1OP0A

Crystal structure of aav-sp-i, a glycosylated snake venom serine proteinase from agkistrodon acutus
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
234
Chain Sequence
VIGGNECDINEHRFLVAFFNTTGFFCGGTLINPEWVVTAAHCDSTDFQMQLGVHSKKVLNEDEQTRNPKEKFICPNKNNNEVLDKDIMLIKLDKPISNSKHIAPLSLPSSPPSVGSVCRIMGWGSITPVKETFPDVPYCANINLLDHAVCQAGYPELLAEYRTLCAGIVQGGKDTCGGDSGGPLICNGQFQGIVSYGAHPCGQGPKPGIYTNVFDYTDWIQRNIAGNTDATCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Venom serine proteinase
publication title Crystal Structures and Amidolytic Activities of Two Glycosylated Snake Venom Serine Proteinases
pubmed doi rcsb
molecule tags Hydrolase
total genus 60
structure length 234
sequence length 234
ec nomenclature ec 3.4.21.-:
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op0A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op0A02
1QA7A 1V6DA 1DDJA 2QXJA 4YOGA 2A5AA 2FOBA 1OWIA 2BX3A 1C1RA 3M5MA 3P95A 4RN6A 1EOJA 3VEQB 5JBAS 1AIXH 1EX3A 1GI5A 3RXJA 5L6NH 1EPTC 3GCNA 2QN5T 1CA0B 3SN8A 4A7IB 1OWJA 1YPEH 4FUJA 2BB4A 5CHAB 1HJ9A 2ZQ2A 3QGJA 1GMDG 3ZZ6A 1AMHA 3SU6A 2GDEH 3MO3A 2IPHA 1OYQA 3MNCA 1QRWA 2PSXA 1SGYE 2PUQH 1EB2A 1GI7B 5F8ZA 1F5KU 3M3TA 2ZFSA 3SNAA 7ESTE 3SV9A 1CGJE 1GBAA 1F92A 3LGIA 3BTQE 1U6QA 7GCHG 1GCTC 3NUMA 4CBOA 1O5DH 1LDTT 1UVPA 5FPYA 4NFFA 2ZWLH 4DG4A 8KME2 2V3HH 3STJA 1O3PB 3RMMH 1LQEA 1VGCB 1CBWC 1P2JA 3MH4A 1TA2A 5DP8A 1G3CA 1CHOF 1GHVH 3RU4D 1TOCB 4H6SB 3VB5A 2BY9X 2IOTA 2CN0H 3BEFB 1O3EA 4X2WA 5EQQA 2QIQA 8GCHG 5JYIA 3LH1A 1C1TA 3RXFA 2OXSA 5AVDA 1GCDA 1QBOA 2R2WU 2FI5E 1C2EA 3LGWA 4ISOA 3SU2A 1XUGA 1XVOA 1A5IA 1A0JA 1MAYA 3A81A 4TY6A 1SVPA 5ETXA 1YGCH 2ZDVH 3H5CB 4TWWA 5HXFA 4MPVA 1CHGA 2AFQB 4I8HA 2FOCA 1GDUA 1ELTA 1P9SA 2P8OB 4YTAA 2YNAA 1LHEH 3TJNA 4AOQA 1ZSJA 1KDQA 3RDZA 3V3MA 3ATWA 3DD2H 4Y6DA 3MNBA 1WOFA 5JBTA 1P11E 3GY7A 2BVSH 1FNIA 3VB7A 1BHXB 2Z9JA 3C27B 1P3EA 2ZHFH 3E0PB 1TIOA 5JPMH 1HLTH 3RLYH 5FX5A 3UOUA 1GJDB 1O2UA 1NT1A 4Y76A 3A7TA 1BB0B 1ETRH 2C90B 2GZ8A 3SNCA 5GCHG 4ZMAH 3QTVH 2OQ5A 5E2PA 1AE5A 1A0LA 6ESTA 3BIVH 4CRBA 4KP0A 3LJJA 3UFAA 1EZXC 1C9TA 5FX6A 1OP8A 2VIOA 4OGYA 5DG6A 2BDCA 5DP3A 2A0QB 3MOCA 1KLIH 4B1TA 1LPKB 1ZTLA 3E6PH 1NRPH 1GBHA 1DUAA 2FI4E 5J4SA 1GG6C 4BANB 1HAZB 4XBDA 2B7DH 3QN7A 1KSNA 1SQOA 2ZFTA 1AKSA 1O3OA 2A4OA 1C5XB 2GZ7A 1AWFH 2R3YA 3GCTG 3RXCA 4WY3A 1P05A 4WH8A 4YT7H 1D6WA 1GJAB 1SOTA 2VIDA 1N8OB 1Y3UA 2ZGJA 1O2OA 5DP9A 4TPYA 3RXUA 3SJ8A 1LVMA 3PB1E 1FIZA 2FODA 4Y7AA 2J38A 6LPRA 4AB9A 1RD3B 3PMJA 3BG4B 3O8RA 2AMDA 2BLQA 1F0UA 1O35A 2FOHA 4A1TA 2F3CE 4E7RG 2BXUH 5HGGA 2ZZUH 1O31A 2D2DA 1W12U 2ZFFH 3OY6U 4ZROA 3QUMP 1ZJKA 3SV8A 1BTZA 1SLXB 2HPPH 3R0FA 1J17T 2G4UA 5FCRA 3QK1A 1GMCG 3A83A 2FOMB 2WINI 4MNVA 4YOIA 2ZTZA 3PMHB 3PYHA 2BX4A 1ABIH 2ZI2H 2PGBB 4X6PA 5C1UA 3BTWE 3CS0A 2OC7A 3VXFH 2GTBA 2GP9B 1E34B 3RM2H 3A8BA 2ZGHA 4B71A 2GCHF 1GI2A 2XWBI 1MZDA 1SFIA 4ZKSU 2GCTB 1T8MA 3RMNH 1K1PA 3K2UA 3CS7A 1EP6A 3M3VA 5EPYA 3KQDA 1GI8B 1TMTH 1WU1A 2FLBH 4KGAA 3F1SB 3RXOA 1W7GH 1S85A 5A2MH 2W5EA 3RXLA 1D6RA 3ZV9A 5DJ7A 1J14A 3BTGE 1IQJA 2Z9LA 1HRTH 1XX9A 1P3CA 1C5UA 1GDQA 4WMFA 4B74A 1EP5A 4Z0KA 1WTHD 3RXVA 1BUIA 4H42U 2QA9E 3P8GA 1GBLA 1H8IH 2IN2A 1EXFA 5F8TA 1O2KA 1MBMA 2QYIA 2BZAA 3OYPA 2O8TA 2FOGA 3UTUH 1JIMA 1P04A 2UUKB 1TPPA 1TA6A 2XWAA 1LQDB 3EE0B 4F49A 1RGQA 1XMNB 2LNCA 2ZGBH 3E3TA 2EC9H 3RC5A 2BDAA 1C5OH 2PKAA 3OTJE 4RKOB 5T6GA 1O2ZA 1O3NA 3DHKH 1GPZA 2P94A 2SGAA 3RP2A 4FXGH 1DM4B 4CH8B 1CVWH 2ZTYA 1C5SA 1TBQH 4BAKB 5FCKA 2AGIX 1T8OA 3TNSA 5JBCS 4AG1A 1SQTA 1ZMLA 3A86A 1MTNB 5B6OA 5DPAA 1NU7B 1TPOA 1O3HA 4RKJB 4D8NA 1A3BH 4ZH8A 2JETB 1UTLM 4KTSA 4NSVA 5E2OA 1SFQB 1SGNE 1OS8A 5LGOA 1IQIA 3L3TA 2BHGA 1C4U2 1O2LA 2CGAA 4U2WA 3UUZA 4ABBA 3LH3A 3SV7A 2ZEBA 1VJAU 1K2I1 3MH7A 2R9PA 2GT7A 1IQNA 1CT0E 3SUFA 1MKWH 1V2OT 1EJAA 1GBIA 1VCQA 1WSSH 2QXGA 2P3FH 1VR1H 4X1QU 1EOLA 1SOZA 3RXRA 1D3DB 2ZCKP 1DITH 2GT8A 1HDTH 2VIPA 1SLUB 2GMTC 3AAUA 1NFYA 4ABGA 1S5SA 1Y3WA 1GI1A 4XFQA 2TIOA 3RC6A 1FXYA 3ZZ3A 1YPHE 5JB8S 3JZ1B 8ESTE 4BTTB 7LPRA 1FQ3A 1KXDA 1HIAB 1Y5UT 4X8TH 1L1JA 2BD4A 5GJ4B 3T5FH 1CT4E 2ZECA 2Y5GA 1SLWB 2FOFA 3T29A 4K8YA 1AFEH 1FN6A 3SZNA 1AHTH 3NWUA 3UOPA 1B0FA 1O3KA 1P2IA 2VVCA 2VVVA 2VWNA 3SQHE 1H4WA 4H4FA 1WYKA 2ZP0H 2A7CA 4GLYA 3RXQA 4GHQA 3V0XA 1ELBA 1ZZZA 2BD7A 1A0HB 5T3HA 5BRRE 1UCYE 1XUKA 2STBE 3EA8A 1HJAC 4XBCA 1O3FA 2J4IA 2ODYB 1V2LT 3ZV8A 2SGFE 2ALPA 1GI9B 1GJBB 4JZ1A 1DFPA 1EAWA 1MU6B 3A7WA 3A8CA 1CQQA 4VGCB 4A1VA 1HJ8A 1MTVA 1HGTH 1LHDH 1Q31A 4AB8A 1BTUA 2Z7FE 3W94A 1AO5A 4ZXXH 3PMAB 3FVFB 3S7HB 3FP6E 1VITG 1E36B 3EYDA 4FU7A 2NU0E 1HAIH 1TE0A 3BTTE 4NWKA 4JYVH 4ABJA 2VGCB 2P95A 1OX1A 2XCFA 1GVLA 4UE7H 1BCUH 1HAXB 1BRCE 1EATA 4FUDA 1ZPBA 3ZZCA 3ZVGA 4BXSA 2EI8A 1SG8B 3M5LA 1ELVA 1YPMH 4MLFB 4FUEA 1QQUA 1TNJA 3GDVA 2UUFB 3A7ZA 5DP5A 3A85A 1T4VH 4WXIA 4ESTE 1C5WB 2WPLS 2V6NA 1GJ4H 3WY8A 4UFFH 1QURH 4AFZA 3F6UH 1DXWA 4K1TA 4WF8A 2PKSB 1DUEA 1O3DA 1YP9A 4I32A 1BTYA 2BDGA 2ZHDA 2ZIQH 1AE8H 1LO6A 1DS2E 2NU4E 5EOKA 2C8XB 2G8TA 2ZCLP 3DA9B 5IDKA 1IAUA 2GD4B 1PPCE 4LK4A 1DT2A 1NS3A 2NWNA 2R2MB 3RXDA 1SPJA 1F2SE 3C1KA 2AYWA 1QL9A 4J2YB 5C3NA 2XC4A 4AORA 6CHAB 1F0SA 3V13A 2VVUA 2A2XH 3PLBA 5ESTE 1FPCH 3GCHC 1UHBA 3SU4A 1ESBA 1MCTA 5E0HA 1O2JA 1A7SA 1UCYK 3GYMA 2WV4A 3KEEA 4ZXYH 3KQBA 3PM3A 3SI3H 1SL3A 2C3SA 5DP7A 1ETSH 3K9XB 3TNTA 2OBOA 4NIWA 1O0DH 1QA0A 5A09A 4YESB 4FU8A 2HWLB 4TY7A 1DVAH 1KYNA 4Y10E 4NIXA 5C1XA 2NU3E 2XBYA 3T62A 1TQ0B 1Y3XA 3RU4T 2H2ZA 1N6XA 4HI3A 4XBBA 3SHAH 3VGCC 4ABEA 1PPHE 3RMOH 1AQ7A 3RUOA 2CMYA 2VH0A 1ELGA 3SHCH 1XUFA 3PO1C 1G36A 3O8CA 4INKA 1V2ST 3F9GA 3MWIU 3SW2B 1PYTC 3HPTB 3BN9A 4Q7YA 5FPTA 1AY6H 1SLVB 3UWIA 1ELCA 2XXLA 3GDUA 1RIWB 1DX5M 3GY5A 4JCNA 1VJ9U 2O8WA 1OWKA 3Q3YA 1XXFA 4WWYA 1LHCH 1EZQA 1AB9B 3PTBA 2OC8A 1RTFB 4KTUA 2G4TA 1W8BH 2QCYA 1HCGA 3PROA 2CV3A 2FYRA 4I8GA 4O9VA 1AUJA 1K1LA 2ESTE 4LXBH 1F0RA 1UTKA 1V2TT 1DOJA 3Q00A 3SJKA 1A5HA 1LPGB 1F5LA 3D23A 4NFEA 3RM0H 2J34A 3ESTA 1XUIA 4UFEH 1UVSH 2FI3E 5HMAA 3BEIB 4NA9H 1GVZA 4IW4E 3ZZBA 3KF2A 2UWOA 1TWXB 2VINA 4U32A 3S0NA 5A0CA 1SGRE 1DSTA 3PV4A 1K1NA 5TCAA 2CHAC 4MPXA 3M5NA 1Y3VA 1INCA 3N7OA 1C9PA 3TGJE 3PMBB 3MI4A 3SORA 4ZUHA 3SU0A 3LONA 1OWDA 3ATKA 1QB1A 3MFJA 1UTPA 4UFGH 8LPRA 1IQFA 1GI0A 2FEQH 1C4V2 3ZVFA 1ANBA 3B9FH 1L4DA 2XNIA 3SO3A 3URDA 2BVXH 1Z6JH 1BIOA 3MYWA 1ABJH 2H9TH 1A61H 1ZMNA 2GX4A 4OGXA 1HAYB 3HKJB 4R8TB 4JYUH 4KKDA 4ABHA 2BY6X 4K8BA 3W95A 4FUBA 2ZPRA 1SGPE 1N6YA 1O3GA 1QL7A 1GWAA 2DUCA 1V2KT 4ZAEA 3O8BA 4Y79A 1BT7A 1GBBA 3D62A 4BOHA 1GGDC 1PPFE 2ANMH 5JB9S 4Y8YA 5FBEA 2IJOB 1FY4A 1JRTA 1JIRA 1V2QT 1YPKH 4B2CA 4YZUA 3LIWA 1PQAA 4GPGA 4I8KA 1O2YA 1TAWA 1TNLA 4INLA 1QIXB 2ZC9H 2PSYA 2ZU4A 4DVAU 4X0WU 2OTVA 3F9FA 3OY5U 4AFUA 4AZ2B 2F9NA 5CMXH 1KXAA 1SGDE 2J9NA 1C1UH 1C5RA 3SNEA 1KTSB 3A80A 1GHZA 1MKXH 5GPIB 3UNQA 2FPZA 4B76A 3ENSB 1IQMA 3A84A 3ZVCA 1BDAA 1O2GH 2C8ZB 3G01A 1W3CA 2C8WB 1YF4A 3MO6A 2WPJS 1SBWA 1MQ5A 2C4FH 1SGTA 3M5OA 5J4QA 3SJOA 4AGJA 5GXPA 4YO9A 1ZHRA 1SGFG 1C2HA 3I77A 2GV7A 1HNEE 1Y8TA 4UFDH 3ITIA 3M37A 1A2CH 2B0FA 2BOHB 3FZDA 1RS0A 4ASHA 1QFKH 1WUNH 1UK3A 2HGTH 2V35A 4GCHG 1DWBH 2A4RA 1FY5A 2Q6FA 2ZDLA 5LH8A 1C1PA 1D3TB 2FESH 3SGBE 1UJ1A 2B8OH 4E05H 2PR3A 2QAAA 2BLOA 1Z6EA 3LU9B 1S81A 2HOBA 2FS9A 4DOQA 1O3BA 1DY9A 1UVTH 4ISNA 1VITF 2VWLA 2WPMS 4ZHAA 2J94A 3O8DA 4BAOB 2BDHA 1FAXA 1ZHMA 1TBRH 2XCNA 1RFNA 3PLKA 4CHAC 3BIUH 1AWHB 1TYNA 1O2XA 3SUDA 1TGTA 1V2PT 1IQEA 1GBKA 1C5NH 2PV9B 1V2UT 2W7SA 3HGPA 3ZZDA 1KTTB 3UR6A 3OSYA 3FFGA 2XC5A 3TGIE 2G52A 2TBSA 1W13U 3S9BA 1J16A 2WUCA 1GMHG 1ZOMA 3M7QA 1VITH 1ANEA 3V12A 1TPAE 1GHAG 1O34A 4Q2KA 5LPFA 1CGHA 1J9CH 3ZZ5A 1WTGH 3A87A 2JH6D 1P02A 1JXPA 1L0ZA 1QCPA 1BITA 5C20A 4X8VH 1NY22 2R0KA 3QZQA 5F8XA 4AN7A 3PLPA 1HAVB 2F83A 4TWYA 5EU8A 1TMBH 1E37B 2OD3B 4SGBE 4MDSA 2ZCHP 4X6MA 3BTDE 4E7NA 3TITA 2BQ6B 1ZLRA 3MO9A 1W14U 2BXTH 4IN1A 5A8ZA 1O3AA 1D9IA 2FX6A 1CU1A 1EZSC 1B7XB 2ZF0H 1DWEH 4D7FA 1HXEH 4JZIA 3B23B 4IMZA 2OUAA 5F03A 1E38B 3BTME 4WVPE 3Q76A 1ARCA 1HXFH 2P93A 1P8VC 2WPKS 4CRGA 1CA8B 1SMFE 3UY9A 1F5RA 1PQ5A 1XUJA 3UNRA 2ALVA 1C2FA 2UUJB 1ETTH 4XSKU 2EI7A 3DUXH 1W2KH 1AVGH 1FONA 4WMDA 1C4Y2 1KLTA 1HAPH 1EPTB 4JMYA 1Y5BT 1KXEA 3TGKE 3S69A 1YPLH 1XVMA 5ESBA 1D3PB 4IC6A 1TBZH 1UMAH 1ZRBA 3GYLB 1IQHA 3M3SA 4FUHA 1DANH 1C1VH 3PWCA 4A6LA 5DGJA 2VB0A 3TJOA 3P17H 1PPGE 4HFPB 2BQ7B 4KTCA 3E1XB 1FAKH 2P16A 2UUYA 1HAHH 1H1BA 1O3CA 3MU5A 1TX8A 1GCTB 1FV9A 3M61U 3URCA 1SGQE 2HALA 4FVDA 1K28D 1DSUA 2VJ1A 1GJ6A 1O5AB 4D7GA 3B8JA 4X2YA 4D76A 1C1NA 2V3OH 4U01A 1CBWB 2XBWA 1C2GA 1GHBG 3BV9B 3BTEE 2NU2E 1MQ6A 3D65E 1TALA 2A7JA 1TFXA 4I33A 4ZKNU 5L30H 4J1YA 1HAOH 1BRBE 1NTPA 1TGBA 2A4QA 3LGTA 2A5KA 2XRCA 4YLUA 5PTPA 2ZDAH 1V2MT 1H9LB 1D4PB 1ZSLA 4ABFA 1L4ZA 4I31A 1FZZA 3SU3A 1DLKB 1P9UA 4AFSA 3TLOA 2SNVA 5FPSA 1EJMA 1BBRE 2SGEE 2XW9A 1ZRKA 1T31A 4NGAH 1NO9H 3HK6B 1VZQH 3QLPH 1MUEB 3TH2H 1GMDF 2K1QA 1SI5H 4Q80A 4ABDA 5C5OA 5GIBA 1EZUC 1DY8A 1O2PA 2PGQB 2TGDA 3R3GB 1XKAC 4UONA 1ZGIA 2RA0A 2EEKA 4A5TS 5A0AE 1BMNH 1ANDA 3BG8A 1C2KA 1KXFA 3ELAH 3U8OH 5DO4H 7GCHF 2ZG0H 1S83A 1P01A 1OKXA 2KAIB 1ZGVA 1AFQC 2B9LA 4CRAA 2VNTA 4FUGA 2Y81A 2A7HA 1MD7A 1GL1A 4CRFA 2H1UA 2UWLA 1AU8A 5C1YA 1C5VA 1TPSA 1TONA 2O8UA 2GV6A 3FZZA 3A89A 3U1IB 4NA7A 2PLXA 5AF9H 8GCHF 1SR5C 1ZTJA 2GGVB 4YM9A 1FI8A 1S6FA 1GG6B 2HNTC 1P12E 2CF9H 2ZKSA 2H9EH 1BJUA 3ODFA 2ZU5A 1CA0C 1G3EA 4CREA 1V3XA 2XC0A 5CHAC 5EXMA 1S0QA 3T27A 3F9EA 3SU1A 3AAVA 3RMLH 4BAQB 3SV2H 3TH4H 3E8LA 1D3QB 3GICB 2O8LA 3AW0A 1NU9A 4NWLA 1LCYA 1O5CB 3SGAE 2G51A 1O2IA 2WYGA 2FTMA 2Q1JA 3GISB 2FOAA 1BMAA 2XTTB 1SSXA 3SU5A 1K1MA 1SQAA 1BA8B 1SHYA 4AGKA 4ZHMU 4NA8A 2FOEA 2EA3A 1TX7A 2J92A 3ZVBA 1VGCC 3ODDA 3UQVA 1TMUH 4MVNA 3BSQA 2Z6BD 1BBRK 4CH2B 1JMOH 1P2NA 1C5YB 2BD8A 2RA3A 3ZVAA 4R0IA 3NCLA 1N1LA 2F9OA 1HAGE 3SQEE 5GCHF 3UR9A 1O3IA 2ZGCA 3E91A 1O38A 2TGPZ 1WQVH 3M7TA 3BF6H 3KHVA 4GCHF 1MTSA 4X1SU 5I46H 1P09A 5AHGH 5C2ZA 4BNRA 2H5DA 1K21H 1RTKA 3EA7A 2I6SA 3GCOA 3SOSA 1YCPK 1QB6A 2P8OC 4AX9H 1FDPA 1IQKA 3P8NA 1GHYH 3T2NA 3RLWH 3CP7A 3MTYA 4WH6A 3GCTF 1HBTH 2WUBA 3RXMA 2F9PA 3U8TH 1NPMA 4K60A 2FLRH 1ZMJA 3AASA 1QGFA 2A5IA 1OP0A 3EAJA 1P2KA 2WYJA 1SGIB 1X7AC 1YLDA 3M35A 1PPBH 1V2RT 1IOEA 1W11U 2PHBA 5IYTA 3SUEA 1EQ9A 3VB3A 1NM6A 1FIWA 3QZRA 2BLWA 2RG3A 4U30A 5DKMA 3VPKA 2D1JA 2W26A 4OS1A 4BAHB 2HVXA 1DPOA 4K1SA 2ZU1A 1KXCA 4IS5A 2ZHWH 1EB1H 2CF8H 5EQSA 1O30A 1Z71A 2FX4A 1YPJH 3SI4H 3L6PA 4K3JA 4AYVB 1OXGA 5EG4A 1YLCA 4GAWA 1GMCF 2F9BH 1GBTA 3U8RH 1NESE 1TNHA 3K6ZA 4XE4A 3RXKA 2VU8E 3T25A 3QO6A 1TRYA 3FP8E 1HIAA 1PYTD 5JDUB 1W7XH 1ZYOA 4BXWA 3HKIB 4GUXA 2A4GA 3SJ9A 2J2UA 4MQAA 1GJ7B 4A1XA 1CSOE 4X8UH 1L2EA 1THRH 3V7TA 4X8SH 1GJ5H 1GHXH 1OOKB 2BQWB 2ASUB 1EAIA 2BMGB 3KNXA 1N8OC 1G3DA 1XUHA 1KY9A 1YBWA 1GI6A 2BDIA 4IBLH 3UREA 5EQRA 3GY3A 1F0TA 1GBEA 4TYDA 4HGCA 2Y7ZA 3EDXB 1EJNA 1QRZA 1G2LA 4YT6H 2Y7XA 1MTUA 1KDQB 2ZDKA 9LPRA 3BG4C 1C1OA 3P6ZB 2HRVA 1O32A 3BTKE 5LPRA 3LT3A 1O39A 4Z6AH 4MPUA 1P2MA 1C2DA 1TGSZ 3L33A 1BRAA 2ODQA 3RXBA 3ZZ7A 1C2LA 1UK2A 2QF3A 4DY7B 1O2RA 5K7RA 3DT0H 2VIVA 2PW8H 2A45B 5EODA 1S84A 1ZPCA 4DW2U 1QNJA 2FM2A 1GHWH 2AERH 1ORFA 1FMGA 1ESTA 1RTLA 2R0LA 3QTOH 2C8YB 2Z3CA 2Y6TA 3UQOA 4X2VA 4OS4A 1MCVA 1L1NA 1Z7KA 5I25A 3RXHA 1WCZA 2GMTB 1FY8E 1AVWA 1C5QA 3T28A 2HNTF 2Z9IA 1PPEE 3ZVDA 2GZ9A 1ZPZA 2A31A 1A4WH 1SGCA 4FVBA 1GJCB 2AGGX 4ABIA 2ZHQH 2ZTXA 2JH5D 2ANYA 2UWPA 3LC3A 1K1OA 2BD5A 2F9UA 1V2NT 2GCTC 4ZKOU 1RJXB 1GHBF 1SGFA 4Q7ZA 4IGDA 1KLJH 4OS5A 1AKSB 1UTJA 3LOXA 2ZHEH 3SNDA 1S6HA 1P2OA 5DP4A 1HV7A 3P8OA 2VWOA 3U98H 2P3TB 4ZKRU 1C5MD 2YOLA 1GI4A 1UCYH 2G00A 1P57B 3ATLA 1OYTH 1VCPA 1HUTH 1ELAA 1IHTH 1NRRH 5E0JA 1FPHH 4JZEH 4DIIH 2A2QH 1IQLA 1HJAB 1HPGA 3U9AH 3TIUA 4B2AA 3IITA 4BAMB 3F9HA 2BZ6H 1E0FD 2Z9KA 3U1JB 5A0BA 3BEUA 4I7YH 3NZIA 1UTOA 1C5PA 2STAE 2VIQA 1G32B 2JKHA 1ARBA 4INHA 4ZHLU 1M9UA 4DCDA 1T7CA 1FY1A 4NIYA 1NFWA 2OQUA 2BOKA 2BTCE 1Z1JA 1AI8H 1H9IE 1EUFA 3VXEH 2FTLE 2HLCA 2V0BA 1O3LA 1MZAA 3E90B 5SGAE 4B2BA 5AFZH 5HM2A 1MTNC 4MNWA 2BY8X 4NZQA 1P0SH 6GCHG 3HK3B 4IN2A 5T6DA 5H4IB 1QJ6B 4DURA 2JETC 4AFQA 1PJPA 3GOVB 1BHXF 1PQ8A 1HFDA 1C2JA 2Z3DA 3A82A 4JZDH 1YM0A 3P8FA 3KIDU 1O5FH 2FWWA 3Q3XA 1KIGH 4XOJA 5GDSH 1AVXA 3UPEA 2AIPA 3TVJB 2RDLA 3EQ0H 3TK6A 1UTQA 2XYAA 1AZZA 3RXTA 4I8LA 1C2IA 3MU4A 1MH0A 4Y0YE 2BY5X 1HB0B 1FY3A 4Y71A 1LKAA 2SFAA 1J15A 1GDNA 2SGPE 1JRSA 3RXPA 4ABAA 2M5TA 2PTCE 3A7XA 5TJXA 4K69A 2P59A 1C1MA 3RU4E 3KQCA 2DE9A 2PKAB 2G5VA 1H9HE 1O2SA 3GCHB 4YLQH 1O2VA 9ESTA 1UVOA 4SGAE 1QRXA 1O2HA 1OP2A 1TNIA 3MNXA 3SUGA 4UEHH 4IMQA 1IHSH 1G37A 1ID5H 1O2WA 4FUIA 1V2JT 1NN6A 1JWTA 2H9HA 1NRSH 3S9CA 1Y5AT 1WV7H 4OS6A 1YYY1 2BVRH 4JK5A 3GY6A 1XKBC 4CRCA 3Q3KA 2TPIZ 1LTOA 1RXPA 1A1RA 2PUXB 4D9QA 2ZDMA 3EA9A 1AGJA 1BJVA 1OWHA 1GVKB 2ZU2A 1ESAA 1V2WT 1LMWB 3NPSA 3VGCB 1GI3A 2Y5HA 3ATIA 1VCWA 1TNKA 2FYQA 1NRNH 3PO1B 4K2YA 4QT8C 4DIHH 2YNBA 3MH5A 2ZPQA 3FP7E 4Q7XA 2SNWA 1FUJA 1FJSA 1NFXA 5A8YA 2ZO3H 1BMLA 1XM1A 4VGCC 4WMEA 1NC6A 4O3UA 3RC4A 1DXPA 4MPWA 1TGCA 2TGAA 1O2MA 1LVBA 4Y8ZA 5EW1H 1QQ4A 2VGCC 3NXPA 1YCPM 3LDXH 1DICA 3P92A 1TOMH 3TPIZ 1AZ8A 4GHTA 4Y7BA 5ABWA 5JBBS 4JZFH 1O2QA 5EGMA 2HPQH 4MG3A 1O3JA 3BTHE 1MKWK 3ZZ9A 1LKBA 1QTFA 2NU1E 1BTHH 1QY6A 2AH4X 2PWXA 4AYYB 3DFJA 3SV6A 3KL6A 5AFYH 3LJOA 2A1DB 2CHAB 2PKSC 1NRQH 3MH6A 1QL8A 1DE7H 1F7ZA 2AMQA 5FHTA 1A5GH 4FU9A 3RXAA 2THFB 1O5EH 1TLDA 2BDYA 1GBDA 1E35B 2ZU3A 5DP6A 1ELEE 1C5ZB 3A88A 3LKWA 4Y11E 4NIVA 4BTUB 1G2MA 2AEIH 5G4BA 3M36A 3BTFE 6CHAC 4FUCA 5C5NA 2OBQA 2Z9GA 2QXIA 1Z8IB 1W0YH 3OU0A 1Z8JB 2FS8A 2BDBA 1GGDB 2CJIA 1GJ8B 5EPNA 4NSYA 5E8EH 2BD3A 1EASA 2QY0B 3HGNA 2XBVA 1C1SA 1CO7E 1PPZA 1C2MA 3JZ2B 2Y82A 1MMJN 1RRKA 4KELA 1W0ZU 3ZZAA 2BM2A 1UTMA 2FP7B 3A7VA 3KN2A 3LPRA 4AG2A 1C5TA 2ULLA 4K5ZA 1XXDA 2BD9A 1T4UH 1BZXE 4MTBA 2PTNA 1T8LA 1P10A 2OC1A 1QBNA 3LGUA 1SHHB 2ANKH 4WXVA 3TJVA 1LVYA 3RXEA 4D9RA 2G55A 3TH3H 3Q77A 3ZYEA 3EGKH 4O97A 1RIWC 1WBGB 1T32A 1YPHC 3TU7H 2Q6GA 1MTWA 4CR9A 3RXIA 2Q6DA 5EW2H 1SC8U 5TCCA 1SB1H 3OX7U 2Y80A 4GSOA 1AB9C 5T6FA 1CHOG 2ZFPH 1BMMH 1Y59T 2XBXA 1QJ7B 2FO9A 1GBFA 1OPHB 1UTNA 1HAVA 1BTPA 3K65B 1UHBB 2DE8A 3H7TA 4WJG2 4JYTA 4DJZB 1BTXA 3FAOA 4X6NA 4Y8XA 1G30B 1PFXC 3I29A 3PWBA 2ZFQH 3MHWU 3SNBA 1GBJA 1UVUH 1TGNA 2ILNA 4X2XA 4TPIZ 2QXHA 1O5BB 3F68H 1S0RA 3SJIA 1NFUA 1BOQA 4NZLA 1T8NA 2FZZA 3ZYDA 1YKTA 4B75A 3QWCH 4I8JA 1EAUA 3AVZA 1MBQA 1Q2WA 1C5LH 2FMJA 1YPGH 4B73A 1LHFH 1ZHPA 1EKBB 4CHAB 4LZ4B 1P06A 2W7UA 2Y5FA 2TRMA 2D26C 3S9AA 6GCHF 1AUTC 3VB4A 1THPB 1THSH 2AIQA 3AW1A 2W3KA 1EPTA 3MU8A 1LPZB 1TRMA 4RSPA 2BD2A 1QJ1B 4NCYA 4OS2A 4NG9H 2WPIS 1BRUP 2G5NA 2OLGA 1Z8GA 1AD8H 4IC5A 1W10U 2HNTE 2CXVA 4HZHA 3ZZ8A 2QF0A 5LPEA 1O5GH 1QB9A 1SGEE 5FAHA 1K22H 2OC0A 2Z94A 1ZJDA 5C67A 1LHGH 1QBVH 4X6OA 1Y3YA 1C1QA 1G3BA 2W3IA 2BY7X 1K9OE 4OS7A 2ZGXH 1O2NA 2A32A 3VB6A 2FIRH 3IWMA 3GDSA 1K1JA 5L2ZH 2P3UB 1MU8B 3I78A 1IQGA 1TX6A 3TK5A 4ISIH 2WPHS 5CE1A 2VWMA 2O9QA 1L1GA 3M7UA 3ATMA 3KCGH 3TJUA 1GJ9B 5FXLA 1J8AA 3SBKA 1TB6H 1O37A 4FUFA 2BLVA 1O36A 4UD9H 4ISLA 3UNSA 4THNH 1K1IA 4CBNA 3VFEA 5K0HA 3QX5H 1QR3E 1DWDH 2Z3EA 1G9IE 1DWCH 4X1NU 2ZFRH 4XDEA 3RXGA 3SGQE 4M7GA 1UK4A 5L2YH 2J95A 2G81E 3NKKA 1ELDE 3UWJH 3T26A 2VIWA 2ZQ1A 2D8WA 1TNGA 3NK8A 1O33A 4UDWH 2ZNKH 2F9VA 4Y0ZE 3STIA 4DT7B 1NROH 2R3UA 3HATH 1P03A 4K1EA 4CR5A 4E06H 1HYLA 1GMHF 7KMEH 3KGPA 4X1PU 4MNXA 1H8DH 1GBCA 3E0NB 1GHAF 5FBIA 2WV5A 2ANWA 2GVFA 2I6QA 3MNSA 2QGRA 5GWZA 3A8AA 3GY4A 1P2QA 2OCVB 1Z8RA 4X1RU 1KXBA 1WAYB 3LGYA 4LOYH 1MAXA 2KAIA 2QV1A 1ACBE 1S82A 1JOUB 1GL0E 1ANCA 2GDDA 1ELFA 2GCHG 1OWEA 2F91A 2ZA5A 5F6MA 3K6YA 3LC5A 2AS9A 1B5GH 2H5CA 3E16B 1BQYA 4LZ1H 1TRNA 1TABE 2VH6A 1DLEA 3MU1A 3KQEA 5EXNA 3ZZ4A 4YOJA 1ZSKA 2PFEA 1QHRB 4O3TA 5HYOA 2RCEA 1FLEE 1A46H 2OINA 3FANA 2AMPA 2JH0D 4DGJA 1YC0A 2O8MA 3S7KB 1CGIE 4BTIB 1BTWA 1Z1IA 5A8XA 5HM9A 1Q3XA 4O03A 3UIRA 3CENA 1BBRH 3A7YA 1CT2E 2ZPSA 1A3EH 3IG6B 1AN1E 2TGTA 3PTNA 2FXRA 1PQ7A 2BYAX 3H7OA 4A92A 2GKVE 2QC2A 2SGQE 1WQSA 5EXLA 3TK9A 1UO6A 4HTCH 1O3MA 2AGEX 1JBUH 2EI6A 2SGDE 1ZR0A 4ISHH 2H6MA 1FN8A 1GBMA 3GY2A 2LPRA 1B0EA 1MD8A 2ODPA 5BPEA 3P70B 3RXSA 1LVOA 2OP9A 3ZVEA 4H6TA 3LGVA 3QDZB 3U69H 1YCPH 3GY8A 1TQ7B 1V2VT 2ZDNA 1MKXK 1OSSA 1NZQH 3MMGA 2C93B 1AFQB 4CRDA 1CE5A 3QGNB 4JK6A 4F4OC 2FDAA 3D49H 2B5TB 1O2TA 4GVUA 4PROA 1C1WH 4MNYA 3MU0A 3A8DA 5E0GA 3DFLA 5DK1A 1ZTKA 1EAXA
chains in the Genus database with same CATH superfamily
1QA7A 1V6DA 1DDJA 2QXJA 4YOGA 2A5AA 2FOBA 1OWIA 2BX3A 1C1RA 3M5MA 3P95A 4RN6A 1EOJA 3VEQB 5JBAS 1AIXH 1EX3A 1GI5A 3RXJA 5L6NH 1EPTC 3GCNA 2QN5T 1CA0B 3SN8A 4A7IB 1OWJA 1YPEH 4FUJA 2BB4A 5CHAB 1HJ9A 2ZQ2A 3QGJA 1GMDG 3ZZ6A 1AMHA 3SU6A 2GDEH 3MO3A 2IPHA 1OYQA 3MNCA 1QRWA 2PSXA 1SGYE 3ZIAD 2PUQH 1EB2A 1GI7B 5F8ZA 1F5KU 3M3TA 2ZFSA 3SNAA 7ESTE 3SV9A 5C0TA 1CGJE 1GBAA 1F92A 3LGIA 3BTQE 1U6QA 7GCHG 1GCTC 2J5UA 3NUMA 1O5DH 4CBOA 1LDTT 1UVPA 5FPYA 4NFFA 2ZWLH 4DG4A 8KME2 2V3HH 3STJA 1O3PB 3RMMH 1LQEA 1VGCB 1CBWC 1P2JA 3MH4A 1TA2A 5DP8A 1G3CA 1CHOF 1GHVH 3RU4D 1TOCB 4H6SB 3VB5A 2BY9X 2IOTA 2CN0H 3BEFB 1O3EA 4X2WA 5EQQA 2QIQA 8GCHG 5JYIA 3LH1A 1C1TA 3RXFA 2KCPA 2OXSA 5AVDA 1GCDA 1QBOA 2R2WU 2FI5E 1C2EA 3LGWA 4ISOA 3SU2A 1XUGA 1XVOA 1A5IA 1A0JA 1MAYA 3A81A 4TY6A 1SVPA 5ETXA 1YGCH 2ZDVH 3H5CB 4TWWA 5HXFA 4MPVA 1CHGA 2AFQB 4I8HA 2FOCA 1GDUA 1ELTA 1FX0B 1P9SA 2P8OB 4YTAA 2YNAA 1LHEH 3TJNA 4AOQA 1ZSJA 1KDQA 3RDZA 3V3MA 3ATWA 3DD2H 4Y6DA 3MNBA 1WOFA 5JBTA 1P11E 3GY7A 2BVSH 1FNIA 3VB7A 1BHXB 2Z9JA 3C27B 1P3EA 2ZHFH 3E0PB 1TIOA 5JPMH 3OEHD 1K0HA 1HLTH 3RLYH 5FX5A 3UOUA 1GJDB 1O2UA 1NT1A 3KYGA 4Y76A 3KYFA 3A7TA 1BB0B 1ETRH 2C90B 2GZ8A 3SNCA 5GCHG 4ZMAH 3QTVH 2OQ5A 5E2PA 1AE5A 1A0LA 6ESTA 3BIVH 4CRBA 3FO8D 4KP0A 3LJJA 3UFAA 1EZXC 1C9TA 5FX6A 1OP8A 2VIOA 4OGYA 5DG6A 2BDCA 5DP3A 3OFND 2A0QB 3MOCA 1KLIH 4B1TA 1LPKB 1ZTLA 3E6PH 1NRPH 1GBHA 1DUAA 2FI4E 5J4SA 1GG6C 4BANB 1HAZB 4XBDA 2B7DH 3QN7A 1KSNA 1SQOA 2ZFTA 1AKSA 1O3OA 2A4OA 1C5XB 2GZ7A 1AWFH 2R3YA 3GCTG 3RXCA 4WY3A 1YY3A 1P05A 4WH8A 4YT7H 1D6WA 1GJAB 1SOTA 2VIDA 1N8OB 1Y3UA 2ZGJA 1O2OA 5DP9A 4TPYA 3RXUA 3SJ8A 1LVMA 3PB1E 1FIZA 2FODA 4Y7AA 2J38A 6LPRA 4AB9A 1RD3B 3PMJA 3BG4B 3O8RA 2VBCA 2AMDA 2BLQA 1F0UA 1O35A 2FOHA 4A1TA 2F3CE 2HLDD 4E7RG 2BXUH 5HGGA 2ZZUH 1O31A 2D2DA 1W12U 4FETA 2ZFFH 3OY6U 4ZROA 3QUMP 1ZJKA 3SV8A 1BTZA 1SLXB 2HPPH 3R0FA 1J17T 2G4UA 5FCRA 3QK1A 1GMCG 3A83A 2FOMB 2WINI 3GS9A 4MNVA 4YOIA 2ZTZA 3PMHB 3PYHA 2BX4A 1ABIH 2JIZD 2ZI2H 2PGBB 4X6PA 5C1UA 3BTWE 3CS0A 2OC7A 3VXFH 2GTBA 2GP9B 1E34B 3RM2H 3A8BA 2ZGHA 4B71A 2GCHF 1GI2A 2XWBI 1MZDA 1SFIA 2HVYB 4ZKSU 2GCTB 1T8MA 3RMNH 1K1PA 3K2UA 3CS7A 1EP6A 3M3VA 5EPYA 3KQDA 1GI8B 1TMTH 1WU1A 2FLBH 4KGAA 3F1SB 3RXOA 1W7GH 1S85A 5A2MH 2W5EA 3RXLA 1D6RA 3ZV9A 5DJ7A 1J14A 3BTGE 1IQJA 2Z9LA 1HRTH 1XX9A 1P3CA 1C5UA 1GDQA 4WMFA 4B74A 1EP5A 4Z0KA 1WTHD 3RXVA 1BUIA 4H42U 2QA9E 3P8GA 1GBLA 1H8IH 2IN2A 1EXFA 5F8TA 1O2KA 1MBMA 2QYIA 2BZAA 3OYPA 2O8TA 1YLNA 2FOGA 1JIMA 1P04A 3UTUH 2UUKB 1TPPA 1TA6A 2XWAA 1LQDB 3EE0B 3OAAD 4F49A 1RGQA 1XMNB 2LNCA 2ZGBH 3E3TA 2EC9H 3RC5A 2BDAA 1C5OH 2PKAA 3OTJE 4RKOB 5T6GA 4P02A 1O2ZA 1O3NA 3DHKH 1GPZA 2P94A 2SGAA 3RP2A 4FXGH 1DM4B 4CH8B 1CVWH 2ZTYA 1C5SA 1TBQH 4BAKB 5FCKA 2AGIX 1T8OA 2EQNA 3TNSA 4FOUC 5JBCS 4AG1A 1SQTA 1ZMLA 3A86A 1MTNB 5B6OA 5DPAA 1NU7B 1TPOA 1O3HA 3OE7D 4RKJB 4D8NA 1A3BH 4ZH8A 4ACBA 2JETB 2F4LA 1UTLM 4KTSA 4NSVA 5E2OA 1SFQB 1SGNE 1OS8A 5LGOA 1IQIA 4RI0A 5FL7D 3L3TA 2BHGA 1C4U2 1O2LA 2CGAA 4U2WA 3UUZA 4ABBA 3LH3A 3SV7A 2ZEBA 1VJAU 1K2I1 3MH7A 2R9PA 2GT7A 1IQNA 1CT0E 3SUFA 1MKWH 2LP6A 1V2OT 1EJAA 1GBIA 1VCQA 1WSSH 2QXGA 2P3FH 1VR1H 4X1QU 1EOLA 1SOZA 3RXRA 1D3DB 2ZCKP 1DITH 2GT8A 1HDTH 2VIPA 1SLUB 2GMTC 3AAUA 1NFYA 4ABGA 1S5SA 1Y3WA 1GI1A 4XFQA 2TIOA 3RC6A 1FXYA 1BMFD 1YPHE 3ZZ3A 5JB8S 3JZ1B 8ESTE 4BTTB 7LPRA 3PRDA 1FQ3A 1KXDA 1HIAB 1Y5UT 4X8TH 1L1JA 2BD4A 5GJ4B 3T5FH 1CT4E 2ZECA 2Y5GA 1SLWB 2FOFA 3T29A 4K8YA 1AFEH 1FN6A 4XRNA 3SZNA 1AHTH 3WWBA 3NWUA 3UOPA 1B0FA 1O3KA 1P2IA 2VVCA 2VVVA 2VWNA 3SQHE 1H4WA 3F2HA 4H4FA 1WYKA 2ZP0H 2A7CA 4GLYA 2XNDD 3RXQA 4GHQA 3V0XA 1ELBA 1ZZZA 2BD7A 1A0HB 5T3HA 5BRRE 1UCYE 1XUKA 2STBE 3EA8A 1HJAC 4XBCA 1O3FA 2J4IA 2ODYB 1V2LT 3ZV8A 2SGFE 2ALPA 1GI9B 1GJBB 2KM0A 4JZ1A 1DFPA 1EAWA 1MU6B 3A7WA 3A8CA 1CQQA 4VGCB 4A1VA 1HJ8A 1MTVA 1HGTH 1LHDH 1Q31A 4AB8A 1BTUA 2Z7FE 3W94A 1AO5A 4ZXXH 3PMAB 3FVFB 3S7HB 3FP6E 1VITG 5T1VA 1E36B 3EYDA 4FU7A 2NU0E 1HAIH 1TE0A 3BTTE 4NWKA 4JYVH 4ABJA 2VGCB 2P95A 1OX1A 2XCFA 1GVLA 4UE7H 1BCUH 1HAXB 1BRCE 1EATA 4FUDA 1ZPBA 3ZZCA 3ZVGA 4BXSA 2EI8A 5HIZA 1SG8B 3M5LA 1ELVA 1YPMH 4MLFB 4FUEA 1QQUA 1TNJA 3GDVA 2UUFB 3A7ZA 5DP5A 3A85A 1T4VH 4WXIA 4ESTE 1C5WB 2WPLS 2PP6A 2V6NA 1GJ4H 3WY8A 4UFFH 1QURH 4AFZA 3F6UH 1DXWA 4K1TA 4WF8A 2PKSB 1DUEA 1O3DA 1YP9A 4I32A 1BTYA 2BDGA 3FN8A 2ZHDA 2ZIQH 1AE8H 1LO6A 1DS2E 2NU4E 5EOKA 2C8XB 2G8TA 2ZCLP 3DA9B 5IDKA 1IAUA 2GD4B 1PPCE 4LK4A 1DT2A 1NS3A 2NWNA 2R2MB 3RXDA 1SPJA 1F2SE 3C1KA 2AYWA 1QL9A 2JDID 4J2YB 5C3NA 1YWUA 2XC4A 4AORA 6CHAB 1F0SA 3V13A 2VVUA 2A2XH 3PLBA 2WPDD 5ESTE 1FPCH 3GCHC 1UHBA 3SU4A 1ESBA 1MCTA 5E0HA 3SYJA 1O2JA 1A7SA 1UCYK 3GYMA 2WV4A 3KEEA 4ZXYH 3KQBA 3PM3A 3SI3H 1SL3A 2C3SA 5DP7A 1ETSH 3K9XB 3TNTA 2OBOA 4NIWA 1O0DH 1QA0A 5A09A 4YESB 4FU8A 2HWLB 4TY7A 1DVAH 1KYNA 4Y10E 4NIXA 4Q63A 5C1XA 2NU3E 2XBYA 3T62A 1TQ0B 1Y3XA 3RU4T 2H2ZA 1N6XA 4HI3A 4XBBA 3SHAH 3VGCC 4ABEA 1PPHE 3RMOH 1AQ7A 3RUOA 2CMYA 2VH0A 1ELGA 3SHCH 1XUFA 3PO1C 1G36A 3O8CA 2YMSB 4INKA 1V2ST 3F9GA 5EJZA 3MWIU 3SW2B 1PYTC 3HPTB 3BN9A 4Q7YA 5FPTA 1AY6H 1SLVB 3UWIA 1ELCA 2XXLA 3GDUA 1RIWB 1DX5M 3GY5A 4JCNA 1VJ9U 2O8WA 1OWKA 3Q3YA 1XXFA 4WWYA 1LHCH 1EZQA 1AB9B 3PTBA 2OC8A 1RTFB 4KTUA 2G4TA 3N7DA 1W8BH 2QCYA 1HCGA 3PROA 2CV3A 2FYRA 4I8GA 4O9VA 2QE7D 1AUJA 1K1LA 2ESTE 4LXBH 1F0RA 1UTKA 1V2TT 1DOJA 3Q00A 3SJKA 1A5HA 1LPGB 1F5LA 3D23A 4ASUD 4NFEA 2WV9A 3RM0H 2J34A 3ESTA 1XUIA 4UFEH 1UVSH 2FI3E 5HMAA 3BEIB 4NA9H 1GVZA 4IW4E 3ZZBA 3KF2A 2UWOA 1TWXB 2VINA 4U32A 3S0NA 5A0CA 1SGRE 1DSTA 3PV4A 1K1NA 5TCAA 3EE7A 2CHAC 4MPXA 3M5NA 1Y3VA 3PRBA 1INCA 3N7OA 1C9PA 3TGJE 3PMBB 3MI4A 3SORA 4ZUHA 3SU0A 3LONA 2AHME 1OWDA 3ATKA 1QB1A 3MFJA 1UTPA 4UFGH 8LPRA 1IQFA 1GI0A 2FEQH 1C4V2 3ZVFA 1ANBA 3B9FH 1W0KD 1L4DA 2XNIA 3SO3A 3URDA 2BVXH 1Z6JH 1BIOA 3MYWA 2KFWA 1ABJH 2H9TH 1A61H 4XD7D 1E1RD 1ZMNA 2GX4A 4OGXA 1HAYB 3HKJB 4R8TB 4JYUH 4KKDA 4ABHA 2BY6X 4K8BA 3W95A 4FUBA 2ZPRA 1SGPE 1N6YA 1O3GA 1QL7A 5F53A 1GWAA 2DUCA 1V2KT 4ZAEA 3O8BA 4Y79A 1BT7A 1GBBA 3D62A 4BOHA 1GGDC 1PPFE 2ANMH 5JB9S 4Y8YA 5FBEA 3F0OA 2IJOB 1FY4A 1JRTA 1JIRA 4YXWD 1V2QT 1YPKH 4B2CA 4YZUA 3LIWA 1VKYA 1PQAA 4GPGA 4I8KA 1O2YA 1TAWA 1TNLA 4INLA 1QIXB 2ZC9H 2PSYA 2ZU4A 4DVAU 4X0WU 2OTVA 3F9FA 3OY5U 4AFUA 4AZ2B 2F9NA 4ZCNA 5CMXH 1KXAA 1SGDE 2J9NA 1C1UH 1C5RA 3SNEA 1KTSB 3A80A 1GHZA 1MKXH 5GPIB 3UNQA 2FPZA 4B76A 3ENSB 1IQMA 3A84A 3ZVCA 1BDAA 1O2GH 2C8ZB 3G01A 1W3CA 2C8WB 1YF4A 3MO6A 2WPJS 1SBWA 1MQ5A 2C4FH 1SGTA 3M5OA 5J4QA 3SJOA 4AGJA 5C94A 3F2FA 5GXPA 3CNRA 4YO9A 1ZHRA 1SGFG 1C2HA 3I77A 2GV7A 1HNEE 1Y8TA 4UFDH 3ITIA 3M37A 1A2CH 2F43B 2B0FA 2BOHB 3FZDA 1RS0A 4ASHA 1QFKH 1WUNH 1UK3A 2HGTH 2V35A 4GCHG 1DWBH 2A4RA 1FY5A 2Q6FA 2ZDLA 5LH8A 1C1PA 1D3TB 2FESH 3SGBE 1UJ1A 3UAIC 2B8OH 4E05H 2PR3A 1NBMD 2QAAA 1WXRA 2BLOA 1Z6EA 3LU9B 1S81A 2HOBA 2FS9A 4DOQA 1O3BA 1DY9A 1UVTH 4ISNA 1VITF 2VWLA 2WPMS 4ZHAA 2J94A 3O8DA 4RT0A 4BAOB 2BDHA 1FAXA 1ZHMA 1TBRH 2XCNA 1RFNA 3PLKA 4CHAC 3BIUH 1AWHB 1TYNA 1O2XA 3SUDA 1TGTA 1V2PT 1IQEA 1GBKA 1C5NH 2PV9B 1V2UT 2W7SA 3HGPA 3ZZDA 1KTTB 3UR6A 3OSYA 3FFGA 2XC5A 3TGIE 2G52A 2TBSA 1W13U 3S9BA 1J16A 2WUCA 1GMHG 1ZOMA 3M7QA 1VITH 1ANEA 3V12A 1TPAE 1GHAG 1O34A 4Q2KA 5LPFA 1CGHA 1J9CH 3ZZ5A 1WTGH 3A87A 2JH6D 1P02A 1JXPA 1L0ZA 1QCPA 1H8ED 1BITA 5C20A 4X8VH 1NY22 2R0KA 3QZQA 5F8XA 4AN7A 3PLPA 3N7EA 1HAVB 2F83A 4TWYA 5EU8A 1TMBH 1E37B 2OD3B 4SGBE 4MDSA 2ZCHP 4X6MA 3N99A 3BTDE 1NBME 4E7NA 2KCAA 3TITA 2BQ6B 1ZLRA 3MO9A 1W14U 2BXTH 4IN1A 5A8ZA 1O3AA 1D9IA 2FX6A 1CU1A 1EZSC 1B7XB 1MABB 2ZF0H 1DWEH 4D7FA 1HXEH 4JZIA 3B23B 4IMZA 2OUAA 5F03A 1E38B 3BTME 4WVPE 3Q76A 1ARCA 1HXFH 1COWD 2P93A 1P8VC 2WPKS 4CRGA 1CA8B 1SMFE 3UY9A 1F5RA 1PQ5A 1XUJA 3UNRA 2ALVA 3F0PA 1C2FA 2UUJB 1ETTH 4XSKU 2EI7A 3DUXH 1W2KH 2XOKD 1AVGH 1FONA 4WMDA 1C4Y2 1KLTA 1HAPH 1EPTB 4JMYA 1Y5BT 1KXEA 3TGKE 3S69A 1YPLH 1XVMA 3FOAA 5ESBA 1D3PB 4IC6A 1TBZH 1UMAH 1ZRBA 3GYLB 1IQHA 3M3SA 4FUHA 1DANH 1QZ8A 1C1VH 3PWCA 4A6LA 5DGJA 2VB0A 3TJOA 3P17H 1PPGE 4HFPB 2BQ7B 4KTCA 3E1XB 1FAKH 3DSPA 2P16A 2UUYA 1HAHH 1H1BA 1O3CA 3MU5A 1TX8A 1GCTB 1FV9A 3M61U 3URCA 1SGQE 2HALA 4FVDA 1K28D 1DSUA 2VJ1A 1GJ6A 1O5AB 5KGOA 3B8JA 4X2YA 4D7GA 4D76A 1C1NA 2V3OH 4U01A 1CBWB 2XBWA 1C2GA 1GHBG 3BV9B 3BTEE 2NU2E 1MQ6A 3D65E 1TALA 2A7JA 1TFXA 4I33A 4ZKNU 5L30H 4J1YA 1HAOH 1BRBE 1NTPA 1TGBA 2A4QA 2CK3D 3LGTA 2A5KA 2XRCA 4YLUA 5PTPA 2ZDAH 1V2MT 1H9LB 1D4PB 1ZSLA 4ABFA 1L4ZA 4I31A 1FZZA 3SU3A 1DLKB 1P9UA 4AFSA 3TLOA 2SNVA 5FPSA 1EJMA 1BBRE 2SGEE 2XW9A 1ZRKA 2KX4A 1T31A 4NGAH 1NO9H 3HK6B 1VZQH 2YMSC 3QLPH 1MUEB 3TH2H 1GMDF 2K1QA 1SI5H 4Q80A 4ABDA 5C5OA 5GIBA 1EZUC 1DY8A 1O2PA 2PGQB 2TGDA 3R3GB 1XKAC 4UONA 1ZGIA 2RA0A 2EEKA 4A5TS 5A0AE 1BMNH 1ANDA 3BG8A 1C2KA 3U28C 1KXFA 3ELAH 3U8OH 5DN6D 5DO4H 7GCHF 2ZG0H 1S83A 1P01A 1OKXA 2KAIB 1ZGVA 1AFQC 2B9LA 4CRAA 2VNTA 4FUGA 2Y81A 2A7HA 1MD7A 1GL1A 4CRFA 2H1UA 2UWLA 1AU8A 5C1YA 1C5VA 1TPSA 1TONA 2O8UA 2GV6A 3FZZA 3A89A 1OHHD 3U1IB 2W6JD 4NA7A 2LELA 2PLXA 5AF9H 3SZEA 8GCHF 2J98B 1SR5C 1ZTJA 2GGVB 4YM9A 1FI8A 1S6FA 1GG6B 2HNTC 1P12E 2CF9H 2ZKSA 2H9EH 1BJUA 3ODFA 2ZU5A 1CA0C 1G3EA 4CREA 1V3XA 2XC0A 5CHAC 5EXMA 1S0QA 3T27A 3F9EA 3SU1A 3AAVA 3RMLH 4BAQB 3SV2H 3TH4H 3E8LA 1SKYE 1D3QB 3GICB 2O8LA 3AW0A 1NU9A 4NWLA 1LCYA 1O5CB 3SGAE 2G51A 4M9FA 1O2IA 2WYGA 2FTMA 2Q1JA 3GISB 2FOAA 1BMAA 2XTTB 1SSXA 2IPQX 3SU5A 1K1MA 1SQAA 1BA8B 1SHYA 4AGKA 4ZHMU 4NA8A 2FOEA 2EA3A 1TX7A 2J92A 3ZVBA 1VGCC 3ODDA 3UQVA 1TMUH 4MVNA 3BSQA 2RFKC 2Z6BD 1BBRK 4CH2B 1JMOH 1P2NA 1C5YB 2BD8A 2RA3A 3ZVAA 4R0IA 3NCLA 1N1LA 2F9OA 3PV2A 1HAGE 3SQEE 5GCHF 3UR9A 1O3IA 5EIYA 2ZGCA 1SQRA 3E91A 1O38A 2TGPZ 1WQVH 3M7TA 3BF6H 3KHVA 1W0JD 4GCHF 1MTSA 4X1SU 5I46H 1P09A 2QF4A 2IJD1 5AHGH 5C2ZA 4BNRA 2H5DA 1K21H 1RTKA 3H09A 3EA7A 2I6SA 3GCOA 3SOSA 1YCPK 1QB6A 2P8OC 4AX9H 1FDPA 1IQKA 3P8NA 1GHYH 3T2NA 1S6LA 3RLWH 3CP7A 3MTYA 4WH6A 3GCTF 1HBTH 2WUBA 3RXMA 2F9PA 3U8TH 1NPMA 4K60A 2FLRH 1ZMJA 3AASA 1QGFA 2A5IA 1OP0A 3EAJA 1P2KA 2WYJA 1SGIB 1X7AC 1YLDA 3M35A 1PPBH 1V2RT 1IOEA 1E1QD 1W11U 2PHBA 5IYTA 3SUEA 1EQ9A 3VB3A 1NM6A 4Z1MD 1FIWA 3QZRA 2BLWA 2RG3A 4U30A 5DKMA 3VPKA 5IK2D 2D1JA 2W26A 4OS1A 4BAHB 2HVXA 1DPOA 4K1SA 2ZU1A 1KXCA 4IS5A 2ZHWH 1EB1H 2CF8H 5EQSA 1O30A 1Z71A 2FX4A 1YPJH 3SI4H 3L6PA 4K3JA 4AYVB 5GNDA 1OXGA 5EG4A 1YLCA 4GAWA 1GMCF 2F9BH 1GBTA 3U8RH 1NESE 1TNHA 3K6ZA 4XE4A 3RXKA 2VU8E 3T25A 3QO6A 1TRYA 3FP8E 1HIAA 1PYTD 5JDUB 1W7XH 1ZYOA 4BXWA 3HKIB 4GUXA 2A4GA 3SJ9A 2J2UA 4MQAA 1GJ7B 4A1XA 1CSOE 4X8UH 4F55A 1L2EA 1THRH 3V7TA 4X8SH 1GJ5H 1GHXH 1OOKB 2WHXA 2BQWB 2ASUB 1EAIA 2BMGB 3KNXA 1N8OC 1G3DA 1XUHA 1KY9A 1YBWA 1GI6A 2BDIA 4IBLH 3UREA 2V7QD 5EQRA 5KEDA 3GY3A 1F0TA 1GBEA 4TYDA 4HGCA 2Y7ZA 3EDXB 2KCYA 1EJNA 1QRZA 1G2LA 4DT4A 4YT6H 2Y7XA 1MTUA 1KDQB 2ZDKA 9LPRA 3BG4C 1C1OA 2V3MA 3P6ZB 2HRVA 1O32A 3BTKE 5LPRA 3LT3A 1O39A 4Z6AH 3DCLA 4MPUA 1P2MA 3F2GA 1C2DA 1TGSZ 3L33A 1BRAA 2ODQA 3RXBA 3ZZ7A 1C2LA 1UK2A 2QF3A 4DY7B 1O2RA 5K7RA 3DT0H 3WWFA 2VIVA 2PW8H 2A45B 5EODA 1S84A 1ZPCA 4DW2U 1QNJA 2FM2A 1GHWH 2AERH 1ORFA 1FMGA 1ESTA 1RTLA 2R0LA 3QTOH 2C8YB 2Z3CA 2Y6TA 3UQOA 4X2VA 4OS4A 1MCVA 1L1NA 1Z7KA 5I25A 3RXHA 1WCZA 2GMTB 1FY8E 1AVWA 1C5QA 3T28A 2HNTF 2Z9IA 1PPEE 3ZVDA 2GZ9A 1ZPZA 2A31A 1A4WH 1SGCA 4FVBA 1GJCB 2AGGX 3KQ5A 4ABIA 2ZHQH 4ACAA 2ZTXA 2JH5D 2ANYA 2UWPA 3LC3A 1K1OA 2BD5A 1UW7A 2F9UA 1V2NT 2GCTC 4ZKOU 1RJXB 1GHBF 1SGFA 4Q7ZA 4IGDA 1KLJH 4OS5A 1AKSB 1UTJA 3LOXA 2ZHEH 3SNDA 2KCOA 1S6HA 1P2OA 5DP4A 1HV7A 3P8OA 2VWOA 3U98H 2P3TB 4ZKRU 4B6FA 1C5MD 5CDFE 2YOLA 1GI4A 1UCYH 2G00A 1P57B 3ATLA 1OYTH 1VCPA 1HUTH 1ELAA 1IHTH 1NRRH 5E0JA 1FPHH 4JZEH 4DIIH 2A2QH 1IQLA 1HJAB 1HPGA 3U9AH 3TIUA 4B2AA 3IITA 4BAMB 3F9HA 2BZ6H 1E0FD 2Z9KA 3U1JB 5A0BA 3BEUA 4I7YH 3NZIA 1UTOA 1C5PA 4RT1A 2STAE 2VIQA 1G32B 2JKHA 1ARBA 2OK5A 4INHA 4ZHLU 1M9UA 4DCDA 1T7CA 1FY1A 4NIYA 1NFWA 2OQUA 2BOKA 2BTCE 1Z1JA 1AI8H 1H9IE 4P00A 1EUFA 3VXEH 2FTLE 2HLCA 2V0BA 1O3LA 1MZAA 3E90B 5SGAE 4B2BA 5AFZH 5HM2A 1MTNC 4MNWA 2BY8X 4NZQA 1P0SH 6GCHG 3HK3B 2K8IA 4IN2A 5T6DA 5DSFA 5H4IB 1QJ6B 4DURA 2JETC 4AFQA 1PJPA 3GOVB 5EJLA 1BHXF 1PQ8A 1HFDA 1C2JA 2Z3DA 3A82A 4JZDH 1YM0A 3P8FA 3KIDU 1O5FH 2FWWA 3Q3XA 2RDEA 1KIGH 4XOJA 5GDSH 1AVXA 3UPEA 2AIPA 3TVJB 2RDLA 3EQ0H 3TK6A 1UTQA 3WW7A 2XYAA 1AZZA 3RXTA 4I8LA 5B6LA 1C2IA 3MU4A 1MH0A 4Y0YE 2BY5X 1HB0B 1FY3A 4Y71A 1LKAA 2SFAA 1J15A 1GDNA 4HG6A 2SGPE 1JRSA 3RXPA 4ABAA 4OM9A 2M5TA 2PTCE 3A7XA 5TJXA 4K69A 2P59A 1C1MA 2J97A 3RU4E 3KQCA 2DE9A 2PKAB 2G5VA 4TT3D 1H9HE 1O2SA 3GCHB 4YLQH 1O2VA 9ESTA 1UVOA 4SGAE 1QRXA 1O2HA 1OP2A 1TNIA 3MNXA 3SUGA 4UEHH 4IMQA 1IHSH 1G37A 1ID5H 1O2WA 4FUIA 2L6OA 1V2JT 1NN6A 1JWTA 2H9HA 1NRSH 5C0UA 3S9CA 1Y5AT 1WV7H 4OS6A 1YYY1 2BVRH 4JK5A 3GY6A 1XKBC 4CRCA 3Q3KA 2TPIZ 1LTOA 1RXPA 1A1RA 2PUXB 4D9QA 2ZDMA 2JJ1D 1AGJA 1BJVA 3EA9A 1OWHA 1GVKB 2ZU2A 1ESAA 1V2WT 1LMWB 3NPSA 3VGCB 1GI3A 2Y5HA 3ATIA 5CHBA 1VCWA 1TNKA 2FYQA 1NRNH 3PO1B 4K2YA 4QT8C 4DIHH 2YNBA 3MH5A 2ZPQA 3FP7E 4Q4LA 4Q7XA 2SNWA 1FUJA 1FJSA 1NFXA 5A8YA 2ZO3H 1BMLA 1XM1A 4VGCC 4WMEA 1NC6A 4O3UA 3RC4A 1DXPA 4MPWA 1TGCA 2TGAA 1O2MA 1LVBA 4Y8ZA 5EW1H 1QQ4A 3AK5A 2VGCC 3NXPA 1YCPM 3LDXH 1DICA 3P92A 1TOMH 3TPIZ 1AZ8A 4GHTA 4Y7BA 5ABWA 5JBBS 4JZFH 1O2QA 5EGMA 2HPQH 4MG3A 1O3JA 3BTHE 1MKWK 3ZZ9A 1LKBA 1QTFA 2NU1E 1BTHH 1QY6A 2AH4X 2PWXA 4AYYB 3DFJA 3SV6A 3KL6A 5AFYH 3LJOA 2A1DB 2CHAB 2M2AA 2PKSC 1NRQH 3MH6A 1QL8A 1DE7H 1F7ZA 4TSFD 2AMQA 5FHTA 1A5GH 2W6ID 4FU9A 3RXAA 2THFB 1O5EH 1TLDA 2BDYA 1GBDA 1KMHB 2EY4C 1E35B 2ZU3A 5DP6A 1ELEE 1C5ZB 3A88A 3LKWA 4Y11E 3MQKC 4NIVA 4BTUB 1G2MA 3OEED 2AEIH 5G4BA 3M36A 3BTFE 6CHAC 4FUCA 5C5NA 2OBQA 2Z9GA 2QXIA 1Z8IB 1W0YH 3OU0A 1Z8JB 2FS8A 2BDBA 1GGDB 2CJIA 2YMSD 1GJ8B 5EPNA 5C17A 4NSYA 5E8EH 2BD3A 1EASA 2QY0B 3HGNA 2XBVA 1C1SA 1CO7E 1PPZA 1C2MA 3JZ2B 2Y82A 1MMJN 1RRKA 4KELA 1W0ZU 3ZZAA 2BM2A 1UTMA 2FP7B 3A7VA 3KN2A 3LPRA 2K0QA 4AG2A 3W1EA 1C5TA 2ULLA 4K5ZA 1XXDA 2BD9A 1T4UH 1BZXE 4MTBA 2PTNA 1T8LA 1P10A 2OC1A 1QBNA 3LGUA 1SHHB 2ANKH 4WXVA 4B6EA 3TJVA 1LVYA 3RXEA 4D9RA 2G55A 3TH3H 3Q77A 3ZYEA 3EGKH 4O97A 1RIWC 1WBGB 1T32A 1YPHC 3TU7H 2Q6GA 1MTWA 4CR9A 3RXIA 2Q6DA 5EW2H 1SC8U 5TCCA 1SB1H 3OX7U 2Y80A 4GSOA 1AB9C 5T6FA 1CHOG 2ZFPH 4F48B 1H8HD 1BMMH 1Y59T 2XBXA 1QJ7B 2FO9A 5HIYA 1GBFA 1OPHB 1UTNA 1HAVA 1BTPA 3K65B 1UHBB 2DE8A 3H7TA 4WJG2 2QF5A 4JYTA 1BTXA 3FAOA 4DJZB 4X6NA 4Y8XA 1G30B 1PFXC 3I29A 3PWBA 2ZFQH 3MHWU 3SNBA 1GBJA 2KR7A 1UVUH 1TGNA 2ILNA 4X2XA 4TPIZ 2QXHA 1O5BB 3F68H 1S0RA 3F3BA 3SJIA 1NFUA 1BOQA 4NZLA 1T8NA 2FZZA 4I86A 3ZYDA 1YKTA 4B75A 2WZQA 3QWCH 4I8JA 1EAUA 3AVZA 3NRLA 1MBQA 1Q2WA 1C5LH 2FMJA 1YPGH 4B73A 1LHFH 1ZHPA 1EKBB 4CHAB 4LZ4B 1P06A 2W7UA 2Y5FA 2TRMA 2D26C 3S9AA 6GCHF 1AUTC 3VB4A 1THPB 1THSH 2AIQA 1WDIA 2W3KA 1EPTA 3AW1A 3MU8A 1LPZB 1TRMA 4RSPA 2BD2A 1QJ1B 4NCYA 4OS2A 4NG9H 2WPIS 1BRUP 2G5NA 2OLGA 1Z8GA 1AD8H 4IC5A 1W10U 2HNTE 2CXVA 4HZHA 3ZZ8A 2QF0A 5LPEA 1O5GH 1QB9A 1SGEE 5FAHA 1K22H 2OC0A 2Z94A 1ZJDA 5C67A 1LHGH 1QBVH 4X6OA 1Y3YA 1C1QA 1G3BA 2W3IA 2BY7X 1K9OE 4OS7A 2ZGXH 1O2NA 2A32A 3VB6A 2FIRH 3IWMA 3GDSA 1K1JA 5L2ZH 2P3UB 1MU8B 3I78A 1IQGA 3VG8A 1TX6A 3TK5A 4ISIH 2WPHS 5CE1A 2VWMA 2O9QA 1L1GA 3M7UA 3ATMA 3KCGH 3TJUA 1GJ9B 5FXLA 1J8AA 3SBKA 1TB6H 1O37A 4FUFA 2BLVA 1O36A 4UD9H 4ISLA 3UNSA 4THNH 1K1IA 4CBNA 3VFEA 5K0HA 3QX5H 1QR3E 1DWDH 2Z3EA 1G9IE 1DWCH 4X1NU 2ZFRH 4XDEA 3RXGA 3SGQE 4M7GA 1UK4A 3UB0A 5L2YH 2J95A 2G81E 3NKKA 1ELDE 3OTPA 3UWJH 3T26A 2VIWA 2ZQ1A 2D8WA 1TNGA 3NK8A 1O33A 4UDWH 2ZNKH 2F9VA 3DSOA 4Y0ZE 5HKKD 3STIA 4DT7B 1NROH 2R3UA 3HATH 1P03A 4K1EA 4CR5A 4E06H 1HYLA 1GMHF 7KMEH 3KGPA 1E79D 4X1PU 4MNXA 1H8DH 1GBCA 3E0NB 1GHAF 5FBIA 2WV5A 2ANWA 2GVFA 2I6QA 3MNSA 2QGRA 5GWZA 3A8AA 3GY4A 1P2QA 2OCVB 1Z8RA 4X1RU 1KXBA 1WAYB 3FKSD 3LGYA 4LOYH 1MAXA 2KAIA 2QV1A 1ACBE 1S82A 1JOUB 1GL0E 1ANCA 2GDDA 1ELFA 2GCHG 1OWEA 2F91A 2ZA5A 5F6MA 3K6YA 3LC5A 2AS9A 1B5GH 2H5CA 3E16B 3DSGA 1BQYA 4LZ1H 1TRNA 1TABE 2VH6A 1DLEA 3MU1A 3KQEA 5EXNA 3ZZ4A 4YOJA 1ZSKA 2PFEA 1QHRB 4O3TA 2J98A 5HYOA 2RCEA 1FLEE 2L74A 1A46H 2OINA 3FANA 2AMPA 2JH0D 4DGJA 1YC0A 2O8MA 3S7KB 1CGIE 4BTIB 1BTWA 1Z1IA 5A8XA 5HM9A 1Q3XA 4O03A 3UIRA 3CENA 1BBRH 3A7YA 1CT2E 2ZPSA 1A3EH 3IG6B 1AN1E 2TGTA 3PTNA 2FXRA 1PQ7A 2BYAX 3H7OA 4A92A 2GKVE 2QC2A 2SGQE 1WQSA 5EXLA 3TK9A 1UO6A 4HTCH 1O3MA 2AGEX 1JBUH 2EI6A 2SGDE 1ZR0A 4ISHH 2H6MA 1FN8A 1GBMA 2KZ4A 3GY2A 2LPRA 1B0EA 1MD8A 5KECA 2ODPA 5BPEA 1EFRD 3P70B 3RXSA 1LVOA 2OP9A 3ZVEA 4H6TA 3LGVA 3QDZB 2GJGA 3U69H 5EJ1A 2WSSD 1YCPH 3GY8A 1TQ7B 1V2VT 2ZDNA 1MKXK 1OSSA 1NZQH 3MMGA 2C93B 1AFQB 4AC9A 1CE5A 4CRDA 3QGNB 4JK6A 4F4OC 2FDAA 3D49H 2B5TB 1O2TA 4GVUA 4PROA 1C1WH 4MNYA 3MU0A 3A8DA 5E0GA 2JJ2D 3PV5A 3DFLA 5DK1A 1ZTKA 1EAXA
chains in the Genus database with same CATH topology
1QA7A 1V6DA 1DDJA 2QXJA 4YOGA 2A5AA 2FOBA 1OWIA 2BX3A 1C1RA 3M5MA 3P95A 4RN6A 1EOJA 3VEQB 5JBAS 1AIXH 1EX3A 1GI5A 3RXJA 5L6NH 1EPTC 3GCNA 2QN5T 1CA0B 3SN8A 4A7IB 1OWJA 1YPEH 4FUJA 2BB4A 5CHAB 1HJ9A 2ZQ2A 3QGJA 1GMDG 3ZZ6A 1AMHA 3SU6A 2GDEH 3MO3A 2IPHA 1OYQA 3MNCA 1QRWA 2PSXA 1SGYE 2PUQH 1EB2A 1GI7B 5F8ZA 1F5KU 3M3TA 2ZFSA 3SNAA 7ESTE 3SV9A 1CGJE 1GBAA 1F92A 3LGIA 3BTQE 1U6QA 7GCHG 1GCTC 3NUMA 4CBOA 1O5DH 1LDTT 1UVPA 5FPYA 4NFFA 2ZWLH 4DG4A 8KME2 2V3HH 3STJA 1O3PB 3RMMH 1LQEA 1VGCB 1CBWC 1P2JA 3MH4A 1TA2A 5DP8A 1G3CA 1CHOF 1GHVH 3RU4D 1TOCB 4H6SB 3VB5A 2BY9X 2IOTA 2CN0H 3BEFB 1O3EA 4X2WA 5EQQA 2QIQA 8GCHG 5JYIA 3LH1A 1C1TA 3RXFA 2OXSA 5AVDA 1GCDA 1QBOA 2R2WU 2FI5E 1C2EA 3LGWA 4ISOA 3SU2A 1XUGA 1XVOA 1A5IA 1A0JA 1MAYA 3A81A 4TY6A 1SVPA 5ETXA 1YGCH 2ZDVH 3H5CB 4TWWA 5HXFA 4MPVA 1CHGA 2AFQB 4I8HA 2FOCA 1GDUA 1ELTA 1P9SA 2P8OB 4YTAA 2YNAA 1LHEH 3TJNA 4AOQA 1ZSJA 1KDQA 3RDZA 3V3MA 3ATWA 3DD2H 4Y6DA 3MNBA 1WOFA 5JBTA 1P11E 3GY7A 2BVSH 1FNIA 3VB7A 1BHXB 2Z9JA 3C27B 1P3EA 2ZHFH 3E0PB 1TIOA 5JPMH 1HLTH 3RLYH 5FX5A 3UOUA 1GJDB 1O2UA 1NT1A 4Y76A 3A7TA 1BB0B 1ETRH 2C90B 2GZ8A 3SNCA 5GCHG 4ZMAH 3QTVH 2OQ5A 5E2PA 1AE5A 1A0LA 6ESTA 3BIVH 4CRBA 4KP0A 3LJJA 3UFAA 1EZXC 1C9TA 5FX6A 1OP8A 2VIOA 4OGYA 5DG6A 2BDCA 5DP3A 2A0QB 3MOCA 1KLIH 4B1TA 1LPKB 1ZTLA 3E6PH 1NRPH 1GBHA 1DUAA 2FI4E 5J4SA 1GG6C 4BANB 1HAZB 4XBDA 2B7DH 3QN7A 1KSNA 1SQOA 2ZFTA 1AKSA 1O3OA 2A4OA 1C5XB 2GZ7A 1AWFH 2R3YA 3GCTG 3RXCA 4WY3A 1P05A 4WH8A 4YT7H 1D6WA 1GJAB 1SOTA 2VIDA 1N8OB 1Y3UA 2ZGJA 1O2OA 5DP9A 4TPYA 3RXUA 3SJ8A 1LVMA 3PB1E 1FIZA 2FODA 4Y7AA 2J38A 6LPRA 4AB9A 1RD3B 3PMJA 3BG4B 3O8RA 2AMDA 2BLQA 1F0UA 1O35A 2FOHA 4A1TA 2F3CE 4E7RG 2BXUH 5HGGA 2ZZUH 1O31A 2D2DA 1W12U 2ZFFH 3OY6U 4ZROA 3QUMP 1ZJKA 3SV8A 1BTZA 1SLXB 2HPPH 3R0FA 1J17T 2G4UA 5FCRA 3QK1A 1GMCG 3A83A 2FOMB 2WINI 4MNVA 4YOIA 2ZTZA 3PMHB 3PYHA 2BX4A 1ABIH 2ZI2H 2PGBB 4X6PA 5C1UA 3BTWE 3CS0A 2OC7A 3VXFH 2GTBA 2GP9B 1E34B 3RM2H 3A8BA 2ZGHA 4B71A 2GCHF 1GI2A 2XWBI 1MZDA 1SFIA 4ZKSU 2GCTB 1T8MA 3RMNH 1K1PA 3K2UA 3CS7A 1EP6A 3M3VA 5EPYA 3KQDA 1GI8B 1TMTH 1WU1A 2FLBH 4KGAA 3F1SB 3RXOA 1W7GH 1S85A 5A2MH 2W5EA 3RXLA 1D6RA 3ZV9A 5DJ7A 1J14A 3BTGE 1IQJA 2Z9LA 1HRTH 1XX9A 1P3CA 1C5UA 1GDQA 4WMFA 4B74A 1EP5A 4Z0KA 1WTHD 3RXVA 1BUIA 4H42U 2QA9E 3P8GA 1GBLA 1H8IH 2IN2A 1EXFA 5F8TA 1O2KA 1MBMA 2QYIA 2BZAA 3OYPA 2O8TA 2FOGA 3UTUH 1JIMA 1P04A 2UUKB 1TPPA 1TA6A 2XWAA 1LQDB 3EE0B 4F49A 1RGQA 1XMNB 2LNCA 2ZGBH 3E3TA 2EC9H 3RC5A 2BDAA 1C5OH 2PKAA 3OTJE 4RKOB 5T6GA 1O2ZA 1O3NA 3DHKH 1GPZA 2P94A 2SGAA 3RP2A 4FXGH 1DM4B 4CH8B 1CVWH 2ZTYA 1C5SA 1TBQH 4BAKB 5FCKA 2AGIX 1T8OA 3TNSA 5JBCS 4AG1A 1SQTA 1ZMLA 3A86A 1MTNB 5B6OA 5DPAA 1NU7B 1TPOA 1O3HA 4RKJB 4D8NA 1A3BH 4ZH8A 2JETB 1UTLM 4KTSA 4NSVA 5E2OA 1SFQB 1SGNE 1OS8A 5LGOA 1IQIA 3L3TA 2BHGA 1C4U2 1O2LA 2CGAA 4U2WA 3UUZA 4ABBA 3LH3A 3SV7A 2ZEBA 1VJAU 1K2I1 3MH7A 2R9PA 2GT7A 1IQNA 1CT0E 3SUFA 1MKWH 1V2OT 1EJAA 1GBIA 1VCQA 1WSSH 2QXGA 2P3FH 1VR1H 4X1QU 1EOLA 1SOZA 3RXRA 1D3DB 2ZCKP 1DITH 2GT8A 1HDTH 2VIPA 1SLUB 2GMTC 3AAUA 1NFYA 4ABGA 1S5SA 1Y3WA 1GI1A 4XFQA 2TIOA 3RC6A 1FXYA 3ZZ3A 1YPHE 5JB8S 3JZ1B 8ESTE 4BTTB 7LPRA 1FQ3A 1KXDA 1HIAB 1Y5UT 4X8TH 1L1JA 2BD4A 5GJ4B 3T5FH 1CT4E 2ZECA 2Y5GA 1SLWB 2FOFA 3T29A 4K8YA 1AFEH 1FN6A 3SZNA 1AHTH 3NWUA 3UOPA 1B0FA 1O3KA 1P2IA 2VVCA 2VVVA 2VWNA 3SQHE 1H4WA 4H4FA 1WYKA 2ZP0H 2A7CA 4GLYA 3RXQA 4GHQA 3V0XA 1ELBA 1ZZZA 2BD7A 1A0HB 5T3HA 5BRRE 1UCYE 1XUKA 2STBE 3EA8A 1HJAC 4XBCA 1O3FA 2J4IA 2ODYB 1V2LT 3ZV8A 2SGFE 2ALPA 1GI9B 1GJBB 4JZ1A 1DFPA 1EAWA 1MU6B 3A7WA 3A8CA 1CQQA 4VGCB 4A1VA 1HJ8A 1MTVA 1HGTH 1LHDH 1Q31A 4AB8A 1BTUA 2Z7FE 3W94A 1AO5A 4ZXXH 3PMAB 3FVFB 3S7HB 3FP6E 1VITG 1E36B 3EYDA 4FU7A 2NU0E 1HAIH 1TE0A 3BTTE 4NWKA 4JYVH 4ABJA 2VGCB 2P95A 1OX1A 2XCFA 1GVLA 4UE7H 1BCUH 1HAXB 1BRCE 1EATA 4FUDA 1ZPBA 3ZZCA 3ZVGA 4BXSA 2EI8A 1SG8B 3M5LA 1ELVA 1YPMH 4MLFB 4FUEA 1QQUA 1TNJA 3GDVA 2UUFB 3A7ZA 5DP5A 3A85A 1T4VH 4WXIA 4ESTE 1C5WB 2WPLS 2V6NA 1GJ4H 3WY8A 4UFFH 1QURH 4AFZA 3F6UH 1DXWA 4K1TA 4WF8A 2PKSB 1DUEA 1O3DA 1YP9A 4I32A 1BTYA 2BDGA 2ZHDA 2ZIQH 1AE8H 1LO6A 1DS2E 2NU4E 5EOKA 2C8XB 2G8TA 2ZCLP 3DA9B 5IDKA 1IAUA 2GD4B 1PPCE 4LK4A 1DT2A 1NS3A 2NWNA 2R2MB 3RXDA 1SPJA 1F2SE 3C1KA 2AYWA 1QL9A 4J2YB 5C3NA 2XC4A 4AORA 6CHAB 1F0SA 3V13A 2VVUA 2A2XH 3PLBA 5ESTE 1FPCH 3GCHC 1UHBA 3SU4A 1ESBA 1MCTA 5E0HA 1O2JA 1A7SA 1UCYK 3GYMA 2WV4A 3KEEA 4ZXYH 3KQBA 3PM3A 3SI3H 1SL3A 2C3SA 5DP7A 1ETSH 3K9XB 3TNTA 2OBOA 4NIWA 1O0DH 1QA0A 5A09A 4YESB 4FU8A 2HWLB 4TY7A 1DVAH 1KYNA 4Y10E 4NIXA 5C1XA 2NU3E 2XBYA 3T62A 1TQ0B 1Y3XA 3RU4T 2H2ZA 1N6XA 4HI3A 4XBBA 3SHAH 3VGCC 4ABEA 1PPHE 3RMOH 1AQ7A 3RUOA 2CMYA 2VH0A 1ELGA 3SHCH 1XUFA 3PO1C 1G36A 3O8CA 4INKA 1V2ST 3F9GA 3MWIU 3SW2B 1PYTC 3HPTB 3BN9A 4Q7YA 5FPTA 1AY6H 1SLVB 3UWIA 1ELCA 2XXLA 3GDUA 1RIWB 1DX5M 3GY5A 4JCNA 1VJ9U 2O8WA 1OWKA 3Q3YA 1XXFA 4WWYA 1LHCH 1EZQA 1AB9B 3PTBA 2OC8A 1RTFB 4KTUA 2G4TA 1W8BH 2QCYA 1HCGA 3PROA 2CV3A 2FYRA 4I8GA 4O9VA 1AUJA 1K1LA 2ESTE 4LXBH 1F0RA 1UTKA 1V2TT 1DOJA 3Q00A 3SJKA 1A5HA 1LPGB 1F5LA 3D23A 4NFEA 3RM0H 2J34A 3ESTA 1XUIA 4UFEH 1UVSH 2FI3E 5HMAA 3BEIB 4NA9H 1GVZA 4IW4E 3ZZBA 3KF2A 2UWOA 1TWXB 2VINA 4U32A 3S0NA 5A0CA 1SGRE 1DSTA 3PV4A 1K1NA 5TCAA 2CHAC 4MPXA 3M5NA 1Y3VA 1INCA 3N7OA 1C9PA 3TGJE 3PMBB 3MI4A 3SORA 4ZUHA 3SU0A 3LONA 1OWDA 3ATKA 1QB1A 3MFJA 1UTPA 4UFGH 8LPRA 1IQFA 1GI0A 2FEQH 1C4V2 3ZVFA 1ANBA 3B9FH 1L4DA 2XNIA 3SO3A 3URDA 2BVXH 1Z6JH 1BIOA 3MYWA 1ABJH 2H9TH 1A61H 1ZMNA 2GX4A 4OGXA 1HAYB 3HKJB 4R8TB 4JYUH 4KKDA 4ABHA 2BY6X 4K8BA 3W95A 4FUBA 2ZPRA 1SGPE 1N6YA 1O3GA 1QL7A 1GWAA 2DUCA 1V2KT 4ZAEA 3O8BA 4Y79A 1BT7A 1GBBA 3D62A 4BOHA 1GGDC 1PPFE 2ANMH 5JB9S 4Y8YA 5FBEA 2IJOB 1FY4A 1JRTA 1JIRA 1V2QT 1YPKH 4B2CA 4YZUA 3LIWA 1PQAA 4GPGA 4I8KA 1O2YA 1TAWA 1TNLA 4INLA 1QIXB 2ZC9H 2PSYA 2ZU4A 4DVAU 4X0WU 2OTVA 3F9FA 3OY5U 4AFUA 4AZ2B 2F9NA 5CMXH 1KXAA 1SGDE 2J9NA 1C1UH 1C5RA 3SNEA 1KTSB 3A80A 1GHZA 1MKXH 5GPIB 3UNQA 2FPZA 4B76A 3ENSB 1IQMA 3A84A 3ZVCA 1BDAA 1O2GH 2C8ZB 3G01A 1W3CA 2C8WB 1YF4A 3MO6A 2WPJS 1SBWA 1MQ5A 2C4FH 1SGTA 3M5OA 5J4QA 3SJOA 4AGJA 5GXPA 4YO9A 1ZHRA 1SGFG 1C2HA 3I77A 2GV7A 1HNEE 1Y8TA 4UFDH 3ITIA 3M37A 1A2CH 2B0FA 2BOHB 3FZDA 1RS0A 4ASHA 1QFKH 1WUNH 1UK3A 2HGTH 2V35A 4GCHG 1DWBH 2A4RA 1FY5A 2Q6FA 2ZDLA 5LH8A 1C1PA 1D3TB 2FESH 3SGBE 1UJ1A 2B8OH 4E05H 2PR3A 2QAAA 2BLOA 1Z6EA 3LU9B 1S81A 2HOBA 2FS9A 4DOQA 1O3BA 1DY9A 1UVTH 4ISNA 1VITF 2VWLA 2WPMS 4ZHAA 2J94A 3O8DA 4BAOB 2BDHA 1FAXA 1ZHMA 1TBRH 2XCNA 1RFNA 3PLKA 4CHAC 3BIUH 1AWHB 1TYNA 1O2XA 3SUDA 1TGTA 1V2PT 1IQEA 1GBKA 1C5NH 2PV9B 1V2UT 2W7SA 3HGPA 3ZZDA 1KTTB 3UR6A 3OSYA 3FFGA 2XC5A 3TGIE 2G52A 2TBSA 1W13U 3S9BA 1J16A 2WUCA 1GMHG 1ZOMA 3M7QA 1VITH 1ANEA 3V12A 1TPAE 1GHAG 1O34A 4Q2KA 5LPFA 1CGHA 1J9CH 3ZZ5A 1WTGH 3A87A 2JH6D 1P02A 1JXPA 1L0ZA 1QCPA 1BITA 5C20A 4X8VH 1NY22 2R0KA 3QZQA 5F8XA 4AN7A 3PLPA 1HAVB 2F83A 4TWYA 5EU8A 1TMBH 1E37B 2OD3B 4SGBE 4MDSA 2ZCHP 4X6MA 3BTDE 4E7NA 3TITA 2BQ6B 1ZLRA 3MO9A 1W14U 2BXTH 4IN1A 5A8ZA 1O3AA 1D9IA 2FX6A 1CU1A 1EZSC 1B7XB 2ZF0H 1DWEH 4D7FA 1HXEH 4JZIA 3B23B 4IMZA 2OUAA 5F03A 1E38B 3BTME 4WVPE 3Q76A 1ARCA 1HXFH 2P93A 1P8VC 2WPKS 4CRGA 1CA8B 1SMFE 3UY9A 1F5RA 1PQ5A 1XUJA 3UNRA 2ALVA 1C2FA 2UUJB 1ETTH 4XSKU 2EI7A 3DUXH 1W2KH 1AVGH 1FONA 4WMDA 1C4Y2 1KLTA 1HAPH 1EPTB 4JMYA 1Y5BT 1KXEA 3TGKE 3S69A 1YPLH 1XVMA 5ESBA 1D3PB 4IC6A 1TBZH 1UMAH 1ZRBA 3GYLB 1IQHA 3M3SA 4FUHA 1DANH 1C1VH 3PWCA 4A6LA 5DGJA 2VB0A 3TJOA 3P17H 1PPGE 4HFPB 2BQ7B 4KTCA 3E1XB 1FAKH 2P16A 2UUYA 1HAHH 1H1BA 1O3CA 3MU5A 1TX8A 1GCTB 1FV9A 3M61U 3URCA 1SGQE 2HALA 4FVDA 1K28D 1DSUA 2VJ1A 1GJ6A 1O5AB 4D7GA 3B8JA 4X2YA 4D76A 1C1NA 2V3OH 4U01A 1CBWB 2XBWA 1C2GA 1GHBG 3BV9B 3BTEE 2NU2E 1MQ6A 3D65E 1TALA 2A7JA 1TFXA 4I33A 4ZKNU 5L30H 4J1YA 1HAOH 1BRBE 1NTPA 1TGBA 2A4QA 3LGTA 2A5KA 2XRCA 4YLUA 5PTPA 2ZDAH 1V2MT 1H9LB 1D4PB 1ZSLA 4ABFA 1L4ZA 4I31A 1FZZA 3SU3A 1DLKB 1P9UA 4AFSA 3TLOA