2QF3A 3M3SA 1GBTA 1ETTH 1GJAB 1NTPA 4XFQA 3ZZ7A 1AUTC 2OUAA 1BBRE 3IWMA 1OP8A 3KNXA 2WPLS 1EPTB 1AGJA 3A81A 4O3TA 1FY8E 2FWWA 3U8TH 3E3TA 1P2KA 1WQVH 1CO7E 4THNH 3ZZDA 1RGQA 1MD8A 3A8CA 3F1SB 2A4GA 1IOEA 2VB0A 5G4BA 1V2UT 2A5AA 2BQ7B 1TNLA 4OGYA 2BY6X 2ZZUH 1TYNA 1SQOA 2F9BH 3A80A 4YO9A 4UONA 1O2KA 7LPRA 1MZDA 1TOCB 3SJ8A 1GHBF 3S0NA 4ZH8A 1DXWA 4DG4A 1GI7B 4Q80A 3EAJA 3QZRA 2ZWLH 2ZC9H 1WQSA 2SGFE 2Q6FA 1SVPA 2WV5A 4UD9H 1C5SA 2C8XB 3QGJA 4X2WA 1EP6A 1GBEA 4Y8XA 2ZFQH 3ODFA 1FN8A 4XDEA 1TMBH 3FVFB 1HAXB 2NU0E 3M35A 1O38A 1GBMA 2BDIA 3MH6A 1X7AC 3GCHC 1DWBH 5FX5A 2OLGA 1KIGH 2ZU3A 2FX6A 4A5TS 2ZEBA 3STIA 2PKSC 2GZ9A 4OS1A 3ZV8A 1UVTH 3ZZ4A 2SGAA 2BVXH 4GPGA 1C1TA 3ZVAA 1FAKH 1SGIB 1UK4A 4BAOB 1HAGE 1P2JA 4YOGA 1UHBB 3RXOA 3UUZA 1L1NA 3BEUA 5EQQA 1P2NA 3U1JB 3LGWA 3PTNA 1MKXH 4WVPE 4TYDA 2Y80A 1SHYA 3ITIA 1EB1H 2VWMA 4K1SA 1BMNH 5TCCA 3PWBA 4Y7AA 3BV9B 2EI8A 3VFEA 1ORFA 2THFB 1MKWH 2Z3CA 3BIUH 1QFKH 1ESAA 1DS2E 1HNEE 2W5EA 1A3EH 2SGEE 4BAHB 1SGYE 4MTBA 3TNTA 1TRYA 1BMMH 5EPNA 3LJJA 1W13U 1GJ9B 3RXCA 2VWNA 2J94A 2ZFSA 3Q3YA 2FOEA 5CHAC 2H5DA 2BD5A 3QN7A 4H42U 3KL6A 1V2RT 1VJ9U 4FUFA 2FEQH 3OTJE 5F03A 4GCHG 3SJKA 1O2MA 2C4FH 2JH6D 2FIRH 3SU4A 1E37B 3MH4A 4CR5A 1PJPA 1C5TA 2A7CA 4UDWH 4ABAA 1BHXB 1C5ZB 3RC6A 2Z9GA 3L6PA 5E0HA 1FY5A 2A1DB 1KDQA 1ARCA 1TA6A 1CQQA 3PV4A 1IHTH 1O33A 2HOBA 1LHEH 3A84A 1SL3A 1J8AA 1HXFH 1BITA 4K3JA 1QIXB 5SGAE 1YPKH 2FYQA 1O3LA 4FUDA 1O5FH 1W12U 3R0FA 2VH6A 1OP2A 4IMQA 1CHGA 1EP5A 4AGKA 5C2ZA 4D9RA 4X2YA 2Y5GA 1HPGA 1OOKB 2C8YB 1BBRH 3OSYA 3BSQA 4U32A 2OQUA 2PGBB 1UK2A 4X2VA 7KMEH 2ZU5A 5TCAA 1XUGA 1XM1A 2IPHA 1O2WA 2M5TA 2YOLA 1SLUB 1GJCB 2QA9E 1C5YB 5E0JA 4O97A 1S0QA 1A4WH 2ZTYA 2GZ8A 3MU1A 1EOJA 1PPHE 3RXRA 1NC6A 5BPEA 3BG4B 1K22H 1T8LA 2ZFFH 5A09A 1XKAC 3D23A 1SFQB 3PLKA 1V3XA 3SOSA 1SC8U 4ABDA 4XOJA 3VB5A 2QXHA 3BEIB 1CT0E 2A31A 1GJ8B 4GLYA 1H1BA 4Z6AH 1QURH 2OTVA 3FP7E 1MU8B 1CSOE 2STAE 2ZHDA 1FY4A 3WY8A 2I6QA 4DW2U 2A45B 3ATWA 1UVUH 4I32A 3UFAA 1YPEH 3EE0B 5FBIA 1O3MA 5AHGH 3TGIE 3SNDA 3URCA 3P92A 2Z7FE 1P2OA 1OWEA 4F4OC 3RP2A 1C5WB 1MU6B 1DY8A 3QGNB 1C1QA 3S7KB 4AYVB 1GHXH 3STJA 2FOCA 4IS5A 1ZSJA 1ESTA 1KLIH 3GY7A 2UUKB 2J34A 3F9EA 4Y11E 3S69A 1ZJKA 2DE9A 1A2CH 1O5CB 3EQ0H 4X1PU 3PTBA 4NSVA 2GT8A 1GHBG 2ZDAH 5DPAA 1BJUA 2O8MA 2XYAA 1O3AA 4I8GA 1FDPA 3GCOA 2EI7A 2JETB 4WY3A 1NFXA 1GWAA 2A2XH 1GCTB 1J14A 4ISNA 4AG2A 1B0EA 2FYRA 1SB1H 1O3GA 2OBOA 2D26C 1F5KU 2BLVA 1HJAB 5C20A 1SI5H 3M5MA 2OINA 2ZGBH 3LT3A 2LPRA 3LKWA 2ZNKH 2HNTF 3GY2A 4INLA 3O8DA 1EATA 3DFLA 1SGFG 4MPWA 4ZKNU 5DO4H 1LPGB 1UVPA 3LGYA 4B73A 2ZDMA 2ZI2H 4GHTA 1TONA 2FXRA 4FUIA 1C2GA 2ZECA 1ZPBA 3SJIA 1HAPH 2Z94A 5I46H 3GCHB 1C4Y2 2Z9JA 2QGRA 3NPSA 1FPHH 3AAVA 1NY22 1SLWB 2VWLA 1V2TT 2FODA 4RSPA 4KELA 1PPGE 1QNJA 2SNVA 1O5AB 2GDEH 2ZKSA 4CHAB 1T7CA 4XSKU 1NRPH 1WUNH 5H4IB 2A32A 3A83A 1EPTA 1U6QA 4Q7ZA 2BB4A 1ANCA 2KAIA 3C27B 1O5DH 3RDZA 3U8RH 3U1IB 1JIRA 1GMHF 1W2KH 3K65B 4WMFA 4Y0ZE 5GCHG 3RC5A 2BDBA 1JWTA 4KP0A 1VGCB 1C1SA 2LNCA 4X1SU 3B9FH 2FS9A 2BD3A 2CHAC 1GMDG 2AGIX 1LKBA 2C90B 1ZLRA 1SGFA 1CBWC 1JOUB 3QO6A 5DP5A 4IN1A 1SBWA 1HAIH 2C93B 1JBUH 2RA3A 3UWIA 7GCHG 2R3YA 2VGCC 3LGIA 2VVVA 1K1JA 1QB1A 4PROA 4BAMB 3OY6U 4NG9H 3MU0A 2QCYA 1BMLA 2GGVB 3KQBA 3L33A 2J92A 3O8CA 2FMJA 1KLTA 3DA9B 1CA8B 4X1QU 1FNIA 3V3MA 1NT1A 1V2JT 2VVCA 2PKSB 1SHHB 5LPEA 3FZDA 4X2XA 1QRWA 3PMHB 1O2XA 2CHAB 4I31A 2ZCLP 1D4PB 3RMNH 1ABIH 3GY5A 3UWJH 4FUCA 3SU2A 4DY7B 4UE7H 3TJNA 3RXMA 2NU4E 1P9SA 4ZHLU 3T5FH 1XVOA 4Y8YA 1NU9A 4AB8A 3E0PB 1MCVA 2FPZA 4NIXA 4ISHH 1OYQA 2VIPA 1HXEH 1F0TA 3PWCA 1YKTA 1CHOF 1KXDA 3UY9A 3RXLA 1GHAF 1GHYH 1ZYOA 5E2PA 1ELAA 1RS0A 2ZO3H 5JYIA 2GMTC 2OQ5A 5AFZH 1Q2WA 3M36A 3UNSA 4B76A 1S6HA 2ZHFH 4NZQA 4KTCA 2ZTZA 4WXIA 1O2SA 2ZGCA 2VIQA 1HAOH 1GDQA 1BRAA 3MYWA 1FPCH 1J9CH 2ZPSA 2W7SA 1XUHA 3BIVH 2P3UB 3GY4A 1K1MA 2FTMA 4I7YH 1W11U 3VB7A 2WUCA 2Y6TA 4B2CA 4WH8A 1FIWA 2BD8A 1JRSA 2D8WA 4ABBA 2XWBI 4JCNA 5I25A 4CH2B 1AB9C 1GBDA 3HPTB 4LXBH 3AAUA 1DSTA 1HAHH 4JZDH 1LVYA 2XBVA 4D7GA 3EA7A 3RUOA 3BG8A 3MNBA 1C4V2 1ELTA 3SW2B 4AB9A 2HLCA 1GGDB 1UCYE 3G01A 3FP6E 4FU8A 1BBRK 1YCPM 1HJAC 1A5HA 1EZQA 2FI5E 4I8LA 1W0YH 1MZAA 2BY5X 3PYHA 4ZKRU 1G3BA 1UTJA 1RD3B 1BIOA 1C5MD 2Z3EA 1V2PT 1H9HE 3TPIZ 3PMJA 2G4TA 4A1XA 1NRRH 1VGCC 5ETXA 2HALA 3JZ2B 5JBCS 5EQSA 4U30A 1P01A 1KSNA 1G3EA 3SV7A 1GVZA 3DT0H 4MQAA 1DWEH 1GJ4H 1H8IH 2CMYA 1G3CA 2ZDKA 1C9TA 1QBOA 4AFQA 2G4UA 1P2MA 1BTYA 2PR3A 1BRBE 1P10A 4RKOB 1Q3XA 1C2HA 2EEKA 3TK6A 4X6PA 4HZHA 5C67A 1BJVA 4ESTE 1P12E 2PFEA 3PROA 5C1UA 2VVUA 4ZAEA 3Q3KA 4XBBA 1IQNA 1AD8H 2BX4A 1RJXB 2UWOA 4JK6A 4ISOA 2ESTE 4O9VA 1UTMA 2WV4A 3E0NB 2XNIA 2FZZA 5DP3A 4Y79A 4AX9H 1TE0A 1YPMH 1V2ST 1GMCG 2AMQA 2ASUB 3URDA 1YBWA 4NA7A 3ZZ5A 1TGCA 2OC7A 3N7OA 1TRNA 2OC1A 3UR6A 5FHTA 1IAUA 1Y3YA 1MUEB 1AB9B 1AHTH 3ELAH 2A0QB 3M61U 2G00A 3ESTA 1NRSH 2QAAA 3AASA 4YM9A 1YP9A 1C2KA 5T3HA 5L2YH 4H6TA 4DOQA 1O35A 1Z6JH 3SNAA 2XRCA 2DUCA 2VH0A 2AMPA 2ZDNA 4MNXA 5LH8A 4AN7A 3NCLA 1TPSA 3ZYEA 1C1OA 5C1YA 4D7FA 2RA0A 3QDZB 3S7HB 2BQ6B 3SGAE 1IHSH 2QY0B 4AYYB 3TJOA 3GISB 1LHGH 1HAVA 1NS3A 4B1TA 2BDGA 1LTOA 4DURA 1O2LA 5HM2A 1O2UA 1YLDA 2CN0H 3MO3A 2JKHA 2R0KA 3A7XA 1WSSH 2AGGX 2BMGB 1DOJA 5A8ZA 2P16A 1H4WA 5DP4A 4TPYA 1ETSH 1YPJH 2Y82A 5EW2H 1AMHA 6LPRA 1A5GH 3LPRA 1F92A 2TPIZ 2W26A 2AEIH 2AYWA 3LGTA 3H5CB 2BZAA 2SNWA 4TPIZ 5EODA 1V2WT 5FBEA 1UTNA 2F9NA 2HVXA 1BRUP 2PKAB 1LHDH 3OY5U 1CA0B 1THRH 2O9QA 1NU7B 2XBXA 2B0FA 1HJ8A 3SU3A 3TNSA 3BTWE 2GV6A 1TRMA 4OS4A 3MH7A 1QY6A 2XCFA 1GMDF 1TGBA 1HDTH 2ZFPH 1ELGA 1NPMA 2G5NA 1Z8GA 2KAIB 3ZVDA 1EOLA 3TJVA 1T31A 4JMYA 1C2JA 1C2FA 2GCTC 2SGDE 3F9GA 2ZGXH 1LKAA 4Y7BA 1W7GH 4O03A 1ZZZA 2VGCB 1XKBC 1YPHE 1KXBA 4KTSA 1NRQH 4DCDA 4HI3A 1G30B 1HAVB 1PYTD 1O32A 1XUJA 1C1RA 5CMXH 3TH4H 2GZ7A 1ESBA 4Q2KA 1AKSB 2WPKS 1ARBA 3V13A 3F6UH 2TGPZ 3BEFB 3PO1C 4CBOA 1UK3A 3M37A 4ZHMU 5ESTE 1MTVA 3QZQA 2ZGHA 4IC5A 3MH5A 2ODYB 4NA8A 1O0DH 1ZGIA 3GOVB 1V2LT 2BVSH 3OYPA 2ZHQH 2C8WB 1DICA 1SGRE 1GI1A 8LPRA 3SU1A 1MAYA 3S9CA 3SHCH 3EDXB 1IQMA 4JZIA 4K69A 1BTHH 4NSYA 2WUBA 1AFEH 1IQGA 1A61H 4I8HA 5J4QA 1C2LA 2DE8A 1GBJA 2Q6DA 1O2QA 1Z1JA 3GCTG 3IITA 1M9UA 1TB6H 5E2OA 3PMBB 2QV1A 1CHOG 3VGCB 2AERH 3UIRA 1GI2A 1IQKA 2Y5HA 2FI4E 2J4IA 5A0CA 1FMGA 3GDUA 1E0FD 5C5OA 2BLWA 1QJ7B 1ZTLA 3RXSA 1IQFA 3QX5H 4HGCA 4ABFA 1AWFH 2P8OB 3U69H 3A7TA 5FCKA 4IC6A 4UFFH 4E7RG 3BTME 2WPJS 3KQEA 3TH3H 1HJ9A 1P2IA 1WTGH 1A7SA 1ZOMA 2FOGA 1UMAH 4ABGA 2BXTH 5EXLA 1TX6A 5A2MH 1C5UA 3MNCA 2EA3A 5F8ZA 4ZUHA 4CH8B 2FX4A 2IN2A 2PSYA 1C1WH 2VNTA 1QQUA 4YT6H 1CU1A 2WPIS 4JZFH 1PQAA 1J15A 1VITG 1Y3UA 4FXGH 3MWIU 4OGXA 1LPZB 5J4SA 2ZU1A 3MMGA 1S83A 1KXCA 1CA0C 5DG6A 2A7HA 1O2PA 1O2RA 3QK1A 8KME2 3RXKA 2ALPA 3ATIA 4I33A 1T8NA 2W3KA 1UHBA 5A0BA 2UUYA 3TU7H 1G2LA 1T8OA 2CJIA 1NFYA 1SGDE 2G55A 4HFPB 4B2AA 1HAYB 5L6NH 1C5PA 1QA7A 6CHAB 2RG3A 2QYIA 1T32A 2VIDA 1G37A 2V35A 2ZP0H 3AVZA 1LHCH 1S0RA 4D9QA 4YLUA 3DD2H 2ULLA 2TGTA 1TX7A 2ZDLA 3LOXA 2BXUH 1O3EA 3HK3B 1OXGA 2BD4A 1P05A 1F0UA 3RXEA 5DP9A 3ZZ9A 3TIUA 1Y8TA 1Y3VA 1O3OA 2ZQ1A 3M7UA 1B7XB 3RXAA 3ZVEA 1K21H 5JDUB 1MTWA 2ANYA 1C1UH 1QL7A 3QUMP 5F6MA 4IW4E 4Y76A 1A0JA 1O3JA 2H2ZA 3TVJB 3PO1B 3CP7A 1HCGA 4BOHA 3A86A 1C2DA 1PQ8A 2XXLA 2V6NA 1AVWA 1BHXF 1V2KT 3NK8A 2AS9A 4FU7A 5FXLA 2Y7XA 4YOIA 1Y3WA 1AO5A 4I8KA 3LDXH 2CF8H 4BAKB 1V2OT 1EX3A 4ABHA 1HIAB 5IDKA 4K8YA 4MPVA 1MBMA 1QL8A 2QF0A 3TK9A 2FTLE 4CR9A 5HXFA 1O3HA 3P6ZB 4IMZA 1W8BH 2QIQA 2BY7X 5C5NA 1HBTH 1GBIA 1HLTH 1VJAU 3SGBE 5C1XA 1A0HB 3E16B 4ABEA 1N6YA 4QT8C 2TIOA 4IGDA 1UVSH 1GI8B 2QC2A 1AQ7A 1A1RA 1QJ1B 1TA2A 4D8NA 2FDAA 2QXIA 3U8OH 4MG3A 1H8DH 4WWYA 5DK1A 4J1YA 2HPQH 1C5NH 3K9XB 1JXPA 1XUIA 1BMAA 1BOQA 1FAXA 2PGQB 3SN8A 1EXFA 2ZHEH 2P3TB 4X1RU 1GI4A 1ZRKA 2H1UA 2ODPA 3B8JA 2PTNA 2UWPA 1L0ZA 3VGCC 1UCYH 3L3TA 3FZZA 4OS2A 1FN6A 1AIXH 1O2ZA 3M3VA 1EKBB 8ESTE 3V12A 1MKWK 1DSUA 4CRAA 2FOMB 2NU2E 1QTFA 1AE8H 4R8TB 1P8VC 4NFEA 2GT7A 3UQVA 3K6ZA 1SGQE 3RXPA 3T25A 5K7RA 2TGAA 1FJSA 1F5LA 4TY7A 2A5IA 2BYAX 3SU0A 4YTAA 1G2MA 1WV7H 3RMMH 7ESTE 2BVRH 1AI8H 3SUEA 1ZSLA 2HGTH 1DLEA 1P04A 1RTLA 2F9VA 3BN9A 1ZMNA 1THPB 1O3KA 2GCHG 4UFGH 1PFXC 1Y5AT 1GG6C 2FOFA 3IG6B 2BDAA 2Z9KA 4Y8ZA 5FAHA 4AFUA 1UCYK 2F9PA 2ANMH 3PMAB 4CRDA 1YPGH 1GI6A 1K1OA 2GV7A 3LH3A 3E6PH 3SNCA 1HRTH 3W95A 1DITH 2P59A 2OP9A 4Y6DA 1AVXA 2ZCKP 1TBRH 3LGVA 1F0SA 5JBTA 1ZTKA 1TNHA 1T4UH 3I29A 3GYMA 2VJ1A 2P95A 3ZV9A 1B0FA 4GCHF 1FV9A 5EW1H 3ZVFA 1RIWC 1B5GH 1VITF 3V7TA 4B74A 3AW0A 1A46H 1MD7A 1L4DA 1PYTC 3RXFA 1GHAG 1QBNA 4WJG2 1O3NA 3BF6H 3HK6B 1YF4A 1W7XH 1BDAA 1P06A 3KQDA 4Q7YA 1O3FA 3RXTA 1OWHA 3FP8E 1MBQA 3M3TA 3SGQE 1GMHG 3SV2H 3MFJA 1TGSZ 1XX9A 1LMWB 1C5LH 3P8GA 3T26A 1BB0B 2RDLA 9LPRA 4BTUB 1O3PB 2STBE 4YT7H 4NIYA 1HFDA 1QB9A 2WPMS 2AIPA 5GXPA 1EJAA 4KKDA 1ELDE 2WINI 2AH4X 3A7YA 5FCRA 3A7WA 1OKXA 1C9PA 2WYJA 2Y81A 1GBKA 1AZ8A 5IYTA 3P95A 3R3GB 3MU4A 2YNAA 1DFPA 1O34A 1VCWA 2VU8E 3NUMA 1JMOH 2BD9A 1D6RA 2B8OH 2PSXA 2ANKH 3MU5A 3SHAH 2R3UA 2BD7A 1DX5M 5DJ7A 3P8OA 2CF9H 2GMTB 1MQ6A 2PLXA 8GCHG 1Q31A 1TNKA 2D2DA 4B2BA 1N8OB 3OU0A 2J38A 1GDNA 4ISLA 2Y5FA 1QBVH 1CGIE 5ABWA 1ANEA 4NGAH 2F3CE 1AFQB 2ANWA 1NFUA 1Y5BT 1YLCA 2W3IA 4SGBE 1ELBA 1VCPA 1S82A 1GI3A 2J9NA 1WYKA 2BTCE 3RMLH 1QHRB 2Z3DA 1FI8A 1N6XA 1P57B 3M5OA 3FAOA 4X8VH 5HMAA 1D3TB 5DP8A 1LVBA 1AUJA 1E34B 4UEHH 1G9IE 2V3OH 1S84A 3AW1A 1NO9H 2PKAA 4CRBA 3O8BA 5GCHF 1KXEA 1EJNA 1N8OC 4FUGA 3UNQA 2G52A 2EI6A 2UWLA 2ZU4A 3QTOH 1MTNB 2PUXB 2Z6BD 3K6YA 2O8TA 5DP7A 5FPTA 3F9HA 1D6WA 3C1KA 1MTUA 1GBFA 3VB6A 4Z0KA 4GHQA 1BZXE 1YCPK 4DGJA 1O2NA 2BDHA 3UNRA 3CS0A 2P94A 2I6SA 3ZYDA 1O5BB 4WH6A 1ANDA 2O8LA 1OPHB 3SU5A 4LZ4B 1EAXA 3TJUA 1IQLA 1GHZA 7GCHF 4WMDA 4A7IB 1VZQH 3U9AH 1FZZA 1SGNE 1FY3A 3NZIA 1DM4B 4ZKOU 1FY1A 5LGOA 1TNIA 1CBWB 2R0LA 1KXFA 1GBCA 1S6FA 1ZTJA 5T6GA 2BM2A 2UUFB 3A8BA 2ZU2A 4K1EA 1ABJH 1WTHD 2Y7ZA 1LQEA 4K2YA 3RU4E 1TALA 1TQ0B 1C1MA 3MHWU 5AVDA 2A2QH 3MNXA 1F7ZA 3S9AA 2BDYA 1C1PA 4BTIB 4CBNA 4ZMAH 1GBHA 3PLPA 1LVMA 2GKVE 1K9OE 4A92A 1G3DA 4NFFA 1DANH 3H7OA 2VIOA 4O3UA 4D76A 4Y10E 3U98H 4DVAU 1EB2A 3I77A 4FUBA 1GCTC 1UTOA 5GPIB 1OP0A 2H6MA 3RU4T 2H9EH 2BDCA 4TWYA 3A7VA 5DKMA 1GVLA 1QRXA 1C4U2 3OX7U 5EXNA 1HIAA 1EASA 2TGDA 3GICB 1W10U 1SMFE 1GJ5H 1O2HA 1UTLM 1TAWA 1YPLH 2QXGA 4INKA 1HGTH 2VIWA 5FPYA 5JB8S 2F83A 1BTWA 1DWDH 1G32B 2FOAA 3TITA 4XBDA 1LVOA 1AWHB 4YOJA 3SZNA 1NROH 1OSSA 1MCTA 4INHA 4DIIH 1WU1A 1AE5A 1BTPA 1ZSKA 1Z7KA 4DIHH 3LU9B 2VWOA 3ZVGA 2XC5A 1ANBA 4E06H 1UTKA 4ASHA 3SI3H 2G81E 4ZROA 3MTYA 2ZPRA 4X6OA 1JRTA 2GDDA 3D62A 5BRRE 1S5SA 1TBQH 1N1LA 2FP7B 1DPOA 3D49H 4TY6A 3RMOH 1QCPA 2BOHB 1BUIA 2F9OA 3GCNA 3E91A 2BX3A 1P11E 1CT2E 1SGCA 3PLBA 5GIBA 4BTTB 2ZHWH 1SLVB 2JETC 2XC4A 4JYVH 1ELVA 1BTUA 1ETRH 2CGAA 1V2MT 1TX8A 4TWWA 3RXJA 1FIZA 1D3PB 2GVFA 1RFNA 3GY6A 1EAUA 4XBCA 1PPFE 1D3QB 3A8DA 1P02A 3SU6A 2ZFRH 3ATKA 2XTTB 1CT4E 4KTUA 1A5IA 1KDQB 1YPHC 1P09A 4FUEA 2PV9B 1MKXK 2FI3E 3EA8A 3MI4A 1Z6EA 2P3FH 2GD4B 3A7ZA 2GCTB 3LGUA 4ZKSU 1AVGH 2ZIQH 3VXFH 1INCA 3EYDA 1MTSA 5E8EH 1OWDA 4JYUH 1AKSA 1K28D 4VGCC 2VIVA 3SJOA 1GG6B 5HM9A 2EC9H 1PPCE 3UTUH 3CENA 3SORA 3SQEE 1DLKB 1TPPA 4AORA 2G8TA 2F91A 3ZVBA 3SUDA 1TNJA 5LPRA 3SUFA 2ZF0H 5A0AE 1TLDA 3FANA 4F49A 2RCEA 3VEQB 4X6MA 1WAYB 3BTFE 1WCZA 1GBLA 3BTKE 4WMEA 2K1QA 1GJ7B 3T62A 4H4FA 1GJDB 4ABJA 4BNRA 1SR5C 2IJOB 4UFEH 1SQTA 3RXBA 4X0WU 5PTPA 1AFQC 3DFJA 1A3BH 3UREA 1O5EH 3VB3A 3VXEH 2HWLB 2Z9IA 1E36B 1GI0A 3T29A 4KGAA 2HNTC 1LDTT 2BLQA 4LOYH 1P0SH 2G51A 1RIWB 2J2UA 1YCPH 2H9HA 1NN6A 1O36A 4JYTA 1MTNC 5GJ4B 1O3IA 3MNSA
chains in the Genus database with same CATH superfamily
3JZ1B 1V2VT 1O2OA 1YLNA 3BG4C 4IN2A 4SGAE 5FPSA 3RM0H 1PPEE 1T4VH 2TRMA 3CS7A 5CE1A 2AGEX 2BHGA 5HGGA 1XXFA 2W7UA 3SBKA 2B9LA 2GTBA 5EG4A 2W6JD 5GWZA 5EXMA 1P3CA 4UFDH 3RXIA 4GSOA 1TGNA 3GY8A 4FVDA 1C5OH 3GY3A 1V2QT 3ZZBA 5ESBA 1LPKB 4E05H 1SOZA 1GGDC 3T28A 1PPZA 3Q00A 3RLYH 1YC0A 4NA9H 3LC5A 1DXPA 3RU4D 1OWKA 4MNYA 4X6NA 1SKYE 1GBBA 1GI9B 1SGEE 1VCQA 1L1GA 2FLRH 1DDJA 3SO3A 2J5UA 2FS8A 2WPHS 4CREA 1P2QA 3TK5A 3KF2A 4H6SB 4A6LA 1W3CA 3M5LA 3ODDA 2AFQB 1WOFA 1SPJA 1XVMA 1ID5H 2OC8A 3RXHA 1LQDB 1K1PA 4JK5A 1HYLA 1UTPA 4AZ2B 2SGPE 3EGKH 2A4RA 3ZVCA 1F5RA 2ALVA 3M7QA 3I78A 1CGJE 2JH0D 2P8OC 3UOPA 4X8UH 4MPXA 1O5GH 1C5XB 1GJ6A 1VR1H 2ODQA 4ZXYH 2R2MB 3NWUA 3ZIAD 1NFWA 4Q4LA 2HVYB 3HGNA 1Y59T 3SYJA 4VGCB 2OCVB 1JIMA 1ZJDA 1Y3XA 1K0HA 2Q1JA 1MAXA 1C2MA 1ZPCA 2HPPH 1GMCF 3H7TA 3DHKH 4NIVA 3SQHE 1XUKA 3RM2H 2LP6A 1PQ7A 4LZ1H 1ELCA 2P93A 4RN6A 4B6EA 3UOUA 3RC4A 3SJ9A 3A8AA 3ATLA 4P02A 3N7EA 3PM3A 2ZA5A 3SUGA 2Q6GA 1KY9A 1FQ3A 3BTHE 5KEDA 1ACBE 3TH2H 2XC0A 4BAQB 3M5NA 4CHAC 4DJZB 5F8TA 1ZHMA 2CV3A 2HRVA 3UQOA 1E38B 3BTTE 1RXPA 1TGTA 5E0GA 3TGJE 1O37A 2SFAA 3RXUA 5L30H 1Z8IB 1W0JD 1AN1E 3ZZAA 4Y0YE 1GL0E 2WZQA 1G36A 1QZ8A 2A5KA 3LC3A 4ISIH 4K5ZA 1GPZA 4B71A 1QL9A 5KGOA 6ESTA 1TOMH 1GHVH 4YESB 4BXSA 1DWCH 3SNEA 1SGTA 1SLXB 2XBWA 1OX1A 1IQEA 3A87A 5EGMA 3MO9A 1AZZA 3A85A 1LCYA 3OFND 5EQRA 4R0IA 4A1TA 2A4QA 2J95A 4IBLH 3F2HA 1O2GH 1TPAE 1K1IA 4JZEH 3M7TA 1K2I1 4MVNA 2CK3D 3D65E 1QA0A 2H5CA 2NWNA 2GX4A 1P9UA 1RTFB 1BT7A 1KYNA 4WF8A 1TBZH 5DGJA 5JBBS 1DT2A 3K2UA 1EQ9A 1UO6A 1TFXA 2Z9LA 3ATMA 4Q7XA 4FU9A 3TLOA 4AFZA 4FUJA 3MO6A 4BANB 1GL1A 1QRZA 4NWKA 3NXPA 4AOQA 1SFIA 4E7NA 1K1LA 1O39A 3ENSB 5JPMH 1FUJA 1QJ6B 3GYLB 5HYOA 1QB6A 2XW9A 1FXYA 5EU8A 1DE7H 1Z71A 4I8JA 1NZQH 1F0RA 1SG8B 4P00A 3WWBA 2PUQH 3HATH 1V2NT 5GDSH 1NRNH 3ZZ8A 4BXWA 5TJXA 3ZZ6A 1KXAA 3P17H 1COWD 2IJD1 3QWCH 3FOAA 5FL7D 2YMSB 5CHAB 4X8TH 3SV9A 1P03A 3RXQA 1O2JA 8GCHF 5JBAS 3Q77A 1BTZA 4LK4A 1QQ4A 1YGCH 1W14U 3ZZCA 3OTPA 1O2IA 2ZGJA 1MH0A 2R2WU 1OWJA 6GCHF 4OS5A 1ZPZA 5AFYH 4B75A 1UW7A 4B6FA 2XCNA 2ZPQA 1C2IA 3O8RA 1V6DA 4AFSA 1CVWH 4YLQH 1SGPE 2QXJA 5LPFA 3GDSA 1TMTH 1GDUA 2R9PA 2V0BA 1WBGB 2FOBA 3FFGA 1TMUH 2B7DH 5C17A 4MPUA 4CRCA 2TBSA 1O31A 1QR3E 1KTTB 1TIOA 3F9FA 6GCHG 4YZUA 3SV6A 1UJ1A 2ZFTA 1IQJA 5AF9H 1GCDA 1SSXA 3EE7A 3Q76A 4Y71A 4K8BA 1ZHPA 4DT7B 1BCUH 4HTCH 1O2YA 1E35B 1ZHRA 2YNBA 1O3CA 6CHAC 3EA9A 1NBME 1BA8B 2FO9A 1OS8A 2QF5A 3RXDA 2BY8X 3BTGE 3QLPH 1OYTH 2KCOA 2FLBH 4CRFA 3HKJB 4WXVA 5EJLA 1ZRBA 3VB4A 4NCYA 1C5QA 4A1VA 3KN2A 4FUHA 2FESH 4JZ1A 1Y5UT 4AGJA 1NESE 4NWLA 9ESTA 4GUXA 1TWXB 5T6DA 3KQCA 4U2WA 1ZMJA 3T27A 2NU1E 1GVKB 1RTKA 2OBQA 4J2YB 2H9TH 4K60A 2KX4A 1K1NA 1GBAA 1D9IA 2OC0A 1AU8A 1C1NA 3E1XB 1MQ5A 3FN8A 1HV7A 3VPKA 4X8SH 1E79D 2EQNA 1HAZB 2NU3E 2O8WA 5F53A 3HGPA 2C8ZB 2VINA 3P8FA 3S9BA 5JB9S 2AIQA 1BRCE 2XWAA 2SGQE 1Z8JB 2HNTE 3GCTF 2ZG0H 2ZTXA 3DUXH 3V0XA 2ZCHP 1Z1IA 3KIDU 1GI5A 5T6FA 4CRGA 2GP9B 3Q3XA 4FVBA 5C0UA 1ELFA 1EAWA 4GAWA 4ZXXH 2IOTA 1QGFA 2K0QA 2OXSA 3KEEA 1C5VA 2BZ6H 3W94A 5EOKA 1AY6H 1A0LA 2JJ1D 2FOHA 1EZSC 3P70B 2PWXA 5FX6A 1EJMA 4M9FA 1O2TA 1EUFA 2V3HH 1DUAA 2PP6A 4MNVA 1PPBH 1TABE 1PQ5A 2A7JA 4ZHAA 3GDVA 1MMJN 2BLOA 1XUFA 3A88A 1H9IE 1GJBB 3LH1A 4K1TA 1HB0B 2BQWB 4NZLA 1BTXA 2ZDVH 5F8XA 2BOKA 1EZUC 1S85A 4F48B 1KTSB 1W0ZU 4FOUC 1IQHA 3PB1E 1LHFH 2AMDA 1YM0A 1L2EA 1OWIA 2ILNA 5DP6A 5L2ZH 4GVUA 1J16A 1IQIA 1ZR0A 1SQAA 1CE5A 1NM6A 1L4ZA 3UPEA 2OD3B 3BTDE 4AG1A 4M7GA 4MNWA 1EZXC 1ZMLA 1O3DA 1EAIA 2BY9X 3LJOA 2CXVA 1DY9A 3F68H 1BQYA 3P8NA 2GCHF 1XMNB 3E90B 2O8UA 1CGHA 3BTQE 3HKIB 1Z8RA 2WYGA 2FM2A 2PTCE 3MU8A 4MLFB 5EPYA 2UUJB 1LO6A 1E1RD 1O3BA 2PW8H 4X1NU 1C2EA 5A8YA 2B5TB 3UR9A 3SV8A 4XE4A 1J17T 1ZGVA 1UTQA 2A4OA 1ELEE 1L1JA 2HLDD 3SI4H 1F2SE 4ACAA 1O30A 5A8XA 1GHWH 3KHVA 4FETA 2PHBA 3RXVA 3SNBA 1RRKA 4ABIA 1T8MA 1HUTH 3B23B 4NIWA 2YMSD 5C94A 1THSH 1D3DB 1SOTA 3WW7A 1O2VA 3E8LA 2XBYA 1H9LB 1XXDA 2C3SA 5CDFE 1S81A 1C1VH 3F2GA 1C5RA 4OS6A 5C3NA 2D1JA 2JIZD 3RLWH 5K0HA 1FONA 1P3EA 3KGPA 2ZQ2A 4U01A 2G5VA 3A82A 1EPTC 5B6OA 1TPOA 2QN5T 3T2NA 3RXGA 4RKJB 1UVOA 3BTEE 3LIWA 1DUEA 1FLEE 3LONA 3NKKA 4MDSA 4OS7A 3TGKE 1TQ7B 3QTVH 1KLJH 1YYY1 2WPDD 3ZZ3A 3A89A 2F9UA 2BD2A 1VITH 3KCGH 1DVAH 1TNGA 3MOCA 2JH5D 2QF3A 3M3SA 1GBTA 1ETTH 1GJAB 1NTPA 4XFQA 3ZZ7A 1AUTC 2OUAA 1BBRE 3IWMA 1OP8A 3KNXA 2WPLS 1EPTB 1AGJA 3A81A 4O3TA 1FY8E 2FWWA 3U8TH 3E3TA 1P2KA 5GNDA 1WQVH 1CO7E 4THNH 3ZZDA 1RGQA 2RFKC 1MD8A 3A8CA 3F1SB 2A4GA 1IOEA 2VB0A 5G4BA 1V2UT 2A5AA 2BQ7B 1TNLA 4OGYA 2BY6X 2ZZUH 1TYNA 1SQOA 2F9BH 3A80A 3DSPA 4YO9A 4UONA 3MQKC 1O2KA 7LPRA 1NBMD 1MZDA 1TOCB 3SJ8A 1GHBF 3S0NA 4ZH8A 1DXWA 4DG4A 1GI7B 4Q80A 3EAJA 3QZRA 2ZWLH 2ZC9H 1WQSA 2SGFE 2Q6FA 1SVPA 2WV5A 4UD9H 1C5SA 2C8XB 3QGJA 4X2WA 1EP6A 1GBEA 4Y8XA 2ZFQH 3ODFA 1FN8A 4XDEA 1TMBH 3FVFB 1HAXB 2NU0E 3M35A 1O38A 1GBMA 2BDIA 3MH6A 1X7AC 3GCHC 1DWBH 5FX5A 2OLGA 1KIGH 2ZU3A 2FX6A 4A5TS 2ZEBA 3STIA 2PKSC 2GZ9A 4OS1A 4ACBA 3ZV8A 1UVTH 3WWFA 2SGAA 3ZZ4A 2BVXH 4GPGA 1C1TA 3ZVAA 1FAKH 1SGIB 1UK4A 4BAOB 1HAGE 1P2JA 4YOGA 1UHBB 3RXOA 3UUZA 1L1NA 3BEUA 5EQQA 1P2NA 3U1JB 3LGWA 3PTNA 1MKXH 4WVPE 4TYDA 2Y80A 1SHYA 3ITIA 1EB1H 2VWMA 4K1SA 1BMNH 5TCCA 3PWBA 4Y7AA 3BV9B 2EI8A 3VFEA 1ORFA 2THFB 1MKWH 2Z3CA 3BIUH 1QFKH 1ESAA 1DS2E 2GJGA 1HNEE 2W5EA 1A3EH 2SGEE 4BAHB 1SGYE 4MTBA 3TNTA 1TRYA 1BMMH 5EPNA 3LJJA 1W13U 1GJ9B 3RXCA 2VWNA 2J94A 2ZFSA 3Q3YA 4TT3D 2FOEA 5CHAC 2H5DA 2BD5A 3QN7A 4H42U 3KL6A 1V2RT 1VJ9U 4FUFA 2FEQH 3OTJE 5F03A 1WXRA 4GCHG 3SJKA 1O2MA 2C4FH 2JH6D 2FIRH 3SU4A 1E37B 3MH4A 4CR5A 1PJPA 1C5TA 2A7CA 4UDWH 4ABAA 1BHXB 1W0KD 1C5ZB 3RC6A 2Z9GA 3L6PA 5E0HA 1FY5A 2A1DB 1KDQA 1KMHB 1ARCA 1TA6A 1CQQA 3PV4A 1IHTH 1O33A 2HOBA 1LHEH 3A84A 1SL3A 1J8AA 1HXFH 1BITA 4K3JA 1QIXB 3F0OA 5SGAE 1YPKH 2FYQA 1O3LA 4FUDA 1O5FH 1W12U 3R0FA 2VH6A 1OP2A 4IMQA 1CHGA 1EP5A 4AGKA 5C2ZA 4D9RA 4X2YA 2Y5GA 1HPGA 1OOKB 2C8YB 1BBRH 3OSYA 3BSQA 4U32A 2OQUA 2PGBB 1UK2A 4X2VA 7KMEH 2ZU5A 5TCAA 1XUGA 1XM1A 2IPHA 1O2WA 2M5TA 2YOLA 1SLUB 1GJCB 2QA9E 1C5YB 5E0JA 4AC9A 4O97A 1S0QA 1A4WH 2ZTYA 2GZ8A 3MU1A 1EOJA 4Q63A 1PPHE 3RXRA 1NC6A 5BPEA 3BG4B 1K22H 1T8LA 2ZFFH 5A09A 1XKAC 3D23A 1SFQB 3PLKA 1V3XA 3SOSA 1SC8U 3OEHD 4ABDA 4XOJA 3VB5A 2QXHA 3BEIB 1CT0E 2A31A 1GJ8B 4GLYA 1H1BA 4Z6AH 1QURH 2OTVA 3FP7E 1MU8B 1CSOE 2STAE 2ZHDA 1FY4A 3WY8A 2I6QA 4DW2U 2A45B 3ATWA 1UVUH 4I32A 3UFAA 1YPEH 3EE0B 5FBIA 1O3MA 5AHGH 3TGIE 3SNDA 3URCA 3P92A 2Z7FE 1P2OA 1OWEA 4F4OC 3RP2A 1C5WB 1MU6B 1DY8A 3QGNB 1C1QA 3S7KB 4AYVB 1GHXH 3STJA 2FOCA 4IS5A 1ZSJA 1ESTA 1KLIH 3GY7A 2UUKB 2J34A 3F9EA 4Y11E 3S69A 1ZJKA 2DE9A 1A2CH 1O5CB 3EQ0H 4X1PU 3PTBA 4NSVA 2GT8A 3W1EA 1GHBG 2ZDAH 5DPAA 1BJUA 2O8MA 2XYAA 1O3AA 4I8GA 1FDPA 3GCOA 2EI7A 5T1VA 2JETB 4WY3A 1NFXA 1GWAA 2A2XH 1GCTB 1J14A 4ISNA 4AG2A 5HIYA 1B0EA 2FYRA 1SB1H 1O3GA 2OBOA 2D26C 1F5KU 2BLVA 1HJAB 5C20A 1SI5H 3M5MA 2OINA 2ZGBH 3LT3A 2LPRA 3LKWA 2ZNKH 2HNTF 3GY2A 4INLA 3O8DA 3FO8D 1EATA 3DFLA 1SGFG 4MPWA 4ZKNU 5DO4H 1LPGB 1UVPA 3LGYA 4B73A 2ZDMA 2ZI2H 4GHTA 1TONA 2FXRA 4FUIA 1C2GA 2ZECA 1ZPBA 3SJIA 1HAPH 2Z94A 5I46H 3GCHB 1C4Y2 2Z9JA 2QGRA 3NPSA 1FPHH 4RI0A 3AAVA 1NY22 1SLWB 2VWLA 1V2TT 2FODA 4RSPA 4KELA 2EY4C 1PPGE 1QNJA 2SNVA 1O5AB 2GDEH 2V7QD 2ZKSA 4CHAB 1T7CA 4XSKU 1NRPH 1WUNH 5H4IB 2A32A 3A83A 1EPTA 1U6QA 4Q7ZA 2BB4A 1ANCA 2KAIA 3C27B 1O5DH 3RDZA 3U8RH 3U1IB 1JIRA 4YXWD 3N7DA 1GMHF 1W2KH 3K65B 4WMFA 4Y0ZE 5GCHG 3RC5A 2BDBA 1JWTA 4KP0A 1VGCB 1C1SA 2LNCA 4X1SU 3B9FH 2FS9A 2BD3A 2CHAC 1GMDG 2AGIX 1LKBA 2C90B 1ZLRA 1SGFA 4I86A 1CBWC 1JOUB 3QO6A 5DP5A 4IN1A 1SBWA 1HAIH 2C93B 1JBUH 2RA3A 3UWIA 7GCHG 2R3YA 2VGCC 3LGIA 2VVVA 1K1JA 1QB1A 4PROA 2QF4A 4BAMB 3OY6U 4NG9H 3MU0A 2QCYA 1BMLA 2KCPA 2GGVB 3KQBA 3L33A 2J92A 3O8CA 2FMJA 1KLTA 3DA9B 1CA8B 4X1QU 1FNIA 3V3MA 1NT1A 1V2JT 2VVCA 2PKSB 1SHHB 5LPEA 3FZDA 4X2XA 1QRWA 3PMHB 1O2XA 2CHAB 4I31A 2KFWA 2ZCLP 1D4PB 3RMNH 1ABIH 3GY5A 1EFRD 3UWJH 4FUCA 3SU2A 4DY7B 4UE7H 3TJNA 3RXMA 2NU4E 1P9SA 4ZHLU 3T5FH 1XVOA 4Y8YA 1NU9A 4AB8A 3E0PB 1MCVA 2FPZA 4NIXA 4ISHH 1OYQA 2VIPA 1HXEH 1F0TA 3PWCA 1YKTA 1CHOF 1KXDA 3UY9A 3RXLA 1GHAF 1GHYH 1ZYOA 5E2PA 5DSFA 1ELAA 1RS0A 2ZO3H 5HIZA 5JYIA 2GMTC 2OQ5A 5AFZH 3SZEA 1Q2WA 3M36A 3UNSA 4B76A 1S6HA 2ZHFH 4NZQA 4KTCA 2ZTZA 2LELA 4WXIA 1O2SA 2ZGCA 2VIQA 1HAOH 1GDQA 1BRAA 3MYWA 1FPCH 4Z1MD 1J9CH 2ZPSA 2W7SA 1XUHA 3BIVH 2P3UB 3GY4A 1K1MA 2FTMA 4I7YH 1W11U 3VB7A 2WUCA 2Y6TA 4B2CA 4WH8A 1FIWA 2BD8A 1JRSA 2D8WA 4ABBA 2XWBI 4JCNA 5I25A 4CH2B 1AB9C 1GBDA 3HPTB 4LXBH 3AAUA 1DSTA 1HAHH 4JZDH 1LVYA 2XBVA 4D7GA 5CHBA 2XNDD 2QE7D 3EA7A 3RUOA 3BG8A 3MNBA 1C4V2 1ELTA 3SW2B 4AB9A 2HLCA 1GGDB 1UCYE 3G01A 3FP6E 4FU8A 1BBRK 1YCPM 1HJAC 1A5HA 1EZQA 2FI5E 4I8LA 1W0YH 1MZAA 2BY5X 3PYHA 2JJ2D 4ZKRU 2KR7A 1G3BA 1UTJA 1RD3B 1BIOA 1C5MD 2Z3EA 1V2PT 2WSSD 1H9HE 3TPIZ 3PMJA 2G4TA 4A1XA 1NRRH 4RT1A 1VGCC 5ETXA 2HALA 3JZ2B 5JBCS 5EQSA 4U30A 1P01A 1KSNA 1G3EA 3SV7A 1GVZA 3DT0H 4MQAA 1DWEH 1GJ4H 3VG8A 1H8IH 2CMYA 1G3CA 2ZDKA 1C9TA 1QBOA 4AFQA 2G4UA 1P2MA 1BTYA 2PR3A 1BRBE 1P10A 4RKOB 2VBCA 1Q3XA 1C2HA 3KYGA 2EEKA 3TK6A 4X6PA 4HZHA 5C67A 1BJVA 4ESTE 1P12E 2PFEA 3PROA 5C1UA 2VVUA 4ZAEA 3Q3KA 4XBBA 1IQNA 1AD8H 2BX4A 1RJXB 2UWOA 5DN6D 4JK6A 4ISOA 2ESTE 4O9VA 1UTMA 2WV4A 1H8HD 3E0NB 2XNIA 2FZZA 5DP3A 4Y79A 4AX9H 1TE0A 1YPMH 1V2ST 1GMCG 2AMQA 2ASUB 3URDA 1YBWA 4NA7A 3ZZ5A 1TGCA 2OC7A 3N7OA 1TRNA 2OC1A 3UR6A 5FHTA 1IAUA 1Y3YA 3U28C 1MUEB 1AB9B 1AHTH 3ELAH 2A0QB 1BMFD 3M61U 2G00A 3ESTA 1NRSH 2QAAA 3AASA 4YM9A 2J98B 1YP9A 1C2KA 5T3HA 5L2YH 4H6TA 4DOQA 1O35A 1Z6JH 3SNAA 2XRCA 2DUCA 2VH0A 2AMPA 2ZDNA 4MNXA 5LH8A 4AN7A 3NCLA 1TPSA 3ZYEA 1C1OA 5C1YA 4D7FA 2RA0A 3QDZB 3S7HB 2BQ6B 3SGAE 1IHSH 2QY0B 4AYYB 3TJOA 2WHXA 3GISB 1LHGH 1HAVA 1NS3A 4B1TA 2BDGA 1LTOA 4DURA 1O2LA 1YWUA 5HM2A 1O2UA 1WDIA 1YLDA 2CN0H 3MO3A 2JKHA 2R0KA 3A7XA 1WSSH 2AGGX 2BMGB 1DOJA 5A8ZA 2P16A 1H4WA 5DP4A 4TPYA 1ETSH 1YPJH 2Y82A 5EW2H 1AMHA 6LPRA 1A5GH 3LPRA 1F92A 2TPIZ 2AEIH 2AYWA 2W26A 3LGTA 3H5CB 2BZAA 2SNWA 4TPIZ 5EODA 1V2WT 5FBEA 1UTNA 2F9NA 2HVXA 1BRUP 2PKAB 1LHDH 3OY5U 1CA0B 1THRH 2O9QA 1NU7B 2XBXA 2B0FA 1HJ8A 3KQ5A 3SU3A 3TNSA 3BTWE 2GV6A 1TRMA 4OS4A 3MH7A 1QY6A 2XCFA 1GMDF 1TGBA 1HDTH 2ZFPH 1ELGA 1NPMA 2G5NA 1Z8GA 2KAIB 3ZVDA 1MABB 1EOLA 1S6LA 3TJVA 1T31A 4JMYA 1C2JA 1C2FA 2GCTC 2SGDE 3F9GA 2ZGXH 1LKAA 4Y7BA 1W7GH 4O03A 1ZZZA 2VGCB 1XKBC 1YPHE 1KXBA 4KTSA 1NRQH 4DCDA 4HI3A 1G30B 1HAVB 1PYTD 1O32A 1XUJA 1C1RA 5CMXH 3TH4H 2GZ7A 1ESBA 4Q2KA 1AKSB 2WPKS 1ARBA 3V13A 3F6UH 2TGPZ 3BEFB 3PO1C 4CBOA 1UK3A 3M37A 4ZHMU 5ESTE 1MTVA 3QZQA 2ZGHA 4IC5A 3MH5A 2ODYB 4NA8A 5EJZA 1O0DH 1ZGIA 3GOVB 1V2LT 2BVSH 3OYPA 2ZHQH 2C8WB 1DICA 1SGRE 1GI1A 3AK5A 8LPRA 3SU1A 1MAYA 3S9CA 3SHCH 3EDXB 1IQMA 4JZIA 4K69A 1BTHH 4NSYA 2WUBA 1AFEH 1IQGA 1A61H 4I8HA 5J4QA 1C2LA 2DE8A 1GBJA 2Q6DA 1O2QA 1Z1JA 3GCTG 3IITA 2KZ4A 1M9UA 1TB6H 5E2OA 3PMBB 2QV1A 1CHOG 3VGCB 2AERH 3UIRA 1GI2A 1IQKA 3PRDA 2JDID 2Y5HA 2FI4E 2J4IA 5C0TA 5A0CA 4RT0A 1FMGA 3GDUA 1E0FD 5C5OA 2BLWA 3F2FA 1QJ7B 1ZTLA 3RXSA 1IQFA 3QX5H 4HGCA 4ABFA 1AWFH 2P8OB 3PV2A 3U69H 3A7TA 5FCKA 2J97A 4IC6A 4UFFH 4E7RG 3BTME 2WPJS 3KQEA 3TH3H 1HJ9A 1P2IA 1WTGH 1A7SA 1ZOMA 2FOGA 3UAIC 1UMAH 4ABGA 2BXTH 5EXLA 1TX6A 5A2MH 1C5UA 3MNCA 2EA3A 5F8ZA 4ZUHA 3FKSD 2FX4A 4CH8B 2IN2A 2PSYA 1C1WH 2VNTA 1QQUA 4YT6H 1CU1A 2WPIS 4JZFH 1PQAA 1J15A 1VITG 1Y3UA 4FXGH 3MWIU 4OGXA 1LPZB 5J4SA 2ZU1A 3MMGA 1S83A 1KXCA 1CA0C 5DG6A 2A7HA 1O2PA 1O2RA 3QK1A 8KME2 2OK5A 3RXKA 2ALPA 3ATIA 4I33A 1T8NA 2W3KA 1UHBA 5A0BA 2UUYA 3TU7H 1G2LA 1T8OA 2CJIA 1NFYA 5B6LA 1SGDE 2G55A 4HFPB 4B2AA 1HAYB 5L6NH 1C5PA 1QA7A 6CHAB 2RG3A 2QYIA 1T32A 2VIDA 1G37A 2V35A 2ZP0H 3AVZA 1LHCH 1S0RA 4D9QA 4YLUA 3DD2H 2ULLA 2TGTA 1TX7A 2ZDLA 3LOXA 2BXUH 1O3EA 3HK3B 1OXGA 2BD4A 1P05A 1F0UA 3RXEA 5DP9A 3ZZ9A 3TIUA 1Y8TA 1Y3VA 1O3OA 2ZQ1A 2M2AA 3M7UA 1B7XB 3RXAA 3ZVEA 1K21H 5JDUB 1MTWA 2ANYA 1C1UH 1QL7A 3QUMP 5F6MA 4IW4E 4Y76A 3N99A 1A0JA 1O3JA 2H2ZA 2XOKD 3TVJB 3PO1B 4ASUD 3CP7A 1HCGA 4BOHA 3A86A 1C2DA 1PQ8A 2XXLA 2V6NA 1AVWA 1BHXF 1V2KT 3NK8A 2AS9A 4FU7A 5FXLA 2Y7XA 4YOIA 1Y3WA 1AO5A 4I8KA 3DCLA 3LDXH 2CF8H 4BAKB 1V2OT 1EX3A 4ABHA 1HIAB 5IDKA 4K8YA 4MPVA 1MBMA 1QL8A 2QF0A 3TK9A 2FTLE 4CR9A 2RDEA 5HXFA 1O3HA 3P6ZB 4IMZA 1W8BH 2QIQA 2BY7X 5C5NA 3GS9A 1HBTH 1GBIA 1HLTH 1VJAU 3SGBE 4HG6A 5C1XA 1A0HB 3E16B 4ABEA 1N6YA 4QT8C 2TIOA 4IGDA 1UVSH 1GI8B 2QC2A 1AQ7A 1A1RA 1QJ1B 2K8IA 1TA2A 4D8NA 2FDAA 2QXIA 3U8OH 4MG3A 1H8DH 4WWYA 5DK1A 4J1YA 2HPQH 1C5NH 1FX0B 3K9XB 1JXPA 1XUIA 1E1QD 1BMAA 1BOQA 1FAXA 2PGQB 3SN8A 1EXFA 2ZHEH 2P3TB 4X1RU 1GI4A 2L6OA 1ZRKA 2H1UA 2ODPA 3B8JA 2PTNA 2UWPA 1L0ZA 3VGCC 1UCYH 3L3TA 3FZZA 4OS2A 1FN6A 1AIXH 1O2ZA 3M3VA 4OM9A 1EKBB 8ESTE 3V12A 1MKWK 1DSUA 4CRAA 2FOMB 2NU2E 1QTFA 3NRLA 1AE8H 4R8TB 1P8VC 4NFEA 2GT7A 3PV5A 3UQVA 3K6ZA 1SGQE 3RXPA 3T25A 2L74A 1VKYA 2TGAA 5K7RA 1FJSA 1F5LA 4TY7A 2A5IA 2BYAX 3SU0A 4YTAA 2KCAA 1G2MA 1WV7H 3RMMH 7ESTE 2BVRH 1AI8H 3SUEA 1ZSLA 2HGTH 1DLEA 1P04A 1RTLA 2F9VA 3BN9A 1ZMNA 1THPB 1O3KA 2GCHG 4UFGH 1PFXC 1Y5AT 1GG6C 2FOFA 3IG6B 2BDAA 2Z9KA 4Y8ZA 5FAHA 4AFUA 1UCYK 2F9PA 2KCYA 2ANMH 3PMAB 4CRDA 3PRBA 1YPGH 1GI6A 1K1OA 2GV7A 2J98A 3E6PH 3LH3A 1HRTH 3SNCA 3W95A 1DITH 2P59A 2OP9A 4Y6DA 1AVXA 3DSGA 2ZCKP 1TBRH 3LGVA 1F0SA 5JBTA 1ZTKA 2YMSC 1TNHA 1T4UH 3I29A 3GYMA 2VJ1A 2P95A 3ZV9A 1B0FA 4GCHF 1FV9A 5EW1H 3ZVFA 1RIWC 1B5GH 1VITF 3V7TA 4B74A 3AW0A 1A46H 1MD7A 1L4DA 1PYTC 3RXFA 1GHAG 1QBNA 4WJG2 1O3NA 3BF6H 3HK6B 1YF4A 1W7XH 1BDAA 1P06A 3KQDA 4Q7YA 1O3FA 3RXTA 1OWHA 3FP8E 1MBQA 3M3TA 3SGQE 1GMHG 3SV2H 3MFJA 1TGSZ 1XX9A 1LMWB 1C5LH 4F55A 3P8GA 3T26A 1BB0B 2RDLA 9LPRA 4BTUB 1O3PB 2STBE 4YT7H 3CNRA 4NIYA 1HFDA 1QB9A 2WPMS 2AIPA 2V3MA 5GXPA 1EJAA 4KKDA 1ELDE 2WINI 2AH4X 3A7YA 5FCRA 3A7WA 1OKXA 1C9PA 2IPQX 2WYJA 1GBKA 1AZ8A 2Y81A 3P95A 3R3GB 5IYTA 3MU4A 2YNAA 1DFPA 1O34A 1VCWA 4XD7D 2VU8E 3NUMA 1JMOH 2BD9A 1D6RA 3F3BA 2B8OH 2PSXA 2ANKH 3MU5A 3SHAH 2R3UA 2BD7A 1DX5M 5DJ7A 3P8OA 2CF9H 2GMTB 1MQ6A 2PLXA 8GCHG 1Q31A 1TNKA 2D2DA 4B2BA 1N8OB 3OU0A 5IK2D 2J38A 1GDNA 4ISLA 2Y5FA 1QBVH 1CGIE 5ABWA 1ANEA 4NGAH 2F3CE 1AFQB 2ANWA 1NFUA 1Y5BT 1YLCA 2W3IA 5EIYA 4SGBE 2W6ID 1ELBA 1VCPA 1S82A 1GI3A 2J9NA 1WYKA 2BTCE 3KYFA 3RMLH 2KM0A 1QHRB 2Z3DA 1FI8A 1N6XA 1P57B 3M5OA 3FAOA 4X8VH 5HMAA 1D3TB 5DP8A 1LVBA 2WV9A 1AUJA 1E34B 4UEHH 1G9IE 2V3OH 1S84A 3AW1A 1NO9H 2PKAA 4CRBA 3O8BA 5GCHF 1KXEA 1EJNA 1N8OC 4FUGA 3UNQA 2G52A 2EI6A 2UWLA 2ZU4A 3OEED 3QTOH 1MTNB 2PUXB 2Z6BD 3K6YA 2O8TA 5DP7A 5FPTA 3F9HA 1D6WA 3C1KA 1MTUA 1GBFA 3VB6A 4Z0KA 3F0PA 1BZXE 4GHQA 1YCPK 1YY3A 4DGJA 1O2NA 2BDHA 3UNRA 3CS0A 2P94A 2I6SA 3ZYDA 1O5BB 4WH6A 1ANDA 2O8LA 1OPHB 3SU5A 4LZ4B 1EAXA 3TJUA 1IQLA 5EJ1A 1GHZA 7GCHF 4WMDA 4A7IB 1VZQH 3U9AH 4DT4A 1FZZA 1SGNE 1FY3A 4ZCNA 3NZIA 1DM4B 4ZKOU 1FY1A 5LGOA 1TNIA 1CBWB 2F4LA 2R0LA 1KXFA 1GBCA 1S6FA 1ZTJA 4XRNA 5T6GA 2BM2A 2UUFB 3A8BA 2ZU2A 4K1EA 1ABJH 1WTHD 2Y7ZA 1LQEA 3OAAD 4K2YA 3RU4E 1TALA 1TQ0B 1C1MA 3MHWU 5AVDA 2A2QH 3MNXA 1F7ZA 3S9AA 2BDYA 1C1PA 4BTIB 4CBNA 4ZMAH 1GBHA 3PLPA 1LVMA 2GKVE 1K9OE 4A92A 1G3DA 4NFFA 1DANH 3H7OA 2VIOA 4O3UA 4D76A 4Y10E 3U98H 4DVAU 1EB2A 3I77A 4FUBA 1GCTC 1UTOA 5GPIB 1OP0A 2H6MA 3RU4T 2H9EH 2BDCA 4TWYA 3A7VA 5DKMA 1GVLA 1QRXA 1C4U2 3OX7U 5EXNA 1HIAA 1EASA 2TGDA 3GICB 1W10U 1SMFE 1GJ5H 1O2HA 1UTLM 1TAWA 1YPLH 2QXGA 4INKA 1HGTH 2VIWA 5FPYA 5JB8S 2F83A 1BTWA 1DWDH 1G32B 2FOAA 3TITA 4XBDA 1LVOA 1AWHB 4YOJA 3SZNA 1NROH 1OSSA 1MCTA 4INHA 4DIIH 1WU1A 1AE5A 1BTPA 1ZSKA 1Z7KA 4DIHH 3LU9B 2VWOA 3ZVGA 2XC5A 1ANBA 4E06H 1UTKA 4ASHA 3SI3H 2G81E 4ZROA 3MTYA 2ZPRA 4X6OA 1JRTA 2GDDA 3D62A 5BRRE 1S5SA 1TBQH 1N1LA 2FP7B 1DPOA 3D49H 4TY6A 3RMOH 1QCPA 2BOHB 1BUIA 2F9OA 3GCNA 3E91A 2BX3A 1P11E 1CT2E 1SGCA 1SQRA 3PLBA 5GIBA 4BTTB 2ZHWH 1SLVB 2JETC 2XC4A 4JYVH 1ELVA 1OHHD 1BTUA 1ETRH 2CGAA 1V2MT 1TX8A 4TWWA 3RXJA 1FIZA 1D3PB 2GVFA 1RFNA 3GY6A 1EAUA 4XBCA 1PPFE 1D3QB 3A8DA 1P02A 3SU6A 2ZFRH 3ATKA 2XTTB 1CT4E 3OE7D 4KTUA 1A5IA 1KDQB 1YPHC 1P09A 4FUEA 2PV9B 1MKXK 2FI3E 3EA8A 3MI4A 1Z6EA 2P3FH 2GD4B 3A7ZA 2GCTB 3LGUA 4ZKSU 1AVGH 2ZIQH 3VXFH 1INCA 3EYDA 1MTSA 5E8EH 1OWDA 3H09A 1AKSA 1K28D 4JYUH 4VGCC 2VIVA 3SJOA 1GG6B 4TSFD 5HM9A 2EC9H 1PPCE 3UTUH 3CENA 3SORA 3SQEE 1DLKB 1TPPA 4AORA 2G8TA 2F91A 3ZVBA 3SUDA 1TNJA 5LPRA 3SUFA 2ZF0H 2AHME 5A0AE 1TLDA 3FANA 4F49A 2RCEA 3VEQB 4X6MA 1WAYB 3BTFE 1WCZA 1GBLA 3BTKE 4WMEA 2K1QA 1GJ7B 3T62A 4H4FA 1GJDB 4ABJA 4BNRA 1SR5C 3UB0A 2IJOB 4UFEH 1SQTA 3RXBA 4X0WU 5PTPA 1AFQC 3DFJA 1A3BH 3UREA 1O5EH 5HKKD 3VB3A 3VXEH 2HWLB 2Z9IA 1E36B 1GI0A 3T29A 4KGAA 2HNTC 1H8ED 1LDTT 2BLQA 4LOYH 1P0SH 3DSOA 2G51A 1RIWB 2J2UA 1YCPH 2H9HA 1NN6A 1O36A 4JYTA 1MTNC 5GJ4B 2F43B 1O3IA 3MNSA 5KECA
chains in the Genus database with same CATH topology
3JZ1B 1V2VT 1O2OA 4SGAE 3BG4C 4IN2A 5FPSA 3RM0H 1PPEE 1T4VH 2TRMA 3CS7A 5CE1A 2AGEX 2BHGA 5HGGA 1XXFA 2W7UA 3SBKA 2B9LA 2GTBA 5EG4A 5GWZA 5EXMA 1P3CA 4UFDH 3RXIA 4GSOA 1TGNA 3GY8A 4FVDA 1C5OH 3GY3A 1V2QT 3ZZBA 5ESBA 1LPKB 4E05H 1SOZA 1GGDC 3T28A 1PPZA 3Q00A 3RLYH 1YC0A 4NA9H 3LC5A 1DXPA 3RU4D 1OWKA 4MNYA 4X6NA 1GBBA 1GI9B 1SGEE 1VCQA 1L1GA 2FLRH 1DDJA 3SO3A 2FS8A 2WPHS 4CREA 1P2QA 3TK5A 3KF2A 4H6SB 4A6LA 1W3CA 3M5LA 3ODDA 2AFQB 1WOFA 1SPJA 1XVMA 1ID5H 2OC8A 3RXHA 1LQDB 1K1PA 4JK5A 1HYLA 1UTPA 4AZ2B 2SGPE 3EGKH 2A4RA 3ZVCA 1F5RA 2ALVA 3M7QA 3I78A 1CGJE 2JH0D 2P8OC 3UOPA 4X8UH 4MPXA 1O5GH 1C5XB 1GJ6A 1VR1H 2ODQA 4ZXYH 2R2MB 3NWUA 1NFWA 3HGNA 1Y59T 4VGCB 2OCVB 1JIMA 1ZJDA 1Y3XA 2Q1JA 1MAXA 1C2MA 1ZPCA 2HPPH 1GMCF 3H7TA 3DHKH 4NIVA 3SQHE 1XUKA 3RM2H 4LZ1H 1PQ7A 1ELCA 2P93A 4RN6A 3UOUA 3RC4A 3SJ9A 3A8AA 3ATLA 3PM3A 2ZA5A 3SUGA 2Q6GA 1KY9A 1FQ3A 3BTHE 1ACBE 3TH2H 2XC0A 4BAQB 3M5NA 4CHAC 4DJZB 5F8TA 1ZHMA 2CV3A 2HRVA 3UQOA 1E38B 3BTTE 1RXPA 1TGTA 5E0GA 3TGJE 1O37A 2SFAA 3RXUA 5L30H 1Z8IB 1AN1E 3ZZAA 4Y0YE 1GL0E 1G36A 3LC3A 2A5KA 4ISIH 4K5ZA 1GPZA 4B71A 1QL9A 6ESTA 1TOMH 1GHVH 4YESB 4BXSA 1DWCH 3SNEA 1SGTA 1SLXB 2XBWA 1OX1A 1IQEA 3A87A 5EGMA 3MO9A 1AZZA 3A85A 1LCYA 5EQRA 4R0IA 4A1TA 2A4QA 2J95A 4IBLH 1O2GH 1TPAE 1K1IA 4JZEH 3M7TA 1K2I1 4MVNA 3D65E 1QA0A 2H5CA 2NWNA 2GX4A 1P9UA 1RTFB 1BT7A 1KYNA 4WF8A 1TBZH 5DGJA 5JBBS 1DT2A 3K2UA 1EQ9A 1UO6A 1TFXA 2Z9LA 3ATMA 4Q7XA 4FU9A 3TLOA 4AFZA 4FUJA 3MO6A 4BANB 1GL1A 1QRZA 4NWKA 3NXPA 4AOQA 1SFIA 4E7NA 1K1LA 1O39A 3ENSB 5JPMH 1FUJA 1QJ6B 3GYLB 5HYOA 1QB6A 2XW9A 1FXYA 5EU8A 1DE7H 1Z71A 4I8JA 1NZQH 1F0RA 1SG8B 2PUQH 3HATH 1V2NT 5GDSH 1NRNH 3ZZ8A 4BXWA 5TJXA 3ZZ6A 1KXAA 3P17H 3QWCH 5CHAB 4X8TH 3SV9A 1P03A 3RXQA 1O2JA 8GCHF 5JBAS 3Q77A 1BTZA 4LK4A 1QQ4A 1YGCH 1W14U 3ZZCA 1O2IA 2ZGJA 1MH0A 2R2WU 1OWJA 6GCHF 4OS5A 1ZPZA 5AFYH 4B75A 2XCNA 2ZPQA 1C2IA 3O8RA 1V6DA 4AFSA 1CVWH 4YLQH 1SGPE 2QXJA 5LPFA 3GDSA 1TMTH 1GDUA 2R9PA 2V0BA 1WBGB 2FOBA 3FFGA 1TMUH 2B7DH 4MPUA 4CRCA 2TBSA 1O31A 1QR3E 1KTTB 1TIOA 3F9FA 6GCHG 4YZUA 3SV6A 1UJ1A 2ZFTA 1IQJA 5AF9H 1GCDA 1SSXA 3Q76A 4Y71A 4K8BA 1ZHPA 4DT7B 1BCUH 4HTCH 1O2YA 1E35B 1ZHRA 2YNBA 1O3CA 6CHAC 3EA9A 1BA8B 2FO9A 1OS8A 3RXDA 2BY8X 3BTGE 3QLPH 1OYTH 2FLBH 4CRFA 3HKJB 4WXVA 1ZRBA 3VB4A 4NCYA 1C5QA 4A1VA 3KN2A 4FUHA 2FESH 4JZ1A 1Y5UT 4AGJA 1NESE 4NWLA 9ESTA 4GUXA 1TWXB 5T6DA 3KQCA 4U2WA 1ZMJA 3T27A 2NU1E 1GVKB 1RTKA 2OBQA 4J2YB 2H9TH 4K60A 1K1NA 1GBAA 1D9IA 2OC0A 1AU8A 1C1NA 3E1XB 1MQ5A 1HV7A 3VPKA 4X8SH 1HAZB 2NU3E 2O8WA 3HGPA 2C8ZB 2VINA 3P8FA 3S9BA 5JB9S 2AIQA 1BRCE 2XWAA 2SGQE 1Z8JB 2HNTE 3GCTF 2ZG0H 2ZTXA 3DUXH 3V0XA 2ZCHP 1Z1IA 3KIDU 1GI5A 5T6FA 4CRGA 2GP9B 3Q3XA 4FVBA 1ELFA 1EAWA 4GAWA 4ZXXH 2IOTA 1QGFA 2OXSA 3KEEA 1C5VA 2BZ6H 3W94A 5EOKA 1AY6H 1A0LA 2FOHA 1EZSC 3P70B 2PWXA 5FX6A 1EJMA 1O2TA 1EUFA 2V3HH 1DUAA 4MNVA 1PPBH 1TABE 1PQ5A 2A7JA 4ZHAA 3GDVA 1MMJN 2BLOA 1XUFA 3A88A 1H9IE 1GJBB 3LH1A 4K1TA 1HB0B 2BQWB 4NZLA 1BTXA 2ZDVH 5F8XA 2BOKA 1EZUC 1S85A 1KTSB 1W0ZU 1IQHA 3PB1E 1LHFH 2AMDA 1YM0A 1L2EA 1OWIA 2ILNA 5DP6A 5L2ZH 4GVUA 1J16A 1IQIA 1ZR0A 1SQAA 1CE5A 1NM6A 1L4ZA 3UPEA 2OD3B 3BTDE 4AG1A 4M7GA 4MNWA 1EZXC 1ZMLA 1O3DA 1EAIA 2BY9X 3LJOA 2CXVA 1DY9A 3F68H 1BQYA 3P8NA 2GCHF 1XMNB 3E90B 2O8UA 1CGHA 3BTQE 3HKIB 1Z8RA 2WYGA 2FM2A 2PTCE 3MU8A 4MLFB 5EPYA 2UUJB 1LO6A 1O3BA 4X1NU 2PW8H 1C2EA 5A8YA 2B5TB 3UR9A 3SV8A 4XE4A 1J17T 1ZGVA 1UTQA 2A4OA 1ELEE 1L1JA 3SI4H 1F2SE 1O30A 5A8XA 1GHWH 3KHVA 2PHBA 3RXVA 3SNBA 1RRKA 4ABIA 1T8MA 1HUTH 3B23B 4NIWA 1THSH 1D3DB 1SOTA 1O2VA 3E8LA 2XBYA 1H9LB 1XXDA 2C3SA 1S81A 1C1VH 4OS6A 1C5RA 5C3NA 2D1JA 3RLWH 5K0HA 1FONA 1P3EA 3KGPA 2ZQ2A 4U01A 2G5VA 3A82A 1EPTC 5B6OA 1TPOA 2QN5T 3T2NA 3RXGA 4RKJB 1UVOA 3BTEE 3LIWA 1DUEA 1FLEE 3LONA 3NKKA 4MDSA 4OS7A 3TGKE 1TQ7B 3QTVH 1KLJH 1YYY1 3ZZ3A 3A89A 2F9UA 2BD2A 1VITH 3KCGH 1DVAH 1TNGA 3MOCA 2JH5D 2QF3A 3M3SA 1GBTA 1ETTH 1GJAB 1NTPA 4XFQA 3ZZ7A 1AUTC 2OUAA 1BBRE 3IWMA 1OP8A 3KNXA 2WPLS 1EPTB 1AGJA 3A81A 4O3TA 1FY8E 2FWWA 3U8TH 3E3TA 1P2KA 1WQVH 1CO7E 4THNH 3ZZDA 1RGQA 1MD8A 3A8CA 3F1SB 2A4GA 1IOEA 2VB0A 5G4BA 1V2UT 2A5AA 2BQ7B 1TNLA 4OGYA 2BY6X 2ZZUH 1TYNA 1SQOA 2F9BH 3A80A 4YO9A 4UONA 1O2KA 7LPRA 1MZDA 1TOCB 3SJ8A 1GHBF 3S0NA 4ZH8A 1DXWA 4DG4A 1GI7B 4Q80A 3EAJA 3QZRA 2ZWLH 2ZC9H 1WQSA 2SGFE 2Q6FA 1SVPA 2WV5A 4UD9H 1C5SA 2C8XB 3QGJA 4X2WA 1EP6A 1GBEA 4Y8XA 2ZFQH 3ODFA 1FN8A 4XDEA 1TMBH 3FVFB 1HAXB 2NU0E 3M35A 1O38A 1GBMA 2BDIA 3MH6A 1X7AC 3GCHC 1DWBH 5FX5A 2OLGA 1KIGH 2ZU3A 2FX6A 4A5TS 2ZEBA 3STIA 2PKSC 2GZ9A 4OS1A 3ZV8A 1UVTH 3ZZ4A 2SGAA 2BVXH 4GPGA 1C1TA 3ZVAA 1FAKH 1SGIB 1UK4A 4BAOB 1HAGE 1P2JA 4YOGA 1UHBB 3RXOA 3UUZA 1L1NA 3BEUA 5EQQA 1P2NA 3U1JB 3LGWA 3PTNA 1MKXH 4WVPE 4TYDA 2Y80A 1SHYA 3ITIA 1EB1H 2VWMA 4K1SA 1BMNH 5TCCA 3PWBA 4Y7AA 3BV9B 2EI8A 3VFEA 1ORFA 2THFB 1MKWH 2Z3CA 3BIUH 1QFKH 1ESAA 1DS2E 1HNEE 2W5EA 1A3EH 2SGEE 4BAHB 1SGYE 4MTBA 3TNTA 1TRYA 1BMMH 5EPNA 3LJJA 1W13U 1GJ9B 3RXCA 2VWNA 2J94A 2ZFSA 3Q3YA 2FOEA 5CHAC 2H5DA 2BD5A 3QN7A 4H42U 3KL6A 1V2RT 1VJ9U 4FUFA 2FEQH 3OTJE 5F03A 4GCHG 3SJKA 1O2MA 2C4FH 2JH6D 2FIRH 3SU4A 1E37B 3MH4A 4CR5A 1PJPA 1C5TA 2A7CA 4UDWH 4ABAA 1BHXB 1C5ZB 3RC6A 2Z9GA 3L6PA 5E0HA 1FY5A 2A1DB 1KDQA 1ARCA 1TA6A 1CQQA 3PV4A 1IHTH 1O33A 2HOBA 1LHEH 3A84A 1SL3A 1J8AA 1HXFH 1BITA 4K3JA 1QIXB 5SGAE 1YPKH 2FYQA 1O3LA 4FUDA 1O5FH 1W12U 3R0FA 2VH6A 1OP2A 4IMQA 1CHGA 1EP5A 4AGKA 5C2ZA 4D9RA 4X2YA 2Y5GA 1HPGA 1OOKB 2C8YB 1BBRH 3OSYA 3BSQA 4U32A 2OQUA 2PGBB 1UK2A 4X2VA 7KMEH 2ZU5A 5TCAA 1XUGA 1XM1A 2IPHA 1O2WA 2M5TA 2YOLA 1SLUB 1GJCB 2QA9E 1C5YB 5E0JA 4O97A 1S0QA 1A4WH 2ZTYA 2GZ8A 3MU1A 1EOJA 1PPHE 3RXRA 1NC6A 5BPEA 3BG4B 1K22H 1T8LA 2ZFFH 5A09A 1XKAC 3D23A 1SFQB 3PLKA 1V3XA 3SOSA 1SC8U 4ABDA 4XOJA 3VB5A 2QXHA 3BEIB 1CT0E 2A31A 1GJ8B 4GLYA 1H1BA 4Z6AH 1QURH 2OTVA 3FP7E 1MU8B 1CSOE 2STAE 2ZHDA 1FY4A 3WY8A 2I6QA 4DW2U 2A45B 3ATWA 1UVUH 4I32A 3UFAA 1YPEH 3EE0B 5FBIA 1O3MA 5AHGH 3TGIE 3SNDA 3URCA 3P92A 2Z7FE 1P2OA 1OWEA 4F4OC 3RP2A 1C5WB 1MU6B 1DY8A 3QGNB 1C1QA 3S7KB 4AYVB 1GHXH 3STJA 2FOCA 4IS5A 1ZSJA 1ESTA 1KLIH 3GY7A 2UUKB 2J34A 3F9EA 4Y11E 3S69A 1ZJKA 2DE9A 1A2CH 1O5CB 3EQ0H 4X1PU 3PTBA 4NSVA 2GT8A 1GHBG 2ZDAH 5DPAA 1BJUA 2O8MA 2XYAA 1O3AA 4I8GA 1FDPA 3GCOA 2EI7A 2JETB 4WY3A 1NFXA 1GWAA 2A2XH 1GCTB 1J14A 4ISNA 4AG2A 1B0EA 2FYRA 1SB1H 1O3GA 2OBOA 2D26C 1F5KU 2BLVA 1HJAB 5C20A 1SI5H 3M5MA 2OINA 2ZGBH 3LT3A 2LPRA 3LKWA 2ZNKH 2HNTF 3GY2A 4INLA 3O8DA 1EATA 3DFLA 1SGFG 4MPWA 4ZKNU 5DO4H 1LPGB 1UVPA 3LGYA 4B73A 2ZDMA 2ZI2H 4GHTA 1TONA 2FXRA 4FUIA 1C2GA 2ZECA 1ZPBA 3SJIA 1HAPH 2Z94A 5I46H 3GCHB 1C4Y2 2Z9JA 2QGRA 3NPSA 1FPHH 3AAVA 1NY22 1SLWB 2VWLA 1V2TT 2FODA 4RSPA 4KELA 1PPGE 1QNJA 2SNVA 1O5AB 2GDEH 2ZKSA 4CHAB 1T7CA 4XSKU 1NRPH 1WUNH 5H4IB 2A32A 3A83A 1EPTA 1U6QA 4Q7ZA 2BB4A 1ANCA 2KAIA 3C27B 1O5DH 3RDZA 3U8RH 3U1IB 1JIRA 1GMHF 1W2KH 3K65B 4WMFA 4Y0ZE 5GCHG 3RC5A 2BDBA 1JWTA 4KP0A 1VGCB 1C1SA 2LNCA 4X1SU 3B9FH 2FS9A 2BD3A 2CHAC 1GMDG 2AGIX 1LKBA 2C90B 1ZLRA 1SGFA 1CBWC 1JOUB 3QO6A 5DP5A 4IN1A 1SBWA 1HAIH 2C93B 1JBUH 2RA3A 3UWIA 7GCHG 2R3YA 2VGCC 3LGIA 2VVVA 1K1JA 1QB1A 4PROA 4BAMB 3OY6U 4NG9H 3MU0A 2QCYA 1BMLA 2GGVB 3KQBA 3L33A 2J92A 3O8CA 2FMJA 1KLTA 3DA9B 1CA8B 4X1QU 1FNIA 3V3MA 1NT1A 1V2JT 2VVCA 2PKSB 1SHHB 5LPEA 3FZDA 4X2XA 1QRWA 3PMHB 1O2XA 2CHAB 4I31A 2ZCLP 1D4PB 3RMNH 1ABIH 3GY5A 3UWJH 4FUCA 3SU2A 4DY7B 4UE7H 3TJNA 3RXMA 2NU4E 1P9SA 4ZHLU 3T5FH 1XVOA 4Y8YA 1NU9A 4AB8A 3E0PB 1MCVA 2FPZA 4NIXA 4ISHH 1OYQA 2VIPA 1HXEH 1F0TA 3PWCA 1YKTA 1CHOF 1KXDA 3UY9A 3RXLA 1GHAF 1GHYH 1ZYOA 5E2PA 1ELAA 1RS0A 2ZO3H 5JYIA 2GMTC 2OQ5A 5AFZH 1Q2WA 3M36A 3UNSA 4B76A 1S6HA 2ZHFH 4NZQA 4KTCA 2ZTZA 4WXIA 1O2SA 2ZGCA 2VIQA 1HAOH 1GDQA 1BRAA 3MYWA 1FPCH 1J9CH 2ZPSA 2W7SA 1XUHA 3BIVH 2P3UB 3GY4A 1K1MA 2FTMA 4I7YH 1W11U 3VB7A 2WUCA 2Y6TA 4B2CA 4WH8A 1FIWA 2BD8A 1JRSA 2D8WA 4ABBA 2XWBI 4JCNA 5I25A 4CH2B 1AB9C 1GBDA 3HPTB 4LXBH 3AAUA 1DSTA