1OP0A

Crystal structure of aav-sp-i, a glycosylated snake venom serine proteinase from agkistrodon acutus
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
234
Chain Sequence
VIGGNECDINEHRFLVAFFNTTGFFCGGTLINPEWVVTAAHCDSTDFQMQLGVHSKKVLNEDEQTRNPKEKFICPNKNNNEVLDKDIMLIKLDKPISNSKHIAPLSLPSSPPSVGSVCRIMGWGSITPVKETFPDVPYCANINLLDHAVCQAGYPELLAEYRTLCAGIVQGGKDTCGGDSGGPLICNGQFQGIVSYGAHPCGQGPKPGIYTNVFDYTDWIQRNIAGNTDATCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures and Amidolytic Activities of Two Glycosylated Snake Venom Serine Proteinases
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Venom serine proteinase
total genus 60
structure length 234
sequence length 234
ec nomenclature ec 3.4.21.-:
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op0A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op0A02
3A7WA 3D62A 4HFPB 2BVRH 3E6PH 3ZZ3A 3MU8A 1ABIH 8KME2 3LPRA 1TE0A 3RXIA 2FTMA 5FPSA 1IQGA 1ORFA 3K6YA 1GI4A 4Q80A 4WF8A 1P2OA 3DFLA 2BDAA 2ZQ1A 2QXGA 1G9IE 1O2VA 4Y79A 1G3DA 1NFYA 3EA7A 4D76A 1A3EH 1GJ8B 1C2KA 1K1OA 2FESH 1W2KH 3NPSA 1JOUB 1Z8GA 1FQ3A 1BRBE 2GT8A 3ZYDA 2VIOA 1ZGVA 2PGBB 1LHDH 1GBBA 3QGNB 2M5TA 4XDEA 4IN2A 3ATIA 1EB2A 1VITH 1BIOA 1NU9A 1ZRKA 4WJG2 3MNXA 2CXVA 1AHTH 1TGCA 4OGXA 3MO3A 2ZC9H 5FCKA 1MZAA 3C1KA 1BBRK 1PJPA 4CBNA 3SN8A 2G52A 5I46H 3BV9B 2ZGCA 2Z7FE 4Y10E 3ZZDA 3OYPA 3PROA 3PTBA 4MNWA 1O39A 2P3FH 3SU3A 2D2DA 3VXFH 1O3LA 3BEUA 2ZDLA 1EATA 1PPBH 1UK3A 5PTPA 1QBNA 4AB8A 1UHBA 4DURA 4UDWH 1SVPA 5JBCS 1GHZA 4NFFA 2EA3A 2BQ7B 1SMFE 2XCNA 3EGKH 1P2KA 2AMQA 3SW2B 2VH0A 1PPFE 1WAYB 2P59A 1ZHRA 2AEIH 2ANMH 1IHTH 2STBE 1YPJH 4X0WU 3GCTF 3TJOA 2FOAA 1FAXA 5C67A 2TGDA 4DJZB 1MKXH 2QYIA 4DCDA 1T8OA 2ZDKA 4H42U 2BZAA 2BY8X 1P9SA 3LH1A 1P03A 3T28A 3RXAA 3A8DA 1S0QA 1UTMA 3EA8A 1SLUB 3HGNA 2ODYB 3L3TA 1A4WH 1V2PT 4BANB 2B0FA 3SJOA 1THRH 4FVBA 1C4Y2 1HUTH 4D8NA 1EAUA 3QLPH 1ZJDA 1C2EA 4NIYA 3MU5A 2C93B 3UWIA 3A8BA 4X1PU 2V35A 4TYDA 3AAUA 4ZKNU 1ESBA 2ODQA 1O3JA 1UCYE 2FOGA 1T8LA 1OP8A 1DICA 1Q31A 5ETXA 3H7TA 2H2ZA 4NIWA 4XOJA 3S9CA 4FUDA 1BT7A 2FM2A 2GMTB 2H9TH 1OOKB 1HYLA 2FI4E 1K1PA 1JIMA 1S83A 1MAYA 2ZI2H 3E8LA 4U01A 1GMCF 2GMTC 1C5PA 2XYAA 3FANA 4Y8XA 4JZ1A 1JIRA 1P11E 5FPYA 1LVBA 2UUJB 3ENSB 2PV9B 3RXHA 4Z6AH 3VPKA 2Y5FA 2OINA 4YLUA 3S7KB 5F8XA 1LHGH 3QN7A 4YOGA 1RXPA 5ESBA 1B7XB 1K1LA 1EZSC 3EE0B 2BXTH 1O2WA 1HJ9A 5DK1A 3RMNH 3TIUA 4KKDA 1AFQB 2QC2A 2WPIS 2FODA 4LZ4B 3ZZ7A 2J92A 1ELBA 1FNIA 1GMDG 1TMBH 2FOFA 3K2UA 1BTPA 1OS8A 4X2XA 1C9PA 4OS5A 3CP7A 5EQQA 1QB6A 4YOIA 1IHSH 4JZIA 2XWAA 2A45B 1BTUA 3CS7A 4I8JA 1A2CH 5GPIB 1J14A 2I6SA 1GJ4H 1MU8B 1SQAA 1LCYA 2A7CA 2ZFFH 4IN1A 3SJ8A 3SGQE 1Z8RA 3STJA 2EI7A 4M7GA 1BTZA 1RTKA 1EKBB 4IMQA 1QA7A 1Y3UA 1ANEA 2AMPA 1JWTA 2A4RA 2Z9LA 2EC9H 2GX4A 2KAIA 1O5BB 3RXKA 3TJVA 1YPMH 4ISLA 1KTSB 1NPMA 1TRYA 1E36B 4THNH 1EPTC 1NFUA 3ITIA 4I8KA 1AFQC 1OXGA 1YP9A 1GGDB 4WWYA 2FDAA 4A7IB 3LC5A 3MWIU 1V2JT 1Z1JA 3F9HA 1XUGA 3GDUA 4F4OC 4FUJA 2CHAB 5AHGH 1SGTA 3RP2A 1QRZA 1RIWB 1SI5H 1AY6H 1TA2A 2FOCA 4WMEA 8ESTE 3P8GA 1SGFG 1AFEH 1OWEA 1A5HA 2Y7ZA 4A1TA 1CU1A 2PW8H 1V2RT 1ZHPA 3RXDA 1O2NA 3SI3H 1XXFA 1ELEE 3HKJB 3M61U 1ELCA 3HKIB 4CHAB 1GHXH 3HATH 5HMAA 4H4FA 1E37B 2C8YB 2BDYA 1QQUA 4MPWA 3V3MA 4Y7BA 1TNIA 2J94A 4JMYA 2BQWB 2OLGA 2TGPZ 2ZTZA 3PMJA 2FI5E 4WY3A 6CHAB 4K5ZA 4H6TA 4YLQH 4E7NA 1FAKH 1O3BA 4X6PA 1BHXF 1YPGH 2STAE 2R3UA 1O2ZA 2FO9A 4ABEA 3F9EA 2WUBA 2CHAC 1QL9A 1KTTB 2ULLA 2JH0D 4TPYA 3U8TH 1HAXB 1TWXB 2FPZA 2QY0B 3LJOA 4NSYA 1DVAH 5E0GA 1KYNA 3M3TA 1V2LT 1O3EA 1XKBC 1ZZZA 3A8CA 4U2WA 1O31A 2HPPH 1O32A 4OS4A 1EP6A 2BLWA 1TFXA 1C2GA 1GI3A 5EPYA 3RXLA 1F0RA 1GI8B 5AFYH 1XKAC 2AGEX 3O8CA 1HAHH 3OTJE 4ABHA 1J17T 3U98H 1S81A 1GL0E 4BAOB 2K1QA 3STIA 1GG6B 3BIVH 1BBRH 2CJIA 3KNXA 1MQ5A 2QXIA 4AFUA 6CHAC 4UFEH 4B2BA 1PQAA 1G2MA 1C2IA 3KHVA 4BAKB 5E2OA 1JBUH 3TU7H 1GHAG 1P2MA 1GI7B 1P12E 1EPTA 2I6QA 3ATKA 1Q3XA 3KQDA 1BRCE 3QGJA 4I8LA 1HXEH 1O3KA 2ZU4A 1ZMNA 1TX8A 1IQNA 2H6MA 2F91A 1AVGH 2A0QB 1GBLA 1NM6A 2A5AA 5C3NA 2V0BA 3GCTG 5EU8A 1TRNA 1F5LA 3DD2H 2HNTF 2ZECA 3UY9A 1CGIE 4Y0YE 1GJ5H 1MTUA 2FOBA 1GBCA 1PQ8A 2O9QA 1P8VC 3A83A 2RDLA 1AGJA 2VWOA 1Z8IB 1NROH 3GISB 1EP5A 5GXPA 1BOQA 3GCHB 1P05A 3LGWA 1Z1IA 3EA9A 1HAOH 2ZFRH 3BN9A 3BTKE 2D26C 3ZVEA 2NU3E 1AUJA 4HGCA 4A5TS 1EAIA 1MTVA 1ZLRA 3TK9A 1NRPH 1TX6A 2Z9JA 5EGMA 2QF0A 4X2WA 1OP0A 3TH2H 1HIAB 4FUGA 3ZYEA 4ABGA 2A7HA 1G3EA 2O8MA 1HXFH 2VH6A 1DWBH 1TPSA 1GHVH 1UJ1A 3RXQA 1JXPA 3MOCA 2SNVA 5C2ZA 3GCOA 3Q00A 4X8UH 3GY5A 3URDA 1AB9B 3QUMP 5EODA 2FS8A 2ALPA 1L1JA 1GMCG 1KDQA 3QTVH 1XVOA 2OC7A 4B2AA 1HNEE 1H8DH 1SPJA 2G4TA 1NRNH 2CN0H 2TGTA 3P8OA 1W8BH 1YCPH 2B5TB 3GY2A 1OWHA 1ETRH 4AFZA 1C5MD 1BMLA 4DG4A 3T5FH 1GL1A 4Q2KA 4DVAU 1TB6H 1ANDA 2BX3A 3MU4A 2G5NA 4IW4E 1W14U 1RS0A 1TNHA 1ZSKA 5L30H 3E1XB 2GCHF 1BQYA 1SQOA 2VVUA 2ODPA 3L33A 4AX9H 2VVCA 1RTFB 1QJ1B 3JZ2B 1DLKB 3BTHE 1FLEE 1GHWH 2FXRA 1Y8TA 2B8OH 3CS0A 2EI8A 1F0SA 1JRSA 4JYUH 1O3NA 1MKWK 1DPOA 3A81A 1Z7KA 2A32A 1IQLA 3SUDA 2AFQB 1UVUH 2ASUB 1ZTKA 1TX7A 5CHAB 1P57B 2A7JA 1BBRE 1KY9A 2TPIZ 3ZVBA 3RXCA 2R9PA 1H4WA 2BDHA 2JKHA 1PQ5A 2F9NA 2Z94A 8GCHF 3LGUA 4AG1A 3BTQE 4X6MA 3SNCA 1KLIH 4GHTA 2HOBA 2XC5A 2G81E 3TLOA 1TBZH 2O8TA 2ZF0H 1YLCA 2YOLA 4B71A 5C20A 2QXJA 4NIVA 3SV6A 4A1XA 3GY4A 4ZHAA 1L0ZA 2G55A 1C1NA 2R2WU 1SLVB 2PKSC 3BTDE 3LC3A 3ZVFA 4GVUA 2IPHA 1ZMJA 2THFB 1QIXB 3PWCA 3B8JA 3LIWA 3M37A 1S0RA 5JDUB 1AMHA 2BDCA 5E0HA 4JK6A 1HB0B 3DFJA 5LGOA 1NESE 2SGAA 2P3UB 3PMHB 2AIQA 3UPEA 1SGQE 1P2NA 3E90B 1GDUA 2HPQH 4B75A 1S6HA 3UOPA 3RMMH 1WUNH 1O37A 1H9HE 3SGAE 1IOEA 1LHEH 4X8VH 2AH4X 1MU6B 3FP7E 1HAGE 2OXSA 2ZWLH 1BZXE 1YCPK 1DANH 2BHGA 4Z0KA 1C5SA 4OS6A 2PKAA 5DP6A 2RCEA 1O3FA 1FJSA 4TPIZ 1CHOF 3TPIZ 5EW2H 1UTKA 2AMDA 1ARCA 3SU0A 1U6QA 4K3JA 2SGDE 1CBWC 4XBDA 1ETSH 2J4IA 3W94A 4X1RU 2SGEE 1P04A 2EEKA 1DY8A 2HNTC 5L2ZH 1UVTH 3FZDA 1GJAB 3U1IB 3RXSA 7GCHF 4I33A 3TH3H 3TNSA 4O3TA 1OKXA 2QGRA 3RXTA 1DDJA 1EUFA 5T3HA 3MH6A 3SBKA 1VCWA 1MTSA 1UMAH 3SV2H 2FIRH 1ELVA 3SUFA 4NSVA 1BTHH 5FX6A 2WPLS 1TNJA 1MCTA 4UEHH 3T25A 4FU8A 5HM2A 1ZGIA 1HAZB 1HAVA 5CE1A 1K22H 4R8TB 1CT4E 1C2DA 2TRMA 1H8IH 2C8XB 1ELTA 4BAHB 2FOMB 3ZZ4A 4IBLH 3H5CB 3KN2A 5EW1H 4UE7H 1SGNE 2C3SA 2PUQH 3SJIA 1KXEA 3P8NA 5HGGA 2VVVA 2G00A 3RXJA 2A4QA 1O5EH 1O2QA 1Z6JH 5K7RA 1C5TA 3NK8A 4K1TA 3ZZBA 4X8TH 2Q1JA 1M9UA 4MPUA 4X1NU 1ZRBA 4AGKA 1O3AA 2VIWA 1C5QA 3ZVAA 4Q7YA 3Q77A 3RXVA 3TGIE 4FUBA 4GHQA 5J4QA 2BYAX 1HJ8A 1Y5AT 2RG3A 4WXVA 3R0FA 1UTNA 2R2MB 1CHOG 1QB1A 4K8BA 2BY6X 2ZU3A 4ISOA 2NU1E 3RU4T 1FI8A 4XBCA 5ABWA 1ZOMA 4NA7A 3WY8A 1P01A 4OS1A 4X2VA 1A5IA 1NT1A 1V6DA 2BTCE 4J2YB 5HYOA 7GCHG 1HPGA 4AFSA 5JBAS 1GJDB 1SHHB 2GKVE 3KCGH 5TCCA 4FUEA 4FUIA 1PQ7A 2W7UA 4ABAA 3QWCH 2WV5A 1TBQH 2PWXA 3MNBA 1GVKB 2ZO3H 3UREA 2SGQE 4ABJA 1OYQA 1C2JA 1O2UA 4CREA 1Y59T 5DP5A 1HAPH 3UTUH 4K2YA 3A7TA 4NIXA 1P09A 1Y3XA 3SUEA 1CBWB 4ISIH 1J16A 1MZDA 2BD3A 3M7QA 5FBEA 3K65B 4IGDA 4TY7A 4LOYH 1VR1H 3MU1A 8LPRA 1C1UH 1T7CA 1K21H 2FLRH 2BDIA 2VWLA 3M5OA 3DT0H 3HK6B 2XBVA 2Y81A 4U30A 2FX4A 1AVWA 1AB9C 1D3QB 3T2NA 2UUYA 4WMFA 1AUTC 1FIZA 2QAAA 3P8FA 1ESTA 5AF9H 1C1PA 1ZTLA 1W11U 2GTBA 3Q3XA 3DHKH 1TGTA 1RFNA 1HRTH 3LGVA 1KDQB 2IJOB 5C1YA 2BY5X 3D65E 4NWLA 4JCNA 2P16A 2G51A 4GCHG 5C5OA 4O97A 4X1QU 1S82A 2VINA 4ZXXH 5C5NA 1O30A 5A2MH 4ABFA 3KGPA 5EXNA 4H6SB 1GI1A 2FYRA 1HDTH 3A89A 1SQTA 3BTGE 1UTOA 2F9BH 1GBJA 1ZPBA 4Y7AA 4NFEA 4E7RG 3LJJA 4Y8ZA 5GDSH 2G5VA 3LONA 1ELAA 3VB4A 1AKSA 1XUIA 1DM4B 4B1TA 5L6NH 3CENA 2TBSA 1C1WH 2AERH 3MFJA 5LPFA 1Y5BT 2BLVA 3MYWA 1GPZA 4BTUB 1IQMA 5FPTA 3E3TA 2ZFQH 3FVFB 1TQ7B 4Y0ZE 1A46H 1IAUA 3AW1A 4UFFH 1QGFA 2ZG0H 3LGYA 3PWBA 3DUXH 2J9NA 3BF6H 3IITA 3GY6A 3TVJB 1DFPA 3PMBB 1CA8B 1P2QA 1F2SE 2BZ6H 3L6PA 1SGDE 4YTAA 5BPEA 2Z3CA 2ZA5A 3KIDU 2F83A 1TONA 3RMLH 4BTTB 1OYTH 1QTFA 1FV9A 1W7GH 3I78A 2PSYA 2HLCA 1ZJKA 1V2TT 3MMGA 4NCYA 4SGBE 1LDTT 1FY1A 5GWZA 1C1VH 1QB9A 1V2VT 3GICB 3TJUA 2PKSB 5A8XA 2ZKSA 1SLWB 2PLXA 5J4SA 1TNLA 2ZFSA 3A7YA 5ESTE 1UVPA 1TABE 4DY7B 1OPHB 3C27B 4AGJA 1SOZA 1FUJA 2CMYA 2BB4A 3BG4C 1RD3B 2PUXB 1MUEB 3RLYH 1L4DA 1Y3VA 1HJAB 1AVXA 2Q6DA 2ZGHA 4MTBA 3ZV8A 2KAIB 1TALA 2EI6A 1VJAU 2FX6A 2H9EH 3BEIB 2H1UA 2R0LA 2XTTB 1OX1A 1GHBG 1OWKA 4TY6A 4LZ1H 2BVXH 3RXRA 1EZUC 3K6ZA 5E2PA 1TBRH 2ZQ2A 3E91A 1KLTA 3VB6A 1GDQA 1KXAA 1KIGH 2R3YA 4YESB 4CRBA 1NRQH 3RXOA 2ZP0H 4BAMB 3OY5U 2QCYA 2FS9A 4R0IA 1GBHA 3LH3A 2CV3A 2WPMS 2FMJA 4IC5A 1C5OH 1TYNA 4UD9H 4YOJA 3NKKA 1KXBA 2IOTA 3VFEA 1D6WA 2BD5A 3RC4A 4WH8A 3SGBE 3BG4B 2OBQA 1G3CA 1J15A 5JYIA 4ABIA 2F9OA 2F9UA 1XUFA 4K69A 3UWJH 1GMHG 2GV7A 4FUHA 2PKAB 4KTSA 5GIBA 4KGAA 4KTCA 3TITA 4CR5A 1MD8A 3ZZ6A 2XWBI 1AE8H 3N7OA 3JZ1B 1TLDA 1O38A 2DE9A 4X8SH 3M3SA 3TGKE 2ZHFH 1F92A 1A3BH 1TOMH 3OY6U 4O9VA 1VZQH 3GYMA 5C1XA 2GZ8A 2ZNKH 2ZU5A 2ALVA 3RU4E 1TMTH 1MCVA 1AI8H 4ZKOU 3PYHA 5IDKA 3LDXH 2FP7B 1DX5M 1K2I1 2NU2E 2Z9IA 3B23B 2ANYA 2ZGBH 3AAVA 2VB0A 1FY8E 2A31A 5GCHG 4B74A 1QHRB 3GY8A 5LPRA 3P92A 1H1BA 4B73A 1TA6A 1LTOA 4UONA 2WUCA 1VCPA 2B7DH 1DWDH 3W95A 1GCDA 1QBVH 1EJMA 3FFGA 2OC1A 2SGPE 1UCYH 1SC8U 3F1SB 3IWMA 4D7GA 2A4OA 2ZCKP 3NUMA 4ZKRU 3ATLA 1LVMA 1IQEA 1UTJA 1DSUA 3ELAH 3MU0A 3VB7A 1G36A 1G37A 1HFDA 4Y76A 4JZDH 2GCHG 2P3TB 2GCTC 1C5UA 4ZHLU 1FY4A 1BJVA 4I32A 1Z71A 4IMZA 2UUFB 4Y71A 3Q3KA 3OU0A 1O2GH 1O2RA 2QA9E 1S6FA 2ZPSA 1O2TA 1PPHE 2FTLE 1YGCH 1LPGB 1UTLM 2W26A 1OWJA 2AGGX 1BCUH 1YBWA 2A5KA 1RGQA 1AN1E 1NFXA 2ZHDA 3T26A 5JB9S 2Z3DA 3MH7A 1GBDA 3M36A 2C8ZB 3M5NA 3RC6A 2BD4A 4YO9A 5IYTA 3VGCC 4I8HA 3R3GB 1T8MA 4DIHH 4NWKA 1TGNA 5F8ZA 2BY7X 3RXPA 4FXGH 2GCTB 1GGDC 3S9BA 9LPRA 4XE4A 2P8OB 3VB3A 2FZZA 2AS9A 2PFEA 2VIVA 1QRXA 1W7XH 2NWNA 1G30B 1DSTA 1GBAA 1JMOH 2A2XH 5DPAA 1BMAA 1WV7H 1TPAE 3BG8A 3SOSA 2JH6D 2GZ7A 4CRGA 1CGHA 3LT3A 2OTVA 1IQHA 3M35A 1FDPA 1O33A 1DOJA 1LVYA 2GDDA 3PB1E 4DIIH 3PM3A 4D9RA 4QT8C 1FY5A 1UVSH 4MPVA 2BQ6B 2XBWA 1BMMH 2ZZUH 3SNAA 1BA8B 1N8OC 1HAYB 1VGCC 2C4FH 3OSYA 4RKOB 4BAQB 3UNQA 3MI4A 2ZDAH 1LHFH 1WBGB 3OX7U 1C1QA 1C5ZB 1SGFA 1A0LA 2NU0E 1TNGA 3VB5A 1NS3A 2UWLA 4WMDA 3GY7A 1C4V2 4O03A 1VJ9U 1PFXC 4KELA 1CA0B 3M3VA 2XBXA 4FU7A 1KXDA 1QNJA 1UK2A 2BY9X 1DT2A 1G32B 1P9UA 1ZSJA 3RMOH 4ZH8A 1EOJA 1G2LA 3SQHE 1AQ7A 4A6LA 2PGQB 1OWDA 1YPHC 1LQEA 3LOXA 1EQ9A 1O2SA 2XRCA 2ZU1A 5T6FA 1GJ9B 2TIOA 1MH0A 3KQEA 2OD3B 1N8OB 1VGCB 2Y5HA 2O8UA 4E06H 1GJ6A 1YYY1 1AZ8A 1UTQA 1V2NT 2BOKA 1A61H 5F6MA 1D9IA 2FOHA 1QL7A 2Y82A 2BLQA 4NZLA 3EYDA 3MO6A 2GT7A 2C90B 3I77A 1HCGA 1NO9H 1GJ7B 5E8EH 4YZUA 1PYTD 2Y7XA 1CHGA 1C5RA 2GV6A 1FPCH 1GBIA 3BTWE 1ZPZA 3GDSA 1ABJH 3F9FA 7LPRA 4PROA 4O3UA 2ZHEH 2F3CE 3QX5H 4A1VA 3PLBA 1BTWA 3MTYA 4OS2A 4FU9A 1QY6A 2FEQH 3GOVB 3ATMA 1GJCB 1P2IA 4ESTE 3A87A 4MPXA 4IS5A 1EASA 3VEQB 3ZZ9A 1QRWA 1BJUA 1SR5C 1O3OA 1V2ST 3HK3B 2Z9KA 1QCPA 4TWYA 3SU6A 1BRAA 1O2LA 2GD4B 3M5LA 1THSH 1O5CB 1IQKA 4Q7XA 1MMJN 1TMUH 4X1SU 1SFIA 1GCTC 1THPB 1RJXB 5C1UA 1EX3A 5JPMH 3SI4H 1WQSA 1BDAA 1O34A 2OQ5A 2QIQA 3SV7A 3SORA 1V2WT 3GCHC 2ILNA 2W3KA 4Y6DA 1ZR0A 2OP9A 3SU1A 1ZSLA 4XBBA 1KSNA 4CH8B 2ZGXH 1BUIA 5TJXA 2BD7A 1E34B 1UK4A 3NXPA 5F8TA 3SNDA 1O3HA 5FBIA 2V3OH 5A0BA 2WPJS 4FVDA 1O3GA 3ESTA 3UR6A 4AOQA 4RN6A 5A0AE 1YLDA 3S69A 3DA9B 1MBQA 1D3TB 4JZEH 4X2YA 3U9AH 5EG4A 1TRMA 1B0FA 1CVWH 3NZIA 3U8RH 2WYJA 2BOHB 1OWIA 1QR3E 1O3CA 1WQVH 1HV7A 1XXDA 1F5KU 3SNEA 1V2QT 2J38A 6LPRA 1QL8A 1WTGH 5K0HA 1LPKB 1OP2A 1C5YB 1LKBA 1O36A 1SGCA 3KQBA 1T32A 4BXWA 1D4PB 2BDBA 1IQFA 1C5XB 1GMDF 1A0JA 5CMXH 3D49H 1UO6A 3V13A 1UCYK 3PO1B 1C2MA 1WYKA 1N1LA 1G3BA 4AB9A 1NC6A 1SB1H 2ZEBA 1GDNA 4WXIA 2NU4E 2ESTE 4BTIB 1NZQH 1TNKA 1FXYA 2P8OC 3SU2A 1LHCH 1MKWH 4MNXA 2D1JA 3S0NA 1DE7H 2ZHQH 1FMGA 1S84A 2Y5GA 3FZZA 3GCNA 3PLPA 3SU4A 1PPZA 4VGCC 1SBWA 3EAJA 1L2EA 1Q2WA 1K1IA 2XC0A 3UIRA 1E0FD 4ABBA 1O2YA 5HXFA 1FN8A 1BMNH 1EB1H 1TGBA 1XUHA 3T29A 1QJ6B 2WPHS 4MVNA 1MTNC 1O5FH 1LPZB 2J34A 1C1TA 3FAOA 1W0YH 3V7TA 2AIPA 3ZVDA 3F68H 1MBMA 3ZZ8A 1K28D 3RXGA 1MKXK 2A2QH 5A8YA 1L4ZA 3ODDA 5AVDA 2Q6FA 1UHBB 3E0NB 1FZZA 3HGPA 2SFAA 1C1RA 1WOFA 5HM9A 1AO5A 4MNVA 1E38B 7ESTE 5GCHF 4BNRA 3TK6A 4K1SA 3RM2H 3QDZB 1CSOE 1O3MA 2R0KA 1GHAF 1P3EA 4ABDA 2RA3A 5BRRE 1GBKA 2FLBH 2V3HH 3GDVA 4K1EA 6GCHF 4BXSA 2YNBA 2XC4A 2P93A 1D3PB 4KP0A 2P94A 4DOQA 2ZDMA 2F9VA 4AG2A 2W7SA 3RXUA 1A0HB 1Z6EA 1C1SA 4E05H 2W5EA 1FIWA 1YPKH 2BMGB 3I29A 2HGTH 3SQEE 5DP8A 3B9FH 3SHCH 4CR9A 1SGYE 3ZV9A 5FAHA 1CQQA 3GY3A 5AFZH 4DW2U 6GCHG 1W3CA 4GUXA 3E0PB 1AU8A 3AVZA 5B6OA 1ZYOA 1VCQA 2SGFE 2D8WA 4HTCH 4I7YH 2YNAA 1GI0A 5DG6A 9ESTA 2Y6TA 1Y3YA 4U32A 1W13U 2XW9A 1DWCH 1ELFA 1EOLA 1ID5H 5FX5A 2BX4A 2VWMA 1K9OE 1GI5A 5DP4A 3FP6E 3T27A 3UNRA 1RRKA 1WU1A 1AWFH 1GHYH 2VIPA 2BLOA 4ASHA 1B0EA 1FN6A 5DGJA 3TK5A 4B76A 1C4U2 1Z8JB 1C9TA 1LVOA 5T6DA 1O2JA 4ZUHA 1IQJA 1MTWA 1V2KT 2BD9A 1KLJH 2QV1A 3RM0H 2BDGA 3IG6B 2XCFA 3A85A 2DE8A 3A7VA 3UR9A 2ZDVH 2BM2A 3RU4D 3V0XA 2LPRA 4CHAC 1SHYA 5DP7A 2WPKS 3ZZCA 1EXFA 5EXLA 1YC0A 3PV4A 4JYTA 1YKTA 1O2PA 1C2LA 1O2KA 1V2MT 2CGAA 2HNTE 1SG8B 1BITA 1P06A 1WSSH 2UWPA 1AD8H 1NU7B 1P0SH 1AIXH 3KF2A 1O3DA 4OGYA 4RKJB 1GVZA 3SZNA 3UQVA 5H4IB 1O3PB 3G01A 2CF8H 3PLKA 4UFDH 5SGAE 5G4BA 1E35B 1O5GH 2OUAA 1O2OA 1T8NA 2HALA 3Q3YA 4Y8YA 4X6NA 3P95A 1K1MA 2ZDNA 1SFQB 1O5AB 4AFQA 2PTNA 1FONA 3TGJE 1EAWA 1PYTC 1D6RA 1J9CH 1B5GH 1LMWB 1ARBA 1GBEA 1QURH 2VNTA 1C2FA 2QF3A 1W10U 3F9GA 2ZTXA 3AASA 3HPTB 4GAWA 4JYVH 3AW0A 4GPGA 2XNIA 2UUKB 1K1JA 2WV4A 3SUGA 5LH8A 1CE5A 2FOEA 1O2MA 2SNWA 1O2IA 1NRSH 2ZIQH 4JK5A 2HRVA 2AYWA 3A80A 4I31A 1TGSZ 4ZROA 1BHXB 1SLXB 5A09A 1D3DB 3PO1C 3Q76A 1QA0A 1PPGE 4NG9H 4B2CA 4AORA 2PR3A 3LKWA 1HAIH 1EZXC 1ETTH 5A8ZA 1P2JA 2UWOA 1Y3WA 4A92A 1GMHF 1O2HA 1TPPA 2XBYA 4FUFA 1AZZA 3SU5A 2ZCHP 1T31A 2OC0A 3ZZAA 1DLEA 4MLFB 5DJ7A 1GI6A 3BTFE 4INHA 1O5DH 3A84A 1TPOA 5DP3A 2PSXA 2ZGJA 4ZKSU 4YT7H 2ZFPH 2Z9GA 1P10A 2P95A 1YPLH 1ELDE 2H5CA 3QTOH 4CBOA 5L2YH 4J1YA 3M7TA 5CHAC 3SO3A 1KXFA 1XX9A 4HI3A 1QJ7B 2F9PA 2OC8A 3MNSA 3SV9A 1QBOA 3TNTA 4I8GA 4HZHA 2H9HA 1DUAA 1H9LB 1C5WB 1UVOA 3ZVCA 3BTME 4INLA 1O0DH 3UFAA 1W0ZU 2ZHWH 4MG3A 1GBFA 1AWHB 1BTXA 1S85A 2JETB 1SSXA 1Y5UT 4NA9H 1QQ4A 4Q7ZA 3MNCA 3SHAH 2J2UA 5JB8S 1T4VH 2OCVB 2ZPRA 3UUZA 4CRDA 1XM1A 4DT7B 3RXFA 5EQSA 2Q6GA 3P70B 1GHBF 1P02A 1CO7E 1DY9A 1DS2E 4D7FA 2VIQA 2GGVB 1DXWA 1V2UT 3MO9A 3SV8A 1RIWC 1ANCA 4ZAEA 5LPEA 2C8WB 4ZHMU 2IN2A 2ZTYA 1SGIB 1SGEE 1W12U 1XUKA 1GBMA 1BRUP 2LNCA 4WH6A 4UFGH 1CA0C 3D23A 3LGTA 1MTNB 1ZHMA 3VGCB 3S9AA 1RTLA 2ANWA 1LKAA 3NWUA 3RLWH 3KL6A 4NZQA 4F49A 3O8BA 4AZ2B 1GG6C 4VGCB 2WINI 5A0CA 1YPHE 2G4UA 4FUCA 2A1DB 3NCLA 1VITG 2JETC 5E0JA 1CGJE 1K1NA 3SNBA 5TCAA 2CF9H 4AYVB 5I25A 1V2OT 3A82A 1MQ6A 4WVPE 3RXEA 1P3CA 4GLYA 1YPEH 4CH2B 1GJBB 2G8TA 1GI9B 5JBTA 2ZCLP 2GVFA 3SJ9A 5EXMA 1WTHD 2PTCE 2B9LA 2VGCC 2PHBA 5F03A 1SGPE 2J95A 4CRAA 3P6ZB 1DUEA 3A86A 2W3IA 2Z3EA 1C1OA 1ELGA 1S5SA 4MNYA 3MH5A 1GVLA 4ZMAH 1DXPA 4LXBH 3UQOA 1C5LH 4SGAE 4BOHA 1GBTA 1ZPCA 4OS7A 5DP9A 8GCHG 3EDXB 1O35A 2GP9B 2AGIX 3UOUA 4LK4A 4Y11E 1NTPA 1PPEE 1C5VA 2GDEH 4INKA 1OSSA 2ZPQA 3PMAB 1NFWA 3V12A 1C2HA 4AYYB 2GZ9A 1TAWA 2XXLA 4XSKU 3EQ0H 1O2XA 2BD8A 3TH4H 1J8AA 1F7ZA 4XFQA 3BSQA 2V6NA 1HJAC 1ZTJA 2Z6BD 4CRFA 1DWEH 2VJ1A 1XMNB 2OBOA 3BEFB 5GJ4B 2A4GA 2ANKH 1YCPM 2O8WA 1C5NH 1GI2A 1AE5A 1EZQA 3A88A 3RC5A 1SOTA 1IQIA 1HLTH 3MH4A 1YM0A 2ZU2A 3BIUH 3O8RA 1ANBA 1SGRE 3K9XB 1PPCE 3ZVGA 2RA0A 1MD7A 2QN5T 1GWAA 1MAXA 2Y80A 1GCTB 1QFKH 4JZFH 3H7OA 1L1GA 1ZMLA 3MHWU 1F0UA 5T6GA 6ESTA 1LQDB 3LGIA 2VIDA 4K60A 3RDZA 1TQ0B 1ESAA 3S7HB 1A7SA 2BXUH 3URCA 4YT6H 1HIAA 1A5GH 3FP8E 3ODFA 7KMEH 2WYGA 2OQUA 1BB0B 5DKMA 3U8OH 3A7ZA 3BTTE 3P17H 1HBTH 4RSPA 5DO4H 1TIOA 1HGTH 4K8YA 4MDSA 3F6UH 1EPTB 1A1RA 4YM9A 3M5MA 1EJNA 1TOCB 2QXHA 3BTEE 1CT2E 5JBBS 4TWWA 1DITH 1UTPA 1F5RA 4CRCA 1EAXA 1INCA 1T4UH 1AKSB 2FYQA 1XUJA 2FWWA 5EOKA 2BD2A 1YF4A 3U69H 2TGAA 3QZQA 4KTUA 3TJNA 1WCZA 1FY3A 3QK1A 3RXMA 5EQRA 4X6OA 1SL3A 1L1NA 3GYLB 2HWLB 3UNSA 1LO6A 1N6YA 5FXLA 4ZXYH 2VGCB 4NGAH 5EPNA 2O8LA 4DGJA 2DUCA 2ZFTA 4MQAA 1X7AC 2H5DA 2VWNA 3KEEA 1BTYA 4GCHF 3PTNA 3RXBA 3RUOA 1H9IE 3VXEH 1CT0E 3QO6A 3O8DA 2FI3E 3LU9B 1NY22 1NN6A 3U1JB 4IC6A 1C1MA 1KXCA 2HVXA 1F0TA 1JRTA 3T62A 4NA8A 4D9QA 5FHTA 1NRRH 1O3IA 4AN7A 1N6XA 2VU8E 3KQCA 3ATWA 2BVSH 3M7UA 3ZZ5A 3A8AA 1HAVB 1XVMA 2JH5D 1FPHH 3A7XA 1EJAA 5FCRA 3SJKA 4ISHH 1V3XA 1VITF 3E16B 1ACBE 4ISNA 2A5IA 4GSOA 3QZRA
chains in the Genus database with same CATH superfamily
3A7WA 3D62A 4HFPB 2BVRH 3E6PH 3ZZ3A 3MU8A 1ABIH 8KME2 3LPRA 2QE7D 1TE0A 3WW7A 5DSFA 3RXIA 2FTMA 5FPSA 1IQGA 1ORFA 3K6YA 1GI4A 4Q80A 4WF8A 1P2OA 2V3MA 3DFLA 2BDAA 2ZQ1A 2QXGA 1G9IE 1O2VA 4Y79A 1G3DA 1NFYA 3EA7A 4D76A 1A3EH 1GJ8B 1C2KA 1K1OA 2FESH 1S6LA 1W2KH 3NPSA 2IJD1 1JOUB 1SQRA 1Z8GA 1FQ3A 1BRBE 2GT8A 3ZYDA 4HG6A 2VIOA 1ZGVA 2PGBB 1LHDH 1GBBA 3QGNB 2M5TA 4XDEA 4IN2A 3ATIA 1EB2A 1VITH 1BIOA 1NU9A 1ZRKA 4WJG2 3MNXA 2CXVA 1AHTH 1TGCA 4OGXA 3MO3A 2ZC9H 5FCKA 1MZAA 3C1KA 1BBRK 1PJPA 4CBNA 3SN8A 2G52A 5I46H 3BV9B 2ZGCA 2Z7FE 4Y10E 3ZZDA 3OYPA 3PROA 3PTBA 4MNWA 1O39A 2P3FH 3SU3A 2D2DA 3VXFH 1O3LA 3BEUA 2ZDLA 1EATA 1PPBH 1UK3A 5PTPA 1QBNA 4AB8A 1UHBA 4DURA 4UDWH 1SVPA 5JBCS 1GHZA 3U28C 4NFFA 2EA3A 2BQ7B 1SMFE 2XCNA 3EGKH 1P2KA 2AMQA 5FL7D 3SW2B 3F2GA 2VH0A 1PPFE 1WAYB 2P59A 1ZHRA 2AEIH 2ANMH 1IHTH 2STBE 1YPJH 4X0WU 3GCTF 3TJOA 2FOAA 1FAXA 5C67A 2TGDA 4DJZB 1E1QD 2JIZD 1MKXH 2QYIA 4DCDA 1T8OA 2ZDKA 4H42U 2BZAA 2BY8X 3H09A 1P9SA 3LH1A 1P03A 3T28A 3RXAA 2KM0A 3A8DA 1S0QA 1UTMA 3EA8A 1SLUB 3HGNA 2ODYB 3N7EA 3L3TA 1A4WH 1V2PT 4BANB 2B0FA 3SJOA 1THRH 4FVBA 1C4Y2 1HUTH 4D8NA 1EAUA 3QLPH 1ZJDA 1C2EA 4NIYA 3MU5A 2C93B 3UWIA 3A8BA 4X1PU 2V35A 4TYDA 3AAUA 4ZKNU 1ESBA 2ODQA 1O3JA 1UCYE 2FOGA 1T8LA 1OP8A 1DICA 1Q31A 5ETXA 3H7TA 2H2ZA 1NBMD 4NIWA 4XOJA 3S9CA 4FUDA 1BT7A 2FM2A 2GMTB 1W0KD 2H9TH 1OOKB 1HYLA 2FI4E 1K1PA 1JIMA 1S83A 1MAYA 2ZI2H 3E8LA 4U01A 1GMCF 2GMTC 1C5PA 2XYAA 3FANA 4Y8XA 4JZ1A 1JIRA 1P11E 5FPYA 1LVBA 2UUJB 3ENSB 2PV9B 2F43B 3RXHA 3VPKA 4Z6AH 2Y5FA 2OINA 4YLUA 3S7KB 5C17A 5F8XA 1LHGH 3QN7A 4YOGA 1RXPA 5ESBA 1B7XB 1K1LA 1EZSC 3EE0B 2BXTH 1O2WA 1HJ9A 5DK1A 3RMNH 3TIUA 4KKDA 1AFQB 2QC2A 2WPIS 2FODA 4LZ4B 3ZZ7A 3KQ5A 2J92A 1ELBA 1FNIA 1GMDG 1TMBH 2FOFA 3K2UA 1BTPA 1OS8A 4X2XA 1C9PA 2M2AA 4OS5A 3CP7A 5EQQA 1QB6A 4YOIA 1IHSH 4JZIA 2XWAA 2A45B 1BTUA 3CS7A 4I8JA 1A2CH 5GPIB 1J14A 2I6SA 1GJ4H 3MQKC 1MU8B 1SQAA 1LCYA 2A7CA 2ZFFH 4IN1A 3SJ8A 3SGQE 1Z8RA 3STJA 2EI7A 4M7GA 1BTZA 1RTKA 1EKBB 4IMQA 1QA7A 1Y3UA 1ANEA 2AMPA 1JWTA 2A4RA 2Z9LA 2EC9H 2GX4A 2KAIA 1O5BB 3RXKA 3TJVA 1YPMH 4ISLA 1KTSB 1NPMA 1TRYA 1E36B 4THNH 1EPTC 1NFUA 3ITIA 4I8KA 1AFQC 1OXGA 1YP9A 1GGDB 4WWYA 5EJZA 2FDAA 4A7IB 3LC5A 3MWIU 1V2JT 1Z1JA 3F9HA 1XUGA 3GDUA 4F4OC 4FUJA 2CHAB 5AHGH 1SGTA 3RP2A 1QRZA 1RIWB 1SI5H 1AY6H 1TA2A 2FOCA 4WMEA 8ESTE 3P8GA 1SGFG 1AFEH 1OWEA 1A5HA 2Y7ZA 4A1TA 1CU1A 2PW8H 1V2RT 4DT4A 1ZHPA 3RXDA 1O2NA 3SI3H 1XXFA 1ELEE 3HKJB 3M61U 1ELCA 3HKIB 4CHAB 1GHXH 3HATH 5HMAA 4H4FA 1E37B 2C8YB 2BDYA 1QQUA 4MPWA 3V3MA 2EY4C 4Y7BA 3F0OA 1QZ8A 1TNIA 2J94A 4JMYA 2BQWB 2OLGA 2TGPZ 2ZTZA 3PMJA 2FI5E 4WY3A 6CHAB 4K5ZA 4H6TA 4YLQH 4E7NA 1FAKH 1O3BA 4X6PA 1BHXF 1YPGH 2STAE 2R3UA 1O2ZA 2FO9A 4ABEA 3F9EA 2WUBA 2CHAC 1QL9A 1VKYA 1KTTB 2HVYB 2ULLA 2JH0D 4TPYA 4M9FA 3U8TH 2QY0B 1HAXB 1TWXB 2FPZA 3LJOA 4NSYA 1DVAH 5E0GA 1KYNA 3M3TA 1V2LT 1O3EA 3CNRA 1XKBC 1ZZZA 3A8CA 4U2WA 1O31A 2HPPH 2GJGA 1O32A 4OS4A 1EP6A 2BLWA 1TFXA 1C2GA 1GI3A 5EPYA 3RXLA 1F0RA 1GI8B 5AFYH 1XKAC 2AGEX 3O8CA 1HAHH 3OTJE 4ABHA 1J17T 3U98H 1S81A 2KZ4A 1GL0E 4BAOB 2K1QA 3STIA 1GG6B 3BIVH 1BBRH 2CJIA 3KNXA 1MQ5A 2QXIA 4AFUA 6CHAC 4UFEH 4B2BA 1PQAA 1G2MA 1C2IA 3KHVA 4BAKB 5E2OA 1JBUH 3TU7H 1GHAG 1P2MA 1GI7B 1P12E 1EPTA 2I6QA 3ATKA 1Q3XA 3KQDA 1BRCE 3QGJA 4I8LA 1HXEH 1O3KA 2ZU4A 1NBME 1ZMNA 1TX8A 1IQNA 2H6MA 2F91A 1AVGH 2A0QB 1GBLA 1NM6A 2A5AA 5C3NA 2V0BA 3GCTG 5EU8A 1TRNA 1F5LA 3DD2H 2HNTF 2ZECA 3UY9A 1CGIE 4Y0YE 1GJ5H 1MTUA 2FOBA 1GBCA 1PQ8A 2O9QA 1P8VC 3A83A 2RDLA 1AGJA 2VWOA 1Z8IB 1NROH 3GISB 1EP5A 1H8ED 5GXPA 1BOQA 3GCHB 3GS9A 1P05A 3LGWA 1Z1IA 3EA9A 1HAOH 2ZFRH 3BN9A 3BTKE 2D26C 3ZVEA 2NU3E 1AUJA 4HGCA 4A5TS 1EAIA 1MTVA 1ZLRA 3TK9A 1NRPH 1TX6A 2Z9JA 5EGMA 2QF0A 4X2WA 1OP0A 3TH2H 1HIAB 4FUGA 3ZYEA 5KECA 4ABGA 2WZQA 2A7HA 1G3EA 2O8MA 1HXFH 2VH6A 1DWBH 1TPSA 1GHVH 1UJ1A 3RXQA 1JXPA 1OHHD 3MOCA 2SNVA 5C2ZA 3GCOA 3Q00A 4X8UH 3GY5A 3URDA 1AB9B 3QUMP 5EODA 2FS8A 2ALPA 1L1JA 1GMCG 1KDQA 3QTVH 1XVOA 2OC7A 4B2AA 1HNEE 1H8DH 1SPJA 2G4TA 1NRNH 2CN0H 2TGTA 3P8OA 1W8BH 1YCPH 2B5TB 3GY2A 1OWHA 1ETRH 4AFZA 1C5MD 1BMLA 4DG4A 3T5FH 1GL1A 4Q2KA 4DVAU 1TB6H 1ANDA 2BX3A 3MU4A 2G5NA 4IW4E 1W14U 4F48B 1RS0A 3PRBA 1TNHA 1ZSKA 5L30H 3E1XB 2GCHF 2IPQX 1BQYA 1SQOA 2VVUA 2ODPA 3L33A 4AX9H 2VVCA 1RTFB 1QJ1B 3JZ2B 1DLKB 3BTHE 1FLEE 1GHWH 2FXRA 1Y8TA 2B8OH 3CS0A 2EI8A 1F0SA 1JRSA 4JYUH 1O3NA 1MKWK 1DPOA 3A81A 1Z7KA 2A32A 1IQLA 3SUDA 2AFQB 1UVUH 2ASUB 1ZTKA 1TX7A 5CHAB 1P57B 2A7JA 1BBRE 1KY9A 2TPIZ 3ZVBA 3RXCA 2R9PA 1H4WA 2BDHA 2JKHA 1PQ5A 2F9NA 2Z94A 1YY3A 8GCHF 3LGUA 4AG1A 3BTQE 4X6MA 3SNCA 3PV5A 1KLIH 4GHTA 2HOBA 2XC5A 2KCAA 2G81E 3TLOA 1TBZH 2O8TA 2ZF0H 1YLCA 2YOLA 4B71A 5C20A 2QXJA 4NIVA 3SV6A 4A1XA 3GY4A 4ZHAA 1L0ZA 2G55A 1C1NA 2R2WU 1SLVB 2PKSC 3BTDE 3LC3A 3ZVFA 4GVUA 2IPHA 1ZMJA 2THFB 1QIXB 3PWCA 3B8JA 3LIWA 3M37A 1S0RA 5JDUB 1AMHA 2BDCA 5E0HA 4JK6A 1HB0B 3DFJA 1EFRD 5LGOA 1NESE 2SGAA 2P3UB 3PMHB 2AIQA 3UPEA 1SGQE 1P2NA 3E90B 1GDUA 2HPQH 4Q63A 4B75A 1S6HA 3UOPA 3RMMH 1WUNH 1O37A 1H9HE 3SGAE 1IOEA 1LHEH 4X8VH 2AH4X 1MU6B 3FP7E 1HAGE 2OXSA 2ZWLH 1BZXE 1YCPK 1DANH 2KCPA 2BHGA 4Z0KA 1C5SA 2RFKC 4OS6A 2PKAA 5DP6A 2AHME 2RCEA 1O3FA 1FJSA 4TPIZ 1CHOF 3TPIZ 5EW2H 1UTKA 2AMDA 1ARCA 4TT3D 3SU0A 1U6QA 2QF5A 4K3JA 2SGDE 1CBWC 4XBDA 1ETSH 2EQNA 3WWFA 2J4IA 3W94A 4X1RU 2SGEE 1P04A 2EEKA 1DY8A 2HNTC 5L2ZH 1UVTH 3FZDA 1GJAB 3U1IB 3RXSA 7GCHF 4I33A 3TH3H 3TNSA 4O3TA 1OKXA 2QGRA 3RXTA 3OEED 1DDJA 1EUFA 5T3HA 3MH6A 3SBKA 1VCWA 1MTSA 5KGOA 1UMAH 3SV2H 2FIRH 1ELVA 3SUFA 4NSVA 5HKKD 1BTHH 5FX6A 2WPLS 1TNJA 1MCTA 4UEHH 3T25A 4FU8A 5HM2A 1ZGIA 1HAZB 1HAVA 5CE1A 1K22H 4R8TB 1CT4E 1C2DA 2TRMA 1H8IH 2C8XB 1ELTA 3OEHD 4BAHB 2FOMB 3ZZ4A 4IBLH 3H5CB 3KN2A 5EW1H 4UE7H 1SGNE 2C3SA 2PUQH 3SJIA 1KXEA 3P8NA 5HGGA 5DN6D 2VVVA 2G00A 3RXJA 2A4QA 1O5EH 1O2QA 1Z6JH 5K7RA 1C5TA 3NK8A 3DCLA 4K1TA 3ZZBA 4X8TH 2Q1JA 1M9UA 4MPUA 4X1NU 1ZRBA 4AGKA 1O3AA 2VIWA 1C5QA 3ZVAA 4Q7YA 3Q77A 3RXVA 3TGIE 4FUBA 4GHQA 5J4QA 2BYAX 1HJ8A 1Y5AT 2RG3A 2JJ2D 1WXRA 4WXVA 3R0FA 1UTNA 2R2MB 1CHOG 1QB1A 4K8BA 2BY6X 2ZU3A 4ISOA 2NU1E 3RU4T 1FI8A 4XBCA 2LP6A 5ABWA 1ZOMA 4NA7A 3WY8A 1P01A 4OS1A 4X2VA 1A5IA 1NT1A 1V6DA 2BTCE 4J2YB 4ZCNA 7GCHG 5HYOA 1HPGA 4AFSA 5JBAS 1GJDB 1SHHB 2GKVE 3KCGH 5TCCA 4FUEA 4FUIA 1PQ7A 2W7UA 4ABAA 3QWCH 2WV5A 1TBQH 2PWXA 3MNBA 1GVKB 2ZO3H 3UREA 2SGQE 4ABJA 1OYQA 2OK5A 1C2JA 1O2UA 4CREA 3FOAA 1Y59T 5DP5A 1HAPH 3UTUH 4K2YA 3A7TA 4NIXA 1P09A 1Y3XA 3SUEA 1CBWB 1MABB 4ISIH 1J16A 1MZDA 2BD3A 3M7QA 5FBEA 3K65B 4IGDA 4TY7A 4LOYH 1VR1H 3MU1A 8LPRA 2PP6A 1C1UH 1T7CA 1K21H 2FLRH 2BDIA 2VWLA 5C0TA 3M5OA 3DT0H 3HK6B 3F0PA 2XBVA 2Y81A 4U30A 2FX4A 1AVWA 1AB9C 1D3QB 3T2NA 2UUYA 3SZEA 4WMFA 1AUTC 1FIZA 2QAAA 3P8FA 1ESTA 5AF9H 1C1PA 3DSOA 1ZTLA 1W11U 2GTBA 3Q3XA 3DHKH 1TGTA 1RFNA 1HRTH 3LGVA 1KDQB 2IJOB 5C1YA 2BY5X 3D65E 4NWLA 4JCNA 2P16A 2G51A 4GCHG 5EJLA 4O97A 4X1QU 5C5OA 1S82A 2VINA 4ZXXH 5C5NA 1O30A 5A2MH 4ABFA 3KGPA 5EXNA 2QF4A 4H6SB 1GI1A 2FYRA 1HDTH 3A89A 1SQTA 3BTGE 2CK3D 1UTOA 4I86A 2F9BH 1GBJA 1ZPBA 4Y7AA 4NFEA 4E7RG 3LJJA 4Y8ZA 5GDSH 2G5VA 3LONA 1ELAA 3VB4A 1AKSA 1XUIA 1DM4B 3PRDA 4B1TA 3N99A 5L6NH 3CENA 2TBSA 1C1WH 2AERH 3MFJA 3WWBA 5LPFA 1Y5BT 2BLVA 3MYWA 5GNDA 1GPZA 2WHXA 4BTUB 1IQMA 5FPTA 3E3TA 2ZFQH 3FVFB 1TQ7B 4Y0ZE 1A46H 1IAUA 3AW1A 4UFFH 1QGFA 2ZG0H 3LGYA 3PWBA 3DUXH 2YMSC 2J9NA 3BF6H 3IITA 3GY6A 3TVJB 1DFPA 3PMBB 1CA8B 1P2QA 1F2SE 2BZ6H 3L6PA 1SGDE 4YTAA 5BPEA 2Z3CA 2ZA5A 3KIDU 2F83A 1TONA 3RMLH 4BTTB 1OYTH 1QTFA 4B6EA 1FV9A 1W7GH 3I78A 2PSYA 2HLCA 1ZJKA 1V2TT 3MMGA 4NCYA 4SGBE 1LDTT 3UB0A 1FY1A 5GWZA 1C1VH 1QB9A 1V2VT 3GICB 3TJUA 2PKSB 5A8XA 2ZKSA 1SLWB 2PLXA 5J4SA 1TNLA 5HIYA 5B6LA 2ZFSA 3A7YA 5ESTE 1UVPA 1TABE 4DY7B 1OPHB 3C27B 4AGJA 1SOZA 1FUJA 2CMYA 2BB4A 2W6JD 3BG4C 1RD3B 2PUXB 1MUEB 2KCYA 3RLYH 1L4DA 1Y3VA 1HJAB 1AVXA 2Q6DA 2ZGHA 4MTBA 3ZV8A 2KAIB 2YMSB 1TALA 2EI6A 1VJAU 2FX6A 2H9EH 3BEIB 2H1UA 3OAAD 2R0LA 2XTTB 1OX1A 1GHBG 1OWKA 4TY6A 4LZ1H 2BVXH 3RXRA 1EZUC 2KCOA 3K6ZA 5E2PA 1TBRH 2ZQ2A 3E91A 1KLTA 3VB6A 1GDQA 2R3YA 1KXAA 1KIGH 4YESB 4CRBA 1NRQH 3RXOA 2ZP0H 4BAMB 3OY5U 2QCYA 2FS9A 4R0IA 1GBHA 3LH3A 2RDEA 2CV3A 2WPMS 2FMJA 2K8IA 4IC5A 1C5OH 1TYNA 4UD9H 4YOJA 3NKKA 1KXBA 2IOTA 3VFEA 1D6WA 2BD5A 3RC4A 4WH8A 3SGBE 3BG4B 2OBQA 1G3CA 1J15A 5JYIA 4ABIA 2F9OA 2F9UA 1XUFA 4K69A 3UWJH 1GMHG 2GV7A 4FUHA 2PKAB 4KTSA 5GIBA 4KGAA 4KTCA 3TITA 4CR5A 1MD8A 3ZZ6A 2XWBI 1AE8H 3N7OA 3JZ1B 1TLDA 1O38A 2DE9A 4X8SH 4RI0A 3M3SA 3DSPA 3TGKE 2ZHFH 1F92A 1A3BH 1TOMH 3OY6U 3F2HA 4O9VA 1VZQH 2JDID 3GYMA 5C1XA 2GZ8A 2ZNKH 2ZU5A 2ALVA 3RU4E 1TMTH 1KMHB 1MCVA 1AI8H 4ZKOU 3PYHA 5IDKA 3LDXH 2FP7B 1DX5M 1K2I1 2NU2E 2Z9IA 3B23B 2ANYA 2ZGBH 3AAVA 2VB0A 1FY8E 2A31A 5GCHG 4B74A 1QHRB 3GY8A 5LPRA 3P92A 1H1BA 4B73A 1TA6A 1LTOA 4UONA 1VCPA 2WUCA 2B7DH 1DWDH 3W95A 1GCDA 1QBVH 1EJMA 3FFGA 2OC1A 2SGPE 1UCYH 1SC8U 3F1SB 3IWMA 4D7GA 2A4OA 2ZCKP 3NUMA 4ZKRU 3ATLA 1LVMA 1IQEA 1UTJA 1DSUA 3ELAH 3VG8A 2VBCA 3MU0A 3VB7A 1G36A 1G37A 1HFDA 4Y76A 4JZDH 2GCHG 2P3TB 2GCTC 1C5UA 4ZHLU 1FY4A 1BJVA 4I32A 1Z71A 4IMZA 2UUFB 4Y71A 3Q3KA 3OU0A 1O2GH 1O2RA 2QA9E 1S6FA 2ZPSA 1O2TA 1PPHE 2FTLE 1YGCH 1LPGB 1UTLM 5IK2D 2W26A 1OWJA 2AGGX 1BCUH 1YBWA 2A5KA 1RGQA 1AN1E 5EIYA 1NFXA 2ZHDA 3T26A 5JB9S 2Z3DA 2WSSD 3MH7A 1GBDA 3M36A 2C8ZB 3M5NA 3RC6A 2BD4A 4YO9A 5IYTA 3VGCC 4I8HA 1E79D 3R3GB 1T8MA 4DIHH 4NWKA 1TGNA 5F8ZA 2BY7X 3RXPA 4FXGH 2GCTB 1GGDC 3S9BA 9LPRA 4XE4A 2P8OB 3VB3A 2FZZA 2AS9A 2PFEA 2VIVA 1SKYE 1QRXA 1W7XH 2NWNA 1G30B 1DSTA 1GBAA 2KX4A 1JMOH 2A2XH 5DPAA 1BMAA 1WV7H 1TPAE 3BG8A 3SOSA 2JH6D 2GZ7A 4F55A 4CRGA 1CGHA 3LT3A 2OTVA 1IQHA 3M35A 1FDPA 1O33A 1DOJA 1LVYA 2GDDA 3PB1E 4DIIH 3PM3A 4D9RA 4QT8C 1FY5A 1UVSH 4MPVA 2BQ6B 2XBWA 1BMMH 2ZZUH 3SNAA 1BA8B 1N8OC 1HAYB 1VGCC 2C4FH 3OSYA 4RKOB 4BAQB 3UNQA 3MI4A 5CDFE 2ZDAH 1LHFH 1WBGB 2J97A 3OX7U 1C1QA 1C5ZB 1SGFA 1A0LA 2NU0E 1TNGA 3VB5A 2W6ID 1NS3A 2UWLA 4WMDA 3GY7A 1C4V2 4O03A 1VJ9U 1PFXC 4KELA 1CA0B 3M3VA 2XBXA 2XOKD 4FU7A 1KXDA 1QNJA 1UK2A 1H8HD 2BY9X 1DT2A 1G32B 1P9UA 1ZSJA 3RMOH 4ZH8A 1EOJA 1G2LA 3SQHE 1AQ7A 4A6LA 2PGQB 3DSGA 1OWDA 1YPHC 1LQEA 3LOXA 1EQ9A 1O2SA 2XRCA 2ZU1A 5T6FA 1GJ9B 2TIOA 1MH0A 3KQEA 2OD3B 1N8OB 1VGCB 2Y5HA 2O8UA 4E06H 1GJ6A 1YYY1 4TSFD 1AZ8A 1UTQA 1V2NT 5F53A 2BOKA 1A61H 5F6MA 1D9IA 1UW7A 2FOHA 1QL7A 2Y82A 2BLQA 4NZLA 3EYDA 3MO6A 2GT7A 2C90B 3I77A 1HCGA 2WPDD 1NO9H 1GJ7B 5E8EH 4YXWD 4YZUA 1PYTD 2Y7XA 1CHGA 1C5RA 2YMSD 4Q4LA 2F4LA 2GV6A 1FPCH 1GBIA 3BTWE 1ZPZA 3GDSA 1ABJH 3F9FA 7LPRA 3AK5A 4PROA 4O3UA 2ZHEH 2F3CE 3QX5H 4A1VA 3PLBA 1BTWA 3MTYA 4OS2A 4FU9A 1QY6A 2FEQH 3GOVB 3ATMA 1GJCB 1P2IA 4ESTE 3A87A 4MPXA 4IS5A 1EASA 3VEQB 3ZZ9A 1QRWA 2V7QD 1BJUA 1SR5C 1O3OA 1V2ST 3HK3B 2Z9KA 1QCPA 4TWYA 3SU6A 1BRAA 1O2LA 2GD4B 3OE7D 3M5LA 1THSH 1O5CB 1IQKA 4Q7XA 1MMJN 1TMUH 4X1SU 1SFIA 1GCTC 1THPB 1RJXB 5C1UA 1EX3A 5JPMH 3SI4H 1WQSA 1BDAA 1O34A 2OQ5A 2QIQA 3SV7A 3SORA 1V2WT 3GCHC 2ILNA 2W3KA 4Y6DA 1ZR0A 2OP9A 3SU1A 1ZSLA 4XBBA 1KSNA 4CH8B 2ZGXH 1BUIA 5TJXA 2BD7A 1E34B 1UK4A 3NXPA 5F8TA 3ZIAD 3SNDA 1O3HA 5FBIA 2V3OH 5A0BA 2WPJS 4FVDA 1O3GA 3ESTA 3UR6A 4AOQA 4RN6A 5A0AE 2L6OA 1YLDA 3S69A 3DA9B 1MBQA 1D3TB 4JZEH 1E1RD 4X2YA 3U9AH 5EG4A 1TRMA 1B0FA 1CVWH 3NZIA 3U8RH 2WYJA 2BOHB 1OWIA 1QR3E 1O3CA 1WQVH 1HV7A 1XXDA 1F5KU 3SNEA 1V2QT 3W1EA 2J38A 6LPRA 1QL8A 1WTGH 5K0HA 1LPKB 1OP2A 3F2FA 1C5YB 1LKBA 1O36A 1SGCA 3KQBA 1T32A 4BXWA 1D4PB 2BDBA 1IQFA 1C5XB 1GMDF 1A0JA 2J98A 5CMXH 3D49H 1UO6A 3V13A 4ASUD 1UCYK 3PO1B 1C2MA 1WYKA 1N1LA 1G3BA 4AB9A 1NC6A 1SB1H 2ZEBA 1GDNA 4WXIA 2NU4E 2ESTE 4BTIB 1NZQH 1TNKA 1FXYA 2P8OC 3SU2A 1LHCH 1MKWH 4MNXA 2D1JA 3S0NA 1DE7H 2ZHQH 1FMGA 1S84A 2Y5GA 3FZZA 3GCNA 3PLPA 3SU4A 1PPZA 4VGCC 1SBWA 3EAJA 1L2EA 1Q2WA 1K1IA 2XC0A 3UIRA 1E0FD 2LELA 4ABBA 1O2YA 5HXFA 1FN8A 1BMNH 1W0JD 1EB1H 1TGBA 1XUHA 3T29A 1QJ6B 2WPHS 4MVNA 1MTNC 1O5FH 1LPZB 2J34A 1C1TA 3FAOA 1W0YH 3V7TA 2AIPA 3ZVDA 3F68H 1MBMA 3ZZ8A 1K28D 3RXGA 1MKXK 2A2QH 5A8YA 1L4ZA 3ODDA 5AVDA 2Q6FA 1UHBB 3E0NB 1FZZA 3HGPA 2SFAA 1C1RA 1WOFA 4FOUC 5HM9A 4RT1A 1AO5A 4MNVA 1E38B 7ESTE 5GCHF 4BNRA 3TK6A 4K1SA 3RM2H 3QDZB 1CSOE 1O3MA 2R0KA 1GHAF 1P3EA 2KFWA 4ABDA 2RA3A 5BRRE 3PV2A 1GBKA 2FLBH 2V3HH 3KYGA 3GDVA 4K1EA 6GCHF 4BXSA 2YNBA 2XC4A 2P93A 1D3PB 2WV9A 4KP0A 2P94A 4DOQA 2ZDMA 2F9VA 4AG2A 2W7SA 3RXUA 1A0HB 1Z6EA 1C1SA 4E05H 2W5EA 1FIWA 1YPKH 2BMGB 3I29A 2HGTH 3SQEE 5DP8A 3B9FH 3SHCH 4CR9A 1SGYE 3ZV9A 5FAHA 1CQQA 3GY3A 5AFZH 4DW2U 6GCHG 1W3CA 4GUXA 3E0PB 1AU8A 3AVZA 5B6OA 1ZYOA 1VCQA 3F3BA 2SGFE 2D8WA 4HTCH 4I7YH 2YNAA 1GI0A 5DG6A 9ESTA 2Y6TA 1Y3YA 4U32A 1W13U 2XW9A 1DWCH 1ELFA 1EOLA 1ID5H 5FX5A 2BX4A 2VWMA 3FO8D 1K9OE 3KYFA 1GI5A 5DP4A 3FP6E 3T27A 3UNRA 1RRKA 1WU1A 1AWFH 1GHYH 2VIPA 2BLOA 4ACAA 4ASHA 4AC9A 1B0EA 1FN6A 5DGJA 3TK5A 3SYJA 4B76A 1C4U2 1Z8JB 1C9TA 1LVOA 5T6DA 1O2JA 4ZUHA 1IQJA 1MTWA 1V2KT 2BD9A 1KLJH 2QV1A 3RM0H 2BDGA 3IG6B 2XCFA 3A85A 2DE8A 3A7VA 3UR9A 2ZDVH 2BM2A 3RU4D 3V0XA 4B6FA 2LPRA 4CHAC 1SHYA 5DP7A 2WPKS 3ZZCA 1EXFA 5EXLA 1YC0A 3PV4A 4JYTA 1YKTA 1O2PA 1C2LA 1O2KA 1V2MT 2CGAA 2HNTE 1SG8B 1BITA 1P06A 1WSSH 2UWPA 1AD8H 1NU7B 1P0SH 1AIXH 3KF2A 1O3DA 4OGYA 4RKJB 1GVZA 3SZNA 3UQVA 5H4IB 1O3PB 3G01A 2CF8H 3PLKA 4UFDH 5SGAE 5G4BA 1E35B 1O5GH 2OUAA 1O2OA 1T8NA 2HALA 3Q3YA 4Y8YA 5C94A 1BMFD 4X6NA 3P95A 1K1MA 2ZDNA 1SFQB 1O5AB 4AFQA 2PTNA 1FONA 3TGJE 1EAWA 1PYTC 1D6RA 1J9CH 1B5GH 1LMWB 1ARBA 1GBEA 1QURH 2VNTA 1C2FA 2QF3A 1W10U 3F9GA 2ZTXA 3AASA 3HPTB 4GAWA 4JYVH 3AW0A 4GPGA 2XNIA 2UUKB 1K1JA 2WV4A 3SUGA 5LH8A 1CE5A 2FOEA 1O2MA 2SNWA 1O2IA 1NRSH 2ZIQH 4JK5A 2HRVA 2AYWA 1WDIA 3A80A 4I31A 1TGSZ 4ZROA 1BHXB 1SLXB 5A09A 1D3DB 3PO1C 3Q76A 1QA0A 1PPGE 4NG9H 4B2CA 4AORA 2PR3A 3LKWA 1YLNA 1HAIH 1EZXC 1ETTH 5A8ZA 1P2JA 2UWOA 1Y3WA 2J98B 4A92A 1GMHF 1O2HA 1TPPA 2XBYA 4FUFA 1AZZA 3SU5A 2ZCHP 1T31A 2OC0A 3ZZAA 1DLEA 4MLFB 5DJ7A 1GI6A 3BTFE 4INHA 1O5DH 3A84A 1TPOA 5DP3A 2PSXA 2ZGJA 4ZKSU 4YT7H 4P02A 2ZFPH 2Z9GA 1P10A 2P95A 1YPLH 1ELDE 2H5CA 3QTOH 4CBOA 5L2YH 4J1YA 3M7TA 5CHAC 3SO3A 1KXFA 1XX9A 4HI3A 1QJ7B 2F9PA 2OC8A 3MNSA 3SV9A 1QBOA 3TNTA 3UAIC 4I8GA 4HZHA 2H9HA 1DUAA 1H9LB 1C5WB 1UVOA 3ZVCA 3BTME 4INLA 1O0DH 3UFAA 1W0ZU 2ZHWH 4MG3A 1COWD 1GBFA 1AWHB 1BTXA 1S85A 2JETB 1SSXA 1Y5UT 4NA9H 1QQ4A 4Q7ZA 3MNCA 3SHAH 2J2UA 5JB8S 1T4VH 2OCVB 2ZPRA 3UUZA 4CRDA 1XM1A 4DT7B 3RXFA 5EQSA 2Q6GA 3P70B 1GHBF 1P02A 1CO7E 1DY9A 1DS2E 4D7FA 2VIQA 2GGVB 1DXWA 1V2UT 4FETA 3MO9A 3SV8A 1RIWC 1ANCA 4ZAEA 5LPEA 2C8WB 4ZHMU 2IN2A 2ZTYA 1SGIB 1SGEE 1W12U 3OFND 1XUKA 1GBMA 1BRUP 2LNCA 4WH6A 4UFGH 1CA0C 3D23A 3LGTA 1MTNB 1ZHMA 3VGCB 3S9AA 1RTLA 2ANWA 1LKAA 3NWUA 3RLWH 3KL6A 4NZQA 4F49A 3O8BA 4AZ2B 1GG6C 4VGCB 2WINI 5HIZA 5A0CA 1YPHE 2G4UA 4FUCA 2A1DB 3NCLA 1VITG 2JETC 5E0JA 1CGJE 1K1NA 3SNBA 5TCAA 2CF9H 4AYVB 5I25A 1V2OT 3A82A 1MQ6A 4WVPE 3RXEA 1P3CA 4GLYA 1YPEH 4CH2B 1GJBB 2G8TA 1GI9B 5JBTA 2ZCLP 2GVFA 2HLDD 3SJ9A 5EXMA 1WTHD 2PTCE 2B9LA 2VGCC 2PHBA 2XNDD 1SGPE 2J95A 5F03A 4CRAA 2JJ1D 3P6ZB 1DUEA 3A86A 2W3IA 2Z3EA 1K0HA 1C1OA 1ELGA 1S5SA 4MNYA 3MH5A 1GVLA 4ZMAH 1DXPA 4LXBH 3UQOA 1C5LH 4SGAE 4BOHA 1GBTA 1ZPCA 4OS7A 5DP9A 8GCHG 3EDXB 1O35A 4P00A 2GP9B 2AGIX 3UOUA 4LK4A 3NRLA 4Y11E 1NTPA 1PPEE 1C5VA 2GDEH 4INKA 1OSSA 2ZPQA 3PMAB 1NFWA 3V12A 1C2HA 4AYYB 2GZ9A 1TAWA 2XXLA 4XSKU 3EQ0H 5CHBA 1O2XA 2BD8A 3TH4H 1J8AA 1F7ZA 4XFQA 3BSQA 2V6NA 1HJAC 1ZTJA 2Z6BD 4CRFA 1DWEH 3FN8A 2VJ1A 1XMNB 2OBOA 3BEFB 5GJ4B 2A4GA 2ANKH 1YCPM 2O8WA 1C5NH 1GI2A 1AE5A 1EZQA 3A88A 4XRNA 3RC5A 1SOTA 1IQIA 1HLTH 3MH4A 1YM0A 2ZU2A 3BIUH 3O8RA 1ANBA 1SGRE 3K9XB 1PPCE 3ZVGA 2RA0A 1MD7A 2QN5T 1GWAA 1MAXA 2Y80A 1GCTB 1QFKH 4JZFH 3H7OA 3N7DA 3OTPA 1L1GA 1ZMLA 3MHWU 1F0UA 5T6GA 6ESTA 1LQDB 3LGIA 2VIDA 4K60A 3RDZA 5C0UA 1TQ0B 1ESAA 3EE7A 2J5UA 3S7HB 1A7SA 1FX0B 2BXUH 4ACBA 3URCA 4YT6H 1HIAA 1A5GH 3FP8E 3ODFA 7KMEH 2WYGA 2OQUA 1BB0B 5DKMA 3U8OH 3A7ZA 3BTTE 3P17H 5T1VA 1HBTH 4RSPA 5DO4H 1TIOA 1HGTH 4K8YA 4MDSA 3F6UH 1EPTB 4Z1MD 1A1RA 4YM9A 3M5MA 1EJNA 1TOCB 2QXHA 3BTEE 2K0QA 1CT2E 5JBBS 4TWWA 1DITH 1UTPA 1F5RA 4CRCA 1EAXA 1INCA 1T4UH 1AKSB 2FYQA 1XUJA 2FWWA 5EOKA 2BD2A 1YF4A 3U69H 2TGAA 3QZQA 4KTUA 3TJNA 1WCZA 1FY3A 3QK1A 3RXMA 5EQRA 4X6OA 1SL3A 4OM9A 1L1NA 2KR7A 2HWLB 3GYLB 3UNSA 1LO6A 1N6YA 5FXLA 4ZXYH 2VGCB 4NGAH 5EPNA 2O8LA 4DGJA 4XD7D 2DUCA 2ZFTA 4MQAA 1X7AC 2H5DA 2VWNA 3KEEA 1BTYA 4GCHF 3PTNA 3RXBA 3RUOA 1H9IE 4RT0A 3VXEH 1CT0E 3QO6A 3O8DA 2FI3E 3LU9B 1NY22 1NN6A 3U1JB 4IC6A 1C1MA 1KXCA 2HVXA 1F0TA 1JRTA 3T62A 4NA8A 4D9QA 5FHTA 1NRRH 1O3IA 4AN7A 1N6XA 2VU8E 3KQCA 3ATWA 2BVSH 3M7UA 3ZZ5A 3FKSD 5EJ1A 5KEDA 1YWUA 3A8AA 1HAVB 1XVMA 2JH5D 1FPHH 3A7XA 2L74A 1EJAA 5FCRA 3SJKA 4ISHH 1V3XA 1VITF 3E16B 1ACBE 4ISNA 2A5IA 4GSOA 3QZRA
chains in the Genus database with same CATH topology
3A7WA 3D62A 4HFPB 2BVRH 3E6PH 3ZZ3A 3MU8A 1ABIH 8KME2 3LPRA 1TE0A 3RXIA 2FTMA 5FPSA 1IQGA 1ORFA 3K6YA 1GI4A 4Q80A 4WF8A 1P2OA 3DFLA 2BDAA 2ZQ1A 2QXGA 1G9IE 1O2VA 4Y79A 1G3DA 1NFYA 3EA7A 4D76A 1A3EH 1GJ8B 1C2KA 1K1OA 2FESH 1W2KH 3NPSA 1JOUB 1Z8GA 1FQ3A 1BRBE 2GT8A 3ZYDA 2VIOA 1ZGVA 2PGBB 1LHDH 1GBBA 3QGNB 2M5TA 4XDEA 4IN2A 3ATIA 1EB2A 1VITH 1BIOA 1NU9A 1ZRKA 4WJG2 3MNXA 2CXVA 1AHTH 1TGCA 4OGXA 3MO3A 2ZC9H 5FCKA 1MZAA 3C1KA 1BBRK 1PJPA 4CBNA 3SN8A 2G52A 5I46H 3BV9B 2ZGCA 2Z7FE 4Y10E 3ZZDA 3OYPA 3PROA 3PTBA 4MNWA 1O39A 2P3FH 3SU3A 2D2DA 3VXFH 1O3LA 3BEUA 2ZDLA 1EATA 1PPBH 1UK3A 5PTPA 1QBNA 4AB8A 1UHBA 4DURA 4UDWH 1SVPA 5JBCS 1GHZA 4NFFA 2EA3A 2BQ7B 1SMFE 2XCNA 3EGKH 1P2KA 2AMQA 3SW2B 2VH0A 1PPFE 1WAYB 2P59A 1ZHRA 2AEIH 2ANMH 1IHTH 2STBE 1YPJH 4X0WU 3GCTF 3TJOA 2FOAA 1FAXA 5C67A 2TGDA 4DJZB 1MKXH 2QYIA 4DCDA 1T8OA 2ZDKA 4H42U 2BZAA 2BY8X 1P9SA 3LH1A 1P03A 3T28A 3RXAA 3A8DA 1S0QA 1UTMA 3EA8A 1SLUB 3HGNA 2ODYB 3L3TA 1A4WH 1V2PT 4BANB 2B0FA 3SJOA 1THRH 4FVBA 1C4Y2 1HUTH 4D8NA 1EAUA 3QLPH 1ZJDA 1C2EA 4NIYA 3MU5A 2C93B 3UWIA 3A8BA 4X1PU 2V35A 4TYDA 3AAUA 4ZKNU 1ESBA 2ODQA 1O3JA 1UCYE 2FOGA 1T8LA 1OP8A 1DICA 1Q31A 5ETXA 3H7TA 2H2ZA 4NIWA 4XOJA 3S9CA 4FUDA 1BT7A 2FM2A 2GMTB 2H9TH 1OOKB 1HYLA 2FI4E 1K1PA 1JIMA 1S83A 1MAYA 2ZI2H 3E8LA 4U01A 1GMCF 2GMTC 1C5PA 2XYAA 3FANA 4Y8XA 4JZ1A 1JIRA 1P11E 5FPYA 1LVBA 2UUJB 3ENSB 2PV9B 3RXHA 4Z6AH 3VPKA 2Y5FA 2OINA 4YLUA 3S7KB 5F8XA 1LHGH 3QN7A 4YOGA 1RXPA 5ESBA 1B7XB 1K1LA 1EZSC 3EE0B 2BXTH 1O2WA 1HJ9A 5DK1A 3RMNH 3TIUA 4KKDA 1AFQB 2QC2A 2WPIS 2FODA 4LZ4B 3ZZ7A 2J92A 1ELBA 1FNIA 1GMDG 1TMBH 2FOFA 3K2UA 1BTPA 1OS8A 4X2XA 1C9PA 4OS5A 3CP7A 5EQQA 1QB6A 4YOIA 1IHSH 4JZIA 2XWAA 2A45B 1BTUA 3CS7A 4I8JA 1A2CH 5GPIB 1J14A 2I6SA 1GJ4H 1MU8B 1SQAA 1LCYA 2A7CA 2ZFFH 4IN1A 3SJ8A 3SGQE 1Z8RA 3STJA 2EI7A 4M7GA 1BTZA 1RTKA 1EKBB 4IMQA 1QA7A 1Y3UA 1ANEA 2AMPA 1JWTA 2A4RA 2Z9LA 2EC9H 2GX4A 2KAIA 1O5BB 3RXKA 3TJVA 1YPMH 4ISLA 1KTSB 1NPMA 1TRYA 1E36B 4THNH 1EPTC 1NFUA 3ITIA 4I8KA 1AFQC 1OXGA 1YP9A 1GGDB 4WWYA 2FDAA 4A7IB 3LC5A 3MWIU 1V2JT 1Z1JA 3F9HA 1XUGA 3GDUA 4F4OC 4FUJA 2CHAB 5AHGH 1SGTA 3RP2A 1QRZA 1RIWB 1SI5H 1AY6H 1TA2A 2FOCA 4WMEA 8ESTE 3P8GA 1SGFG 1AFEH 1OWEA 1A5HA 2Y7ZA 4A1TA 1CU1A 2PW8H 1V2RT 1ZHPA 3RXDA 1O2NA 3SI3H 1XXFA 1ELEE 3HKJB 3M61U 1ELCA 3HKIB 4CHAB 1GHXH 3HATH 5HMAA 4H4FA 1E37B 2C8YB 2BDYA 1QQUA 4MPWA 3V3MA 4Y7BA 1TNIA 2J94A 4JMYA 2BQWB 2OLGA 2TGPZ 2ZTZA 3PMJA 2FI5E 4WY3A 6CHAB 4K5ZA 4H6TA 4YLQH 4E7NA 1FAKH 1O3BA 4X6PA 1BHXF 1YPGH 2STAE 2R3UA 1O2ZA 2FO9A 4ABEA 3F9EA 2WUBA 2CHAC 1QL9A 1KTTB 2ULLA 2JH0D 4TPYA 3U8TH 1HAXB 1TWXB 2FPZA 2QY0B 3LJOA 4NSYA 1DVAH 5E0GA 1KYNA 3M3TA 1V2LT 1O3EA 1XKBC 1ZZZA 3A8CA 4U2WA 1O31A 2HPPH 1O32A 4OS4A 1EP6A 2BLWA 1TFXA 1C2GA 1GI3A 5EPYA 3RXLA 1F0RA 1GI8B 5AFYH 1XKAC 2AGEX 3O8CA 1HAHH 3OTJE 4ABHA 1J17T 3U98H 1S81A 1GL0E 4BAOB 2K1QA 3STIA 1GG6B 3BIVH 1BBRH 2CJIA 3KNXA 1MQ5A 2QXIA 4AFUA 6CHAC 4UFEH 4B2BA 1PQAA 1G2MA 1C2IA 3KHVA 4BAKB 5E2OA 1JBUH 3TU7H 1GHAG 1P2MA 1GI7B 1P12E 1EPTA 2I6QA 3ATKA 1Q3XA 3KQDA 1BRCE 3QGJA 4I8LA 1HXEH 1O3KA 2ZU4A 1ZMNA 1TX8A 1IQNA 2H6MA 2F91A 1AVGH 2A0QB 1GBLA 1NM6A 2A5AA 5C3NA 2V0BA 3GCTG 5EU8A 1TRNA 1F5LA 3DD2H 2HNTF 2ZECA 3UY9A 1CGIE 4Y0YE 1GJ5H 1MTUA 2FOBA 1GBCA 1PQ8A 2O9QA 1P8VC 3A83A 2RDLA 1AGJA 2VWOA 1Z8IB 1NROH 3GISB 1EP5A 5GXPA 1BOQA 3GCHB 1P05A 3LGWA 1Z1IA 3EA9A 1HAOH 2ZFRH 3BN9A 3BTKE 2D26C 3ZVEA 2NU3E 1AUJA 4HGCA 4A5TS 1EAIA 1MTVA 1ZLRA 3TK9A 1NRPH 1TX6A 2Z9JA 5EGMA 2QF0A 4X2WA 1OP0A 3TH2H 1HIAB 4FUGA 3ZYEA 4ABGA 2A7HA 1G3EA 2O8MA 1HXFH 2VH6A 1DWBH 1TPSA 1GHVH 1UJ1A 3RXQA 1JXPA 3MOCA 2SNVA 5C2ZA 3GCOA 3Q00A 4X8UH 3GY5A 3URDA 1AB9B 3QUMP 5EODA 2FS8A 2ALPA 1L1JA 1GMCG 1KDQA 3QTVH 1XVOA 2OC7A 4B2AA 1HNEE 1H8DH 1SPJA 2G4TA 1NRNH 2CN0H 2TGTA 3P8OA 1W8BH 1YCPH 2B5TB 3GY2A 1OWHA 1ETRH 4AFZA 1C5MD 1BMLA 4DG4A 3T5FH 1GL1A 4Q2KA 4DVAU 1TB6H 1ANDA 2BX3A 3MU4A 2G5NA 4IW4E 1W14U 1RS0A 1TNHA 1ZSKA 5L30H 3E1XB 2GCHF 1BQYA 1SQOA 2VVUA 2ODPA 3L33A 4AX9H 2VVCA 1RTFB 1QJ1B 3JZ2B 1DLKB 3BTHE 1FLEE 1GHWH 2FXRA 1Y8TA 2B8OH 3CS0A 2EI8A 1F0SA 1JRSA 4JYUH 1O3NA 1MKWK 1DPOA 3A81A 1Z7KA 2A32A 1IQLA 3SUDA 2AFQB 1UVUH 2ASUB 1ZTKA 1TX7A 5CHAB 1P57B 2A7JA 1BBRE 1KY9A 2TPIZ 3ZVBA 3RXCA 2R9PA 1H4WA 2BDHA 2JKHA 1PQ5A 2F9NA 2Z94A 8GCHF 3LGUA 4AG1A 3BTQE 4X6MA 3SNCA 1KLIH 4GHTA 2HOBA 2XC5A 2G81E 3TLOA 1TBZH 2O8TA 2ZF0H 1YLCA 2YOLA 4B71A 5C20A 2QXJA 4NIVA 3SV6A 4A1XA 3GY4A 4ZHAA 1L0ZA 2G55A 1C1NA 2R2WU 1SLVB 2PKSC 3BTDE 3LC3A 3ZVFA 4GVUA 2IPHA 1ZMJA 2THFB 1QIXB 3PWCA 3B8JA 3LIWA 3M37A 1S0RA 5JDUB 1AMHA 2BDCA 5E0HA 4JK6A 1HB0B 3DFJA 5LGOA 1NESE 2SGAA 2P3UB 3PMHB 2AIQA 3UPEA 1SGQE 1P2NA 3E90B 1GDUA 2HPQH 4B75A 1S6HA 3UOPA 3RMMH 1WUNH 1O37A 1H9HE 3SGAE 1IOEA 1LHEH 4X8VH 2AH4X 1MU6B 3FP7E 1HAGE 2OXSA 2ZWLH 1BZXE 1YCPK 1DANH 2BHGA 4Z0KA 1C5SA 4OS6A 2PKAA 5DP6A 2RCEA 1O3FA 1FJSA 4TPIZ 1CHOF 3TPIZ 5EW2H 1UTKA 2AMDA 1ARCA 3SU0A 1U6QA 4K3JA 2SGDE 1CBWC 4XBDA 1ETSH 2J4IA 3W94A 4X1RU 2SGEE 1P04A 2EEKA 1DY8A 2HNTC 5L2ZH 1UVTH 3FZDA 1GJAB 3U1IB 3RXSA 7GCHF 4I33A 3TH3H 3TNSA 4O3TA 1OKXA 2QGRA 3RXTA 1DDJA 1EUFA 5T3HA 3MH6A 3SBKA 1VCWA 1MTSA 1UMAH 3SV2H 2FIRH 1ELVA 3SUFA 4NSVA 1BTHH 5FX6A 2WPLS 1TNJA 1MCTA 4UEHH 3T25A 4FU8A 5HM2A 1ZGIA 1HAZB 1HAVA 5CE1A 1K22H 4R8TB 1CT4E 1C2DA 2TRMA 1H8IH 2C8XB 1ELTA 4BAHB 2FOMB 3ZZ4A 4IBLH 3H5CB 3KN2A 5EW1H 4UE7H 1SGNE 2C3SA 2PUQH 3SJIA 1KXEA 3P8NA 5HGGA 2VVVA 2G00A 3RXJA 2A4QA 1O5EH 1O2QA 1Z6JH 5K7RA 1C5TA 3NK8A 4K1TA 3ZZBA 4X8TH 2Q1JA 1M9UA 4MPUA 4X1NU 1ZRBA 4AGKA 1O3AA 2VIWA 1C5QA 3ZVAA 4Q7YA 3Q77A 3RXVA 3TGIE 4FUBA 4GHQA 5J4QA 2BYAX 1HJ8A 1Y5AT 2RG3A 4WXVA 3R0FA 1UTNA 2R2MB 1CHOG 1QB1A 4K8BA 2BY6X 2ZU3A 4ISOA 2NU1E 3RU4T 1FI8A 4XBCA 5ABWA 1ZOMA 4NA7A 3WY8A 1P01A 4OS1A 4X2VA 1A5IA 1NT1A 1V6DA 2BTCE 4J2YB 5HYOA 7GCHG 1HPGA 4AFSA 5JBAS 1GJDB 1SHHB 2GKVE 3KCGH 5TCCA 4FUEA 4FUIA 1PQ7A 2W7UA 4ABAA 3QWCH 2WV5A 1TBQH 2PWXA 3MNBA 1GVKB 2ZO3H 3UREA 2SGQE 4ABJA 1OYQA 1C2JA 1O2UA 4CREA 1Y59T 5DP5A 1HAPH 3UTUH 4K2YA 3A7TA 4NIXA 1P09A 1Y3XA 3SUEA 1CBWB 4ISIH 1J16A 1MZDA 2BD3A 3M7QA 5FBEA 3K65B 4IGDA 4TY7A 4LOYH 1VR1H 3MU1A 8LPRA 1C1UH 1T7CA 1K21H 2FLRH 2BDIA 2VWLA 3M5OA 3DT0H 3HK6B 2XBVA 2Y81A 4U30A 2FX4A 1AVWA 1AB9C 1D3QB 3T2NA 2UUYA 4WMFA 1AUTC 1FIZA 2QAAA 3P8FA 1ESTA 5AF9H 1C1PA 1ZTLA 1W11U 2GTBA 3Q3XA 3DHKH 1TGTA 1RFNA 1HRTH 3LGVA 1KDQB 2IJOB 5C1YA 2BY5X 3D65E 4NWLA 4JCNA 2P16A 2G51A 4GCHG 5C5OA 4O97A 4X1QU 1S82A 2VINA 4ZXXH 5C5NA 1O30A 5A2MH 4ABFA 3KGPA 5EXNA 4H6SB 1GI1A 2FYRA 1HDTH 3A89A 1SQTA 3BTGE 1UTOA 2F9BH 1GBJA 1ZPBA 4Y7AA 4NFEA 4E7RG 3LJJA 4Y8ZA 5GDSH 2G5VA 3LONA 1ELAA 3VB4A 1AKSA 1XUIA 1DM4B 4B1TA 5L6NH 3CENA 2TBSA 1C1WH 2AERH 3MFJA 5LPFA 1Y5BT 2BLVA 3MYWA 1GPZA 4BTUB 1IQMA 5FPTA 3E3TA 2ZFQH 3FVFB 1TQ7B 4Y0ZE 1A46H 1IAUA 3AW1A 4UFFH 1QGFA 2ZG0H 3LGYA 3PWBA 3DUXH 2J9NA 3BF6H 3IITA 3GY6A 3TVJB 1DFPA 3PMBB 1CA8B 1P2QA 1F2SE 2BZ6H 3L6PA 1SGDE 4YTAA 5BPEA 2Z3CA 2ZA5A 3KIDU 2F83A 1TONA 3RMLH 4BTTB 1OYTH 1QTFA 1FV9A 1W7GH 3I78A 2PSYA 2HLCA 1ZJKA 1V2TT 3MMGA 4NCYA 4SGBE 1LDTT 1FY1A 5GWZA 1C1VH 1QB9A 1V2VT 3GICB 3TJUA 2PKSB 5A8XA 2ZKSA 1SLWB 2PLXA 5J4SA 1TNLA 2ZFSA 3A7YA 5ESTE 1UVPA 1TABE 4DY7B 1OPHB 3C27B 4AGJA 1SOZA 1FUJA 2CMYA 2BB4A 3BG4C 1RD3B 2PUXB 1MUEB 3RLYH 1L4DA 1Y3VA 1HJAB 1AVXA 2Q6DA 2ZGHA 4MTBA 3ZV8A 2KAIB 1TALA 2EI6A 1VJAU 2FX6A 2H9EH 3BEIB 2H1UA 2R0LA 2XTTB 1OX1A 1GHBG 1OWKA 4TY6A 4LZ1H 2BVXH 3RXRA 1EZUC 3K6ZA 5E2PA 1TBRH 2ZQ2A 3E91A 1KLTA 3VB6A 1GDQA 1KXAA 1KIGH 2R3YA 4YESB 4CRBA 1NRQH 3RXOA 2ZP0H 4BAMB 3OY5U 2QCYA 2FS9A 4R0IA 1GBHA 3LH3A 2CV3A 2WPMS 2FMJA 4IC5A 1C5OH 1TYNA 4UD9H 4YOJA 3NKKA 1KXBA 2IOTA 3VFEA 1D6WA 2BD5A 3RC4A 4WH8A 3SGBE 3BG4B 2OBQA 1G3CA 1J15A 5JYIA 4ABIA 2F9OA 2F9UA 1XUFA 4K69A 3UWJH 1GMHG 2GV7A 4FUHA 2PKAB 4KTSA 5GIBA 4KGAA 4KTCA 3TITA 4CR5A 1MD8A 3ZZ6A 2XWBI 1AE8H 3N7OA 3JZ1B 1TLDA 1O38A 2DE9A 4X8SH 3M3SA 3TGKE 2ZHFH 1F92A 1A3BH 1TOMH 3OY6U 4O9VA 1VZQH 3GYMA