1OP0A

Crystal structure of aav-sp-i, a glycosylated snake venom serine proteinase from agkistrodon acutus
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
234
Chain Sequence
VIGGNECDINEHRFLVAFFNTTGFFCGGTLINPEWVVTAAHCDSTDFQMQLGVHSKKVLNEDEQTRNPKEKFICPNKNNNEVLDKDIMLIKLDKPISNSKHIAPLSLPSSPPSVGSVCRIMGWGSITPVKETFPDVPYCANINLLDHAVCQAGYPELLAEYRTLCAGIVQGGKDTCGGDSGGPLICNGQFQGIVSYGAHPCGQGPKPGIYTNVFDYTDWIQRNIAGNTDATCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Venom serine proteinase
publication title Crystal Structures and Amidolytic Activities of Two Glycosylated Snake Venom Serine Proteinases
pubmed doi rcsb
total genus 60
structure length 234
sequence length 234
ec nomenclature ec 3.4.21.-:
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op0A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op0A02
3OY5U 1GDUA 5DKMA 4OGXA 1D6WA 1JMOH 1DLEA 5J4QA 2BDYA 2WUCA 4DIHH 1MU6B 3B8JA 1ABJH 1LVOA 4X6PA 1G30B 1NY22 2QF0A 1KLTA 3P70B 3LOXA 1C5WB 1PYTC 2ANKH 4Q80A 1QRWA 2CXVA 1TBZH 3RUOA 1DY8A 1ESTA 1FY8E 1GBBA 1DXWA 4D9QA 2FWWA 5T3HA 1ANBA 1CT0E 5E0HA 3I78A 2AEIH 3P95A 1OWJA 4JZDH 1FV9A 4JZFH 1D6RA 1H9HE 2VWNA 4J1YA 3PYHA 1GHXH 2A45B 1H4WA 1LCYA 1EAUA 5LH8A 1V2QT 2J92A 1LVBA 4B2AA 3RC4A 2ZGHA 2ZGJA 3GCHB 1NS3A 2BM2A 3V3MA 2LNCA 2GCHF 1Q31A 3MO6A 4JZEH 2SGFE 3SU4A 4YZUA 1G2MA 1ZJKA 4BTUB 3TNSA 2VVUA 3VXEH 1S81A 3GCHC 5AF9H 1IQKA 1JIRA 4A1TA 1V2UT 3HKIB 1TNJA 2Y80A 1ETTH 5ESTE 4ISIH 2ZPRA 1RTKA 2ZU5A 1GBIA 1KLIH 2J2UA 1MH0A 3TJNA 1GI1A 1AVGH 4K69A 1YCPH 2OUAA 1KSNA 2W3IA 2H1UA 2CV3A 4HFPB 3PMHB 4R8TB 1DVAH 3A83A 2NU4E 3TGJE 2GT8A 1XUGA 2OQUA 3ATWA 4FUHA 4Q7YA 1O2WA 3A81A 1DXPA 4X6MA 1UTPA 4BAQB 5EPNA 2JH5D 5HYOA 1O3EA 1SOTA 4MPWA 1C1UH 1QJ6B 1V2VT 2FTLE 1ARBA 5JBAS 1G2LA 1LMWB 1SPJA 1RTFB 1MCVA 3KQCA 4I8KA 3RU4D 4THNH 4Y6DA 4ISHH 3P17H 1SC8U 4FUEA 4O03A 1TE0A 2GP9B 1A1RA 2PGBB 3VPKA 1W0YH 2V3OH 1C5UA 1GBKA 3UWIA 2FDAA 4I32A 1GBAA 3SUEA 3A87A 1BTHH 1J16A 4FUFA 4YLUA 2ANMH 3DT0H 3MU1A 1KXAA 3SUGA 4D7GA 1UMAH 1QQUA 1VITG 3NXPA 1EZSC 4FUGA 5C1XA 1CSOE 5AFZH 5DG6A 3PMJA 3BTDE 3ZVGA 3QDZB 1KY9A 2BD8A 2Z9LA 3QTOH 3KQDA 2AH4X 3MNCA 1XUJA 2ZU2A 4ZMAH 1TX8A 4WH6A 3T27A 1GHBF 4K1TA 4HZHA 2V0BA 3BSQA 4A5TS 3RXJA 1HAPH 2BX4A 1AI8H 1BMAA 1L0ZA 2OQ5A 4XSKU 3ZZ9A 1SB1H 5JB9S 2JETB 3SV2H 1UTQA 3A8CA 1K1MA 3Q00A 1BOQA 5JB8S 1TQ7B 1GHZA 4Y7AA 1L1JA 2GT7A 3MU0A 4GUXA 2FOAA 4BXSA 1SHHB 2ZZUH 3EYDA 5JBBS 2PTNA 2GGVB 2JETC 2EI6A 1BRUP 3PO1B 4MNVA 3BEFB 2PWXA 3FP7E 1J8AA 2PV9B 2ZHQH 2ZTXA 1WAYB 3QX5H 3FVFB 3FP8E 3UPEA 4JZ1A 2RDLA 3PO1C 1UO6A 3SU6A 4ZXYH 1LO6A 1VR1H 4ZXXH 1YCPM 5DK1A 1O2PA 4FVBA 3KHVA 3RMMH 1MTNB 3UFAA 1TPAE 3KF2A 5DP4A 3RXQA 3U8RH 4D7FA 2XBWA 3ZZDA 1XVOA 3I29A 1LQDB 1MTNC 3TH2H 1WU1A 1QFKH 2ZO3H 1ZOMA 4U30A 1MZDA 1CT2E 3RM2H 1EZXC 1PPBH 1YC0A 2P3UB 2P93A 4BOHA 2Z9IA 3MO3A 1UCYK 4X8TH 2DE8A 2BLOA 1AFEH 4LXBH 1EP5A 4UDWH 1O36A 4IW4E 5L2YH 1TGCA 1IQFA 4AG2A 1EASA 1F7ZA 1NFYA 3QO6A 2ZDKA 1EUFA 3SU5A 1HJ9A 1BHXB 1DWDH 1KLJH 1GHVH 1O5AB 4GPGA 2RA0A 1O3GA 1VITF 1O5BB 2QAAA 4I7YH 1GI2A 4X8SH 1BBRE 1SGDE 3SNCA 2EI7A 1P3CA 3A86A 4BAHB 3OTJE 3QUMP 1GJBB 1W14U 3SU0A 4A92A 3VEQB 3M5OA 3LC5A 4MQAA 1HAHH 1VITH 3NK8A 1MZAA 1YM0A 3HATH 1ORFA 2F9OA 3RXCA 1QJ1B 1J9CH 1T7CA 1O2GH 1C2IA 3NUMA 1UHBA 1CHGA 2TGPZ 3PM3A 1TMBH 4JK5A 1AZ8A 2IN2A 2ZA5A 2W3KA 1HIAB 1Z7KA 4I8JA 2WPJS 5C1YA 3AVZA 2XC4A 3STJA 1MBQA 4Y7BA 3ATIA 4X2XA 2FTMA 2G4TA 1YLCA 4UFDH 4IMQA 1ESAA 2CF8H 1MTSA 2EA3A 3URDA 4FU9A 3KNXA 3TVJB 5EGMA 3BN9A 3M35A 3LGVA 1MBMA 1KYNA 4RKOB 3ZZ5A 1HJ8A 1O3HA 3SOSA 1THPB 1A4WH 1EJAA 2O8UA 2ZIQH 3ZVCA 2ZDNA 4NA9H 3SNEA 3VGCB 1T4UH 2J94A 3AW0A 2ZHWH 2BOHB 5F8TA 5TJXA 1VCQA 8GCHG 1GMHG 1BTXA 5CMXH 1LHCH 1G32B 3FAOA 4ISOA 3P8NA 3ZZBA 3VGCC 1V2MT 5EXMA 4X1RU 3LONA 1Z1IA 2ZDVH 1IAUA 1QBOA 2FEQH 4BANB 1FONA 1N1LA 2AMQA 1G37A 2FESH 2FZZA 2XWBI 4DGJA 2Z7FE 4O3UA 3GDVA 1CT4E 1O35A 3KL6A 1FXYA 1F92A 3SV8A 1GHAF 4AFSA 3RXMA 2OBOA 1D3DB 1BDAA 3MH4A 5EG4A 5E8EH 1YLDA 1TWXB 1A3EH 3RXEA 1TNIA 1P09A 1YCPK 2VH0A 2Y81A 4GCHG 1OX1A 2PGQB 2VINA 3UOPA 3MH5A 2AMDA 1UTJA 1WTHD 2BDIA 4UFEH 3ZV9A 1OP8A 2FO9A 3KN2A 1GBDA 2PSYA 3BF6H 5LPRA 4MNYA 1C2EA 3CS0A 4NSVA 4D9RA 1SQAA 2PSXA 4MVNA 1O33A 2BD2A 2BD5A 4Y8XA 1TPSA 4FU8A 1THRH 4I8GA 3ZZCA 1XM1A 2HGTH 3N7OA 4Z0KA 1O2YA 4AYVB 1JBUH 2FP7B 6ESTA 1MCTA 5GPIB 1LPGB 2ZP0H 2G5VA 3UQOA 5C20A 2SNWA 1L2EA 3RC5A 1AFQB 3W94A 1JOUB 1BITA 5FPTA 1TGTA 3SHCH 4DVAU 5EQRA 1D3QB 2O8LA 1AFQC 1C5PA 4INKA 1F0UA 1ELBA 1RFNA 2BQ6B 2YNAA 1OWKA 1C5ZB 1SGCA 1LHEH 3LH1A 3P6ZB 3WY8A 1LVYA 4ZHLU 1LQEA 3UQVA 1Y5BT 2ZU3A 1HAYB 4FUIA 1K22H 4I8HA 1SFIA 2PTCE 1CO7E 1GI6A 5EODA 2VVCA 2PKAB 5FAHA 8GCHF 2CGAA 3GDSA 1LHDH 1YYY1 1HAOH 1B5GH 4OS5A 2A4RA 2GVFA 2FM2A 5HGGA 2A32A 1YPMH 5IYTA 1W7XH 1A61H 2BQ7B 2P59A 5JPMH 3M5NA 3TJUA 4AYYB 4TY6A 3ATMA 2BY5X 2ZHDA 3S0NA 1T31A 3L6PA 2BOKA 1MTVA 1GBFA 1O37A 5FCRA 2QXIA 2Y82A 3SGAE 1KDQB 2ULLA 1ZHPA 1BTZA 4WY3A 3P8OA 2FIRH 3ZZ4A 3FFGA 5JBTA 4ABFA 1ZGVA 2GDDA 5K7RA 3V0XA 1V2KT 1YF4A 3T5FH 4I33A 3SJKA 4MTBA 5FPSA 3M3TA 2Z9JA 1FY3A 4U2WA 1O31A 2BHGA 1GHWH 2A7JA 3ZV8A 4UFGH 1YP9A 4F4OC 2J95A 2R2WU 1WV7H 1AMHA 2FMJA 1HAGE 4X8VH 3U1IB 1OS8A 4ABDA 1DLKB 3UTUH 2BDAA 2WPKS 5EW2H 3HK3B 4ZAEA 2OTVA 4AFZA 4Q2KA 2Z6BD 4AOQA 1UK3A 3BTWE 1CVWH 3MWIU 3A80A 3S9BA 1NRSH 3RMLH 1P11E 1EAXA 2HRVA 1EB1H 4XOJA 3TGKE 4NG9H 2VIPA 5HMAA 1QBNA 3SN8A 2BVXH 2QC2A 3PLKA 1AGJA 2SGPE 2BD9A 1W13U 5FBIA 2KAIB 3URCA 1ZPBA 5FPYA 2NU2E 1N6XA 5L6NH 4GVUA 2GCTB 1HAZB 1ZR0A 2ZFSA 3A88A 4Y11E 3LJOA 3S7HB 1AKSB 1SGEE 1A2CH 4YM9A 3UNQA 1GBEA 5DP3A 1EZQA 1QY6A 2WV5A 2GCTC 3RXHA 1NTPA 3TU7H 1TRNA 1HV7A 1PQ5A 4K5ZA 2BY7X 1JIMA 1SGFG 1TFXA 2H6MA 5CHAB 4AB9A 1C4Y2 3F6UH 3NZIA 1VCPA 3OYPA 3UUZA 4NCYA 3AASA 1C2LA 2HOBA 1V2NT 1E35B 4X1NU 2VWLA 3PTBA 1HPGA 2PUXB 2BB4A 1XUHA 3PLPA 1A5IA 3V12A 1FIWA 1CGIE 2V6NA 2BX3A 1ELAA 3U8TH 1O3LA 1ZJDA 3LGUA 3NCLA 1O2KA 2SGQE 3A7XA 2NU0E 1DE7H 3K9XB 2ZU1A 3SV7A 1C1QA 4NIYA 5IDKA 1FN8A 4K3JA 1HXFH 4AFQA 4BAKB 4CH2B 3SW2B 2R0KA 1TAWA 1P06A 1ZPZA 1TIOA 1QB1A 1LKAA 1SLVB 1SQTA 3GY2A 2FXRA 5A09A 1KXDA 2XYAA 5LGOA 1BJVA 1Y59T 2AFQB 4SGAE 1Y8TA 3M7UA 4XBCA 4LOYH 3MU8A 1F0TA 1NROH 5FBEA 1TNLA 3S9CA 2FODA 4ZHAA 4U32A 3KIDU 1O3MA 2Z9GA 4YOGA 1HAXB 1JRSA 2OBQA 1P2IA 1ESBA 2AIQA 1MD8A 5EPYA 3LDXH 1P10A 3FP6E 2GV6A 2ZPQA 4MDSA 1V2JT 2FOBA 4DCDA 1P2QA 3NPSA 4NIXA 1NC6A 1GBLA 1A0LA 3C1KA 1O2NA 4Y79A 3C27B 2P94A 1ZLRA 3Q3XA 4ZHMU 3QZQA 1HAVB 1GMCG 1ZHMA 3A84A 4UONA 3PROA 3E16B 4DJZB 1FQ3A 2ZECA 1NM6A 4B76A 1XX9A 3UIRA 1V2OT 3BG4B 1E0FD 2QN5T 1UTMA 3M3VA 1ZRBA 1VGCB 1YPKH 3MYWA 1XUKA 2O8WA 1QQ4A 2P95A 2OC8A 1FUJA 1FAKH 2SGAA 1A0HB 3GCNA 3BG4C 1C5OH 1VGCC 1LVMA 3VB3A 3T2NA 1S85A 1A5GH 1C1WH 4JZIA 1P2NA 1IQHA 1GCDA 1IQGA 4FXGH 1A7SA 2TBSA 2G5NA 1EB2A 3MI4A 4NZLA 4D76A 5G4BA 1BRBE 1QURH 1SMFE 2OC1A 3SJOA 1EXFA 1NU9A 4ZROA 4Y8YA 1C5RA 2AIPA 3ZZ3A 4ZH8A 2G55A 4I8LA 3KGPA 1UVSH 1KXEA 1NRNH 2O8TA 1TONA 1NU7B 4VGCB 2A5KA 2BDCA 1GBMA 2V3HH 3BTTE 1C4V2 1O2VA 4OS2A 2J34A 4ABBA 2FOGA 2OLGA 2HALA 4WXVA 5DP6A 3VB7A 4VGCC 3E1XB 2HWLB 2ZF0H 1O3NA 3CP7A 2TPIZ 1O39A 1SQOA 3F9EA 3VXFH 4MNWA 4NA7A 3AAVA 3D65E 3ZZAA 1PPHE 1XXFA 1DWCH 1UVPA 3LT3A 3NWUA 2QXJA 4J2YB 1P8VC 3DFJA 2GZ9A 3A7WA 3SO3A 4D8NA 1PJPA 3PLBA 1RJXB 3LGYA 4X6NA 3RXAA 3FANA 1FY5A 5FCKA 1TMUH 2C8YB 1EJMA 2BY6X 1KTSB 1ETSH 1GMCF 3H5CB 2DUCA 1P9UA 3LPRA 5ESBA 1BHXF 1ELVA 1P2OA 3ZVAA 1DFPA 2VGCB 3BTEE 2IOTA 3ZZ7A 1DWEH 4OS4A 3W95A 2I6QA 1TYNA 2R3YA 4INLA 2PR3A 1C1VH 1HIAA 1OPHB 1ELFA 2VGCC 2QGRA 1W10U 1L4ZA 3FZDA 3UOUA 1H8IH 2FOEA 2H9EH 1DDJA 2YOLA 1O3DA 4KTUA 3HPTB 1GJ9B 1NESE 4TWWA 1O2HA 3LH3A 2D1JA 3RU4E 2OCVB 1WSSH 1BZXE 1BRAA 3BIVH 4CHAB 3RXPA 5K0HA 5F6MA 3O8RA 2GD4B 1GMDG 4A1VA 3SUFA 1GBJA 1GHYH 2YNBA 4CHAC 4YLQH 2ZKSA 1PPGE 1OXGA 1O5GH 4NSYA 1C2JA 2XC5A 1C5LH 2ZWLH 1VJAU 3SQHE 5C5NA 2PW8H 1IOEA 1TB6H 1O2SA 2W5EA 1DICA 1P01A 1SGTA 3Q3YA 1ID5H 3O8CA 5C1UA 1GL1A 2VIOA 4Y71A 1BMNH 1XUFA 1GJCB 2VIQA 2ZTZA 1NZQH 3SJ9A 2PHBA 1FZZA 1AE8H 1CU1A 1NN6A 1SBWA 1O5EH 4FVDA 2W26A 1GGDB 3HK6B 5EQQA 5ETXA 3TJVA 1IQMA 7KMEH 3ESTA 1BMMH 2A4OA 1DS2E 1HAIH 2CMYA 1C1OA 2AMPA 1YPGH 1O3AA 1GGDC 2TGTA 3RXBA 1S6HA 2D26C 1BTWA 3T26A 1VZQH 1L1NA 4WMEA 2R9PA 3IITA 2F9UA 3E91A 2JKHA 4NZQA 2C3SA 1BBRK 2WPHS 4ABJA 4TYDA 2C8WB 3QGJA 1F5LA 4MNXA 3UNSA 2A5IA 4A6LA 4JYVH 1TRYA 1RD3B 4IC6A 1WOFA 1H9IE 1FAXA 1P2JA 2FI4E 2W7UA 1Q2WA 1AUJA 3MHWU 1BMLA 1ZMNA 4HGCA 4PROA 2VIVA 3OX7U 1MKXH 1O32A 2WINI 3KEEA 4JCNA 1SG8B 1E36B 1XUIA 4H4FA 2A4GA 1EPTB 5ABWA 3TK9A 1OOKB 2B5TB 1IHSH 5BPEA 1AU8A 3QN7A 1GMDF 3E0NB 3Q76A 4A7IB 4RN6A 1QGFA 1TNGA 1EPTC 1F5RA 2BQWB 3RLWH 2PKAA 1Z8GA 1E34B 5F8ZA 2A5AA 1IQNA 1GI8B 4CRGA 2G00A 2EEKA 1D3PB 1ZSJA 2ZHEH 5A2MH 3F9GA 4DY7B 1TGSZ 3RLYH 6GCHG 3V7TA 1K2I1 4ZKRU 2FYRA 3HGNA 1YKTA 1KDQA 1QA0A 3GYMA 1OKXA 1O3PB 1P3EA 3D49H 4NIWA 1T8NA 1BTUA 2GZ7A 4DOQA 3PWBA 1LDTT 3RXGA 3DFLA 3HKJB 5A8YA 1SGYE 1HRTH 3RXOA 4OGYA 2JH6D 1AY6H 1G3BA 1N6YA 2M5TA 2WV4A 1C2FA 1OWEA 1C1NA 1GBHA 2FLRH 1O2MA 2P16A 3LKWA 5HXFA 1QTFA 1GI4A 1EATA 4CRCA 3EA8A 3RXVA 1H9LB 1MD7A 4KKDA 2G8TA 1UK2A 4H6SB 1ZTKA 1TNKA 1TABE 4XBBA 4R0IA 1A3BH 3A8AA 4X1QU 1TBQH 2J9NA 4X2VA 2ZFPH 3M7QA 2AS9A 1UTNA 2B7DH 2KAIA 5F8XA 1T4VH 2VJ1A 3JZ2B 1GI3A 1PQAA 2A7HA 1O3BA 1AKSA 3P92A 3U69H 1NO9H 5J4SA 1HLTH 1LPKB 2VVVA 2FX6A 3T29A 1FPCH 4GLYA 1GDQA 1GVLA 2ZG0H 1S0RA 3KCGH 3BTME 4ABEA 3STIA 2Q1JA 3SQEE 4AGKA 2QXHA 2ASUB 2IJOB 2XWAA 3LC3A 1S84A 1E37B 2R0LA 3E6PH 4BAMB 1Y3WA 3IG6B 3F9FA 1V2PT 2FYQA 1F0RA 6GCHF 2UUKB 1GWAA 4GAWA 1ANEA 2BD4A 5DP7A 1CBWB 4GHQA 1GBCA 1FDPA 2PLXA 1NT1A 4K8YA 1O2LA 1MUEB 1ZPCA 4TWYA 2GDEH 5CE1A 1NRQH 1GMHF 1CBWC 2ZFFH 5E2PA 1O2UA 2BY8X 1C1PA 2VWOA 2BYAX 1MTWA 2BLQA 4DURA 1C5XB 4UEHH 2CF9H 3ODDA 1OP2A 4NA8A 1OYTH 5C5OA 2Y5HA 4ISLA 2FOHA 4OS7A 3SZNA 1TALA 1TLDA 4MPXA 2Z94A 4ZKNU 1FLEE 4NFEA 1YPHC 1K1IA 2VNTA 1T8OA 2F9PA 2C93B 3UWJH 1OWDA 2A31A 5GCHG 1UVTH 1G3CA 3TK6A 4IN1A 1SR5C 3RMOH 3QTVH 2ALPA 4GCHF 3ODFA 3E8LA 2VB0A 1O2TA 1C5QA 2ZDAH 1W11U 3MU5A 4NFFA 4WVPE 3A89A 3M36A 2A0QB 1C2GA 3EA7A 1C1RA 4X0WU 4FU7A 1KIGH 2FI5E 1MKWH 1Y5UT 1LTOA 1BTPA 2BZAA 2TRMA 2ODYB 3GY5A 1HAVA 1C1SA 4RKJB 4MLFB 1TOCB 5EW1H 1CE5A 1DM4B 1P9SA 2BY9X 5DP5A 1C9TA 2FPZA 3TH4H 3TNTA 5FHTA 5T6GA 1ZZZA 1SSXA 4LZ1H 1JRTA 3Q77A 1NPMA 3R3GB 4CR5A 5C3NA 1ELCA 1QL9A 1C2HA 3MU4A 1XMNB 1AN1E 1GG6B 3RXUA 1SVPA 4A1XA 4B2CA 2ZFQH 1L4DA 4BAOB 2H2ZA 4RSPA 2F91A 2AERH 2V35A 2Z3EA 1GG6C 2Y7ZA 1C5MD 1S0QA 1DX5M 1ELGA 4WXIA 1DPOA 1SLUB 2WYJA 3SGQE 4CH8B 2BDGA 3MTYA 3O8BA 1G36A 4X1SU 1G3DA 3RXRA 1UTKA 1W12U 1TGBA 1C1TA 3F9HA 3SV6A 4K1EA 1MKXK 2WUBA 3K6ZA 1O3IA 2A7CA 1P2KA 3RXLA 1T32A 4DW2U 1HDTH 3O8DA 2ESTE 1FIZA 4BTTB 5CHAC 3SU3A 2DE9A 5EXLA 3SBKA 1AE5A 1HFDA 2GX4A 1PPFE 1W2KH 5SGAE 1QIXB 1SFQB 1EAWA 2ZGCA 2QA9E 1C5YB 1DWBH 2STAE 5GWZA 2VIWA 4Q7ZA 5AFYH 1BUIA 3SNDA 4Y76A 2C90B 1AWFH 3SGBE 1DUEA 1GVZA 4JK6A 1AIXH 1MQ6A 1QB6A 1VCWA 1M9UA 2RG3A 3SNAA 2SGDE 3E0PB 2P3FH 1O2JA 1ETRH 1GCTB 1IQJA 3RMNH 1V2TT 2NWNA 1UCYH 2BDBA 3SHAH 4UD9H 1NRRH 3M3SA 2XBYA 2XBVA 8LPRA 1GCTC 2UWPA 1W3CA 4CRAA 4IC5A 4BXWA 1ELEE 4CRDA 2XC0A 3BEUA 3PTNA 1EOJA 1DT2A 4O3TA 1XVMA 4YT6H 2OC7A 3I77A 1ARCA 2ANWA 1INCA 1ZRKA 1A46H 3BG8A 4ISNA 4UFFH 3DHKH 1HUTH 1SGFA 6LPRA 2RCEA 1BIOA 3GCOA 4B73A 1GPZA 1P05A 1HCGA 1FY1A 1QJ7B 1TBRH 3GDUA 2PFEA 2Y5FA 2R2MB 2F3CE 1Y3XA 3EAJA 4CRFA 4B71A 4INHA 3U9AH 4ESTE 4YT7H 2F83A 1CHOG 5EU8A 1WQSA 4JMYA 2P8OB 1K1OA 1Q3XA 1QA7A 4WF8A 1P0SH 4IN2A 1L1GA 4MPUA 2FS8A 2RA3A 5FX6A 2Q6GA 2P8OC 3UR6A 5HM9A 1CA0B 2IPHA 3ZVFA 5DGJA 3EDXB 4NWLA 2SGEE 1Z8JB 1RGQA 4NWKA 3LU9B 5H4IB 4AZ2B 1CA0C 1O2IA 1RS0A 2EC9H 1C2KA 5LPEA 2TGAA 1C2DA 4CR9A 3CS7A 2QXGA 2C8ZB 2BD3A 4CBOA 3A7VA 1GHBG 2ZQ1A 1Y3UA 1V2WT 4HTCH 3RM0H 2ZDLA 1O2QA 1GDNA 1C5NH 3A7TA 5EOKA 1B0FA 1F0SA 4DIIH 5T6FA 1HXEH 1OWIA 3IWMA 1X7AC 3GY6A 3ATLA 4XE4A 3SUDA 1IQIA 1EP6A 1Z6EA 3P8GA 1QL8A 1S83A 1YPLH 3F68H 3EGKH 1EQ9A 1Z1JA 3ELAH 2Z3DA 2Q6FA 1GI9B 2VH6A 4XDEA 1O2XA 2A2XH 4ASHA 1GJ8B 2AGGX 1HYLA 5F03A 3GISB 1H8DH 1J17T 4WWYA 3R0FA 1UTOA 2XBXA 1QB9A 3TPIZ 1O5DH 2ZGXH 3VFEA 2G81E 3KQBA 1CGHA 2QY0B 1TNHA 3SI4H 1QRXA 1SGNE 2D8WA 3K6YA 1Z8RA 3AAUA 4B75A 2Z3CA 1FMGA 3MOCA 3GCTG 3H7TA 1AHTH 1K28D 5A8ZA 4AX9H 3M61U 1EPTA 1CHOF 2OC0A 1PPZA 1W8BH 2ZPSA 1ZHRA 3UNRA 2ZGBH 1MAYA 4CRBA 5DJ7A 1GJ7B 1MKWK 4X8UH 5DO4H 1OYQA 2F9NA 3PB1E 4JYUH 1PQ7A 1Z71A 4XBDA 3CENA 7LPRA 4FUJA 3TGIE 2Q6DA 3SNBA 2R3UA 2ILNA 4Y0ZE 1ACBE 1P04A 1W7GH 1YBWA 5GJ4B 1ZSLA 2W7SA 5E0JA 3SU2A 1PYTD 1NRPH 1Z6JH 2ZCKP 1C4U2 2ODQA 1TRMA 2UUJB 4X2YA 1A5HA 3LGWA 3LGIA 2QIQA 2BVRH 2XNIA 1RRKA 3VB5A 1B7XB 2HNTF 2BLWA 2Z9KA 1TOMH 2F9BH 1GJAB 4K1SA 3RP2A 3RXFA 1P2MA 4YOIA 4NGAH 3GOVB 2A2QH 4KP0A 1RXPA 1P57B 1O3OA 5E0GA 1KXFA 2BXUH 1DSUA 4ZKOU 4E05H 1K21H 5A0CA 1ZSKA 1GJDB 1AUTC 2FLBH 3GY8A 3BTHE 1K1NA 2PKSB 3OSYA 4F49A 1QBVH 2WPLS 3SJ8A 1SLWB 1V2LT 4H42U 2PKSC 3RXIA 1FN6A 1ZMJA 5TCCA 2VIDA 4AB8A 3GY7A 1WBGB 1FJSA 3TJOA 5B6OA 1AWHB 3HGPA 2P3TB 1TGNA 3M7TA 4CREA 1ABIH 4BNRA 3DA9B 2C4FH 1TX7A 1HJAB 1AVXA 4Y10E 3GCTF 4ABIA 1K1LA 1C1MA 3BTGE 5L2ZH 3G01A 4MG3A 1C2MA 1O2ZA 1PQ8A 1HJAC 2XRCA 1GJ6A 3FZZA 3SU1A 2GKVE 3M5LA 2SNVA 2VU8E 2BD7A 2BLVA 4SGBE 1UCYE 2ZNKH 1GHAG 3SJIA 1NFWA 1BTYA 4WH8A 1QR3E 2J38A 4YTAA 1QHRB 3ZVBA 1O3KA 1EX3A 4KTSA 3RXKA 1B0EA 2HPQH 1NFXA 5A0AE 2ZFRH 1QL7A 1BJUA 2ZEBA 1G3EA 1BB0B 4IBLH 5E2OA 3TH3H 2ODPA 2J4IA 1WYKA 1OSSA 4IS5A 1ZTJA 1F2SE 4YO9A 3VB6A 2BXTH 1ANDA 2AYWA 2B9LA 1SL3A 1V6DA 3PWCA 1F5KU 1XKAC 2FOFA 3V13A 3EQ0H 2D2DA 3K2UA 1D3TB 1BRCE 1ANCA 2F9VA 4KGAA 2UUYA 4YESB 1KTTB 2QYIA 1GI7B 4CBNA 1GJ5H 1K1JA 1FI8A 2AGIX 1J14A 1O30A 4LZ4B 1O38A 2HNTC 3ZYEA 4UE7H 3UREA 2ALVA 4M7GA 3GYLB 3QGNB 1C5TA 2QV1A 4Y0YE 4AG1A 3SV9A 1P03A 1RIWB 1EJNA 2WPIS 4E7NA 4AGJA 2PUQH 1IQLA 1PFXC 1RIWC 2H5DA 2STBE 3EE0B 1EAIA 3OU0A 3MFJA 3MH7A 3LJJA 1TQ0B 6CHAB 2GMTB 5HM2A 4H6TA 3RU4T 1Z8IB 5PTPA 3E3TA 3T62A 5DPAA 6CHAC 1VJ9U 2GMTC 2K1QA 2FS9A 1PPEE 5LPFA 1Y3YA 3BV9B 3GICB 2BTCE 4I31A 4AORA 1O34A 1LPZB 1JWTA 4ABAA 1ZTLA 2QCYA 3MNBA 2Y5GA 2A1DB 2XCFA 1MMJN 4K2YA 2BVSH 2NU1E 2SFAA 1H1BA 3OY6U 1TPPA 1Y3VA 1AD8H 2XCNA 1DITH 9ESTA 4FUCA 1ZGIA 5GDSH 1UTLM 2ZHFH 1D9IA 3VB4A 3QZRA 3DD2H 1ZYOA 1MAXA 5TCAA 3AW1A 4XFQA 1A0JA 4Q7XA 4GHTA 4IMZA 4WMDA 3ZYDA 1AB9B 3ITIA 3UR9A 3U8OH 2ZC9H 1O3CA 1V2ST 1LHGH 2Y7XA 4FUDA 1WQVH 1SI5H 5GIBA 1AB9C 1OWHA 2FOCA 3A7ZA 1O5CB 2XXLA 1SGRE 1HNEE 2AGEX 1MTUA 2O9QA 3PMBB 1UJ1A 3D62A 1ELDE 1W0ZU 1DUAA 3RXSA 1CQQA 1MU8B 1SGPE 1C9PA 2OXSA 3Q3KA 4X6OA 5BRRE 4Z6AH 5C67A 3PMAB 3S9AA 3TITA 1N8OB 5A8XA 3QLPH 2ZI2H 3F1SB 4AFUA 5GXPA 1U6QA 4TPYA 3B23B 2GTBA 3MNSA 2TGDA 3KQEA 1N8OC 4O97A 1TA6A 4E7RG 7GCHG 1BCUH 1IHTH 2GZ8A 4AN7A 3TLOA 1GJ4H 4OS6A 3BIUH 3LGTA 2ZU4A 4B1TA 3SI3H 1O0DH 4YOJA 1TPOA 2THFB 5JYIA 1QNJA 1D4PB 1SGIB 4DG4A 2XW9A 1UHBB 4K60A 4KTCA 4E06H 3RXDA 4X2WA 1FY4A 3LIWA 2GV7A 1SOZA 1ZMLA 3MH6A 2HPPH 3A8BA 1ELTA 1WUNH 3BTFE 4WJG2 2A4QA 1JXPA 3A8DA 3RC6A 2Y6TA 1CA8B 2NU3E 1O3JA 1KXCA 1T8MA 5JBCS 3GY4A 2H9HA 2XTTB 3U98H 1EOLA 1YPJH 3QWCH 3L3TA 3T28A 1NFUA 5JDUB 1UVOA 2H9TH 1KXBA 2HNTE 2BMGB 2FX4A 1DOJA 1S82A 2ZCHP 9LPRA 5C2ZA 1SLXB 1E38B 2O8MA 4IGDA 1BA8B 1V2RT 4O9VA 1XKBC 1O5FH 1O2OA 3QK1A 1DANH 1J15A 1IQEA 4WMFA 1S6FA 1O2RA 4ZUHA 1GI5A 1TMTH 3RXTA 3ENSB 2OP9A 1K1PA 1MQ5A 1P12E 5EQSA 5AVDA 3ZZ8A 1GL0E 1OP0A 2ANYA 2ZCLP 1DSTA 3M37A 1QCPA 2FI3E 5EXNA 2CHAB 1EKBB 1K9OE 3NKKA 5L30H 3A7YA 2OINA 2UWLA 1AQ7A 2B8OH 1WCZA 2G52A 1Y5AT 1AVWA 2CHAC 3A82A 3ZVEA 3B9FH 5T6DA 3TK5A 3A85A 3UY9A 4QT8C 5A0BA 1C5SA 7GCHF 1DY9A 2HLCA 2UUFB 3ATKA 3ZVDA 3T25A 2G4UA 1FNIA 2WYGA 3P8FA 7ESTE 4LK4A 1SGQE 2BZ6H 2VWMA 3TIUA 3BEIB 1BQYA 4KELA 1HB0B 1C5VA 3DUXH 5FXLA 5DP9A 1GBTA 1SHYA 2LPRA 1FPHH 4B74A 8ESTE 2QF3A 2G51A 2OD3B 2HVXA 3RDZA 1O3FA 1GVKB 5AHGH 3PV4A 1CGJE 3H7OA 3L33A 2C8XB 2BDHA 3M5MA 4GSOA 3JZ1B 1EZUC 3MNXA 1UK4A 1UVUH 3MMGA 4MPVA 5DP8A 3GY3A 1LKBA 5GCHF 3S69A 1THSH 2ZQ2A 4X1PU 1HGTH 4BTIB 3D23A 4JYTA 1BT7A 1T8LA 2I6SA 1TX6A 4ABGA 1RTLA 3BTKE 1G9IE 3BTQE 4OS1A 2GCHG 4ZKSU 2H5CA 4B2BA 3EA9A 4DT7B 5I25A 4TPIZ 8KME2 3S7KB 1GI0A 3ZZ6A 4Y8ZA 1AZZA 1LHFH 2WPMS 2ZFTA 5FX5A 4NIVA 2B0FA 2CJIA 1AO5A 2FOMB 2ZDMA 1YGCH 1HBTH 1PPCE 4HI3A 4TY7A 4ABHA 1BBRH 1QRZA 3MO9A 1XXDA 1V3XA 2EI8A 2CN0H 3SORA 2ZTYA 1WTGH 5I46H 1P02A 2JH0D 2UWOA 4FUBA 3K65B 3E90B 3U1JB 1TA2A 1YPEH 1YPHE 4K8BA 2TIOA 4U01A 1S5SA
chains in the Genus database with same CATH superfamily
3OY5U 1GDUA 5DKMA 4OGXA 1D6WA 1JMOH 1DLEA 5J4QA 2BDYA 2WUCA 3DSOA 1MU6B 3B8JA 1ABJH 4DIHH 1LVOA 4X6PA 1G30B 2KCAA 1NY22 2QF0A 1KLTA 3P70B 3LOXA 1C5WB 1PYTC 2ANKH 4Q80A 1QRWA 2CXVA 1TBZH 3RUOA 1DY8A 1ESTA 1FY8E 1GBBA 1DXWA 4D9QA 2FWWA 5T3HA 1ANBA 1CT0E 5E0HA 3I78A 2AEIH 3P95A 1OWJA 4JZDH 3ZIAD 1FV9A 4JZFH 1D6RA 1H9HE 2VWNA 4J1YA 3PYHA 1GHXH 2A45B 1H4WA 1LCYA 1EAUA 5LH8A 1V2QT 2J92A 1LVBA 4B2AA 3RC4A 2ZGHA 2ZGJA 2VBCA 3GCHB 1NS3A 2BM2A 3V3MA 2LNCA 2GCHF 1Q31A 3MO6A 4JZEH 2SGFE 3SU4A 4YZUA 1G2MA 1ZJKA 4BTUB 3TNSA 3OFND 2VVUA 3VXEH 1S81A 2KM0A 3GCHC 5AF9H 1IQKA 1JIRA 4A1TA 1V2UT 3HKIB 1TNJA 2Y80A 1ETTH 3AK5A 5ESTE 4ISIH 2ZPRA 1RTKA 2ZU5A 1GBIA 1KLIH 2J2UA 5HIZA 1MH0A 3TJNA 1GI1A 1AVGH 5C94A 4K69A 1YCPH 2OUAA 1KSNA 2W3IA 2H1UA 2CV3A 4HFPB 3PMHB 4R8TB 1DVAH 3A83A 2NU4E 3TGJE 3FOAA 2GT8A 1XUGA 2OQUA 3ATWA 4FUHA 4Q7YA 1O2WA 3A81A 1DXPA 4X6MA 1UTPA 4BAQB 5EPNA 2JH5D 5HYOA 1O3EA 1SOTA 3VG8A 4MPWA 1C1UH 1QJ6B 1V2VT 2FTLE 4YXWD 1ARBA 5JBAS 1G2LA 1LMWB 1SPJA 1RTFB 1MCVA 3KQCA 4I8KA 3RU4D 4THNH 2YMSD 4Y6DA 4ISHH 3P17H 1SC8U 4FUEA 4O03A 1TE0A 3CNRA 2GP9B 1A1RA 2PGBB 3VPKA 1W0YH 2V3OH 1C5UA 1GBKA 5IK2D 3UWIA 2FDAA 4Q4LA 4I32A 1GBAA 3SUEA 3A87A 1BTHH 1J16A 4FUFA 4YLUA 2ANMH 3DT0H 3MU1A 1KXAA 3SUGA 4D7GA 1UMAH 1QQUA 1VITG 3NXPA 1EZSC 4FUGA 5C1XA 1UW7A 1CSOE 5AFZH 5DG6A 3PMJA 3BTDE 3ZVGA 3QDZB 1KY9A 2BD8A 2Z9LA 3QTOH 3KQDA 2AH4X 3MNCA 1XUJA 2ZU2A 4ZMAH 1TX8A 4WH6A 3T27A 1GHBF 4K1TA 5T1VA 4HZHA 2V0BA 3BSQA 4A5TS 3RXJA 1HAPH 2BX4A 1AI8H 1BMAA 1L0ZA 2OQ5A 4XSKU 3ZZ9A 1SB1H 5JB9S 2JETB 3SV2H 1UTQA 3A8CA 1K1MA 3Q00A 1BOQA 5JB8S 1TQ7B 1GHZA 4Y7AA 2KCYA 1L1JA 2GT7A 3MU0A 4GUXA 2FOAA 4BXSA 1SHHB 2ZZUH 3EYDA 5JBBS 2PTNA 2GGVB 2JETC 2EI6A 1BRUP 3PO1B 4MNVA 3BEFB 2PWXA 3FP7E 1J8AA 2PV9B 2ZHQH 2ZTXA 1WAYB 3QX5H 3FVFB 4TSFD 3FP8E 3UPEA 4JZ1A 2RDLA 3PO1C 1UO6A 3SU6A 4ZXYH 2PP6A 5GNDA 1LO6A 1VR1H 4ZXXH 1YCPM 5DK1A 1O2PA 4FVBA 3KHVA 4B6FA 3RMMH 1MTNB 3UFAA 1TPAE 3KF2A 5DP4A 3RXQA 3U8RH 4D7FA 2XBWA 3ZZDA 1XVOA 3I29A 1LQDB 1MTNC 3TH2H 1WU1A 1QFKH 2ZO3H 1ZOMA 4U30A 1MZDA 1CT2E 3RM2H 1EZXC 1PPBH 3GS9A 1YC0A 2P3UB 2P93A 4BOHA 2Z9IA 3MO3A 5CHBA 1UCYK 4X8TH 2DE8A 2BLOA 1AFEH 4LXBH 1EP5A 4UDWH 1O36A 4IW4E 5L2YH 1TGCA 1IQFA 4AG2A 1EASA 1F7ZA 1NFYA 3QO6A 2ZDKA 1EUFA 3SU5A 2L6OA 1HJ9A 1BHXB 1DWDH 1KLJH 1GHVH 1O5AB 4GPGA 2RA0A 1O3GA 1VITF 1O5BB 2QAAA 4I7YH 1GI2A 4X8SH 1BBRE 1SGDE 3SNCA 2EI7A 1P3CA 3A86A 4BAHB 2LP6A 3OTJE 3QUMP 1GJBB 1W14U 3SU0A 4A92A 3F2HA 3VEQB 3M5OA 3LC5A 4MQAA 1HAHH 1VITH 3NK8A 3PRBA 1MZAA 1YM0A 3HATH 1ORFA 2F9OA 3RXCA 1QJ1B 1J9CH 1T7CA 1O2GH 1C2IA 3NUMA 1UHBA 1CHGA 2TGPZ 3PM3A 1TMBH 4JK5A 1AZ8A 2IN2A 2ZA5A 2W3KA 1HIAB 1Z7KA 4I8JA 2WPJS 5C1YA 3AVZA 2WV9A 2XC4A 3STJA 1MBQA 4Y7BA 3ATIA 4X2XA 2FTMA 2G4TA 1YLCA 4UFDH 4IMQA 1ESAA 2CF8H 1MTSA 2EA3A 3URDA 4FU9A 3KNXA 3TVJB 5EGMA 3BN9A 3M35A 3LGVA 1MBMA 3PRDA 1KYNA 3DSGA 4RKOB 3ZZ5A 1HJ8A 1O3HA 3OEHD 2F4LA 3SOSA 1THPB 1SKYE 1A4WH 1EJAA 2O8UA 2ZIQH 3ZVCA 2ZDNA 4NA9H 3SNEA 3VGCB 1T4UH 2J94A 3AW0A 2ZHWH 2BOHB 5F8TA 5TJXA 1VCQA 8GCHG 1GMHG 1BTXA 5CMXH 1LHCH 1G32B 3FAOA 4ISOA 3P8NA 3ZZBA 3VGCC 1V2MT 5EXMA 4X1RU 3LONA 1Z1IA 2ZDVH 1IAUA 1QBOA 2FEQH 4BANB 1FONA 1N1LA 2AMQA 1G37A 2FESH 2FZZA 2XWBI 1YLNA 4DGJA 2Z7FE 4O3UA 3GDVA 1CT4E 1O35A 3KL6A 1FXYA 1F92A 3SV8A 1GHAF 4AFSA 3RXMA 2OBOA 1D3DB 3SYJA 1BDAA 3MH4A 5EG4A 5E8EH 1YLDA 1TWXB 1A3EH 3RXEA 1TNIA 1P09A 1YCPK 3H09A 2VH0A 2Y81A 4GCHG 1OX1A 2PGQB 2VINA 3UOPA 3MH5A 2AMDA 1UTJA 1WTHD 2BDIA 3F2GA 4UFEH 3ZV9A 1OP8A 2FO9A 3KN2A 1GBDA 2PSYA 3BF6H 5LPRA 4MNYA 1C2EA 3CS0A 4NSVA 4D9RA 1SQAA 2PSXA 4MVNA 1O33A 2BD2A 2BD5A 4Y8XA 1TPSA 4AC9A 4FU8A 1THRH 4I8GA 3ZZCA 1XM1A 2HGTH 3N7OA 4Z0KA 1O2YA 4AYVB 1JBUH 2FP7B 6ESTA 1MCTA 5GPIB 1LPGB 2ZP0H 2G5VA 3UQOA 5C20A 4I86A 2SNWA 1L2EA 3RC5A 1AFQB 3W94A 1JOUB 1BITA 5FPTA 1TGTA 3SHCH 4DVAU 5EQRA 1D3QB 2O8LA 1AFQC 1C5PA 4INKA 1F0UA 1ELBA 1RFNA 2BQ6B 2YNAA 1OWKA 1E1RD 1C5ZB 1SGCA 1LHEH 3LH1A 3P6ZB 3WY8A 1LVYA 4ZHLU 1LQEA 3UQVA 1Y5BT 2ZU3A 1HAYB 4FUIA 1K22H 4I8HA 1SFIA 2PTCE 1CO7E 1GI6A 5EODA 2VVCA 2PKAB 5FAHA 8GCHF 2CGAA 3GDSA 1LHDH 1YYY1 1HAOH 1B5GH 2W6ID 4OS5A 2A4RA 2GVFA 2FM2A 5HGGA 2A32A 1YPMH 5IYTA 1W7XH 1A61H 2BQ7B 2P59A 5JPMH 3M5NA 3TJUA 4AYYB 4TY6A 3ATMA 1E1QD 2BY5X 2ZHDA 3S0NA 1T31A 3L6PA 2BOKA 1MTVA 1GBFA 1O37A 5FCRA 2QXIA 2Y82A 3SGAE 1KDQB 2ULLA 1ZHPA 1BTZA 4WY3A 3P8OA 2FIRH 3ZZ4A 3FFGA 5JBTA 4ABFA 1ZGVA 2GDDA 5K7RA 3V0XA 1V2KT 1YF4A 3T5FH 4I33A 3SJKA 4MTBA 5FPSA 3M3TA 2Z9JA 1FY3A 4U2WA 3NRLA 1O31A 2BHGA 1GHWH 2A7JA 3KYGA 3WWBA 3ZV8A 4UFGH 1YP9A 4F4OC 2J95A 2R2WU 1WV7H 1AMHA 2FMJA 1HAGE 1S6LA 4X8VH 3U1IB 1OS8A 4ABDA 1DLKB 3UTUH 2BDAA 2WPKS 5EW2H 3HK3B 4ZAEA 2OTVA 4AFZA 4Q2KA 2Z6BD 4AOQA 3WWFA 1UK3A 3BTWE 1CVWH 3MWIU 3A80A 3OEED 3S9BA 1NRSH 3RMLH 1P11E 1EAXA 2HRVA 1EB1H 4XOJA 3TGKE 4NG9H 2KR7A 2M2AA 2VIPA 5HMAA 1QBNA 5HKKD 3SN8A 2BVXH 2QC2A 3PLKA 1AGJA 2SGPE 2BD9A 1W13U 5FBIA 2KAIB 3URCA 1ZPBA 5FPYA 2NU2E 1N6XA 5L6NH 4GVUA 2GCTB 1HAZB 1ZR0A 3U28C 2ZFSA 3A88A 4Y11E 3LJOA 3S7HB 1AKSB 1SGEE 1A2CH 4YM9A 3UNQA 1GBEA 5DP3A 1EZQA 1QY6A 2WV5A 2GCTC 3RXHA 1NTPA 3TU7H 1TRNA 1HV7A 1PQ5A 4K5ZA 2BY7X 1JIMA 1SGFG 1TFXA 2H6MA 5CHAB 4AB9A 1C4Y2 3F6UH 3NZIA 1VCPA 3OYPA 4Z1MD 3UUZA 4NCYA 3AASA 1C2LA 2HOBA 1V2NT 1E35B 4X1NU 2VWLA 3PTBA 1HPGA 2PUXB 2BB4A 1XUHA 3PLPA 1A5IA 3V12A 1FIWA 1CGIE 2V6NA 3FN8A 2BX3A 1ELAA 3U8TH 1O3LA 1ZJDA 3LGUA 3NCLA 1O2KA 2SGQE 3A7XA 2NU0E 1DE7H 3K9XB 2ZU1A 3SV7A 1C1QA 4NIYA 5IDKA 1FN8A 4K3JA 1HXFH 4AFQA 4BAKB 4CH2B 3SW2B 2R0KA 1TAWA 1P06A 1ZPZA 1TIOA 1QB1A 1LKAA 3DSPA 1SLVB 1SQTA 3GY2A 2YMSB 2FXRA 5A09A 1KXDA 2XYAA 5LGOA 1BJVA 1Y59T 2AFQB 4SGAE 1Y8TA 3M7UA 4XBCA 2YMSC 4LOYH 3MU8A 1F0TA 1NROH 5FBEA 1TNLA 3S9CA 2FODA 4ZHAA 4U32A 3KIDU 1O3MA 2Z9GA 4YOGA 1HAXB 1JRSA 2OBQA 1P2IA 1ESBA 2AIQA 1MD8A 5EPYA 3LDXH 1P10A 3FP6E 2GV6A 2ZPQA 4MDSA 1V2JT 2FOBA 4DCDA 1P2QA 3NPSA 4NIXA 1NC6A 1GBLA 1A0LA 3C1KA 1O2NA 4Y79A 3C27B 2P94A 1ZLRA 3Q3XA 4ZHMU 3QZQA 1HAVB 1GMCG 1ZHMA 3A84A 4UONA 3PROA 3E16B 4RI0A 4DJZB 1FQ3A 2ZECA 1NM6A 4RT0A 4B76A 1XX9A 3UIRA 1V2OT 3BG4B 1E0FD 2QN5T 1UTMA 3M3VA 1ZRBA 1VGCB 1YPKH 3MYWA 1XUKA 2QF4A 2O8WA 1QQ4A 2P95A 2OC8A 1FUJA 1FAKH 2SGAA 1A0HB 3GCNA 3BG4C 2JJ1D 1C5OH 1VGCC 1LVMA 3VB3A 3T2NA 1S85A 1A5GH 1C1WH 4JZIA 1P2NA 1IQHA 1GCDA 2HVYB 1IQGA 4FXGH 1A7SA 2TBSA 2G5NA 1EB2A 3MI4A 4NZLA 2L74A 5G4BA 4D76A 1BRBE 1QURH 1SMFE 2OC1A 3SJOA 1EXFA 1NU9A 1SQRA 4ZROA 4Y8YA 1C5RA 2AIPA 1YWUA 3ZZ3A 4ZH8A 2G55A 4I8LA 5EIYA 3KGPA 1UVSH 1KXEA 1NRNH 2O8TA 1TONA 1NU7B 4VGCB 2A5KA 2BDCA 1GBMA 2V3HH 3BTTE 1C4V2 1O2VA 4OS2A 2J34A 4ABBA 2FOGA 2OLGA 2V3MA 2HALA 4WXVA 5DP6A 3VB7A 4VGCC 3E1XB 1KMHB 2HWLB 2ZF0H 2WZQA 1O3NA 3CP7A 2TPIZ 1O39A 1SQOA 2J5UA 3F9EA 3VXFH 4MNWA 4TT3D 4NA7A 3AAVA 3D65E 5CDFE 5HIYA 3ZZAA 4P02A 1PPHE 1XXFA 1DWCH 1UVPA 3LT3A 3NWUA 2QXJA 4J2YB 1P8VC 3DFJA 2GZ9A 3A7WA 3SO3A 4D8NA 1PJPA 3PLBA 1RJXB 3LGYA 4X6NA 3RXAA 3FANA 1FY5A 5FCKA 1TMUH 2C8YB 3EE7A 1EJMA 3OAAD 2BY6X 1KTSB 1ETSH 1GMCF 5EJ1A 1NBME 3H5CB 2DUCA 1P9UA 3LPRA 5ESBA 1BHXF 1ELVA 3F0PA 1P2OA 3ZVAA 1DFPA 2VGCB 3BTEE 2IOTA 3ZZ7A 1DWEH 4OS4A 3W95A 2I6QA 1TYNA 2R3YA 4INLA 2PR3A 1C1VH 1HIAA 1OPHB 1ELFA 2VGCC 2QGRA 1W10U 1L4ZA 3FZDA 3UOUA 1H8IH 2FOEA 2H9EH 1DDJA 2YOLA 1O3DA 4KTUA 3HPTB 1GJ9B 1NESE 4TWWA 1O2HA 3LH3A 2D1JA 3RU4E 2OCVB 1WSSH 1BZXE 5B6LA 1BRAA 3BIVH 4CHAB 3RXPA 5K0HA 5F6MA 3O8RA 2GD4B 1GMDG 4A1VA 3SUFA 1GBJA 1GHYH 2YNBA 4CHAC 4YLQH 2ZKSA 5DSFA 1PPGE 1OXGA 1O5GH 4NSYA 1C2JA 2XC5A 1C5LH 2ZWLH 1VJAU 3SQHE 5C5NA 2PW8H 3KQ5A 3WW7A 1IOEA 1TB6H 1O2SA 2W5EA 1DICA 4FOUC 1P01A 1SGTA 3Q3YA 1ID5H 3O8CA 5C1UA 1GL1A 2VIOA 4Y71A 1BMNH 1XUFA 5EJZA 1GJCB 2VIQA 2ZTZA 1BMFD 1NZQH 3SJ9A 2PHBA 1FZZA 1AE8H 1CU1A 1NN6A 1SBWA 1O5EH 4FVDA 2W26A 1GGDB 3HK6B 5EQQA 5ETXA 3TJVA 1IQMA 7KMEH 3ESTA 1BMMH 2A4OA 1DS2E 1HAIH 2CMYA 1C1OA 2AMPA 5C0TA 1YPGH 1O3AA 2JDID 1GGDC 2TGTA 3RXBA 1S6HA 2D26C 1BTWA 3T26A 1VZQH 1L1NA 3FO8D 2R9PA 3IITA 4WMEA 2F9UA 3E91A 2JKHA 4NZQA 2C3SA 1BBRK 2KCPA 1EFRD 2WPHS 4ABJA 4TYDA 2C8WB 3QGJA 1F5LA 4MNXA 3UNSA 2A5IA 4A6LA 4JYVH 1TRYA 1RD3B 4IC6A 1WOFA 1H9IE 1FAXA 1P2JA 2FI4E 2W7UA 1Q2WA 1AUJA 3MHWU 1BMLA 1ZMNA 4HGCA 4PROA 2VIVA 3OX7U 1MKXH 1O32A 2WINI 3KEEA 4JCNA 1SG8B 1E36B 1XUIA 4H4FA 2A4GA 1EPTB 5ABWA 3TK9A 1OOKB 2B5TB 1IHSH 5BPEA 1AU8A 3QN7A 1GMDF 3E0NB 3Q76A 4A7IB 4RN6A 1QGFA 1TNGA 1EPTC 1F5RA 2BQWB 3RLWH 2PKAA 2J97A 1Z8GA 1E34B 5F8ZA 2A5AA 1IQNA 1GI8B 4CRGA 2G00A 4ASUD 2EEKA 1D3PB 1ZSJA 2ZHEH 5A2MH 3F9GA 4DY7B 1TGSZ 3RLYH 6GCHG 5KGOA 3V7TA 1K2I1 4ZKRU 2FYRA 3HGNA 1YKTA 1KDQA 1QA0A 3GYMA 1OKXA 1O3PB 1P3EA 3D49H 4NIWA 1T8NA 1BTUA 2GZ7A 4DOQA 3PWBA 1LDTT 3RXGA 3DFLA 3HKJB 5A8YA 1SGYE 1HRTH 3RXOA 4OGYA 2JH6D 2J98B 4F48B 1AY6H 1G3BA 1N6YA 2KZ4A 2M5TA 2WV4A 1C2FA 4OM9A 1OWEA 1C1NA 1GBHA 2FLRH 1O2MA 2P16A 3LKWA 5HXFA 1QTFA 1GI4A 1EATA 4CRCA 3EA8A 3RXVA 1H9LB 1MD7A 4KKDA 2G8TA 1UK2A 4H6SB 1ZTKA 1TNKA 1TABE 4XBBA 4R0IA 1A3BH 3A8AA 4X1QU 1TBQH 2J9NA 4X2VA 2ZFPH 3M7QA 2AS9A 1UTNA 2B7DH 2KAIA 5F8XA 1T4VH 2VJ1A 3JZ2B 1GI3A 4F55A 1PQAA 2A7HA 1O3BA 1AKSA 3P92A 3U69H 1NO9H 5J4SA 1HLTH 1LPKB 2VVVA 2FX6A 3T29A 1FPCH 4GLYA 1GDQA 1GVLA 2ZG0H 1S0RA 3KCGH 3OTPA 2IPQX 3BTME 2KCOA 4ABEA 3STIA 2Q1JA 3SQEE 4AGKA 2HLDD 2QXHA 4RT1A 2ASUB 2IJOB 2XWAA 3LC3A 2WPDD 1S84A 1E37B 2R0LA 3E6PH 2QE7D 4BAMB 1Y3WA 3IG6B 3F9FA 1V2PT 2FYQA 1F0RA 6GCHF 1H8ED 2UUKB 1GWAA 4GAWA 1ANEA 2BD4A 5DP7A 1CBWB 4GHQA 1GBCA 1FDPA 2PLXA 1NT1A 4K8YA 1O2LA 1MUEB 1ZPCA 2XNDD 4TWYA 2GDEH 5CE1A 1NRQH 1GMHF 1CBWC 2ZFFH 5E2PA 1O2UA 2BY8X 1C1PA 2VWOA 2BYAX 1MTWA 2BLQA 4DURA 1C5XB 4UEHH 2CF9H 3ODDA 1OP2A 4NA8A 1OYTH 5C5OA 2Y5HA 4ISLA 2FOHA 4OS7A 3SZNA 1TALA 1TLDA 4MPXA 2Z94A 4ZKNU 1FLEE 4NFEA 1YPHC 3MQKC 1K1IA 2VNTA 1T8OA 2F9PA 2C93B 3UWJH 1OWDA 2QF5A 2A31A 4XD7D 5GCHG 1UVTH 1G3CA 3FKSD 3TK6A 4IN1A 1SR5C 3RMOH 3W1EA 1MABB 3QTVH 2W6JD 2ALPA 4GCHF 3ODFA 3E8LA 2VB0A 1O2TA 1C5QA 2ZDAH 1W11U 3MU5A 4NFFA 4WVPE 3A89A 3M36A 1W0KD 2A0QB 1C2GA 3EA7A 1C1RA 4X0WU 4FU7A 1KIGH 2FI5E 1MKWH 1Y5UT 1LTOA 1BTPA 2RDEA 2BZAA 2TRMA 2ODYB 3GY5A 1HAVA 1C1SA 4RKJB 4DT4A 4MLFB 1TOCB 5EW1H 1CE5A 1DM4B 1P9SA 2BY9X 5DP5A 1C9TA 2FPZA 3TH4H 3TNTA 5FHTA 5T6GA 1ZZZA 1SSXA 4LZ1H 1JRTA 3Q77A 1NPMA 3R3GB 4CR5A 2KFWA 5C3NA 1ELCA 1YY3A 1QL9A 1C2HA 3MU4A 1FX0B 1AN1E 1XMNB 1GG6B 2EQNA 3RXUA 1SVPA 4A1XA 2RFKC 4B2CA 2ZFQH 1L4DA 4BAOB 2H2ZA 4RSPA 2F91A 2AERH 2V35A 2Z3EA 1GG6C 2Y7ZA 3OE7D 1C5MD 1S0QA 1DX5M 1ELGA 4WXIA 1DPOA 1SLUB 2WYJA 3SGQE 4CH8B 2BDGA 3MTYA 3O8BA 3PV2A 1G36A 4X1SU 1G3DA 3RXRA 1UTKA 1W12U 1TGBA 1C1TA 3F9HA 3SV6A 4K1EA 1MKXK 2WUBA 3K6ZA 1O3IA 2A7CA 1P2KA 3RXLA 1T32A 4DW2U 1HDTH 3SZEA 3O8DA 2K0QA 2ESTE 1FIZA 4BTTB 4ACAA 5CHAC 3SU3A 2DE9A 5EXLA 3SBKA 1AE5A 1HFDA 2GX4A 1PPFE 1W2KH 5SGAE 1QIXB 1SFQB 1EAWA 2ZGCA 2QA9E 1C5YB 1DWBH 2STAE 5GWZA 2VIWA 4Q7ZA 5AFYH 1BUIA 3SNDA 1OHHD 4Y76A 2C90B 1AWFH 3SGBE 1DUEA 1GVZA 4JK6A 1AIXH 1MQ6A 1QB6A 1VCWA 1M9UA 2RG3A 3SNAA 2SGDE 3E0PB 2P3FH 1O2JA 1ETRH 1GCTB 1IQJA 3RMNH 1V2TT 2NWNA 1UCYH 2BDBA 3SHAH 4UD9H 1NRRH 3M3SA 1W0JD 2XBYA 5C17A 2XBVA 8LPRA 1GCTC 2UWPA 1W3CA 4CRAA 4IC5A 4BXWA 1ELEE 4CRDA 2XC0A 3BEUA 3PTNA 1EOJA 1DT2A 4O3TA 1XVMA 4YT6H 2OC7A 3I77A 1ARCA 2ANWA 1INCA 1ZRKA 1A46H 3BG8A 4ISNA 4UFFH 3DHKH 1HUTH 1SGFA 6LPRA 2RCEA 1BIOA 3GCOA 2WHXA 4B73A 1GPZA 1P05A 1HCGA 1FY1A 1QJ7B 1TBRH 3GDUA 2PFEA 2Y5FA 2R2MB 2F3CE 1Y3XA 3EAJA 4CRFA 4B71A 4INHA 3U9AH 4ESTE 4YT7H 4HG6A 2F83A 1CHOG 5EU8A 1WQSA 4JMYA 2P8OB 1K1OA 1Q3XA 1QA7A 4WF8A 1P0SH 4IN2A 1L1GA 4MPUA 4M9FA 2FS8A 2RA3A 5FX6A 2Q6GA 2P8OC 3UR6A 5HM9A 1CA0B 2IPHA 5EJLA 3ZVFA 5DGJA 3EDXB 5DN6D 4NWLA 2SGEE 1Z8JB 1RGQA 4NWKA 3LU9B 5H4IB 4AZ2B 1CA0C 1O2IA 1RS0A 2EC9H 1C2KA 5LPEA 2TGAA 1C2DA 4CR9A 3CS7A 2QXGA 3DCLA 2C8ZB 2BD3A 4CBOA 3A7VA 1GHBG 2ZQ1A 1Y3UA 1E79D 1V2WT 4HTCH 3RM0H 2ZDLA 1O2QA 1GDNA 1C5NH 3A7TA 3N7DA 1B0FA 5EOKA 1F0SA 4DIIH 5T6FA 1HXEH 1OWIA 3IWMA 1X7AC 3GY6A 3ATLA 4XE4A 3SUDA 1IQIA 1EP6A 1Z6EA 3P8GA 1QL8A 1S83A 1YPLH 3F68H 3EGKH 1K0HA 1EQ9A 2GJGA 1Z1JA 3ELAH 2Z3DA 2Q6FA 1GI9B 2VH6A 4XDEA 1O2XA 2A2XH 4ASHA 1GJ8B 2AGGX 1HYLA 5F03A 3GISB 1H8DH 1J17T 4WWYA 3R0FA 1UTOA 2XBXA 1QB9A 3TPIZ 1NBMD 1O5DH 2F43B 2ZGXH 1QZ8A 3VFEA 2G81E 3KQBA 5C0UA 1CGHA 2QY0B 1TNHA 3SI4H 1QRXA 1SGNE 2D8WA 3K6YA 1Z8RA 3AAUA 4B75A 2Z3CA 1FMGA 3MOCA 3GCTG 3H7TA 1AHTH 1K28D 5A8ZA 4AX9H 3M61U 1EPTA 1CHOF 1PPZA 2OC0A 1W8BH 2ZPSA 1ZHRA 3UNRA 2ZGBH 1MAYA 4CRBA 5DJ7A 1GJ7B 1MKWK 4X8UH 5DO4H 1OYQA 2F9NA 3PB1E 4JYUH 1PQ7A 1Z71A 4XBDA 3CENA 7LPRA 4FUJA 3TGIE 2Q6DA 3SNBA 2R3UA 2ILNA 4Y0ZE 1ACBE 1P04A 1W7GH 1YBWA 5GJ4B 1ZSLA 2W7SA 5E0JA 3SU2A 1PYTD 1NRPH 1Z6JH 2ZCKP 1C4U2 2ODQA 1TRMA 2UUJB 4X2YA 1A5HA 2K8IA 3LGWA 3LGIA 2QIQA 2BVRH 2XNIA 1RRKA 3VB5A 1B7XB 2HNTF 2BLWA 2Z9KA 1TOMH 2F9BH 1GJAB 4K1SA 3RP2A 3RXFA 2J98A 1P2MA 4YOIA 4NGAH 3GOVB 2A2QH 4KP0A 1RXPA 1P57B 1O3OA 5E0GA 1KXFA 2BXUH 1DSUA 4ZKOU 4E05H 3UB0A 1K21H 5A0CA 1ZSKA 1GJDB 1AUTC 2FLBH 3GY8A 3BTHE 1K1NA 2PKSB 3OSYA 4F49A 1QBVH 2WPLS 3SJ8A 1SLWB 1V2LT 4H42U 2LELA 2PKSC 3RXIA 2IJD1 1FN6A 1ZMJA 5TCCA 2VIDA 4AB8A 3GY7A 1WBGB 1FJSA 3TJOA 5B6OA 1AWHB 3HGPA 2P3TB 1TGNA 3M7TA 4CREA 1ABIH 4BNRA 3DA9B 2C4FH 4XRNA 1TX7A 1HJAB 1AVXA 4Y10E 3GCTF 4ABIA 1K1LA 1C1MA 2KX4A 3BTGE 5L2ZH 3G01A 4MG3A 1C2MA 1O2ZA 1PQ8A 1HJAC 2XRCA 1GJ6A 3FZZA 3SU1A 2GKVE 3M5LA 2SNVA 5KEDA 2VU8E 2BD7A 2BLVA 4SGBE 1UCYE 2ZNKH 1GHAG 3SJIA 1NFWA 2V7QD 1BTYA 4WH8A 1QR3E 2J38A 4YTAA 1QHRB 3ZVBA 1O3KA 1EX3A 4KTSA 3RXKA 1B0EA 2HPQH 1NFXA 5A0AE 2ZFRH 1QL7A 1BJUA 2ZEBA 1G3EA 1BB0B 4IBLH 5E2OA 3TH3H 2ODPA 2J4IA 1WYKA 1OSSA 4IS5A 1ZTJA 1F2SE 4YO9A 3VB6A 2BXTH 1ANDA 2AYWA 2B9LA 1SL3A 1V6DA 3PWCA 1F5KU 1XKAC 2FOFA 5F53A 3V13A 3EQ0H 2OK5A 2D2DA 3K2UA 1D3TB 1BRCE 1ANCA 2F9VA 4KGAA 2UUYA 4YESB 1KTTB 2JIZD 2QYIA 1GI7B 4CBNA 1GJ5H 1K1JA 1FI8A 2AGIX 1J14A 1O30A 4LZ4B 3N7EA 1O38A 2HNTC 3ZYEA 4UE7H 3UREA 2ALVA 4M7GA 3GYLB 3QGNB 1C5TA 2QV1A 4Y0YE 4AG1A 3SV9A 1P03A 1RIWB 1EJNA 2WPIS 4E7NA 4AGJA 2PUQH 1WXRA 1IQLA 1COWD 1PFXC 1RIWC 2H5DA 2STBE 3EE0B 1EAIA 3OU0A 3MFJA 3MH7A 3LJJA 1TQ0B 6CHAB 2GMTB 5HM2A 4H6TA 3RU4T 1Z8IB 5PTPA 3E3TA 3T62A 5DPAA 6CHAC 1VJ9U 2GMTC 2K1QA 2FS9A 1PPEE 5LPFA 5KECA 1Y3YA 3BV9B 3GICB 3UAIC 2BTCE 4I31A 4AORA 1O34A 1LPZB 1JWTA 4ABAA 1ZTLA 2QCYA 3MNBA 2Y5GA 2A1DB 4FETA 2XCFA 1MMJN 4K2YA 2BVSH 2NU1E 2SFAA 1H1BA 3OY6U 1TPPA 1Y3VA 1AD8H 2XCNA 1DITH 9ESTA 4FUCA 1ZGIA 5GDSH 1UTLM 2ZHFH 1D9IA 3VB4A 3QZRA 3DD2H 1ZYOA 1MAXA 5TCAA 3AW1A 4XFQA 1A0JA 4Q7XA 4GHTA 4IMZA 4WMDA 3ZYDA 5FL7D 1AB9B 3ITIA 3UR9A 3U8OH 2ZC9H 1O3CA 1V2ST 1LHGH 2Y7XA 4FUDA 1WQVH 1SI5H 5GIBA 1AB9C 1OWHA 2FOCA 3A7ZA 1O5CB 4ZCNA 2XXLA 1SGRE 1HNEE 2AGEX 1MTUA 2O9QA 3PMBB 1UJ1A 3D62A 1ELDE 1W0ZU 1DUAA 3RXSA 1CQQA 1MU8B 1SGPE 1C9PA 2OXSA 3Q3KA 4X6OA 5BRRE 4Z6AH 3N99A 5C67A 3PMAB 3S9AA 3TITA 1N8OB 5A8XA 3QLPH 2ZI2H 3F1SB 4AFUA 5GXPA 1U6QA 4TPYA 3B23B 2GTBA 3MNSA 2TGDA 3KQEA 1N8OC 4O97A 1TA6A 4E7RG 7GCHG 1BCUH 1IHTH 2GZ8A 4AN7A 3TLOA 1GJ4H 4OS6A 3BIUH 3LGTA 2XOKD 2ZU4A 4B1TA 3SI3H 1O0DH 4YOJA 1TPOA 3F3BA 2THFB 5JYIA 1QNJA 1D4PB 1SGIB 4DG4A 2XW9A 1UHBB 4K60A 4KTCA 4E06H 2WSSD 3RXDA 4X2WA 1FY4A 3LIWA 2GV7A 1SOZA 1ZMLA 3MH6A 2HPPH 3A8BA 1ELTA 2AHME 1WUNH 3BTFE 4WJG2 2A4QA 1JXPA 3A8DA 3RC6A 4P00A 2Y6TA 1CA8B 2NU3E 1O3JA 1KXCA 1T8MA 5JBCS 3GY4A 4B6EA 2H9HA 2XTTB 3U98H 1EOLA 1YPJH 3QWCH 3F0OA 3L3TA 3T28A 1NFUA 5JDUB 1UVOA 2H9TH 1KXBA 2HNTE 4Q63A 2BMGB 2FX4A 1DOJA 1S82A 2ZCHP 9LPRA 5C2ZA 1SLXB 1E38B 2O8MA 4IGDA 1BA8B 1V2RT 4O9VA 1H8HD 1XKBC 1O5FH 1O2OA 3QK1A 1DANH 1J15A 1IQEA 4WMFA 1S6FA 1O2RA 4ZUHA 1GI5A 1TMTH 3RXTA 3ENSB 2OP9A 1K1PA 1MQ5A 1P12E 5EQSA 5AVDA 3ZZ8A 1GL0E 1OP0A 2ANYA 2ZCLP 1WDIA 2EY4C 1DSTA 3M37A 1QCPA 2FI3E 5EXNA 2JJ2D 2CHAB 1EKBB 1K9OE 3NKKA 5L30H 3A7YA 2OINA 2UWLA 1AQ7A 2B8OH 1WCZA 2G52A 1Y5AT 3F2FA 1AVWA 2CHAC 3A82A 1VKYA 3B9FH 3ZVEA 5T6DA 3TK5A 3A85A 3UY9A 4QT8C 5A0BA 1C5SA 7GCHF 1DY9A 2HLCA 2UUFB 3ATKA 3ZVDA 3T25A 2G4UA 1FNIA 2WYGA 3P8FA 7ESTE 4LK4A 1SGQE 2BZ6H 2VWMA 3TIUA 3BEIB 1BQYA 4KELA 1HB0B 1C5VA 3DUXH 5FXLA 5DP9A 1GBTA 1SHYA 2LPRA 1FPHH 4B74A 8ESTE 2QF3A 2G51A 2OD3B 2HVXA 3RDZA 1O3FA 1GVKB 5AHGH 4ACBA 3PV4A 1CGJE 3H7OA 3L33A 2C8XB 2BDHA 3M5MA 4GSOA 3JZ1B 1EZUC 3MNXA 1UK4A 1UVUH 3MMGA 4MPVA 5DP8A 3GY3A 1LKBA 5GCHF 3KYFA 3S69A 1THSH 2ZQ2A 4X1PU 1HGTH 4BTIB 3D23A 3PV5A 4JYTA 1BT7A 1T8LA 2I6SA 1TX6A 4ABGA 1RTLA 3BTKE 1G9IE 3BTQE 4OS1A 2GCHG 4ZKSU 2H5CA 4B2BA 3EA9A 4DT7B 5I25A 4TPIZ 8KME2 3S7KB 1GI0A 3ZZ6A 2CK3D 4Y8ZA 1AZZA 1LHFH 2WPMS 2ZFTA 5FX5A 4NIVA 2B0FA 2CJIA 1AO5A 2FOMB 2ZDMA 1YGCH 1HBTH 1PPCE 4HI3A 4TY7A 4ABHA 1BBRH 1QRZA 3MO9A 1XXDA 1V3XA 2EI8A 2CN0H 3SORA 2ZTYA 1WTGH 5I46H 1P02A 2JH0D 2UWOA 4FUBA 3K65B 3E90B 3U1JB 1TA2A 1YPEH 1YPHE 4K8BA 2TIOA 4U01A 1S5SA
chains in the Genus database with same CATH topology
3OY5U 1GDUA 5DKMA 4OGXA 1D6WA 1JMOH 1DLEA 5J4QA 2BDYA 2WUCA 4DIHH 1MU6B 3B8JA 1ABJH 1LVOA 4X6PA 1G30B 1NY22 2QF0A 1KLTA 3P70B 3LOXA 1C5WB 1PYTC 2ANKH 4Q80A 1QRWA 2CXVA 1TBZH 3RUOA 1DY8A 1ESTA 1FY8E 1GBBA 1DXWA 4D9QA 2FWWA 5T3HA 1ANBA 1CT0E 5E0HA 3I78A 2AEIH 3P95A 1OWJA 4JZDH 1FV9A 4JZFH 1D6RA 1H9HE 2VWNA 4J1YA 3PYHA 1GHXH 2A45B 1H4WA 1LCYA 1EAUA 5LH8A 1V2QT 2J92A 1LVBA 4B2AA 3RC4A 2ZGHA 2ZGJA 3GCHB 1NS3A 2BM2A 3V3MA 2LNCA 2GCHF 1Q31A 3MO6A 4JZEH 2SGFE 3SU4A 4YZUA 1G2MA 1ZJKA 4BTUB 3TNSA 2VVUA 3VXEH 1S81A 3GCHC 5AF9H 1IQKA 1JIRA 4A1TA 1V2UT 3HKIB 1TNJA 2Y80A 1ETTH 5ESTE 4ISIH 2ZPRA 1RTKA 2ZU5A 1GBIA 1KLIH 2J2UA 1MH0A 3TJNA 1GI1A 1AVGH 4K69A 1YCPH 2OUAA 1KSNA 2W3IA 2H1UA 2CV3A 4HFPB 3PMHB 4R8TB 1DVAH 3A83A 2NU4E 3TGJE 2GT8A 1XUGA 2OQUA 3ATWA 4FUHA 4Q7YA 1O2WA 3A81A 1DXPA 4X6MA 1UTPA 4BAQB 5EPNA 2JH5D 5HYOA 1O3EA 1SOTA 4MPWA 1C1UH 1QJ6B 1V2VT 2FTLE 1ARBA 5JBAS 1G2LA 1LMWB 1SPJA 1RTFB 1MCVA 3KQCA 4I8KA 3RU4D 4THNH 4Y6DA 4ISHH 3P17H 1SC8U 4FUEA 4O03A 1TE0A 2GP9B 1A1RA 2PGBB 3VPKA 1W0YH 2V3OH 1C5UA 1GBKA 3UWIA 2FDAA 4I32A 1GBAA 3SUEA 3A87A 1BTHH 1J16A 4FUFA 4YLUA 2ANMH 3DT0H 3MU1A 1KXAA 3SUGA 4D7GA 1UMAH 1QQUA 1VITG 3NXPA 1EZSC 4FUGA 5C1XA 1CSOE 5AFZH 5DG6A 3PMJA 3BTDE 3ZVGA 3QDZB 1KY9A 2BD8A 2Z9LA 3QTOH 3KQDA 2AH4X 3MNCA 1XUJA 2ZU2A 4ZMAH 1TX8A 4WH6A 3T27A 1GHBF 4K1TA 4HZHA 2V0BA 3BSQA 4A5TS 3RXJA 1HAPH 2BX4A 1AI8H 1BMAA 1L0ZA 2OQ5A 4XSKU 3ZZ9A 1SB1H 5JB9S 2JETB 3SV2H 1UTQA 3A8CA 1K1MA 3Q00A 1BOQA 5JB8S 1TQ7B 1GHZA 4Y7AA 1L1JA 2GT7A 3MU0A 4GUXA 2FOAA 4BXSA 1SHHB 2ZZUH 3EYDA 5JBBS 2PTNA 2GGVB 2JETC 2EI6A 1BRUP 3PO1B 4MNVA 3BEFB 2PWXA 3FP7E 1J8AA 2PV9B 2ZHQH 2ZTXA 1WAYB 3QX5H 3FVFB 3FP8E 3UPEA 4JZ1A 2RDLA 3PO1C 1UO6A 3SU6A 4ZXYH 1LO6A 1VR1H 4ZXXH 1YCPM 5DK1A 1O2PA 4FVBA 3KHVA 3RMMH 1MTNB 3UFAA 1TPAE 3KF2A 5DP4A 3RXQA 3U8RH 4D7FA 2XBWA 3ZZDA 1XVOA 3I29A 1LQDB 1MTNC 3TH2H 1WU1A 1QFKH 2ZO3H 1ZOMA 4U30A 1MZDA 1CT2E 3RM2H 1EZXC 1PPBH 1YC0A 2P3UB 2P93A 4BOHA 2Z9IA 3MO3A 1UCYK 4X8TH 2DE8A 2BLOA 1AFEH 4LXBH 1EP5A 4UDWH 1O36A 4IW4E 5L2YH 1TGCA 1IQFA 4AG2A 1EASA 1F7ZA 1NFYA 3QO6A 2ZDKA 1EUFA 3SU5A 1HJ9A 1BHXB 1DWDH 1KLJH 1GHVH 1O5AB 4GPGA 2RA0A 1O3GA 1VITF 1O5BB 2QAAA 4I7YH 1GI2A 4X8SH 1BBRE 1SGDE 3SNCA 2EI7A 1P3CA 3A86A 4BAHB 3OTJE 3QUMP 1GJBB 1W14U 3SU0A 4A92A 3VEQB 3M5OA 3LC5A 4MQAA 1HAHH 1VITH 3NK8A 1MZAA 1YM0A 3HATH 1ORFA 2F9OA 3RXCA 1QJ1B 1J9CH 1T7CA 1O2GH 1C2IA 3NUMA 1UHBA 1CHGA 2TGPZ 3PM3A 1TMBH 4JK5A 1AZ8A 2IN2A 2ZA5A 2W3KA 1HIAB 1Z7KA 4I8JA 2WPJS 5C1YA 3AVZA 2XC4A 3STJA 1MBQA 4Y7BA 3ATIA 4X2XA 2FTMA 2G4TA 1YLCA 4UFDH 4IMQA 1ESAA 2CF8H 1MTSA 2EA3A 3URDA 4FU9A 3KNXA 3TVJB 5EGMA 3BN9A 3M35A 3LGVA 1MBMA 1KYNA 4RKOB 3ZZ5A 1HJ8A 1O3HA 3SOSA 1THPB 1A4WH 1EJAA 2O8UA 2ZIQH 3ZVCA 2ZDNA 4NA9H 3SNEA 3VGCB 1T4UH 2J94A 3AW0A 2ZHWH 2BOHB 5F8TA 5TJXA 1VCQA 8GCHG 1GMHG 1BTXA 5CMXH 1LHCH 1G32B 3FAOA 4ISOA 3P8NA 3ZZBA 3VGCC 1V2MT 5EXMA 4X1RU 3LONA 1Z1IA 2ZDVH 1IAUA 1QBOA 2FEQH 4BANB 1FONA 1N1LA 2AMQA 1G37A 2FESH 2FZZA 2XWBI 4DGJA 2Z7FE 4O3UA 3GDVA 1CT4E 1O35A 3KL6A 1FXYA 1F92A 3SV8A 1GHAF 4AFSA 3RXMA 2OBOA 1D3DB 1BDAA 3MH4A 5EG4A 5E8EH 1YLDA 1TWXB 1A3EH 3RXEA 1TNIA 1P09A 1YCPK 2VH0A 2Y81A 4GCHG 1OX1A 2PGQB 2VINA 3UOPA 3MH5A 2AMDA 1UTJA 1WTHD 2BDIA 4UFEH 3ZV9A 1OP8A 2FO9A 3KN2A 1GBDA 2PSYA 3BF6H 5LPRA 4MNYA 1C2EA 3CS0A 4NSVA 4D9RA 1SQAA 2PSXA 4MVNA 1O33A 2BD2A 2BD5A 4Y8XA 1TPSA 4FU8A 1THRH 4I8GA 3ZZCA 1XM1A 2HGTH 3N7OA 4Z0KA 1O2YA 4AYVB 1JBUH 2FP7B 6ESTA 1MCTA 5GPIB 1LPGB 2ZP0H 2G5VA 3UQOA 5C20A 2SNWA 1L2EA 3RC5A 1AFQB 3W94A 1JOUB 1BITA 5FPTA 1TGTA 3SHCH 4DVAU 5EQRA 1D3QB 2O8LA 1AFQC 1C5PA 4INKA 1F0UA 1ELBA 1RFNA 2BQ6B 2YNAA 1OWKA 1C5ZB 1SGCA 1LHEH 3LH1A 3P6ZB 3WY8A 1LVYA 4ZHLU 1LQEA 3UQVA 1Y5BT 2ZU3A 1HAYB 4FUIA 1K22H 4I8HA 1SFIA 2PTCE 1CO7E 1GI6A 5EODA 2VVCA 2PKAB 5FAHA 8GCHF 2CGAA 3GDSA 1LHDH 1YYY1 1HAOH 1B5GH 4OS5A 2A4RA 2GVFA 2FM2A 5HGGA 2A32A 1YPMH 5IYTA 1W7XH 1A61H 2BQ7B 2P59A 5JPMH 3M5NA 3TJUA 4AYYB 4TY6A 3ATMA 2BY5X 2ZHDA 3S0NA 1T31A 3L6PA 2BOKA 1MTVA 1GBFA 1O37A 5FCRA 2QXIA 2Y82A 3SGAE 1KDQB 2ULLA 1ZHPA 1BTZA 4WY3A 3P8OA 2FIRH 3ZZ4A 3FFGA 5JBTA 4ABFA 1ZGVA 2GDDA 5K7RA 3V0XA 1V2KT 1YF4A 3T5FH 4I33A 3SJKA 4MTBA 5FPSA 3M3TA 2Z9JA 1FY3A 4U2WA 1O31A 2BHGA 1GHWH 2A7JA 3ZV8A 4UFGH 1YP9A 4F4OC 2J95A 2R2WU 1WV7H 1AMHA 2FMJA 1HAGE 4X8VH 3U1IB 1OS8A 4ABDA 1DLKB 3UTUH 2BDAA 2WPKS 5EW2H 3HK3B 4ZAEA 2OTVA 4AFZA 4Q2KA 2Z6BD 4AOQA 1UK3A 3BTWE 1CVWH 3MWIU 3A80A 3S9BA 1NRSH 3RMLH 1P11E 1EAXA 2HRVA 1EB1H 4XOJA 3TGKE 4NG9H 2VIPA 5HMAA 1QBNA 3SN8A 2BVXH 2QC2A 3PLKA 1AGJA 2SGPE 2BD9A 1W13U 5FBIA 2KAIB 3URCA 1ZPBA 5FPYA 2NU2E 1N6XA 5L6NH 4GVUA 2GCTB 1HAZB 1ZR0A 2ZFSA 3A88A 4Y11E 3LJOA 3S7HB 1AKSB 1SGEE 1A2CH 4YM9A 3UNQA 1GBEA 5DP3A 1EZQA 1QY6A 2WV5A 2GCTC 3RXHA 1NTPA 3TU7H 1TRNA 1HV7A 1PQ5A 4K5ZA 2BY7X 1JIMA 1SGFG 1TFXA 2H6MA 5CHAB 4AB9A 1C4Y2 3F6UH 3NZIA 1VCPA 3OYPA 3UUZA 4NCYA 3AASA 1C2LA 2HOBA 1V2NT 1E35B 4X1NU 2VWLA 3PTBA 1HPGA 2PUXB 2BB4A 1XUHA 3PLPA 1A5IA 3V12A 1FIWA 1CGIE 2V6NA 2BX3A 1ELAA 3U8TH 1O3LA 1ZJDA 3LGUA 3NCLA 1O2KA 2SGQE 3A7XA 2NU0E 1DE7H 3K9XB 2ZU1A 3SV7A 1C1QA 4NIYA 5IDKA 1FN8A 4K3JA 1HXFH 4AFQA 4BAKB 4CH2B 3SW2B 2R0KA 1TAWA 1P06A 1ZPZA 1TIOA 1QB1A 1LKAA 1SLVB 1SQTA 3GY2A 2FXRA 5A09A 1KXDA 2XYAA 5LGOA 1BJVA 1Y59T 2AFQB 4SGAE 1Y8TA 3M7UA 4XBCA 4LOYH 3MU8A 1F0TA 1NROH 5FBEA 1TNLA 3S9CA 2FODA 4ZHAA 4U32A 3KIDU 1O3MA 2Z9GA 4YOGA 1HAXB 1JRSA 2OBQA 1P2IA 1ESBA 2AIQA 1MD8A 5EPYA 3LDXH 1P10A 3FP6E 2GV6A 2ZPQA 4MDSA 1V2JT 2FOBA 4DCDA 1P2QA 3NPSA 4NIXA 1NC6A 1GBLA 1A0LA 3C1KA 1O2NA 4Y79A 3C27B 2P94A 1ZLRA 3Q3XA 4ZHMU 3QZQA 1HAVB 1GMCG 1ZHMA 3A84A 4UONA 3PROA 3E16B 4DJZB 1FQ3A 2ZECA 1NM6A 4B76A 1XX9A 3UIRA 1V2OT 3BG4B 1E0FD 2QN5T 1UTMA 3M3VA 1ZRBA 1VGCB 1YPKH 3MYWA 1XUKA 2O8WA 1QQ4A 2P95A 2OC8A 1FUJA 1FAKH 2SGAA 1A0HB 3GCNA 3BG4C 1C5OH 1VGCC 1LVMA 3VB3A 3T2NA 1S85A 1A5GH 1C1WH 4JZIA 1P2NA 1IQHA 1GCDA 1IQGA 4FXGH 1A7SA 2TBSA 2G5NA 1EB2A 3MI4A 4NZLA 4D76A 5G4BA 1BRBE 1QURH 1SMFE 2OC1A 3SJOA 1EXFA 1NU9A 4ZROA 4Y8YA 1C5RA 2AIPA 3ZZ3A 4ZH8A 2G55A 4I8LA 3KGPA 1UVSH 1KXEA 1NRNH 2O8TA 1TONA 1NU7B 4VGCB 2A5KA 2BDCA 1GBMA 2V3HH 3BTTE 1C4V2 1O2VA 4OS2A 2J34A 4ABBA 2FOGA 2OLGA 2HALA 4WXVA 5DP6A 3VB7A 4VGCC 3E1XB 2HWLB 2ZF0H 1O3NA 3CP7A 2TPIZ 1O39A 1SQOA 3F9EA 3VXFH 4MNWA 4NA7A 3AAVA 3D65E 3ZZAA 1PPHE 1XXFA 1DWCH 1UVPA 3LT3A 3NWUA 2QXJA 4J2YB 1P8VC 3DFJA 2GZ9A 3A7WA 3SO3A 4D8NA 1PJPA 3PLBA 1RJXB 3LGYA 4X6NA 3RXAA 3FANA 1FY5A 5FCKA 1TMUH 2C8YB 1EJMA 2BY6X 1KTSB 1ETSH 1GMCF 3H5CB 2DUCA 1P9UA 3LPRA 5ESBA 1BHXF 1ELVA 1P2OA 3ZVAA 1DFPA 2VGCB 3BTEE 2IOTA 3ZZ7A 1DWEH 4OS4A 3W95A 2I6QA 1TYNA 2R3YA 4INLA 2PR3A 1C1VH 1HIAA 1OPHB 1ELFA 2VGCC 2QGRA 1W10U 1L4ZA 3FZDA 3UOUA 1H8IH 2FOEA 2H9EH 1DDJA 2YOLA 1O3DA 4KTUA 3HPTB 1GJ9B 1NESE 4TWWA 1O2HA 3LH3A 2D1JA 3RU4E 2OCVB 1WSSH 1BZXE 1BRAA 3BIVH 4CHAB 3RXPA 5K0HA 5F6MA 3O8RA 2GD4B 1GMDG 4A1VA 3SUFA 1GBJA 1GHYH 2YNBA 4CHAC 4YLQH 2ZKSA 1PPGE 1OXGA 1O5GH 4NSYA 1C2JA 2XC5A 1C5LH 2ZWLH 1VJAU 3SQHE 5C5NA 2PW8H 1IOEA 1TB6H 1O2SA 2W5EA 1DICA 1P01A 1SGTA 3Q3YA 1ID5H 3O8CA 5C1UA 1GL1A 2VIOA 4Y71A 1BMNH 1XUFA 1GJCB 2VIQA 2ZTZA 1NZQH 3SJ9A 2PHBA 1FZZA 1AE8H 1CU1A 1NN6A 1SBWA 1O5EH 4FVDA 2W26A 1GGDB 3HK6B 5EQQA 5ETXA 3TJVA 1IQMA 7KMEH 3ESTA 1BMMH 2A4OA 1DS2E 1HAIH 2CMYA 1C1OA 2AMPA 1YPGH 1O3AA 1GGDC 2TGTA 3RXBA 1S6HA 2D26C 1BTWA 3T26A 1VZQH 1L1NA 4WMEA 2R9PA 3IITA 2F9UA 3E91A 2JKHA 4NZQA 2C3SA 1BBRK 2WPHS 4ABJA 4TYDA 2C8WB 3QGJA 1F5LA 4MNXA 3UNSA 2A5IA 4A6LA 4JYVH 1TRYA 1RD3B 4IC6A 1WOFA 1H9IE 1FAXA 1P2JA 2FI4E 2W7UA 1Q2WA 1AUJA 3MHWU 1BMLA 1ZMNA 4HGCA 4PROA 2VIVA 3OX7U 1MKXH 1O32A 2WINI 3KEEA 4JCNA 1SG8B 1E36B 1XUIA 4H4FA 2A4GA 1EPTB 5ABWA 3TK9A 1OOKB 2B5TB 1IHSH 5BPEA 1AU8A 3QN7A 1GMDF 3E0NB 3Q76A 4A7IB 4RN6A 1QGFA 1TNGA 1EPTC 1F5RA 2BQWB 3RLWH 2PKAA 1Z8GA 1E34B 5F8ZA 2A5AA 1IQNA 1GI8B 4CRGA 2G00A 2EEKA 1D3PB 1ZSJA 2ZHEH 5A2MH 3F9GA 4DY7B 1TGSZ 3RLYH 6GCHG 3V7TA 1K2I1 4ZKRU 2FYRA 3HGNA