1OWEA

Substituted 2-naphthamidine inhibitors of urokinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Identification of Novel Binding Interactions in the Development of Potent, Selective 2-Naphthamidine Inhibitors of Urokinase. Synthesis, Structural Analysis, and SAR of N-Phenyl Amide 6-Substitution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 58
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1oweA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1oweA01
1FXYA 3P6ZB 2FDAA 5EPYA 1A3EH 5J4SA 2CF9H 1KYNA 3E3TA 4MNWA 1C2EA 4ZXYH 4IBLH 3F1SB 2FS9A 1T8OA 1VR1H 2A4QA 2OQUA 4NZLA 3TU7H 2BD4A 2A5AA 1IQHA 4M7GA 2FO9A 1A5GH 3LGTA 1JIMA 1RTKA 2EC9H 4B74A 5G4BA 1GMDF 2C3SA 1GHZA 1ELAA 5EODA 1K1JA 3PROA 1S6FA 1BRCE 4ZUHA 1YYY1 2DE8A 4NA7A 4E7NA 1MAYA 3PYHA 1BTWA 1EJMA 3GY7A 4SGAE 1MH0A 3ITIA 3UTUH 4CHAB 3Q77A 5C1XA 1CE5A 3RC5A 4AG2A 1ANBA 1C2DA 1GI4A 5IYTA 3TGKE 1PYTD 5JPMH 1GL1A 3OSYA 1YLDA 1PPCE 1IQIA 2BB4A 1T7CA 2BOKA 3AAVA 4ZKOU 1QHRB 3DFLA 1TPSA 3MO9A 3A89A 1LHGH 4FUBA 5AFYH 4AOQA 3UOPA 2HALA 1DOJA 5T6GA 2Q6DA 2BY9X 2AFQB 2P16A 3EA8A 1UMAH 3EQ0H 2JH5D 3SO3A 3Q3YA 3DD2H 5EXNA 4IW4E 2Z3DA 3RDZA 3UNRA 2OLGA 1XUHA 1SSXA 1LKBA 5CHAC 1SPJA 4UFGH 2AMPA 4IMZA 1BRBE 1O3JA 1PQ8A 1ZPZA 2D2DA 3TJVA 1J9CH 1BBRK 4AGKA 3PLBA 1ETSH 1O5FH 1UTLM 1RXPA 4TY6A 2WPIS 1C1WH 1GHWH 1AUTC 2BZ6H 3A80A 4I8JA 5I25A 1O2IA 1C5TA 2ZFPH 1G9IE 1YPHE 4ISIH 3GDUA 2G5VA 1P0SH 5FHTA 4B76A 5HM9A 1C5UA 1PPHE 1SGDE 4IC5A 3MNSA 4MNXA 4YM9A 1HPGA 2GMTC 2FLBH 4GUXA 3KN2A 2STBE 4FUGA 1LDTT 2ULLA 5A0CA 5FPYA 1YPJH 1GBIA 2FS8A 1UK2A 2FODA 2PHBA 1YPKH 2RA3A 1O31A 3QDZB 3A8CA 1EP6A 4I8LA 4OGYA 3SU3A 2PWXA 5FBIA 1P02A 2FPZA 2BHGA 2BDCA 1F0UA 4K69A 1D9IA 4R8TB 3SJKA 3BG8A 2G4UA 3VB3A 4HZHA 2XYAA 2ZDMA 2QC2A 3BIUH 4WMEA 3A7ZA 1O39A 4ISHH 1EATA 3A88A 2ZC9H 4MDSA 3TK5A 1MKXK 1AVXA 1AE8H 1QCPA 1IQGA 1B5GH 3OYPA 1EASA 1D4PB 3RXRA 1JBUH 2BD3A 1GBBA 1THRH 1C4Y2 1O2ZA 1TIOA 3SU6A 3PLKA 2FP7B 2SGEE 4ZROA 3TIUA 2Z94A 3P70B 2XW9A 3E0NB 5K0HA 3ZZ4A 1C5YB 3M7UA 5GCHG 1HJAC 2F9VA 1TAWA 3UREA 1MTNB 1THPB 2ZU1A 1LO6A 2AMQA 1EZSC 3H7OA 1G37A 1LKAA 2ZFQH 4NIXA 2ILNA 1KDQB 4I8HA 1JMOH 3T29A 1DXWA 1Z8JB 2QXJA 2OC7A 1QA0A 2HPPH 1ZLRA 1UHBA 1C5QA 2BVXH 1O3HA 1TPOA 2ZFTA 4KTUA 3M61U 1FI8A 1FY8E 1YGCH 1J15A 4AFQA 4BTUB 1GMHG 2AH4X 1TNJA 1HAYB 2F9PA 1C1TA 2ESTE 1KTSB 2C8WB 1Y3UA 1YPHC 1AHTH 2OQ5A 3RXJA 3SBKA 4B2BA 3O8RA 1O2PA 1SLUB 1K1PA 1WCZA 2A1DB 3M5MA 3ZZ6A 4Y7AA 1Z1IA 3UWIA 3L6PA 5K7RA 5L2YH 2J95A 3F9FA 1F92A 1FQ3A 3TJUA 2SNVA 1C5VA 4ABFA 2WUBA 1UVOA 1D3QB 2QA9E 1BQYA 5JBBS 3U8OH 2W7UA 2YNAA 3SGQE 3TPIZ 3SUFA 1DLEA 2BQ7B 3HATH 3A7XA 1EB2A 4NWLA 4BAHB 1FIZA 3A82A 1AU8A 1LQDB 3LOXA 1Z8GA 1U6QA 4FXGH 1HLTH 5A0AE 2ZU4A 1EZUC 2JETC 1HAHH 3MTYA 1O5AB 4X8TH 4DT7B 2BX4A 3LPRA 3TLOA 4RN6A 4LZ1H 1GCTC 3QO6A 1O5CB 3G01A 1C9TA 4FU9A 3QUMP 4ISLA 3ZZ8A 2XXLA 3KQEA 4AZ2B 1LPGB 3T28A 2FOHA 1KLTA 2XCNA 3ZZAA 1LVYA 1NFXA 5AHGH 1V2JT 3ZYEA 2GD4B 1IQFA 1CGJE 4X2VA 1A5IA 1QJ1B 1AN1E 1ELBA 3RXTA 3TK6A 2FOEA 3ELAH 1GHBG 1K28D 1BOQA 3SNEA 1NFWA 2A5IA 4K1EA 1UTMA 4DCDA 1GVKB 2AERH 4VGCC 1QB9A 3RMNH 3UWJH 3SU1A 1P06A 3QGJA 1DY9A 1VJ9U 3A7YA 4YTAA 5C5NA 4AORA 3A87A 3SW2B 1J16A 2GVFA 3ZVBA 1CQQA 1WU1A 3SUEA 1ARBA 5JB9S 5JBTA 2BY5X 4UFEH 1C5ZB 4U32A 1FN6A 4WMFA 4FUCA 1CHOF 4ZXXH 1GWAA 1L4DA 2A4RA 1ELVA 1N6XA 6GCHG 1A0LA 3SJ8A 1HIAA 5CMXH 5C3NA 1Y5UT 1J17T 3KHVA 3SZNA 2BVRH 3MU1A 1C1MA 5GDSH 3P8NA 3ATMA 2XRCA 3UQVA 4MPVA 2VVVA 5E2PA 2ZECA 1UTJA 5JDUB 4CBOA 3TK9A 4U30A 1UCYK 3U98H 3V12A 2OP9A 3BTEE 1O2OA 3MU0A 3RM2H 1ZGIA 3V0XA 1G36A 1GBJA 2FLRH 2ZDVH 2FM2A 2C90B 2BDGA 1ARCA 1QB1A 1EAIA 5TCCA 1TGCA 2BMGB 4JZDH 4MTBA 2ZCKP 1AB9B 3ZVGA 9LPRA 7GCHG 4X2YA 4I32A 1EJNA 2TRMA 2BYAX 1TMBH 1CT4E 1QIXB 6CHAB 1YCPH 3GYMA 3LIWA 3OY6U 2Z3EA 5F8ZA 3RC4A 1V2OT 2FOBA 1DXPA 3LGWA 1GHAF 1Y3VA 2H5CA 1HNEE 1GJ5H 2P3UB 2PLXA 4JYTA 1TB6H 1ZMLA 3VXEH 1BMAA 1UTPA 2QY0B 3L3TA 3I78A 3W95A 1ZSKA 5DPAA 2W7SA 1BTZA 3M3TA 3QZQA 3NKKA 1O3OA 2XWBI 1S84A 1ZJKA 3RM0H 1Z6JH 1SGPE 1ZJDA 4LK4A 1T4VH 1KXCA 3FANA 3RXSA 1ZRBA 1GBTA 5FX5A 1UVPA 4ABJA 1HAVB 3ZVEA 1LQEA 2IPHA 2VINA 1CBWB 3Q00A 5EXMA 5E0GA 1QRWA 1CVWH 4DVAU 1DITH 1C5SA 3BTQE 3U69H 1W8BH 4ZHLU 2ZHQH 2R3UA 1SGCA 4MG3A 2ALPA 4WH6A 4DJZB 1HXFH 1C1UH 1P05A 3PMHB 4J1YA 2PW8H 1O3LA 1ZPBA 1DY8A 1O33A 2QYIA 1KSNA 4FVDA 3E16B 3HKIB 1C4V2 1ZZZA 2NU3E 4SGBE 3V3MA 5C2ZA 1O2HA 3MH6A 2FYRA 2ZU5A 4X8SH 1RIWC 1O2VA 5BPEA 7KMEH 2PGQB 1TRYA 3ZV9A 1WYKA 1BITA 1W13U 3DA9B 4YO9A 1L1NA 2EI8A 4UE7H 3NCLA 2BM2A 1QJ6B 1HGTH 1GJ8B 1CA0B 3FZDA 1GJDB 4IS5A 2F3CE 4AGJA 5I46H 1DPOA 2IJOB 1O34A 2AYWA 2O9QA 1L0ZA 1C5NH 1C5RA 1A61H 3E6PH 3SV2H 2K1QA 4NG9H 3SNBA 2FOGA 4CR9A 1UTNA 4NGAH 1HV7A 2GCTC 1MQ5A 1P2MA 1AVWA 2CF8H 4K5ZA 4ISNA 1SGNE 2ODYB 3VGCC 3MU5A 1ZGVA 4NWKA 1EAUA 1SLVB 3ZVFA 3RXHA 2Y82A 1QJ7B 4LXBH 1UK4A 1LHCH 1SOZA 2HOBA 5E8EH 2AIPA 3QX5H 1RTFB 1GI8B 4CR5A 1G3EA 1QFKH 3UOUA 4O9VA 1P57B 2ZGCA 3BTHE 1WQSA 1F0RA 1LCYA 3V7TA 1TGTA 3S9BA 4UD9H 3K6YA 4MPXA 1HUTH 1L1GA 1W7XH 4X6PA 1Y5AT 1O3PB 4IC6A 4BTIB 1UVTH 1BJVA 1GG6C 1ELFA 1G2LA 3M36A 3RXPA 4B2AA 3M7TA 4AFZA 4B75A 5EQRA 2BLOA 1GGDB 1ANDA 2UUKB 1HAOH 2LNCA 1O3NA 1AFEH 3PWCA 4AG1A 2O8LA 5TCAA 1D3DB 1V6DA 2WPHS 3GY5A 1TGBA 5T3HA 2ZU3A 5HXFA 2XBYA 1G3CA 4KGAA 4O97A 2VH6A 4MNVA 1S83A 1AMHA 4JK6A 2P59A 2RA0A 4O3TA 1C1SA 3QN7A 2OC1A 3Q3KA 4CRDA 4XDEA 4INKA 1FN8A 1ABIH 2ZHDA 1GL0E 4BNRA 2R0LA 1O3CA 4CREA 3VB6A 1O2QA 4H42U 1Y59T 2G51A 4ZHAA 1Y8TA 1CT2E 1Z7KA 1LPKB 3SGAE 1ELDE 3EGKH 3UNSA 2IOTA 3RU4T 1V2UT 3HKJB 2ZPSA 2ODQA 1GBLA 4UEHH 2BDYA 3K6ZA 1PYTC 3QTVH 4Z0KA 1K1LA 1N6YA 1DUEA 1TALA 5GXPA 2OBQA 1OWEA 1AD8H 5E2OA 3ATLA 2ZGBH 1K22H 1GVLA 4YOJA 1HDTH 1GBAA 4IN1A 1FMGA 1HB0B 1YF4A 3BTFE 2PKAB 3BEIB 1ELGA 3M5OA 2ZDNA 1KXEA 1NRSH 2CV3A 2GZ7A 3E1XB 4THNH 1SI5H 1E36B 5DK1A 1J14A 1P2QA 4GCHG 3SV9A 3JZ2B 1NFYA 1HAIH 3ODDA 5A8XA 2ZCHP 1GBFA 1RRKA 1MKWK 1NZQH 1RJXB 1O3BA 3KQCA 1A3BH 2VNTA 1O2SA 1TOCB 3LKWA 4NSYA 1GJ6A 2BD8A 2B0FA 3KL6A 3AASA 3QLPH 1GJ4H 1QQUA 1YC0A 2W3IA 1MQ6A 2BXUH 5B6OA 4Q7ZA 2J2UA 1XKBC 1KIGH 1TFXA 4U2WA 1K1OA 3MI4A 1TNGA 4YLQH 3UR6A 1YPEH 4XBDA 3RXBA 2ZTZA 1N8OB 1S5SA 4OS7A 4ABBA 1T32A 3RMLH 3B8JA 4F49A 2VVCA 2V0BA 5A8YA 1K9OE 1CA8B 2H6MA 1GDNA 2ALVA 3MWIU 1HRTH 4AYVB 7ESTE 4D9QA 2HRVA 3V13A 1TBRH 5JBAS 2SGAA 2ZFFH 1H8IH 2A32A 3SQHE 1NTPA 2W26A 1RD3B 1AY6H 1A4WH 5FCRA 4IN2A 1P8VC 1AWHB 1G2MA 1Z8RA 2P8OB 1SHHB 3ESTA 4A1VA 1D6WA 1VGCB 4WWYA 3RXFA 1C2MA 1SGFG 3BEFB 1FPCH 1HCGA 2GT7A 4X6OA 2OBOA 5ABWA 4U01A 1P10A 3UFAA 3Q3XA 1O5EH 4UDWH 4OS6A 2WYGA 4ZAEA 1FV9A 5L30H 2TIOA 2OUAA 1MCTA 3TH4H 2VGCB 3DUXH 1NRPH 2ZNKH 4MLFB 5EGMA 2OD3B 1O3GA 4JYUH 2ZFRH 4X1SU 2Q6FA 2ZPQA 1GJAB 4DY7B 4FUHA 2JH6D 2GV6A 1C5LH 1AKSB 3E8LA 2G55A 3GCTG 1PPBH 3FZZA 1TPPA 1EUFA 8GCHF 1W3CA 3EA9A 3A8AA 3GY6A 4ZKNU 1GHVH 3S9AA 1BMLA 1MU6B 1EQ9A 1C2IA 5F6MA 3LU9B 4K1TA 2G81E 2PV9B 4VGCB 4BAKB 4FUEA 5JBCS 1IQNA 3T62A 1EOJA 1ABJH 2GTBA 1XUGA 1AKSA 2VH0A 3SUDA 2PSXA 2J38A 2V6NA 1DLKB 1ZHRA 3VFEA 2XTTB 4YZUA 1QBNA 4YESB 3GICB 1W10U 1GMDG 1P01A 1DSTA 3O8DA 5FAHA 1AUJA 2H9EH 4CH8B 1AFQB 1OX1A 3M3VA 2GDEH 1YKTA 2BDIA 2FOMB 1C1VH 2WV5A 3H5CB 1BRUP 2WPLS 1O2GH 1H4WA 4A92A 2ZWLH 3GISB 1QBVH 2KAIA 1Z8IB 2FX6A 2D1JA 1CGIE 1ETRH 4K60A 4GHTA 1BMMH 1C5XB 1GMCF 1MU8B 3PMBB 1IOEA 1PQ7A 2CXVA 4X1PU 1OWJA 1E0FD 1D3PB 1W11U 1P2NA 3E90B 1SGQE 5E0JA 2GX4A 1G32B 4WY3A 1DWCH 3SI3H 1V2KT 1SGIB 1K1NA 5AF9H 4WJG2 1LTOA 3BTME 3SNAA 2HVXA 5DP8A 3MMGA 2F9BH 1NRQH 3FFGA 4ABHA 6GCHF 1ZHPA 1EZXC 1EAXA 1HAXB 1W7GH 4X8VH 1PPFE 1K1MA 1GHXH 2EA3A 1ZSLA 3LGVA 5EOKA 3SV8A 3ZVAA 5DP5A 1C5WB 5DKMA 1BBRH 1O3AA 1EP5A 2BLWA 4CH2B 1O2YA 3M35A 3S9CA 1XUKA 3QK1A 4Y8YA 3SQEE 2GCHG 1GJCB 4FVBA 1PPZA 1A5HA 4R0IA 5F8TA 1M9UA 3RXMA 5LPEA 4X1RU 3UNQA 2VIPA 3SI4H 1LHDH 1BZXE 3BV9B 8KME2 1SBWA 7GCHF 3LDXH 3SU4A 5HM2A 1SC8U 1AQ7A 2XC5A 4FUIA 1XVOA 1GHYH 3HGPA 4Q2KA 1FY3A 3KGPA 4JK5A 1TA2A 4X0WU 2VVUA 1ZTLA 1X7AC 4JYVH 1CGHA 1TLDA 2CMYA 2EEKA 4D9RA 3TH3H 2ANKH 3EA7A 3RXCA 4BXSA 3PMJA 4NIWA 1C1RA 4TYDA 1LVOA 2ZU2A 1MKXH 3CS0A 2J9NA 5EPNA 5EU8A 4X2WA 5GJ4B 3RLYH 4A6LA 1C1QA 1W12U 1LMWB 4KP0A 1IAUA 1NM6A 3S7HB 4E06H 1F0TA 1QRZA 1OP8A 2BY7X 1FNIA 1UHBB 4WXIA 2GDDA 3F6UH 3LJOA 3M37A 3EDXB 4GAWA 4E7RG 3UY9A 1DUAA 1AO5A 3E91A 1EPTA 4D7FA 3ZZCA 1LPZB 5AFZH 1RGQA 1MZAA 3QTOH 1RIWB 6LPRA 1P11E 4O3UA 1V2PT 2Y5FA 3A84A 4XFQA 1DX5M 5C20A 2EI7A 1QY6A 2P95A 2GKVE 1E38B 3U1JB 4Y79A 3LC3A 1H9LB 1GCDA 5LPFA 2Z9JA 3BTDE 1F2SE 3K9XB 1S81A 3PTBA 2B9LA 3RXAA 4XOJA 5A8ZA 1NO9H 1TABE 1DWBH 1MTNC 2QCYA 4HTCH 2AGEX 3UUZA 2V3OH 3VGCB 1WBGB 3GY3A 1XUFA 1SVPA 2V35A 1K21H 3SOSA 2NU4E 2ZGJA 2FIRH 4RKJB 2B7DH 3BF6H 1HAZB 3VB5A 2BD5A 4KTSA 1ID5H 1V2LT 3E0PB 3PTNA 2SGQE 1O2WA 2D8WA 2I6SA 5FCKA 5F03A 1ELCA 1VITH 2PTNA 2H2ZA 2VB0A 1SG8B 2F83A 3NZIA 2PSYA 1V3XA 1Z1JA 1P03A 2ZHWH 3LGUA 4I33A 2FI4E 3RXIA 3PO1B 3BG4B 2P93A 1QURH 2H5DA 2W5EA 1SGRE 1XXFA 2QN5T 4MVNA 2YNBA 4GVUA 2F91A 5PTPA 3NK8A 2ZG0H 3GCHB 1BBRE 1QR3E 5C67A 1A0HB 3MO6A 2SGPE 4QT8C 1Y3WA 4NFEA 4I8KA 2V3HH 3O8CA 1UO6A 4AB9A 1VZQH 2BLQA 1AI8H 3ZZDA 4JCNA 4BXWA 1FONA 5T6FA 9ESTA 3FVFB 4YOGA 2ZTXA 2J34A 5FPTA 3LJJA 1NESE 3KQDA 4DIIH 3MH4A 5DGJA 3WY8A 1T8LA 1V2TT 3OY5U 2ZGHA 4CRBA 1EAWA 1HIAB 3P95A 1XM1A 4OGXA 3TJNA 5LGOA 1NPMA 1BTUA 3SNDA 4DURA 2ODPA 3PB1E 1S0RA 1CHOG 1SLWB 1KLJH 3D49H 3F68H 2DUCA 1MTSA 3MOCA 1C2LA 1UTOA 3DHKH 1SLXB 1SFIA 4DW2U 1BA8B 4WMDA 1ACBE 5E0HA 3LGIA 3RU4E 1HYLA 1H8DH 1TQ0B 4NA8A 3PWBA 3TNTA 1UCYH 1XMNB 2ZHEH 3GOVB 2YOLA 4A5TS 4NSVA 3RMMH 4JZEH 2C4FH 1C4U2 3ZZ7A 4Q80A 2XWAA 1SGFA 1HAGE 1TA6A 2RG3A 3PLPA 1AZ8A 1FY4A 4D76A 3F9EA 1P3EA 2BOHB 3T2NA 2QF3A 1TGNA 2OTVA 3BTTE 1BT7A 4O03A 1O2RA 1MD8A 2O8WA 1QL8A 2Z6BD 2PKSC 2OCVB 4XSKU 2XBWA 2WYJA 4CBNA 3JZ1B 1CO7E 1XUJA 1UJ1A 4K8BA 1O2JA 1MUEB 1SL3A 2CGAA 5GPIB 1GHAG 1OOKB 4JZFH 3MFJA 4FU8A 4DGJA 2BVSH 5DO4H 1GBCA 5F8XA 1A0JA 2I6QA 4FU7A 2AMDA 1JRSA 1TNKA 1GJ7B 4WF8A 2WUCA 4ASHA 1T31A 2PGBB 4HI3A 3N7OA 3OU0A 1C1NA 1AB9C 3ATIA 2Y81A 1OXGA 1OYTH 1DFPA 1C1PA 2H1UA 2VJ1A 2BD7A 2ZDLA 5GIBA 4PROA 2XC4A 1K2I1 4NA9H 5CHAB 3RUOA 3ZZ3A 1C5OH 2VIVA 6CHAC 2TGDA 2VIWA 1AGJA 2HNTE 3MHWU 5L2ZH 3S69A 2VIOA 1EJAA 1T8NA 2R3YA 1NU9A 2TGAA 1SB1H 3TJOA 4ZH8A 3ZVCA 4X6MA 3AVZA 1EZQA 2ZF0H 1Q2WA 4ABDA 1QRXA 5IDKA 2FX4A 4JZIA 5HMAA 3KF2A 3M7QA 2CHAC 5T6DA 5FXLA 5GWZA 1F7ZA 1P9UA 5DP4A 1VCQA 1F0SA 3OTJE 2CJIA 2QAAA 3SJOA 4INLA 5DJ7A 3C1KA 1O37A 1EPTC 1MBMA 2GMTB 2VIDA 1VJAU 3T26A 1LVBA 1NFUA 2SGFE 1BTHH 1FAKH 1SQAA 4NIVA 1O3FA 1CU1A 1TBZH 2ZQ2A 3T25A 2XBXA 1CBWC 1D6RA 1FY1A 1YCPM 1VITG 3TH2H 2OXSA 1G3BA 4X1NU 4B73A 3GYLB 1ESBA 4YLUA 3QZRA 1INCA 2A4OA 1G3DA 1ZMNA 4AFSA 5BRRE 5FBEA 2A31A 8LPRA 3RU4D 1ESTA 1KLIH 3SV7A 1C1OA 1AVGH 2WPKS 3CENA 1TNHA 1BHXF 1V2QT 2VU8E 2FI5E 1HJAB 4B1TA 1JIRA 2BXTH 3PMAB 3PV4A 2QXHA 1SOTA 2R2MB 2G8TA 1V2VT 1TYNA 3GCTF 2STAE 1HJ8A 3ATKA 2ZIQH 2OC8A 2GGVB 1ZHMA 2FOCA 2ZDAH 1HAPH 1TMUH 1E37B 1UCYE 2HNTC 4FUDA 3A86A 3EAJA 2A2XH 2A4GA 2W3KA 4H6SB 2TBSA 2Y6TA 2NWNA 3UPEA 2VIQA 1CA0C 1KXDA 1O3DA 1ZPCA 1C2HA 2HLCA 5LPRA 1SGEE 5DP9A 1JXPA 2QV1A 1T4UH 2ZI2H 3B23B 3GDVA 1WOFA 3LH1A 5EXLA 2O8TA 1WAYB 2BY8X 5GCHF 4BAMB 5LH8A 2HPQH 1C5MD 3KEEA 3RXEA 1DICA 1B7XB 4Y71A 1NT1A 4MPWA 3P8FA 1SHYA 5JYIA 3IITA 4GSOA 4IGDA 1DE7H 1WV7H 1AE5A 3NWUA 4LOYH 3GY2A 2BDHA 3P8OA 2PTCE 4X2XA 1KDQA 2BZAA 4RSPA 2Z9GA 1LHEH 1RS0A 1GMHF 4FUFA 1FZZA 4XE4A 1AWFH 1F5RA 2QXGA 1Z71A 3NPSA 4BOHA 4B71A 2JETB 2NU0E 4A7IB 3RXOA 1O30A 1QL7A 3BEUA 2Y80A 3BN9A 2Z9KA 4Q7YA 1GI3A 4TPYA 5A09A 1IQJA 1GCTB 3ZV8A 3D62A 1OYQA 1GGDC 2UWLA 2ZKSA 4AYYB 5EQSA 1P2OA 2J94A 3D65E 1DVAH 1O5GH 1V2MT 4E05H 4K3JA 5FX6A 2ZHFH 3GY8A 3RLWH 4A1TA 1PQ5A 1TMTH 3RP2A 1O3EA 3LH3A 1O3IA 2ZCLP 1O38A 3P92A 1P3CA 1GBDA 2ZEBA 1BJUA 2G00A 2A5KA 2GCHF 3RC6A 1ZTKA 1O3KA 4UONA 1ELTA 1L1JA 2JH0D 3HK6B 4CRAA 3MNBA 4INHA 2UWPA 4K2YA 3RXDA 2FXRA 3M3SA 4MNYA 3ZYDA 3HK3B 4WH8A 4XBBA 3BSQA 3GCOA 1H9HE 1AZZA 3FP6E 1E34B 1MZDA 5H4IB 5ETXA 1C9PA 3SU0A 4D7GA 1O32A 2IN2A 1PQAA 4KKDA 1B0EA 1FJSA 2A45B 5SGAE 1MKWH 2WINI 3A7WA 2TGPZ 1MBQA 1BUIA 4I8GA 2BLVA 5A2MH 2ZFSA 3MU4A 4H6TA 1ETTH 1GBEA 5ESTE 4WVPE 4YT6H 4ABIA 2Q1JA 1GI2A 3TGJE 1GHBF 2ZDKA 2Z7FE 3GCNA 1V2ST 1YLCA 2C8YB 1THSH 3MH5A 3IWMA 3ZZ9A 2FI3E 2BD2A 4MPUA 4B2CA 2VWLA 1TPAE 3RXGA 2TGTA 2Y5HA 1O2KA 3VEQB 3EE0B 1DSUA 3QGNB 1F5LA 4AN7A 1TX8A 1GI1A 1OWDA 3A83A 5AVDA 3C27B 2C93B 3RXKA 2BTCE 3SHCH 1E35B 1P04A 2BDAA 4AB8A 1O2TA 3STJA 4TY7A 3SHAH 1O2NA 2FOFA 1H1BA 3A7TA 1C2GA 4I31A 3MNCA 4CHAC 4DOQA 3RXLA 2PR3A 1O5BB 4ESTE 1ZRKA 3L33A 2ZZUH 2THFB 2J92A 4OS4A 4OS2A 4CRGA 1N8OC 1BTXA 2GZ8A 1RFNA 1WQVH 1PFXC 2O8MA 3EYDA 5L6NH 3B9FH 1ANEA 2R0KA 2RDLA 2FOAA 4CRFA 1AIXH 1OWHA 1ESAA 4NFFA 4WXVA 2UUJB 5DP7A 1Y3YA 1MMJN 2UWOA 1BIOA 2Y5GA 4X1QU 3Q76A 1ZYOA 1XX9A 1GI9B 5J4QA 1K1IA 1NS3A 2XNIA 4TWWA 5DG6A 3AW0A 1IHSH 1O2MA 3T27A 1V2RT 1YBWA 4I7YH 8GCHG 1GI7B 4Y76A 2C8ZB 2P8OC 1YCPK 2RCEA 2SGDE 1VGCC 1S82A 3KNXA 2ZP0H 4UFDH 1YPMH 1Y3XA 3DFJA 1SGTA 3CP7A 1CHGA 2XCFA 5DP6A 1KXAA 1MD7A 2H9TH 2O8UA 1TNLA 1T8MA 2BDBA 2ZPRA 4ABEA 3SN8A 4D8NA 3RMOH 2G4TA 2ZA5A 1GBMA 4Z6AH 2GV7A 2VGCC 4HFPB 1TBQH 2D26C 2OC0A 3ENSB 2KAIB 1O3MA 1XXDA 2Y7ZA 3MYWA 2XBVA 1ELEE 1FIWA 3D23A 4Y10E 1EXFA 2BY6X 3HPTB 2ZO3H 5DP3A 1KXBA 3P17H 3M5LA 1O0DH 1YM0A 3TITA 1YPGH 3GY4A 3NUMA 2QIQA 1GMCG 1ANCA 1OP2A 2WPJS 1TRNA 1UK3A 3MNXA 1S0QA 1WTHD 3SGBE 1SQOA 3VB4A 3VPKA 1XKAC 2F9UA 1HAVA 2BX3A 2FTLE 3O8BA 4AX9H 3IG6B 3VXFH 1CSOE 1DM4B 1F5KU 1TX7A 1DS2E 5TJXA 1Q3XA 1L4ZA 2HWLB 2XC0A 3NXPA 1W2KH 2G5NA 2EI6A 1LHFH 1O35A 2A7JA 2Z9IA 3BTGE 2PKSB 2AIQA 2F9NA 1AFQC 1DWEH 1GJ9B 2GCTB 3SU2A 3A81A 1ZMJA 3AAUA 1YPLH 4Y7BA 2BQ6B 4TWYA 1BDAA 1IQMA 1P2IA 4GPGA 4Y6DA 1ZSJA 2ANYA 5C5OA 1UTKA 1NRRH 4JMYA 4DIHH 2R2WU 4Y8ZA 4TPIZ 1W14U 1H9IE 4RKOB 3OX7U 4K1SA 3W94A 1ORFA 1VCWA 3FP7E 1ZR0A 3SORA 2NU2E 1PPEE 4KTCA 3SJIA 1UVSH 1ZTJA 1TX6A 1GG6B 1GPZA 1HJ9A 2ZGXH 3ZZBA 3I77A 3SU5A 5C1UA 1GI6A 1SQTA 2F9OA 1FLEE 4YT7H 1V2WT 2VWOA 1SFQB 1QQ4A 3UIRA 1JRTA 2GP9B 1KTTB 2FMJA 1PPGE 2JKHA 2QGRA 3QWCH 2GT8A 1W0ZU 5EG4A 1FPHH 2AEIH 2FEQH 5EQQA 1OPHB 1P2JA 2CHAB 2VWMA 1OS8A 1JWTA 2UUYA 3PM3A 1EPTB 3S7KB 4Q7XA 1WUNH 3F9HA 3U9AH 4AFUA 4NZQA 1Y5BT 2FWWA 3A85A 4J2YB 3FAOA 3I29A 1HXEH 1EOLA 1A2CH 1TE0A 2G52A 2SFAA 1QA7A 2GZ9A 1P09A 1L2EA 4OS1A 1O2XA 3S0NA 1EKBB 4ZMAH 1EX3A 3BIVH 1QBOA 5EW2H 1OSSA 3U8TH 2HGTH 3ZVDA 5A0BA 1P2KA 3KIDU 1SGYE 3LGYA 3STIA 2M5TA 5HGGA 1O36A 2Z3CA 1TONA 2FESH 1NU7B 2WPMS 2VWNA 3FP8E 4Y11E 4BTTB 5ESBA 2AGGX 1HBTH 1FY5A 2PFEA 3LT3A 2BQWB 1KXFA 3URCA 1WTGH 2LPRA 4ZKRU 3MO3A 3TGIE 1O2LA 2Q6GA 1QTFA 1IQKA 2QXIA 1S85A 1G30B 1BRAA 4A1XA 4K8YA 4H4FA 1DT2A 2HNTF 2P3FH 2ZTYA 1XVMA 4ABAA 1VITF 1TNIA 1NY22 1KY9A 1OWKA 1S6HA 1LVMA 1C2KA 1QNJA 1BB0B 1FUJA 4BAOB 1C2FA 3MU8A 2A0QB 1GI0A 4Y0ZE 2A2QH 2PUXB 4UFFH 1SR5C 1B0FA 1OWIA 1OKXA 4JZ1A 4ZKSU 3BTKE 2J4IA 1PJPA 2ANWA 2FTMA 3HGNA 2OINA 2QF0A 4ISOA 3CS7A 1NROH 4OS5A 4BANB 3VB7A 2PKAA 4GCHF 1BTYA 3A8BA 3T5FH 2H9HA 1MAXA 5EW1H 3K2UA 1HFDA 3TNSA 4X6NA 4CRCA 4GHQA 1V2NT 2UUFB 2B5TB 4ZHMU 2C8XB 1P9SA 3URDA 4BAQB 3RXVA 1GBHA 2TPIZ 3F9GA 2ZQ1A 4XBCA 3SV6A 1DANH 3RXUA 3KQBA 1JOUB 3R3GB 1C5PA 3K65B 2DE9A 1WSSH 4HGCA 2A7CA 3ODFA 1GBKA 3MH7A 3U1IB 2NU1E 3DT0H 4Y8XA 1SMFE 8ESTE 3RXQA 1FDPA 2AGIX 1O2UA 2R9PA 1IQLA 1VCPA 1GDUA 1MCVA 3PO1C 3BG4C 3LONA 4KELA 1MTUA 1P12E 1UVUH 1NC6A 2A7HA 1D3TB 1J8AA 5JB8S 2AS9A 3SNCA 1DDJA 3LC5A 3BTWE 4GLYA 4IMQA 4Y0YE 1A1RA 2SNWA 2BD9A 2ASUB 3GCHC 3R0FA 1MTWA 3SJ9A 2ANMH 4NCYA 3KCGH 1A7SA 1QB6A 2P3TB 3UQOA 1N1LA 1A46H 1OP0A 2P94A 1DWDH 1BTPA 1FAXA 3U8RH 3A8DA 3H7TA 1IHTH 1GDQA 1TQ7B 1TOMH 2B8OH 4F4OC 3M5NA 1W0YH 4MQAA 3TVJB 3A7VA 3P8GA 1GJBB 1TRMA 3AW1A 1MTVA 3SUGA 5CE1A 1O5DH 1RTLA 5FPSA 1QGFA 5C1YA 5HYOA 1NN6A 4LZ4B 1BCUH 1BMNH 1BHXB 2PUQH 1NRNH 1IQEA 3ATWA 1Z6EA 1GI5A 4X8UH 4YOIA 3UR9A 2WV4A 3GDSA 6ESTA 1TWXB 1TGSZ 4FUJA 2FZZA 1YP9A 7LPRA 1QL9A 2Y7XA 4DG4A 2FYQA 1EB1H 4NIYA 1CT0E 1C2JA 1Q31A 4ABGA 1UTQA 3ZZ5A 1XUIA 1ZOMA 2Z9LA 1GVZA 2CN0H
chains in the Genus database with same CATH superfamily
1FXYA 3P6ZB 2FDAA 5EPYA 1A3EH 5J4SA 2CF9H 1KYNA 3E3TA 4MNWA 1C2EA 4ZXYH 4IBLH 3F1SB 2FS9A 1T8OA 1VR1H 3PRBA 2A4QA 2OQUA 4NZLA 3TU7H 2BD4A 2A5AA 1IQHA 4M7GA 2FO9A 1A5GH 3LGTA 1JIMA 1RTKA 2EC9H 4B74A 5G4BA 1GMDF 2C3SA 1GHZA 1ELAA 5EODA 1K1JA 3PROA 1S6FA 1BRCE 4ZUHA 1YYY1 5T1VA 2DE8A 2J98B 4NA7A 4E7NA 1MAYA 3PYHA 1BTWA 1EJMA 3GY7A 4SGAE 1MH0A 3ITIA 3UTUH 4CHAB 3Q77A 5C1XA 1CE5A 3RC5A 4AG2A 1ANBA 1C2DA 1GI4A 5IYTA 3TGKE 1PYTD 5JPMH 1GL1A 3OSYA 1YLDA 1PPCE 1IQIA 2BB4A 1T7CA 2BOKA 3AAVA 4ZKOU 1QHRB 3DFLA 1TPSA 3MO9A 1BMFD 3A89A 1LHGH 4FUBA 5AFYH 4AOQA 3UOPA 2HALA 1DOJA 5T6GA 2Q6DA 5EJLA 2BY9X 2AFQB 2P16A 3EA8A 1WXRA 1UMAH 3EQ0H 2JH5D 3SO3A 3Q3YA 3DD2H 5EXNA 4IW4E 2Z3DA 3RDZA 3UNRA 2OLGA 1XUHA 1SSXA 2XOKD 4HG6A 1LKBA 5CHAC 1SPJA 4UFGH 2AMPA 4IMZA 1BRBE 1O3JA 1PQ8A 1ZPZA 2D2DA 3N7EA 3TJVA 1J9CH 1BBRK 3WWFA 4AGKA 3PLBA 1ETSH 1O5FH 1UTLM 1RXPA 4TY6A 2WPIS 1C1WH 1GHWH 1AUTC 2BZ6H 3A80A 4I8JA 5I25A 1O2IA 1C5TA 2ZFPH 3PRDA 4XRNA 1G9IE 1YPHE 4ISIH 3GDUA 3DSPA 2G5VA 2WHXA 1P0SH 2KR7A 5FHTA 4B76A 5HM9A 1C5UA 1PPHE 1SGDE 4IC5A 3MNSA 4MNXA 4YM9A 1HPGA 2WPDD 2GMTC 2FLBH 4GUXA 3KN2A 2STBE 4FUGA 1LDTT 2ULLA 5A0CA 5FPYA 1YPJH 1GBIA 2FS8A 1UK2A 2FODA 2PHBA 1YPKH 2RA3A 1O31A 3QDZB 3A8CA 1EP6A 4I8LA 4OGYA 3SU3A 2PWXA 5FBIA 1P02A 2FPZA 2BHGA 2BDCA 2WZQA 1F0UA 4K69A 1D9IA 4R8TB 3SJKA 3BG8A 2G4UA 3VB3A 4HZHA 2XYAA 2ZDMA 2QC2A 3BIUH 4WMEA 3A7ZA 1O39A 4ISHH 1EATA 3A88A 2ZC9H 4MDSA 3TK5A 1MKXK 1AVXA 1AE8H 1QCPA 1IQGA 1B5GH 3OYPA 4XD7D 1EASA 1D4PB 3RXRA 1JBUH 2BD3A 1GBBA 1THRH 1C4Y2 1O2ZA 2JJ1D 1TIOA 3SU6A 3PLKA 2FP7B 2SGEE 4ZROA 3TIUA 5DN6D 2Z94A 3P70B 2CK3D 2XW9A 3E0NB 1YY3A 5K0HA 3ZZ4A 1C5YB 3M7UA 5GCHG 1HJAC 2F9VA 1TAWA 3UREA 1MTNB 1THPB 2ZU1A 1LO6A 2AMQA 1K0HA 1EZSC 3H7OA 1G37A 1LKAA 2ZFQH 4NIXA 2ILNA 1KDQB 4I8HA 1JMOH 3T29A 1DXWA 1Z8JB 2JIZD 2KM0A 2QXJA 2OC7A 1QA0A 2HPPH 1ZLRA 1UHBA 1H8ED 1C5QA 2BVXH 1O3HA 1TPOA 2ZFTA 4KTUA 3M61U 1FI8A 1FY8E 1YGCH 1J15A 4AFQA 4BTUB 1GMHG 2AH4X 1TNJA 1HAYB 2F9PA 1C1TA 2ESTE 1KTSB 2C8WB 1Y3UA 1YPHC 1AHTH 2OQ5A 3RXJA 3SBKA 4B2BA 3O8RA 1O2PA 1SLUB 1K1PA 1WCZA 2A1DB 3M5MA 3ZZ6A 4Y7AA 1Z1IA 3UWIA 3L6PA 5K7RA 5L2YH 2J95A 3F9FA 1F92A 1FQ3A 3TJUA 2SNVA 1C5VA 4ABFA 2WUBA 1UVOA 1D3QB 2QA9E 1BQYA 5JBBS 3U8OH 2W7UA 2YNAA 3SGQE 3TPIZ 3SUFA 1DLEA 2BQ7B 3HATH 3A7XA 1EB2A 4NWLA 4BAHB 1FIZA 3A82A 1AU8A 1LQDB 3LOXA 1Z8GA 1U6QA 2V3MA 4FXGH 1FX0B 1HLTH 5A0AE 2ZU4A 1EZUC 2JETC 1HAHH 3MTYA 1O5AB 4OM9A 4X8TH 3WWBA 4DT7B 2BX4A 3LPRA 3TLOA 4RN6A 4LZ1H 1GCTC 3QO6A 1O5CB 3G01A 1C9TA 4FU9A 3QUMP 5B6LA 4ISLA 3ZZ8A 2XXLA 3KQEA 4AZ2B 1LPGB 3T28A 2FOHA 1KLTA 2XCNA 3ZZAA 1LVYA 1NFXA 5AHGH 1V2JT 3ZYEA 2GD4B 2KCYA 1IQFA 1CGJE 4X2VA 1A5IA 4ZCNA 1QJ1B 1AN1E 1ELBA 3RXTA 3TK6A 2FOEA 2IJD1 3ELAH 1GHBG 1K28D 1BOQA 3SNEA 1NFWA 2A5IA 4K1EA 1UTMA 4DCDA 1GVKB 2AERH 4VGCC 1QB9A 3RMNH 3UWJH 3SU1A 1P06A 3QGJA 1DY9A 1VJ9U 3A7YA 4YTAA 5C5NA 4AORA 3A87A 3SW2B 1J16A 2GVFA 3ZVBA 1CQQA 1YLNA 1WU1A 3SUEA 3OEHD 1ARBA 5JB9S 5JBTA 2BY5X 4UFEH 1C5ZB 4U32A 1FN6A 4WMFA 4FUCA 1CHOF 4ZXXH 1GWAA 2A4RA 1L4DA 1NBME 3FOAA 1ELVA 1N6XA 6GCHG 1A0LA 3SJ8A 1HIAA 3OFND 5CMXH 5C3NA 1Y5UT 1J17T 3KHVA 3SZNA 2BVRH 3MU1A 1C1MA 2HLDD 5GDSH 3P8NA 3ATMA 2XRCA 3UQVA 4MPVA 2VVVA 5E2PA 2ZECA 1UTJA 5JDUB 4CBOA 3TK9A 4U30A 1UCYK 4I86A 3U98H 3V12A 2OP9A 3BTEE 1O2OA 3MU0A 3RM2H 1ZGIA 3V0XA 1G36A 1GBJA 2FLRH 2ZDVH 2FM2A 2C90B 2BDGA 1ARCA 1QB1A 1EAIA 5TCCA 1TGCA 2BMGB 4JZDH 4MTBA 2ZCKP 3F0PA 1AB9B 3ZVGA 2OK5A 9LPRA 7GCHG 4X2YA 4I32A 1EJNA 2TRMA 2BYAX 1TMBH 1CT4E 1QIXB 6CHAB 3ZIAD 1YCPH 3GYMA 3LIWA 3OY6U 2Z3EA 4ACBA 5F8ZA 3RC4A 1V2OT 2FOBA 1DXPA 3LGWA 1GHAF 1Y3VA 2H5CA 1HNEE 1GJ5H 2P3UB 2RFKC 5EIYA 2PLXA 4JYTA 1TB6H 1ZMLA 3VXEH 1BMAA 1UTPA 2QY0B 3L3TA 3I78A 5HKKD 3W95A 1ZSKA 5DPAA 2W7SA 1BTZA 3M3TA 3QZQA 3NKKA 1O3OA 3DCLA 2XWBI 1S84A 1ZJKA 3RM0H 5C17A 1Z6JH 1SGPE 1ZJDA 4LK4A 1T4VH 1KXCA 3FANA 2QF5A 3RXSA 1ZRBA 1GBTA 5FX5A 1UVPA 4ABJA 1HAVB 3F2HA 3ZVEA 1LQEA 2IPHA 2VINA 1CBWB 3Q00A 2QE7D 5EXMA 5E0GA 1QRWA 1CVWH 4DVAU 1DITH 1C5SA 3BTQE 3U69H 1W8BH 2YMSD 4ZHLU 2ZHQH 2R3UA 1SGCA 4MG3A 2ALPA 4WH6A 4DJZB 1HXFH 1C1UH 1P05A 3PMHB 4J1YA 2W6ID 2PW8H 1O3LA 1ZPBA 1DY8A 1O33A 2QYIA 5CHBA 1KSNA 4FVDA 3E16B 3HKIB 1C4V2 1ZZZA 2NU3E 4SGBE 3V3MA 5C2ZA 1O2HA 3MH6A 2FYRA 2ZU5A 4X8SH 1RIWC 1O2VA 1NBMD 5BPEA 7KMEH 2PGQB 1TRYA 3ZV9A 1WYKA 1BITA 1W13U 3DA9B 4YO9A 3AK5A 1L1NA 2EI8A 4UE7H 3NCLA 2BM2A 2J5UA 1QJ6B 1HGTH 1GJ8B 1CA0B 3FZDA 1GJDB 4IS5A 2F3CE 4AGJA 5I46H 1DPOA 2IJOB 1O34A 2AYWA 2O9QA 1L0ZA 1C5NH 1C5RA 1A61H 3E6PH 3SV2H 2K1QA 4NG9H 3SNBA 2FOGA 4CR9A 1UTNA 4NGAH 1HV7A 2GCTC 1MQ5A 1P2MA 1AVWA 4F55A 2CF8H 4K5ZA 4ISNA 1SGNE 2ODYB 3VGCC 3MU5A 1ZGVA 1WDIA 4NWKA 1EAUA 1SLVB 3ZVFA 3RXHA 2Y82A 1QJ7B 4LXBH 1UK4A 1LHCH 1SOZA 2HOBA 5E8EH 2AIPA 3QX5H 1RTFB 1GI8B 4CR5A 1G3EA 1QFKH 3UOUA 4O9VA 1P57B 2ZGCA 3BTHE 1WQSA 1F0RA 1LCYA 3V7TA 1TGTA 3S9BA 4UD9H 5GNDA 3K6YA 4MPXA 1HUTH 1L1GA 1W7XH 4X6PA 1Y5AT 1O3PB 4IC6A 4BTIB 1UVTH 1BJVA 1GG6C 1ELFA 1G2LA 3M36A 3RXPA 2EQNA 4B2AA 3M7TA 4AFZA 4B6EA 5EQRA 2BLOA 4B75A 1GGDB 1ANDA 2UUKB 1HAOH 2LNCA 1O3NA 3U28C 1AFEH 3PWCA 4AG1A 2O8LA 5TCAA 1D3DB 1V6DA 5EJ1A 2WPHS 3GY5A 1TGBA 5T3HA 2ZU3A 5HXFA 2XBYA 1G3CA 4KGAA 4O97A 2VH6A 4MNVA 1S83A 1AMHA 4JK6A 2P59A 2RA0A 4O3TA 4FOUC 1C1SA 3QN7A 2OC1A 5C94A 3Q3KA 4CRDA 4XDEA 2VBCA 4INKA 1FN8A 1ABIH 2ZHDA 1GL0E 4BNRA 3EE7A 2R0LA 1O3CA 4CREA 3VB6A 1O2QA 4H42U 1Y59T 2G51A 4ZHAA 1Y8TA 1CT2E 1Z7KA 1LPKB 3SGAE 1ELDE 3EGKH 3UNSA 2IOTA 3RU4T 1V2UT 3HKJB 2ZPSA 2ODQA 1GBLA 4UEHH 2BDYA 3K6ZA 1PYTC 3QTVH 4Z0KA 1K1LA 1N6YA 2LP6A 1DUEA 1TALA 5GXPA 2OBQA 1OWEA 1AD8H 5E2OA 3ATLA 2ZGBH 1K22H 4F48B 4Q63A 1GVLA 3FO8D 4YOJA 1HDTH 1GBAA 4IN1A 1FMGA 1HB0B 1YF4A 3BTFE 2PKAB 3BEIB 1ELGA 3M5OA 2ZDNA 1KXEA 1QZ8A 1NRSH 2CV3A 2GZ7A 3E1XB 4THNH 1SI5H 1E36B 3CNRA 1J14A 1P2QA 5DK1A 4GCHG 3SV9A 3JZ2B 1NFYA 1HAIH 3ODDA 5A8XA 2ZCHP 1GBFA 1RRKA 1MKWK 1NZQH 1RJXB 1O3BA 3KQCA 1A3BH 2VNTA 1O2SA 1TOCB 3LKWA 4NSYA 1GJ6A 2BD8A 2B0FA 3KL6A 3AASA 3QLPH 1GJ4H 1QQUA 1YC0A 2W3IA 2JDID 1MQ6A 2BXUH 5FL7D 5B6OA 4Q7ZA 2J2UA 1XKBC 1KIGH 1TFXA 4U2WA 1K1OA 3MI4A 1TNGA 3PV5A 4YLQH 3UR6A 1YPEH 4XBDA 3RXBA 1E79D 1N8OB 2ZTZA 1S5SA 4OS7A 4ABBA 1T32A 3RMLH 3B8JA 4F49A 2VVCA 2V0BA 5A8YA 1K9OE 1CA8B 2H6MA 1GDNA 2ALVA 3MWIU 1HRTH 4AYVB 7ESTE 4D9QA 2HRVA 3V13A 1TBRH 5JBAS 2SGAA 2ZFFH 1H8IH 1OHHD 2A32A 3SQHE 1NTPA 2W26A 1RD3B 1AY6H 3W1EA 1A4WH 5FCRA 4IN2A 1P8VC 1AWHB 1G2MA 1Z8RA 2P8OB 1SHHB 3ESTA 4A1VA 1D6WA 1VGCB 4WWYA 3RXFA 1C2MA 1SGFG 3BEFB 1FPCH 1HCGA 2GT7A 4X6OA 2M2AA 4YXWD 2OBOA 5ABWA 2KFWA 4U01A 1P10A 3UFAA 3Q3XA 1O5EH 4UDWH 4OS6A 2WYGA 4ZAEA 1FV9A 2QF4A 5L30H 2TIOA 2OUAA 1MCTA 3TH4H 2VGCB 3DUXH 1NRPH 2ZNKH 2KCAA 4MLFB 5EGMA 2OD3B 1O3GA 4JYUH 2ZFRH 4X1SU 2Q6FA 2ZPQA 1GJAB 4DY7B 4FUHA 2JH6D 1E1RD 2GV6A 1C5LH 1AKSB 3E8LA 2G55A 3GCTG 1PPBH 3FZZA 1TPPA 1EUFA 8GCHF 3F2FA 1W3CA 3EA9A 3A8AA 3GY6A 4ZKNU 1GHVH 3S9AA 1BMLA 1MU6B 1EQ9A 1C2IA 5F6MA 3LU9B 4K1TA 2G81E 2PV9B 4VGCB 5EJZA 4BAKB 4FUEA 5JBCS 1IQNA 3T62A 1EOJA 1ABJH 2GTBA 1XUGA 1AKSA 2VH0A 3SUDA 2PSXA 2J38A 2V6NA 1DLKB 1ZHRA 3VFEA 2XTTB 4YZUA 4RT0A 1QBNA 4YESB 3GICB 1W10U 1GMDG 1P01A 1DSTA 3O8DA 5FAHA 3SYJA 1AUJA 2H9EH 4CH8B 1AFQB 1OX1A 3M3VA 2GDEH 1YKTA 2BDIA 2FOMB 1C1VH 2WV5A 3H5CB 1BRUP 2WPLS 1O2GH 1H4WA 4A92A 2ZWLH 3KYGA 3GISB 1QBVH 2KAIA 1Z8IB 2FX6A 2D1JA 1CGIE 1ETRH 4K60A 4GHTA 1BMMH 1C5XB 1GMCF 1MU8B 3PMBB 1IOEA 1PQ7A 2CXVA 4X1PU 1OWJA 1E0FD 1D3PB 1W11U 4DT4A 1P2NA 3E90B 1SGQE 5E0JA 2GX4A 1G32B 4WY3A 1DWCH 3UB0A 3SI3H 1V2KT 1SGIB 1K1NA 5AF9H 4WJG2 1LTOA 3BTME 3SNAA 2HVXA 5DP8A 3MMGA 2F9BH 1NRQH 3FFGA 4ABHA 6GCHF 1ZHPA 1EZXC 1EAXA 1HAXB 1W7GH 4X8VH 1PPFE 1K1MA 1GHXH 2EA3A 1ZSLA 3LGVA 5EOKA 3SV8A 3ZVAA 5DP5A 1C5WB 5DKMA 1BBRH 1O3AA 1EP5A 2BLWA 4CH2B 1O2YA 3DSOA 3M35A 3S9CA 1XUKA 3QK1A 4Y8YA 3SQEE 2GCHG 1GJCB 4FVBA 1PPZA 1A5HA 4R0IA 5F8TA 1M9UA 3RXMA 5LPEA 4X1RU 3UNQA 2VIPA 3SI4H 1LHDH 1BZXE 3BV9B 8KME2 1SBWA 7GCHF 3LDXH 3SU4A 5HM2A 1SC8U 1AQ7A 2XC5A 4FUIA 1XVOA 1GHYH 3HGPA 4Q2KA 1FY3A 3KGPA 4JK5A 1TA2A 4X0WU 2VVUA 1ZTLA 1X7AC 4JYVH 1CGHA 1TLDA 2CMYA 2EEKA 4D9RA 3TH3H 2ANKH 3EA7A 3RXCA 2JJ2D 4BXSA 3PMJA 4NIWA 1C1RA 4TYDA 1LVOA 2ZU2A 1MKXH 3CS0A 2J9NA 5EPNA 5EU8A 1VKYA 4X2WA 3WW7A 5GJ4B 3RLYH 4A6LA 1C1QA 5IK2D 1W12U 1LMWB 4KP0A 1IAUA 1NM6A 3S7HB 4E06H 4RT1A 1F0TA 1QRZA 1OP8A 2BY7X 1FNIA 1UHBB 4WXIA 2GDDA 3F6UH 3LJOA 3M37A 3EDXB 4GAWA 4E7RG 3UY9A 1DUAA 1AO5A 3E91A 1EPTA 4D7FA 3ZZCA 1LPZB 4TT3D 5AFZH 1RGQA 1MZAA 4ASUD 3QTOH 1RIWB 6LPRA 1P11E 4O3UA 1V2PT 2Y5FA 3A84A 2W6JD 4XFQA 1DX5M 3SZEA 5C20A 2EI7A 1QY6A 2P95A 2GKVE 1E38B 3U1JB 4Y79A 3LC3A 2KCOA 1H9LB 1GCDA 5LPFA 2Z9JA 3BTDE 1F2SE 3K9XB 1S81A 3PTBA 2B9LA 3RXAA 4XOJA 5A8ZA 4B6FA 1NO9H 1TABE 1DWBH 2LELA 5CDFE 2WSSD 1MTNC 2QCYA 4HTCH 2AGEX 3UUZA 2V3OH 3VGCB 1WBGB 3GY3A 1XUFA 1SVPA 2V35A 1K21H 3SOSA 2NU4E 2ZGJA 2FIRH 2GJGA 2B7DH 4RKJB 3BF6H 1HAZB 3VB5A 2BD5A 4KTSA 1ID5H 1V2LT 3E0PB 3PTNA 2SGQE 1O2WA 2D8WA 2I6SA 2YMSC 5FCKA 5F03A 1ELCA 1VITH 2PTNA 2H2ZA 2VB0A 1SG8B 2F83A 3NZIA 2PSYA 1V3XA 1Z1JA 3F0OA 1P03A 2ZHWH 3LGUA 4I33A 2FI4E 3RXIA 3PO1B 3BG4B 2P93A 1QURH 2F43B 2H5DA 2W5EA 1SGRE 3OTPA 1XXFA 2QN5T 4MVNA 2YNBA 4GVUA 2F91A 5PTPA 3NK8A 2ZG0H 3GCHB 1BBRE 1QR3E 5C67A 4P02A 1A0HB 3MO6A 2SGPE 4QT8C 1Y3WA 4NFEA 4I8KA 2V3HH 3O8CA 1UO6A 4AB9A 1VZQH 2BLQA 1AI8H 3ZZDA 4JCNA 4BXWA 1FONA 2K0QA 5T6FA 9ESTA 3FVFB 4YOGA 2ZTXA 2J34A 5FPTA 3LJJA 1NESE 3KQDA 4DIIH 3MH4A 5DGJA 3WY8A 1T8LA 1V2TT 3OY5U 2ZGHA 4CRBA 1EAWA 1HIAB 3P95A 1XM1A 4OGXA 3TJNA 5LGOA 1NPMA 1BTUA 3SNDA 4FETA 4DURA 2ODPA 3PB1E 1S0RA 1CHOG 1SLWB 1KLJH 3D49H 3F68H 2DUCA 1MTSA 3MOCA 1C2LA 1UTOA 3DHKH 1SLXB 1SFIA 4DW2U 1BA8B 4WMDA 1ACBE 5E0HA 2EY4C 3LGIA 3RU4E 1HYLA 1H8DH 1TQ0B 4NA8A 3PWBA 3TNTA 1UCYH 1XMNB 1E1QD 2ZHEH 3GOVB 3UAIC 2YOLA 4A5TS 4NSVA 3RMMH 4JZEH 2C4FH 1C4U2 3ZZ7A 4Q80A 2XWAA 1SGFA 1HAGE 1TA6A 2RG3A 3PLPA 1AZ8A 1H8HD 2RDEA 1FY4A 4D76A 3F9EA 1P3EA 2BOHB 3T2NA 2QF3A 1TGNA 2OTVA 2AHME 3BTTE 1BT7A 4O03A 1O2RA 1MD8A 2O8WA 1QL8A 3OEED 2Z6BD 2PKSC 2OCVB 4XSKU 2XBWA 2WYJA 4CBNA 3JZ1B 1CO7E 1XUJA 1UJ1A 4K8BA 1O2JA 1MUEB 1SL3A 2CGAA 5GPIB 1GHAG 1OOKB 4JZFH 3MFJA 4FU8A 4DGJA 2BVSH 5DO4H 1GBCA 5F8XA 1A0JA 2I6QA 4FU7A 2AMDA 1JRSA 1TNKA 1GJ7B 4WF8A 2WUCA 4ASHA 1T31A 2PGBB 4HI3A 3N7OA 3OU0A 1C1NA 1AB9C 1SQRA 3ATIA 2Y81A 1OXGA 1OYTH 1DFPA 1C1PA 2H1UA 2VJ1A 2BD7A 2ZDLA 5GIBA 4PROA 2XC4A 1K2I1 4NA9H 5CHAB 3RUOA 3ZZ3A 1C5OH 2VIVA 6CHAC 2TGDA 2VIWA 1AGJA 3NRLA 2HNTE 3MHWU 5L2ZH 3S69A 2VIOA 1EJAA 2J98A 1T8NA 2R3YA 1NU9A 2TGAA 1SB1H 3TJOA 4ZH8A 5KECA 3ZVCA 4ACAA 3KQ5A 4X6MA 3AVZA 1EZQA 2ZF0H 1Q2WA 1W0JD 1QRXA 4ABDA 5IDKA 2FX4A 4JZIA 5HMAA 3KF2A 3M7QA 2CHAC 5KEDA 5T6DA 5FXLA 5GWZA 1F7ZA 1P9UA 5DP4A 1VCQA 1F0SA 5F53A 3OTJE 2CJIA 2QAAA 3SJOA 4INLA 5DJ7A 3C1KA 1O37A 1EPTC 1MBMA 2GMTB 2VIDA 1VJAU 3T26A 1LVBA 1NFUA 2SGFE 1BTHH 1FAKH 1SQAA 4NIVA 1O3FA 1CU1A 1TBZH 2ZQ2A 4RI0A 3T25A 2XBXA 1CBWC 1D6RA 1FY1A 1YCPM 1VITG 3TH2H 2OXSA 1G3BA 4X1NU 4B73A 3GYLB 1ESBA 4YLUA 3QZRA 1INCA 2A4OA 1G3DA 1ZMNA 4AFSA 5BRRE 1SKYE 5HIYA 5FBEA 2K8IA 2A31A 8LPRA 3RU4D 1ESTA 1KLIH 3SV7A 1C1OA 1AVGH 2WPKS 3CENA 1TNHA 1BHXF 1V2QT 2VU8E 2FI5E 1HJAB 4B1TA 2HVYB 1JIRA 2BXTH 3PMAB 3PV4A 2QXHA 1SOTA 2R2MB 2G8TA 1V2VT 1TYNA 3GCTF 2STAE 1HJ8A 3ATKA 2ZIQH 2OC8A 2GGVB 1ZHMA 2FOCA 2ZDAH 1HAPH 1TMUH 1E37B 1UCYE 2HNTC 4FUDA 3A86A 3EAJA 2A2XH 3F2GA 2A4GA 2W3KA 4H6SB 2TBSA 2Y6TA 3OE7D 2NWNA 3UPEA 2VIQA 1CA0C 4P00A 1KXDA 1O3DA 1ZPCA 1EFRD 1C2HA 2HLCA 4AC9A 5LPRA 1SGEE 5DP9A 1JXPA 2QV1A 1T4UH 2ZI2H 3B23B 3GDVA 1WOFA 3LH1A 5EXLA 2O8TA 1WAYB 2BY8X 5GCHF 4BAMB 5LH8A 2HPQH 1C5MD 3KEEA 3DSGA 3RXEA 1DICA 1B7XB 4Y71A 1NT1A 4MPWA 3P8FA 1SHYA 5JYIA 3IITA 4GSOA 4IGDA 1DE7H 1WV7H 1AE5A 3NWUA 4LOYH 3GY2A 2BDHA 3P8OA 2PTCE 4X2XA 1KDQA 2BZAA 4RSPA 2Z9GA 1LHEH 1RS0A 1GMHF 4FUFA 1FZZA 4XE4A 1AWFH 1F5RA 2QXGA 1Z71A 3NPSA 1YWUA 4BOHA 4B71A 2JETB 2NU0E 4A7IB 3RXOA 1O30A 1QL7A 3BEUA 2Y80A 3BN9A 2Z9KA 4Q7YA 1GI3A 4TPYA 5A09A 1IQJA 1GCTB 3ZV8A 3D62A 1OYQA 1GGDC 2UWLA 2L6OA 2ZKSA 4AYYB 5EQSA 1P2OA 2J94A 3D65E 1DVAH 1O5GH 1V2MT 4E05H 4K3JA 5FX6A 2ZHFH 3GY8A 3RLWH 4A1TA 1PQ5A 1TMTH 3RP2A 1O3EA 3LH3A 1O3IA 2ZCLP 1O38A 3P92A 1P3CA 1GBDA 2ZEBA 1BJUA 2G00A 2A5KA 2GCHF 3RC6A 1ZTKA 1O3KA 4UONA 1ELTA 1L1JA 2JH0D 3HK6B 4CRAA 3MNBA 4INHA 2UWPA 4K2YA 3RXDA 2FXRA 3M3SA 4MNYA 3ZYDA 3HK3B 4WH8A 4XBBA 3BSQA 3GCOA 1H9HE 1AZZA 3FP6E 1E34B 1MZDA 5H4IB 5ETXA 1C9PA 3SU0A 4D7GA 1O32A 2IN2A 1PQAA 4KKDA 1B0EA 1FJSA 2A45B 5SGAE 1MKWH 2WINI 3A7WA 3H09A 2TGPZ 1MBQA 1BUIA 4I8GA 2BLVA 5A2MH 2ZFSA 2WV9A 3MU4A 4H6TA 1ETTH 1GBEA 5ESTE 4WVPE 4YT6H 5KGOA 4ABIA 2Q1JA 1GI2A 3TGJE 1GHBF 4TSFD 2ZDKA 2Z7FE 3GCNA 1V2ST 1YLCA 2C8YB 1THSH 3MH5A 3IWMA 3ZZ9A 2FI3E 2BD2A 4MPUA 4B2CA 2VWLA 1TPAE 3RXGA 2TGTA 2Y5HA 1O2KA 3VEQB 3EE0B 1DSUA 3QGNB 1F5LA 4AN7A 1TX8A 1GI1A 1OWDA 3A83A 5AVDA 3C27B 2C93B 3RXKA 2BTCE 3SHCH 1E35B 1P04A 2BDAA 4AB8A 1O2TA 3STJA 4TY7A 3N99A 3SHAH 1O2NA 2KZ4A 2FOFA 1H1BA 3A7TA 1C2GA 2YMSB 4I31A 3MNCA 4CHAC 4DOQA 3RXLA 2PR3A 1O5BB 4ESTE 1ZRKA 3L33A 2ZZUH 2THFB 2J92A 4OS4A 1S6LA 4OS2A 4CRGA 1N8OC 1BTXA 2GZ8A 3GS9A 1RFNA 1WQVH 1PFXC 2O8MA 3EYDA 5L6NH 3B9FH 1ANEA 2R0KA 2RDLA 2FOAA 4CRFA 1AIXH 1OWHA 1ESAA 4NFFA 4WXVA 2UUJB 5DP7A 1Y3YA 1MMJN 2UWOA 1BIOA 2Y5GA 4X1QU 3Q76A 1ZYOA 1XX9A 1GI9B 5J4QA 1K1IA 1NS3A 2XNIA 4TWWA 5DG6A 3AW0A 1IHSH 1O2MA 3T27A 1V2RT 1YBWA 4I7YH 8GCHG 1GI7B 4Y76A 2C8ZB 2P8OC 1YCPK 2RCEA 2SGDE 1VGCC 1COWD 1S82A 3KNXA 2PP6A 2ZP0H 4UFDH 1YPMH 1Y3XA 3DFJA 1SGTA 1MABB 3CP7A 1CHGA 2XCFA 5DP6A 1KXAA 1MD7A 2H9TH 2O8UA 1TNLA 1T8MA 2BDBA 2ZPRA 4ABEA 3SN8A 4D8NA 3RMOH 2G4TA 2ZA5A 1GBMA 4Z6AH 2GV7A 2VGCC 4HFPB 1TBQH 2D26C 2OC0A 3ENSB 2KAIB 1O3MA 1XXDA 2Y7ZA 3MYWA 2XBVA 1ELEE 1FIWA 3D23A 4Y10E 1EXFA 2BY6X 3HPTB 2ZO3H 5DP3A 1KXBA 3P17H 3M5LA 1O0DH 1YM0A 3TITA 1YPGH 3GY4A 3NUMA 2QIQA 1GMCG 1ANCA 1OP2A 2WPJS 1TRNA 1UK3A 3MNXA 1S0QA 1WTHD 3SGBE 1SQOA 3VB4A 3VPKA 1XKAC 2F9UA 1HAVA 2BX3A 2V7QD 2FTLE 3O8BA 4AX9H 3IG6B 3VXFH 1CSOE 1DM4B 1F5KU 1TX7A 1DS2E 5TJXA 1Q3XA 1L4ZA 2HWLB 2XC0A 3NXPA 1W2KH 2J97A 2G5NA 2EI6A 1LHFH 1O35A 2A7JA 2Z9IA 3BTGE 2PKSB 2AIQA 2F9NA 1AFQC 1DWEH 1GJ9B 2GCTB 3SU2A 3A81A 1ZMJA 3AAUA 5DSFA 1YPLH 4Y7BA 2BQ6B 4TWYA 1BDAA 1IQMA 1P2IA 4GPGA 4Y6DA 1ZSJA 2ANYA 1UW7A 5C5OA 1UTKA 1NRRH 4JMYA 4DIHH 2R2WU 4Y8ZA 4TPIZ 1W14U 1H9IE 4RKOB 3OX7U 4K1SA 3W94A 1ORFA 1VCWA 3FP7E 1ZR0A 3SORA 3MQKC 2NU2E 1PPEE 4KTCA 3SJIA 1UVSH 1ZTJA 1TX6A 1GG6B 1GPZA 1HJ9A 2ZGXH 3KYFA 3ZZBA 3I77A 3SU5A 5C1UA 1GI6A 1SQTA 2F9OA 1FLEE 4YT7H 1V2WT 2VWOA 1SFQB 1QQ4A 3PV2A 3UIRA 1JRTA 2GP9B 1KTTB 2FMJA 1PPGE 2JKHA 2QGRA 3QWCH 2GT8A 1W0ZU 5EG4A 1FPHH 2AEIH 2FEQH 5EQQA 1OPHB 1P2JA 2CHAB 2XNDD 2VWMA 1OS8A 1JWTA 2UUYA 3PM3A 1EPTB 3S7KB 4Q7XA 3VG8A 1WUNH 3F9HA 3U9AH 4AFUA 4NZQA 1Y5BT 2FWWA 3A85A 4J2YB 3FAOA 3I29A 3OAAD 1HXEH 1EOLA 1A2CH 1TE0A 2G52A 2SFAA 1QA7A 2GZ9A 2IPQX 1P09A 1L2EA 4OS1A 1O2XA 3S0NA 1EKBB 4ZMAH 1EX3A 3BIVH 1QBOA 5EW2H 1OSSA 3U8TH 2HGTH 3ZVDA 2L74A 1P2KA 3KIDU 5A0BA 1SGYE 3LGYA 3STIA 2M5TA 5HGGA 1O36A 2Z3CA 1TONA 2FESH 1NU7B 2WPMS 2VWNA 3FP8E 4Y11E 4BTTB 5ESBA 2AGGX 1HBTH 1FY5A 4Z1MD 2PFEA 3LT3A 2BQWB 1KXFA 3URCA 1WTGH 2LPRA 4ZKRU 3MO3A 3TGIE 1O2LA 2Q6GA 1QTFA 1IQKA 2QXIA 1S85A 1G30B 4M9FA 1BRAA 4A1XA 4K8YA 4H4FA 4Q4LA 1DT2A 2HNTF 2P3FH 2ZTYA 1XVMA 4ABAA 1VITF 1TNIA 1NY22 5C0TA 1KY9A 1OWKA 1S6HA 1LVMA 1C2KA 1QNJA 1BB0B 1FUJA 4BAOB 1C2FA 3MU8A 2A0QB 1GI0A 4Y0ZE 2A2QH 2PUXB 4UFFH 1SR5C 1B0FA 1OWIA 1OKXA 4JZ1A 4ZKSU 3BTKE 2J4IA 1PJPA 2ANWA 2FTMA 3HGNA 2OINA 3FKSD 2QF0A 4ISOA 3CS7A 1NROH 4OS5A 4BANB 3VB7A 2PKAA 4GCHF 1BTYA 3A8BA 3T5FH 2H9HA 1MAXA 5EW1H 3K2UA 1HFDA 3TNSA 4X6NA 4CRCA 4GHQA 1V2NT 2UUFB 2B5TB 4ZHMU 2C8XB 1P9SA 3URDA 4BAQB 3RXVA 1GBHA 2TPIZ 3F9GA 2ZQ1A 4XBCA 3SV6A 1DANH 3RXUA 3KQBA 1JOUB 2F4LA 3R3GB 1C5PA 3K65B 2DE9A 1WSSH 4HGCA 2A7CA 3ODFA 1GBKA 3MH7A 3U1IB 2NU1E 3DT0H 4Y8XA 1SMFE 8ESTE 3RXQA 1FDPA 2AGIX 1O2UA 2R9PA 1IQLA 1VCPA 1GDUA 1MCVA 3PO1C 3BG4C 3LONA 4KELA 1MTUA 1P12E 1UVUH 1NC6A 2A7HA 1D3TB 1J8AA 5JB8S 2AS9A 3SNCA 1DDJA 3LC5A 3BTWE 3FN8A 4GLYA 4IMQA 4Y0YE 1A1RA 2SNWA 2BD9A 2ASUB 3GCHC 3R0FA 1MTWA 3SJ9A 2ANMH 4NCYA 3KCGH 1A7SA 1QB6A 2P3TB 3UQOA 1N1LA 1A46H 1KMHB 1OP0A 2P94A 1DWDH 1BTPA 1FAXA 3U8RH 3A8DA 3H7TA 1IHTH 1GDQA 1TQ7B 1TOMH 2B8OH 4F4OC 3M5NA 1W0YH 4MQAA 3TVJB 3A7VA 5C0UA 3P8GA 1GJBB 2KX4A 1TRMA 3AW1A 1MTVA 3SUGA 5CE1A 1W0KD 1O5DH 1RTLA 5FPSA 1QGFA 5C1YA 5HYOA 3F3BA 1NN6A 4LZ4B 1BCUH 1BMNH 1BHXB 2PUQH 1NRNH 1IQEA 3ATWA 1Z6EA 1GI5A 4X8UH 4YOIA 3UR9A 2WV4A 3GDSA 6ESTA 1TWXB 1TGSZ 4FUJA 2FZZA 1YP9A 7LPRA 5HIZA 1QL9A 2Y7XA 3N7DA 4DG4A 2FYQA 1EB1H 4NIYA 1CT0E 1C2JA 1Q31A 4ABGA 1UTQA 3ZZ5A 1XUIA 1ZOMA 2Z9LA 1GVZA 2KCPA 2CN0H
chains in the Genus database with same CATH topology
1FXYA 3P6ZB 2FDAA 5EPYA 1A3EH 5J4SA 2CF9H 1KYNA 3E3TA 4MNWA 1C2EA 4ZXYH 4IBLH 3F1SB 2FS9A 1T8OA 1VR1H 2A4QA 2OQUA 4NZLA 3TU7H 2BD4A 2A5AA 1IQHA 4M7GA 2FO9A 1A5GH 3LGTA 1JIMA 1RTKA 2EC9H 4B74A 5G4BA 1GMDF 2C3SA 1GHZA 1ELAA 5EODA 1K1JA 3PROA 1S6FA 1BRCE 4ZUHA 1YYY1 2DE8A 4NA7A 4E7NA 1MAYA 3PYHA 1BTWA 1EJMA 3GY7A 4SGAE 1MH0A 3ITIA 3UTUH 4CHAB 3Q77A 5C1XA 1CE5A 3RC5A 4AG2A 1ANBA 1C2DA 1GI4A 5IYTA 3TGKE 1PYTD 5JPMH 1GL1A 3OSYA 1YLDA 1PPCE 1IQIA 2BB4A 1T7CA 2BOKA 3AAVA 4ZKOU 1QHRB 3DFLA 1TPSA 3MO9A 3A89A 1LHGH 4FUBA 5AFYH 4AOQA 3UOPA 2HALA 1DOJA 5T6GA 2Q6DA 2BY9X 2AFQB 2P16A 3EA8A 1UMAH 3EQ0H 2JH5D 3SO3A 3Q3YA 3DD2H 5EXNA 4IW4E 2Z3DA 3RDZA 3UNRA 2OLGA 1XUHA 1SSXA 1LKBA 5CHAC 1SPJA 4UFGH 2AMPA 4IMZA 1BRBE 1O3JA 1PQ8A 1ZPZA 2D2DA 3TJVA 1J9CH 1BBRK 4AGKA 3PLBA 1ETSH 1O5FH 1UTLM 1RXPA 4TY6A 2WPIS 1C1WH 1GHWH 1AUTC 2BZ6H 3A80A 4I8JA 5I25A 1O2IA 1C5TA 2ZFPH 1G9IE 1YPHE 4ISIH 3GDUA 2G5VA 1P0SH 5FHTA 4B76A 5HM9A 1C5UA 1PPHE 1SGDE 4IC5A 3MNSA 4MNXA 4YM9A 1HPGA 2GMTC 2FLBH 4GUXA 3KN2A 2STBE 4FUGA 1LDTT 2ULLA 5A0CA 5FPYA 1YPJH 1GBIA 2FS8A 1UK2A 2FODA 2PHBA 1YPKH 2RA3A 1O31A 3QDZB 3A8CA 1EP6A 4I8LA 4OGYA 3SU3A 2PWXA 5FBIA 1P02A 2FPZA 2BHGA 2BDCA 1F0UA 4K69A 1D9IA 4R8TB 3SJKA 3BG8A 2G4UA 3VB3A 4HZHA 2XYAA 2ZDMA 2QC2A 3BIUH 4WMEA 3A7ZA 1O39A 4ISHH 1EATA 3A88A 2ZC9H 4MDSA 3TK5A 1MKXK 1AVXA 1AE8H 1QCPA 1IQGA 1B5GH 3OYPA 1EASA 1D4PB 3RXRA 1JBUH 2BD3A 1GBBA 1THRH 1C4Y2 1O2ZA 1TIOA 3SU6A 3PLKA 2FP7B 2SGEE 4ZROA 3TIUA 2Z94A 3P70B 2XW9A 3E0NB 5K0HA 3ZZ4A 1C5YB 3M7UA 5GCHG 1HJAC 2F9VA 1TAWA 3UREA 1MTNB 1THPB 2ZU1A 1LO6A 2AMQA 1EZSC 3H7OA 1G37A 1LKAA 2ZFQH 4NIXA 2ILNA 1KDQB 4I8HA 1JMOH 3T29A 1DXWA 1Z8JB 2QXJA 2OC7A 1QA0A 2HPPH 1ZLRA 1UHBA 1C5QA 2BVXH 1O3HA 1TPOA 2ZFTA 4KTUA 3M61U 1FI8A 1FY8E 1YGCH 1J15A 4AFQA 4BTUB 1GMHG 2AH4X 1TNJA 1HAYB 2F9PA 1C1TA 2ESTE 1KTSB 2C8WB 1Y3UA 1YPHC 1AHTH 2OQ5A 3RXJA 3SBKA 4B2BA 3O8RA 1O2PA 1SLUB 1K1PA 1WCZA 2A1DB 3M5MA 3ZZ6A 4Y7AA 1Z1IA 3UWIA 3L6PA 5K7RA 5L2YH 2J95A 3F9FA 1F92A 1FQ3A 3TJUA 2SNVA 1C5VA 4ABFA 2WUBA 1UVOA 1D3QB 2QA9E 1BQYA 5JBBS 3U8OH 2W7UA 2YNAA 3SGQE 3TPIZ 3SUFA 1DLEA 2BQ7B 3HATH 3A7XA 1EB2A 4NWLA 4BAHB 1FIZA 3A82A 1AU8A 1LQDB 3LOXA 1Z8GA 1U6QA 4FXGH 1HLTH 5A0AE 2ZU4A 1EZUC 2JETC 1HAHH 3MTYA 1O5AB 4X8TH 4DT7B 2BX4A 3LPRA 3TLOA 4RN6A 4LZ1H 1GCTC 3QO6A 1O5CB 3G01A 1C9TA 4FU9A 3QUMP 4ISLA 3ZZ8A 2XXLA 3KQEA 4AZ2B 1LPGB 3T28A 2FOHA 1KLTA 2XCNA 3ZZAA 1LVYA 1NFXA 5AHGH 1V2JT 3ZYEA 2GD4B 1IQFA 1CGJE 4X2VA 1A5IA 1QJ1B 1AN1E 1ELBA 3RXTA 3TK6A 2FOEA 3ELAH 1GHBG 1K28D 1BOQA 3SNEA 1NFWA 2A5IA 4K1EA 1UTMA 4DCDA 1GVKB 2AERH 4VGCC 1QB9A 3RMNH 3UWJH 3SU1A 1P06A 3QGJA 1DY9A 1VJ9U 3A7YA 4YTAA 5C5NA 4AORA 3A87A 3SW2B 1J16A 2GVFA 3ZVBA 1CQQA 1WU1A 3SUEA 1ARBA 5JB9S 5JBTA 2BY5X 4UFEH 1C5ZB 4U32A 1FN6A 4WMFA 4FUCA 1CHOF 4ZXXH 1GWAA 1L4DA 2A4RA 1ELVA 1N6XA 6GCHG 1A0LA 3SJ8A 1HIAA 5CMXH 5C3NA 1Y5UT 1J17T 3KHVA 3SZNA 2BVRH 3MU1A 1C1MA 5GDSH 3P8NA 3ATMA 2XRCA 3UQVA 4MPVA 2VVVA 5E2PA 2ZECA 1UTJA 5JDUB 4CBOA 3TK9A 4U30A 1UCYK 3U98H 3V12A 2OP9A 3BTEE 1O2OA 3MU0A 3RM2H 1ZGIA 3V0XA 1G36A 1GBJA 2FLRH 2ZDVH 2FM2A 2C90B 2BDGA 1ARCA 1QB1A 1EAIA 5TCCA 1TGCA 2BMGB 4JZDH 4MTBA 2ZCKP 1AB9B 3ZVGA 9LPRA 7GCHG 4X2YA 4I32A 1EJNA 2TRMA 2BYAX 1TMBH 1CT4E 1QIXB 6CHAB 1YCPH 3GYMA 3LIWA 3OY6U 2Z3EA 5F8ZA 3RC4A 1V2OT 2FOBA 1DXPA 3LGWA 1GHAF 1Y3VA 2H5CA 1HNEE 1GJ5H 2P3UB 2PLXA 4JYTA 1TB6H 1ZMLA 3VXEH 1BMAA 1UTPA 2QY0B 3L3TA 3I78A 3W95A 1ZSKA 5DPAA 2W7SA 1BTZA 3M3TA 3QZQA 3NKKA 1O3OA 2XWBI 1S84A 1ZJKA 3RM0H 1Z6JH 1SGPE 1ZJDA 4LK4A 1T4VH 1KXCA 3FANA 3RXSA 1ZRBA 1GBTA 5FX5A 1UVPA 4ABJA 1HAVB 3ZVEA 1LQEA 2IPHA 2VINA 1CBWB 3Q00A 5EXMA 5E0GA 1QRWA 1CVWH 4DVAU 1DITH 1C5SA 3BTQE 3U69H 1W8BH 4ZHLU 2ZHQH 2R3UA 1SGCA 4MG3A 2ALPA 4WH6A 4DJZB 1HXFH 1C1UH 1P05A 3PMHB 4J1YA 2PW8H 1O3LA 1ZPBA 1DY8A 1O33A 2QYIA 1KSNA 4FVDA 3E16B 3HKIB 1C4V2 1ZZZA 2NU3E 4SGBE 3V3MA 5C2ZA 1O2HA 3MH6A 2FYRA 2ZU5A 4X8SH 1RIWC 1O2VA 5BPEA 7KMEH 2PGQB 1TRYA 3ZV9A 1WYKA 1BITA 1W13U 3DA9B 4YO9A 1L1NA 2EI8A 4UE7H 3NCLA 2BM2A 1QJ6B 1HGTH 1GJ8B 1CA0B 3FZDA 1GJDB 4IS5A 2F3CE 4AGJA 5I46H 1DPOA 2IJOB 1O34A 2AYWA 2O9QA 1L0ZA 1C5NH 1C5RA 1A61H 3E6PH 3SV2H 2K1QA 4NG9H 3SNBA 2FOGA 4CR9A 1UTNA 4NGAH 1HV7A 2GCTC 1MQ5A 1P2MA 1AVWA 2CF8H 4K5ZA 4ISNA 1SGNE 2ODYB 3VGCC 3MU5A 1ZGVA 4NWKA 1EAUA 1SLVB 3ZVFA 3RXHA 2Y82A 1QJ7B 4LXBH 1UK4A 1LHCH 1SOZA 2HOBA 5E8EH 2AIPA 3QX5H 1RTFB 1GI8B 4CR5A 1G3EA 1QFKH 3UOUA 4O9VA 1P57B 2ZGCA 3BTHE 1WQSA 1F0RA 1LCYA 3V7TA 1TGTA 3S9BA 4UD9H 3K6YA 4MPXA 1HUTH 1L1GA 1W7XH 4X6PA 1Y5AT 1O3PB 4IC6A 4BTIB 1UVTH 1BJVA 1GG6C 1ELFA 1G2LA 3M36A 3RXPA 4B2AA 3M7TA 4AFZA 4B75A 5EQRA 2BLOA 1GGDB 1ANDA 2UUKB 1HAOH 2LNCA 1O3NA 1AFEH 3PWCA 4AG1A 2O8LA 5TCAA 1D3DB 1V6DA 2WPHS 3GY5A 1TGBA 5T3HA 2ZU3A 5HXFA 2XBYA 1G3CA 4KGAA 4O97A 2VH6A 4MNVA 1S83A 1AMHA 4JK6A 2P59A 2RA0A 4O3TA 1C1SA 3QN7A 2OC1A 3Q3KA 4CRDA 4XDEA 4INKA 1FN8A 1ABIH 2ZHDA 1GL0E 4BNRA 2R0LA 1O3CA 4CREA 3VB6A 1O2QA 4H42U 1Y59T 2G51A 4ZHAA 1Y8TA 1CT2E 1Z7KA 1LPKB 3SGAE 1ELDE 3EGKH 3UNSA 2IOTA 3RU4T 1V2UT 3HKJB 2ZPSA 2ODQA 1GBLA 4UEHH 2BDYA 3K6ZA 1PYTC 3QTVH 4Z0KA 1K1LA 1N6YA 1DUEA 1TALA 5GXPA 2OBQA 1OWEA 1AD8H 5E2OA 3ATLA 2ZGBH 1K22H 1GVLA 4YOJA 1HDTH 1GBAA 4IN1A 1FMGA 1HB0B 1YF4A 3BTFE 2PKAB 3BEIB 1ELGA 3M5OA 2ZDNA 1KXEA 1NRSH 2CV3A 2GZ7A 3E1XB 4THNH 1SI5H 1E36B 5DK1A 1J14A 1P2QA 4GCHG 3SV9A 3JZ2B 1NFYA 1HAIH 3ODDA 5A8XA 2ZCHP 1GBFA 1RRKA 1MKWK 1NZQH 1RJXB 1O3BA 3KQCA 1A3BH 2VNTA 1O2SA 1TOCB 3LKWA 4NSYA 1GJ6A 2BD8A 2B0FA 3KL6A 3AASA 3QLPH 1GJ4H 1QQUA 1YC0A 2W3IA 1MQ6A 2BXUH 5B6OA 4Q7ZA 2J2UA 1XKBC 1KIGH 1TFXA 4U2WA 1K1OA 3MI4A 1TNGA 4YLQH 3UR6A 1YPEH 4XBDA 3RXBA 2ZTZA 1N8OB 1S5SA 4OS7A 4ABBA 1T32A 3RMLH 3B8JA 4F49A 2VVCA 2V0BA 5A8YA 1K9OE 1CA8B 2H6MA 1GDNA 2ALVA 3MWIU 1HRTH 4AYVB 7ESTE 4D9QA 2HRVA 3V13A 1TBRH 5JBAS 2SGAA 2ZFFH 1H8IH 2A32A 3SQHE 1NTPA 2W26A 1RD3B 1AY6H 1A4WH 5FCRA 4IN2A 1P8VC 1AWHB 1G2MA 1Z8RA 2P8OB 1SHHB 3ESTA 4A1VA 1D6WA 1VGCB 4WWYA 3RXFA 1C2MA 1SGFG 3BEFB 1FPCH 1HCGA 2GT7A 4X6OA 2OBOA 5ABWA 4U01A 1P10A 3UFAA 3Q3XA 1O5EH 4UDWH 4OS6A 2WYGA 4ZAEA 1FV9A 5L30H 2TIOA 2OUAA 1MCTA 3TH4H 2VGCB 3DUXH 1NRPH 2ZNKH 4MLFB 5EGMA 2OD3B 1O3GA 4JYUH 2ZFRH 4X1SU 2Q6FA 2ZPQA 1GJAB 4DY7B 4FUHA 2JH6D 2GV6A 1C5LH 1AKSB 3E8LA 2G55A 3GCTG 1PPBH 3FZZA 1TPPA 1EUFA 8GCHF 1W3CA 3EA9A 3A8AA 3GY6A 4ZKNU 1GHVH 3S9AA 1BMLA 1MU6B 1EQ9A 1C2IA 5F6MA 3LU9B 4K1TA 2G81E 2PV9B 4VGCB 4BAKB 4FUEA 5JBCS 1IQNA 3T62A 1EOJA 1ABJH 2GTBA 1XUGA 1AKSA 2VH0A 3SUDA 2PSXA 2J38A 2V6NA 1DLKB 1ZHRA 3VFEA 2XTTB 4YZUA 1QBNA 4YESB 3GICB 1W10U 1GMDG 1P01A 1DSTA 3O8DA 5FAHA 1AUJA 2H9EH 4CH8B 1AFQB 1OX1A 3M3VA 2GDEH 1YKTA 2BDIA 2FOMB 1C1VH 2WV5A 3H5CB 1BRUP 2WPLS 1O2GH 1H4WA 4A92A 2ZWLH 3GISB 1QBVH 2KAIA 1Z8IB 2FX6A 2D1JA 1CGIE 1ETRH 4K60A 4GHTA 1BMMH 1C5XB 1GMCF 1MU8B 3PMBB 1IOEA 1PQ7A 2CXVA 4X1PU 1OWJA 1E0FD 1D3PB 1W11U 1P2NA 3E90B 1SGQE 5E0JA 2GX4A 1G32B 4WY3A 1DWCH 3SI3H 1V2KT 1SGIB 1K1NA 5AF9H 4WJG2 1LTOA 3BTME 3SNAA 2HVXA 5DP8A 3MMGA 2F9BH 1NRQH 3FFGA 4ABHA 6GCHF 1ZHPA 1EZXC 1EAXA 1HAXB 1W7GH 4X8VH 1PPFE 1K1MA 1GHXH 2EA3A 1ZSLA 3LGVA 5EOKA 3SV8A 3ZVAA 5DP5A 1C5WB 5DKMA 1BBRH 1O3AA 1EP5A 2BLWA 4CH2B 1O2YA 3M35A 3S9CA 1XUKA 3QK1A 4Y8YA 3SQEE 2GCHG 1GJCB 4FVBA 1PPZA 1A5HA 4R0IA 5F8TA 1M9UA 3RXMA 5LPEA 4X1RU 3UNQA 2VIPA 3SI4H 1LHDH 1BZXE 3BV9B 8KME2 1SBWA 7GCHF 3LDXH 3SU4A 5HM2A 1SC8U 1AQ7A 2XC5A 4FUIA 1XVOA 1GHYH 3HGPA 4Q2KA 1FY3A 3KGPA 4JK5A 1TA2A 4X0WU 2VVUA 1ZTLA 1X7AC 4JYVH 1CGHA 1TLDA 2CMYA 2EEKA 4D9RA 3TH3H 2ANKH 3EA7A 3RXCA 4BXSA 3PMJA 4NIWA 1C1RA 4TYDA 1LVOA 2ZU2A 1MKXH 3CS0A 2J9NA 5EPNA 5EU8A 4X2WA 5GJ4B 3RLYH 4A6LA 1C1QA 1W12U 1LMWB 4KP0A 1IAUA 1NM6A 3S7HB 4E06H 1F0TA 1QRZA 1OP8A 2BY7X 1FNIA 1UHBB 4WXIA 2GDDA 3F6UH 3LJOA 3M37A 3EDXB 4GAWA 4E7RG 3UY9A 1DUAA 1AO5A 3E91A 1EPTA 4D7FA 3ZZCA 1LPZB 5AFZH 1RGQA 1MZAA 3QTOH 1RIWB 6LPRA 1P11E 4O3UA 1V2PT 2Y5FA 3A84A 4XFQA 1DX5M 5C20A 2EI7A 1QY6A 2P95A