1OWEA

Substituted 2-naphthamidine inhibitors of urokinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
publication title Identification of Novel Binding Interactions in the Development of Potent, Selective 2-Naphthamidine Inhibitors of Urokinase. Synthesis, Structural Analysis, and SAR of N-Phenyl Amide 6-Substitution.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1oweA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1oweA01
1ZMNA 1O3BA 3C1KA 5A0CA 1CGHA 1IQFA 2C4FH 4Y8XA 1G37A 1RGQA 1QURH 4X1PU 1C5PA 3SV2H 3TIUA 4XFQA 1T8OA 2XXLA 1GG6C 4XBBA 3VPKA 5DJ7A 2OUAA 4NA8A 3ATIA 1GVKB 5DGJA 2BXTH 1L4DA 4K2YA 1LVBA 1O39A 5SGAE 1EKBB 3SNAA 5F6MA 3RXJA 1C1OA 4I8JA 3RMOH 2QF3A 1IQGA 2GT8A 1ZR0A 4IMQA 3V13A 1P3CA 1H8IH 3M5OA 1GWAA 1GJ5H 2QN5T 1Y3VA 1LKBA 2FOCA 3UQVA 6CHAB 4X6MA 4AG2A 4HZHA 1TOMH 1NU9A 1BRBE 1QFKH 2Y80A 3MTYA 2JETB 1HLTH 5HXFA 1AB9C 1O5EH 1CHOF 1ZRBA 1NROH 2ANMH 3M61U 3PMBB 1G3EA 2G4UA 5JPMH 2CF9H 4INHA 3TGJE 1GBKA 3RM0H 4KP0A 3K6ZA 2VWNA 5FX5A 1A3BH 3DUXH 2FTLE 1G3DA 1SLVB 5HMAA 2BDAA 2BM2A 1NT1A 4YT7H 1FV9A 3TGKE 3SJKA 1OP8A 1BJVA 3MNCA 3SJOA 2R2MB 2Y5FA 1ANEA 1GPZA 1HAPH 2BDBA 2M5TA 2PTNA 2Z9LA 1PQ7A 4FUHA 1HBTH 1UCYK 1TRNA 2H9EH 1WCZA 4Y76A 5FX6A 1THRH 1UCYH 1DM4B 4MDSA 4BAKB 4DG4A 3SNCA 2ZC9H 1TYNA 1JRTA 4DJZB 1GMCF 1FY5A 1AZZA 2BX4A 4JZDH 2A0QB 3PTNA 1WAYB 3E0PB 1IHTH 3QUMP 3BG4C 1SSXA 1QBVH 2P3FH 1DOJA 3OY6U 3MU8A 1HAOH 1AE8H 2ZHFH 1AD8H 3EA9A 1ELAA 1MQ6A 2XTTB 4CREA 2ZTZA 3M36A 4NG9H 2VH0A 1EZXC 2A5KA 4X0WU 3ZZCA 1O5BB 1T8MA 1ZPCA 1O5CB 1XUJA 1A2CH 3PO1C 5CMXH 5J4QA 2SGAA 1V2PT 3V3MA 3RXGA 1VITF 2OC7A 1SPJA 1O38A 5C20A 5L2YH 4A1XA 1QRWA 1LVMA 3RC5A 3JZ2B 2RA3A 2AEIH 1V2ST 1DSTA 1YP9A 1ZTKA 4J1YA 3SNDA 4YT6H 1YC0A 2ZGXH 1W3CA 4AFUA 2GGVB 4ZKNU 1ZTJA 1TQ0B 2A7HA 1C4U2 3RXEA 5EW2H 3E90B 4DGJA 2XBYA 3Q77A 4B71A 4UEHH 1V6DA 2VIVA 4UD9H 1DXWA 2HNTE 4I32A 1KXFA 5T6DA 2BD3A 1QRXA 1JBUH 1CA0B 1O5DH 1UO6A 3MU0A 3GDVA 1WBGB 1QA0A 1UHBB 5C5OA 1V2TT 4YOIA 3M5MA 2PGQB 1MTNB 3P70B 4Q7ZA 1BIOA 3SV8A 1MH0A 1DPOA 1D6RA 1TPAE 2BY9X 4UE7H 1SR5C 3RP2A 1ZZZA 1D6WA 3QDZB 4O9VA 2F9OA 3EDXB 1GI0A 1KDQA 1QB9A 1FXYA 1MUEB 2O9QA 2ZO3H 4MPWA 1FY3A 4Q2KA 2GCHG 2GV7A 2BMGB 2FI5E 1O3CA 1ZTLA 4Q80A 2NU2E 1DDJA 2AMQA 2UUKB 2A4OA 4CRGA 1AVGH 2WINI 4B76A 2PSYA 2ULLA 1DLEA 1W13U 1NU7B 3T28A 1BRUP 3ZVGA 3SGAE 2LNCA 2ZPQA 1GCTC 3R0FA 3ATKA 2YNAA 3SO3A 1PPGE 3SOSA 1RFNA 1UTQA 2GMTB 2A32A 2Z94A 3B9FH 3A89A 4Y10E 1GJ6A 5T6FA 4K8YA 1DITH 4GHTA 1P02A 4ABDA 2EEKA 2A7JA 1S83A 2W7SA 2C8ZB 1NRSH 1GVZA 1EPTC 3RM2H 4X8VH 3B23B 3MO3A 1TMUH 2ANYA 2ZDVH 3Q76A 2BOHB 1XUKA 1DWCH 1B5GH 1G3BA 1GHAF 3A7WA 3S9CA 3U8OH 1RRKA 1ZMLA 4YOGA 4HTCH 3RXIA 1O2NA 3UNQA 4X1SU 2QXIA 2PTCE 2H9TH 1KXCA 1LHCH 1KXBA 4K1EA 1C2GA 3AW1A 5JB8S 4RN6A 3QZQA 2UWLA 4WH6A 1ABJH 1P2QA 3RXTA 1UK3A 1TX8A 3URDA 2FOHA 6GCHG 1DWBH 5EOKA 3HK6B 2CXVA 1O2YA 2FESH 4X8SH 1BCUH 1NM6A 2Z3CA 1Z8IB 1C1QA 3RXPA 2QXJA 4GCHG 1O2VA 1RS0A 3LT3A 3BG8A 1PPZA 3BV9B 3NUMA 4JZEH 1KXDA 1O3IA 3QGJA 1QJ7B 2ZFPH 1EX3A 1O2XA 2ZDNA 2AERH 1QA7A 1PPCE 4MPUA 4NSVA 1UVPA 1FLEE 4ZROA 5A8XA 1O3NA 2ZHDA 1P03A 2J94A 3BTME 1CBWB 2OP9A 1IQIA 1GMHF 4O03A 2XBVA 4FUJA 4BAOB 1O2MA 5LGOA 3SV7A 5DG6A 3VXEH 2WPHS 1ZRKA 3P8FA 1HAXB 2O8MA 3ZZ9A 3SJ9A 1QL7A 3TVJB 4WMDA 1UK2A 1V2WT 3EYDA 3RXLA 4ESTE 1CA8B 1HAHH 3KHVA 3MYWA 2Z9GA 2B7DH 2A5IA 2J2UA 3K65B 3R3GB 1J17T 3QLPH 3AW0A 4OGXA 2SGDE 3UIRA 4ZKOU 1UMAH 2XWBI 2Q1JA 1LQDB 2W26A 1AHTH 1SGTA 1D4PB 3ATWA 1W11U 1XKBC 1KIGH 1WTGH 1NRRH 2Z9IA 3LGTA 3LONA 3ZZAA 3D49H 5HM9A 2CF8H 3E16B 1AKSB 1UTPA 1NS3A 3UTUH 2SGQE 2H1UA 3SUDA 4Y7AA 1GGDB 3ZVEA 1O3LA 3S9BA 2FP7B 2PKAB 3I29A 1O5GH 2ZU2A 4BAMB 5DP6A 1LHDH 2C8WB 2K1QA 1UTNA 4ZKSU 4KTUA 3GDSA 1YPHC 1ELCA 5CHAC 3SU5A 4ZMAH 3L3TA 1BTPA 1EJMA 2SGFE 1SLXB 1CT2E 2ZTYA 3TJOA 1NFYA 3TH2H 4O3UA 4LZ4B 4WF8A 1KXEA 2BVXH 1T8LA 2V6NA 3PMAB 1TMBH 1DICA 1WUNH 2FOBA 1E34B 1Z1IA 4LOYH 2J9NA 4AFZA 1FY4A 3NK8A 4IN1A 1PQAA 1ZHMA 1FY1A 5GCHF 1WQVH 1TNJA 4UDWH 1VCWA 1BUIA 1TBRH 1VGCC 4DCDA 1SG8B 1FI8A 1RXPA 4FU9A 1IOEA 3ZZ8A 1J8AA 6ESTA 4MNWA 3ZVBA 3ZZ4A 4XBDA 4H4FA 2PW8H 2Y5GA 1JMOH 1OKXA 4MNYA 5C2ZA 5G4BA 2C8XB 1V2KT 1T31A 4BNRA 1IAUA 1C1TA 5L6NH 1ZPZA 3CP7A 1O37A 1WTHD 2KAIB 3RU4T 2OC1A 1GI7B 1O2RA 2A2QH 1GMDG 3S7HB 2WPJS 2O8WA 5J4SA 4NZQA 3SN8A 1TE0A 1SBWA 4U2WA 1HYLA 4D9RA 1C2LA 4FU8A 2O8UA 1QBOA 1O3FA 1OWDA 2FO9A 1A5IA 1GDNA 4E7NA 5FCRA 4R8TB 2RCEA 1QNJA 3ELAH 1TRYA 3MU5A 3UNSA 5EPNA 1Y5AT 2STAE 5CE1A 5LPEA 3RMNH 5ETXA 1XX9A 2ESTE 3ZZ7A 1V2OT 2DUCA 1V2JT 2WPLS 5I46H 2A1DB 3DD2H 1VJAU 1SGIB 3MO6A 1INCA 1RIWC 2AGEX 4ZAEA 5C67A 2PWXA 2FEQH 2XWAA 5EQSA 1ELVA 1O35A 2HWLB 2Y81A 2ZFSA 4WWYA 1F5LA 2FYQA 1UVSH 1S85A 3VB7A 1OWIA 1MTWA 2TRMA 4D76A 4TWYA 1EB2A 1GBFA 1L2EA 1YCPK 1HXEH 3M3VA 1KXAA 1YCPH 1D3DB 1P01A 3TJVA 3PLBA 3ZVAA 1YYY1 2A31A 4I8GA 3BEUA 3BTFE 3ZZ5A 4Y8YA 2BHGA 1OWKA 3SQHE 2PKSB 2FMJA 3TITA 5EQQA 4CRDA 5I25A 1KTSB 2BD2A 5DP8A 2B5TB 4TY7A 1T8NA 1GJDB 4X6PA 3L6PA 4CR5A 2EA3A 1C5NH 1YBWA 2SFAA 3KQDA 1P2KA 1TNKA 3QTOH 1BRCE 1ESBA 3SNBA 2Y6TA 2UWPA 3EE0B 2F83A 1CU1A 1SB1H 1ACBE 1SGDE 2Q6GA 3A87A 1SFQB 1QJ1B 1FONA 1L1NA 4GSOA 2QY0B 3GYLB 1TNIA 4OS1A 1GI9B 1HV7A 2OINA 4K60A 3MNXA 3D23A 1Y8TA 1O30A 2VU8E 2WV5A 4VGCC 5LH8A 4AORA 1AUJA 1HB0B 4DIHH 2HVXA 3CS0A 4OGYA 1E37B 1SC8U 3F9GA 1C2FA 2W7UA 3S7KB 4KGAA 4B1TA 3TNSA 1E36B 1RJXB 5DKMA 2TGDA 5FPYA 2H6MA 3LKWA 1JIMA 1SVPA 1GL0E 1SL3A 1N8OB 1O2LA 3H5CB 1OWHA 2SNWA 1PPHE 3FP8E 1O3PB 3MH7A 4NIXA 1L1JA 1F7ZA 3RUOA 2GCTB 3I77A 4CR9A 2ZWLH 1O2QA 1FUJA 2J34A 4GHQA 3MWIU 4WVPE 4BTUB 1BQYA 1TONA 1LHFH 3BEFB 3RXAA 2VINA 3ENSB 4WJG2 3UPEA 3EQ0H 3GOVB 1TPPA 2ZNKH 5EQRA 2VIDA 5F8ZA 1C9TA 4ABAA 3EAJA 1A4WH 4MNXA 3PYHA 2AYWA 1FNIA 3PTBA 2C3SA 4YLUA 1UTKA 1ZLRA 1XUHA 3CENA 4TY6A 2C8YB 4UFGH 4H6TA 3O8BA 5C1XA 1W8BH 3FZZA 1IQHA 4ISLA 1GDUA 1TFXA 1SQOA 1BMNH 3ZVCA 4A92A 3EA8A 4B2CA 4ABGA 2WPKS 2ZU4A 1SGCA 2GZ8A 2QF0A 1AFQC 1Q31A 1G2LA 1TA2A 1EP6A 2ODYB 2VGCC 2FI3E 3PMJA 5EGMA 4FUGA 3P92A 4AZ2B 1NPMA 4BAHB 4CH2B 1UTMA 2FOMB 1PPBH 3PO1B 1GBEA 3SHCH 1N6XA 3PM3A 3SJ8A 1VITG 4UONA 2ZFTA 4X2YA 1GHBG 4SGBE 1P8VC 2C90B 1FAKH 2SNVA 4Y6DA 2Z9KA 1LVOA 1K1NA 3P8NA 2J4IA 1QY6A 2W5EA 1RTLA 3BF6H 1ETSH 1NO9H 1XUGA 2I6SA 2SGPE 1NFUA 4FXGH 3Q3XA 5E0JA 1JWTA 2A5AA 1BBRE 3MOCA 5TCCA 1GBMA 3TH3H 7ESTE 2FWWA 2Q6DA 2ZQ1A 2ZA5A 3RXUA 5F8XA 1BTXA 3VB6A 2H5DA 4DOQA 2IPHA 3AAUA 3SU3A 3M5LA 1GI1A 1E0FD 2XYAA 3DFLA 3ESTA 8GCHG 3NZIA 1VR1H 3SGQE 1P9SA 4B74A 1GBTA 1GHYH 3GCTF 1G3CA 4NCYA 1O2HA 2HALA 2HGTH 3RC4A 2B0FA 4ZUHA 4DY7B 1VCPA 4X1RU 3SV6A 2ZPRA 1C1UH 1HAYB 4BAQB 3I78A 4CRBA 1NTPA 3ZYDA 2JETC 2QYIA 1HAVA 2VWOA 1BT7A 2XW9A 3FVFB 1P09A 1BZXE 1MQ5A 1O2KA 4ISNA 1A1RA 1W0YH 2WV4A 1ANBA 3SQEE 1P9UA 2B9LA 1C5WB 4MLFB 3TGIE 1YGCH 5FCKA 5C3NA 3BTEE 1W14U 3MHWU 4QT8C 1YCPM 1EPTA 1D3TB 2BOKA 3TK6A 2PR3A 4JCNA 2QGRA 4Z0KA 2DE8A 4YTAA 3BSQA 2CHAB 3K2UA 3G01A 2VJ1A 2TGAA 2F3CE 3TNTA 4AG1A 1Z1JA 3RXDA 2F9VA 1Y59T 1HJ9A 4IGDA 3RXBA 3NWUA 1GBAA 1SQTA 1E35B 3U1IB 1IQJA 1UHBA 3GISB 2GKVE 1ESAA 1IHSH 3KGPA 1ETRH 1TNHA 2BB4A 1EXFA 1DLKB 1P10A 3KF2A 3MNSA 1S5SA 5JBBS 3UREA 4KTSA 1LKAA 1ZMJA 3SUGA 2A4GA 3T29A 2Z3EA 4YZUA 5A09A 3W94A 3F6UH 2G00A 1UCYE 3LIWA 3BTDE 3MMGA 3RXHA 9ESTA 1FY8E 3MNBA 1CT0E 4I8LA 3A82A 1O2SA 1LHGH 2BY5X 3FAOA 4FUCA 2AH4X 3RXVA 3VXFH 4WH8A 2GP9B 4BXWA 3QO6A 4AFQA 4NWLA 2BY8X 1H4WA 1JRSA 2ZCLP 5FXLA 1A5HA 3LH3A 3ZVDA 1F5RA 1GBLA 1C5SA 1W2KH 1TX6A 4Q7YA 3MU1A 3HK3B 1AQ7A 2OQUA 3LH1A 1OPHB 2BY7X 2ZDMA 2BQWB 4NWKA 2AIQA 1HJAB 4Z6AH 5JB9S 4A6LA 2ODQA 1KYNA 2TBSA 2HPQH 1GBBA 1JIRA 5C5NA 1AU8A 1GMHG 3SGBE 5JBCS 1GI3A 3RXCA 4I31A 3E3TA 4FU7A 2F91A 2QIQA 3A84A 3UNRA 3GICB 1BITA 5EPYA 1CA0C 2NU3E 1ZGIA 2EI7A 1HIAB 3A83A 2OQ5A 3LGVA 1DWEH 2RG3A 2G5NA 3MO9A 4U30A 1MTNC 1XXFA 1C1RA 3F9HA 1BRAA 4A7IB 2DE9A 2BYAX 2BD9A 2FX6A 3M3TA 2QXHA 3BTHE 1OS8A 3RXFA 3KEEA 1EAWA 3GYMA 1PFXC 1O2PA 4XBCA 4KTCA 1CGIE 5A2MH 2ZGHA 1QQ4A 4MQAA 1O2ZA 2G4TA 1G9IE 3KQEA 4HGCA 1NN6A 3TK9A 3PLPA 1TOCB 2FS8A 3ZV9A 2CMYA 1K1JA 4ZHMU 1W0ZU 5LPRA 1HFDA 1C5XB 1Z8JB 3ZV8A 2TIOA 1AY6H 3A7YA 1GJCB 4TWWA 1O0DH 3GCOA 1QJ6B 4Q7XA 4THNH 2ODPA 2BDCA 4U01A 1YPEH 2SGEE 1A0HB 4WMEA 5CHAB 1P2JA 1P05A 4B2AA 2VWLA 1NESE 4NIWA 3SU4A 2GMTC 2NU1E 1AGJA 3HKJB 1O3HA 2FX4A 3RU4D 2ZF0H 1O31A 4X2VA 3STIA 4AYVB 1Y3UA 2WYGA 4BTTB 1B0EA 4JYUH 5GWZA 4E06H 3GCHB 1ETTH 4DIIH 3ZZ6A 1BTHH 1P3EA 1F0UA 1MAYA 3O8RA 3NPSA 1QB1A 2YNBA 4GAWA 4YESB 4R0IA 1ELEE 1C5QA 1C1NA 1GL1A 1GHXH 1KTTB 1GHWH 3MH4A 4UFFH 1PQ5A 3UR9A 3VB4A 3F9FA 1P11E 3EGKH 3LGUA 1FDPA 1QGFA 3A80A 3SU1A 3V7TA 2UUFB 5DP9A 1F0TA 1NC6A 2FI4E 1PQ8A 3ATLA 5FBIA 3U9AH 2VWMA 2LPRA 3P8GA 3GY7A 4U32A 2FIRH 5DP3A 1CT4E 2H5CA 3M7UA 3SU0A 1MD8A 2PKAA 2QAAA 2B8OH 4BOHA 3OTJE 1C5ZB 1FQ3A 4CHAB 1WYKA 1BTWA 4AB8A 6LPRA 1WOFA 1GJBB 4IW4E 1O3JA 1H9IE 3OU0A 5HM2A 4UFEH 3A7XA 3M5NA 5TCAA 2J95A 3RU4E 2R3YA 3GY5A 2BTCE 2BD8A 5EXNA 1QL9A 2AGGX 2ALPA 7GCHG 2IJOB 2ASUB 5C1YA 1C5LH 2D2DA 1CBWC 1ZHPA 1NY22 1AVXA 1V2VT 1GI8B 5FPSA 4CRCA 1ELFA 1Z7KA 3Q3YA 5GDSH 5GXPA 2ANKH 2BLVA 4FUBA 1GJ9B 1KSNA 1EJAA 2P8OB 5AVDA 3E6PH 1D3QB 2ZFRH 1DFPA 2I6QA 4K69A 3QWCH 5ABWA 1VITH 2J92A 3A85A 4KKDA 1B7XB 5L30H 1S81A 2XC0A 1HAIH 3SUFA 5DP5A 2PSXA 3DT0H 1O3DA 4B73A 1L1GA 1SOZA 1AFEH 1DVAH 1Z71A 5DO4H 2OBQA 5DK1A 1MZDA 5JDUB 1O5FH 1FZZA 1DS2E 2KAIA 2F9PA 1LCYA 3A81A 3U8TH 2PHBA 3SU2A 3QX5H 2Y7XA 2AIPA 4D9QA 1TPOA 1MU8B 2EC9H 4ABJA 1XM1A 1TBQH 1C2HA 3E0NB 1FMGA 2ZCKP 2EI6A 3SHAH 3IG6B 3V12A 1SFIA 2GZ7A 1AWHB 2A45B 1XKAC 3MH6A 2WPIS 1SHYA 1MMJN 3ATMA 4YO9A 1TRMA 4FUEA 1NRPH 1DANH 5PTPA 3MFJA 1ELTA 3SU6A 1Z8GA 1C2DA 2P95A 4CRAA 4KELA 1HRTH 1PYTC 1O3OA 4ABEA 2ZDKA 3VEQB 4DVAU 2VIWA 5FHTA 1HAGE 4ISHH 1OYQA 1WV7H 3SORA 5FBEA 1YPHE 1TGSZ 4I8KA 1DE7H 1LQEA 1D3PB 3IWMA 5EG4A 2ZQ2A 5DP4A 1ARCA 3RMMH 2A2XH 2BZ6H 1YKTA 2GD4B 1U6QA 5LPFA 1V2LT 3ODDA 1FJSA 4IN2A 2Z9JA 1MTVA 4E7RG 3GY3A 1K2I1 1C2MA 2WUBA 1P04A 4Y0YE 2TGPZ 5HYOA 1P57B 2ZHWH 3VGCB 1MKWK 1MZAA 1GDQA 3GCNA 1HUTH 1H8DH 1MKWH 1OP0A 5FPTA 4AOQA 1QQUA 2G5VA 3K6YA 4ZHLU 4WXVA 1MBQA 4NIYA 1LDTT 1K22H 1A5GH 3MI4A 4Y71A 4XDEA 4YOJA 2OTVA 3LC5A 2HOBA 1UVOA 3LGWA 1CQQA 3EA7A 4NFFA 5GJ4B 1GCDA 4JZFH 1Y5UT 1SGQE 3Q3KA 4Y11E 2PGBB 5F03A 1GG6B 3DA9B 3RMLH 4FUFA 4ABFA 4E05H 1PPEE 4DW2U 4Y8ZA 3UY9A 1GI4A 1AI8H 1BTZA 2XRCA 1O2IA 1A0JA 2ZP0H 5ESTE 1ID5H 1C5UA 3T27A 3AASA 2OBOA 2QXGA 3RXOA 1M9UA 1T4UH 2BLQA 2BQ7B 4BANB 4A5TS 4O3TA 3UR6A 2ZI2H 2R2WU 1AUTC 1Y3YA 1P2MA 4K8BA 2OLGA 1AB9B 2FTMA 3LDXH 5EXMA 1AO5A 1CHOG 2ZEBA 1EAIA 2BDIA 4I7YH 2Y82A 3HATH 2BY6X 1VJ9U 3KL6A 4I33A 4AB9A 1HCGA 2P16A 2ZFFH 1YLCA 3SNEA 5BPEA 1AE5A 5A8YA 1VCQA 2XBWA 1F5KU 1GBCA 1O2UA 1Q3XA 3HKIB 5B6OA 1FAXA 1HGTH 2PKSC 1C2IA 3M3SA 1K1IA 3LJOA 1TIOA 5K0HA 4MVNA 3BTWE 1TQ7B 3BTTE 3S0NA 3V0XA 1TWXB 4INLA 1LPGB 4GUXA 1L4ZA 3LOXA 1GMCG 5E8EH 4AN7A 1NZQH 2PV9B 1TX7A 1KLJH 3RXSA 3BG4B 3PWBA 5EW1H 1O36A 4XE4A 1ZPBA 1DXPA 1DT2A 3T25A 4FVDA 1SLWB 4F4OC 1AWFH 3GY6A 1EZQA 3M7QA 1V2QT 1SOTA 3Q00A 4ZH8A 2ZKSA 3KN2A 2V0BA 2F9BH 4RKJB 3BTGE 3GCTG 3T62A 3ODFA 1O2JA 1NRNH 2GT7A 3KNXA 1SI5H 1Y3XA 5H4IB 2D8WA 2P3TB 4OS2A 3T5FH 2A4QA 2ZGBH 4A1VA 3PLKA 4XOJA 1UTOA 3NCLA 4UFDH 1SGRE 2HNTC 1EATA 4HFPB 1BA8B 3VFEA 1P2IA 2ZZUH 3TU7H 4CH8B 1ZSJA 1ELGA 1XVOA 3LPRA 4ABIA 3VB5A 1N8OC 1ELDE 1C5YB 1O2OA 4CBNA 2Z3DA 3GDUA 2BVRH 1MAXA 4Y0ZE 5AFYH 2GCTC 2ZDAH 3A86A 1CGJE 2WYJA 4MTBA 1GVLA 1MTSA 1QB6A 2JH0D 1C1WH 4JYVH 2QA9E 2ZG0H 5E0GA 2HPPH 3P6ZB 1J9CH 1YPLH 4MPVA 3B8JA 3A8BA 3SW2B 1N1LA 2PFEA 1V2NT 1XXDA 1THPB 1MD7A 1HJ8A 3AVZA 4K1TA 1SHHB 2BLOA 1BJUA 1S84A 4X1NU 2Q6FA 3RXKA 4A1TA 1Y3WA 1GJ7B 1QR3E 1ZSKA 1EOJA 5E0HA 4BTIB 1D9IA 4DT7B 3FP6E 3A7VA 1V2UT 1G2MA 2P93A 3BEIB 1ZSLA 4X1QU 1EJNA 2FZZA 3U98H 3T2NA 2FODA 2Z7FE 1MCTA 6CHAC 4ZHAA 2FXRA 1QIXB 1S6HA 2GDDA 2OC8A 3DFJA 4INKA 2GZ9A 1J14A 2ZPSA 1W7GH 2ZU3A 1Y5BT 3A8CA 4X8TH 1O3MA 1AVWA 2TGTA 3KQCA 1MTUA 5AF9H 2STBE 2ZECA 1NRQH 4NA7A 1IQNA 3E1XB 1GCTB 3A8AA 3M7TA 3ZZBA 1EASA 1VZQH 1GHBF 5IDKA 1C1PA 1DUEA 1HAVB 2ZGCA 4NIVA 1A61H 2BDYA 1ZGVA 1YM0A 4NZLA 5HGGA 2AMDA 1O2TA 2UUJB 3PWCA 1UK4A 2J38A 1EUFA 2RA0A 4OS7A 3O8DA 3UWIA 1O2WA 1SMFE 1EPTB 3PROA 1C2KA 1HAZB 2V3HH 2A7CA 1G32B 2EI8A 1MU6B 1GHAG 4NGAH 1YPJH 2ZTXA 1XUIA 2GDEH 2R0LA 1HXFH 3NXPA 4OS6A 3STJA 4AGJA 1AMHA 1A3EH 1V2RT 1K1MA 3PMHB 3RXQA 1TGTA 4K3JA 3PV4A 2FYRA 2P3UB 2OXSA 2AMPA 8GCHF 5L2ZH 4HI3A 3RXMA 1FN8A 1T7CA 2XC4A 1KDQB 1GI6A 4RKOB 2VNTA 3P95A 1C1SA 1C9PA 1ZJKA 4D7GA 4GVUA 2VVVA 2NU0E 2XBXA 2D26C 2VIOA 3QGNB 3FANA 4H42U 1CE5A 2P59A 1B0FA 4ZXXH 2BD7A 1C2EA 3UWJH 4ABBA 1UJ1A 3E91A 3LGYA 1RD3B 4IMZA 3KCGH 4IBLH 1TALA 2FLBH 2BD5A 4X8UH 1TNGA 2FLRH 3MU4A 5ESBA 2FPZA 1ZYOA 1W7XH 3SUEA 5IYTA 2BXUH 2BDHA 4TPIZ 2FOFA 1IQMA 3OSYA 3A7ZA 1K1LA 2ZU5A 1BHXF 3QZRA 1XUFA 2CHAC 2Z6BD 2FOGA 1XVMA 1H9HE 1EB1H 2G8TA 3ZVFA 2OCVB 1QL8A 3A88A 3SV9A 1AN1E 1OX1A 1HIAA 1JOUB 4WY3A 1SGFG 4AYYB 2BX3A 1A7SA 1O32A 4K5ZA 1TNLA 2CGAA 1FIZA 1WQSA 5E2PA 2IN2A 7KMEH 4FUIA 3JZ1B 4F49A 3GY2A 1S0RA 3F9EA 2XCNA 1ARBA 3TH4H 1SQAA 2GCHF 3PB1E 3GY4A 2V35A 4X2WA 4Y7BA 5E2OA 1SGPE 2ZFQH 1Z8RA 2G81E 1NFXA 1O5AB 1K9OE 4MPXA 4AX9H 5C1UA 2Y5HA 3UQOA 4FUDA 3LU9B 1A0LA 1KY9A 3H7OA 3QN7A 5DP7A 2YOLA 2H9HA 1PJPA 4SGAE 2GVFA 3VB3A 1P12E 1EP5A 4J2YB 4X2XA 1TABE 1YLDA 1OYTH 2QCYA 4JK5A 4GLYA 2WPMS 1HJAC 1TA6A 3S9AA 1GBDA 3GY8A 1W10U 4WMFA 5GPIB 3BIUH 2NU4E 1C5MD 1ABIH 3D65E 1H9LB 2BZAA 2FM2A 2V3OH 2HRVA 1K1OA 3E8LA 4YLQH 2GV6A 3TJNA 5TJXA 1MBMA 4LK4A 5GCHG 1TGNA 1ELBA 3KIDU 4AGKA 3HGNA 1P2OA 2G55A 1C4V2 1TLDA 1VGCB 3MH5A 2O8TA 4ABHA 2BDGA 9LPRA 4H6SB 4LXBH 4JYTA 1E38B 4I8HA 1OOKB 1LVYA 3ZYEA 1THSH 1AKSA 2BD4A 3H7TA 6GCHF 1IQLA 2ZU1A 3TJUA 4D8NA 2HLCA 3SI4H 1BMMH 1KLIH 2Y7ZA 1SLUB 4ISIH 4ASHA 1Z6EA 4Y79A 1EAXA 3BTQE 4GCHF 8LPRA 1OXGA 3TLOA 4GPGA 4O97A 1K21H 3F1SB 1ORFA 2BLWA 2OC0A 4IS5A 2ILNA 3HGPA 1X7AC 4JZ1A 2R3UA 2XCFA 1ZHRA 2W3IA 4JK6A 3SZNA 4MG3A 1BTUA 1OSSA 3TPIZ 1BB0B 1DWDH 5JBTA 1J15A 1MCVA 3UUZA 3T26A 3UOPA 4PROA 3M35A 1TGBA 4FVBA 1HDTH 3KQBA 1C2JA 5FAHA 5GIBA 3RLYH 2HNTF 4IC6A 4AFSA 1LHEH 1BMLA 3RLWH 1OP2A 1GHZA 4X6NA 5EODA 1QHRB 7LPRA 3GCHC 2ZCHP 2PLXA 1RIWB 2O8LA 1F92A 1GJAB 5BRRE 1WU1A 2G51A 1HNEE 5T3HA 4M7GA 1IQKA 1LMWB 3U1JB 1MKXK 1DY9A 1MKXH 1N6YA 1BHXB 1WSSH 4X6OA 1V2MT 1W12U 2CV3A 4BXSA 1S82A 3P8OA 2VVCA 4LZ1H 4JMYA 3W95A 4RSPA 5EU8A 1O34A 1GGDC 2JH6D 2XNIA 2ALVA 1FIWA 4B75A 1YPMH 1TPSA 3C27B 1F2SE 4NSYA 3URCA 1NFWA 5T6GA 3WY8A 4ZXYH 1UTLM 1FN6A 1DSUA 4CBOA 1C5RA 1IQEA 1CSOE 1T4VH 1P0SH 3OY5U 3TK5A 4CHAC 5A0AE 1P2NA 4NFEA 1FPHH 5AFZH 1K28D 1OWEA 3LGIA 1J16A 1G30B 1BTYA 2D1JA 3D62A 3O8CA 1SGNE 2F9UA 4ISOA 3N7OA 1QTFA 2IOTA 1UVUH 1QRZA 3SJIA 3DHKH 2AFQB 5A0BA 3HPTB 7GCHF 2QC2A 1O3AA 2CJIA 3CS7A 3NKKA 1GBHA 4OS4A 1YF4A 2ANWA 1Z6JH 3IITA 3QK1A 4OS5A 3UFAA 2F9NA 2XC5A 2ZIQH 1TAWA 1YPGH 2P94A 4VGCB 2P8OC 2AGIX 1ZJDA 1EZUC 1ANDA 4TPYA 5A8ZA 2BQ6B 2FOAA 1L0ZA 2UWOA 1O3EA 2ZGJA 3ZZ3A 3ITIA 1OWJA 1GHVH 2FOEA 2C93B 2W3KA 1DX5M 1LPZB 2OD3B 1O3KA 1QCPA 1A46H 4DURA 1PYTD 3QTVH 1EOLA 1TMTH 1V3XA 1SGFA 1ANCA 4IC5A 3FP7E 8KME2 1BMAA 1EAUA 1TB6H 2VIQA 1C1MA 1UTJA 3L33A 5F8TA 1BDAA 3U69H 2CN0H 3FFGA 2ZHEH 1GJ4H 2PUXB 3BTKE 4ZKRU 1GBJA 5JBAS 1O33A 2JKHA 2ZDLA 3RDZA 2GTBA 1C5OH 3RXRA 5EXLA 2R9PA 1GBIA 1GMDF 1S0QA 4NA9H 1CO7E 4TYDA 1C4Y2 1PPFE 2TPIZ 1F0RA 1S6FA 2UUYA 8ESTE 5AHGH 1YPKH 1AZ8A 4K1SA 1T32A 3A8DA 1CHGA 1EZSC 2VH6A 1QBNA 2ZHQH 1TBZH 1C5VA 3FZDA 1SGEE 4MNVA 4D7FA 1UVTH 4JZIA 1HPGA 1BOQA 1AIXH 3A7TA 1O3GA 5K7RA 3SBKA 1H1BA 3P17H 2VB0A 3BIVH 4XSKU 4B2BA 5DPAA 2G52A 2JH5D 2A4RA 2WUCA 1ESTA 3ZZDA 3SI3H 1AFQB 3U8RH 2VGCB 1LPKB 3BN9A 1O2GH 4CRFA 1CVWH 1Q2WA 1F0SA 3LJJA 3OYPA 1GI2A 1LTOA 2AS9A 1LO6A 3K9XB 3S69A 1DY8A 1P06A 3M37A 2H2ZA 1EQ9A 1XMNB 3OX7U 1GJ8B 3LC3A 1KLTA 2VIPA 1C1VH 1FPCH 1G36A 1BBRK 1TGCA 3VGCC 1RTFB 3AAVA 1BBRH 1C5TA 4YM9A 3F68H 1K1PA 1RTKA 2R0KA 2RDLA 2THFB 5JYIA 1SGYE 2FDAA 2FS9A 2VVUA 2NWNA 1DUAA 1ZOMA 4WXIA 2PUQH 1GI5A 2QV1A 1JXPA 3UOUA 2BVSH 2GX4A 3RC6A
chains in the Genus database with same CATH superfamily
1ZMNA 4Z1MD 1O3BA 3C1KA 5A0CA 1CGHA 1IQFA 2C4FH 4Y8XA 1G37A 1RGQA 1QURH 4X1PU 1C5PA 3SV2H 3TIUA 4XFQA 1T8OA 2XXLA 1GG6C 4XBBA 3VPKA 5DJ7A 3EE7A 2OUAA 4NA8A 3ATIA 1GVKB 5DGJA 2BXTH 1L4DA 4K2YA 1LVBA 1O39A 5SGAE 1EKBB 3SNAA 5F6MA 3RXJA 1C1OA 4I8JA 3RMOH 2QF3A 1IQGA 2GT8A 3UAIC 1ZR0A 3PRBA 4IMQA 1P3CA 1H8IH 3V13A 3M5OA 1GWAA 1WDIA 4RI0A 1GJ5H 2QN5T 1Y3VA 2XOKD 1LKBA 2FOCA 3UQVA 6CHAB 4X6MA 4AG2A 4HZHA 1TOMH 1NU9A 1BRBE 1QFKH 2Y80A 3MTYA 2JETB 1HLTH 4XD7D 5HXFA 1AB9C 1O5EH 1CHOF 1ZRBA 1NROH 2ANMH 3M61U 3PMBB 1G3EA 2G4UA 5JPMH 2CF9H 4INHA 3TGJE 1GBKA 3RM0H 4KP0A 3K6ZA 2VWNA 5FX5A 1A3BH 3DUXH 2FTLE 1G3DA 1SLVB 5HMAA 1YLNA 2BDAA 2BM2A 1NT1A 4YT7H 1FV9A 3TGKE 3SJKA 1OP8A 1BJVA 3MNCA 3SJOA 2R2MB 2Y5FA 1ANEA 1GPZA 1HAPH 2BDBA 2M5TA 2PTNA 2Z9LA 1PQ7A 4FUHA 1HBTH 1UCYK 1TRNA 2H9EH 1WCZA 4Y76A 5FX6A 1THRH 1UCYH 1DM4B 4MDSA 4BAKB 4DG4A 3SNCA 2ZC9H 1TYNA 1JRTA 4RT0A 4DJZB 1GMCF 1FY5A 1AZZA 2BX4A 4JZDH 4B6FA 2A0QB 3PTNA 1WAYB 3E0PB 1IHTH 3QUMP 3BG4C 1SSXA 4P02A 1QBVH 2P3FH 1DOJA 3FN8A 3MU8A 3OY6U 1HAOH 1AE8H 5C17A 2ZHFH 1AD8H 3EA9A 1ELAA 1MQ6A 2XTTB 4CREA 2ZTZA 3M36A 4NG9H 2VH0A 1EZXC 2A5KA 4X0WU 1YWUA 3ZZCA 1O5BB 1T8MA 1ZPCA 1O5CB 1XUJA 1A2CH 3PO1C 5CMXH 5J4QA 3MQKC 2SGAA 1E1RD 1V2PT 3V3MA 3RXGA 1VITF 2OC7A 1SPJA 1O38A 5C20A 5L2YH 4A1XA 1QRWA 1LVMA 3RC5A 3JZ2B 2RA3A 2AEIH 1V2ST 1DSTA 1YP9A 1ZTKA 4J1YA 3SNDA 4YT6H 1YC0A 2ZGXH 1W3CA 4AFUA 2GGVB 4ZKNU 1ZTJA 1TQ0B 2A7HA 1C4U2 3RXEA 5EW2H 3E90B 4DGJA 2XBYA 3Q77A 4B71A 4UEHH 1V6DA 2VIVA 4UD9H 1DXWA 2HNTE 4I32A 1KXFA 5IK2D 5T6DA 2BD3A 1QRXA 1JBUH 1CA0B 1O5DH 1UO6A 3MU0A 3GDVA 1WBGB 1QA0A 1UHBB 5C5OA 1V2TT 4YOIA 3M5MA 2PGQB 1MTNB 3P70B 4Q7ZA 1BIOA 3SV8A 1MH0A 1DPOA 1D6RA 1TPAE 2BY9X 2QF5A 4UE7H 1SR5C 3RP2A 1ZZZA 1D6WA 3QDZB 4O9VA 2F9OA 3EDXB 1GI0A 1KDQA 1QB9A 1FXYA 1MUEB 2O9QA 2ZO3H 4MPWA 1FY3A 4Q2KA 2GCHG 2GV7A 2BMGB 2FI5E 1O3CA 3DCLA 1ZTLA 4Q80A 2NU2E 1DDJA 2AMQA 2UUKB 2A4OA 4CRGA 1AVGH 2WINI 4B76A 2PSYA 2ULLA 1DLEA 1W13U 1NU7B 3T28A 1BRUP 3ZVGA 3SGAE 2LNCA 2ZPQA 1GCTC 3R0FA 3ATKA 2YNAA 3SO3A 1PPGE 3SOSA 1RFNA 1UTQA 2GMTB 2A32A 2Z94A 3B9FH 3A89A 4Y10E 1GJ6A 5T6FA 4K8YA 1DITH 4GHTA 1P02A 4ABDA 2EEKA 2A7JA 2V7QD 1S83A 2W7SA 2C8ZB 1NRSH 1GVZA 1EPTC 3RM2H 4X8VH 3B23B 3MO3A 1TMUH 2ANYA 2ZDVH 3Q76A 2BOHB 2KZ4A 1XUKA 1DWCH 1B5GH 1G3BA 1GHAF 3A7WA 3S9CA 3U8OH 1RRKA 1ZMLA 4YOGA 4HTCH 3RXIA 1O2NA 3UNQA 4X1SU 2QXIA 2PTCE 2H9TH 1KXCA 1W0JD 1LHCH 1KXBA 4K1EA 1C2GA 3AW1A 5JB8S 4RN6A 3QZQA 2UWLA 4WH6A 1ABJH 5CHBA 4ASUD 1P2QA 3RXTA 1UK3A 1TX8A 3URDA 2FOHA 2J98B 6GCHG 1DWBH 5EOKA 3HK6B 2CXVA 1O2YA 3DSPA 2FESH 4X8SH 1BCUH 1NM6A 2Z3CA 1Z8IB 1C1QA 3RXPA 2QXJA 4GCHG 1O2VA 1RS0A 3LT3A 3BG8A 1PPZA 3BV9B 3NUMA 4JZEH 1KXDA 1O3IA 3QGJA 1QJ7B 2ZFPH 1EX3A 1O2XA 2ZDNA 2AERH 1QA7A 4F55A 1PPCE 4MPUA 4NSVA 1UVPA 1FLEE 4ZROA 5C0UA 5A8XA 1O3NA 2ZHDA 1P03A 2J94A 3BTME 4ZCNA 1CBWB 2OP9A 1IQIA 1GMHF 4O03A 2XBVA 4FUJA 4BAOB 1O2MA 5LGOA 3SV7A 5DG6A 3VXEH 2WPHS 1ZRKA 3P8FA 1HAXB 2O8MA 3ZZ9A 4P00A 3SJ9A 5C0TA 1QL7A 3TVJB 4WMDA 1UK2A 1V2WT 3EYDA 3RXLA 4ESTE 1CA8B 1HAHH 3KHVA 3MYWA 2Z9GA 2B7DH 2A5IA 2J2UA 3K65B 3R3GB 1J17T 3QLPH 3AW0A 4OGXA 2SGDE 3UIRA 4ZKOU 1UMAH 2XWBI 2Q1JA 1LQDB 2W26A 1AHTH 1SGTA 1D4PB 5EJ1A 3ATWA 1W11U 1KMHB 1KIGH 1XKBC 1WTGH 1NRRH 2Z9IA 3LGTA 3LONA 3ZZAA 3D49H 5HM9A 2CF8H 3E16B 1AKSB 1UTPA 1NS3A 3UTUH 2SGQE 2H1UA 3SUDA 3OEED 4Y7AA 1GGDB 3ZVEA 1O3LA 3PRDA 3S9BA 2FP7B 2PKAB 5HIYA 3I29A 1O5GH 2ZU2A 4BAMB 5DP6A 1LHDH 2C8WB 2K1QA 1UTNA 4ZKSU 4KTUA 3GDSA 1H8HD 1YPHC 1ELCA 5CHAC 3SU5A 4ZMAH 3L3TA 1BTPA 1EJMA 2SGFE 4HG6A 1SLXB 1CT2E 2ZTYA 3TJOA 1NFYA 3TH2H 4O3UA 4LZ4B 4WF8A 1KXEA 2BVXH 1T8LA 2V6NA 3N99A 3PMAB 1TMBH 5T1VA 1DICA 1WUNH 2FOBA 1E34B 3KYGA 1Z1IA 4LOYH 2J9NA 4AFZA 1FY4A 3NK8A 4IN1A 1PQAA 1ZHMA 1FY1A 5GCHF 1WQVH 1TNJA 4UDWH 1VCWA 1BUIA 1TBRH 1VGCC 4DCDA 1SG8B 1FI8A 1RXPA 4FU9A 1IOEA 3ZZ8A 5B6LA 1J8AA 6ESTA 4MNWA 3ZVBA 3ZZ4A 2EY4C 4H4FA 4XBDA 2PW8H 2Y5GA 1JMOH 1OKXA 4MNYA 5C2ZA 5G4BA 2C8XB 1V2KT 1T31A 4BNRA 1IAUA 1C1TA 5L6NH 1ZPZA 1NBME 3CP7A 1O37A 1WTHD 2KAIB 2HLDD 3RU4T 2OC1A 1GI7B 1O2RA 3WWBA 2A2QH 1GMDG 3S7HB 2WPJS 2O8WA 5J4SA 4NZQA 3SN8A 1TE0A 1SBWA 4U2WA 1HYLA 4D9RA 1C2LA 2YMSC 4FU8A 2O8UA 1QBOA 1O3FA 3FKSD 1OWDA 2FO9A 1A5IA 1GDNA 4E7NA 5FCRA 4R8TB 2RCEA 1QNJA 3ELAH 1TRYA 3MU5A 3UNSA 5EPNA 3VG8A 1Y5AT 2STAE 5EJZA 5CE1A 5LPEA 3RMNH 5ETXA 1XX9A 2ESTE 3ZZ7A 1V2OT 4FETA 2DUCA 1V2JT 2WPLS 5I46H 2A1DB 3DD2H 1VJAU 1SGIB 3MO6A 1INCA 1RIWC 2AGEX 4ZAEA 5C67A 2PWXA 2FEQH 2XWAA 5EQSA 1ELVA 1O35A 2HWLB 2Y81A 2ZFSA 4WWYA 1F5LA 2FYQA 1UVSH 1S85A 3VB7A 1OWIA 1MTWA 2TRMA 4D76A 2GJGA 4TWYA 1EB2A 1GBFA 1L2EA 1YCPK 1HXEH 5GNDA 3M3VA 1KXAA 1YCPH 1D3DB 1P01A 3TJVA 3PLBA 3ZVAA 1YYY1 2A31A 4I8GA 3BEUA 3BTFE 3ZZ5A 4Y8YA 2BHGA 1OWKA 3SQHE 2PKSB 2FMJA 3TITA 5EQQA 4CRDA 5I25A 1KTSB 2BD2A 5DP8A 2B5TB 4TY7A 2V3MA 1T8NA 1GJDB 4X6PA 3L6PA 4CR5A 2EA3A 1C5NH 1YBWA 2SFAA 3KQDA 1P2KA 1TNKA 3QTOH 1BRCE 1ESBA 3SNBA 2Y6TA 3OEHD 2UWPA 3EE0B 2F83A 1CU1A 1SB1H 1ACBE 1SGDE 2Q6GA 3A87A 1SFQB 1QJ1B 4AC9A 1FONA 1L1NA 4GSOA 2QY0B 3GYLB 1TNIA 4OS1A 1GI9B 1HV7A 2OINA 4K60A 3MNXA 3D23A 1Y8TA 1O30A 2VU8E 2WV5A 4VGCC 1VKYA 4AORA 5LH8A 1AUJA 1HB0B 4DIHH 2HVXA 3CS0A 1E1QD 4OGYA 1E37B 1SC8U 3F9GA 1C2FA 2W7UA 3S7KB 4KGAA 4B1TA 3TNSA 1E36B 1RJXB 5DKMA 2TGDA 5FPYA 2H6MA 2KR7A 3LKWA 2WV9A 1JIMA 1SVPA 1GL0E 1SL3A 1N8OB 1O2LA 2LP6A 3H5CB 1OWHA 2SNWA 1PPHE 3FP8E 1O3PB 3MH7A 4NIXA 1L1JA 1F7ZA 3RUOA 2GCTB 3I77A 4CR9A 2ZWLH 1O2QA 1FUJA 2WZQA 3F0OA 2J34A 4GHQA 3MWIU 4WVPE 4BTUB 1BQYA 1TONA 1LHFH 3BEFB 3RXAA 2VINA 1W0KD 3ENSB 4WJG2 3UPEA 3EQ0H 3GOVB 1TPPA 2ZNKH 5EQRA 3WWFA 2VIDA 5F8ZA 1C9TA 4ABAA 3EAJA 1A4WH 4MNXA 3PYHA 1FX0B 2AYWA 1FNIA 3PTBA 2C3SA 4YLUA 1UTKA 1ZLRA 1XUHA 3CENA 4TY6A 5F53A 2C8YB 4UFGH 4H6TA 3O8BA 5C1XA 1W8BH 3CNRA 3FZZA 1IQHA 4ISLA 1GDUA 1TFXA 1SQOA 1BMNH 3ZVCA 4A92A 3EA8A 4B2CA 4ABGA 2WPKS 2ZU4A 1SGCA 2GZ8A 2QF0A 1AFQC 1Q31A 1G2LA 1TA2A 1EP6A 2ODYB 2VGCC 2FI3E 3PMJA 5EGMA 4FUGA 3P92A 4AZ2B 1NPMA 4BAHB 4CH2B 1UTMA 2FOMB 1PPBH 3PO1B 1GBEA 3SHCH 1N6XA 3PM3A 3SJ8A 1VITG 4UONA 2ZFTA 4X2YA 1GHBG 3SZEA 4ACBA 4SGBE 1P8VC 2C90B 1FAKH 2SNVA 4Y6DA 2Z9KA 1LVOA 1K1NA 3P8NA 2F43B 2J4IA 1QY6A 2W5EA 1RTLA 3BF6H 4XRNA 1ETSH 2KCPA 1NO9H 1XUGA 2I6SA 2SGPE 4YXWD 1NFUA 4FXGH 3Q3XA 5E0JA 1JWTA 2A5AA 1BBRE 3MOCA 5TCCA 1GBMA 2WSSD 3TH3H 7ESTE 2FWWA 2Q6DA 2ZQ1A 2ZA5A 3N7EA 3RXUA 5F8XA 1BTXA 3VB6A 2H5DA 4DOQA 2IPHA 3AAUA 3SU3A 3M5LA 1GI1A 1E0FD 2XYAA 3DFLA 3ESTA 8GCHG 3NZIA 1VR1H 3SGQE 1P9SA 4B74A 1GBTA 1GHYH 3GCTF 1G3CA 4NCYA 1O2HA 2HALA 2HGTH 3GS9A 2B0FA 3RC4A 4ZUHA 4DY7B 1VCPA 4X1RU 3SV6A 2ZPRA 1C1UH 1HAYB 1YY3A 4BAQB 3I78A 4CRBA 1NTPA 3ZYDA 2JETC 2QYIA 1HAVA 2VWOA 1BT7A 3OFND 2QE7D 2XW9A 3FVFB 1P09A 1BZXE 1MQ5A 4F48B 1O2KA 4ISNA 1A1RA 1W0YH 2WV4A 1ANBA 2KM0A 3SQEE 1P9UA 2B9LA 1C5WB 4MLFB 3TGIE 1YGCH 5FCKA 5C3NA 3BTEE 1W14U 3MHWU 4QT8C 1YCPM 1EPTA 1D3TB 2BOKA 3TK6A 2PR3A 4JCNA 2QGRA 4Z0KA 2DE8A 4YTAA 3BSQA 2CHAB 3K2UA 3G01A 2VJ1A 2TGAA 2F3CE 3TNTA 4AG1A 1Z1JA 3RXDA 2F9VA 1Y59T 1HJ9A 4IGDA 3RXBA 1SQRA 3NWUA 1GBAA 1SQTA 1E35B 3U1IB 1H8ED 1IQJA 1UHBA 3GISB 2GKVE 1ESAA 1IHSH 3KGPA 1ETRH 1TNHA 2BB4A 1EXFA 3NRLA 1DLKB 1P10A 3KF2A 3MNSA 1S5SA 3PV2A 5JBBS 3UREA 4KTSA 1LKAA 1ZMJA 3SUGA 2A4GA 3T29A 2Z3EA 3OTPA 4YZUA 5A09A 3W94A 3F6UH 2G00A 1UCYE 3LIWA 3BTDE 2K8IA 3MMGA 3RXHA 9ESTA 1FY8E 3MNBA 1CT0E 4I8LA 3A82A 1O2SA 1LHGH 2BY5X 3FAOA 4FUCA 2AH4X 3RXVA 3VXFH 4WH8A 2GP9B 4BXWA 3ZIAD 3QO6A 4AFQA 4NWLA 2BY8X 1H4WA 1JRSA 2ZCLP 5FXLA 1A5HA 3LH3A 3ZVDA 1F5RA 1GBLA 1C5SA 1W2KH 1TX6A 4Q7YA 3MU1A 3HK3B 1AQ7A 2OQUA 3LH1A 1OPHB 2BY7X 2ZDMA 2BQWB 4NWKA 2AIQA 1HJAB 4Z6AH 5JB9S 4A6LA 2ODQA 5KGOA 1KYNA 2TBSA 2HPQH 1GBBA 1JIRA 5C5NA 1AU8A 1GMHG 3SGBE 5JBCS 1GI3A 3RXCA 4I31A 3E3TA 4FU7A 2F91A 2QIQA 3A84A 3UNRA 3GICB 1BITA 5EPYA 1CA0C 2NU3E 1ZGIA 2EI7A 1HIAB 3A83A 2OQ5A 1QZ8A 3LGVA 1DWEH 2RG3A 2G5NA 3MO9A 4U30A 1MTNC 1XXFA 1C1RA 3F9HA 1BRAA 4A7IB 2DE9A 2BYAX 2BD9A 2FX6A 3M3TA 2QXHA 3BTHE 1OS8A 3RXFA 3KEEA 1EAWA 3GYMA 1PFXC 1O2PA 4XBCA 4KTCA 1CGIE 5A2MH 2ZGHA 1QQ4A 4MQAA 2EQNA 1O2ZA 2G4TA 1G9IE 3KQEA 4HGCA 1NN6A 3TK9A 3PLPA 1TOCB 2FS8A 3ZV9A 2CMYA 1K1JA 4ZHMU 1W0ZU 2L6OA 1HFDA 5LPRA 1C5XB 1Z8JB 3ZV8A 2TIOA 1AY6H 3A7YA 1GJCB 4TWWA 1O0DH 3GCOA 1QJ6B 4Q7XA 4THNH 2ODPA 2BDCA 4U01A 1YPEH 2SGEE 1A0HB 4WMEA 5CHAB 1P2JA 1P05A 4B2AA 3H09A 2VWLA 1NESE 3F2FA 4NIWA 2GMTC 2RDEA 2PP6A 2VBCA 3SU4A 2NU1E 1AGJA 2XNDD 3HKJB 1O3HA 2FX4A 3RU4D 2ZF0H 2JIZD 1O31A 4X2VA 3STIA 4AYVB 1Y3UA 2WYGA 4BTTB 1B0EA 4JYUH 5GWZA 4E06H 3GCHB 1ETTH 4DIIH 3ZZ6A 1BTHH 1P3EA 1F0UA 1MAYA 3O8RA 3NPSA 1QB1A 2YNBA 4Q63A 2CK3D 4GAWA 4YESB 4R0IA 1ELEE 1C5QA 1C1NA 1GL1A 1GHXH 1KTTB 1GHWH 3MH4A 4UFFH 1PQ5A 3UR9A 3VB4A 3F9FA 1P11E 3EGKH 3LGUA 2KCAA 1FDPA 1QGFA 2M2AA 3A80A 3SU1A 3V7TA 2UUFB 4OM9A 1F0TA 1NC6A 5DP9A 2FI4E 1PQ8A 3ATLA 5FBIA 3U9AH 2VWMA 1WXRA 2LPRA 3P8GA 3GY7A 4U32A 2FIRH 5DP3A 1CT4E 2H5CA 3M7UA 3SU0A 1MD8A 2PKAA 1NBMD 2B8OH 2QAAA 4BOHA 3OTJE 1C5ZB 1FQ3A 4CHAB 1WYKA 1BTWA 4AB8A 6LPRA 1WOFA 1GJBB 4IW4E 1O3JA 1H9IE 3OU0A 5HM2A 4UFEH 3A7XA 3M5NA 5TCAA 2J95A 3RU4E 2R3YA 3GY5A 4I86A 2BTCE 2BD8A 3DSGA 5EXNA 1QL9A 2AGGX 2ALPA 7GCHG 2IJOB 2ASUB 4M9FA 5C1YA 4B6EA 1C5LH 2D2DA 1CBWC 1ZHPA 1NY22 1AVXA 1V2VT 1GI8B 5FPSA 4CRCA 1ELFA 1Z7KA 3Q3YA 5GDSH 5GXPA 2ANKH 2BLVA 4FUBA 1GJ9B 1KSNA 1EJAA 2P8OB 5AVDA 3E6PH 1D3QB 2ZFRH 1DFPA 2I6QA 4K69A 3QWCH 5ABWA 1VITH 2J92A 3A85A 4KKDA 1B7XB 5L30H 1S81A 2XC0A 1HAIH 5KECA 3SUFA 5DP5A 2PSXA 3DT0H 1O3DA 4B73A 1L1GA 1SOZA 1AFEH 1DVAH 1Z71A 5DO4H 2OBQA 5DK1A 1MZDA 2WHXA 5JDUB 1O5FH 1FZZA 1DS2E 2KAIA 2F9PA 1LCYA 3A81A 3U8TH 2PHBA 3SU2A 3QX5H 2Y7XA 2AIPA 4D9QA 1TPOA 1MU8B 2EC9H 4ABJA 1XM1A 1TBQH 1C2HA 3E0NB 1FMGA 2J5UA 2ZCKP 2EI6A 3SHAH 3IG6B 3V12A 1SFIA 2GZ7A 1AWHB 2A45B 1XKAC 3MH6A 2WPIS 1SHYA 1MMJN 3ATMA 4YO9A 1TRMA 4FUEA 1NRPH 1DANH 5PTPA 3MFJA 1ELTA 3SU6A 1Z8GA 1C2DA 2P95A 4CRAA 4KELA 1HRTH 1PYTC 1O3OA 4ABEA 2ZDKA 3VEQB 4DVAU 2VIWA 5FHTA 1HAGE 4ISHH 1OYQA 1WV7H 3SORA 5FBEA 1YPHE 1TGSZ 4I8KA 1DE7H 1LQEA 1D3PB 3IWMA 5EG4A 2ZQ2A 5DP4A 1ARCA 3RMMH 1OHHD 2A2XH 3OAAD 2BZ6H 1YKTA 2GD4B 2K0QA 1U6QA 5LPFA 1V2LT 3ODDA 1FJSA 4IN2A 2Z9JA 1MTVA 4E7RG 3GY3A 1K2I1 1C2MA 2L74A 2WUBA 1P04A 4Y0YE 2J97A 2TGPZ 5HYOA 1P57B 2ZHWH 3VGCB 1MKWK 1MZAA 1GDQA 3GCNA 1HUTH 1H8DH 1MKWH 1OP0A 5FPTA 4AOQA 1QQUA 2G5VA 3K6YA 4ZHLU 4WXVA 1MBQA 4NIYA 1LDTT 1K22H 1A5GH 3MI4A 4Y71A 2OK5A 4XDEA 4YOJA 2OTVA 3LC5A 2HOBA 1UVOA 3LGWA 1CQQA 3EA7A 4NFFA 5GJ4B 1GCDA 5DN6D 4JZFH 1Y5UT 1SGQE 3Q3KA 4Y11E 2PGBB 5F03A 1GG6B 3AK5A 3DA9B 3RMLH 4FUFA 4ABFA 3F3BA 4E05H 1EFRD 1PPEE 4DW2U 4Y8ZA 3UY9A 1GI4A 1AI8H 1BTZA 2XRCA 2F4LA 1O2IA 1A0JA 2ZP0H 5ESTE 1ID5H 1C5UA 3T27A 3AASA 2OBOA 2QXGA 3RXOA 1M9UA 1T4UH 2BLQA 2BQ7B 4BANB 4A5TS 4O3TA 3UR6A 2ZI2H 2R2WU 1AUTC 1Y3YA 1P2MA 4K8BA 2OLGA 3SYJA 1AB9B 2FTMA 3LDXH 5EXMA 1AO5A 1CHOG 2ZEBA 1EAIA 2BDIA 4I7YH 2Y82A 3HATH 2BY6X 1VJ9U 3KL6A 4I33A 4AB9A 1HCGA 2P16A 2ZFFH 1YLCA 3SNEA 5BPEA 1AE5A 5A8YA 1VCQA 2XBWA 1F5KU 1GBCA 1O2UA 1Q3XA 3HKIB 5B6OA 1FAXA 1HGTH 2PKSC 1C2IA 3M3SA 1K1IA 3LJOA 1TIOA 5K0HA 4MVNA 3BTWE 1TQ7B 3BTTE 3S0NA 3V0XA 1TWXB 4INLA 1LPGB 4GUXA 1L4ZA 1MABB 3LOXA 1GMCG 5E8EH 4AN7A 1NZQH 2PV9B 1TX7A 1KLJH 3RXSA 3BG4B 3PWBA 5EW1H 1O36A 4XE4A 1ZPBA 1DXPA 1DT2A 3T25A 4FVDA 1SLWB 4F4OC 1AWFH 3GY6A 1EZQA 3M7QA 1V2QT 1SOTA 3Q00A 4ZH8A 2ZKSA 3KN2A 2V0BA 2F9BH 4RKJB 3BTGE 3N7DA 3GCTG 3T62A 3KYFA 3ODFA 1O2JA 1NRNH 2GT7A 3KNXA 1SI5H 1Y3XA 5H4IB 2D8WA 2P3TB 4OS2A 3T5FH 2A4QA 2ZGBH 4A1VA 3PLKA 4XOJA 1UTOA 3NCLA 4UFDH 1SGRE 3UB0A 2HNTC 1EATA 4HFPB 1BA8B 3VFEA 1P2IA 2ZZUH 3TU7H 4CH8B 1ZSJA 1ELGA 1XVOA 3LPRA 4ABIA 3VB5A 1N8OC 1ELDE 1C5YB 1O2OA 4CBNA 2Z3DA 3GDUA 2BVRH 1MAXA 4Y0ZE 5AFYH 2GCTC 2ZDAH 3A86A 1CGJE 2WYJA 4MTBA 1GVLA 1MTSA 1QB6A 2AHME 1C1WH 2JH0D 3FOAA 4JYVH 2QA9E 2ZG0H 5E0GA 2HPPH 3P6ZB 1J9CH 1YPLH 4MPVA 3B8JA 3A8BA 3SW2B 1N1LA 2PFEA 3KQ5A 1V2NT 1XXDA 1THPB 1MD7A 1HJ8A 3AVZA 4K1TA 1SHHB 2BLOA 1BJUA 1S84A 4X1NU 2Q6FA 3RXKA 4A1TA 1Y3WA 1GJ7B 1QR3E 1ZSKA 1EOJA 5E0HA 4BTIB 1D9IA 4DT7B 3FP6E 3A7VA 1V2UT 1G2MA 2P93A 3BEIB 1ZSLA 3F2GA 4X1QU 1EJNA 2FZZA 3U98H 3T2NA 2FODA 2Z7FE 1MCTA 6CHAC 4ZHAA 2FXRA 1QIXB 1S6HA 2GDDA 2OC8A 3DFJA 4INKA 1S6LA 2GZ9A 1J14A 2ZPSA 1W7GH 1E79D 2ZU3A 1Y5BT 3A8CA 4X8TH 1O3MA 1AVWA 2W6JD 2TGTA 3KQCA 1MTUA 5AF9H 2STBE 2ZECA 1NRQH 4NA7A 1IQNA 3E1XB 1GCTB 3A8AA 3M7TA 3ZZBA 1EASA 1VZQH 1GHBF 5IDKA 1C1PA 1DUEA 1HAVB 2ZGCA 5C94A 4NIVA 1A61H 2BDYA 1ZGVA 1YM0A 4NZLA 5HGGA 2AMDA 1O2TA 2UUJB 3PWCA 1UK4A 2J38A 1EUFA 2RA0A 4OS7A 3O8DA 3UWIA 1O2WA 1SMFE 2LELA 1EPTB 5CDFE 3PROA 1C2KA 1HAZB 2V3HH 2A7CA 1G32B 2EI8A 1MU6B 1GHAG 4NGAH 1YPJH 2ZTXA 1XUIA 2GDEH 2HVYB 2R0LA 1HXFH 3NXPA 4OS6A 3STJA 4AGJA 1AMHA 1A3EH 1V2RT 1K1MA 3PMHB 3RXQA 1TGTA 4K3JA 3PV4A 2FYRA 2P3UB 2OXSA 2IJD1 2AMPA 8GCHF 5L2ZH 4HI3A 3RXMA 1FN8A 1T7CA 2XC4A 1KDQB 1GI6A 4RKOB 2VNTA 3P95A 1C1SA 1C9PA 1ZJKA 4D7GA 4GVUA 2VVVA 2NU0E 2XBXA 2D26C 2VIOA 3QGNB 3FANA 4H42U 1CE5A 2P59A 1B0FA 4ZXXH 2BD7A 2KFWA 1C2EA 3UWJH 2IPQX 4Q4LA 4ABBA 1UJ1A 3E91A 3LGYA 1RD3B 4IMZA 3KCGH 4IBLH 1TALA 2FLBH 2BD5A 4X8UH 1TNGA 2FLRH 3MU4A 5ESBA 2FPZA 1ZYOA 1W7XH 2JJ2D 3SUEA 5IYTA 2BXUH 2BDHA 4TPIZ 2FOFA 5EIYA 1IQMA 5HIZA 3OSYA 3A7ZA 1K1LA 2ZU5A 1BHXF 3QZRA 1XUFA 2CHAC 2Z6BD 2FOGA 1XVMA 3PV5A 1H9HE 1EB1H 2G8TA 3ZVFA 2OCVB 1QL8A 3A88A 3SV9A 1AN1E 1OX1A 2WPDD 1HIAA 1JOUB 4WY3A 1SGFG 4AYYB 2BX3A 1A7SA 1O32A 4K5ZA 1TNLA 2CGAA 1FIZA 3W1EA 1WQSA 5E2PA 2IN2A 7KMEH 4FUIA 1SKYE 2J98A 3JZ1B 4F49A 3GY2A 1S0RA 3F2HA 3F9EA 2XCNA 1ARBA 3TH4H 1SQAA 2GCHF 3PB1E 3GY4A 2V35A 4X2WA 4Y7BA 5E2OA 5KEDA 1SGPE 2ZFQH 1Z8RA 2G81E 1NFXA 1O5AB 1K9OE 4MPXA 4AX9H 5C1UA 2KCYA 2Y5HA 3UQOA 4FUDA 3LU9B 1A0LA 1KY9A 3H7OA 3QN7A 5DP7A 2YOLA 2H9HA 1PJPA 4SGAE 2GVFA 3VB3A 1P12E 1EP5A 4J2YB 4X2XA 1TABE 1YLDA 1OYTH 2QCYA 4JK5A 4GLYA 2WPMS 1HJAC 1TA6A 3FO8D 1GBDA 3GY8A 3S9AA 1W10U 4WMFA 5GPIB 3BIUH 2NU4E 1C5MD 1ABIH 3D65E 1H9LB 2BZAA 2FM2A 2V3OH 2HRVA 1K1OA 3E8LA 4YLQH 2GV6A 3TJNA 5TJXA 1MBMA 4LK4A 5GCHG 1TGNA 1ELBA 3KIDU 4AGKA 3HGNA 4TT3D 1P2OA 2G55A 1C4V2 1TLDA 1VGCB 3MH5A 2O8TA 4ABHA 2BDGA 9LPRA 4H6SB 4LXBH 4JYTA 1E38B 4I8HA 1OOKB 1LVYA 4TSFD 3ZYEA 1THSH 1AKSA 2BD4A 3H7TA 6GCHF 1IQLA 2ZU1A 3TJUA 4D8NA 2HLCA 3SI4H 1BMMH 1KLIH 2JDID 1SLUB 2Y7ZA 4ISIH 4ASHA 1Z6EA 2QF4A 4Y79A 3DSOA 1EAXA 3BTQE 4GCHF 8LPRA 1OXGA 3TLOA 4GPGA 4O97A 1K21H 3F1SB 1ORFA 2BLWA 2OC0A 4IS5A 2ILNA 3HGPA 1X7AC 2YMSB 4JZ1A 2R3UA 2XCFA 1ZHRA 2W3IA 4JK6A 3SZNA 4MG3A 1BTUA 1OSSA 3TPIZ 1BB0B 1DWDH 5JBTA 1J15A 1MCVA 3UUZA 3T26A 3UOPA 4PROA 3M35A 1TGBA 4FVBA 1HDTH 3KQBA 1C2JA 5FAHA 5GIBA 3RLYH 2HNTF 4IC6A 4AFSA 2RFKC 1LHEH 1BMLA 3RLWH 1OP2A 3WW7A 1GHZA 4X6NA 5EODA 1QHRB 7LPRA 3GCHC 2ZCHP 2PLXA 1RIWB 2O8LA 1F92A 1GJAB 5BRRE 1WU1A 2G51A 1HNEE 5T3HA 4M7GA 1IQKA 1LMWB 3U1JB 1MKXK 1DY9A 1MKXH 1N6YA 1BHXB 1WSSH 4X6OA 1V2MT 1W12U 2CV3A 4BXSA 1S82A 3P8OA 2VVCA 4LZ1H 4JMYA 3W95A 4RSPA 5EU8A 1O34A 1GGDC 2JH6D 2XNIA 2ALVA 1FIWA 4B75A 1YPMH 1TPSA 3C27B 1F2SE 4NSYA 3URCA 1NFWA 3OE7D 5T6GA 3WY8A 4ZXYH 1UTLM 1FN6A 1DSUA 5DSFA 4CBOA 1C5RA 1IQEA 1CSOE 1T4VH 1P0SH 3OY5U 3TK5A 4CHAC 5A0AE 1P2NA 4NFEA 1FPHH 5AFZH 1K28D 1OWEA 3LGIA 1J16A 1G30B 4FOUC 1BTYA 2D1JA 3D62A 3O8CA 1SGNE 2F9UA 4ISOA 3N7OA 1QTFA 2IOTA 1UVUH 1QRZA 3SJIA 3DHKH 2AFQB 5A0BA 3HPTB 7GCHF 2QC2A 1O3AA 2CJIA 3CS7A 3NKKA 1GBHA 4ACAA 4OS4A 1YF4A 2ANWA 1Z6JH 3IITA 3QK1A 4OS5A 3UFAA 2F9NA 2XC5A 3F0PA 2ZIQH 1TAWA 1YPGH 2P94A 4VGCB 2P8OC 2AGIX 1ZJDA 4RT1A 1EZUC 1ANDA 4TPYA 5A8ZA 2BQ6B 2FOAA 1L0ZA 2YMSD 2UWOA 1O3EA 2ZGJA 3ZZ3A 3ITIA 1OWJA 1GHVH 2FOEA 2KCOA 2C93B 2W3KA 1DX5M 1LPZB 2OD3B 1O3KA 1QCPA 2W6ID 1A46H 4DURA 1PYTD 3QTVH 1EOLA 1TMTH 1V3XA 1SGFA 1ANCA 4IC5A 3FP7E 8KME2 1BMAA 1EAUA 5EJLA 1TB6H 2VIQA 1C1MA 1UTJA 3L33A 5F8TA 5HKKD 1BDAA 3U69H 2CN0H 2JJ1D 3FFGA 2ZHEH 1GJ4H 2PUXB 3BTKE 4ZKRU 1GBJA 5JBAS 1O33A 2JKHA 4DT4A 2ZDLA 3RDZA 2GTBA 1C5OH 3RXRA 5EXLA 2R9PA 1GBIA 2KX4A 1GMDF 1S0QA 4NA9H 1CO7E 4TYDA 1C4Y2 1PPFE 2TPIZ 1F0RA 1S6FA 2UUYA 1COWD 8ESTE 5AHGH 1YPKH 1AZ8A 4K1SA 1T32A 3A8DA 1CHGA 1EZSC 2VH6A 1QBNA 2ZHQH 1TBZH 1C5VA 3FZDA 1SGEE 4MNVA 4D7FA 1UVTH 3U28C 4JZIA 1HPGA 1BOQA 1AIXH 3A7TA 1UW7A 1O3GA 5K7RA 3SBKA 1H1BA 3P17H 2VB0A 3BIVH 4XSKU 4B2BA 5DPAA 2G52A 2JH5D 2A4RA 2WUCA 1ESTA 3ZZDA 3SI3H 1AFQB 3U8RH 1BMFD 2VGCB 1LPKB 3BN9A 1O2GH 4CRFA 1CVWH 1Q2WA 1F0SA 3LJJA 3OYPA 1GI2A 1LTOA 2AS9A 1LO6A 3K9XB 3S69A 5FL7D 1DY8A 1P06A 3M37A 2H2ZA 1EQ9A 1XMNB 3OX7U 1GJ8B 3LC3A 1KLTA 2VIPA 1C1VH 1FPCH 1K0HA 1G36A 1BBRK 1TGCA 3VGCC 1RTFB 3AAVA 1BBRH 1C5TA 4YM9A 3F68H 1K1PA 1RTKA 2R0KA 2RDLA 2THFB 5JYIA 1SGYE 2FDAA 2FS9A 2VVUA 2NWNA 1DUAA 1ZOMA 4WXIA 2PUQH 1GI5A 2QV1A 1JXPA 3UOUA 2BVSH 2GX4A 3RC6A
chains in the Genus database with same CATH topology
1ZMNA 1O3BA 3C1KA 5A0CA 1CGHA 1IQFA 2C4FH 4Y8XA 1G37A 1RGQA 1QURH 4X1PU 1C5PA 3SV2H 3TIUA 4XFQA 1T8OA 2XXLA 1GG6C 4XBBA 3VPKA 5DJ7A 2OUAA 4NA8A 3ATIA 1GVKB 5DGJA 2BXTH 1L4DA 4K2YA 1LVBA 1O39A 5SGAE 1EKBB 3SNAA 5F6MA 3RXJA 1C1OA 4I8JA 3RMOH 2QF3A 1IQGA 2GT8A 1ZR0A 4IMQA 3V13A 1P3CA 1H8IH 3M5OA 1GWAA 1GJ5H 2QN5T 1Y3VA 1LKBA 2FOCA 3UQVA 6CHAB 4X6MA 4AG2A 4HZHA 1TOMH 1NU9A 1BRBE 1QFKH 2Y80A 3MTYA 2JETB 1HLTH 5HXFA 1AB9C 1O5EH 1CHOF 1ZRBA 1NROH 2ANMH 3M61U 3PMBB 1G3EA 2G4UA 5JPMH 2CF9H 4INHA 3TGJE 1GBKA 3RM0H 4KP0A 3K6ZA 2VWNA 5FX5A 1A3BH 3DUXH 2FTLE 1G3DA 1SLVB 5HMAA 2BDAA 2BM2A 1NT1A 4YT7H 1FV9A 3TGKE 3SJKA 1OP8A 1BJVA 3MNCA 3SJOA 2R2MB 2Y5FA 1ANEA 1GPZA 1HAPH 2BDBA 2M5TA 2PTNA 2Z9LA 1PQ7A 4FUHA 1HBTH 1UCYK 1TRNA 2H9EH 1WCZA 4Y76A 5FX6A 1THRH 1UCYH 1DM4B 4MDSA 4BAKB 4DG4A 3SNCA 2ZC9H 1TYNA 1JRTA 4DJZB 1GMCF 1FY5A 1AZZA 2BX4A 4JZDH 2A0QB 3PTNA 1WAYB 3E0PB 1IHTH 3QUMP 3BG4C 1SSXA 1QBVH 2P3FH 1DOJA 3OY6U 3MU8A 1HAOH 1AE8H 2ZHFH 1AD8H 3EA9A 1ELAA 1MQ6A 2XTTB 4CREA 2ZTZA 3M36A 4NG9H 2VH0A 1EZXC 2A5KA 4X0WU 3ZZCA 1O5BB 1T8MA 1ZPCA 1O5CB 1XUJA 1A2CH 3PO1C 5CMXH 5J4QA 2SGAA 1V2PT 3V3MA 3RXGA 1VITF 2OC7A 1SPJA 1O38A 5C20A 5L2YH 4A1XA 1QRWA 1LVMA 3RC5A 3JZ2B 2RA3A 2AEIH 1V2ST 1DSTA 1YP9A 1ZTKA 4J1YA 3SNDA 4YT6H 1YC0A 2ZGXH 1W3CA 4AFUA 2GGVB 4ZKNU 1ZTJA 1TQ0B 2A7HA 1C4U2 3RXEA 5EW2H 3E90B 4DGJA 2XBYA 3Q77A 4B71A 4UEHH 1V6DA 2VIVA 4UD9H 1DXWA 2HNTE 4I32A 1KXFA 5T6DA 2BD3A 1QRXA 1JBUH 1CA0B 1O5DH 1UO6A 3MU0A 3GDVA 1WBGB 1QA0A 1UHBB 5C5OA 1V2TT 4YOIA 3M5MA 2PGQB 1MTNB 3P70B 4Q7ZA 1BIOA 3SV8A 1MH0A 1DPOA 1D6RA 1TPAE 2BY9X 4UE7H 1SR5C 3RP2A 1ZZZA 1D6WA 3QDZB 4O9VA 2F9OA 3EDXB 1GI0A 1KDQA 1QB9A 1FXYA 1MUEB 2O9QA 2ZO3H 4MPWA 1FY3A 4Q2KA 2GCHG 2GV7A 2BMGB 2FI5E 1O3CA 1ZTLA 4Q80A 2NU2E 1DDJA 2AMQA 2UUKB 2A4OA 4CRGA 1AVGH 2WINI 4B76A 2PSYA 2ULLA 1DLEA 1W13U 1NU7B 3T28A 1BRUP 3ZVGA 3SGAE 2LNCA 2ZPQA 1GCTC 3R0FA 3ATKA 2YNAA 3SO3A 1PPGE 3SOSA 1RFNA 1UTQA 2GMTB 2A32A 2Z94A 3B9FH 3A89A 4Y10E 1GJ6A 5T6FA 4K8YA 1DITH 4GHTA 1P02A 4ABDA 2EEKA 2A7JA 1S83A 2W7SA 2C8ZB 1NRSH 1GVZA 1EPTC 3RM2H 4X8VH 3B23B 3MO3A 1TMUH 2ANYA 2ZDVH 3Q76A 2BOHB 1XUKA 1DWCH 1B5GH 1G3BA 1GHAF 3A7WA 3S9CA 3U8OH 1RRKA 1ZMLA 4YOGA 4HTCH 3RXIA 1O2NA 3UNQA 4X1SU 2QXIA 2PTCE 2H9TH 1KXCA 1LHCH 1KXBA 4K1EA 1C2GA 3AW1A 5JB8S 4RN6A 3QZQA 2UWLA 4WH6A 1ABJH 1P2QA 3RXTA 1UK3A 1TX8A 3URDA 2FOHA 6GCHG 1DWBH 5EOKA 3HK6B 2CXVA 1O2YA 2FESH 4X8SH 1BCUH 1NM6A 2Z3CA 1Z8IB 1C1QA 3RXPA 2QXJA 4GCHG 1O2VA 1RS0A 3LT3A 3BG8A 1PPZA 3BV9B 3NUMA 4JZEH 1KXDA 1O3IA 3QGJA 1QJ7B 2ZFPH 1EX3A 1O2XA 2ZDNA 2AERH 1QA7A 1PPCE 4MPUA 4NSVA 1UVPA 1FLEE 4ZROA 5A8XA 1O3NA 2ZHDA 1P03A 2J94A 3BTME 1CBWB 2OP9A 1IQIA 1GMHF 4O03A 2XBVA 4FUJA 4BAOB 1O2MA 5LGOA 3SV7A 5DG6A 3VXEH 2WPHS 1ZRKA 3P8FA 1HAXB 2O8MA 3ZZ9A 3SJ9A 1QL7A 3TVJB 4WMDA 1UK2A 1V2WT 3EYDA 3RXLA 4ESTE 1CA8B 1HAHH 3KHVA 3MYWA 2Z9GA 2B7DH 2A5IA 2J2UA 3K65B 3R3GB 1J17T 3QLPH 3AW0A 4OGXA 2SGDE 3UIRA 4ZKOU 1UMAH 2XWBI 2Q1JA 1LQDB 2W26A 1AHTH 1SGTA 1D4PB 3ATWA 1W11U 1XKBC 1KIGH 1WTGH 1NRRH 2Z9IA 3LGTA 3LONA 3ZZAA 3D49H 5HM9A 2CF8H 3E16B 1AKSB 1UTPA 1NS3A 3UTUH 2SGQE 2H1UA 3SUDA 4Y7AA 1GGDB 3ZVEA 1O3LA 3S9BA 2FP7B 2PKAB 3I29A 1O5GH 2ZU2A 4BAMB 5DP6A 1LHDH 2C8WB 2K1QA 1UTNA 4ZKSU 4KTUA 3GDSA 1YPHC 1ELCA 5CHAC 3SU5A 4ZMAH 3L3TA 1BTPA 1EJMA 2SGFE 1SLXB 1CT2E 2ZTYA 3TJOA 1NFYA 3TH2H 4O3UA 4LZ4B 4WF8A 1KXEA 2BVXH 1T8LA 2V6NA 3PMAB 1TMBH 1DICA 1WUNH 2FOBA 1E34B 1Z1IA 4LOYH 2J9NA 4AFZA 1FY4A 3NK8A 4IN1A 1PQAA 1ZHMA 1FY1A 5GCHF 1WQVH 1TNJA 4UDWH 1VCWA 1BUIA 1TBRH 1VGCC 4DCDA 1SG8B 1FI8A 1RXPA 4FU9A 1IOEA 3ZZ8A 1J8AA 6ESTA 4MNWA 3ZVBA 3ZZ4A 4XBDA 4H4FA 2PW8H 2Y5GA 1JMOH 1OKXA 4MNYA 5C2ZA 5G4BA 2C8XB 1V2KT 1T31A 4BNRA 1IAUA 1C1TA 5L6NH 1ZPZA 3CP7A 1O37A 1WTHD 2KAIB 3RU4T 2OC1A 1GI7B 1O2RA 2A2QH 1GMDG 3S7HB 2WPJS 2O8WA 5J4SA 4NZQA 3SN8A 1TE0A 1SBWA 4U2WA 1HYLA 4D9RA 1C2LA 4FU8A 2O8UA 1QBOA 1O3FA 1OWDA 2FO9A 1A5IA 1GDNA 4E7NA 5FCRA 4R8TB 2RCEA 1QNJA 3ELAH 1TRYA 3MU5A 3UNSA 5EPNA 1Y5AT 2STAE 5CE1A 5LPEA 3RMNH 5ETXA 1XX9A 2ESTE 3ZZ7A 1V2OT 2DUCA 1V2JT 2WPLS 5I46H 2A1DB 3DD2H 1VJAU 1SGIB 3MO6A 1INCA 1RIWC 2AGEX 4ZAEA 5C67A 2PWXA 2FEQH 2XWAA 5EQSA 1ELVA 1O35A 2HWLB 2Y81A 2ZFSA 4WWYA 1F5LA 2FYQA 1UVSH 1S85A 3VB7A 1OWIA 1MTWA 2TRMA 4D76A 4TWYA 1EB2A 1GBFA 1L2EA 1YCPK 1HXEH 3M3VA 1KXAA 1YCPH 1D3DB 1P01A 3TJVA 3PLBA 3ZVAA 1YYY1 2A31A 4I8GA 3BEUA 3BTFE 3ZZ5A 4Y8YA 2BHGA 1OWKA 3SQHE 2PKSB 2FMJA 3TITA 5EQQA 4CRDA 5I25A 1KTSB 2BD2A 5DP8A 2B5TB 4TY7A 1T8NA 1GJDB 4X6PA 3L6PA 4CR5A 2EA3A 1C5NH 1YBWA 2SFAA 3KQDA 1P2KA 1TNKA 3QTOH 1BRCE 1ESBA 3SNBA 2Y6TA 2UWPA 3EE0B 2F83A 1CU1A 1SB1H 1ACBE 1SGDE 2Q6GA 3A87A 1SFQB 1QJ1B 1FONA 1L1NA 4GSOA 2QY0B 3GYLB 1TNIA 4OS1A 1GI9B 1HV7A 2OINA 4K60A 3MNXA 3D23A 1Y8TA 1O30A 2VU8E 2WV5A 4VGCC 5LH8A 4AORA 1AUJA 1HB0B 4DIHH 2HVXA 3CS0A 4OGYA 1E37B 1SC8U 3F9GA 1C2FA 2W7UA 3S7KB 4KGAA 4B1TA 3TNSA 1E36B 1RJXB 5DKMA 2TGDA 5FPYA 2H6MA 3LKWA 1JIMA 1SVPA 1GL0E 1SL3A 1N8OB 1O2LA 3H5CB 1OWHA 2SNWA 1PPHE 3FP8E 1O3PB 3MH7A 4NIXA 1L1JA 1F7ZA 3RUOA 2GCTB 3I77A 4CR9A 2ZWLH 1O2QA 1FUJA 2J34A 4GHQA 3MWIU 4WVPE 4BTUB 1BQYA 1TONA 1LHFH 3BEFB 3RXAA 2VINA 3ENSB 4WJG2 3UPEA 3EQ0H 3GOVB 1TPPA 2ZNKH 5EQRA 2VIDA 5F8ZA 1C9TA 4ABAA 3EAJA 1A4WH 4MNXA 3PYHA 2AYWA 1FNIA 3PTBA 2C3SA 4YLUA 1UTKA 1ZLRA 1XUHA 3CENA 4TY6A 2C8YB 4UFGH 4H6TA 3O8BA 5C1XA 1W8BH 3FZZA 1IQHA 4ISLA 1GDUA 1TFXA 1SQOA 1BMNH 3ZVCA 4A92A 3EA8A 4B2CA 4ABGA 2WPKS 2ZU4A 1SGCA 2GZ8A 2QF0A 1AFQC 1Q31A 1G2LA 1TA2A 1EP6A 2ODYB 2VGCC 2FI3E 3PMJA 5EGMA 4FUGA 3P92A 4AZ2B 1NPMA 4BAHB 4CH2B 1UTMA 2FOMB 1PPBH 3PO1B 1GBEA 3SHCH 1N6XA 3PM3A 3SJ8A 1VITG 4UONA 2ZFTA 4X2YA 1GHBG 4SGBE 1P8VC 2C90B 1FAKH 2SNVA 4Y6DA 2Z9KA 1LVOA 1K1NA 3P8NA 2J4IA 1QY6A 2W5EA 1RTLA 3BF6H 1ETSH 1NO9H 1XUGA 2I6SA 2SGPE 1NFUA 4FXGH 3Q3XA 5E0JA 1JWTA 2A5AA 1BBRE 3MOCA 5TCCA 1GBMA 3TH3H 7ESTE 2FWWA 2Q6DA 2ZQ1A 2ZA5A 3RXUA 5F8XA 1BTXA 3VB6A 2H5DA 4DOQA 2IPHA 3AAUA 3SU3A 3M5LA 1GI1A 1E0FD 2XYAA 3DFLA 3ESTA 8GCHG 3NZIA 1VR1H 3SGQE 1P9SA 4B74A 1GBTA 1GHYH 3GCTF 1G3CA 4NCYA 1O2HA 2HALA 2HGTH 3RC4A 2B0FA 4ZUHA 4DY7B 1VCPA 4X1RU 3SV6A 2ZPRA 1C1UH 1HAYB 4BAQB 3I78A 4CRBA 1NTPA 3ZYDA 2JETC 2QYIA 1HAVA 2VWOA 1BT7A 2XW9A 3FVFB 1P09A 1BZXE 1MQ5A 1O2KA 4ISNA 1A1RA 1W0YH 2WV4A 1ANBA 3SQEE 1P9UA 2B9LA 1C5WB 4MLFB 3TGIE 1YGCH 5FCKA 5C3NA 3BTEE 1W14U 3MHWU 4QT8C 1YCPM 1EPTA 1D3TB 2BOKA 3TK6A 2PR3A 4JCNA 2QGRA 4Z0KA 2DE8A 4YTAA 3BSQA 2CHAB 3K2UA 3G01A 2VJ1A 2TGAA 2F3CE 3TNTA 4AG1A 1Z1JA 3RXDA 2F9VA 1Y59T 1HJ9A 4IGDA 3RXBA 3NWUA 1GBAA 1SQTA 1E35B 3U1IB 1IQJA 1UHBA 3GISB 2GKVE 1ESAA 1IHSH 3KGPA 1ETRH 1TNHA 2BB4A 1EXFA 1DLKB 1P10A 3KF2A 3MNSA 1S5SA 5JBBS 3UREA 4KTSA 1LKAA 1ZMJA 3SUGA 2A4GA 3T29A 2Z3EA 4YZUA 5A09A 3W94A 3F6UH 2G00A 1UCYE 3LIWA 3BTDE 3MMGA 3RXHA 9ESTA 1FY8E 3MNBA 1CT0E 4I8LA 3A82A 1O2SA 1LHGH 2BY5X 3FAOA 4FUCA 2AH4X 3RXVA 3VXFH 4WH8A 2GP9B 4BXWA 3QO6A 4AFQA 4NWLA 2BY8X 1H4WA 1JRSA 2ZCLP 5FXLA 1A5HA 3LH3A 3ZVDA 1F5RA 1GBLA 1C5SA 1W2KH 1TX6A 4Q7YA 3MU1A 3HK3B 1AQ7A 2OQUA 3LH1A 1OPHB 2BY7X 2ZDMA 2BQWB 4NWKA 2AIQA 1HJAB 4Z6AH 5JB9S 4A6LA 2ODQA 1KYNA 2TBSA 2HPQH 1GBBA 1JIRA 5C5NA 1AU8A 1GMHG 3SGBE 5JBCS 1GI3A 3RXCA 4I31A 3E3TA 4FU7A 2F91A 2QIQA 3A84A 3UNRA 3GICB 1BITA 5EPYA 1CA0C 2NU3E 1ZGIA 2EI7A 1HIAB 3A83A 2OQ5A 3LGVA 1DWEH 2RG3A 2G5NA 3MO9A 4U30A 1MTNC 1XXFA 1C1RA 3F9HA 1BRAA 4A7IB 2DE9A 2BYAX 2BD9A 2FX6A 3M3TA 2QXHA 3BTHE 1OS8A 3RXFA 3KEEA 1EAWA 3GYMA 1PFXC 1O2PA 4XBCA 4KTCA 1CGIE 5A2MH 2ZGHA 1QQ4A 4MQAA 1O2ZA 2G4TA 1G9IE 3KQEA 4HGCA 1NN6A 3TK9A 3PLPA 1TOCB 2FS8A 3ZV9A 2CMYA 1K1JA 4ZHMU 1W0ZU 5LPRA 1HFDA 1C5XB 1Z8JB 3ZV8A 2TIOA 1AY6H 3A7YA 1GJCB 4TWWA 1O0DH 3GCOA 1QJ6B 4Q7XA 4THNH 2ODPA 2BDCA 4U01A 1YPEH 2SGEE 1A0HB 4WMEA 5CHAB 1P2JA 1P05A 4B2AA 2VWLA 1NESE 4NIWA 3SU4A 2GMTC 2NU1E 1AGJA 3HKJB 1O3HA 2FX4A 3RU4D 2ZF0H 1O31A 4X2VA 3STIA 4AYVB 1Y3UA 2WYGA 4BTTB 1B0EA 4JYUH 5GWZA 4E06H 3GCHB 1ETTH 4DIIH 3ZZ6A</