1O3FA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3fA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3fA02
2A32A 1MTUA 3SV8A 2VWMA 2AGGX 3M5OA 4Q7ZA 1IQKA 5SGAE 3QLPH 1OYTH 2ZU2A 2AEIH 3RXSA 1J15A 2ZHFH 3A7YA 1CGJE 3LJOA 1UTQA 3BEUA 5BPEA 2Z9KA 5LGOA 2G52A 1ARCA 2SGEE 1SGFA 2WV5A 5K0HA 3RU4E 1C1OA 1GBTA 1DLKB 4ABEA 1O2UA 4FUFA 1AKSB 1GVZA 1MZDA 3SU0A 4A1VA 1EPTA 2ESTE 1LPKB 1YPMH 4YESB 1BITA 1O2RA 3KF2A 1P2OA 3M61U 1FLEE 2DE9A 1CT4E 4NGAH 1CU1A 3PMHB 1F0UA 1O3JA 5DGJA 1FUJA 3VPKA 2LPRA 2OC7A 1D3PB 1GI8B 4X6MA 1TNKA 2BDCA 2XWAA 4DJZB 2CF9H 4IMQA 1DSTA 3E0NB 5C1UA 1JIRA 2PUQH 5F8ZA 2ZQ2A 1ID5H 3OU0A 1V2QT 1MKXH 4MNWA 2UWLA 1ZTLA 1Z8RA 2FS9A 2A4GA 3GY7A 4DT7B 1BJUA 5J4SA 1UTOA 3RXGA 3A7ZA 3RXKA 1C9PA 4Y7BA 5CE1A 3DA9B 4KELA 4BAKB 1F0RA 3A7TA 3E91A 1UHBA 4IGDA 1KDQA 4ABAA 1MQ5A 2Y82A 2BD5A 1S6HA 6GCHG 2B7DH 4XSKU 3ZZ3A 2GKVE 2BY9X 3GY3A 4MDSA 5A8YA 1GDNA 1QRZA 1O3CA 4K1SA 2FS8A 3VB3A 1ZSJA 1BRUP 3AW0A 1C5MD 5GCHG 5F8TA 5EOKA 1MTNC 4XFQA 1EZQA 1GVLA 5T6FA 3D62A 4WH8A 3ZYEA 1FXYA 2QY0B 1DSUA 2ZGCA 3NK8A 4FU8A 3SNCA 1SGCA 1EPTC 1S84A 1GJBB 1A3BH 2OCVB 2STBE 3UR6A 1ZSKA 1NRPH 4X2XA 1TPPA 1O2YA 1ETSH 3PMJA 2WPMS 3VFEA 3A85A 1TBRH 5GXPA 2EC9H 2XBWA 1BTHH 1UVUH 4YLUA 1EZSC 3TK5A 1GMHG 4OS2A 4THNH 3UWJH 1DPOA 3QO6A 1DXWA 1H8IH 3RXAA 5A8XA 1FPHH 1LVOA 4K60A 3KGPA 1PJPA 1QCPA 4X8VH 4ZHMU 1F5RA 4Q7YA 4H6TA 1ABIH 1MTNB 2ZHQH 1XMNB 2FMJA 3F9GA 3EA8A 4FVBA 4NSVA 1J16A 4I7YH 1KXEA 4JZFH 1EPTB 4UONA 1LO6A 8GCHF 2O8LA 1XXDA 1RGQA 1UTLM 1WBGB 1NY22 1BOQA 1C5UA 2Y7XA 1Z1IA 4GLYA 4QT8C 4XBDA 3HK3B 2BY6X 1A0HB 1C1PA 1GI2A 4MNVA 2AMQA 3T27A 2ZHWH 1AHTH 1VITG 1GJ5H 1P3CA 3SORA 1HAHH 1L0ZA 1OP2A 4WMEA 3DFJA 1O35A 4CRCA 2BD7A 2STAE 1N6YA 2ZDVH 3LJJA 1ELVA 3IG6B 4KTSA 1GL1A 2GT8A 1AVGH 1Z6JH 1Y59T 2F9VA 1BTUA 3MH6A 5AHGH 1OYQA 1ETRH 4Y6DA 4HI3A 2ZU1A 1ELEE 1Y5AT 2FI4E 3H7TA 3RXVA 4ZKOU 1ANEA 3MO9A 1BBRE 1KDQB 3ZVFA 1HAGE 2VB0A 2D26C 5DP4A 3Q76A 1ETTH 4MVNA 2F9UA 3MTYA 5IYTA 3P6ZB 2XC4A 2FX6A 1P10A 4XDEA 4CR9A 4D76A 1QR3E 4RKJB 1YCPH 2VGCC 2ZZUH 1BTWA 4TY6A 4ZAEA 4K8YA 1V2OT 4WMDA 1IOEA 2Y7ZA 3EYDA 2OINA 2W5EA 4LZ4B 4LOYH 1ZHPA 2VNTA 4X2YA 1V2KT 2R2MB 1Z7KA 3D65E 3T2NA 1V3XA 4B74A 3RXMA 3O8CA 2QIQA 1P04A 1O3BA 5AF9H 2H9EH 2R3UA 5CHAC 2AYWA 4AX9H 2BVXH 4YLQH 4INKA 2ZWLH 1D6WA 1Y3YA 2FTMA 1GBFA 1NU7B 2VIDA 5BRRE 4YT6H 1Z71A 2ODPA 4ZXXH 2D2DA 4UDWH 2RCEA 1W7GH 1TABE 1LHFH 2BX3A 5JPMH 1O39A 1GMDF 3O8BA 2HPPH 1HRTH 1T8OA 2NU4E 1O2SA 2XC0A 3V7TA 3ZZ6A 2VGCB 1O5CB 3STIA 1TNGA 3RXDA 1NZQH 6ESTA 2ALVA 2NU1E 3P8GA 3Q3YA 2BD2A 1GHBG 1KXFA 2VH6A 1HAZB 2H9HA 1G30B 3UR9A 2PTNA 1IQMA 1HYLA 4X1PU 1K1OA 1Z8GA 2A2QH 3M5MA 3FP8E 4F49A 1PPFE 1F0TA 1UTMA 2QAAA 4O9VA 5CHAB 1XUHA 1O5GH 2WINI 1T7CA 1TGCA 1OWKA 1OWDA 1H4WA 4E7RG 3BTME 1UTNA 2G00A 3MNXA 1NM6A 1ZHMA 2XBXA 3ZVCA 3U69H 2BD9A 1JBUH 2P3UB 2WPKS 4I33A 1ZYOA 2CN0H 4A7IB 1JRSA 4I8LA 2XWBI 5A0CA 3SJIA 1FZZA 3V3MA 3E8LA 1GVKB 4ABDA 1A46H 3I29A 4AYVB 3ZVGA 4Y10E 4B71A 4I31A 1LQEA 4GCHF 1TGSZ 3ZZCA 1PPBH 1DUEA 1V2JT 1UCYH 1AI8H 2W3IA 1V2NT 4MQAA 1JIMA 1GMCF 5F8XA 2GCTC 2Z7FE 1RS0A 2A5IA 5EW1H 1O2MA 4IC5A 4IW4E 2XC5A 2GZ7A 5LPEA 1DICA 3BEIB 2VIVA 3RC4A 2F9BH 2TRMA 3PM3A 1ESBA 2Z94A 2C8WB 2BDHA 1YPHC 2W7SA 3K6ZA 2H5DA 4Y7AA 2J92A 2B0FA 3IWMA 3PMBB 4Y8ZA 1YLDA 1ANCA 3SJ8A 3RXOA 5L2ZH 2BLQA 1SGYE 3KIDU 4JZEH 1MAXA 4INLA 4ZMAH 1OP8A 4GVUA 2KAIB 3GY6A 5FAHA 1GBIA 2ZTXA 1AD8H 1G37A 3GYMA 1V6DA 2TGDA 3H7OA 3S0NA 4FU9A 2PR3A 1TOMH 2W26A 3TJOA 1O2OA 3VGCC 1EB2A 1ELDE 5E8EH 2BDYA 2WPJS 5FPTA 1QJ6B 1ZJDA 2K1QA 1QURH 4AG2A 2GCTB 4UFEH 1YPHE 2H5CA 4DIIH 1D3QB 2G51A 3URCA 1C5RA 3PMAB 2FP7B 2VWOA 3P70B 3QWCH 4JZDH 1EAWA 1DOJA 2XW9A 1UVPA 3BTHE 4NIYA 1P2IA 5T6GA 3SW2B 1DWBH 2BD3A 1AWFH 3ZVBA 2BB4A 2NU3E 4BAHB 2BOHB 1O2IA 2QXGA 3P95A 1O3GA 3KQDA 4NFEA 1DWEH 1ZMNA 3C1KA 3LKWA 1MKWH 3L3TA 5A09A 4R0IA 1UMAH 2P16A 4OS1A 3QUMP 4AB8A 2RG3A 3AVZA 2P94A 3NUMA 1ZSLA 4YOJA 3A7VA 5JB9S 5FBEA 3ENSB 6CHAC 2Z9LA 1GHVH 4Y8YA 5DG6A 3ZZ5A 3URDA 3Q77A 3VGCB 3K9XB 5C1YA 3VB5A 3NZIA 4BXSA 1O38A 1GI3A 1TGTA 2RDLA 3MU0A 3GY8A 3SNAA 1XVOA 3K6YA 2I6QA 2WPIS 1G3CA 1BTZA 1YPEH 2UWOA 1C2KA 1GDUA 2WUBA 4B75A 5AVDA 1L1GA 1TNLA 3ATKA 3M7QA 1UVTH 1TQ7B 4ABFA 1YKTA 1AO5A 4X2VA 3ZZ4A 3GYLB 1W10U 1O2JA 1AB9C 4CRBA 2GP9B 3UPEA 3VEQB 1ELCA 4AFZA 2A45B 1W14U 3UTUH 3D49H 3VXEH 1ELFA 3A8BA 5JDUB 1SQTA 1PPCE 3GCTF 1KIGH 2H6MA 1G32B 3LDXH 1O2ZA 1GCTC 2BMGB 2A5KA 1FY3A 4UE7H 4BAMB 1W12U 4X1SU 2EI8A 3ZV9A 3BTDE 6CHAB 4J2YB 4DCDA 1FONA 3A83A 1LHCH 3EDXB 1JMOH 3A8CA 4JK5A 2ZEBA 5ESTE 4ABHA 4WJG2 4CR5A 4X6OA 1GBBA 1FAKH 2FOAA 1QJ7B 3A7XA 2IPHA 2G81E 2RA0A 2J9NA 2FEQH 3CS7A 3SQHE 1LCYA 3UREA 2QCYA 1G3DA 4ISIH 8ESTE 1YYY1 3SGQE 1ELTA 4HFPB 2FOHA 1MCVA 2P93A 1AB9B 3B8JA 3M36A 1C2MA 2F3CE 5FX6A 5DP6A 1PFXC 2ZU3A 1AZ8A 1MU6B 1LKAA 2IOTA 2PGBB 5EQSA 2WUCA 5H4IB 9LPRA 1EJMA 1GCTB 2ZGBH 1SLUB 2LNCA 4OS4A 5EW2H 2BX4A 3TGJE 2ZIQH 1LVBA 2ANWA 1NESE 2J95A 1LHEH 2GDDA 2Z9GA 2GT7A 3SU3A 1UK3A 3SNBA 2XCNA 3I78A 1NN6A 4ZXYH 1ELAA 1AUTC 1HFDA 1XM1A 1PPZA 5GPIB 3ZVEA 5EU8A 1EAIA 1KXCA 3UQVA 2SGDE 1KYNA 1AFEH 3MU5A 3A87A 2ZDKA 2A4QA 4UFGH 1ESTA 3JZ2B 2NU2E 4NIVA 1O5DH 3P8OA 5FPSA 1THRH 1TPOA 1MAYA 1MTWA 1Q3XA 1QA7A 1ZZZA 2GCHF 3NPSA 3OY5U 3RP2A 3UFAA 1Y3XA 1RJXB 3UNSA 4KP0A 2ZGHA 4ABIA 2QA9E 1ZPCA 2O8WA 1GBCA 2BYAX 4LXBH 3TK9A 2BQ7B 1IQLA 4NFFA 2VJ1A 4ZUHA 1J17T 4OS5A 2A7JA 5LPRA 1W11U 2BY7X 1P3EA 7KMEH 3SJKA 1BRBE 1H1BA 4FUCA 4WVPE 3PV4A 1AUJA 4B1TA 1CQQA 1EQ9A 1UCYE 3OTJE 4JZIA 2JKHA 3RXPA 4U2WA 1OSSA 1SG8B 5J4QA 2VVUA 3RXRA 1PPEE 2OTVA 2PUXB 4D7FA 5HYOA 1O2KA 1A5HA 2HRVA 2QN5T 4AGJA 1P05A 1CT0E 1EJAA 1O34A 1AN1E 4BAQB 4YM9A 1SGRE 1H9LB 1UTKA 5G4BA 2PSXA 1C4Y2 1TGBA 1HNEE 3SOSA 1ZPBA 1UK4A 3OYPA 2UUKB 2PFEA 1ABJH 2FOEA 1F5KU 3GY5A 3TPIZ 1THSH 1DX5M 4WXIA 4K8BA 1TX8A 4A1XA 1GDQA 4AOQA 1DLEA 1V2TT 4Y11E 2Z3CA 3ATMA 2D8WA 1BUIA 3TNSA 1SI5H 1GJ8B 3O8RA 1O36A 2GTBA 3VB7A 3R0FA 4CRGA 1O2LA 3RXJA 1HAYB 3RMMH 2XXLA 1L1JA 5FPYA 1C5QA 4X1RU 1FJSA 4I8KA 3TGKE 1C5XB 1K1MA 1F92A 1C5VA 3PYHA 1ESAA 1MD8A 3E16B 5E0JA 1O5FH 2AGEX 1GHZA 2TPIZ 1O2WA 1IHSH 1QRWA 3MH5A 5JB8S 2FWWA 1MQ6A 4B2AA 1EAUA 1DITH 1YPJH 2ZFSA 2C8ZB 5C5NA 1P03A 3RXLA 5GIBA 3GICB 1O2XA 3A8DA 1XVMA 3SHAH 1DUAA 3S9CA 2OBOA 1HB0B 1TIOA 2Q6DA 2ZGJA 4WF8A 4TWWA 4E05H 4GHTA 2A7HA 1Z8IB 2HNTF 1KLJH 1TNHA 3T28A 2BLOA 1A5IA 1TRYA 3NWUA 2HVXA 1C2IA 3KCGH 1YC0A 4O03A 3QN7A 1B0EA 3SUEA 1GWAA 1ZRKA 1HAOH 1PYTC 1N8OC 2ZCLP 1GHWH 1TLDA 1VJ9U 1G3EA 1O3EA 1VITF 3ZVDA 2QF3A 1TOCB 1ZMLA 2QXHA 2V0BA 1A2CH 1NU9A 1W7XH 3M3SA 4AYYB 2QGRA 3A86A 3MNBA 3TLOA 1TMUH 5DP8A 1P2KA 1C5WB 1QFKH 1V2UT 4TYDA 4MPUA 1P09A 3QDZB 1OP0A 1OKXA 1DT2A 2P3TB 2PV9B 1RTLA 2GX4A 4ISOA 1QB6A 2J2UA 1GBAA 1E34B 1AGJA 3KQEA 7GCHG 3TVJB 1PQ7A 2QXIA 1LHDH 1P06A 2UWPA 1V2MT 1N8OB 2FX4A 1E0FD 1VCWA 5CMXH 2FO9A 1K21H 2BD8A 1E38B 3H5CB 1ELGA 1TBZH 5EG4A 1X7AC 1QHRB 2AH4X 1TA2A 4X8TH 3KQCA 3RXCA 2Z9IA 1MCTA 8GCHG 1ZTKA 1GBDA 3ODDA 1QY6A 3P92A 1WTGH 3F9FA 3LH3A 1XUFA 1HXEH 1C5SA 2XNIA 2WYJA 3A8AA 1UTJA 1UTPA 2AIPA 2HPQH 3F6UH 4CH8B 1AZZA 2GV7A 1EP6A 3OSYA 1RIWC 4D7GA 4UFDH 3GOVB 4I8GA 3F9HA 5F6MA 2UUJB 3F9EA 4K69A 1GJ7B 2ANKH 5T6DA 1SGTA 2SGPE 1MD7A 1G9IE 1O2HA 2Z6BD 3JZ1B 1BZXE 1Y3UA 1G3BA 4ZKSU 5C20A 2BDAA 1QNJA 1S81A 2ULLA 1KTSB 1S82A 1VR1H 3M3VA 2KAIA 5PTPA 3MHWU 3SV2H 3MFJA 1SLVB 1SGFG 3F68H 1DWDH 5HM9A 4JYTA 2OLGA 2FYQA 2CV3A 2NWNA 1E35B 5FBIA 4BNRA 3M35A 3MMGA 2XCFA 3BF6H 2CXVA 5L6NH 1GBJA 4WH6A 4FXGH 4NZQA 1AMHA 4RN6A 2HOBA 1MBQA 1TB6H 3ZVAA 4B76A 1P9SA 1T8NA 1C4V2 1C2FA 2A5AA 3U98H 1BMAA 1RIWB 1MTSA 1QB1A 5HGGA 1IQEA 2O8MA 3TNTA 2XRCA 1CT2E 1QB9A 1GI1A 2A4OA 4K2YA 1W3CA 1D9IA 1HBTH 2ZNKH 1G2MA 4TWYA 1OXGA 6LPRA 4ZKRU 1GL0E 2XBVA 3RXIA 2A7CA 1ORFA 7ESTE 1HAXB 3K2UA 2C93B 3S9BA 2VINA 3SUGA 3QGJA 4OS7A 1P12E 2R0KA 5DPAA 3EA9A 3BG4C 1O3PB 1C5LH 1O3DA 3Q3XA 1V2LT 4WWYA 1EB1H 4MLFB 1O30A 4FUBA 1GMDG 1TPAE 4X6NA 4DGJA 1ZRBA 2FODA 2ILNA 1S0QA 2AFQB 1SGPE 4MPVA 4CREA 5F03A 3BTQE 3RMNH 1HDTH 5IDKA 3FP6E 2VWNA 1C1UH 5FHTA 5JBCS 3LC3A 4YO9A 2Z3DA 2ASUB 4BTTB 5DJ7A 3DFLA 1ZGIA 3LH1A 3LGVA 5L2YH 4YZUA 5A0BA 2ZECA 3P8NA 1CHOF 1K28D 2R9PA 4BTUB 4CRDA 3TU7H 1NPMA 2FESH 3AW1A 3ZZDA 3AAUA 1EZUC 1G36A 1GHAG 1CA8B 3LGIA 4FUJA 2HALA 1BB0B 1BTXA 2GDEH 1FNIA 2HWLB 1UCYK 2V3HH 1TA6A 3TH4H 1O2PA 2CMYA 1EZXC 1XUGA 4UEHH 1BRAA 1PQ5A 1ZHRA 2BDIA 5A2MH 3T29A 1L2EA 1WAYB 1T31A 3BG4B 1C5PA 4XE4A 4YTAA 3RU4D 4DG4A 1GJ6A 1SGIB 3LONA 2CF8H 1GI5A 3SU2A 1ZJKA 4HZHA 1TNJA 1A0JA 4NA9H 4RSPA 4XBBA 2VIOA 2PTCE 2FZZA 3TIUA 3PB1E 1GJAB 2BLWA 3EE0B 1O3LA 4FUGA 1SHHB 1FPCH 4CH2B 1ANDA 3WY8A 1B7XB 3PTBA 3SJ9A 4O97A 1QQ4A 1VITH 5GWZA 2OQ5A 1O3HA 4Y0YE 1NS3A 1RTKA 3FVFB 4CRFA 2C8XB 2F91A 1HGTH 1C1NA 4I32A 4B2BA 5FXLA 3UIRA 4O3TA 3VXFH 1P2JA 2FOGA 2SGAA 4Q80A 1O3AA 1WQSA 4J1YA 1C1RA 2B8OH 3QZQA 2C8YB 1HAVA 1T8LA 2A2XH 2ALPA 1HPGA 2J34A 4Y71A 3BN9A 5JYIA 1TGNA 4R8TB 3EQ0H 1D4PB 1AU8A 1C9TA 3TH3H 1WQVH 2PGQB 1BMNH 1P02A 5ETXA 5FX5A 1DY9A 1KXAA 1TNIA 2HGTH 5TJXA 3U9AH 2VVVA 1KSNA 5C1XA 1FY8E 2OP9A 5A8ZA 1F7ZA 1OWIA 3SI3H 1IQGA 1N6XA 1FN6A 5EODA 1GI4A 3DUXH 2BHGA 3BTTE 1TX7A 4U01A 1BA8B 4AGKA 1FN8A 1GGDC 2FDAA 1P01A 4GSOA 4MNXA 3SZNA 1AE8H 4A1TA 3RXBA 2WV4A 1FAXA 4K3JA 2ZO3H 1D6RA 3M5LA 2ZFFH 4ZH8A 1VCPA 1P9UA 3G01A 5JBTA 2O8TA 4U30A 3M5NA 1FV9A 3FZZA 1ZPZA 3TH2H 5LPFA 2D1JA 4FVDA 1PQ8A 1G2LA 1QL9A 3E6PH 2ZP0H 3BTGE 5EGMA 1F0SA 1HJ9A 1Y8TA 1TALA 4I8JA 1F2SE 1YPLH 4AFSA 3RXEA 3RDZA 2SGFE 4D9QA 3GY2A 1OS8A 5I25A 3R3GB 2AMPA 3TJUA 4JCNA 1MMJN 1O0DH 3T25A 5DP7A 2IJOB 4E06H 1F5LA 4ESTE 3SU1A 2ZFPH 1GBEA 1GGDB 1OX1A 4YT7H 2J4IA 2H9TH 3QK1A 2BXTH 3SBKA 3GCHC 4X1NU 4FUEA 1IAUA 1FMGA 1BRCE 1EP5A 4NIWA 1ARBA 3EA7A 2ODQA 3MYWA 1TE0A 3RXFA 5A0AE 2GV6A 4NCYA 1BHXB 1K1LA 5DP9A 2RA3A 1TFXA 2QC2A 1QGFA 1DXPA 3ZZ9A 1C2LA 3KNXA 1O5BB 2BDBA 3MH4A 4K1TA 4A5TS 1TYNA 1SLWB 5E2PA 4ISLA 4I8HA 1TMBH 1SOTA 4NG9H 1BBRK 3EAJA 4SGBE 1CHGA 1E36B 1GJDB 1MTVA 3CENA 2JH0D 2AS9A 1TONA 2ZHDA 1YGCH 5C2ZA 3LGYA 1HAVB 4INHA 5TCAA 4AB9A 4MNYA 3NKKA 5DK1A 2ZDMA 3M7TA 1ACBE 1JOUB 2BVSH 2P59A 1FIZA 3SGAE 2EI7A 3UY9A 2VWLA 2OC0A 3ELAH 1EOJA 1OPHB 1L4DA 3GCHB 1AWHB 1SBWA 1SL3A 4NA8A 1GBKA 1UVSH 3PLBA 2P3FH 4IN2A 2BXUH 2ZCKP 4ABBA 1JWTA 3BV9B 2BOKA 4B2CA 3ZZAA 1BHXF 3HPTB 3BTEE 1Q2WA 1QBNA 2FOBA 1A61H 5FCKA 2XTTB 3RXTA 1EATA 1IQIA 5EPNA 2GMTC 1C2DA 3SU5A 1TBQH 4JMYA 1H9IE 3W94A 1EASA 2HNTC 2BLVA 1J8AA 1GPZA 1TMTH 3U8OH 3KQBA 1C2HA 1W8BH 1ZGVA 4H6SB 1LTOA 3LGUA 1O31A 2H1UA 2JH6D 1ZR0A 4HGCA 1XUIA 5HXFA 2VIWA 4UD9H 1BCUH 4X0WU 5HMAA 3S9AA 3A80A 1Y5UT 2BQWB 1A7SA 2PLXA 1BIOA 3SU6A 2A1DB 4FUIA 1C5TA 1W0YH 1QQUA 1AIXH 1GHYH 1P57B 3SJOA 2GCHG 2AGIX 1RFNA 4BAOB 2CJIA 1C2GA 2ZFRH 2P95A 3SI4H 2PKSC 1S6FA 2JETC 1V2WT 1FI8A 3MNSA 1HXFH 2HNTE 6GCHF 1PPHE 5EQQA 3U8TH 3MH7A 3N7OA 3RC5A 1NFXA 3V12A 1AQ7A 1NRSH 1W0ZU 1VCQA 2GMTB 5GCHF 4ABJA 1E37B 2ODYB 1VZQH 2V6NA 1FQ3A 2ZA5A 1VGCC 5C3NA 1FY4A 3UNQA 1WV7H 1MKXK 2IN2A 2TIOA 3BTFE 3DD2H 4TPYA 2FLBH 5TCCA 4PROA 2SGQE 3RMLH 3SHCH 4Y0ZE 1ZTJA 1A1RA 1ANBA 1BDAA 3VB6A 4X2WA 3RLWH 3MU8A 2Y6TA 2ZU5A 4CBOA 2J38A 1GMHF 1C1MA 2FI3E 4KKDA 3UNRA 2PKSB 2EA3A 2JETB 1K1JA 1J9CH 1BMMH 1CGHA 1MZAA 3HATH 1FIWA 4H42U 4ISNA 3DHKH 4DVAU 2GVFA 1M9UA 2GZ9A 4HTCH 1K2I1 4K5ZA 3UOPA 5GDSH 2ZCHP 4XBCA 1NO9H 4BTIB 1THPB 1O2VA 4GHQA 2FYRA 3NXPA 4BANB 1VGCB 1HLTH 1CO7E 1JXPA 2FOMB 3MU4A 4D9RA 1S83A 3QTVH 3V0XA 3ATIA 3RXHA 2I6SA 1QJ1B 2BVRH 3HKIB 2F9OA 1Z8JB 1C1WH 4X8SH 3TJVA 1OOKB 3PLKA 4ASHA 1QL7A 1XKAC 2QXJA 2WPLS 1O2TA 5EXMA 2BY5X 2SNWA 1QL8A 3LGWA 1SB1H 1HV7A 1JRTA 2ANYA 3PO1C 3ATLA 1DY8A 3A81A 2VIQA 1QIXB 7GCHF 2W3KA 1GBHA 1RRKA 1ZMJA 3A89A 4MG3A 1DFPA 1WUNH 4O3UA 2GGVB 2BY8X 2O8UA 5DP5A 4CBNA 1C5OH 1CA0C 3HGNA 2BD4A 2ZDAH 1W2KH 3BIVH 3O8DA 1KTTB 1O3IA 5L30H 1GI0A 1RD3B 4RKOB 2TBSA 1FY1A 4MPXA 4Q7XA 4TPIZ 5I46H 3ZZBA 5DP3A 2OXSA 4WMFA 2DUCA 1SC8U 4CRAA 1YM0A 3RC6A 1WCZA 5AFYH 1NC6A 1SFIA 1MH0A 1CE5A 1PQAA 2VU8E 3MU1A 2UUYA 1UO6A 1HJAC 3RXQA 2Y81A 4LK4A 4WXVA 3PLPA 1WOFA 2NU0E 2OQUA 3B23B 1RTFB 1NROH 2QV1A 1DDJA 5EXNA 1SLXB 1INCA 4Z6AH 1LHGH 1Q31A 3PO1B 3A7WA 3C27B 3AAVA 2V3OH 3SUFA 2ZDNA 3ZV8A 1GI7B 2FTLE 1QA0A 4A92A 2QYIA 3A82A 1O3NA 4AFQA 1CGIE 1K9OE 1O37A 1A0LA 1SQAA 3ZZ8A 1QTFA 3UWIA 2Z3EA 1CA0B 3TK6A 3OX7U 4SGAE 5C67A 4MPWA 1IQHA 1A5GH 1P2QA 4B73A 1LKBA 4Y8XA 2ZKSA 1UHBB 2Q6GA 5ABWA 4JZ1A 1C1QA 3EGKH 3CP7A 3LC5A 1HAPH 2OUAA 1SPJA 3BTKE 5C5OA 3E3TA 2ZF0H 2VH0A 1YCPK 1Y5BT 2BTCE 2ZDLA 3K65B 1C2EA 2PHBA 1LVMA 1WU1A 2HLCA 2ZG0H 2FIRH 1A4WH 1WSSH 1HJAB 2ZHEH 3B9FH 4ISHH 3P8FA 3T26A 5LH8A 3RUOA 1ZOMA 2CHAC 1NFYA 3PTNA 2ZQ1A 3DT0H 1EKBB 1KY9A 1GHBF 2J94A 3AASA 1C2JA 1LMWB 4NZLA 1KXDA 2DE8A 1GI9B 2FI5E 4BOHA 4ZHLU 1AVXA 1GI6A 4F4OC 3Q3KA 3SV6A 4NWLA 2G5NA 1O3MA 2R3YA 4X6PA 4A6LA 3BEFB 5E0GA 5JBBS 2SNVA 1L1NA 4AZ2B 4IBLH 1W13U 4U32A 4KTUA 1K1NA 2A31A 4M7GA 4ZHAA 3HKJB 2G4UA 2F83A 1EOLA 3GCOA 3M7UA 1C5NH 3SU4A 3TJNA 3MO3A 1L4ZA 1LQDB 4KGAA 1UK2A 1A3EH 4JYVH 1FDPA 3CS0A 3GDSA 2CHAB 3D23A 1SR5C 1NRRH 4AG1A 4GAWA 3Q00A 2TGAA 1WTHD 4OGXA 3ODFA 1V2PT 5DO4H 3STJA 3S7HB 2Y80A 1WYKA 3VB4A 3FANA 2OD3B 4DW2U 4K1EA 1GHAF 2Y5HA 3T62A 1XKBC 1DWCH 2Q6FA 2ZPRA 2UUFB 4AORA 1V2RT 1YCPM 4OS6A 1GJ4H 1HUTH 1LPGB 3W95A 1T32A 1SGEE 3UUZA 2WYGA 2R2WU 2BM2A 2C3SA 1SOZA 3M3TA 5B6OA 4ZKNU 7LPRA 3BG8A 9ESTA 4Z0KA 5T3HA 2PWXA 1DANH 3S69A 1EX3A 5AFZH 3E1XB 1O2NA 3SNEA 1SGNE 3T5FH 3M37A 1O3KA 1LDTT 2EI6A 1C5ZB 2AMDA 2VIPA 4OGYA 2F9PA 2FPZA 4WY3A 1T4UH 3QX5H 1ELBA 3KN2A 2PKAA 1P11E 1IQNA 4KTCA 4H4FA 3SO3A 4BXWA 5DKMA 4Y76A 1GG6C 1HJ8A 3BTWE 1D3DB 3I77A 1RXPA 2G55A 1S85A 1GHXH 1ZLRA 4GCHG 1CHOG 1J14A 3MNCA 4FU7A 2EEKA 3LPRA 1YLCA 3S7KB 1GMCG 3LIWA 2A0QB 3KHVA 4DIHH 2P8OC 1TQ0B 2XYAA 1SHYA 1CVWH 2XBYA 1O3FA 2AIQA 3E0PB 2SFAA 2YNBA 3RM2H 1LVYA 3KL6A 1SFQB 2PSYA 1H9HE 3LU9B 2FM2A 3FP7E 4JYUH 2THFB 2FOFA 1V2VT 2BDGA 1NFWA 1YP9A 4ABGA 1XXFA 4D8NA 2B5TB 3A88A 1K1IA 4VGCC 1O2QA 2Y5GA 1SSXA 1U6QA 2F9NA 1O32A 2M5TA 2PW8H 3TITA 2OBQA 4AFUA 4TY7A 1MUEB 4CHAC 1OWHA 3HK6B 3GDUA 3GCNA 1GG6B 3U1JB 3PWCA 1CSOE 3RU4T 4NA7A 3SV9A 5E0HA 1BJVA 3U1IB 1MKWK 4YOIA 1S0RA 1OWEA 4IS5A 2OC8A 3ITIA 3SN8A 1YPKH 2G4TA 3SNDA 4GUXA 3P17H 1O2GH 2FLRH 2G8TA 1P8VC 1TRMA 2P8OB 1NTPA 3ESTA 5K7RA 1DVAH 1NT1A 1PPGE 1BMLA 1SMFE 1HIAA 2ZTYA 3PROA 1HCGA 1Z6EA 3UOUA 2OC1A 1GJCB 4GPGA 3RM0H 2Z9JA 3NCLA 3QGNB 3L33A 1C1SA 2BZ6H 1SVPA 4FUDA 5ESBA 3SQEE 1B5GH 1YF4A 3HGPA 1TX6A 1GBLA 1S5SA 1T4VH 3LOXA 4VGCB 2TGPZ 3U8RH 3ZYDA 5EXLA 3QTOH 1NRQH 1TPSA 1AE5A 3BSQA 3A84A 1QBOA 1NRNH 4CHAB 3UQOA 2B9LA 1KXBA 1AFQC 1GJ9B 2JH5D 1BQYA 1P2NA 3RXUA 4E7NA 4JK6A 4DY7B 1BT7A 4MTBA 4NWKA 2WPHS 4IC6A 2ZU4A 1AKSA 2ZFTA 1NFUA 2BQ6B 2G5VA 1KLIH 1LPZB 2PKAB 3GY4A 3E90B 1BTYA 1D3TB 8LPRA 1FY5A 1P0SH 1QBVH 1MU8B 1EJNA 4IN1A 5EPYA 2TGTA 3QZRA 2V35A 1IQFA 1T8MA 1O3OA 4UFFH 1PYTD 2ZFQH 3LGTA 4XOJA 3LT3A 2AERH 2Y5FA 1DE7H 1HAIH 1C4U2 3V13A 4DURA 1GBMA 3ZZ7A 1XUKA 3MWIU 1B0FA 4LZ1H 2QF0A 1AY6H 1IHTH 1SGQE 1H8DH 1Z1JA 1EXFA 3GCTG 1IQJA 2FOCA 5GJ4B 1K1PA 3FAOA 5JBAS 1V2ST 4Y79A 2VVCA 1KLTA 1Y3VA 1AFQB 2ZI2H 3F1SB 1QRXA 2ZPQA 4IMZA 1BBRH 1CBWC 3FZDA 1P2MA 2W7UA 1OWJA 1C1VH 3IITA 2GD4B 4FUHA 1N1LA 3FFGA 4X8UH 1MBMA 3PWBA 4YOGA 3MO6A 2O9QA 8KME2 1O5AB 3OY6U 2BZAA 1TRNA 1GCDA 4NSYA 1O33A 2FXRA 2Q1JA 1Y3WA 1DS2E 1DM4B 4Q2KA 2GZ8A 1XUJA 1YBWA 3MOCA 1C5YB 3ATWA 1BTPA 5E2OA 1XX9A 3SGBE 1C1TA 4NIXA 3GISB 2YNAA 2ZTZA 5FCRA 2C90B 3MI4A 1SGDE 1AVWA 1UVOA 2H2ZA 2ZC9H 4DOQA 5HM2A 2CGAA 2R0LA 4ZROA 3SUDA 5EQRA 4AN7A 1VJAU 1HIAB 1TAWA 3KEEA 3TGIE 2A4RA 3SV7A 3L6PA 3RMOH 3BIUH 2ANMH 2ZGXH 2C4FH 1TWXB 1O5EH 3GDVA 2YOLA 1UJ1A 1CBWB 1EAXA 2ZPSA 1K22H 1EUFA 1SQOA 3RLYH 1YPGH 4X1QU
chains in the Genus database with same CATH superfamily
2A32A 1MTUA 3SV8A 3N99A 2VWMA 2AGGX 3M5OA 4Q7ZA 1IQKA 5SGAE 3QLPH 1OYTH 2ZU2A 2AEIH 3RXSA 1J15A 2ZHFH 3A7YA 1CGJE 2JIZD 3LJOA 1UTQA 3BEUA 5BPEA 2Z9KA 5LGOA 2G52A 1ARCA 2SGEE 1SGFA 2WV5A 5K0HA 3RU4E 1C1OA 1GBTA 1DLKB 4ABEA 5HIYA 1O2UA 4FUFA 1AKSB 1GVZA 1MZDA 3SU0A 4A1VA 1EPTA 2ESTE 1LPKB 1YPMH 4YESB 1BITA 1O2RA 4DT4A 3KF2A 1P2OA 3M61U 1FLEE 2DE9A 1CT4E 4NGAH 1CU1A 3PMHB 1F0UA 1O3JA 5DGJA 1FUJA 3VPKA 2LPRA 2OC7A 1D3PB 1GI8B 4X6MA 1TNKA 2BDCA 2XWAA 4DJZB 2CF9H 4IMQA 1DSTA 3E0NB 5F53A 5C1UA 1JIRA 2PUQH 5F8ZA 2ZQ2A 1ID5H 3OU0A 1V2QT 1MKXH 4MNWA 2UWLA 1ZTLA 1Z8RA 2FS9A 2A4GA 3GY7A 4DT7B 5C94A 1BJUA 5J4SA 1UTOA 3RXGA 3A7ZA 3RXKA 1C9PA 4Y7BA 5CE1A 3DA9B 4KELA 4BAKB 1F0RA 3A7TA 3E91A 1UHBA 4IGDA 1KDQA 4ABAA 1MQ5A 2Y82A 2BD5A 1S6HA 6GCHG 2B7DH 3H09A 4XSKU 3ZZ3A 2GKVE 2BY9X 3GY3A 4MDSA 5A8YA 1GDNA 1QRZA 1O3CA 4K1SA 2FS8A 3VB3A 1ZSJA 1BRUP 3AW0A 1C5MD 5GCHG 5F8TA 5EOKA 1MTNC 2RFKC 4XFQA 1EZQA 1GVLA 5T6FA 3D62A 4WH8A 3ZYEA 1FXYA 2QY0B 1DSUA 2ZGCA 3NK8A 4FU8A 3SNCA 1SGCA 1EPTC 1S84A 1GJBB 1A3BH 2OCVB 2STBE 3UR6A 1ZSKA 1NRPH 4X2XA 1TPPA 1O2YA 1ETSH 3PMJA 2WPMS 3VFEA 3A85A 1TBRH 5GXPA 2EC9H 2XBWA 1BTHH 1UVUH 4YLUA 1EZSC 3TK5A 1GMHG 4OS2A 1W0JD 4THNH 3UWJH 1DPOA 3QO6A 1DXWA 1H8IH 3RXAA 5A8XA 1FPHH 1LVOA 4K60A 3KGPA 1PJPA 1QCPA 4X8VH 4ZHMU 1F5RA 4Q7YA 4H6TA 1ABIH 1MTNB 2ZHQH 1XMNB 2FMJA 3F9GA 3EA8A 1E79D 4FVBA 4NSVA 1J16A 4I7YH 1KXEA 4JZFH 1EPTB 2HVYB 4UONA 1LO6A 8GCHF 2O8LA 1XXDA 1RGQA 1UTLM 1WBGB 1NY22 1BOQA 1C5UA 2Y7XA 1Z1IA 4GLYA 4QT8C 1BMFD 4XBDA 3HK3B 2BY6X 1A0HB 1C1PA 1GI2A 4MNVA 2AMQA 3T27A 2ZHWH 1AHTH 1VITG 1GJ5H 1P3CA 3SORA 1HAHH 1L0ZA 1OP2A 4WMEA 3DFJA 1O35A 2W6ID 4CRCA 2BD7A 5FL7D 2STAE 1N6YA 3EE7A 2ZDVH 3LJJA 1ELVA 3IG6B 4KTSA 1GL1A 2GT8A 1AVGH 1Z6JH 1E1QD 1Y59T 2F9VA 1BTUA 3MH6A 5AHGH 1OYQA 1ETRH 4Y6DA 4HI3A 2ZU1A 1ELEE 2IPQX 1Y5AT 2QF5A 2FI4E 3H7TA 3RXVA 4ZKOU 1ANEA 3MO9A 1BBRE 1KDQB 3ZVFA 1HAGE 2VB0A 3FO8D 2D26C 5DP4A 3Q76A 1ETTH 4MVNA 2F9UA 3MTYA 5IYTA 3P6ZB 2XC4A 2FX6A 1P10A 4XDEA 4CR9A 4D76A 1QR3E 4RKJB 1YCPH 2VGCC 2ZZUH 1BTWA 4TY6A 4ZAEA 2EQNA 4K8YA 1V2OT 4WMDA 1IOEA 2Y7ZA 3EYDA 2OINA 2W5EA 4LZ4B 4LOYH 1ZHPA 2VNTA 5DN6D 4X2YA 1V2KT 2R2MB 1Z7KA 3D65E 3T2NA 1V3XA 4B74A 3RXMA 3O8CA 2QIQA 1P04A 1O3BA 5AF9H 2H9EH 2R3UA 5CHAC 2AYWA 4AX9H 2BVXH 4YLQH 4INKA 2ZWLH 1D6WA 1Y3YA 2FTMA 1GBFA 1NU7B 2VIDA 5BRRE 4YT6H 1Z71A 2ODPA 4ZXXH 2D2DA 4UDWH 2RCEA 1W7GH 1TABE 1LHFH 2BX3A 5JPMH 1O39A 1GMDF 3O8BA 2HPPH 1HRTH 1T8OA 2NU4E 1O2SA 2XC0A 3V7TA 3ZZ6A 2VGCB 1O5CB 3STIA 1TNGA 3RXDA 1NZQH 6ESTA 2ALVA 2NU1E 3P8GA 3Q3YA 2BD2A 1GHBG 1KXFA 2VH6A 1HAZB 2H9HA 3VG8A 1G30B 3UR9A 2PTNA 1IQMA 1HYLA 4X1PU 1K1OA 1Z8GA 2A2QH 3M5MA 3FP8E 4F49A 1PPFE 1F0TA 1UTMA 2QAAA 4O9VA 5CHAB 1XUHA 5GNDA 1O5GH 2WINI 1T7CA 1TGCA 1OWKA 1OWDA 1H4WA 4E7RG 3BTME 2WZQA 1UTNA 2G00A 3MNXA 1NM6A 1ZHMA 2XBXA 3ZVCA 3U69H 2BD9A 1JBUH 2P3UB 3DCLA 2XOKD 2WPKS 4I33A 1ZYOA 2CN0H 4A7IB 1JRSA 4I8LA 2XWBI 5A0CA 3SJIA 1FZZA 3V3MA 3E8LA 1GVKB 4ABDA 1A46H 3I29A 4AYVB 3ZVGA 4Y10E 4B71A 4I31A 1LQEA 4GCHF 1TGSZ 3ZZCA 1PPBH 1DUEA 1V2JT 1UCYH 2VBCA 1AI8H 2W3IA 1V2NT 4MQAA 3F0OA 1JIMA 1GMCF 5F8XA 2GCTC 2Z7FE 1RS0A 2A5IA 5EW1H 1O2MA 4IC5A 4IW4E 2XC5A 2GZ7A 2V3MA 5LPEA 1DICA 3BEIB 2VIVA 3RC4A 2F9BH 2TRMA 3PM3A 5C0UA 1ESBA 2Z94A 2C8WB 2BDHA 1YPHC 2W7SA 3K6ZA 2H5DA 4Y7AA 2J92A 2B0FA 3IWMA 3PMBB 4Y8ZA 1YLDA 1ANCA 3SJ8A 3RXOA 5L2ZH 2BLQA 1SGYE 3KIDU 4JZEH 1MAXA 4INLA 4ZMAH 1OP8A 4GVUA 2KAIB 3GY6A 5FAHA 1GBIA 2ZTXA 1AD8H 1G37A 3GYMA 1V6DA 2TGDA 3H7OA 3S0NA 4FU9A 2PR3A 1TOMH 5T1VA 2W26A 3TJOA 4ACAA 1O2OA 3VGCC 1EB2A 1ELDE 5E8EH 2BDYA 2WPJS 4P00A 5FPTA 1QJ6B 1ZJDA 2K1QA 1QURH 4AG2A 2GCTB 4UFEH 1YPHE 2H5CA 4DIIH 1D3QB 2G51A 3URCA 1C5RA 3PMAB 2FP7B 2VWOA 3P70B 1YWUA 3QWCH 2GJGA 2RDEA 1EAWA 4JZDH 1DOJA 2XW9A 1UVPA 3BTHE 4NIYA 1P2IA 5T6GA 3SW2B 1DWBH 2BD3A 1AWFH 3ZVBA 2BB4A 2NU3E 4BAHB 2BOHB 3N7DA 1O2IA 2QXGA 3P95A 1O3GA 3DSPA 3KQDA 4NFEA 1DWEH 1ZMNA 3C1KA 3LKWA 1MKWH 3L3TA 5A09A 4R0IA 1UMAH 2P16A 4OS1A 3QUMP 4AB8A 2RG3A 3AVZA 2P94A 3NUMA 1ZSLA 4YOJA 3A7VA 5JB9S 5FBEA 3ENSB 6CHAC 2Z9LA 1GHVH 4Y8YA 5DG6A 3ZZ5A 3URDA 3Q77A 3VGCB 3K9XB 5C1YA 3VB5A 3NZIA 4BXSA 1O38A 1GI3A 1TGTA 2RDLA 3MU0A 3GY8A 3SNAA 1XVOA 3K6YA 1YY3A 2I6QA 5CHBA 2WPIS 1G3CA 1BTZA 1YPEH 2UWOA 1C2KA 1GDUA 2WUBA 1WXRA 4B75A 5AVDA 1L1GA 1TNLA 3ATKA 3M7QA 1UVTH 1TQ7B 4ABFA 1YKTA 1AO5A 4X2VA 3ZZ4A 3GYLB 1W10U 1O2JA 1AB9C 4CRBA 2GP9B 3UPEA 3VEQB 1ELCA 4AFZA 2A45B 1W14U 3FOAA 3D49H 3UTUH 3VXEH 1ELFA 3A8BA 2OK5A 5JDUB 1SQTA 2LELA 1PPCE 3GCTF 1KIGH 2H6MA 1G32B 3PRBA 3LDXH 1O2ZA 1GCTC 2BMGB 2A5KA 1FY3A 4UE7H 4BAMB 1W12U 4X1SU 2EI8A 3ZV9A 3BTDE 2F43B 6CHAB 3PV5A 4J2YB 4DCDA 1FONA 3A83A 1LHCH 3EDXB 1JMOH 3A8CA 3SYJA 4JK5A 2ZEBA 5ESTE 4ABHA 4WJG2 4CR5A 2WV9A 1GBBA 4X6OA 1FAKH 2FOAA 1QJ7B 2KFWA 3A7XA 2IPHA 2G81E 2L74A 2J9NA 2RA0A 2FEQH 4P02A 3CS7A 3SQHE 1LCYA 3UREA 2QCYA 1G3DA 4ISIH 8ESTE 1YYY1 3SGQE 1ELTA 4HFPB 2FOHA 1MCVA 2P93A 2V7QD 1AB9B 3B8JA 3M36A 1C2MA 2F3CE 5FX6A 5DP6A 1PFXC 2ZU3A 1AZ8A 1MU6B 1LKAA 2IOTA 2PGBB 5EQSA 2WUCA 5H4IB 9LPRA 1EJMA 1GCTB 2ZGBH 1SLUB 2LNCA 4OS4A 5EW2H 2BX4A 3TGJE 2ZIQH 1LVBA 2ANWA 1NESE 2J95A 1LHEH 2GDDA 2Z9GA 2GT7A 3SU3A 1UK3A 3SNBA 2XCNA 2KCPA 1NN6A 3I78A 4ZXYH 1ELAA 1AUTC 1HFDA 1XM1A 1PPZA 5GPIB 3ZVEA 5EU8A 1EAIA 1KXCA 3UQVA 2SGDE 1KYNA 2QE7D 1AFEH 3MU5A 3A87A 2ZDKA 2A4QA 4UFGH 1ESTA 3JZ2B 2NU2E 4NIVA 1O5DH 3P8OA 5FPSA 5C0TA 1THRH 1FX0B 1TPOA 1MAYA 2YMSD 1MTWA 1Q3XA 2XNDD 1QA7A 1ZZZA 2GCHF 3NPSA 2J97A 3F0PA 3OY5U 3RP2A 3UFAA 1Y3XA 1RJXB 3UNSA 4KP0A 2ZGHA 4ABIA 2QA9E 1ZPCA 2O8WA 1GBCA 2BYAX 4LXBH 3TK9A 2BQ7B 1IQLA 4NFFA 2VJ1A 4ZUHA 1J17T 4OS5A 2A7JA 5LPRA 1W11U 2BY7X 1P3EA 7KMEH 3SJKA 1BRBE 1H1BA 4FUCA 1NBMD 4WVPE 3PV4A 1AUJA 4B1TA 1CQQA 1EQ9A 1UCYE 3OTJE 3WWBA 4JZIA 2JKHA 3RXPA 4U2WA 1OSSA 1SG8B 5J4QA 2VVUA 3RXRA 3N7EA 1PPEE 2OTVA 2PUXB 4D7FA 5HYOA 1O2KA 2WPDD 1A5HA 2HRVA 2QN5T 4AGJA 1P05A 1CT0E 1EJAA 1O34A 1AN1E 4BAQB 4YM9A 4FETA 1SGRE 1H9LB 1UTKA 5G4BA 2PSXA 1C4Y2 1TGBA 2JJ2D 1HNEE 3SOSA 1ZPBA 1UK4A 3OYPA 2UUKB 2PFEA 1ABJH 5KGOA 5KECA 2FOEA 1F5KU 3GY5A 3TPIZ 1THSH 1DX5M 4WXIA 5IK2D 4K8BA 1TX8A 4A1XA 1GDQA 4AOQA 1DLEA 1V2TT 4Y11E 2Z3CA 3ATMA 2D8WA 1BUIA 1SQRA 1SI5H 3TNSA 1GJ8B 4Z1MD 3O8RA 1O36A 2GTBA 3VB7A 3R0FA 4CRGA 1O2LA 3RXJA 1HAYB 3RMMH 2XXLA 1L1JA 5FPYA 1C5QA 4X1RU 1FJSA 4I8KA 3TGKE 1C5XB 1K1MA 1F92A 5EJ1A 1C5VA 3PYHA 1ESAA 1MD8A 2L6OA 3E16B 3OEHD 5E0JA 1O5FH 2AGEX 1GHZA 2TPIZ 2KZ4A 1O2WA 1IHSH 1QRWA 3MH5A 5JB8S 2FWWA 1MQ6A 4B2AA 1EAUA 1DITH 1YPJH 2ZFSA 2C8ZB 5C5NA 1P03A 3RXLA 5GIBA 3GICB 1O2XA 3A8DA 1XVMA 3SHAH 1DUAA 3S9CA 2OBOA 1HB0B 1TIOA 2Q6DA 2ZGJA 4WF8A 4TWWA 4E05H 4GHTA 2K0QA 2A7HA 1Z8IB 2HNTF 1KLJH 1TNHA 3T28A 2BLOA 1A5IA 1TRYA 3NWUA 2HVXA 1C2IA 3KCGH 1YC0A 4O03A 5DSFA 3QN7A 1B0EA 2KX4A 1GWAA 3SUEA 1ZRKA 1HAOH 1PYTC 1N8OC 1E1RD 1GHWH 2ZCLP 1TLDA 1VJ9U 1G3EA 1O3EA 1VITF 3ZVDA 2QF3A 1TOCB 1ZMLA 2QXHA 2V0BA 3ZIAD 1A2CH 1NU9A 1W7XH 3M3SA 4RT0A 4AYYB 2QGRA 3A86A 3MNBA 3TLOA 1TMUH 5DP8A 1P2KA 1C5WB 1QFKH 1V2UT 4TYDA 4MPUA 1P09A 3QDZB 1OP0A 1OKXA 1DT2A 2P3TB 2PV9B 1RTLA 2GX4A 4ISOA 1QB6A 2J2UA 1GBAA 1E34B 1AGJA 3KQEA 7GCHG 3TVJB 1PQ7A 2QXIA 1LHDH 1P06A 2UWPA 1V2MT 1N8OB 2FX4A 1E0FD 4ASUD 4RT1A 1VCWA 5CMXH 2FO9A 1K21H 2BD8A 1E38B 3H5CB 1ELGA 1TBZH 1WDIA 5EG4A 1X7AC 1QHRB 2AH4X 1TA2A 4X8TH 3KQCA 3RXCA 2Z9IA 1MCTA 8GCHG 1ZTKA 1GBDA 3ODDA 1QY6A 3P92A 4RI0A 1H8ED 1WTGH 3F9FA 3LH3A 1XUFA 1HXEH 1C5SA 2XNIA 2WYJA 3A8AA 1UTJA 1UTPA 2AIPA 2HPQH 3F6UH 4CH8B 2K8IA 1AZZA 2GV7A 1EP6A 3OSYA 1RIWC 4D7GA 4Q63A 3GOVB 4UFDH 4I8GA 3F9HA 1H8HD 2UUJB 5F6MA 3F9EA 4K69A 1GJ7B 2ANKH 5T6DA 1SGTA 2SGPE 1MD7A 1G9IE 1O2HA 2Z6BD 3JZ1B 1BZXE 1Y3UA 1G3BA 4ZKSU 5C20A 2BDAA 1QNJA 1S81A 2ULLA 1KTSB 1S82A 1S6LA 1VR1H 3M3VA 2KAIA 5PTPA 3MHWU 3SV2H 3MFJA 1SLVB 1SGFG 3F68H 1DWDH 5HM9A 4JYTA 2OLGA 2FYQA 2CV3A 2NWNA 1E35B 5FBIA 4BNRA 3M35A 3MMGA 2XCFA 3BF6H 2CXVA 5L6NH 3MQKC 1GBJA 4WH6A 4FXGH 4NZQA 1AMHA 4RN6A 2HOBA 1MBQA 1TB6H 3ZVAA 4B76A 1P9SA 1T8NA 1C4V2 1C2FA 2A5AA 3U98H 1BMAA 1QZ8A 1MTSA 1QB1A 1RIWB 5HGGA 1IQEA 2O8MA 3TNTA 3OFND 2XRCA 1CT2E 1QB9A 1GI1A 2A4OA 4K2YA 4AC9A 1W3CA 4OM9A 1UW7A 1D9IA 1HBTH 2ZNKH 1G2MA 4TWYA 1OXGA 6LPRA 4ZKRU 1GL0E 2XBVA 3RXIA 2A7CA 1ORFA 7ESTE 1HAXB 3NRLA 3K2UA 2C93B 3S9BA 2VINA 3SUGA 3QGJA 4OS7A 1P12E 2R0KA 4Q4LA 3EA9A 5DPAA 3BG4C 1O3PB 4YXWD 1C5LH 1O3DA 3Q3XA 2J5UA 1V2LT 4WWYA 3U28C 1EB1H 4MLFB 5B6LA 1O30A 4FUBA 1GMDG 1TPAE 4X6NA 4DGJA 1ZRBA 2FODA 2ILNA 1S0QA 2AFQB 1SGPE 4MPVA 4CREA 5F03A 3BTQE 3GS9A 3RMNH 1HDTH 5IDKA 3FP6E 2VWNA 1C1UH 5FHTA 5JBCS 3LC3A 4YO9A 2Z3DA 2ASUB 4BTTB 5DJ7A 3DFLA 1ZGIA 3LH1A 3LGVA 5L2YH 4YZUA 5A0BA 2ZECA 3P8NA 1CHOF 1K28D 1EFRD 2R9PA 4BTUB 4CRDA 3TU7H 1NPMA 2FESH 4ACBA 3AW1A 3ZZDA 3AAUA 1EZUC 1G36A 1GHAG 1CA8B 3LGIA 4B6EA 4FUJA 2HALA 1BB0B 1BTXA 2GDEH 1FNIA 2HWLB 1UCYK 2V3HH 1TA6A 3TH4H 1O2PA 2CMYA 1EZXC 1XUGA 4UEHH 1W0KD 4F48B 1BRAA 1PQ5A 1ZHRA 2BDIA 5A2MH 3T29A 1L2EA 1WAYB 1T31A 3BG4B 1C5PA 4XE4A 4YTAA 3RU4D 4DG4A 1GJ6A 1SGIB 3LONA 2CF8H 1GI5A 3SU2A 1ZJKA 4HZHA 1TNJA 1A0JA 4NA9H 4RSPA 4XBBA 2VIOA 2PTCE 2FZZA 3TIUA 3PB1E 1MABB 5HIZA 1GJAB 2BLWA 3EE0B 1O3LA 4FUGA 1SHHB 1FPCH 4CH2B 1ANDA 3WY8A 1B7XB 3PTBA 3SJ9A 4O97A 1QQ4A 1VITH 5GWZA 2OQ5A 1O3HA 4Y0YE 1NS3A 1RTKA 3FVFB 4CRFA 2C8XB 2F91A 1HGTH 1C1NA 4I32A 4B2BA 5FXLA 3UIRA 4O3TA 1VKYA 3VXFH 1P2JA 2QF4A 3DSGA 2FOGA 2SGAA 4Q80A 1O3AA 2PP6A 1WQSA 4J1YA 1C1RA 3AK5A 2B8OH 3QZQA 2C8YB 1HAVA 1T8LA 2A2XH 2ALPA 3F2FA 1HPGA 2J34A 4Y71A 3BN9A 3SZEA 5JYIA 1TGNA 4R8TB 3EQ0H 3CNRA 1D4PB 1AU8A 1C9TA 3TH3H 1WQVH 2PGQB 1BMNH 1P02A 5ETXA 5FX5A 1DY9A 1KXAA 1TNIA 2HGTH 5TJXA 3U9AH 2VVVA 1KSNA 5C1XA 1FY8E 2OP9A 5A8ZA 1F7ZA 1OWIA 3SI3H 1IQGA 1N6XA 1FN6A 5EODA 1GI4A 3DUXH 2BHGA 3BTTE 1TX7A 4U01A 1BA8B 4AGKA 1FN8A 1GGDC 2FDAA 1P01A 4GSOA 4MNXA 3SZNA 1AE8H 4A1TA 3RXBA 2WV4A 1FAXA 4K3JA 2ZO3H 1D6RA 3M5LA 2ZFFH 4ZH8A 1VCPA 1P9UA 3G01A 5JBTA 2O8TA 4U30A 3M5NA 1FV9A 3FZZA 1ZPZA 3TH2H 5LPFA 2D1JA 4FVDA 1PQ8A 1G2LA 1QL9A 3E6PH 2ZP0H 3BTGE 5EGMA 1F0SA 1HJ9A 1Y8TA 1TALA 4I8JA 1F2SE 1YPLH 2JJ1D 4AFSA 3RXEA 2KR7A 3RDZA 2SGFE 4D9QA 3GY2A 1OS8A 5I25A 3R3GB 2AMPA 3TJUA 4JCNA 1MMJN 1O0DH 3T25A 5DP7A 2IJOB 4E06H 1F5LA 4ESTE 3FN8A 3SU1A 2ZFPH 1GBEA 1GGDB 1OX1A 4YT7H 2J4IA 2H9TH 3QK1A 2BXTH 3SBKA 3OEED 3GCHC 4X1NU 4FUEA 1IAUA 1FMGA 3WW7A 1BRCE 1EP5A 4NIWA 1ARBA 3EA7A 2ODQA 3MYWA 1TE0A 3RXFA 5A0AE 2GV6A 4NCYA 1BHXB 1K1LA 5DP9A 2RA3A 1TFXA 2QC2A 1QGFA 1DXPA 3ZZ9A 1C2LA 3KNXA 1O5BB 2BDBA 3MH4A 4K1TA 4A5TS 1TYNA 1SLWB 5E2PA 4ISLA 4I8HA 1TMBH 1SOTA 4NG9H 1BBRK 3EAJA 4SGBE 1CHGA 1E36B 1GJDB 1MTVA 3CENA 2JH0D 2AS9A 1TONA 2ZHDA 1YGCH 5C2ZA 3LGYA 1HAVB 4INHA 5TCAA 4AB9A 4MNYA 3NKKA 5DK1A 2ZDMA 3M7TA 1ACBE 1JOUB 2BVSH 2P59A 1FIZA 3SGAE 2EI7A 3UY9A 2VWLA 2OC0A 3ELAH 1EOJA 1OPHB 1L4DA 3GCHB 1AWHB 1SBWA 1SL3A 4NA8A 1GBKA 1UVSH 3PLBA 2P3FH 4IN2A 2BXUH 2ZCKP 4ABBA 4FOUC 1JWTA 3BV9B 2BOKA 4B2CA 3ZZAA 1BHXF 3HPTB 3BTEE 1Q2WA 1QBNA 2FOBA 1A61H 5FCKA 2XTTB 3RXTA 1EATA 1IQIA 5EPNA 2GMTC 1C2DA 3SU5A 1TBQH 4JMYA 1H9IE 3W94A 2W6JD 1EASA 2HNTC 2BLVA 1J8AA 1GPZA 1TMTH 3U8OH 3KQBA 1C2HA 1W8BH 1ZGVA 4H6SB 1LTOA 3LGUA 1O31A 2H1UA 2JH6D 1ZR0A 4HGCA 1XUIA 5HXFA 2VIWA 4UD9H 1BCUH 4X0WU 5HMAA 2CK3D 3PV2A 3S9AA 3A80A 1Y5UT 2BQWB 1A7SA 2PLXA 1BIOA 3SU6A 2A1DB 4FUIA 1C5TA 1W0YH 1QQUA 1AIXH 1GHYH 1P57B 3SJOA 2GCHG 2AGIX 1RFNA 4BAOB 2CJIA 1C2GA 2ZFRH 2P95A 3KYGA 3SI4H 2PKSC 1S6FA 2JETC 3KQ5A 1V2WT 1FI8A 3MNSA 1HXFH 2HNTE 6GCHF 1PPHE 5EQQA 3U8TH 3MH7A 3WWFA 3N7OA 3RC5A 1NFXA 3V12A 1AQ7A 1NRSH 1W0ZU 1VCQA 2GMTB 5GCHF 4ABJA 1E37B 2ODYB 1VZQH 2V6NA 5C17A 1FQ3A 2ZA5A 1VGCC 5C3NA 1FY4A 3UNQA 1WV7H 2AHME 1MKXK 2IN2A 2TIOA 3BTFE 3DD2H 4TPYA 2FLBH 5TCCA 4PROA 2SGQE 3RMLH 3SHCH 4Y0ZE 1ZTJA 1A1RA 1YLNA 1ANBA 1BDAA 3VB6A 3OTPA 4X2WA 3RLWH 3MU8A 2Y6TA 2ZU5A 4CBOA 2J38A 1GMHF 1C1MA 2FI3E 4KKDA 3UNRA 2PKSB 2EA3A 2JETB 1K1JA 1J9CH 1BMMH 1CGHA 1MZAA 3HATH 1FIWA 4H42U 4ISNA 3DHKH 4DVAU 2GVFA 1M9UA 5HKKD 2GZ9A 4HTCH 1K2I1 4K5ZA 3UOPA 5GDSH 2ZCHP 4XBCA 1NO9H 4BTIB 1THPB 2J98A 1O2VA 4GHQA 2FYRA 3NXPA 1SKYE 1VGCB 4BANB 1HLTH 1CO7E 1JXPA 2FOMB 3MU4A 4D9RA 1S83A 3QTVH 3V0XA 3ATIA 3RXHA 2I6SA 1K0HA 1QJ1B 2BVRH 3HKIB 2F9OA 1Z8JB 1C1WH 4X8SH 3TJVA 1OOKB 3PLKA 4ASHA 1QL7A 1XKAC 2QXJA 2WPLS 5KEDA 1O2TA 5EXMA 2BY5X 2SNWA 1QL8A 3LGWA 1SB1H 1HV7A 1JRTA 2ANYA 4XRNA 3PO1C 3ATLA 1DY8A 3A81A 2VIQA 1QIXB 7GCHF 2W3KA 1GBHA 1RRKA 1ZMJA 3A89A 4MG3A 1DFPA 1WUNH 4O3UA 2GGVB 2BY8X 2O8UA 5DP5A 4CBNA 1C5OH 1CA0C 3HGNA 2BD4A 2ZDAH 1W2KH 3BIVH 3O8DA 1KTTB 1O3IA 5L30H 1GI0A 1RD3B 4RKOB 2TBSA 1FY1A 5EJZA 4MPXA 4Q7XA 4TPIZ 5I46H 3ZZBA 5DP3A 2OXSA 4WMFA 2DUCA 3UAIC 1SC8U 4CRAA 1YM0A 3RC6A 1WCZA 5AFYH 1NC6A 3F2HA 1SFIA 1MH0A 1CE5A 1PQAA 2VU8E 3MU1A 2UUYA 1UO6A 1HJAC 3RXQA 2Y81A 4LK4A 4WXVA 3PLPA 1WOFA 2NU0E 2OQUA 3B23B 1RTFB 1NROH 2QV1A 1DDJA 5EXNA 1SLXB 1INCA 4Z6AH 1LHGH 1Q31A 3PO1B 3A7WA 3C27B 3AAVA 2V3OH 4TT3D 3SUFA 5EJLA 2ZDNA 3ZV8A 1GI7B 2FTLE 1QA0A 4A92A 2QYIA 3A82A 1O3NA 4AFQA 1CGIE 1K9OE 1O37A 2YMSC 4TSFD 1A0LA 1SQAA 3ZZ8A 1QTFA 3UWIA 2Z3EA 1CA0B 3TK6A 3OX7U 4SGAE 5C67A 4MPWA 1IQHA 1A5GH 1P2QA 4B73A 1LKBA 4Y8XA 2ZKSA 1UHBB 2Q6GA 5ABWA 4JZ1A 1C1QA 3EGKH 3CP7A 2F4LA 3LC5A 1HAPH 2OUAA 1SPJA 3BTKE 5C5OA 3E3TA 2LP6A 2ZF0H 2VH0A 1YCPK 1Y5BT 2BTCE 2ZDLA 3K65B 1C2EA 2PHBA 1LVMA 1WU1A 4HG6A 2HLCA 2J98B 2ZG0H 2FIRH 1A4WH 1WSSH 1HJAB 2ZHEH 3B9FH 2JDID 4ISHH 3P8FA 3T26A 5LH8A 3RUOA 1ZOMA 2CHAC 1NFYA 3PTNA 2ZQ1A 3DT0H 1EKBB 1KY9A 1GHBF 2J94A 3AASA 1C2JA 1LMWB 4F55A 4NZLA 1KXDA 2DE8A 1GI9B 2FI5E 4BOHA 2YMSB 4ZHLU 1AVXA 1GI6A 4F4OC 3Q3KA 3SV6A 4NWLA 1NBME 2G5NA 1O3MA 2R3YA 4X6PA 4A6LA 3BEFB 5E0GA 5JBBS 2SNVA 1L1NA 4AZ2B 4B6FA 4IBLH 1W13U 3PRDA 4U32A 4KTUA 1K1NA 2A31A 4M7GA 2IJD1 4ZHAA 3HKJB 2G4UA 2F83A 1EOLA 3GCOA 3M7UA 1C5NH 3SU4A 3TJNA 3MO3A 1L4ZA 1LQDB 4KGAA 1UK2A 1A3EH 4JYVH 2WSSD 1FDPA 3CS0A 3GDSA 2CHAB 3D23A 1SR5C 1NRRH 4AG1A 4GAWA 3UB0A 3Q00A 2TGAA 4ZCNA 1WTHD 4OGXA 3ODFA 1V2PT 5DO4H 3STJA 3S7HB 2Y80A 1WYKA 3VB4A 3FANA 2OD3B 4DW2U 4K1EA 1GHAF 2Y5HA 3T62A 1XKBC 1DWCH 2Q6FA 2ZPRA 2UUFB 4AORA 1V2RT 1YCPM 4M9FA 4OS6A 1GJ4H 1HUTH 1LPGB 3W95A 1T32A 1SGEE 3UUZA 2WYGA 2R2WU 2BM2A 2KCAA 2C3SA 1SOZA 3M3TA 5B6OA 4ZKNU 7LPRA 3BG8A 9ESTA 4Z0KA 5T3HA 2PWXA 1DANH 3S69A 1EX3A 5AFZH 3E1XB 1O2NA 3SNEA 1SGNE 3T5FH 3M37A 1O3KA 1COWD 1LDTT 3W1EA 2EI6A 1C5ZB 2AMDA 2VIPA 4OGYA 2F9PA 2FPZA 4WY3A 1T4UH 3QX5H 1ELBA 3KN2A 2PKAA 1P11E 1IQNA 4KTCA 4H4FA 3SO3A 4BXWA 5DKMA 4Y76A 1GG6C 1HJ8A 3BTWE 1D3DB 3I77A 1RXPA 2G55A 1S85A 1GHXH 1ZLRA 4GCHG 1CHOG 1J14A 3MNCA 4FU7A 2EEKA 3LPRA 1YLCA 3S7KB 2KCYA 1GMCG 3LIWA 2A0QB 3KHVA 4DIHH 2P8OC 1TQ0B 2XYAA 1SHYA 1CVWH 2XBYA 1O3FA 2AIQA 3E0PB 2SFAA 2YNBA 3RM2H 1LVYA 3KL6A 1SFQB 2PSYA 1H9HE 3OE7D 3LU9B 2FM2A 3FP7E 4JYUH 2THFB 2FOFA 1V2VT 2BDGA 1NFWA 1YP9A 4ABGA 1XXFA 4D8NA 2B5TB 3A88A 1K1IA 4VGCC 1O2QA 2Y5GA 1SSXA 1U6QA 2F9NA 1O32A 2M5TA 2PW8H 3TITA 2OBQA 4AFUA 4TY7A 1MUEB 4CHAC 1OWHA 3HK6B 3GDUA 3GCNA 1GG6B 3U1JB 1OHHD 3PWCA 1CSOE 3RU4T 4NA7A 3SV9A 5E0HA 1BJVA 3U1IB 1MKWK 4YOIA 1S0RA 1OWEA 4IS5A 2OC8A 3ITIA 3SN8A 1YPKH 2G4TA 3SNDA 4GUXA 3P17H 1O2GH 2FLRH 2G8TA 1P8VC 1TRMA 5EIYA 2P8OB 1NTPA 3ESTA 5K7RA 1DVAH 1NT1A 1PPGE 1BMLA 1SMFE 1HIAA 2ZTYA 3PROA 1HCGA 1Z6EA 3UOUA 2OC1A 1GJCB 4GPGA 3RM0H 2Z9JA 3FKSD 3NCLA 3QGNB 3L33A 4I86A 1C1SA 2BZ6H 1SVPA 4FUDA 5ESBA 3SQEE 3F3BA 1B5GH 1YF4A 3HGPA 1TX6A 1GBLA 1S5SA 1T4VH 2HLDD 3LOXA 4VGCB 2TGPZ 3U8RH 3ZYDA 5EXLA 3QTOH 1NRQH 1TPSA 1AE5A 3BSQA 3A84A 1QBOA 1NRNH 4CHAB 3UQOA 2B9LA 1KXBA 1AFQC 1GJ9B 2JH5D 1BQYA 1P2NA 3RXUA 4E7NA 4JK6A 4DY7B 1BT7A 4MTBA 4NWKA 2WPHS 4IC6A 2ZU4A 1AKSA 2ZFTA 4XD7D 1NFUA 2BQ6B 2G5VA 1KLIH 1LPZB 2PKAB 3GY4A 3E90B 1BTYA 1D3TB 8LPRA 1FY5A 1P0SH 1QBVH 1MU8B 1EJNA 5CDFE 4IN1A 5EPYA 2TGTA 3QZRA 2V35A 1IQFA 1T8MA 1O3OA 4UFFH 1PYTD 2ZFQH 3LGTA 4XOJA 3LT3A 2AERH 2Y5FA 1DE7H 1HAIH 1C4U2 3V13A 4DURA 1GBMA 3ZZ7A 1XUKA 3MWIU 1B0FA 4LZ1H 2QF0A 1AY6H 1IHTH 1SGQE 1H8DH 1Z1JA 1EXFA 3GCTG 1IQJA 2FOCA 2EY4C 5GJ4B 1K1PA 3FAOA 5JBAS 1V2ST 4Y79A 2VVCA 1KLTA 1Y3VA 3F2GA 1AFQB 2ZI2H 3F1SB 1QRXA 2ZPQA 4IMZA 1BBRH 1CBWC 3FZDA 1P2MA 2W7UA 1OWJA 3DSOA 1C1VH 3IITA 2GD4B 4FUHA 1N1LA 3FFGA 2KM0A 4X8UH 1MBMA 3PWBA 4YOGA 3MO6A 2O9QA 8KME2 1O5AB 3OY6U 2M2AA 2BZAA 1TRNA 1GCDA 4NSYA 1O33A 2FXRA 2Q1JA 1Y3WA 1DS2E 1DM4B 4Q2KA 2GZ8A 1XUJA 1YBWA 3MOCA 1C5YB 3ATWA 1BTPA 5E2OA 1XX9A 3SGBE 1C1TA 4NIXA 2KCOA 3GISB 2YNAA 2ZTZA 5FCRA 2C90B 3MI4A 1SGDE 1AVWA 1UVOA 2H2ZA 2ZC9H 4DOQA 5HM2A 2CGAA 2R0LA 3KYFA 4ZROA 3SUDA 5EQRA 4AN7A 1VJAU 1HIAB 1TAWA 3KEEA 3TGIE 2A4RA 3SV7A 3L6PA 3OAAD 3RMOH 3BIUH 2ANMH 1KMHB 2ZGXH 2C4FH 1TWXB 1O5EH 3GDVA 2YOLA 1UJ1A 1CBWB 1EAXA 2ZPSA 1K22H 2WHXA 1EUFA 1SQOA 3RLYH 1YPGH 4X1QU
chains in the Genus database with same CATH topology
2A32A 1MTUA 3SV8A 2VWMA 2AGGX 3M5OA 4Q7ZA 1IQKA 5SGAE 3QLPH 1OYTH 2ZU2A 2AEIH 3RXSA 1J15A 2ZHFH 3A7YA 1CGJE 3LJOA 1UTQA 3BEUA 5BPEA 2Z9KA 5LGOA 2G52A 1ARCA 2SGEE 1SGFA 2WV5A 5K0HA 3RU4E 1C1OA 1GBTA 1DLKB 4ABEA 1O2UA 4FUFA 1AKSB 1GVZA 1MZDA 3SU0A 4A1VA 1EPTA 2ESTE 1LPKB 1YPMH 4YESB 1BITA 1O2RA 3KF2A 1P2OA 3M61U 1FLEE 2DE9A 1CT4E 4NGAH 1CU1A 3PMHB 1F0UA 1O3JA 5DGJA 1FUJA 3VPKA 2LPRA 2OC7A 1D3PB 1GI8B 4X6MA 1TNKA 2BDCA 2XWAA 4DJZB 2CF9H 4IMQA 1DSTA 3E0NB 5C1UA 1JIRA 2PUQH 5F8ZA 2ZQ2A 1ID5H 3OU0A 1V2QT 1MKXH 4MNWA 2UWLA 1ZTLA 1Z8RA 2FS9A 2A4GA 3GY7A 4DT7B 1BJUA 5J4SA 1UTOA 3RXGA 3A7ZA 3RXKA 1C9PA 4Y7BA 5CE1A 3DA9B 4KELA 4BAKB 1F0RA 3A7TA 3E91A 1UHBA 4IGDA 1KDQA 4ABAA 1MQ5A 2Y82A 2BD5A 1S6HA 6GCHG 2B7DH 4XSKU 3ZZ3A 2GKVE 2BY9X 3GY3A 4MDSA 5A8YA 1GDNA 1QRZA 1O3CA 4K1SA 2FS8A 3VB3A 1ZSJA 1BRUP 3AW0A 1C5MD 5GCHG 5F8TA 5EOKA 1MTNC 4XFQA 1EZQA 1GVLA 5T6FA 3D62A 4WH8A 3ZYEA 1FXYA 2QY0B 1DSUA 2ZGCA 3NK8A 4FU8A 3SNCA 1SGCA 1EPTC 1S84A 1GJBB 1A3BH 2OCVB 2STBE 3UR6A 1ZSKA 1NRPH 4X2XA 1TPPA 1O2YA 1ETSH 3PMJA 2WPMS 3VFEA 3A85A 1TBRH 5GXPA 2EC9H 2XBWA 1BTHH 1UVUH 4YLUA 1EZSC 3TK5A 1GMHG 4OS2A 4THNH 3UWJH 1DPOA 3QO6A 1DXWA 1H8IH 3RXAA 5A8XA 1FPHH 1LVOA 4K60A 3KGPA 1PJPA 1QCPA 4X8VH 4ZHMU 1F5RA 4Q7YA 4H6TA 1ABIH 1MTNB 2ZHQH 1XMNB 2FMJA 3F9GA 3EA8A 4FVBA 4NSVA 1J16A 4I7YH 1KXEA 4JZFH 1EPTB 4UONA 1LO6A 8GCHF 2O8LA 1XXDA 1RGQA 1UTLM 1WBGB 1NY22 1BOQA 1C5UA 2Y7XA 1Z1IA 4GLYA 4QT8C 4XBDA 3HK3B 2BY6X 1A0HB 1C1PA 1GI2A 4MNVA 2AMQA 3T27A 2ZHWH 1AHTH 1VITG 1GJ5H 1P3CA 3SORA 1HAHH 1L0ZA 1OP2A 4WMEA 3DFJA 1O35A 4CRCA 2BD7A 2STAE 1N6YA 2ZDVH 3LJJA 1ELVA 3IG6B 4KTSA 1GL1A 2GT8A 1AVGH 1Z6JH 1Y59T 2F9VA 1BTUA 3MH6A 5AHGH 1OYQA 1ETRH 4Y6DA 4HI3A 2ZU1A 1ELEE 1Y5AT 2FI4E 3H7TA 3RXVA 4ZKOU 1ANEA 3MO9A 1BBRE 1KDQB 3ZVFA 1HAGE 2VB0A 2D26C 5DP4A 3Q76A 1ETTH 4MVNA 2F9UA 3MTYA 5IYTA 3P6ZB 2XC4A 2FX6A 1P10A 4XDEA 4CR9A 4D76A 1QR3E 4RKJB 1YCPH 2VGCC 2ZZUH 1BTWA 4TY6A 4ZAEA 4K8YA 1V2OT 4WMDA 1IOEA 2Y7ZA 3EYDA 2OINA 2W5EA 4LZ4B 4LOYH 1ZHPA 2VNTA 4X2YA 1V2KT 2R2MB 1Z7KA 3D65E 3T2NA 1V3XA 4B74A 3RXMA 3O8CA 2QIQA 1P04A 1O3BA 5AF9H 2H9EH 2R3UA 5CHAC 2AYWA 4AX9H 2BVXH 4YLQH 4INKA 2ZWLH 1D6WA 1Y3YA 2FTMA 1GBFA 1NU7B 2VIDA 5BRRE 4YT6H 1Z71A 2ODPA 4ZXXH 2D2DA 4UDWH 2RCEA 1W7GH 1TABE 1LHFH 2BX3A 5JPMH 1O39A 1GMDF 3O8BA 2HPPH 1HRTH 1T8OA 2NU4E 1O2SA 2XC0A 3V7TA 3ZZ6A 2VGCB 1O5CB 3STIA 1TNGA 3RXDA 1NZQH 6ESTA 2ALVA 2NU1E 3P8GA 3Q3YA 2BD2A 1GHBG 1KXFA 2VH6A 1HAZB 2H9HA 1G30B 3UR9A 2PTNA 1IQMA 1HYLA 4X1PU 1K1OA 1Z8GA 2A2QH 3M5MA 3FP8E 4F49A 1PPFE 1F0TA 1UTMA 2QAAA 4O9VA 5CHAB 1XUHA 1O5GH 2WINI 1T7CA 1TGCA 1OWKA 1OWDA 1H4WA 4E7RG 3BTME 1UTNA 2G00A 3MNXA 1NM6A 1ZHMA 2XBXA 3ZVCA 3U69H 2BD9A 1JBUH 2P3UB 2WPKS 4I33A 1ZYOA 2CN0H 4A7IB 1JRSA 4I8LA 2XWBI 5A0CA 3SJIA 1FZZA 3V3MA 3E8LA 1GVKB 4ABDA 1A46H 3I29A 4AYVB 3ZVGA 4Y10E 4B71A 4I31A 1LQEA 4GCHF 1TGSZ 3ZZCA 1PPBH 1DUEA 1V2JT 1UCYH 1AI8H 2W3IA 1V2NT 4MQAA 1JIMA 1GMCF 5F8XA 2GCTC 2Z7FE 1RS0A 2A5IA 5EW1H 1O2MA 4IC5A 4IW4E 2XC5A 2GZ7A 5LPEA 1DICA 3BEIB 2VIVA 3RC4A 2F9BH 2TRMA 3PM3A 1ESBA 2Z94A 2C8WB 2BDHA 1YPHC 2W7SA 3K6ZA 2H5DA 4Y7AA 2J92A 2B0FA 3IWMA 3PMBB 4Y8ZA 1YLDA 1ANCA 3SJ8A 3RXOA 5L2ZH 2BLQA 1SGYE 3KIDU 4JZEH 1MAXA 4INLA 4ZMAH 1OP8A 4GVUA 2KAIB 3GY6A 5FAHA 1GBIA 2ZTXA 1AD8H 1G37A 3GYMA 1V6DA 2TGDA 3H7OA 3S0NA 4FU9A 2PR3A 1TOMH 2W26A 3TJOA 1O2OA 3VGCC 1EB2A 1ELDE 5E8EH 2BDYA 2WPJS 5FPTA 1QJ6B 1ZJDA 2K1QA 1QURH 4AG2A 2GCTB 4UFEH 1YPHE 2H5CA 4DIIH 1D3QB 2G51A 3URCA 1C5RA 3PMAB 2FP7B 2VWOA 3P70B 3QWCH 4JZDH 1EAWA 1DOJA 2XW9A 1UVPA 3BTHE 4NIYA 1P2IA 5T6GA 3SW2B 1DWBH 2BD3A 1AWFH 3ZVBA 2BB4A 2NU3E 4BAHB 2BOHB 1O2IA 2QXGA 3P95A 1O3GA 3KQDA 4NFEA 1DWEH 1ZMNA 3C1KA 3LKWA 1MKWH 3L3TA 5A09A 4R0IA 1UMAH 2P16A 4OS1A 3QUMP 4AB8A 2RG3A 3AVZA 2P94A 3NUMA 1ZSLA 4YOJA 3A7VA 5JB9S 5FBEA 3ENSB 6CHAC 2Z9LA 1GHVH 4Y8YA 5DG6A 3ZZ5A 3URDA 3Q77A 3VGCB 3K9XB 5C1YA 3VB5A 3NZIA 4BXSA 1O38A 1GI3A 1TGTA 2RDLA 3MU0A 3GY8A 3SNAA 1XVOA 3K6YA 2I6QA 2WPIS 1G3CA 1BTZA 1YPEH 2UWOA 1C2KA 1GDUA 2WUBA 4B75A 5AVDA 1L1GA 1TNLA 3ATKA 3M7QA 1UVTH 1TQ7B 4ABFA 1YKTA 1AO5A 4X2VA 3ZZ4A 3GYLB 1W10U 1O2JA 1AB9C 4CRBA 2GP9B 3UPEA 3VEQB 1ELCA 4AFZA 2A45B 1W14U 3UTUH 3D49H 3VXEH 1ELFA 3A8BA 5JDUB 1SQTA 1PPCE 3GCTF 1KIGH 2H6MA 1G32B 3LDXH 1O2ZA 1GCTC 2BMGB 2A5KA 1FY3A 4UE7H 4BAMB 1W12U 4X1SU 2EI8A 3ZV9A 3BTDE 6CHAB 4J2YB 4DCDA 1FONA 3A83A 1LHCH 3EDXB 1JMOH 3A8CA 4JK5A 2ZEBA 5ESTE 4ABHA 4WJG2 4CR5A 4X6OA 1GBBA 1FAKH 2FOAA 1QJ7B 3A7XA 2IPHA 2G81E 2RA0A 2J9NA 2FEQH 3CS7A 3SQHE 1LCYA 3UREA 2QCYA 1G3DA 4ISIH 8ESTE 1YYY1 3SGQE 1ELTA 4HFPB 2FOHA 1MCVA 2P93A 1AB9B 3B8JA 3M36A 1C2MA 2F3CE 5FX6A 5DP6A 1PFXC 2ZU3A 1AZ8A 1MU6B 1LKAA 2IOTA 2PGBB 5EQSA 2WUCA 5H4IB 9LPRA 1EJMA 1GCTB 2ZGBH 1SLUB 2LNCA 4OS4A 5EW2H 2BX4A 3TGJE 2ZIQH 1LVBA 2ANWA 1NESE 2J95A 1LHEH 2GDDA 2Z9GA 2GT7A 3SU3A 1UK3A 3SNBA 2XCNA 3I78A 1NN6A 4ZXYH 1ELAA 1AUTC 1HFDA 1XM1A 1PPZA 5GPIB 3ZVEA 5EU8A 1EAIA 1KXCA 3UQVA 2SGDE 1KYNA 1AFEH 3MU5A 3A87A 2ZDKA 2A4QA 4UFGH 1ESTA 3JZ2B 2NU2E 4NIVA 1O5DH 3P8OA 5FPSA 1THRH 1TPOA 1MAYA 1MTWA 1Q3XA 1QA7A 1ZZZA 2GCHF 3NPSA 3OY5U 3RP2A 3UFAA 1Y3XA 1RJXB 3UNSA 4KP0A 2ZGHA 4ABIA 2QA9E 1ZPCA 2O8WA 1GBCA 2BYAX 4LXBH 3TK9A 2BQ7B 1IQLA 4NFFA 2VJ1A 4ZUHA 1J17T 4OS5A 2A7JA 5LPRA 1W11U 2BY7X 1P3EA 7KMEH 3SJKA 1BRBE 1H1BA 4FUCA 4WVPE 3PV4A 1AUJA 4B1TA 1CQQA 1EQ9A 1UCYE 3OTJE 4JZIA 2JKHA 3RXPA 4U2WA 1OSSA 1SG8B 5J4QA 2VVUA 3RXRA 1PPEE 2OTVA 2PUXB 4D7FA 5HYOA 1O2KA 1A5HA 2HRVA 2QN5T 4AGJA 1P05A 1CT0E 1EJAA 1O34A 1AN1E 4BAQB 4YM9A 1SGRE 1H9LB 1UTKA 5G4BA 2PSXA 1C4Y2 1TGBA 1HNEE 3SOSA 1ZPBA 1UK4A 3OYPA 2UUKB 2PFEA 1ABJH 2FOEA 1F5KU 3GY5A 3TPIZ 1THSH 1DX5M 4WXIA 4K8BA 1TX8A 4A1XA 1GDQA 4AOQA 1DLEA 1V2TT 4Y11E 2Z3CA 3ATMA 2D8WA 1BUIA 3TNSA 1SI5H 1GJ8B 3O8RA 1O36A 2GTBA 3VB7A 3R0FA 4CRGA 1O2LA 3RXJA 1HAYB 3RMMH 2XXLA 1L1JA 5FPYA 1C5QA 4X1RU 1FJSA 4I8KA 3TGKE 1C5XB 1K1MA 1F92A 1C5VA 3PYHA 1ESAA 1MD8A 3E16B 5E0JA 1O5FH 2AGEX 1GHZA 2TPIZ 1O2WA 1IHSH 1QRWA 3MH5A 5JB8S 2FWWA 1MQ6A 4B2AA 1EAUA 1DITH 1YPJH 2ZFSA 2C8ZB 5C5NA 1P03A 3RXLA 5GIBA 3GICB 1O2XA 3A8DA 1XVMA 3SHAH 1DUAA 3S9CA 2OBOA 1HB0B 1TIOA 2Q6DA 2ZGJA 4WF8A 4TWWA 4E05H 4GHTA 2A7HA 1Z8IB 2HNTF 1KLJH 1TNHA 3T28A 2BLOA 1A5IA 1TRYA 3NWUA 2HVXA 1C2IA 3KCGH 1YC0A 4O03A 3QN7A 1B0EA 3SUEA 1GWAA 1ZRKA 1HAOH 1PYTC 1N8OC 2ZCLP 1GHWH 1TLDA 1VJ9U 1G3EA 1O3EA 1VITF 3ZVDA 2QF3A 1TOCB 1ZMLA 2QXHA 2V0BA 1A2CH 1NU9A 1W7XH 3M3SA 4AYYB 2QGRA 3A86A 3MNBA 3TLOA 1TMUH 5DP8A 1P2KA 1C5WB 1QFKH 1V2UT 4TYDA 4MPUA 1P09A 3QDZB 1OP0A 1OKXA 1DT2A 2P3TB 2PV9B 1RTLA 2GX4A 4ISOA 1QB6A 2J2UA 1GBAA 1E34B 1AGJA 3KQEA 7GCHG 3TVJB 1PQ7A 2QXIA 1LHDH 1P06A 2UWPA 1V2MT 1N8OB 2FX4A 1E0FD 1VCWA 5CMXH 2FO9A 1K21H 2BD8A 1E38B 3H5CB 1ELGA 1TBZH 5EG4A 1X7AC 1QHRB 2AH4X 1TA2A 4X8TH 3KQCA 3RXCA 2Z9IA 1MCTA 8GCHG 1ZTKA 1GBDA 3ODDA 1QY6A 3P92A 1WTGH 3F9FA 3LH3A 1XUFA 1HXEH 1C5SA 2XNIA 2WYJA 3A8AA 1UTJA 1UTPA 2AIPA 2HPQH 3F6UH 4CH8B 1AZZA 2GV7A 1EP6A 3OSYA 1RIWC 4D7GA 4UFDH 3GOVB 4I8GA 3F9HA 5F6MA 2UUJB 3F9EA 4K69A 1GJ7B 2ANKH 5T6DA 1SGTA 2SGPE 1MD7A 1G9IE 1O2HA 2Z6BD 3JZ1B 1BZXE 1Y3UA 1G3BA 4ZKSU 5C20A 2BDAA 1QNJA 1S81A 2ULLA 1KTSB 1S82A 1VR1H 3M3VA 2KAIA 5PTPA 3MHWU 3SV2H 3MFJA 1SLVB 1SGFG 3F68H 1DWDH 5HM9A 4JYTA 2OLGA 2FYQA 2CV3A 2NWNA 1E35B 5FBIA 4BNRA 3M35A 3MMGA 2XCFA 3BF6H 2CXVA 5L6NH 1GBJA 4WH6A 4FXGH 4NZQA 1AMHA 4RN6A 2HOBA 1MBQA 1TB6H 3ZVAA 4B76A 1P9SA 1T8NA 1C4V2 1C2FA 2A5AA 3U98H 1BMAA 1RIWB 1MTSA 1QB1A 5HGGA 1IQEA 2O8MA 3TNTA 2XRCA 1CT2E 1QB9A 1GI1A 2A4OA 4K2YA 1W3CA 1D9IA 1HBTH 2ZNKH 1G2MA 4TWYA 1OXGA 6LPRA 4ZKRU 1GL0E 2XBVA 3RXIA 2A7CA 1ORFA 7ESTE 1HAXB 3K2UA 2C93B 3S9BA 2VINA 3SUGA 3QGJA 4OS7A 1P12E 2R0KA 5DPAA 3EA9A 3BG4C 1O3PB 1C5LH 1O3DA 3Q3XA 1V2LT 4WWYA 1EB1H 4MLFB 1O30A 4FUBA 1GMDG 1TPAE 4X6NA 4DGJA 1ZRBA 2FODA 2ILNA 1S0QA 2AFQB 1SGPE 4MPVA 4CREA 5F03A 3BTQE 3RMNH 1HDTH 5IDKA 3FP6E 2VWNA 1C1UH 5FHTA 5JBCS 3LC3A 4YO9A 2Z3DA 2ASUB 4BTTB