1MCTA

The refined 1.6 angstroms resolution crystal structure of the complex formed between porcine beta-trypsin and mcti-a, a trypsin inhibitor of squash family
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
223
structure length
223
Chain Sequence
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGNMICVGFLQGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords BETA-TRYPSIN
publication title Refined 1.6 A resolution crystal structure of the complex formed between porcine beta-trypsin and MCTI-A, a trypsin inhibitor of the squash family. Detailed comparison with bovine beta-trypsin and its complex.
pubmed doi rcsb
source organism Sus scrofa
total genus 47
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1992-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mctA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mctA02
4E05H 4E7RG 5JDUB 4AFSA 2FTLE 4LZ4B 4RN6A 3U8RH 1HB0B 2Z94A 2GGVB 3S9CA 3GY6A 5EXLA 1G9IE 2RA0A 1ESTA 3SBKA 1U6QA 1W13U 1O32A 1HAYB 3O8BA 5C1YA 5DK1A 4D76A 3CS7A 5FCRA 2ODYB 1PFXC 1GHAF 4IC5A 1EPTA 4IN1A 3VGCC 1ANEA 3KQDA 2PHBA 1WTGH 2STBE 3MNXA 1BJVA 1X7AC 1QA0A 4M7GA 1O37A 3PMJA 2Z9IA 1FIWA 3OSYA 3QGJA 2VGCB 4IW4E 1XUKA 3SUFA 2H2ZA 4BAQB 2B9LA 5LPEA 1UTLM 1E37B 3SW2B 3LPRA 1ANDA 1ZTLA 2VH0A 5BPEA 4JCNA 1C2GA 2Z9KA 1UK3A 2R2WU 2P3TB 1YLCA 1FY3A 1C1RA 1VCWA 3A8DA 2ZCKP 1SB1H 1SGTA 2HWLB 2B7DH 2XBVA 5TCAA 3RXGA 2V6NA 1AU8A 1SSXA 2A5KA 1YPHE 4FUGA 4A5TS 1A2CH 4CH8B 1TX8A 4AOQA 3LIWA 1FMGA 2ALVA 5H4IB 3E3TA 3PYHA 2W3KA 3QZQA 3VFEA 2GT8A 2BX3A 4YTAA 5GCHF 5GPIB 1QBNA 2FMJA 1N6YA 1TBRH 1P03A 2XBWA 1OXGA 4BXWA 2D1JA 2ZDVH 1ELTA 3VB6A 1VGCB 4MVNA 1C4V2 4MTBA 3KN2A 9ESTA 1C1QA 5JPMH 3SJ8A 1V2PT 1S0RA 3SV7A 2HGTH 1BOQA 3FVFB 2Y80A 3TGKE 1A0LA 1AFQC 1DM4B 2LPRA 4XBDA 1A4WH 3F9HA 2GZ7A 5C67A 6ESTA 4I8HA 1DOJA 4X1NU 5FBIA 1FN6A 1DSUA 3RXKA 1BT7A 1FJSA 1C2MA 2TBSA 2ZECA 4YLQH 3ZV8A 2G4UA 3KQBA 1AUJA 1KSNA 2R0LA 1SGFA 2O9QA 1HV7A 2G5VA 1XKBC 2W5EA 2BY6X 1CU1A 1W10U 1C2IA 1W7XH 4QT8C 1C5QA 1HNEE 1H9LB 1K1IA 2PKAB 4U30A 1VJ9U 3UQVA 2F3CE 1O2JA 1QL9A 5DP5A 1MAYA 2NU2E 3VEQB 4Y0YE 1C9TA 4GCHF 1MBQA 3PLBA 4B71A 1MAXA 1THSH 1EZQA 2ILNA 3LGIA 5F03A 3VB7A 1KXBA 1CHOG 2FPZA 3U69H 1C1OA 2OC0A 3JZ2B 4KTSA 5FXLA 4WXVA 1C1MA 1N8OB 2VINA 4KTUA 2HOBA 2FOHA 4AG1A 3V3MA 2ZHWH 3IWMA 2IN2A 2F9VA 3S0NA 1O2VA 1ZMLA 2W3IA 1GI5A 4BXSA 2PWXA 4K8YA 5DKMA 1UVSH 1CT4E 1O2YA 2H9TH 1GMHG 2ODQA 1T7CA 1BHXB 1L0ZA 2BXTH 5HM2A 3Q3KA 5K0HA 4XBBA 2ZU1A 2A7HA 4Q2KA 2BTCE 1C5SA 3A7WA 1EATA 1D3TB 2UWOA 1WYKA 2CHAB 4TY6A 1UHBB 3PM3A 2BD4A 1HIAB 2ZEBA 2H9EH 1UMAH 1UTMA 3EE0B 2A4OA 1DICA 3RC4A 7GCHG 4D9QA 3GY2A 4ASHA 1GHBF 1UCYH 2FOMB 1K1JA 4NGAH 3RP2A 4DOQA 1RTFB 1O0DH 4ABJA 2BDYA 2BLQA 3CP7A 4KELA 3T25A 1O3FA 2BY7X 3HKJB 4F49A 1OOKB 1ZJDA 1V2KT 4BNRA 1ZYOA 1J8AA 1P11E 1O5GH 4MPVA 3BTEE 1S6FA 4Y76A 3M5MA 5GIBA 2Q1JA 5E2OA 1ZHRA 3HKIB 1GI2A 4ISOA 2ZO3H 2AGEX 5LPFA 2P3UB 3HPTB 3KQEA 2GMTB 1AE8H 2J34A 1O2TA 1BBRE 4B73A 2BQ7B 4ZROA 2ZPSA 1P01A 2ANMH 1SI5H 4AZ2B 4DY7B 1CHGA 3SU5A 3RXJA 2FYQA 2W7UA 1PYTD 4U32A 3TH2H 1CVWH 1MTUA 1T8OA 3E91A 1A5HA 5ESBA 3NZIA 3P92A 1XUIA 5EODA 2RG3A 4MNXA 1MD8A 1J16A 1BHXF 1P10A 2B0FA 2F9BH 3URDA 2V35A 1EAXA 3RU4D 1EZXC 1INCA 2AEIH 4AORA 3EGKH 1LDTT 4CRCA 3ZVGA 1E38B 1O3HA 1V2ST 4I32A 3TK5A 4JZIA 4HZHA 1P8VC 2J95A 1NROH 4O97A 2THFB 3MMGA 2QXJA 1Z7KA 2H5DA 1O3MA 3P8FA 3DHKH 2C3SA 3UPEA 3TNSA 1TBZH 2AYWA 1EASA 3AVZA 5BRRE 4HI3A 5JBTA 1S83A 1XXDA 2AMDA 4NG9H 4NIYA 4CR5A 1HAOH 1PPZA 3LT3A 1BRAA 2FWWA 1HAGE 3VB5A 2ANYA 3P95A 1GBAA 1GBJA 1MQ6A 1Y8TA 1ZGVA 4FUHA 4RKJB 2J4IA 1LO6A 1H9HE 2JH6D 4NIXA 4YLUA 1O3IA 1LKAA 2PTNA 1TOCB 2ANWA 2P8OC 4MPUA 3AASA 2BD8A 3MTYA 1TE0A 2A5AA 1P2KA 1Z8RA 1TBQH 1LMWB 5F8XA 3LC3A 2C8YB 2YOLA 5A0BA 1C4U2 1GJAB 2HNTC 1O5CB 1B7XB 4WF8A 5E2PA 2XBYA 4AFZA 1SHYA 1K21H 1M9UA 1C1PA 2P3FH 1GJ8B 2BLOA 1P2NA 2ZQ1A 3ZVFA 2IJOB 1ETTH 5L2YH 1A7SA 4X8VH 1IAUA 1UJ1A 2BD5A 3VPKA 2Z7FE 3MI4A 3ZYEA 3DFLA 3QTVH 2FS9A 4XOJA 2XWAA 2ULLA 4YOIA 1S85A 1NM6A 5HYOA 2GCTC 1FZZA 1ZHPA 1PPGE 6LPRA 1DLKB 3MU1A 2H6MA 2GZ9A 1MH0A 2BDIA 1OWIA 1Y3VA 1PPEE 3A80A 5FCKA 5JB8S 3RXLA 3ZZCA 1KTTB 1O3BA 1Z1IA 5DG6A 2A4QA 3F68H 1MQ5A 2A0QB 1GBCA 1EKBB 1ZJKA 2ZU5A 1D3DB 2Y7XA 4JZDH 4O03A 4AX9H 1S5SA 2OINA 2BD7A 3U1IB 1AB9B 2PTCE 3GCTF 1C9PA 4GHTA 3GICB 3LGYA 2G5NA 1QL8A 1YPKH 1EPTB 3RLYH 2VVUA 1TMBH 3KHVA 3T5FH 3QGNB 2C4FH 3P70B 1OX1A 4YT6H 2PFEA 4NSYA 1J17T 2RA3A 4FU7A 5ESTE 2JETB 3BIUH 1GI9B 1HJAB 1O2LA 3QWCH 4X2WA 1TMTH 4OS7A 1GDQA 4XFQA 1Y59T 1ZMJA 4KTCA 4MG3A 1EAWA 4IBLH 2SNVA 1O2SA 3ZVCA 3E90B 2VIPA 4TPIZ 1EAIA 3ZZ6A 1HAZB 3ZVEA 1W0YH 1A3EH 2FOBA 1ACBE 1LHDH 2ZCHP 4Y8ZA 2CF9H 3M35A 5JB9S 1GHAG 2HNTF 3W95A 2FI5E 4ZKNU 2C8ZB 5I46H 2QC2A 3SNEA 1FNIA 1G3BA 1YPHC 4E7NA 1UVOA 3BG4B 1GI8B 2FM2A 2ZGXH 5EGMA 1DS2E 4UFDH 2UWPA 1DUEA 1ELCA 2OP9A 3TH3H 1OWEA 1YPGH 3NUMA 4YM9A 1SGEE 1MTSA 1FPCH 1JMOH 3M36A 3P8NA 3IG6B 1TX7A 4CHAC 3VB3A 4AG2A 3A86A 2SFAA 3LH3A 1GJ9B 4ABEA 1W3CA 1A5IA 1UTQA 2ALPA 3UQOA 4B2AA 1RRKA 1AE5A 5FBEA 4Q7XA 1OKXA 4IC6A 2BYAX 1V6DA 1D4PB 3OTJE 5C2ZA 1HJ8A 3HGPA 1XUHA 1ZOMA 2ZDKA 4FU8A 7KMEH 3VB4A 1FONA 1FY5A 1O39A 1GBDA 1C2KA 4ABIA 1T31A 5C1XA 1VCQA 2A45B 4MNWA 1TGSZ 2ZG0H 3LH1A 1V2MT 3SU0A 2VJ1A 3QK1A 1KDQA 4ABFA 1MTNB 1O3PB 1GG6B 3LOXA 5GCHG 3GCNA 2Y81A 1QJ1B 1BTHH 2BVSH 3DT0H 3TNTA 2OBOA 2BZ6H 4X1PU 2SGQE 4A7IB 2IPHA 1NO9H 5E8EH 1EP5A 4VGCC 2AIPA 3A88A 3KL6A 4XDEA 2SGAA 2B5TB 1HAXB 1QNJA 1SPJA 1BJUA 1B5GH 2V0BA 5A8XA 1O31A 3L6PA 3R0FA 4Y8YA 2G52A 3M7QA 2P94A 1YLDA 2A7CA 2Z3CA 1G32B 4MNYA 3EYDA 4CRGA 4FUCA 1CE5A 1GHWH 2NU0E 2XRCA 3ATMA 4ISHH 3SORA 1RJXB 1UO6A 3WY8A 1IQEA 1C5UA 4THNH 2WPJS 5CMXH 3A83A 5GJ4B 2OUAA 5EQSA 1RTLA 2SNWA 1JBUH 2OC1A 3BV9B 2BMGB 2TIOA 3RXUA 2UUFB 2FX6A 3MYWA 1A3BH 1AWHB 2GT7A 1QURH 2VGCC 1F7ZA 4K69A 2O8WA 4Y8XA 1T32A 4JYTA 3H7TA 1GPZA 3FP8E 3ATKA 3M7UA 5AHGH 1SQTA 1QB1A 1O2ZA 2QN5T 4Q7YA 1OYTH 5FPYA 1Y5BT 5EPYA 4NIWA 4CR9A 5DGJA 2WV4A 2PV9B 1BMLA 2VIVA 4GCHG 1ETRH 2A32A 3E8LA 1G3CA 1W14U 4H6TA 1EXFA 2XYAA 4X6OA 1NN6A 1SFIA 3SI4H 4DW2U 3BTFE 3SZNA 2VNTA 4LXBH 1O2PA 2V3OH 2W26A 2BD3A 1AGJA 1XUGA 4CRBA 3A8BA 4NWKA 4OS5A 2GVFA 3RM2H 1OWKA 1SR5C 3RMMH 1BIOA 2ZU4A 2OQUA 3BTQE 4TWWA 2GZ8A 5HMAA 1O5EH 2BX4A 2V3HH 1ID5H 3GY4A 1PPBH 1TGTA 1C1WH 1IOEA 4YO9A 3MH4A 1XUFA 4MLFB 4X1SU 1O5AB 2XCNA 2C8XB 4H4FA 2P93A 4X2VA 4AFUA 1O5BB 1WTHD 2F9UA 4SGAE 1VGCC 1YPEH 5LH8A 1G36A 2FIRH 1K9OE 1QBOA 1TRYA 3BN9A 1SOZA 2D26C 1AQ7A 2CGAA 1VJAU 4FUIA 5FPSA 6GCHF 1TQ0B 1EJNA 2ZDNA 4X2YA 4Y7AA 3RU4T 1GI1A 2NU1E 2Y6TA 8GCHG 1G30B 3QLPH 4K1SA 4B2CA 2ZDLA 2BLVA 1UTPA 1EOJA 3PV4A 4X2XA 2VWOA 4UFEH 4A1TA 1THRH 1EQ9A 1LPKB 2J38A 2B8OH 4Y6DA 2FOFA 2OC7A 3GCHB 3BG8A 1RGQA 2P16A 1BBRK 2Q6GA 4X8TH 1Y3XA 3DFJA 1OWHA 3MO3A 3PLPA 1UTKA 1GMCF 1FY4A 2O8MA 3M3TA 1BTYA 3UIRA 3UREA 4JYVH 2A4GA 2SGFE 1SQAA 3TJOA 4JMYA 1DXWA 3MU8A 1F0TA 5ETXA 1DWCH 1XX9A 1O3NA 2BM2A 5AFZH 1EAUA 2ZGBH 3EAJA 2IOTA 1C2FA 2F9PA 2Y5HA 1CGHA 1IQHA 3M5LA 4JZEH 3SQEE 3MNBA 1OWDA 1O2QA 1RTKA 3FP7E 1LHFH 3LJJA 1ELBA 2WPLS 1ZHMA 1DANH 1BTXA 1HBTH 2GTBA 3GYMA 3A7ZA 1AHTH 1MKXK 1MZDA 2QYIA 1H8IH 5DO4H 3MNCA 1DT2A 2TRMA 1TONA 1AFEH 3A8CA 1N8OC 2NWNA 4DG4A 1FUJA 2FXRA 1WQSA 1BRBE 3OY6U 2UUKB 4FVBA 1ZZZA 3K2UA 1GL0E 4WXIA 1TALA 4WMEA 1YF4A 2BXUH 1O3DA 1EUFA 4ISLA 1AO5A 5CHAB 3UOPA 4ZKRU 1BTPA 3URCA 3GY3A 1QGFA 1XUJA 1S84A 3SNDA 3TPIZ 3QO6A 2J9NA 1TGNA 3IITA 3P17H 1FI8A 2VWMA 1DSTA 3SV2H 4UFFH 2CHAC 3KQCA 1C2HA 1JRTA 1O2KA 1QY6A 4O3TA 1W8BH 1MTVA 3MFJA 3QUMP 4ZAEA 1ELFA 1UVUH 1NT1A 3EDXB 5IYTA 2GCHG 2OLGA 3L3TA 3RXEA 3V7TA 3SV6A 1GJBB 1PPFE 2ZFSA 1S6HA 3CS0A 5F6MA 1JIMA 3AAUA 3O8CA 1PQAA 3LKWA 2ZPQA 2CJIA 1P06A 1VCPA 5DP3A 3QTOH 1ZSJA 1GWAA 2P59A 4NCYA 2AIQA 2BDAA 3PMAB 5GWZA 3FZDA 2VU8E 1ARCA 2PGQB 1CA0B 2ZHQH 1F5LA 4GSOA 1ELAA 1HAIH 1MBMA 2FOCA 2ODPA 2WV5A 2STAE 1HUTH 1SGQE 1TYNA 2GMTC 3TGIE 3ZYDA 2JH5D 1DITH 1LCYA 3LGTA 1UTOA 1UK2A 3LGVA 3PMHB 1G2LA 1HAVA 4E06H 4YOGA 3HGNA 2F91A 3PWCA 2G8TA 2VIOA 1QRZA 2PUQH 2FYRA 3PO1B 1E34B 1Y5UT 5DP8A 3UUZA 1FPHH 4I33A 1HYLA 2GD4B 1O3OA 5DP7A 1W12U 3SU4A 2ZFQH 3RLWH 1ABJH 4YZUA 1P05A 2QXIA 1V2OT 1QQUA 1GJ5H 1YC0A 2ZI2H 1HXEH 1AVXA 4XE4A 1QL7A 2Z3EA 1SQOA 2A4RA 3RXIA 1RD3B 2AS9A 2CV3A 3TH4H 3GCTG 1ZMNA 3A87A 3GDVA 2BVXH 2PKSB 1AIXH 1NFXA 5C3NA 5DP6A 1RIWB 1KXDA 4ABDA 2A1DB 2BD2A 2VB0A 3ZZ3A 4DVAU 3HK3B 1Z6EA 4NA9H 3N7OA 4MDSA 2AERH 1MCTA 3RM0H 2HLCA 3BIVH 1SOTA 3M7TA 4X6MA 2GV6A 3EA8A 1KIGH 1Z8GA 3RXRA 3S7HB 1Y3UA 1UVTH 4CRAA 2FZZA 3D49H 3DA9B 1EJMA 3ZZ9A 4ZMAH 1KLTA 2QAAA 1SGCA 3BTTE 3F6UH 3PTBA 4Y10E 1AI8H 4JZ1A 5FAHA 2QA9E 3OY5U 1AUTC 1P2MA 1QCPA 1YCPK 1MU6B 2JKHA 4INKA 8KME2 3T62A 3BTME 4UDWH 4CRFA 3A7YA 1O3JA 4YT7H 1ESBA 1MU8B 2G51A 1O3AA 3SQHE 1PQ8A 2BY9X 2FLRH 5HM9A 1FXYA 2UUJB 1TWXB 1Z71A 1EJAA 1GVKB 1C5OH 4ABGA 1PYTC 1ZGIA 2Y82A 4XBCA 1HXFH 1CHOF 9LPRA 3T26A 1Q3XA 3Q3YA 1D3QB 3RMOH 3FANA 1GJ4H 5EPNA 1C2DA 1TA2A 1O5DH 1P3CA 4B74A 1IQKA 3D62A 2Y7ZA 4OGYA 1DXPA 1ZPCA 2PSYA 1LVOA 1F5KU 2KAIA 1CBWB 1SGIB 1D9IA 1YCPM 1LHEH 1GMHF 3TK9A 3SJOA 1TGCA 3D65E 1IQJA 1XKAC 2ANKH 1V2NT 3DUXH 3LGWA 2PKAA 2ZFFH 1Z8IB 1OSSA 1O3GA 3B9FH 2PR3A 2WPMS 3HK6B 4NZQA 5GXPA 1P02A 3H5CB 3RXCA 3HATH 1SGDE 3RUOA 2QGRA 3EA9A 3BTWE 4F4OC 1Z8JB 4H42U 1BZXE 1AB9C 1EP6A 2J2UA 4GHQA 4CREA 1P04A 3GY5A 1DFPA 1C5RA 4ZH8A 7GCHF 1EPTC 1PQ5A 5SGAE 1AD8H 5L2ZH 2R3YA 3BTHE 3KF2A 4JZFH 4BAMB 1O36A 1O2UA 5GDSH 1CGIE 1UCYE 1WU1A 3D23A 4NFEA 2JETC 1T4VH 1KY9A 2BQWB 4LK4A 2OBQA 4AGJA 2WYGA 2Y5GA 1HJAC 2H9HA 1DWDH 2XC0A 1QJ7B 3AAVA 2O8LA 4WWYA 1TNHA 2BOKA 3LC5A 1LQEA 1W2KH 4DIIH 3QDZB 1RFNA 3ESTA 1BTWA 1PJPA 1C5MD 1P2JA 3U98H 1FAKH 4WMDA 1HIAA 4AN7A 5E0JA 3AW1A 4INHA 1GHVH 1HRTH 8LPRA 4DJZB 1JIRA 2RDLA 2TGAA 1IHTH 2FDAA 4BOHA 2XC5A 1KYNA 1HLTH 1O2RA 2VWLA 4ISIH 3UWIA 1ORFA 1HPGA 3BG4C 3UNRA 1MUEB 3KNXA 4D8NA 1O2GH 1DWEH 2WINI 1O3LA 4I8LA 3TU7H 1NU9A 3E16B 1L4ZA 3T28A 1MMJN 2D8WA 1G37A 3SNBA 3NXPA 4R8TB 5HGGA 3SJIA 3SHAH 1MTWA 2YNAA 2O8UA 1AN1E 1TA6A 1GI6A 4AYYB 5HXFA 3OYPA 3A8AA 3RXHA 1LVMA 1YBWA 1GBMA 3T27A 1AKSA 2ZC9H 3QX5H 3TGJE 3AW0A 3SNCA 1GGDC 1GCTB 1DVAH 3PROA 1BUIA 3K65B 1IQMA 4O9VA 4HTCH 2QF3A 4GVUA 1ZRKA 3E0PB 2NU4E 3ZZDA 5LGOA 3KIDU 4GPGA 3V12A 1TNKA 5A2MH 4TWYA 1V2TT 3UY9A 1MTNC 2BDGA 1GG6C 5C5OA 3BTGE 1GMDF 1XVOA 3A82A 1C1TA 1S81A 2CN0H 1FY1A 1GGDB 3RXMA 1EOLA 3VXFH 1SGRE 2I6QA 3ODFA 2FI3E 1TFXA 3S9AA 2P95A 2Q6FA 1SBWA 6GCHG 1WV7H 3FAOA 4K2YA 3MO9A 2ZFRH 3U1JB 5FX6A 1QQ4A 1T8NA 4ABBA 1FAXA 2QCYA 1DE7H 4OGXA 1GBFA 1V3XA 1IQGA 1TLDA 1FY8E 2PW8H 4DURA 1F0UA 2R2MB 3PMBB 3UNSA 3SOSA 5DP9A 1SLWB 3U8TH 1Z1JA 1FV9A 1O30A 3SI3H 1GI3A 1GDUA 4MQAA 1GBLA 1TMUH 4X1RU 4UEHH 3SO3A 3UR6A 5C5NA 6CHAB 3A7VA 1GMCG 1A61H 2BQ6B 3F9FA 1ESAA 2DE9A 1O2OA 1B0EA 3GCOA 1LTOA 5EU8A 3ATIA 2WUBA 1T8MA 1ZSLA 5JYIA 1SGYE 2F9NA 4KGAA 4K1EA 5ABWA 4Q80A 1OYQA 1THPB 4ZUHA 4MPWA 1O2NA 4MPXA 3BTDE 3RXFA 4WVPE 4U01A 2XTTB 1K2I1 1C1VH 2VH6A 4WJG2 1OWJA 2PUXB 1C5ZB 3LONA 3GDUA 4X1QU 1DPOA 2ZZUH 4B76A 1A46H 2BDHA 1MKWK 1UVPA 1QTFA 2SGPE 3GDSA 5L30H 1DY8A 5T6FA 3RXDA 1C2LA 1WQVH 2Q6DA 1PPHE 1T8LA 1VITF 1Y3YA 3S9BA 2ZF0H 1LQDB 4FUEA 1LVBA 5EXMA 3ZV9A 3LDXH 3S69A 2GX4A 3K6ZA 2BHGA 2BDBA 1BA8B 2R3UA 1LHCH 4I8KA 1HAHH 1P2QA 3MNSA 4X6PA 1OP0A 1C5WB 7ESTE 2WPHS 4Q7ZA 1YPMH 5A09A 2Z6BD 1FDPA 1WAYB 2FODA 2H5CA 2XWBI 2AFQB 1Q31A 2ESTE 1IQIA 2TGDA 5EQRA 3P6ZB 3SJKA 1V2UT 2TPIZ 2QV1A 1K1OA 4ZKSU 4ZHLU 1HAVB 1L1JA 4X0WU 1CA8B 1AWFH 3PLKA 2BY5X 4AYVB 1BQYA 3MH6A 4GAWA 2SGEE 5JBBS 3S7KB 1QHRB 3SV9A 1NFYA 1N1LA 1GJCB 1DY9A 1F5RA 1KLJH 3P8OA 2AH4X 1F0SA 3GCHC 1O3KA 2ZHFH 3VGCB 1BMMH 4Y0ZE 1HJ9A 4O3UA 1P57B 1WCZA 1NFWA 1IHSH 4BANB 2A7JA 2GDDA 2ZU3A 2XBXA 2ZHEH 1ZTKA 4TYDA 1K1PA 1GHBG 3E1XB 1C5LH 1UTNA 1DWBH 1D6WA 3F9EA 1MZAA 4H6SB 1QRWA 3VXEH 1AVGH 1BRCE 3PB1E 3TJNA 5J4SA 2BD9A 4FUJA 2M5TA 5EOKA 2GDEH 1OPHB 1TOMH 1O3CA 1TPAE 4BTTB 1LKBA 2FI4E 2Z9GA 4IMQA 2PLXA 2A2XH 1C5PA 4YESB 3GY7A 4NWLA 4IGDA 3LU9B 1BBRH 4D7FA 2ZDMA 1TIOA 3ENSB 1V2JT 2QF0A 7LPRA 3V13A 1J9CH 1GVZA 2ZGHA 1QBVH 3A89A 1ZSKA 4ABAA 3TLOA 1O2WA 3B8JA 4OS2A 1GJ7B 1NRQH 3RXQA 1ELDE 1GVLA 3H7OA 1ELEE 1NRPH 4JYUH 1A0HB 1GI7B 1NY22 4RKOB 1RS0A 2A5IA 3ZZ5A 2OC8A 2ZFPH 2BLWA 2GP9B 4FUBA 5CHAC 1P12E 1TGBA 3Q77A 4I7YH 2Z9LA 1O5FH 1DX5M 4KKDA 1SFQB 2ZFTA 3LGUA 1BDAA 3SJ9A 3OX7U 5C1UA 1XVMA 1ARBA 1GDNA 3MHWU 5C20A 3O8RA 3LJOA 4X8UH 4GLYA 2VWNA 1P2OA 4JK6A 1GBTA 1TNJA 1MKXH 1UK4A 2RCEA 4FXGH 1ZRBA 1ZR0A 1AFQB 2PGBB 2QXGA 2G81E 1F2SE 1QB6A 4I8GA 3A85A 2KAIB 3RC5A 1AY6H 3Q76A 3SHCH 1V2RT 2OXSA 1WBGB 5IDKA 3RXBA 1LVYA 1G2MA 3ZZ7A 1P2IA 5G4BA 3RXTA 3U9AH 2J94A 1C2JA 4Z6AH 1V2QT 3MH5A 5K7RA 3ZZBA 3UNQA 2SGDE 2C90B 3BTKE 4INLA 3SUDA 8ESTE 2BZAA 2QY0B 2A2QH 4ZXYH 2FOGA 4LOYH 1EX3A 1K28D 1Y3WA 1CA0C 1YGCH 4CH2B 2A31A 2O8TA 1CO7E 3QN7A 5L6NH 1A5GH 1S82A 4WH8A 3QZRA 3SU6A 2EI7A 1SL3A 1SLXB 1DUAA 2FESH 3MU4A 2ZKSA 3UWJH 2BDCA 1TAWA 3TVJB 5EW2H 1HCGA 1BCUH 4IS5A 3PO1C 1BRUP 1YP9A 2WPKS 5PTPA 1L1NA 1WUNH 4WMFA 1N6XA 4BTUB 1TPPA 3TITA 1HDTH 2AMQA 4R0IA 5F8TA 1V2VT 5EG4A 1F0RA 2EA3A 2ZTXA 5A0AE 1NRNH 4AB8A 1UCYK 3UTUH 3EQ0H 3U8OH 1ABIH 5AFYH 3SUEA 5J4QA 4KP0A 1ETSH 8GCHF 1T4UH 1O2MA 3E6PH 3I77A 1AZZA 1HAPH 1ELVA 2FX4A 4K60A 1NS3A 3SNAA 1EB1H 1MCVA 2PKSC 3I29A 4J2YB 2EEKA 2ZCLP 1GHXH 4Y71A 1TX6A 1E35B 1RIWC 4X6NA 1CT2E 3FZZA 2ZPRA 3FFGA 3ZZAA 1NPMA 1NTPA 1XMNB 3K6YA 4NIVA 1QR3E 3BEFB 1Q2WA 3GOVB 4PROA 4FU9A 2OTVA 1QJ6B 1XXFA 2ZNKH 2ASUB 1BB0B 4K1TA 5A8YA 4DGJA 3M3VA 4BAHB 1KXAA 1CQQA 3SV8A 2FTMA 4NSVA 2GV7A 1JWTA 1O33A 3BEIB 2BOHB 1ZPZA 1UTJA 3STIA 3MWIU 1Z6JH 3RMNH 2CF8H 1JXPA 4YOJA 4UFGH 1AKSB 1HGTH 3M5NA 4Y7BA 1O38A 1ANBA 2GKVE 3UFAA 1SGPE 3E0NB 1AVWA 3NK8A 2ZTYA 1O2HA 1GJDB 2AMPA 1ZPBA 1O35A 2FOEA 1A0JA 1J15A 3MH7A 2HPPH 3BF6H 5FHTA 1TB6H 2OQ5A 3C27B 5FX5A 1RXPA 1ELGA 2XC4A 2C8WB 1H4WA 1L2EA 3NPSA 4SGBE 3KEEA 1H8DH 1H1BA 3ZZ8A 1AZ8A 2VIWA 3P8GA 2F83A 2I6SA 3RXSA 1CBWC 3ZZ4A 3SU1A 1AMHA 3W94A 2VIQA 4CBNA 1NC6A 1YCPH 4TPYA 4BTIB 4RSPA 1GL1A 2VVVA 2WPIS 1C1SA 1NESE 1KDQB 1CT0E 4LZ1H 1LPGB 1P9SA 4ESTE 1YKTA 3A84A 2ZA5A 1TRNA 5EQQA 1E36B 3I78A 3TK6A 4DCDA 3ZVDA 1PPCE 1NRSH 4FVDA 2OD3B 1WSSH 1ZTJA 3T2NA 1OS8A 2ZDAH 4ZKOU 3ODDA 1SG8B 2GCHF 4B1TA 3SGBE 1HFDA 3MU0A 1SHHB 1NFUA 4DIHH 1GMDG 1J14A 2C93B 4J1YA 4A6LA 2EI8A 1LHGH 1TRMA 1G3EA 2FEQH 3M61U 1KXCA 1IQFA 1F92A 1TNGA 2TGPZ 2XCFA 3KCGH 5T6GA 3TJUA 3ZVBA 1TNLA 4TY7A 2ZWLH 1ANCA 3A81A 1GBEA 3SGQE 2K1QA 1GHYH 3ELAH 3UOUA 5LPRA 1Y5AT 4OS4A 1BTZA 4AB9A 1O34A 2LNCA 4DT7B 5DP4A 5EXNA 2P8OB 3GYLB 1TQ7B 1GI0A 1TABE 1L4DA 1W11U 4IMZA 5TJXA 3RXAA 2W7SA 5AF9H 4B75A 2F9OA 1YPLH 1IQLA 3SUGA 4WH6A 3GISB 2FOAA 4NA8A 3KGPA 4OS6A 5F8ZA 2G4TA 4BAOB 2HVXA 4ZHAA 4FUFA 1GBIA 1NRRH 3C1KA 3SGAE 2G00A 3FP6E 5DPAA 3MOCA 4UONA 3G01A 1VZQH 1QB9A 3JZ1B 5I25A 1KXFA 1UHBA 3NCLA 1V2LT 1OP8A 2BVRH 1GBKA 1B0FA 1DDJA 3V0XA 1SVPA 2D2DA 1GBBA 2OCVB 1BMAA 5EW1H 1QFKH 1KXEA 3B23B 2GCTB 1C5VA 3TJVA 1MD7A 1FN8A 2ZQ2A 1K1NA 1S0QA 2ZIQH 1K1LA 1K22H 2VVCA 4ABHA 1WOFA 4NA7A 5JBCS 2ZU2A 1TNIA 4K5ZA 3DD2H 1YM0A 1YPJH 4WY3A 1GCTC 1D6RA 3BEUA 1VITG 2R9PA 3PWBA 4D7GA 1FQ3A 1LPZB 1FIZA 1GBHA 1P0SH 1C5XB 1TPOA 1C1UH 1KTSB 1SLVB 1GJ6A 5E0HA 3M3SA 4U2WA 2FO9A 2EI6A 3MU5A 1P9UA 4K8BA 1TPSA 1K1MA 2AGIX 5AVDA 3Q3XA 4UD9H 4Z0KA 4B2BA 3RC6A 1O2IA 3A7TA 3GY8A 1OP2A 3EA7A 3RDZA 2FS8A 5A8ZA 1SGFG 2CMYA 4X8SH 3SU2A 3ZVAA 1JRSA 4I8JA 1GCDA 1KLIH 1QA7A 2BY8X 2XXLA 2XW9A 4CRDA 1EZUC 4BAKB 1QIXB 1GI4A 1C5YB 2TGTA 1L1GA 1D3PB 2FP7B 4Y79A 5DJ7A 1YYY1 1BMNH 1H9IE 1W7GH 3T29A 4A1VA 3M37A 1P3EA 3F9GA 3SN8A 4HFPB 1EZSC 3RMLH 2CXVA 2ZHDA 1P09A 3STJA 4ZHMU 3UR9A 2H1UA 1O3EA 4FUDA 3NKKA 3OU0A 5TCCA 3A7XA 2AGGX 4Y11E 6CHAC 5JBAS 4K3JA 3F1SB 1G3DA 1SLUB 2Y5FA 1NZQH 1VITH 2ZP0H 4A92A 1C5NH 3SU3A 4UE7H 5T3HA 1EB2A 4AGKA 1XM1A 3ATWA 2DUCA 1GHZA 2WYJA 5FPTA 2XNIA 4XSKU 4CHAB 5T6DA 3CENA 1ZLRA 3R3GB 1E0FD 5CE1A 4CBOA 1O2XA 4NZLA 3NWUA 4JK5A 3M5OA 1DLEA 2PSXA 2G55A 1C2EA 1IQNA 2Z9JA 2YNBA 1A1RA 3Q00A 3ITIA 2HPQH 5E0GA 5B6OA 2Z3DA 2J92A 2ZGJA 3MO6A 1FLEE 3BSQA 1W0ZU 1CSOE 2ZTZA 2EC9H 3PTNA 4MNVA 4AFQA 2HALA 2HNTE 1NU7B 2ZGCA 4NFFA 3RU4E 2FLBH 4ISNA 5A0CA 2NU3E 1C1NA 3L33A 1C4Y2 3RXOA 2QIQA 4A1XA 4I31A 4IN2A 1SGNE 3RXVA 3RXPA 1QRXA 3ATLA 4HGCA 2QXHA 4OS1A 3TIUA 2BB4A 1SMFE 2VIDA 1PQ7A 2JH0D 3K9XB 1SC8U 1CGJE 2WUCA 2R0KA 1BTUA 2DE8A 1C5TA 2HRVA 2UWLA 4D9RA 1VR1H 4ZXXH 4GUXA 3O8DA 1JOUB 4VGCB 1BITA 1V2WT 2UUYA 1MKWH
chains in the Genus database with same CATH superfamily
4E05H 2QF5A 4E7RG 5JDUB 4AFSA 2FTLE 4LZ4B 4RN6A 3U8RH 4RT0A 1HB0B 2Z94A 2GGVB 3S9CA 2RDEA 3GY6A 5EXLA 1G9IE 2RA0A 1ESTA 3SBKA 1U6QA 1W13U 1O32A 1HAYB 3O8BA 5C1YA 5DK1A 4D76A 3CS7A 5FCRA 2ODYB 1PFXC 1GHAF 4IC5A 1EPTA 4IN1A 3VGCC 1ANEA 3KQDA 2PHBA 1WTGH 2STBE 3MNXA 1BJVA 1X7AC 1QA0A 4M7GA 1O37A 3PMJA 2Z9IA 1FIWA 1UW7A 3OSYA 3QGJA 2VGCB 4IW4E 1XUKA 3SUFA 2H2ZA 4BAQB 2B9LA 5LPEA 1UTLM 1E37B 3SW2B 3LPRA 1ANDA 1ZTLA 2VH0A 5BPEA 4JCNA 1C2GA 2Z9KA 1UK3A 2R2WU 2P3TB 1YLCA 1FY3A 5F53A 1C1RA 1VCWA 2F4LA 3A8DA 2EQNA 1SB1H 1SGTA 2HWLB 2B7DH 2XBVA 2ZCKP 5TCAA 3RXGA 2V6NA 1AU8A 1SSXA 2A5KA 3F0OA 1YPHE 2KCYA 4FUGA 4A5TS 2WHXA 1A2CH 4CH8B 1TX8A 4AOQA 3LIWA 1FMGA 2ALVA 5H4IB 3E3TA 3NRLA 3PYHA 2W3KA 3QZQA 3VFEA 2GT8A 2BX3A 4YTAA 5GCHF 5GPIB 1QBNA 2JJ2D 2FMJA 1N6YA 1TBRH 1P03A 2XBWA 1OXGA 4BXWA 2D1JA 2ZDVH 1ELTA 3VB6A 1VGCB 4MVNA 1C4V2 4MTBA 2RFKC 3KN2A 9ESTA 1C1QA 5JPMH 3SJ8A 1V2PT 1S0RA 3SV7A 2HGTH 1BOQA 3FVFB 2Y80A 3TGKE 1A0LA 1AFQC 1DM4B 2LPRA 4XBDA 1YY3A 1A4WH 3F9HA 2GZ7A 5C67A 4HG6A 6ESTA 4I8HA 1DOJA 5EJ1A 4X1NU 5FBIA 1FN6A 1FX0B 1DSUA 3RXKA 1BT7A 1FJSA 5KECA 1C2MA 2TBSA 2ZECA 4YLQH 3ZV8A 2G4UA 3KQBA 1AUJA 1KSNA 2R0LA 1SGFA 2O9QA 1HV7A 5C17A 2G5VA 1XKBC 2W5EA 2BY6X 3DSPA 1CU1A 1W10U 1C2IA 1W7XH 4QT8C 1C5QA 1HNEE 1H9LB 1K1IA 2PKAB 4U30A 1VJ9U 3UQVA 2F3CE 2CK3D 1O2JA 1QL9A 3EE7A 5DP5A 1MAYA 2OK5A 2NU2E 3VEQB 4Y0YE 1C9TA 4GCHF 1MBQA 3PLBA 4B71A 1MAXA 1THSH 1EZQA 2ILNA 3LGIA 5F03A 2V3MA 3VB7A 1KXBA 1CHOG 2FPZA 3U69H 3F2FA 1C1OA 2OC0A 3JZ2B 4KTSA 3ZIAD 5FXLA 4WXVA 1C1MA 1N8OB 2VINA 3MQKC 4KTUA 2HOBA 2FOHA 4AG1A 3V3MA 2ZHWH 3IWMA 2IN2A 2F9VA 3S0NA 1O2VA 1ZMLA 2W3IA 2EY4C 1GI5A 4BXSA 2PWXA 4K8YA 5DKMA 1UVSH 1CT4E 1O2YA 2H9TH 1GMHG 2ODQA 1T7CA 1BHXB 1L0ZA 2BXTH 5HM2A 3Q3KA 5K0HA 4XBBA 2ZU1A 2XOKD 2A7HA 4Q2KA 2BTCE 1C5SA 3A7WA 1EATA 1D3TB 2UWOA 1WYKA 2CHAB 4TY6A 1UHBB 3PM3A 2BD4A 1HIAB 2ZEBA 2H9EH 4B6FA 1UMAH 1UTMA 3EE0B 2A4OA 1DICA 3RC4A 7GCHG 4D9QA 3GY2A 4ASHA 1GHBF 1UCYH 2FOMB 1K1JA 4NGAH 3RP2A 4DOQA 1RTFB 1O0DH 4ABJA 2BDYA 2BLQA 3CP7A 4KELA 3T25A 1O3FA 2BY7X 3HKJB 4F49A 1OOKB 1ZJDA 1V2KT 4BNRA 1ZYOA 1J8AA 1P11E 1O5GH 4MPVA 3BTEE 1S6FA 4Y76A 3M5MA 5GIBA 2Q1JA 5E2OA 4TSFD 1ZHRA 3HKIB 1GI2A 4ISOA 2ZO3H 2AGEX 5LPFA 2P3UB 3HPTB 3KQEA 2GMTB 1AE8H 2J34A 4ASUD 1O2TA 1BBRE 4B73A 2BQ7B 4ZROA 2ZPSA 1P01A 2ANMH 2JIZD 1SI5H 4AZ2B 4DY7B 1CHGA 3SU5A 3RXJA 5DSFA 2FYQA 2W7UA 1PYTD 4U32A 3TH2H 1CVWH 2KX4A 1MTUA 1T8OA 3E91A 1A5HA 5ESBA 3NZIA 3P92A 2QF4A 1XUIA 5EODA 3FO8D 2RG3A 4MNXA 1MD8A 1J16A 1BHXF 1P10A 2B0FA 2F9BH 4RT1A 3URDA 2V35A 1EAXA 3RU4D 1EZXC 1INCA 2AEIH 4AORA 3EGKH 1LDTT 4CRCA 3ZVGA 1E38B 1O3HA 1V2ST 4I32A 3PV2A 3TK5A 4JZIA 4HZHA 1P8VC 2J95A 1NROH 4O97A 2THFB 3MMGA 2QXJA 1Z7KA 2H5DA 1O3MA 3P8FA 3DHKH 2C3SA 3UPEA 3TNSA 1TBZH 2AYWA 1EASA 3AVZA 5BRRE 4HI3A 5JBTA 1S83A 1XXDA 2AMDA 4NG9H 4NIYA 4CR5A 1HAOH 1PPZA 3LT3A 1BRAA 2FWWA 1HAGE 3VB5A 2ANYA 3P95A 1GBAA 1GBJA 1MQ6A 1Y8TA 1ZGVA 4FUHA 4RKJB 2J4IA 1LO6A 1H9HE 2JH6D 4NIXA 4YLUA 1O3IA 1LKAA 2PTNA 1TOCB 2ANWA 2P8OC 4MPUA 3AASA 2BD8A 3MTYA 1TE0A 2A5AA 1P2KA 1Z8RA 1TBQH 1LMWB 5F8XA 3LC3A 2C8YB 2YOLA 5A0BA 1C4U2 1GJAB 2HNTC 1O5CB 4XRNA 1B7XB 4WF8A 5E2PA 2XBYA 4AFZA 1SHYA 1K21H 1M9UA 1C1PA 2P3FH 1GJ8B 2BLOA 1P2NA 2ZQ1A 3ZVFA 2IJOB 1ETTH 5L2YH 1A7SA 4X8VH 1IAUA 1UJ1A 1H8HD 2BD5A 3VPKA 2Z7FE 3MI4A 3ZYEA 3DFLA 3QTVH 2FS9A 4XOJA 2XWAA 2ULLA 4YOIA 1S85A 1NM6A 5HYOA 2GCTC 1FZZA 1ZHPA 1PPGE 6LPRA 1DLKB 3MU1A 2H6MA 2GZ9A 1MH0A 2BDIA 1OWIA 1Y3VA 1PPEE 3A80A 5FCKA 5JB8S 3RXLA 3ZZCA 1KTTB 1O3BA 1Z1IA 5DG6A 2IJD1 2A4QA 3F68H 1MQ5A 2A0QB 1GBCA 1EKBB 1ZJKA 2ZU5A 1D3DB 3WW7A 2Y7XA 4JZDH 4O03A 4AX9H 1S5SA 3F2GA 2OINA 2BD7A 3U1IB 1AB9B 2PTCE 3GCTF 1C9PA 4GHTA 3GICB 3LGYA 2G5NA 1QL8A 1YPKH 1EPTB 3RLYH 2VVUA 1TMBH 3KHVA 3T5FH 3QGNB 2C4FH 3P70B 1OX1A 4YT6H 2PFEA 4NSYA 1J17T 2RA3A 4FU7A 5ESTE 2L6OA 2JETB 3BIUH 1GI9B 1HJAB 1O2LA 3QWCH 4X2WA 1TMTH 4OS7A 4OM9A 1GDQA 4XFQA 1Y59T 1ZMJA 4KTCA 4MG3A 1EAWA 4IBLH 2SNVA 3FOAA 1O2SA 3ZVCA 3E90B 2VIPA 4TPIZ 1EAIA 3ZZ6A 1HAZB 3ZVEA 1W0YH 1A3EH 2FOBA 1ACBE 1LHDH 2ZCHP 4Y8ZA 4M9FA 2CF9H 3M35A 5JB9S 1GHAG 2HNTF 3W95A 2FI5E 4ZKNU 2C8ZB 5I46H 2QC2A 3SNEA 1FNIA 3CNRA 1G3BA 1YPHC 4E7NA 1UVOA 3BG4B 1GI8B 2FM2A 2ZGXH 5EGMA 1DS2E 4UFDH 4ACBA 2UWPA 1DUEA 1ELCA 2OP9A 3TH3H 1OWEA 1YPGH 3NUMA 4YM9A 1SGEE 1MTSA 1FPCH 1JMOH 3M36A 3P8NA 3IG6B 1TX7A 4CHAC 3VB3A 4AG2A 3A86A 2SFAA 3LH3A 3SYJA 1GJ9B 2KCPA 4ABEA 1W3CA 1A5IA 1UTQA 2ALPA 3UQOA 4B2AA 1RRKA 1AE5A 5FBEA 4Q7XA 1OKXA 4IC6A 2BYAX 1V6DA 1D4PB 3OTJE 5C2ZA 1HJ8A 3HGPA 1XUHA 1ZOMA 2ZDKA 4FU8A 7KMEH 3VB4A 1FONA 1FY5A 1O39A 1GBDA 1C2KA 4ABIA 1T31A 5C1XA 1VCQA 2A45B 4MNWA 1TGSZ 2ZG0H 3LH1A 1V2MT 3SU0A 2VJ1A 3QK1A 1KDQA 4ABFA 1MTNB 1O3PB 1GG6B 3LOXA 5GCHG 3GCNA 2Y81A 1QJ1B 1BTHH 2BVSH 2IPQX 3DT0H 3TNTA 2OBOA 2BZ6H 4X1PU 2SGQE 4A7IB 2IPHA 1NO9H 5E8EH 5C0UA 1EP5A 4VGCC 2AIPA 3A88A 3KL6A 4XDEA 2SGAA 2B5TB 1HAXB 1QNJA 1SPJA 1BJUA 1B5GH 2V0BA 5A8XA 1O31A 3L6PA 3R0FA 4Y8YA 2M2AA 2G52A 3M7QA 2P94A 1YLDA 2A7CA 2Z3CA 1G32B 4MNYA 3EYDA 4CRGA 4FUCA 1CE5A 1GHWH 5EIYA 2NU0E 2XRCA 3ATMA 4ISHH 4Q63A 3SORA 1RJXB 1UO6A 3WY8A 1IQEA 1C5UA 4THNH 2WPJS 5CMXH 3A83A 2PP6A 1VKYA 5GJ4B 2OUAA 5EQSA 1RTLA 2SNWA 1JBUH 2OC1A 3BV9B 2BMGB 2TIOA 3RXUA 2UUFB 2FX6A 3MYWA 1A3BH 1AWHB 2GT7A 1QURH 2VGCC 5T1VA 1F7ZA 4K69A 2O8WA 4Y8XA 1T32A 4JYTA 3H7TA 1GPZA 3FP8E 1W0KD 3ATKA 3M7UA 5AHGH 1SQTA 1QB1A 1O2ZA 2QN5T 4Q7YA 1OYTH 5FPYA 1Y5BT 5EPYA 4NIWA 4CR9A 5DGJA 2WV4A 5DN6D 2PV9B 1BMLA 2VIVA 4GCHG 1ETRH 2A32A 3E8LA 1G3CA 1W14U 4H6TA 1EXFA 2XYAA 4X6OA 1NN6A 1SFIA 3SI4H 4DW2U 3BTFE 1E1RD 3SZNA 2VNTA 4LXBH 1O2PA 2V3OH 2W26A 2BD3A 3SZEA 1AGJA 1XUGA 4CRBA 3A8BA 4NWKA 4OS5A 2GVFA 3RM2H 1OWKA 1SR5C 3RMMH 1BIOA 2ZU4A 2OQUA 3BTQE 4TWWA 2GZ8A 5HMAA 1O5EH 2BX4A 2V3HH 1ID5H 3GY4A 1PPBH 1TGTA 3FN8A 1C1WH 1IOEA 4YO9A 3MH4A 1XUFA 4MLFB 4X1SU 3F3BA 1O5AB 2XCNA 2C8XB 4H4FA 2P93A 4X2VA 4AFUA 1O5BB 1WTHD 2F9UA 4SGAE 1VGCC 1YPEH 5LH8A 1G36A 2FIRH 1S6LA 1K9OE 1QBOA 1TRYA 3BN9A 1SOZA 2D26C 1AQ7A 2CGAA 1VJAU 2K0QA 4FUIA 5FPSA 6GCHF 1TQ0B 1EJNA 2ZDNA 4X2YA 4Y7AA 3RU4T 1GI1A 2NU1E 2Y6TA 8GCHG 1G30B 3QLPH 4K1SA 4B2CA 2ZDLA 2BLVA 1UTPA 1EOJA 3PV4A 4X2XA 2VWOA 4UFEH 4A1TA 1THRH 1EQ9A 1LPKB 2J38A 2B8OH 4Y6DA 4YXWD 2LP6A 2FOFA 2OC7A 3GCHB 3BG8A 1RGQA 2P16A 1BBRK 2Q6GA 4X8TH 1Y3XA 3DFJA 1OWHA 3MO3A 3PLPA 1UTKA 1GMCF 2J98A 1FY4A 2O8MA 3M3TA 1BTYA 3UIRA 3UREA 4JYVH 2A4GA 2SGFE 1SQAA 3TJOA 2WPDD 4JMYA 1DXWA 3MU8A 1F0TA 5ETXA 1DWCH 1XX9A 1W0JD 1O3NA 2BM2A 5AFZH 1EAUA 2ZGBH 3EAJA 2IOTA 1C2FA 2F9PA 2Y5HA 1CGHA 1IQHA 3M5LA 4JZEH 3SQEE 3MNBA 1OWDA 1O2QA 1RTKA 3FP7E 1LHFH 3LJJA 1ELBA 2WPLS 1ZHMA 1DANH 1BTXA 1HBTH 2GTBA 3GYMA 3A7ZA 1AHTH 1MKXK 1MZDA 2QYIA 1E79D 1H8IH 3KYFA 5DO4H 3MNCA 1DT2A 2TRMA 1TONA 1AFEH 3A8CA 1N8OC 2NWNA 4DG4A 1FUJA 2FXRA 1WQSA 1BRBE 3OY6U 2UUKB 4FVBA 5KEDA 1ZZZA 3K2UA 1GL0E 4WXIA 1TALA 4WMEA 1YF4A 2BXUH 5C0TA 1O3DA 1EUFA 4ISLA 3OEED 1AO5A 5CHAB 3UOPA 4ZKRU 1BTPA 3URCA 3GY3A 1QGFA 1XUJA 1S84A 3SNDA 3TPIZ 3QO6A 2J9NA 1TGNA 3IITA 3P17H 1FI8A 2VWMA 1DSTA 3SV2H 4UFFH 5CDFE 2CHAC 3KQCA 1C2HA 1JRTA 3OFND 1O2KA 1QY6A 4O3TA 1W8BH 1MTVA 3MFJA 3QUMP 4ZAEA 4P02A 1ELFA 1UVUH 1NT1A 3EDXB 5IYTA 2GCHG 2OLGA 1EFRD 3L3TA 3RXEA 3V7TA 3SV6A 1GJBB 1PPFE 2ZFSA 1S6HA 3CS0A 5F6MA 1JIMA 3AAUA 3O8CA 1PQAA 3LKWA 2ZPQA 2CJIA 1P06A 2F43B 1VCPA 5DP3A 3QTOH 1ZSJA 1GWAA 2P59A 4NCYA 2AIQA 2BDAA 3PMAB 5GWZA 1K0HA 3FZDA 2VU8E 1ARCA 2PGQB 1CA0B 2ZHQH 1F5LA 4GSOA 1ELAA 1HAIH 1MBMA 3PRBA 2FOCA 2ODPA 2WV5A 2STAE 1HUTH 1SGQE 1TYNA 2GMTC 3VG8A 3TGIE 3ZYDA 2JH5D 1DITH 1LCYA 3LGTA 1UTOA 1UK2A 3LGVA 3PMHB 1G2LA 1HAVA 4E06H 4YOGA 3HGNA 4TT3D 2F91A 3PWCA 2G8TA 2VIOA 1QRZA 2PUQH 2FYRA 3PO1B 1E34B 1Y5UT 5DP8A 3UUZA 3WWBA 1FPHH 4I33A 1HYLA 2GD4B 1O3OA 5DP7A 1W12U 3SU4A 2ZFQH 3RLWH 1ABJH 4YZUA 1P05A 2QXIA 1V2OT 1QQUA 1GJ5H 1YC0A 2ZI2H 1HXEH 1AVXA 4XE4A 1QL7A 2Z3EA 1SQOA 2A4RA 2GJGA 3RXIA 1RD3B 2AS9A 2CV3A 3TH4H 3GCTG 1ZMNA 3A87A 3GDVA 2BVXH 2PKSB 1AIXH 1NFXA 5C3NA 5DP6A 1RIWB 1KXDA 4ABDA 2A1DB 2BD2A 2VB0A 3ZZ3A 4DVAU 3HK3B 1Z6EA 4NA9H 3N7OA 4MDSA 2AERH 1MCTA 3RM0H 2HLCA 3BIVH 1WDIA 1SOTA 3M7TA 4X6MA 2GV6A 3EA8A 1KIGH 1Z8GA 3RXRA 3S7HB 1Y3UA 1UVTH 4CRAA 2FZZA 3D49H 3DA9B 1EJMA 3ZZ9A 4ZMAH 1KLTA 2QAAA 1SGCA 3BTTE 3F6UH 3PTBA 4Y10E 1AI8H 4JZ1A 2JDID 2QA9E 1E1QD 3OY5U 5FAHA 1AUTC 1P2MA 1QCPA 1YCPK 1MU6B 2JKHA 4INKA 8KME2 3U28C 5FL7D 3T62A 3BTME 4UDWH 4CRFA 3A7YA 1O3JA 4YT7H 1ESBA 1MU8B 2G51A 2V7QD 1O3AA 3SQHE 1PQ8A 2BY9X 2FLRH 5HM9A 1FXYA 2UUJB 2HVYB 1TWXB 1Z71A 1EJAA 2AHME 1GVKB 1C5OH 4ABGA 1PYTC 1ZGIA 2Y82A 4XBCA 1HXFH 1CHOF 9LPRA 3T26A 1Q3XA 3Q3YA 1D3QB 3RMOH 3FANA 1GJ4H 5EPNA 1C2DA 1TA2A 1O5DH 1P3CA 4B74A 1IQKA 3D62A 2Y7ZA 4OGYA 1DXPA 1ZPCA 2PSYA 1LVOA 1F5KU 2KAIA 1CBWB 1SGIB 1D9IA 1YCPM 1LHEH 1GMHF 3TK9A 3SJOA 1TGCA 3D65E 1IQJA 1XKAC 2ANKH 1V2NT 3DUXH 3LGWA 2PKAA 2ZFFH 1Z8IB 1OSSA 1O3GA 3B9FH 2PR3A 2WPMS 3HK6B 4NZQA 5GXPA 1P02A 3H5CB 3RXCA 3HATH 1SGDE 1SQRA 3RUOA 2QGRA 3EA9A 3BTWE 4F4OC 1Z8JB 4H42U 1BZXE 1AB9C 1EP6A 2J2UA 4GHQA 4CREA 1P04A 3GY5A 1DFPA 1C5RA 4ZH8A 7GCHF 1EPTC 1PQ5A 5SGAE 1AD8H 5L2ZH 2R3YA 3BTHE 3KF2A 4JZFH 4BAMB 1O36A 1O2UA 5GDSH 1CGIE 1UCYE 1WU1A 3D23A 4NFEA 2JETC 1T4VH 1KY9A 2BQWB 4LK4A 2OBQA 4AGJA 2WYGA 2Y5GA 1HJAC 4Q4LA 2H9HA 2WZQA 1DWDH 2XC0A 1QJ7B 2WSSD 3AAVA 2O8LA 4WWYA 1TNHA 2BOKA 3LC5A 1LQEA 1W2KH 4DIIH 3QDZB 1RFNA 3ESTA 1BTWA 1PJPA 1C5MD 1P2JA 3U98H 1FAKH 4WMDA 1HIAA 4AN7A 5E0JA 3AW1A 4INHA 1GHVH 1HRTH 8LPRA 4DJZB 4FETA 1JIRA 2RDLA 2TGAA 1IHTH 2FDAA 3DSOA 4BOHA 2XC5A 1KYNA 1HLTH 1O2RA 2VWLA 4ISIH 3UWIA 1ORFA 1HPGA 3BG4C 3UNRA 1MUEB 3KNXA 4D8NA 1O2GH 1DWEH 2WINI 1O3LA 4DT4A 4I8LA 3TU7H 1NU9A 3E16B 1L4ZA 3T28A 1MMJN 2D8WA 1G37A 3SNBA 2HLDD 3NXPA 4R8TB 5HGGA 3SJIA 3SHAH 1MTWA 2YNAA 2O8UA 1AN1E 1TA6A 1GI6A 4AYYB 5HXFA 3OYPA 3A8AA 3RXHA 1LVMA 1YBWA 1GBMA 3T27A 1AKSA 2ZC9H 3QX5H 3TGJE 1SKYE 3AW0A 3SNCA 1GGDC 1GCTB 1DVAH 3PROA 1BUIA 3K65B 1IQMA 4O9VA 4HTCH 2QF3A 4GVUA 1ZRKA 3E0PB 2NU4E 3ZZDA 5LGOA 3KIDU 3WWFA 4GPGA 3V12A 1TNKA 5A2MH 4TWYA 1V2TT 3UY9A 1MTNC 2BDGA 2J98B 1GG6C 5C5OA 3BTGE 1GMDF 1XVOA 3A82A 1C1TA 1S81A 2CN0H 1FY1A 1GGDB 3RXMA 1EOLA 3VXFH 1SGRE 2I6QA 3ODFA 2FI3E 1TFXA 3S9AA 2P95A 2Q6FA 1SBWA 6GCHG 1WV7H 3FAOA 4K2YA 3MO9A 2ZFRH 3U1JB 5FX6A 1QQ4A 1T8NA 4ABBA 1FAXA 2QCYA 1DE7H 4OGXA 1GBFA 1V3XA 1IQGA 1TLDA 1COWD 1FY8E 2PW8H 4DURA 1F0UA 2R2MB 3PMBB 3UNSA 3SOSA 5DP9A 1SLWB 3U8TH 1Z1JA 1FV9A 1O30A 3SI3H 1GI3A 1GDUA 4MQAA 1GBLA 1TMUH 4X1RU 4UEHH 3SO3A 3UR6A 5C5NA 6CHAB 3A7VA 1GMCG 1A61H 2BQ6B 3F9FA 1ESAA 2DE9A 1O2OA 1B0EA 3GCOA 1LTOA 5EU8A 3ATIA 2WUBA 1T8MA 1ZSLA 3W1EA 5JYIA 1SGYE 2F9NA 4KGAA 4K1EA 5ABWA 4Q80A 1OYQA 1THPB 2LELA 4ZUHA 4MPWA 1O2NA 4MPXA 3BTDE 3RXFA 4WVPE 4U01A 2XTTB 1K2I1 1C1VH 2VH6A 4WJG2 1OWJA 2PUXB 1C5ZB 3LONA 3GDUA 4X1QU 1DPOA 2ZZUH 4B76A 1A46H 2BDHA 1MKWK 1UVPA 1QTFA 2SGPE 3GDSA 5L30H 2L74A 1DY8A 5T6FA 3RXDA 1C2LA 1WQVH 2Q6DA 5KGOA 1PPHE 1T8LA 1VITF 1Y3YA 3S9BA 2ZF0H 1LQDB 3N7DA 4FUEA 1LVBA 5EXMA 3ZV9A 3LDXH 3S69A 2GX4A 3K6ZA 2BHGA 2BDBA 1BA8B 2R3UA 1LHCH 4I8KA 1HAHH 1P2QA 3MNSA 4X6PA 1OP0A 1C5WB 7ESTE 2WPHS 4Q7ZA 1YPMH 2KCOA 5A09A 2Z6BD 1FDPA 5HIYA 4B6EA 1WAYB 2FODA 2H5CA 2XWBI 2AFQB 1Q31A 2ESTE 1IQIA 2TGDA 5B6LA 5EQRA 3P6ZB 3SJKA 1V2UT 2TPIZ 2QV1A 1K1OA 4ZKSU 4ZHLU 3UB0A 1HAVB 1L1JA 4X0WU 1CA8B 1AWFH 3PLKA 2BY5X 4AYVB 1BQYA 3MH6A 4GAWA 2SGEE 5JBBS 3S7KB 1QHRB 3SV9A 1NFYA 1N1LA 1GJCB 1DY9A 1F5RA 1KLJH 2J5UA 3F0PA 3P8OA 1NBME 2AH4X 1F0SA 3GCHC 1O3KA 2ZHFH 3VGCB 1BMMH 4Y0ZE 4F48B 1HJ9A 4O3UA 1P57B 1WCZA 1NFWA 1IHSH 4BANB 2A7JA 2GDDA 2ZU3A 2XBXA 2ZHEH 1ZTKA 4TYDA 1K1PA 1GHBG 3E1XB 1C5LH 1UTNA 1DWBH 1D6WA 3DCLA 1MZAA 3F9EA 4H6SB 1QRWA 3VXEH 1AVGH 4RI0A 3KQ5A 1BRCE 3PB1E 3TJNA 5J4SA 2BD9A 4FUJA 2M5TA 5EOKA 2GDEH 1OPHB 1TOMH 1O3CA 1TPAE 4BTTB 1LKBA 2FI4E 2Z9GA 4IMQA 2PLXA 2A2XH 1C5PA 4YESB 3GY7A 4NWLA 2KFWA 4IGDA 3LU9B 1BBRH 4D7FA 2ZDMA 1TIOA 3ENSB 1V2JT 2QF0A 7LPRA 3V13A 1J9CH 1GVZA 2ZGHA 1QBVH 3A89A 1ZSKA 4ABAA 3TLOA 1O2WA 3B8JA 1H8ED 4OS2A 1GJ7B 1NRQH 3RXQA 2J97A 1ELDE 1GVLA 3H7OA 2XNDD 1ELEE 1NRPH 4JYUH 1A0HB 1GI7B 3UAIC 1NY22 4RKOB 4FOUC 1RS0A 2A5IA 3ZZ5A 2OC8A 2ZFPH 2BLWA 2GP9B 4FUBA 5CHAC 1P12E 1TGBA 3Q77A 4I7YH 2Z9LA 1O5FH 1DX5M 4KKDA 1SFQB 2ZFTA 3LGUA 1BDAA 3SJ9A 3OX7U 5C1UA 1XVMA 1ARBA 1GDNA 3MHWU 5C20A 3O8RA 3LJOA 4X8UH 4GLYA 2VWNA 1P2OA 4JK6A 1GBTA 1TNJA 1MKXH 1UK4A 2RCEA 4FXGH 1ZRBA 1ZR0A 5C94A 1AFQB 2PGBB 2QXGA 2G81E 1F2SE 1QB6A 5IK2D 4I8GA 2WV9A 3A85A 2KAIB 3RC5A 1AY6H 3Q76A 3SHCH 1V2RT 2OXSA 1WBGB 5IDKA 3RXBA 1LVYA 1G2MA 3PRDA 1P2IA 3ZZ7A 5G4BA 3DSGA 3RXTA 2J94A 3U9AH 1C2JA 4Z6AH 1V2QT 3MH5A 1BMFD 5K7RA 3ZZBA 3UNQA 2SGDE 2C90B 3BTKE 4INLA 3SUDA 8ESTE 2BZAA 2JJ1D 2QY0B 2A2QH 3GS9A 4ZXYH 2FOGA 4LOYH 1EX3A 1K28D 1Y3WA 1CA0C 1YGCH 4CH2B 2A31A 2O8TA 1CO7E 3QN7A 5L6NH 1A5GH 1S82A 4WH8A 3QZRA 5HKKD 3SU6A 2EI7A 1SL3A 1SLXB 1DUAA 2FESH 3MU4A 2ZKSA 3UWJH 2BDCA 1TAWA 3TVJB 5EW2H 1HCGA 1BCUH 4IS5A 3PO1C 1BRUP 1YP9A 2WPKS 5PTPA 1L1NA 1WUNH 4WMFA 1N6XA 4BTUB 1TPPA 3TITA 1HDTH 2AMQA 4R0IA 5F8TA 1V2VT 5EG4A 1F0RA 2EA3A 2ZTXA 5A0AE 2YMSD 1NRNH 4AB8A 1UCYK 3UTUH 3EQ0H 3U8OH 1ABIH 5AFYH 3SUEA 5J4QA 4AC9A 4KP0A 1ETSH 8GCHF 1T4UH 1O2MA 3E6PH 3I77A 1AZZA 1HAPH 1ELVA 2FX4A 4K60A 1NS3A 3SNAA 1EB1H 1MCVA 2PKSC 3I29A 4J2YB 2EEKA 2ZCLP 1GHXH 4Y71A 1TX6A 1E35B 1RIWC 4X6NA 4F55A 1CT2E 3FZZA 2ZPRA 3FFGA 3ZZAA 1NPMA 1NTPA 1XMNB 3K6YA 4NIVA 1QR3E 3BEFB 1Q2WA 3GOVB 4PROA 4FU9A 2OTVA 1QJ6B 1XXFA 2ZNKH 2ASUB 2QE7D 2KZ4A 1BB0B 4K1TA 5A8YA 4DGJA 3M3VA 4BAHB 1KXAA 1CQQA 3SV8A 3KYGA 2FTMA 4NSVA 3OAAD 2GV7A 1JWTA 1O33A 3PV5A 3BEIB 2BOHB 1ZPZA 1UTJA 3STIA 3MWIU 1Z6JH 3RMNH 2CF8H 1JXPA 4YOJA 4UFGH 1AKSB 1HGTH 3H09A 3M5NA 4Y7BA 1O38A 1ANBA 2GKVE 3UFAA 1SGPE 3E0NB 3AK5A 2YMSC 1AVWA 3NK8A 2ZTYA 1O2HA 1GJDB 2AMPA 1ZPBA 1O35A 2FOEA 1A0JA 1J15A 3MH7A 2HPPH 3BF6H 5FHTA 1TB6H 2OQ5A 3C27B 5FX5A 1RXPA 1ELGA 2XC4A 2C8WB 1H4WA 1L2EA 3NPSA 4SGBE 3KEEA 1H8DH 1H1BA 3ZZ8A 1AZ8A 2VIWA 3P8GA 2F83A 2YMSB 2I6SA 3RXSA 1CBWC 3ZZ4A 3SU1A 1AMHA 3W94A 2KCAA 2VIQA 4CBNA 1NC6A 1YCPH 4TPYA 4BTIB 4RSPA 1GL1A 4I86A 2VVVA 2WPIS 1C1SA 5EJZA 1NESE 1KDQB 1CT0E 4LZ1H 1LPGB 1P9SA 4ESTE 1YKTA 3A84A 2ZA5A 1TRNA 5EQQA 1E36B 3I78A 3TK6A 4DCDA 3ZVDA 1PPCE 1NRSH 4FVDA 2OD3B 5GNDA 1WSSH 1YWUA 1ZTJA 3T2NA 1OS8A 2ZDAH 4ZKOU 3ODDA 1SG8B 2GCHF 4B1TA 3SGBE 1HFDA 3MU0A 1SHHB 1NFUA 4DIHH 1OHHD 1GMDG 1J14A 2C93B 4J1YA 4A6LA 2EI8A 1WXRA 1LHGH 3FKSD 1TRMA 4ACAA 1G3EA 2FEQH 3M61U 1KXCA 1IQFA 1F92A 1TNGA 2TGPZ 2XCFA 3KCGH 5T6GA 3TJUA 3ZVBA 1TNLA 4TY7A 2ZWLH 1ANCA 3A81A 1GBEA 3SGQE 2K1QA 1GHYH 3ELAH 3UOUA 5LPRA 1Y5AT 4OS4A 1BTZA 4AB9A 1O34A 2LNCA 4DT7B 5DP4A 3F2HA 5EXNA 4P00A 2P8OB 3GYLB 1TQ7B 1GI0A 1TABE 1L4DA 1W11U 4IMZA 5TJXA 3RXAA 2W7SA 5AF9H 4B75A 2F9OA 1NBMD 1YPLH 1IQLA 3SUGA 4WH6A 3GISB 2FOAA 4NA8A 3KGPA 4OS6A 5F8ZA 2G4TA 4BAOB 2HVXA 4ZHAA 4FUFA 1GBIA 1NRRH 3C1KA 3SGAE 2G00A 1KMHB 3FP6E 5DPAA 3MOCA 4UONA 3G01A 1VZQH 1QB9A 3JZ1B 5I25A 1KXFA 1UHBA 3NCLA 1V2LT 1OP8A 2BVRH 1GBKA 1B0FA 1DDJA 3V0XA 1SVPA 2D2DA 2KM0A 1GBBA 2OCVB 1BMAA 5EW1H 1QFKH 1KXEA 3B23B 2GCTB 1C5VA 3TJVA 1MD7A 1FN8A 2ZQ2A 1K1NA 1S0QA 2ZIQH 2W6JD 1K1LA 1K22H 2VVCA 3OEHD 4ABHA 1WOFA 4NA7A 5JBCS 2ZU2A 1TNIA 2KR7A 4K5ZA 3DD2H 1YM0A 1YPJH 2K8IA 4WY3A 1GCTC 1D6RA 3BEUA 1VITG 2R9PA 3PWBA 4D7GA 1FQ3A 1LPZB 1FIZA 1GBHA 1P0SH 1C5XB 1TPOA 1C1UH 1KTSB 1SLVB 1GJ6A 5E0HA 3M3SA 4U2WA 2FO9A 2EI6A 3MU5A 1P9UA 4K8BA 5EJLA 1TPSA 1K1MA 2AGIX 5AVDA 3Q3XA 4UD9H 4Z0KA 4B2BA 3RC6A 1O2IA 3A7TA 3GY8A 1OP2A 3EA7A 3RDZA 2FS8A 5A8ZA 1SGFG 2CMYA 4X8SH 3SU2A 3ZVAA 1JRSA 4I8JA 5HIZA 1GCDA 1KLIH 1QA7A 2BY8X 2XXLA 2XW9A 4CRDA 1EZUC 4BAKB 1QIXB 1GI4A 1C5YB 2TGTA 1L1GA 1D3PB 2FP7B 4Y79A 5DJ7A 1YYY1 1BMNH 1H9IE 1W7GH 3T29A 4A1VA 3M37A 1P3EA 3F9GA 3SN8A 4HFPB 1EZSC 3RMLH 2CXVA 2ZHDA 1P09A 3STJA 4ZHMU 3UR9A 2H1UA 1O3EA 4FUDA 4XD7D 3NKKA 3OU0A 5TCCA 3A7XA 2AGGX 4Y11E 6CHAC 5JBAS 4K3JA 3F1SB 1G3DA 1SLUB 1QZ8A 1NZQH 1VITH 2Y5FA 2ZP0H 4A92A 1C5NH 1MABB 3SU3A 4UE7H 5T3HA 1EB2A 4AGKA 1XM1A 3OTPA 3ATWA 2DUCA 1GHZA 2WYJA 5FPTA 2XNIA 4XSKU 4CHAB 5T6DA 3CENA 1ZLRA 3R3GB 1E0FD 5CE1A 4CBOA 1O2XA 4NZLA 3N99A 3NWUA 4JK5A 3M5OA 1DLEA 4ZCNA 2PSXA 2G55A 1C2EA 1IQNA 2Z9JA 2YNBA 3OE7D 1A1RA 3Q00A 3ITIA 2HPQH 5E0GA 5B6OA 2Z3DA 2J92A 2VBCA 2ZGJA 1FLEE 3BSQA 1W0ZU 1CSOE 2ZTZA 2EC9H 3MO6A 3PTNA 4MNVA 4AFQA 2HALA 2HNTE 1NU7B 2ZGCA 4NFFA 2W6ID 3RU4E 2FLBH 4ISNA 5A0CA 2NU3E 1C1NA 3L33A 1C4Y2 3RXOA 2QIQA 4A1XA 4I31A 4IN2A 1SGNE 3RXVA 3RXPA 1QRXA 1YLNA 3ATLA 4HGCA 4Z1MD 2QXHA 4OS1A 3TIUA 2BB4A 1SMFE 3N7EA 2VIDA 1PQ7A 2JH0D 3K9XB 5CHBA 1SC8U 1CGJE 2WUCA 2R0KA 1BTUA 2DE8A 1C5TA 2HRVA 2UWLA 4D9RA 1VR1H 4ZXXH 4GUXA 3O8DA 1JOUB 4VGCB 1BITA 1V2WT 2UUYA 1MKWH
chains in the Genus database with same CATH topology
4E05H 4E7RG 5JDUB 4AFSA 2FTLE 4LZ4B 4RN6A 3U8RH 1HB0B 2Z94A 2GGVB 3S9CA 3GY6A 5EXLA 1G9IE 2RA0A 1ESTA 3SBKA 1U6QA 1W13U 1O32A 1HAYB 3O8BA 5C1YA 5DK1A 4D76A 3CS7A 5FCRA 2ODYB 1PFXC 1GHAF 4IC5A 1EPTA 4IN1A 3VGCC 1ANEA 3KQDA 2PHBA 1WTGH 2STBE 3MNXA 1BJVA 1X7AC 1QA0A 4M7GA 1O37A 3PMJA 2Z9IA 1FIWA 3OSYA 3QGJA 2VGCB 4IW4E 1XUKA 3SUFA 2H2ZA 4BAQB 2B9LA 5LPEA 1UTLM 1E37B 3SW2B 3LPRA 1ANDA 1ZTLA 2VH0A 5BPEA 4JCNA 1C2GA 2Z9KA 1UK3A 2R2WU 2P3TB 1YLCA 1FY3A 1C1RA 1VCWA 3A8DA 2ZCKP 1SB1H 1SGTA 2HWLB 2B7DH 2XBVA 5TCAA 3RXGA 2V6NA 1AU8A 1SSXA 2A5KA 1YPHE 4FUGA 4A5TS 1A2CH 4CH8B 1TX8A 4AOQA 3LIWA 1FMGA 2ALVA 5H4IB 3E3TA 3PYHA 2W3KA 3QZQA 3VFEA 2GT8A 2BX3A 4YTAA 5GCHF 5GPIB 1QBNA 2FMJA 1N6YA 1TBRH 1P03A 2XBWA 1OXGA 4BXWA 2D1JA 2ZDVH 1ELTA 3VB6A 1VGCB 4MVNA 1C4V2 4MTBA 3KN2A 9ESTA 1C1QA 5JPMH 3SJ8A 1V2PT 1S0RA 3SV7A 2HGTH 1BOQA 3FVFB 2Y80A 3TGKE 1A0LA 1AFQC 1DM4B 2LPRA 4XBDA 1A4WH 3F9HA 2GZ7A 5C67A 6ESTA 4I8HA 1DOJA 4X1NU 5FBIA 1FN6A 1DSUA 3RXKA 1BT7A 1FJSA 1C2MA 2TBSA 2ZECA 4YLQH 3ZV8A 2G4UA 3KQBA 1AUJA 1KSNA 2R0LA 1SGFA 2O9QA 1HV7A 2G5VA 1XKBC 2W5EA 2BY6X 1CU1A 1W10U 1C2IA 1W7XH 4QT8C 1C5QA 1HNEE 1H9LB 1K1IA 2PKAB 4U30A 1VJ9U 3UQVA 2F3CE 1O2JA 1QL9A 5DP5A 1MAYA 2NU2E 3VEQB 4Y0YE 1C9TA 4GCHF 1MBQA 3PLBA 4B71A 1MAXA 1THSH 1EZQA 2ILNA 3LGIA 5F03A 3VB7A 1KXBA 1CHOG 2FPZA 3U69H 1C1OA 2OC0A 3JZ2B 4KTSA 5FXLA 4WXVA 1C1MA 1N8OB 2VINA 4KTUA 2HOBA 2FOHA 4AG1A 3V3MA 2ZHWH 3IWMA 2IN2A 2F9VA 3S0NA 1O2VA 1ZMLA 2W3IA 1GI5A 4BXSA 2PWXA 4K8YA 5DKMA 1UVSH 1CT4E 1O2YA 2H9TH 1GMHG 2ODQA 1T7CA 1BHXB 1L0ZA 2BXTH 5HM2A 3Q3KA 5K0HA 4XBBA 2ZU1A 2A7HA 4Q2KA 2BTCE 1C5SA 3A7WA 1EATA 1D3TB 2UWOA 1WYKA 2CHAB 4TY6A 1UHBB 3PM3A 2BD4A 1HIAB 2ZEBA 2H9EH 1UMAH 1UTMA 3EE0B 2A4OA 1DICA 3RC4A 7GCHG 4D9QA 3GY2A 4ASHA 1GHBF 1UCYH 2FOMB 1K1JA 4NGAH 3RP2A 4DOQA 1RTFB 1O0DH 4ABJA 2BDYA 2BLQA 3CP7A 4KELA 3T25A 1O3FA 2BY7X 3HKJB 4F49A 1OOKB 1ZJDA 1V2KT 4BNRA 1ZYOA 1J8AA 1P11E 1O5GH 4MPVA 3BTEE 1S6FA 4Y76A 3M5MA 5GIBA 2Q1JA 5E2OA 1ZHRA 3HKIB 1GI2A 4ISOA 2ZO3H 2AGEX 5LPFA 2P3UB 3HPTB 3KQEA 2GMTB 1AE8H 2J34A 1O2TA 1BBRE 4B73A 2BQ7B 4ZROA 2ZPSA 1P01A 2ANMH 1SI5H 4AZ2B 4DY7B 1CHGA 3SU5A 3RXJA 2FYQA 2W7UA 1PYTD 4U32A 3TH2H 1CVWH 1MTUA 1T8OA 3E91A 1A5HA 5ESBA 3NZIA 3P92A 1XUIA 5EODA 2RG3A 4MNXA 1MD8A 1J16A 1BHXF 1P10A 2B0FA 2F9BH 3URDA 2V35A 1EAXA 3RU4D 1EZXC 1INCA 2AEIH 4AORA 3EGKH 1LDTT 4CRCA 3ZVGA 1E38B 1O3HA 1V2ST 4I32A 3TK5A 4JZIA 4HZHA 1P8VC 2J95A 1NROH 4O97A 2THFB 3MMGA 2QXJA 1Z7KA 2H5DA 1O3MA 3P8FA 3DHKH 2C3SA 3UPEA 3TNSA 1TBZH 2AYWA 1EASA 3AVZA 5BRRE 4HI3A 5JBTA 1S83A 1XXDA 2AMDA 4NG9H 4NIYA 4CR5A 1HAOH 1PPZA 3LT3A 1BRAA 2FWWA 1HAGE 3VB5A 2ANYA 3P95A 1GBAA 1GBJA 1MQ6A 1Y8TA 1ZGVA 4FUHA 4RKJB 2J4IA 1LO6A 1H9HE 2JH6D 4NIXA 4YLUA 1O3IA 1LKAA 2PTNA 1TOCB 2ANWA 2P8OC 4MPUA 3AASA 2BD8A 3MTYA 1TE0A 2A5AA 1P2KA 1Z8RA 1TBQH 1LMWB 5F8XA 3LC3A 2C8YB 2YOLA 5A0BA 1C4U2 1GJAB 2HNTC 1O5CB 1B7XB 4WF8A 5E2PA 2XBYA 4AFZA 1SHYA 1K21H 1M9UA 1C1PA 2P3FH 1GJ8B 2BLOA 1P2NA 2ZQ1A 3ZVFA 2IJOB 1ETTH 5L2YH 1A7SA 4X8VH 1IAUA 1UJ1A 2BD5A 3VPKA 2Z7FE 3MI4A 3ZYEA 3DFLA 3QTVH 2FS9A 4XOJA 2XWAA 2ULLA 4YOIA 1S85A 1NM6A 5HYOA 2GCTC 1FZZA 1ZHPA 1PPGE 6LPRA 1DLKB 3MU1A 2H6MA 2GZ9A 1MH0A 2BDIA 1OWIA 1Y3VA 1PPEE 3A80A 5FCKA 5JB8S 3RXLA 3ZZCA 1KTTB 1O3BA 1Z1IA 5DG6A 2A4QA 3F68H 1MQ5A 2A0QB 1GBCA 1EKBB 1ZJKA 2ZU5A 1D3DB 2Y7XA 4JZDH 4O03A 4AX9H 1S5SA 2OINA 2BD7A 3U1IB 1AB9B 2PTCE 3GCTF 1C9PA 4GHTA 3GICB 3LGYA 2G5NA 1QL8A 1YPKH 1EPTB 3RLYH 2VVUA 1TMBH 3KHVA 3T5FH 3QGNB 2C4FH 3P70B 1OX1A 4YT6H 2PFEA 4NSYA 1J17T 2RA3A 4FU7A 5ESTE 2JETB 3BIUH 1GI9B 1HJAB 1O2LA 3QWCH 4X2WA 1TMTH 4OS7A 1GDQA 4XFQA 1Y59T 1ZMJA 4KTCA 4MG3A 1EAWA 4IBLH 2SNVA 1O2SA 3ZVCA 3E90B 2VIPA 4TPIZ 1EAIA 3ZZ6A 1HAZB 3ZVEA 1W0YH 1A3EH 2FOBA 1ACBE 1LHDH 2ZCHP 4Y8ZA 2CF9H 3M35A 5JB9S 1GHAG 2HNTF 3W95A 2FI5E 4ZKNU 2C8ZB 5I46H 2QC2A 3SNEA 1FNIA 1G3BA 1YPHC 4E7NA 1UVOA 3BG4B 1GI8B 2FM2A 2ZGXH 5EGMA 1DS2E 4UFDH 2UWPA 1DUEA 1ELCA 2OP9A 3TH3H 1OWEA 1YPGH 3NUMA 4YM9A 1SGEE 1MTSA 1FPCH 1JMOH 3M36A 3P8NA 3IG6B 1TX7A 4CHAC 3VB3A 4AG2A 3A86A 2SFAA 3LH3A 1GJ9B 4ABEA 1W3CA 1A5IA 1UTQA 2ALPA 3UQOA 4B2AA 1RRKA 1AE5A 5FBEA 4Q7XA 1OKXA 4IC6A 2BYAX 1V6DA 1D4PB 3OTJE 5C2ZA 1HJ8A 3HGPA 1XUHA 1ZOMA 2ZDKA 4FU8A 7KMEH 3VB4A 1FONA 1FY5A 1O39A 1GBDA 1C2KA 4ABIA 1T31A 5C1XA 1VCQA 2A45B 4MNWA 1TGSZ 2ZG0H 3LH1A 1V2MT 3SU0A 2VJ1A 3QK1A 1KDQA 4ABFA 1MTNB 1O3PB 1GG6B 3LOXA 5GCHG 3GCNA 2Y81A 1QJ1B 1BTHH 2BVSH 3DT0H 3TNTA 2OBOA 2BZ6H 4X1PU 2SGQE 4A7IB 2IPHA 1NO9H 5E8EH 1EP5A 4VGCC 2AIPA 3A88A 3KL6A 4XDEA 2SGAA 2B5TB 1HAXB 1QNJA 1SPJA 1BJUA 1B5GH 2V0BA 5A8XA 1O31A 3L6PA 3R0FA 4Y8YA 2G52A 3M7QA 2P94A 1YLDA 2A7CA 2Z3CA 1G32B 4MNYA 3EYDA 4CRGA 4FUCA 1CE5A 1GHWH 2NU0E 2XRCA 3ATMA 4ISHH 3SORA 1RJXB 1UO6A 3WY8A 1IQEA 1C5UA 4THNH 2WPJS 5CMXH 3A83A 5GJ4B 2OUAA 5EQSA 1RTLA 2SNWA 1JBUH 2OC1A 3BV9B 2BMGB 2TIOA 3RXUA 2UUFB 2FX6A 3MYWA 1A3BH 1AWHB 2GT7A 1QURH 2VGCC 1F7ZA 4K69A 2O8WA 4Y8XA 1T32A 4JYTA 3H7TA 1GPZA 3FP8E 3ATKA 3M7UA 5AHGH 1SQTA 1QB1A 1O2ZA 2QN5T 4Q7YA 1OYTH 5FPYA 1Y5BT 5EPYA 4NIWA 4CR9A 5DGJA 2WV4A 2PV9B 1BMLA 2VIVA 4GCHG 1ETRH 2A32A 3E8LA 1G3CA 1W14U 4H6TA 1EXFA 2XYAA 4X6OA 1NN6A 1SFIA 3SI4H 4DW2U 3BTFE 3SZNA 2VNTA 4LXBH 1O2PA 2V3OH 2W26A 2BD3A 1AGJA 1XUGA 4CRBA 3A8BA 4NWKA 4OS5A 2GVFA 3RM2H 1OWKA 1SR5C 3RMMH 1BIOA 2ZU4A 2OQUA 3BTQE 4TWWA 2GZ8A 5HMAA 1O5EH 2BX4A 2V3HH 1ID5H 3GY4A 1PPBH 1TGTA 1C1WH 1IOEA 4YO9A 3MH4A 1XUFA 4MLFB 4X1SU 1O5AB 2XCNA 2C8XB 4H4FA 2P93A 4X2VA 4AFUA 1O5BB 1WTHD 2F9UA 4SGAE 1VGCC 1YPEH 5LH8A 1G36A 2FIRH 1K9OE 1QBOA 1TRYA 3BN9A 1SOZA 2D26C 1AQ7A 2CGAA 1VJAU 4FUIA 5FPSA 6GCHF 1TQ0B 1EJNA 2ZDNA 4X2YA 4Y7AA 3RU4T 1GI1A 2NU1E 2Y6TA 8GCHG 1G30B 3QLPH 4K1SA 4B2CA 2ZDLA 2BLVA 1UTPA 1EOJA 3PV4A 4X2XA 2VWOA 4UFEH 4A1TA 1THRH 1EQ9A 1LPKB 2J38A 2B8OH 4Y6DA 2FOFA 2OC7A 3GCHB 3BG8A 1RGQA 2P16A 1BBRK 2Q6GA 4X8TH 1Y3XA 3DFJA 1OWHA 3MO3A 3PLPA 1UTKA 1GMCF 1FY4A 2O8MA 3M3TA 1BTYA 3UIRA 3UREA 4JYVH 2A4GA 2SGFE 1SQAA 3TJOA 4JMYA 1DXWA 3MU8A 1F0TA 5ETXA 1DWCH 1XX9A 1O3NA 2BM2A 5AFZH 1EAUA 2ZGBH 3EAJA 2IOTA 1C2FA 2F9PA 2Y5HA 1CGHA 1IQHA 3M5LA 4JZEH 3SQEE 3MNBA 1OWDA 1O2QA 1RTKA 3FP7E 1LHFH 3LJJA 1ELBA 2WPLS 1ZHMA 1DANH 1BTXA 1HBTH 2GTBA 3GYMA 3A7ZA 1AHTH 1MKXK 1MZDA 2QYIA 1H8IH 5DO4H 3MNCA 1DT2A 2TRMA 1TONA 1AFEH 3A8CA 1N8OC 2NWNA 4DG4A 1FUJA 2FXRA 1WQSA 1BRBE 3OY6U 2UUKB 4FVBA 1ZZZA 3K2UA 1GL0E 4WXIA 1TALA 4WMEA 1YF4A 2BXUH 1O3DA 1EUFA 4ISLA 1AO5A 5CHAB 3UOPA 4ZKRU 1BTPA 3URCA 3GY3A 1QGFA 1XUJA 1S84A 3SNDA 3TPIZ 3QO6A 2J9NA 1TGNA 3IITA 3P17H 1FI8A 2VWMA 1DSTA 3SV2H 4UFFH 2CHAC 3KQCA 1C2HA 1JRTA 1O2KA 1QY6A 4O3TA 1W8BH 1MTVA 3MFJA 3QUMP 4ZAEA 1ELFA 1UVUH 1NT1A 3EDXB 5IYTA 2GCHG 2OLGA 3L3TA 3RXEA 3V7TA 3SV6A 1GJBB 1PPFE 2ZFSA 1S6HA 3CS0A 5F6MA 1JIMA 3AAUA 3O8CA 1PQAA 3LKWA 2ZPQA 2CJIA 1P06A 1VCPA 5DP3A 3QTOH 1ZSJA 1GWAA 2P59A 4NCYA 2AIQA 2BDAA 3PMAB 5GWZA 3FZDA 2VU8E 1ARCA 2PGQB 1CA0B 2ZHQH 1F5LA 4GSOA 1ELAA 1HAIH 1MBMA 2FOCA 2ODPA 2WV5A 2STAE 1HUTH 1SGQE 1TYNA 2GMTC 3TGIE 3ZYDA 2JH5D 1DITH 1LCYA 3LGTA 1UTOA 1UK2A 3LGVA 3PMHB 1G2LA 1HAVA 4E06H 4YOGA 3HGNA 2F91A 3PWCA 2G8TA 2VIOA 1QRZA 2PUQH 2FYRA 3PO1B 1E34B 1Y5UT 5DP8A 3UUZA 1FPHH 4I33A 1HYLA 2GD4B 1O3OA 5DP7A 1W12U 3SU4A 2ZFQH 3RLWH 1ABJH 4YZUA 1P05A 2QXIA 1V2OT 1QQUA 1GJ5H 1YC0A 2ZI2H 1HXEH 1AVXA 4XE4A 1QL7A 2Z3EA 1SQOA 2A4RA 3RXIA 1RD3B 2AS9A 2CV3A 3TH4H 3GCTG 1ZMNA 3A87A 3GDVA 2BVXH 2PKSB 1AIXH 1NFXA 5C3NA 5DP6A 1RIWB 1KXDA 4ABDA 2A1DB 2BD2A 2VB0A 3ZZ3A 4DVAU 3HK3B 1Z6EA 4NA9H 3N7OA 4MDSA 2AERH 1MCTA 3RM0H 2HLCA 3BIVH 1SOTA 3M7TA 4X6MA 2GV6A 3EA8A 1KIGH 1Z8GA 3RXRA 3S7HB 1Y3UA 1UVTH 4CRAA 2FZZA 3D49H 3DA9B 1EJMA 3ZZ9A 4ZMAH 1KLTA 2QAAA 1SGCA 3BTTE 3F6UH 3PTBA 4Y10E 1AI8H 4JZ1A 5FAHA 2QA9E 3OY5U 1AUTC 1P2MA 1QCPA 1YCPK 1MU6B 2JKHA 4INKA 8KME2 3T62A 3BTME 4UDWH 4CRFA 3A7YA 1O3JA 4YT7H 1ESBA 1MU8B 2G51A 1O3AA 3SQHE 1PQ8A 2BY9X 2FLRH 5HM9A 1FXYA 2UUJB 1TWXB