1O3FA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3fA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3fA02
4UONA 2ZPRA 2IN2A 4H42U 1GJ9B 3SI4H 1C2LA 2ODQA 3GOVB 3TK5A 3BTGE 1MTNC 4FUIA 3T62A 5GXPA 1TMUH 1SGRE 3ENSB 1K1IA 4ZKSU 2H5DA 2AMPA 5FPTA 3PMAB 1SI5H 3E1XB 1BJVA 1O38A 2ESTE 1LHCH 3MHWU 1MKWH 4I8GA 1C5TA 2GVFA 1ACBE 1ESAA 1KTSB 1C1SA 1B5GH 3UR6A 1ABJH 3RLWH 1OWIA 3K2UA 1GHAF 1B0EA 1V2VT 2ZFSA 2XCNA 1HJ9A 1BTUA 1O3GA 2WPMS 1V2RT 4Y11E 3V7TA 3SHCH 1AY6H 1TABE 1FNIA 2SGFE 1GI2A 5C1UA 4O97A 2XBXA 2WPJS 2OC7A 4YM9A 2ZU4A 4JZDH 1ABIH 2VB0A 4X8UH 3S9AA 1FI8A 3QX5H 1NU9A 1H8DH 2Z6BD 1ELVA 3A87A 2FI5E 2ALVA 3KIDU 2GV7A 1DSUA 4ZROA 2XC5A 2AMQA 1ANBA 2FDAA 4DGJA 2PKAA 3MNCA 1MD7A 3ESTA 3O8CA 3KNXA 4UD9H 3OY6U 1HAYB 4DG4A 5L30H 2VIVA 2A5IA 1BT7A 2VVCA 4BXSA 1INCA 2QN5T 3TGIE 1TB6H 3D23A 2ZDNA 4NWLA 3E0NB 1LKAA 4OGXA 5A8XA 2GV6A 1C1QA 2XC0A 2WPLS 1SMFE 1O34A 1SOZA 1OXGA 4X6PA 2GDDA 1HYLA 3AAUA 4DJZB 4Y76A 2WPHS 2CHAB 4MPWA 3A88A 1V2OT 4U2WA 4IMZA 3H7TA 4JZ1A 2H9HA 2XBWA 1FZZA 1L4ZA 1XUJA 3WY8A 1ZGVA 1TOMH 1BHXF 1QJ1B 3MNXA 2JH5D 4NIYA 4CHAB 4ISNA 4Y0YE 3TJVA 3RXIA 1SLUB 2BD9A 2FYRA 3SU0A 3TVJB 2GKVE 2PTNA 1TBRH 5CHAC 4LZ1H 3BG8A 5E2PA 1GGDB 1QQUA 1F5KU 2PWXA 1F0SA 3LDXH 3F9EA 1EZQA 1XUFA 3SU2A 1OWEA 3QZRA 3VB5A 1ZHPA 3HK3B 1W10U 4JMYA 3ZVDA 1W7GH 1C2DA 6CHAC 1G3BA 1O3NA 3QLPH 3DUXH 2R3YA 1GHYH 3RXPA 1D3DB 2ZQ1A 1E35B 1O3DA 2BY9X 2QIQA 4ABBA 3RXKA 3NXPA 2PW8H 2OC0A 2FPZA 1LKBA 1O35A 3UY9A 1GJAB 3LGUA 3RXDA 1KXEA 1ZTKA 4IN1A 1DPOA 8LPRA 5F6MA 3GY3A 3QGJA 4R8TB 3RU4T 1ZMJA 1OS8A 2AH4X 3TITA 1IQEA 1GBFA 1WSSH 2D1JA 1K1NA 1SQTA 1YGCH 1O31A 4MVNA 5IYTA 3ZZDA 1EOJA 2PKSC 1SGCA 3UNSA 3R3GB 1TGNA 4NFFA 4BXWA 3ZZAA 4MTBA 3TPIZ 5L6NH 2PLXA 1LQEA 3F9FA 4Y7BA 1SQAA 2R0KA 2ANWA 1CHGA 4HTCH 3VB7A 1C2GA 1YLCA 1ELTA 1T32A 5C3NA 1HFDA 3E90B 2ZIQH 5DP6A 2BVXH 2FLBH 4IMQA 1MAXA 1NRRH 4MPXA 1AB9B 4DCDA 2Y5FA 4KTCA 2ZP0H 3SU6A 3D62A 2ZPQA 2Q6GA 3UIRA 1OWHA 2NWNA 3BN9A 1DS2E 4NZLA 2FTLE 3GY5A 1ZTJA 5DP5A 2ZTXA 1ESBA 3VGCB 1HLTH 2DE8A 2JETB 1HGTH 1Z71A 1D6WA 2FEQH 2FP7B 2Z9JA 2J92A 2J38A 2J2UA 3T29A 4AGJA 1YYY1 3UNQA 2XBYA 4YT7H 4U01A 1TNLA 2UUJB 1GVKB 3IITA 4Y79A 1O2PA 4X1PU 4H6SB 3RU4D 2ZU1A 8KME2 3PMJA 7ESTE 1H8IH 1BMNH 1GVLA 2QXHA 2VJ1A 1LQDB 2D8WA 4CH8B 1OKXA 3SJKA 1GPZA 2BD7A 5F8TA 1Y3UA 3UTUH 3BG4C 1ZSLA 1CSOE 3GY4A 2ANYA 5JYIA 1CGHA 2FOBA 2J94A 4CRFA 3M5OA 4Y71A 1F7ZA 1A46H 1MBMA 2FXRA 3F68H 2YNAA 5E0HA 3BTTE 1MTNB 1EASA 4YO9A 4K60A 1HUTH 1GBIA 4BANB 2WYJA 1ZYOA 4ABHA 1QTFA 4YZUA 2CGAA 1Z1JA 1HB0B 1SG8B 4X2XA 3A81A 3S69A 1C2MA 3P8FA 4IS5A 3P95A 4FU8A 1WQSA 3GICB 3P17H 3GCOA 3EA7A 3GCTG 1XKAC 4XFQA 2HPPH 3RU4E 1OP8A 3QDZB 2DUCA 2WYGA 1ARBA 3SZNA 3LGWA 5SGAE 3A7YA 1OWKA 1NRSH 4AFZA 4JK5A 3NUMA 3LH1A 4AZ2B 1KTTB 4GLYA 1O5DH 3ZZ4A 2JKHA 1ELEE 3BTEE 3AVZA 1PPZA 4GPGA 1E38B 1RTKA 2ZPSA 3SGBE 1CVWH 4XOJA 2UUFB 1UCYE 2ZDAH 1FY1A 3A83A 1AZZA 2ZCLP 3AAVA 1C5YB 3A8DA 1ZRKA 2C90B 4UFEH 1G3EA 2BOHB 1SGYE 3RXUA 1KXCA 1ZRBA 2TBSA 4FUFA 4TWWA 4I8KA 1SSXA 2W7SA 4WMEA 1C1TA 3GCTF 1UK2A 2CN0H 9ESTA 2AERH 2O8LA 1T7CA 1A61H 5JB8S 2XC4A 1DY9A 1PYTD 1GG6C 1MZAA 1O0DH 2J34A 1A4WH 2F9UA 1C4V2 1MAYA 3LJOA 1P3EA 3S7HB 1SGIB 4K1SA 1EZUC 1T31A 3LU9B 4DVAU 4I31A 5K7RA 3ZVEA 1V2UT 4Y6DA 3P70B 4WXIA 8GCHF 1O33A 5DP4A 3NWUA 4OGYA 1O5FH 1UTLM 2NU1E 1TOCB 3A84A 1RIWC 2ZGJA 5I46H 1MKXK 1B0FA 1O3KA 2HPQH 4FU9A 1V2QT 3GDVA 4CRCA 4X0WU 1C5ZB 2VWLA 4FUDA 3RC6A 4CRGA 3KQDA 1VITH 2BX3A 3PO1C 1GJDB 4NSVA 1GMHF 4E7NA 4FUEA 2W5EA 1C2JA 2G4UA 5GPIB 1W14U 1OYTH 1P8VC 2G5VA 3SUDA 2ZQ2A 2A7JA 1Y3VA 3MTYA 6GCHG 4TWYA 5LPRA 4A6LA 1YPHE 2ZHQH 2O8MA 5T6DA 3IWMA 3LJJA 1F0UA 2C4FH 1AVWA 2BLVA 6CHAB 1ZZZA 1GHBG 5FCKA 1SGDE 1EUFA 2TGPZ 3U8OH 2G55A 1RFNA 2ZGBH 2ILNA 2FM2A 1ELDE 3VB6A 1G2LA 1CU1A 1NS3A 3H7OA 4AFSA 4Q2KA 2RG3A 4ZXYH 2V6NA 1C9TA 4YLUA 3GCHC 3RP2A 1SGFG 2ZFFH 2V0BA 5H4IB 5HMAA 1FLEE 3Q77A 1LDTT 1NO9H 3A7XA 3SV8A 3T26A 2P8OC 1O2YA 4FUHA 4AG1A 2Y7XA 2EI8A 4X8VH 4ABJA 7KMEH 1BTYA 5GIBA 2BD4A 1AZ8A 1TYNA 2TIOA 1IQKA 1YCPM 1BTWA 1PYTC 2PGQB 2Y80A 3QK1A 5JDUB 2NU0E 1PPGE 1GHBF 1QJ7B 3SU5A 1S6HA 3SUFA 2G51A 1CA8B 1G9IE 3MWIU 2STBE 3A80A 2CMYA 1P3CA 1RD3B 1HAOH 1BMAA 1O5CB 1AFQB 1FIWA 1QRWA 5DKMA 2OP9A 3S9CA 5FHTA 4INKA 4CBOA 1F5LA 1P02A 4WXVA 1XUGA 5K0HA 1VCPA 5AVDA 1C1PA 4NGAH 1TALA 2Q6FA 4D9RA 1GMDG 2BB4A 1TNGA 2CJIA 1UVUH 1UTJA 1DWDH 1O2UA 1SHYA 3VXFH 2B5TB 1BCUH 1UTKA 1BRCE 2HNTE 2TGDA 3MU0A 5GJ4B 1Y3XA 4UFFH 1K1JA 1FXYA 2GTBA 4B2AA 1RJXB 2Y5HA 3SI3H 1RRKA 3QO6A 2O8WA 3VPKA 4Y8YA 4KP0A 1H9LB 1O30A 1SB1H 5GWZA 2UUYA 3LH3A 3M7TA 4XE4A 5EOKA 1E34B 1GBEA 4K69A 1W0YH 1QA0A 5EW2H 4I8HA 1HJAB 2GD4B 3FP6E 1LHGH 2Z7FE 1UCYK 2QC2A 3Q3YA 4TY7A 1GJ5H 5FPYA 1GMDF 2I6SA 2C3SA 1LMWB 1O3FA 2GT7A 3BG4B 4A92A 1EB2A 2SGDE 1YPMH 4ZKNU 1SHHB 4NSYA 1NY22 3LC3A 1LPZB 2B9LA 3M5LA 3ZYDA 3PWBA 4CRBA 1TBQH 1O3EA 5TCCA 1SGNE 2F9VA 1VR1H 4LXBH 4Y8ZA 1C5UA 3RXVA 3M3VA 3MU8A 1GL0E 3SGAE 1N1LA 2A4OA 2ZU5A 2ZFPH 1WQVH 2OC1A 3ATIA 1AUTC 2BQ7B 1ARCA 1O2SA 3RC5A 1IQIA 3BTFE 1JWTA 1TMTH 3B9FH 2XTTB 1K1OA 4K1TA 1VJAU 3TJOA 1V2MT 3UFAA 4Z6AH 1MZDA 1HDTH 3N7OA 3PM3A 1LVBA 2JH6D 5TCAA 1NRNH 3RUOA 1D3PB 1Y8TA 3UOPA 2K1QA 5HGGA 4B2CA 1L4DA 5FBEA 3BV9B 4I8JA 2W7UA 1GBJA 2GZ7A 1V2WT 1ETSH 2Z94A 1L0ZA 1P11E 1WCZA 3UPEA 3CS0A 4M7GA 4D76A 5HXFA 2ZF0H 1TNJA 2VU8E 3TNTA 1TAWA 1O2VA 3SORA 1GI6A 1C5LH 2OUAA 1HXFH 1G3DA 3Q76A 2SGEE 1P0SH 4MNXA 4AORA 5T6FA 1XMNB 2CXVA 3BSQA 3ZZ8A 2R9PA 2BY7X 1E36B 3QUMP 4Y7AA 3GY6A 3KQBA 1BQYA 2FZZA 1GG6B 5EW1H 1KLTA 1O5GH 4ISHH 2GCTC 2NU3E 1WV7H 4WY3A 3F6UH 1CA0C 1ZSKA 1TFXA 2R0LA 1O5BB 4U30A 1TPAE 1Q2WA 1TQ7B 1C1UH 3U9AH 5DJ7A 2OQ5A 1C9PA 2OCVB 4D8NA 1HAZB 1NC6A 2FESH 1QFKH 3ZZ7A 1CE5A 1OOKB 3RXMA 2V3HH 2AGEX 5CMXH 1NRPH 1RIWB 2F9NA 3LOXA 3RXBA 3UOUA 1GJ6A 4JK6A 2HNTF 1TBZH 3T25A 4CREA 1EJAA 1QRZA 1CT4E 1C5MD 1DE7H 1NROH 1KYNA 3UWJH 3PO1B 3GISB 1HNEE 1FIZA 3PMBB 4NIXA 4ISLA 3ODDA 2BD3A 4IBLH 1K1LA 3A82A 1KSNA 1ZJKA 2F9OA 2OD3B 1FQ3A 1EZSC 2QAAA 3RMNH 3EAJA 4RSPA 3SV2H 1PQ7A 2PGBB 1Y5UT 4H6TA 3E8LA 1O39A 1EP6A 3OTJE 1O2HA 3HPTB 2HRVA 4D7FA 3NZIA 3NK8A 4DURA 1EAIA 1S0RA 2AGIX 3A86A 1YPKH 2Y5GA 4AYVB 3GCNA 2QY0B 1KXAA 4X6OA 5C1XA 3SBKA 1VCWA 3U98H 1UVTH 1WYKA 1LO6A 3ELAH 3LONA 3M5MA 4Q7XA 3TNSA 1AE5A 3RXEA 2P8OB 2GCHG 3RXHA 1DDJA 2EI6A 4X2YA 1GI1A 1HAVB 3ZZ3A 1IQNA 1BB0B 4B1TA 4HFPB 2GP9B 2A45B 4UEHH 4X6NA 2BQWB 1TPPA 1X7AC 5F8XA 5E0GA 3LPRA 4BAHB 4AGKA 1A5GH 1C5SA 3K65B 2BXUH 1O5EH 1RXPA 2F83A 1ZHRA 3LGTA 2FYQA 3PV4A 4KTSA 4FUJA 4NCYA 2XXLA 2Q6DA 4KKDA 2ZECA 1GJ7B 2BLQA 4VGCC 1CBWC 2ZTYA 3U8RH 3RXOA 1AUJA 3MU1A 3SGQE 2VWNA 2AS9A 1DX5M 1XUKA 2BY6X 3FANA 1QQ4A 1AWFH 2GCHF 1GJCB 5EXNA 3KQCA 1FN8A 1S84A 2AYWA 4X8SH 1KXDA 1HPGA 1PPHE 1O2WA 2EI7A 2WUBA 3ZV9A 1IQFA 4AOQA 1C5RA 2ZHWH 3M35A 5C2ZA 1MQ5A 1LVOA 8ESTE 1A0HB 5FXLA 3URDA 2VIOA 3AASA 2RA0A 2SGQE 1G3CA 1EAXA 2Y81A 1PPFE 1ZPCA 3M3SA 2TGTA 2QF3A 1XXFA 2PSYA 5I25A 1SGPE 3MNSA 1HV7A 1O2XA 4ISOA 1FY5A 1MUEB 3G01A 3QTOH 1D6RA 4MLFB 1A2CH 3K6ZA 2QXGA 4Q7YA 3QGNB 4OS1A 1A7SA 3SQEE 2ZNKH 1W8BH 1TRYA 1MKWK 2BQ6B 1UHBB 1H9HE 1SLWB 1ZGIA 1NESE 1NFUA 3RLYH 1J16A 2VNTA 2ZZUH 1DSTA 1HAVA 1BDAA 3TK6A 2HALA 4GHQA 1P2QA 5A09A 2YNBA 2ZGHA 1NRQH 4OS2A 1LHDH 1EOLA 1GDUA 1FDPA 4I7YH 2FOFA 1XUIA 3VEQB 3TH2H 1YBWA 3ZVGA 3TLOA 4LK4A 1Q31A 3GY7A 3SUEA 5ESBA 3VB4A 3V3MA 3QN7A 1QA7A 3SNCA 1HAGE 1JXPA 1DT2A 1G32B 4I32A 3FZDA 1G36A 1A5HA 1KY9A 1OWJA 1ID5H 3LT3A 2PTCE 3TGKE 3U1IB 1QBOA 1IOEA 3JZ1B 1K2I1 1QL9A 2QV1A 1QGFA 1UTNA 1EAUA 4GUXA 4NWKA 3QZQA 3SV7A 1LVYA 1DWCH 1TWXB 1XXDA 1GHWH 4DIIH 1NT1A 4A1XA 1IHSH 2A31A 5ESTE 1O2OA 2XWAA 5DP3A 1IQHA 1IQMA 1BHXB 2A1DB 1N6YA 3DA9B 3RXRA 3P8NA 4CRDA 5DPAA 1LHFH 2ZHEH 1DANH 1ANCA 1GL1A 1C5PA 1IQJA 2IOTA 2A0QB 5T3HA 4BAKB 4O03A 3TH4H 4NIVA 2SFAA 1TGSZ 9LPRA 1DOJA 3ZZ5A 1O3JA 1J9CH 1JBUH 3T27A 1C1NA 1V6DA 1YCPH 3M7QA 3UNRA 2Z3EA 1S5SA 2VIWA 5DP7A 2GCTB 4X1SU 1ELGA 2FI4E 1K1PA 3KF2A 5LGOA 1HAXB 1CA0B 1S0QA 3ZZ6A 1DUAA 3HKJB 1O2JA 1VJ9U 4I33A 1GBHA 2PSXA 2LPRA 4K8BA 2A4RA 1MU8B 2VIQA 8GCHG 1UHBA 2BXTH 1QBVH 1P01A 3DFLA 4X1QU 2FO9A 1BMMH 5HM9A 1QB6A 5CE1A 3IG6B 1QB1A 1WBGB 2M5TA 3SV6A 3RM0H 1EPTC 2OLGA 2ANKH 1AKSB 3C1KA 1O3BA 3JZ2B 4E05H 1Z8JB 1NTPA 2BDIA 3PMHB 3SU4A 1AFEH 1NFXA 1TA2A 3CP7A 4JYVH 5EXLA 1GMHG 4AB8A 3PYHA 3BTKE 1BBRH 1O2TA 5AHGH 2G8TA 3BEFB 1TNKA 2ZG0H 3ZZ9A 4J1YA 3I77A 1A1RA 5PTPA 3H5CB 5F03A 1C5NH 1EAWA 5LH8A 1ZPBA 3EA8A 1Q3XA 1CQQA 1QY6A 1GCTC 4K3JA 2W3IA 3KCGH 4K1EA 5BRRE 1O3CA 1K9OE 2PUQH 1GDNA 3SNDA 1QRXA 1PPBH 1PQ8A 1L1JA 3MH4A 2F9BH 1KXFA 2OC8A 4ZKRU 1K28D 3QWCH 2A2QH 4X1RU 3MFJA 1ZOMA 3M5NA 2TPIZ 2ASUB 4UFGH 3LGVA 3HGNA 2SNVA 3AW1A 4BTTB 3U1JB 3AW0A 5G4BA 5CHAB 5EODA 2G81E 2QYIA 3DT0H 5EQRA 3V13A 3F1SB 3UREA 2AEIH 2QF0A 5DG6A 2ALPA 3LKWA 1C5OH 1O2NA 4XBDA 3TH3H 1Z6EA 3MYWA 6LPRA 2RCEA 3VB3A 2SNWA 2XW9A 1F2SE 2D2DA 1YP9A 1GI4A 1WU1A 2BM2A 1MBQA 1V2PT 2ZU2A 1W0ZU 4ABFA 1EB1H 3MO6A 1MTSA 4ZH8A 1FJSA 1ZTLA 1NM6A 1CT0E 3MI4A 2H1UA 1QCPA 3ZV8A 1GVZA 3E3TA 4HZHA 5LPFA 2G4TA 3P92A 1EKBB 1AKSA 2BLOA 4CRAA 2ZCKP 1AQ7A 1OPHB 2G5NA 1CBWB 1OP2A 4A7IB 1T8OA 1SLVB 3E16B 1F0TA 3ATMA 1WTHD 2H6MA 4MNWA 3EA9A 2PKSB 1EQ9A 1O2MA 2GMTC 1HBTH 3TIUA 1LVMA 2C8YB 1UVOA 1J15A 5A2MH 3M37A 2BDAA 1HRTH 1EX3A 1O3HA 3MU4A 1YPHC 1HJ8A 4FUCA 3BTME 1FY4A 1W3CA 1GGDC 1P03A 2FIRH 3ZVBA 4JCNA 1SR5C 3K9XB 4TY6A 1S83A 2ZHDA 1T4VH 3NCLA 1TRMA 1LTOA 2H5CA 3SNAA 2FTMA 2AGGX 1BOQA 3U8TH 3UWIA 3R0FA 2FX4A 2BY8X 2ZU3A 1V2ST 2C8XB 4DOQA 1TQ0B 1VCQA 3L3TA 3KHVA 1Y59T 4X1NU 1AGJA 5A0BA 1SL3A 4GSOA 3BIVH 1K21H 4XSKU 2ZTZA 3BF6H 1IQGA 4BAQB 4OS4A 1KIGH 5C1YA 3PWCA 1VITG 2Y82A 5EG4A 1Z8GA 3Q3XA 5GCHG 3B8JA 4WH6A 1THRH 4AFUA 2B7DH 4UDWH 5AFYH 1YCPK 5HYOA 1BJUA 3LIWA 1O36A 1MH0A 1YPEH 1AE8H 1TPOA 1JRTA 2ZI2H 4GHTA 3RXCA 3D49H 2BMGB 1C5WB 1P9SA 1GDQA 2WUCA 2ZDKA 1G37A 3ZVFA 1GHZA 2ZCHP 4AYYB 3SW2B 1TGTA 4K2YA 1TMBH 1N6XA 4HI3A 4INHA 2H9EH 2BDCA 3M3TA 5JBTA 1EZXC 3T2NA 1TPSA 3O8RA 1WUNH 2HNTC 3F9HA 1QL8A 2ZFTA 2Z9LA 1Y3YA 1VITF 3TGJE 5GCHF 1O2RA 2ODYB 2FS9A 3VGCC 1ETRH 1YKTA 2JETC 3MMGA 1TNIA 2YOLA 4AB9A 4B71A 1THSH 1P10A 1PPEE 1ZHMA 3SJOA 1WTGH 3RDZA 3L6PA 1A3BH 1MD8A 5DP9A 3BEUA 1GBLA 2FWWA 1Y5BT 2PFEA 3LGYA 1ESTA 1H4WA 3MH7A 2WV4A 1NZQH 1ZMLA 2ULLA 2TGAA 3O8DA 2QXIA 1N8OC 4B73A 2FX6A 1GI7B 1B7XB 4AG2A 3SU3A 4MNVA 1QHRB 2XRCA 1SLXB 3OX7U 1H1BA 3SUGA 3S0NA 1K22H 5B6OA 2P16A 1GWAA 3B23B 1EATA 2TRMA 3EE0B 1EPTB 4BTUB 1THPB 6ESTA 3M7UA 1Y3WA 3T5FH 2PV9B 3MH6A 1OYQA 2FLRH 4U32A 1C2EA 2O8TA 5BPEA 2P59A 1P2KA 2R2MB 1C4Y2 3KEEA 4Y8XA 1TGBA 3FZZA 3PROA 3OSYA 1ZSJA 1LCYA 3T28A 1VGCC 3MO3A 1SFQB 4B75A 1IHTH 1T8LA 1TX7A 2ZFRH 1P2NA 3RXQA 3GY2A 1UMAH 1SPJA 2Z9KA 1L1GA 1O3AA 1SC8U 3V0XA 2AIPA 1GBMA 1PFXC 4ABGA 2G52A 1GCTB 1GI5A 4E06H 4YOGA 1RS0A 4Y10E 4YOJA 1ETTH 1FY3A 4E7RG 1FV9A 3KQEA 4XDEA 2FOMB 1DITH 1SBWA 2OBQA 1P2OA 4B74A 2C93B 2RDLA 5E8EH 3FVFB 4A5TS 3P8OA 3PLPA 3SN8A 3EDXB 1QB9A 2ZDLA 4BOHA 1GI9B 4WH8A 4SGAE 2OINA 1GJ8B 2C8WB 1TE0A 3TU7H 1MCTA 1AD8H 4GCHG 5LPEA 3W95A 3SV9A 2KAIB 5E2OA 4FVDA 5FAHA 2BOKA 3ZYEA 3CENA 3EGKH 2A4GA 1C2FA 4AFQA 2V35A 2XYAA 2FOAA 4ZMAH 4K5ZA 1GBCA 1C1OA 3BEIB 2UWLA 5A8YA 1BA8B 2SGAA 2ZDVH 3SHAH 2VVVA 1CHOG 1GJBB 2AIQA 3VXEH 5AF9H 2B8OH 4FVBA 3PTNA 4MPUA 4O3TA 1ELBA 1FMGA 1BRUP 1P12E 2XWBI 3RXAA 3MOCA 4OS7A 1V2NT 2G00A 2V3OH 2Z3DA 3GCHB 1EPTA 3L33A 2EEKA 1ELAA 1SFIA 5J4SA 2A7CA 3Q00A 4YESB 1JIRA 4JYTA 2BX4A 4KTUA 3DHKH 2GGVB 1V2KT 3PLKA 4GCHF 2C8ZB 2GZ9A 1MMJN 1SOTA 4Z0KA 1ZR0A 5EGMA 2GMTB 4F49A 1O32A 4IC6A 4CR5A 5C67A 5AFZH 4IN2A 1BRBE 3A7VA 1MCVA 4O9VA 1BTPA 1BMLA 2UWPA 1CHOF 3M36A 4XBBA 2FODA 1S82A 2UUKB 4I8LA 4MDSA 2F9PA 5JBAS 1BRAA 1MU6B 1O3IA 4H4FA 1QL7A 1NPMA 1TGCA 4F4OC 1SGFA 4A1TA 1FPHH 4MQAA 4ABIA 1Z8IB 1WAYB 2BVSH 1EXFA 1H9IE 1IQLA 1DVAH 1TLDA 3P6ZB 2B0FA 3FAOA 3QTVH 3S7KB 1GI8B 2VINA 1O3MA 1NFYA 3TJNA 1C4U2 1D3QB 2ZO3H 1GBTA 2ODPA 3RMMH 2ZEBA 3PLBA 3SJ8A 4JZIA 4AN7A 2XNIA 1L1NA 1SGEE 1AU8A 2KAIA 4KGAA 1TIOA 1T4UH 2CF8H 3NPSA 2VIDA 1MKXH 4ZKOU 3DD2H 3EQ0H 3SJIA 5A0CA 2ZWLH 1XM1A 4J2YB 1HIAB 4NIWA 3SO3A 1O2QA 4AX9H 3TK9A 1DY8A 3MO9A 1QURH 2FOHA 1AVGH 1ELCA 2PR3A 3BTHE 1O2ZA 1BTXA 3OU0A 1C1MA 4DY7B 4HGCA 2WINI 2XBVA 1AWHB 1O2IA 4Y0ZE 3U69H 4RKOB 5T6GA 4X2WA 1J8AA 2A7HA 3A85A 2H9TH 2VH6A 3RXTA 1O2KA 1UO6A 3MNBA 4ISIH 1FY8E 1YPGH 2A2XH 1TA6A 5DO4H 1AFQC 1P09A 3HKIB 2EC9H 3E6PH 4NA8A 1V2JT 4ZHLU 7LPRA 1AHTH 1MTVA 1UTOA 1AO5A 1E37B 1HAIH 3GDUA 5EQSA 4CH2B 3ATLA 1W13U 1Z1IA 1O3OA 3RXJA 1C2KA 2HVXA 2Y6TA 3A8CA 3F9GA 3URCA 1V2LT 3SQHE 1TNHA 3LC5A 1P9UA 3PB1E 4TYDA 2P94A 1F0RA 1O5AB 1BZXE 3SJ9A 3RMOH 2AFQB 1EP5A 3C27B 4XBCA 1CGJE 1PQ5A 2UWOA 2P3UB 1KLJH 3M61U 3STIA 2FOCA 2Z9IA 3CS7A 2Z9GA 1GBKA 5HM2A 4WVPE 1F5RA 3A7WA 2VGCC 1HJAC 1GI0A 4NA9H 1S81A 2SGPE 1GBBA 2R2WU 1N8OB 1A3EH 2BYAX 1O3PB 4ABAA 1W2KH 1HAPH 3BIUH 2A5AA 3FFGA 2LNCA 1M9UA 4INLA 1GHVH 4ZHMU 1TX8A 2BZ6H 3EYDA 1J17T 3ITIA 5DGJA 1HIAA 7GCHG 2RA3A 2ZHFH 4MNYA 2OXSA 2F3CE 1S85A 2Z3CA 5ABWA 1XVOA 2HGTH 1BTHH 1MTUA 5JB9S 1UK3A 1A5IA 1SVPA 1D4PB 1P2JA 2J9NA 2QXJA 4FXGH 1DLEA 1RTFB 2VVUA 1V3XA 2IPHA 2AMDA 4D9QA 1VGCB 1EJMA 3OYPA 1DXWA 1FPCH 3RXGA 1DICA 5IDKA 1LPGB 2VIPA 4MPVA 2ZGCA 3ZZBA 2FI3E 2NU4E 5ETXA 3GY8A 3OY5U 1XUHA 1ANDA 3UQOA 3A7ZA 3HGPA 4NA7A 4ZAEA 1T8NA 1UCYH 1CT2E 1ZJDA 1ZMNA 3O8BA 4WJG2 1A0JA 2BZAA 7GCHF 1C5QA 1ORFA 4IC5A 5FPSA 4Q7ZA 3GYMA 2EA3A 4UFDH 1GBAA 3S9BA 1F92A 2ZDMA 5C20A 4NG9H 4JYUH 1ANEA 1QIXB 2QCYA 2FMJA 5EPYA 1W12U 1YM0A 1OSSA 4IGDA 4WWYA 1JIMA 1YPJH 5FBIA 3HK6B 1BBRE 4FUGA 5C5NA 4KELA 1QNJA 2I6QA 4JZFH 1HXEH 2BLWA 4WMDA 1BUIA 2P95A 3ATWA 3TJUA 1W11U 1NFWA 5L2YH 3SNEA 4JZEH 5J4QA 2BDHA 2ZA5A 2FOGA 3Q3KA 1C2IA 2Y7ZA 2QA9E 4X2VA 4IW4E 1YF4A 1DWBH 2QGRA 4YOIA 2STAE 2P3FH 1O37A 1PJPA 1XVMA 4BAOB 2O8UA 1VZQH 1Y5AT 5E0JA 1AMHA 3BTDE 1ZLRA 1SGTA 4DT7B 1UTQA 3RXFA 1GBDA 2Q1JA 2WV5A 1PQAA 3A89A 2A4QA 4WMFA 1NN6A 5A8ZA 1LPKB 2BD2A 4RKJB 2A5KA 1FAXA 1P05A 2JH0D 1OX1A 3UR9A 1KDQB 4DW2U 1BITA 1A0LA 1P2MA 4GVUA 1FN6A 1UTPA 3DFJA 1OWDA 1NU7B 1DXPA 1L2EA 3A7TA 1QR3E 2ZC9H 4A1VA 4BTIB 1O2GH 1W7XH 2GT8A 2GZ8A 5GDSH 1D3TB 2OQUA 3A8AA 2J95A 2ANMH 3RC4A 3I78A 2BDGA 2CHAC 1J14A 2O9QA 3ZZCA 4VGCB 3E0PB 1D9IA 4ESTE 4OS5A 5C5OA 2PUXB 2W3KA 4FUBA 4PROA 2HOBA 4ASHA 4CHAC 1FAKH 1UVSH 3K6YA 1YPLH 1C1WH 5FX6A 2VWMA 2BDBA 1SGQE 1AVXA 1RGQA 1QBNA 2WPKS 1G2MA 4NFEA 1C5XB 4YTAA 5EXMA 1CGIE 2PHBA 2D26C 1Z6JH 4UE7H 1TX6A 1O2LA 1HCGA 1GMCG 3VFEA 4R0IA 1P57B 4LZ4B 6GCHF 3STJA 3FP8E 2CV3A 1AIXH 2F91A 1TONA 4LOYH 1AI8H 4GAWA 3SNBA 5DK1A 4CR9A 1MQ6A 4O3UA 3V12A 1V2TT 1FONA 3ATKA 2A32A 2CF9H 1GCDA 4X6MA 2ZKSA 1FUJA 1SQOA 1YC0A 1BIOA 1G30B 3RXLA 1WOFA 4TPYA 2VWOA 1AN1E 1YLDA 2THFB 4BAMB 2VH0A 4ZHAA 1S6FA 2FS8A 1Z8RA 2W26A 1C2HA 4CBNA 2GDEH 3I29A 1BTZA 3A8BA 3BTQE 5JBCS 2BTCE 3GDSA 4DIHH 1KDQA 2BD8A 1C1RA 3KL6A 1GMCF 5L2ZH 3RM2H 2J4IA 1TRNA 1DLKB 1XKBC 3LGIA 5A0AE 2BHGA 5EPNA 1QJ6B 4X8TH 2GX4A 2HLCA 4QT8C 1DFPA 1MTWA 3P8GA 5FX5A 3PTBA 3FP7E 5JBBS 1C1VH 5TJXA 4YLQH 1OP0A 5JPMH 1JMOH 1UVPA 3MH5A 4BNRA 3ZVCA 1P04A 4B76A 5EQQA 2OBOA 3GYLB 1Z7KA 1DM4B 1ZPZA 2NU2E 5EU8A 2FOEA 4ZXXH 2VGCB 3BTWE 1CO7E 1AB9C 5FCRA 3HATH 1O3LA 1UK4A 2P3TB 3D65E 3ZVAA 1U6QA 1GI3A 3KN2A 2WPIS 4K8YA 1LHEH 2HWLB 2IJOB 4ZUHA 1JRSA 2P93A 2H2ZA 3UQVA 2BD5A 4THNH 1EJNA 4NZQA 1ELFA 1DUEA 4ABEA 4RN6A 1E0FD 1BBRK 4Q80A 1XX9A 1KXBA 3SOSA 2ZGXH 5DP8A 3NKKA 1P2IA 4B2BA 4D7GA 2ZFQH 1UTMA 2R3UA 1PPCE 2PKAB 2BY5X 1KLIH 1T8MA 3RMLH 4ABDA 2DE9A 3UUZA 4FU7A 2BDYA 1K1MA 2OTVA 3RXSA 1JOUB 1GHAG 1IAUA 4SGBE 1UJ1A 4OS6A 1C5VA 2BVRH 1RTLA 3ODFA 5F8ZA 4WF8A 3SU1A 3KGPA 1HAHH 3E91A 3MU5A 4MG3A 1GHXH 1DWEH 4TPIZ 4YT6H 3W94A 1P06A 1GJ4H 2XCFA
chains in the Genus database with same CATH superfamily
4UONA 2ZPRA 2IN2A 4H42U 1GJ9B 3SI4H 1C2LA 2ODQA 3GOVB 2WZQA 3TK5A 3BTGE 1MTNC 4FUIA 3T62A 5GXPA 1TMUH 4ASUD 1SGRE 3ENSB 1K1IA 4ZKSU 2H5DA 2AMPA 3FO8D 5FPTA 3PMAB 1SI5H 3E1XB 1BJVA 1O38A 2ESTE 1LHCH 3KYGA 3MHWU 1MKWH 4I8GA 1C5TA 2GVFA 1ACBE 1ESAA 1KTSB 1C1SA 1B5GH 3UR6A 1ABJH 3RLWH 1OWIA 3K2UA 1GHAF 2F4LA 1B0EA 1V2VT 2LP6A 2ZFSA 2XCNA 1HJ9A 1BTUA 1O3GA 2WPMS 1V2RT 4Y11E 3V7TA 3SHCH 1AY6H 1TABE 1FNIA 2SGFE 1GI2A 5C1UA 4O97A 2XBXA 2WPJS 2OC7A 4YM9A 2ZU4A 4JZDH 1ABIH 2VB0A 4X8UH 3S9AA 1FI8A 3QX5H 1NU9A 1H8HD 1H8DH 2Z6BD 1ELVA 3A87A 2FI5E 2ALVA 3KIDU 2GV7A 1DSUA 4ZROA 2XC5A 2AMQA 1ANBA 2FDAA 4DGJA 2PKAA 3MNCA 1MD7A 3ESTA 3O8CA 3KNXA 4UD9H 2XNDD 3OY6U 1HAYB 4DG4A 5L30H 2W6JD 2VIVA 2A5IA 1BT7A 2VVCA 4BXSA 3KYFA 1INCA 2QN5T 3TGIE 1TB6H 3D23A 2ZDNA 4NWLA 3E0NB 1LKAA 4OGXA 3FN8A 5A8XA 2GV6A 1C1QA 2XC0A 2WPLS 1SMFE 1O34A 1SOZA 1OXGA 4X6PA 2GDDA 1HYLA 3AAUA 4DJZB 4Y76A 2WPHS 1BMFD 1W0JD 2CHAB 4MPWA 3A88A 1V2OT 4U2WA 4IMZA 2VBCA 3H7TA 4JZ1A 2H9HA 2XBWA 1FZZA 1L4ZA 1XUJA 3WY8A 1ZGVA 2KR7A 1TOMH 1BHXF 1QJ1B 3MNXA 2JH5D 4NIYA 4B6EA 4CHAB 4ISNA 4Y0YE 3TJVA 3RXIA 1SLUB 2BD9A 2FYRA 3SU0A 3TVJB 2GKVE 2PTNA 1TBRH 5CHAC 4LZ1H 3BG8A 3WWFA 5E2PA 1GGDB 1QQUA 1F5KU 5EIYA 2PWXA 1F0SA 2RDEA 2F43B 3F9EA 1EZQA 1XUFA 3LDXH 3SU2A 1OWEA 3QZRA 3VB5A 2K8IA 1ZHPA 3HK3B 1W10U 4JMYA 3ZVDA 1W7GH 1C2DA 6CHAC 1G3BA 1O3NA 3QLPH 3DUXH 2R3YA 1GHYH 3RXPA 1D3DB 2ZQ1A 1E35B 1O3DA 2BY9X 2QIQA 4ABBA 3RXKA 3NXPA 2PW8H 2OC0A 2FPZA 1LKBA 1O35A 3UY9A 2L6OA 1GJAB 3LGUA 3RXDA 1KXEA 1OHHD 1ZTKA 4IN1A 1DPOA 4F55A 5F6MA 8LPRA 3GY3A 3QGJA 4R8TB 3RU4T 1ZMJA 1OS8A 2AH4X 3TITA 1IQEA 1GBFA 1WSSH 3W1EA 2D1JA 1K1NA 1SQTA 1YGCH 1O31A 4MVNA 5IYTA 3ZZDA 1EOJA 2PKSC 1SGCA 3UNSA 3R3GB 1TGNA 4NFFA 4BXWA 3ZZAA 4MTBA 3TPIZ 5L6NH 2PLXA 1LQEA 3F9FA 4Y7BA 5F53A 3GS9A 1SQAA 2R0KA 2ANWA 1CHGA 4HTCH 3VB7A 1C2GA 5FL7D 1YLCA 1ELTA 1T32A 5C3NA 1HFDA 3E90B 2ZIQH 5DP6A 2BVXH 2FLBH 4IMQA 1MAXA 1NRRH 4MPXA 1AB9B 4DCDA 2Y5FA 4KTCA 2ZP0H 3AK5A 3SU6A 3D62A 2ZPQA 2Q6GA 3UIRA 1OWHA 2NWNA 3BN9A 1DS2E 4NZLA 2FTLE 3GY5A 1ZTJA 5DP5A 2ZTXA 1ESBA 3VGCB 1HLTH 2DE8A 2JETB 1HGTH 2CK3D 1Z71A 1D6WA 2FEQH 2FP7B 2Z9JA 2J92A 2J38A 2J2UA 3T29A 4AGJA 1S6LA 1YYY1 3UNQA 2XBYA 3U28C 4YT7H 4U01A 1TNLA 2UUJB 1GVKB 3IITA 4Y79A 1O2PA 4X1PU 4H6SB 3RU4D 2ZU1A 8KME2 3PMJA 7ESTE 1H8IH 1BMNH 1GVLA 2QXHA 2VJ1A 1LQDB 2D8WA 4CH8B 1OKXA 3SJKA 1GPZA 2BD7A 5F8TA 1Y3UA 3UTUH 3BG4C 5DN6D 1ZSLA 1CSOE 3GY4A 2ANYA 5JYIA 1CGHA 2FOBA 2J94A 4CRFA 3M5OA 4Y71A 1F7ZA 1A46H 4F48B 1MBMA 2FXRA 3F68H 2YNAA 5E0HA 3BTTE 1MTNB 1EASA 4YO9A 4K60A 1HUTH 1GBIA 4BANB 2WYJA 4P00A 1ZYOA 4ABHA 1QTFA 4YZUA 2CGAA 1Z1JA 1HB0B 1SG8B 4X2XA 3A81A 3S69A 1C2MA 3P8FA 4IS5A 3P95A 4FU8A 1WQSA 3GICB 3P17H 3GCOA 3EA7A 3GCTG 1XKAC 4XFQA 2HPPH 3F0OA 1OP8A 3QDZB 3RU4E 2DUCA 2WYGA 1ARBA 3SZNA 3LGWA 5SGAE 3A7YA 1OWKA 1NRSH 4AFZA 4JK5A 3NUMA 3LH1A 4AZ2B 1KTTB 4GLYA 1O5DH 3ZZ4A 2JKHA 1ELEE 3BTEE 3AVZA 1PPZA 4GPGA 1E38B 1RTKA 2ZPSA 3SGBE 1CVWH 4XOJA 2UUFB 1UCYE 2ZDAH 1FY1A 3A83A 1AZZA 2ZCLP 3AAVA 1C5YB 3A8DA 1ZRKA 2C90B 4UFEH 2HVYB 1G3EA 2BOHB 1SGYE 3RXUA 1K0HA 1KXCA 1ZRBA 2TBSA 4FUFA 4TWWA 4I8KA 1SSXA 2W7SA 4WMEA 1C1TA 3WW7A 3GCTF 1UK2A 2CN0H 9ESTA 2AERH 2O8LA 1T7CA 1A61H 5JB8S 2XC4A 1DY9A 1PYTD 1GG6C 1MZAA 1O0DH 2J34A 1A4WH 2F9UA 1C4V2 1MAYA 3LJOA 1P3EA 3S7HB 1SGIB 4K1SA 1EZUC 1T31A 4TT3D 3LU9B 4DVAU 4I31A 3OTPA 5K7RA 3ZVEA 1V2UT 2WHXA 4Y6DA 3P70B 4WXIA 8GCHF 1O33A 5DP4A 3NWUA 4OGYA 1O5FH 1UTLM 2NU1E 1TOCB 3A84A 1RIWC 2ZGJA 5I46H 1MKXK 1B0FA 1O3KA 2HPQH 4FU9A 1V2QT 3GDVA 4CRCA 4X0WU 1C5ZB 2VWLA 4FUDA 3RC6A 4CRGA 4AC9A 3KQDA 1VITH 2BX3A 3PO1C 1GJDB 4NSVA 1GMHF 4E7NA 4FUEA 2W5EA 1C2JA 2G4UA 5GPIB 1W14U 1OYTH 1P8VC 2G5VA 3F2GA 2ZQ2A 2A7JA 1Y3VA 3MTYA 5GNDA 3SUDA 4TWYA 5LPRA 4A6LA 1YPHE 2ZHQH 2O8MA 3DSOA 5T6DA 3IWMA 3LJJA 1F0UA 2C4FH 1AVWA 2BLVA 6CHAB 1ZZZA 1GHBG 5FCKA 1SGDE 1EUFA 2TGPZ 3U8OH 2G55A 1RFNA 2ZGBH 2ILNA 2FM2A 1ELDE 3VB6A 1G2LA 1CU1A 1NS3A 3H7OA 4B6FA 4AFSA 4Q2KA 2RG3A 4ZXYH 2V6NA 1C9TA 4YLUA 3GCHC 3RP2A 1SGFG 2OK5A 5HIZA 2ZFFH 2V0BA 5H4IB 5HMAA 1FLEE 2J5UA 3Q77A 1LDTT 2K0QA 5EJZA 1NO9H 3A7XA 3SV8A 3T26A 2P8OC 1O2YA 3N7EA 4FUHA 4Q63A 4AG1A 2Y7XA 2EI8A 3N7DA 4X8VH 4ABJA 7KMEH 1BTYA 5GIBA 2BD4A 1AZ8A 1TYNA 2TIOA 1IQKA 1YCPM 1BTWA 1PYTC 2PGQB 2Y80A 3QK1A 5JDUB 2NU0E 1PPGE 1GHBF 1QJ7B 3SU5A 1S6HA 3SUFA 2G51A 1CA8B 1G9IE 3MWIU 2STBE 3A80A 2CMYA 1P3CA 1RD3B 1HAOH 1BMAA 1O5CB 1AFQB 1FIWA 1QRWA 5DKMA 2OP9A 3S9CA 5FHTA 4INKA 5CHBA 4CBOA 3FKSD 1F5LA 1P02A 4RT1A 4WXVA 1XUGA 5K0HA 1VCPA 5AVDA 1C1PA 4NGAH 1TALA 2Q6FA 4D9RA 1GMDG 2BB4A 5EJ1A 1TNGA 2CJIA 1UVUH 1UTJA 1DWDH 1O2UA 1YY3A 3PRBA 1SHYA 3VXFH 2B5TB 1BCUH 1UTKA 1BRCE 2HNTE 2TGDA 3MU0A 5GJ4B 1Y3XA 2KZ4A 4UFFH 1K1JA 1FXYA 2GTBA 4B2AA 1RJXB 2Y5HA 3SI3H 1RRKA 3QO6A 2O8WA 3VPKA 4Y8YA 4KP0A 1H9LB 1O30A 1SB1H 5GWZA 2UUYA 2QF4A 3LH3A 3M7TA 4XE4A 5EOKA 1E34B 1GBEA 4K69A 1W0YH 1QA0A 5EW2H 4I8HA 1HJAB 3F2HA 2GD4B 3FP6E 1LHGH 2YMSD 2Z7FE 1UCYK 2QC2A 3Q3YA 4TY7A 1GJ5H 5FPYA 1GMDF 2I6SA 2C3SA 1LMWB 1O3FA 2GT7A 3BG4B 4A92A 1EB2A 2SGDE 1YPMH 4ZKNU 1SHHB 4NSYA 1NY22 3LC3A 1LPZB 2B9LA 3M5LA 3ZYDA 3PWBA 4CRBA 1TBQH 1O3EA 3CNRA 5TCCA 1SGNE 2F9VA 1VR1H 4LXBH 4Y8ZA 1C5UA 3RXVA 3M3VA 3MU8A 1GL0E 3SGAE 1N1LA 2A4OA 2ZU5A 2ZFPH 1WQVH 2OC1A 3ATIA 1AUTC 2BQ7B 1ARCA 1O2SA 3RC5A 1IQIA 3BTFE 1JWTA 1TMTH 3B9FH 2QE7D 2XTTB 1K1OA 4K1TA 1VJAU 3TJOA 1V2MT 3UFAA 4Z6AH 1MZDA 3UAIC 1HDTH 3N7OA 3PM3A 1LVBA 2JH6D 1YWUA 5TCAA 1NRNH 2JJ2D 3RUOA 1D3PB 1Y8TA 3UOPA 2K1QA 5HGGA 4B2CA 1L4DA 5FBEA 3BV9B 4I8JA 2W7UA 1GBJA 2GZ7A 1V2WT 1ETSH 2Z94A 2IPQX 1L0ZA 1P11E 1WCZA 3UPEA 3CS0A 4M7GA 4D76A 5HXFA 2ZF0H 1TNJA 2VU8E 3TNTA 1TAWA 1O2VA 3SORA 1GI6A 1C5LH 2OUAA 1HXFH 1G3DA 3Q76A 2SGEE 1P0SH 4MNXA 4AORA 5T6FA 1XMNB 2CXVA 3BSQA 3ZZ8A 2R9PA 2BY7X 1E36B 3QUMP 5T1VA 4Y7AA 3GY6A 3KQBA 1BQYA 3VG8A 2FZZA 1GG6B 5EW1H 1KLTA 1O5GH 4ISHH 2GCTC 2NU3E 1WV7H 4WY3A 3F6UH 1CA0C 1ZSKA 1TFXA 2YMSC 2R0LA 2V3MA 1O5BB 4U30A 1TPAE 1Q2WA 1TQ7B 1C1UH 3U9AH 5DJ7A 2OQ5A 1C9PA 2OCVB 4D8NA 1HAZB 5DSFA 1NC6A 2FESH 1QFKH 3ZZ7A 1CE5A 1OOKB 3RXMA 2V3HH 2AGEX 5CMXH 1NRPH 1RIWB 2F9NA 3LOXA 3RXBA 3UOUA 1GJ6A 4JK6A 2HNTF 1TBZH 3T25A 4CREA 1EJAA 1QRZA 1CT4E 4ACAA 1C5MD 1DE7H 1NROH 1KYNA 3UWJH 3PO1B 4Z1MD 3GISB 1HNEE 1FIZA 2EY4C 3PMBB 4NIXA 4ISLA 3ODDA 2BD3A 4IBLH 1K1LA 3A82A 1KSNA 1ZJKA 2F9OA 2OD3B 1FQ3A 1EZSC 2QAAA 3RMNH 3EAJA 4RSPA 3SV2H 1PQ7A 2PGBB 1Y5UT 4H6TA 4OM9A 3E8LA 1O39A 1EP6A 3OTJE 3OEED 1O2HA 3HPTB 2HRVA 4D7FA 3NZIA 3NK8A 4DURA 1EAIA 1S0RA 2AGIX 3A86A 1YPKH 2Y5GA 4AYVB 3GCNA 2QY0B 1KXAA 4X6OA 5C1XA 3SBKA 1VCWA 3U98H 1UVTH 1WYKA 4ACBA 1LO6A 3ELAH 3LONA 3M5MA 4Q7XA 3TNSA 3OAAD 1AE5A 3RXEA 2P8OB 2GCHG 3RXHA 1DDJA 2EI6A 4X2YA 1GI1A 1HAVB 3ZZ3A 1IQNA 1BB0B 4B1TA 4HFPB 2GP9B 2A45B 4UEHH 4X6NA 2BQWB 1TPPA 1X7AC 5F8XA 5E0GA 2WSSD 3LPRA 4BAHB 4AGKA 1A5GH 1C5SA 3K65B 2BXUH 1O5EH 1RXPA 2F83A 1ZHRA 3LGTA 2FYQA 3PV4A 4KTSA 4FUJA 4NCYA 2XXLA 2Q6DA 4KKDA 2ZECA 1GJ7B 2BLQA 4VGCC 1CBWC 2ZTYA 3U8RH 3RXOA 1AUJA 3MU1A 3SGQE 2VWNA 2AS9A 1DX5M 1XUKA 2BY6X 3FANA 1QQ4A 1AWFH 2GCHF 1GJCB 5EXNA 3KQCA 1FN8A 1S84A 2AYWA 4X8SH 1KXDA 1HPGA 1PPHE 1O2WA 2EI7A 2WUBA 3ZV9A 1IQFA 4AOQA 1C5RA 2ZHWH 3M35A 5C2ZA 1MQ5A 1LVOA 8ESTE 6GCHG 1A0HB 5FXLA 3URDA 2VIOA 3AASA 2RA0A 2SGQE 1G3CA 1EAXA 2Y81A 1PPFE 1ZPCA 3M3SA 2TGTA 2QF3A 1XXFA 2PSYA 5I25A 1SGPE 3MNSA 1HV7A 1O2XA 4ISOA 1FY5A 1MUEB 3G01A 3QTOH 1D6RA 4MLFB 1A2CH 3K6ZA 2QXGA 4Q7YA 3QGNB 4OS1A 1A7SA 4Q4LA 3SQEE 2ZNKH 1W8BH 1TRYA 1MKWK 2BQ6B 1UHBB 1H9HE 1SLWB 1ZGIA 1NESE 1NFUA 3RLYH 1J16A 2VNTA 2ZZUH 1DSTA 1HAVA 1BDAA 3TK6A 2HALA 4GHQA 1P2QA 5A09A 2YNBA 2ZGHA 1NRQH 4OS2A 1LHDH 1EOLA 1GDUA 1FDPA 4I7YH 2FOFA 1XUIA 3VEQB 3TH2H 1SQRA 1YBWA 3SZEA 3ZVGA 3TLOA 4LK4A 1Q31A 3GY7A 1KMHB 3SUEA 5ESBA 3VB4A 3V3MA 3QN7A 1QA7A 3SNCA 1HAGE 1JXPA 1DT2A 1G32B 4I32A 3FZDA 1G36A 1A5HA 1KY9A 1OWJA 1ID5H 3LT3A 2PTCE 3TGKE 3U1IB 1QBOA 1IOEA 3JZ1B 1K2I1 1QL9A 4FETA 2QV1A 1QGFA 1UTNA 1EAUA 4GUXA 4NWKA 3QZQA 3SV7A 1LVYA 1DWCH 1TWXB 1XXDA 1GHWH 4DIIH 1NT1A 4A1XA 1IHSH 2A31A 5ESTE 1O2OA 2XWAA 5DP3A 1IQHA 1IQMA 1BHXB 2A1DB 1N6YA 3DA9B 3RXRA 3P8NA 4CRDA 5DPAA 1LHFH 2JJ1D 2M2AA 2ZHEH 1DANH 1ANCA 1GL1A 1C5PA 1IQJA 2IOTA 2A0QB 5T3HA 4BAKB 4O03A 3TH4H 1WXRA 4NIVA 2L74A 1NBME 2SFAA 1TGSZ 9LPRA 2KCAA 1DOJA 3ZZ5A 1O3JA 1J9CH 1JBUH 3T27A 1C1NA 1V6DA 1YCPH 3M7QA 5C94A 3UNRA 2Z3EA 1S5SA 2VIWA 5DP7A 2GCTB 4X1SU 1ELGA 2FI4E 1K1PA 3KF2A 5LGOA 1HAXB 1CA0B 1S0QA 3ZZ6A 1DUAA 3HKJB 1O2JA 1VJ9U 4I33A 1GBHA 2PSXA 2LPRA 4K8BA 2A4RA 1MU8B 2VIQA 8GCHG 1UHBA 2BXTH 1QBVH 1P01A 2W6ID 1SKYE 3DFLA 4X1QU 2FO9A 1BMMH 5HM9A 2JDID 1QB6A 5CE1A 3IG6B 1QB1A 1WBGB 2M5TA 3SV6A 3RM0H 1EPTC 2OLGA 2ANKH 1AKSB 3C1KA 1O3BA 3JZ2B 4E05H 1Z8JB 1NTPA 2BDIA 3PMHB 3SU4A 1AFEH 1NFXA 1TA2A 3CP7A 4JYVH 5EXLA 1GMHG 4AB8A 3PYHA 3BTKE 1BBRH 1O2TA 5AHGH 2G8TA 3BEFB 1TNKA 2GJGA 2ZG0H 3ZZ9A 4J1YA 3I77A 1A1RA 5PTPA 3H5CB 5F03A 1C5NH 1EAWA 3OFND 5LH8A 3SYJA 5IK2D 1ZPBA 3EA8A 1Q3XA 1CQQA 1QY6A 1GCTC 4K3JA 2W3IA 3KCGH 4K1EA 5BRRE 1O3CA 1K9OE 2PUQH 1GDNA 4TSFD 3SNDA 1QRXA 1PPBH 1PQ8A 1L1JA 3MH4A 2F9BH 1KXFA 2OC8A 4ZKRU 1K28D 3QWCH 2A2QH 4X1RU 3MFJA 1ZOMA 3M5NA 2IJD1 2TPIZ 2ASUB 4UFGH 3LGVA 3HGNA 2SNVA 3AW1A 4BTTB 3U1JB 3AW0A 5G4BA 4ZCNA 5CHAB 5EODA 2G81E 2QYIA 3DT0H 5EQRA 3V13A 3F1SB 1EFRD 3UREA 2AEIH 2QF0A 5DG6A 2ALPA 3LKWA 1C5OH 1O2NA 4XBDA 3TH3H 1Z6EA 3MYWA 6LPRA 2RCEA 3VB3A 2SNWA 2XW9A 1F2SE 2D2DA 1YP9A 1GI4A 1WU1A 2BM2A 1MBQA 1V2PT 2ZU2A 1W0ZU 2WPDD 1W0KD 2KCOA 1EB1H 4ABFA 3MO6A 1MTSA 4ZH8A 1FJSA 1ZTLA 1NM6A 1CT0E 3MI4A 2H1UA 1QCPA 3ZV8A 1GVZA 3E3TA 4HZHA 5LPFA 2G4TA 3P92A 1EKBB 1AKSA 2BLOA 4CRAA 2ZCKP 1AQ7A 1OPHB 5C0TA 2G5NA 1CBWB 1OP2A 4A7IB 1T8OA 1SLVB 3E16B 1F0TA 3ATMA 1WTHD 2H6MA 4MNWA 3EA9A 2PKSB 3UB0A 1EQ9A 1O2MA 1QZ8A 2GMTC 1HBTH 3TIUA 1LVMA 2C8YB 1UVOA 1J15A 2V7QD 5A2MH 3M37A 2BDAA 1HRTH 1EX3A 1O3HA 3MU4A 1YPHC 1HJ8A 3N99A 4FUCA 2KCYA 3BTME 1FY4A 1W3CA 1GGDC 1P03A 2FIRH 3ZVBA 4JCNA 1SR5C 3K9XB 4TY6A 1S83A 2ZHDA 1T4VH 3NCLA 1TRMA 1LTOA 2H5CA 3SNAA 2FTMA 2AGGX 1BOQA 3U8TH 3UWIA 3R0FA 2FX4A 4RI0A 2BY8X 2ZU3A 1COWD 1V2ST 2C8XB 4DOQA 1TQ0B 1VCQA 1YLNA 3L3TA 3KHVA 1Y59T 4X1NU 1AGJA 5A0BA 1SL3A 3KQ5A 4GSOA 3BIVH 1K21H 4XSKU 2ZTZA 3BF6H 1IQGA 4BAQB 4OS4A 1KIGH 5C1YA 3PWCA 1VITG 2Y82A 5EG4A 1Z8GA 3Q3XA 5GCHG 3B8JA 4WH6A 1THRH 4AFUA 2B7DH 2KCPA 4UDWH 5AFYH 1YCPK 5HYOA 1BJUA 3LIWA 1O36A 1MH0A 1YPEH 1AE8H 1TPOA 1JRTA 2ZI2H 4GHTA 3RXCA 3D49H 2BMGB 1C5WB 1P9SA 1GDQA 2WUCA 2ZDKA 1G37A 3ZVFA 1GHZA 2ZCHP 4AYYB 3SW2B 1TGTA 4K2YA 1TMBH 1N6XA 4HI3A 4INHA 2H9EH 2BDCA 3M3TA 5JBTA 1EZXC 3T2NA 1TPSA 2QF5A 3O8RA 1WUNH 2HNTC 3F9HA 1QL8A 2ZFTA 2Z9LA 1Y3YA 1VITF 3TGJE 5GCHF 1O2RA 2ODYB 2FS9A 3VGCC 1ETRH 1YKTA 2JETC 3MMGA 1TNIA 2YOLA 4AB9A 4B71A 1THSH 1P10A 1PPEE 1ZHMA 2J97A 3SJOA 1WTGH 3RDZA 3L6PA 1A3BH 1E1RD 1MD8A 5DP9A 3BEUA 2KX4A 1GBLA 2FWWA 1Y5BT 2PFEA 3LGYA 1ESTA 1H4WA 3MH7A 2WV4A 4M9FA 1NZQH 1ZMLA 2ULLA 2TGAA 3O8DA 2QXIA 1N8OC 4B73A 2FX6A 1GI7B 1B7XB 4AG2A 3SU3A 4MNVA 3DSGA 1QHRB 2XRCA 1SLXB 3OX7U 3MQKC 1H1BA 3SUGA 3S0NA 1K22H 5B6OA 2P16A 1GWAA 3B23B 1EATA 2TRMA 3EE0B 1EPTB 4BTUB 1THPB 6ESTA 3M7UA 1Y3WA 2KFWA 3T5FH 2PV9B 2XOKD 3MH6A 1OYQA 2FLRH 4U32A 1C2EA 2O8TA 5BPEA 2P59A 1P2KA 2R2MB 1C4Y2 3KEEA 4Y8XA 1TGBA 3FZZA 3PROA 3OSYA 1ZSJA 1LCYA 3T28A 1VGCC 3MO3A 1SFQB 4B75A 1IHTH 1T8LA 1TX7A 2ZFRH 1P2NA 3RXQA 3GY2A 1UMAH 1SPJA 2Z9KA 1L1GA 1O3AA 1SC8U 3V0XA 2AIPA 1GBMA 1PFXC 2LELA 4ABGA 2G52A 1GCTB 1GI5A 4E06H 4YOGA 1RS0A 4Y10E 4YOJA 1ETTH 1FY3A 4E7RG 1FV9A 3KQEA 4XDEA 2FOMB 1DITH 1SBWA 1P2OA 2OBQA 4B74A 2C93B 2RDLA 5E8EH 3FVFB 4A5TS 3P8OA 2HLDD 3PLPA 3SN8A 3EDXB 1QB9A 2ZDLA 4BOHA 1GI9B 4WH8A 4SGAE 2OINA 1GJ8B 2C8WB 1TE0A 3TU7H 1MCTA 1AD8H 4GCHG 5LPEA 3W95A 3SV9A 2KAIB 5E2OA 4FVDA 5FAHA 2BOKA 3ZYEA 3CENA 3EGKH 2A4GA 1C2FA 4AFQA 2V35A 2XYAA 2FOAA 4ZMAH 4K5ZA 1GBCA 1C1OA 1UW7A 3BEIB 2UWLA 5A8YA 1BA8B 2SGAA 2ZDVH 3SHAH 2VVVA 1CHOG 1GJBB 2AIQA 3VXEH 5AF9H 2B8OH 3PV2A 4FVBA 3PTNA 4MPUA 4O3TA 1ELBA 1FMGA 1BRUP 1P12E 2XWBI 3PV5A 3RXAA 3MOCA 4OS7A 1V2NT 2G00A 2V3OH 2Z3DA 3GCHB 1EPTA 3L33A 2EEKA 1ELAA 1SFIA 5J4SA 2A7CA 3Q00A 4YESB 1JIRA 4JYTA 2BX4A 4KTUA 3DHKH 2GGVB 1V2KT 3PLKA 4GCHF 4RT0A 2C8ZB 2GZ9A 1MMJN 1SOTA 4Z0KA 2WV9A 1ZR0A 5EGMA 2GMTB 4F49A 1O32A 4IC6A 4CR5A 5C67A 5AFZH 4IN2A 1BRBE 3A7VA 5KEDA 1MCVA 2J98B 4O9VA 1BTPA 1BMLA 2UWPA 1CHOF 3M36A 4XBBA 2FODA 1S82A 2UUKB 4I8LA 5C17A 4MDSA 2F9PA 4P02A 5JBAS 1BRAA 1MU6B 1O3IA 4H4FA 1QL7A 1NPMA 1TGCA 4F4OC 1SGFA 4A1TA 1FPHH 4MQAA 4ABIA 1Z8IB 1WAYB 2BVSH 1EXFA 1H9IE 1IQLA 1DVAH 1TLDA 3P6ZB 2B0FA 3FAOA 3QTVH 3S7KB 1GI8B 2VINA 1O3MA 1NFYA 3TJNA 1C4U2 1D3QB 2ZO3H 1GBTA 2ODPA 3RMMH 2ZEBA 3PLBA 3SJ8A 4JZIA 4AN7A 2XNIA 1L1NA 1SGEE 1AU8A 2KAIA 4KGAA 1TIOA 1T4UH 2CF8H 3NPSA 2VIDA 1MKXH 4XD7D 4ZKOU 3DD2H 3EQ0H 3SJIA 5A0CA 2ZWLH 1XM1A 4J2YB 1HIAB 4NIWA 3SO3A 3PRDA 1O2QA 4AX9H 3TK9A 1DY8A 3MO9A 1QURH 2FOHA 1AVGH 1ELCA 2PR3A 3BTHE 1O2ZA 1BTXA 3OU0A 1C1MA 4DY7B 4HGCA 2WINI 2XBVA 1AWHB 1O2IA 4I86A 4Y0ZE 3U69H 4RKOB 5T6GA 4DT4A 4X2WA 1J8AA 2A7HA 3A85A 2H9TH 2VH6A 3RXTA 1O2KA 1UO6A 3MNBA 4ISIH 1FY8E 1YPGH 2A2XH 1TA6A 5DO4H 1AFQC 1P09A 3HKIB 2EC9H 3E6PH 4NA8A 1V2JT 4ZHLU 3F2FA 7LPRA 1AHTH 1MTVA 1UTOA 1AO5A 1E37B 1HAIH 3GDUA 5EQSA 4CH2B 3ATLA 1W13U 1Z1IA 1MABB 1O3OA 3RXJA 1C2KA 2HVXA 2Y6TA 3A8CA 3F9GA 3URCA 1V2LT 2J98A 3SQHE 1TNHA 3LC5A 1P9UA 3PB1E 4TYDA 2P94A 3OEHD 1F0RA 1O5AB 1BZXE 1NBMD 3SJ9A 3RMOH 2AFQB 1EP5A 5B6LA 3C27B 4XBCA 1CGJE 1PQ5A 2UWOA 2P3UB 1KLJH 3M61U 3STIA 2FOCA 2Z9IA 2AHME 3CS7A 2Z9GA 3OE7D 1GBKA 5HM2A 4WVPE 1F5RA 3A7WA 2VGCC 1HJAC 1GI0A 4NA9H 1S81A 2SGPE 1GBBA 2R2WU 1N8OB 1A3EH 2BYAX 1O3PB 4ABAA 1W2KH 1HAPH 3F3BA 3BIUH 2A5AA 3FFGA 2LNCA 1M9UA 1VKYA 1GHVH 4INLA 4ZHMU 1TX8A 2BZ6H 3EYDA 1J17T 3ITIA 5DGJA 1HIAA 7GCHG 2RA3A 2ZHFH 4MNYA 2OXSA 2F3CE 1S85A 2Z3CA 5ABWA 1XVOA 2HGTH 1BTHH 1MTUA 4YXWD 5JB9S 1UK3A 1A5IA 1SVPA 1D4PB 1P2JA 2J9NA 2QXJA 4FXGH 1DLEA 1RTFB 2VVUA 1V3XA 2IPHA 2AMDA 4D9QA 1VGCB 1EJMA 1WDIA 3OYPA 1DXWA 1FPCH 3DCLA 3RXGA 1DICA 3ZIAD 5IDKA 3NRLA 1LPGB 2YMSB 2VIPA 4MPVA 2ZGCA 3ZZBA 2FI3E 2NU4E 5ETXA 3GY8A 3OY5U 1XUHA 1ANDA 3UQOA 3A7ZA 2PP6A 3HGPA 4NA7A 4ZAEA 1T8NA 1UCYH 1CT2E 1ZJDA 1ZMNA 3O8BA 4WJG2 1A0JA 2BZAA 5C0UA 7GCHF 1C5QA 1ORFA 4IC5A 5FPSA 4Q7ZA 3GYMA 2EA3A 4UFDH 1GBAA 3S9BA 1F92A 2ZDMA 5C20A 4NG9H 4JYUH 1ANEA 1QIXB 2QCYA 2FMJA 5EPYA 1W12U 1YM0A 1H8ED 1OSSA 4IGDA 4WWYA 1JIMA 1YPJH 5FBIA 3HK6B 1BBRE 4FUGA 5C5NA 4KELA 1QNJA 2I6QA 4JZFH 1HXEH 2BLWA 4WMDA 1BUIA 2P95A 3ATWA 3TJUA 1W11U 1NFWA 5L2YH 3SNEA 4JZEH 5J4QA 2BDHA 2ZA5A 2FOGA 3Q3KA 1C2IA 2Y7ZA 2QA9E 4X2VA 4IW4E 1YF4A 1DWBH 2QGRA 4YOIA 2STAE 2P3FH 1O37A 1PJPA 1XVMA 4BAOB 2O8UA 1VZQH 1Y5AT 5E0JA 1AMHA 3BTDE 1ZLRA 1SGTA 4DT7B 1UTQA 3RXFA 1GBDA 2Q1JA 3FOAA 2WV5A 1PQAA 3A89A 2A4QA 4WMFA 1NN6A 5A8ZA 1LPKB 2BD2A 4RKJB 2A5KA 1FAXA 1P05A 2JH0D 1OX1A 3UR9A 1KDQB 4DW2U 1BITA 1A0LA 1P2MA 4GVUA 1FN6A 1UTPA 3DFJA 1OWDA 1NU7B 1DXPA 1L2EA 3A7TA 1QR3E 2ZC9H 4A1VA 4BTIB 1O2GH 1W7XH 2GT8A 3WWBA 2GZ8A 5GDSH 1D3TB 2OQUA 3A8AA 2J95A 2ANMH 3RC4A 3H09A 3I78A 2BDGA 2CHAC 5HIYA 1J14A 2O9QA 3ZZCA 4VGCB 3E0PB 1D9IA 4ESTE 4OS5A 5C5OA 2PUXB 2W3KA 4FUBA 4PROA 2HOBA 4ASHA 4HG6A 4CHAC 1FAKH 1UVSH 3K6YA 5KECA 1YPLH 1C1WH 5FX6A 2VWMA 2BDBA 1SGQE 1AVXA 1RGQA 1QBNA 2WPKS 1G2MA 4NFEA 1C5XB 4YTAA 5EXMA 1CGIE 2PHBA 2D26C 1Z6JH 4UE7H 1TX6A 1O2LA 1HCGA 1GMCG 3VFEA 4R0IA 1P57B 3F0PA 4LZ4B 6GCHF 3STJA 3FP8E 2CV3A 1AIXH 2F91A 4FOUC 1TONA 4LOYH 1AI8H 4GAWA 3SNBA 5DK1A 4CR9A 1MQ6A 4O3UA 3V12A 1V2TT 1FONA 3ATKA 2A32A 2CF9H 1GCDA 4X6MA 2ZKSA 2JIZD 1FUJA 1SQOA 1YC0A 1BIOA 1G30B 2RFKC 3RXLA 1WOFA 5HKKD 4TPYA 2VWOA 1AN1E 1YLDA 2THFB 4BAMB 2VH0A 4ZHAA 1S6FA 2FS8A 1Z8RA 2W26A 1C2HA 4CBNA 2GDEH 3I29A 1BTZA 3A8BA 3BTQE 5JBCS 5EJLA 2BTCE 3GDSA 4DIHH 1KDQA 2BD8A 1C1RA 3KL6A 1GMCF 5L2ZH 3RM2H 2J4IA 1TRNA 1DLKB 1XKBC 3LGIA 5A0AE 2BHGA 5EPNA 1QJ6B 4X8TH 2GX4A 2HLCA 4QT8C 1DFPA 1E79D 1MTWA 3P8GA 5FX5A 3PTBA 3FP7E 5JBBS 1C1VH 5TJXA 4YLQH 1OP0A 5JPMH 1JMOH 1UVPA 3MH5A 2KM0A 4BNRA 3ZVCA 1P04A 4B76A 5EQQA 2OBOA 3GYLB 1Z7KA 1DM4B 1ZPZA 2NU2E 5EU8A 2FOEA 4ZXXH 2VGCB 3BTWE 1CO7E 1AB9C 5FCRA 3HATH 1O3LA 1UK4A 2P3TB 3D65E 3ZVAA 1U6QA 1GI3A 3KN2A 2WPIS 4K8YA 1LHEH 2HWLB 2IJOB 4ZUHA 1JRSA 2P93A 2H2ZA 1E1QD 3UQVA 2BD5A 4THNH 1EJNA 4NZQA 1ELFA 1DUEA 4ABEA 2EQNA 3EE7A 1E0FD 1BBRK 4Q80A 4RN6A 5CDFE 1XX9A 1KXBA 3SOSA 2ZGXH 5DP8A 3NKKA 1P2IA 4B2BA 4D7GA 2ZFQH 1UTMA 2R3UA 1PPCE 2PKAB 3DSPA 2BY5X 1KLIH 1T8MA 3RMLH 4ABDA 2DE9A 3UUZA 4FU7A 2BDYA 1K1MA 2OTVA 5KGOA 3RXSA 1JOUB 1GHAG 1IAUA 4SGBE 1UJ1A 4OS6A 1FX0B 1C5VA 2BVRH 1RTLA 3ODFA 5F8ZA 4WF8A 3SU1A 3KGPA 1HAHH 3E91A 3MU5A 4MG3A 1GHXH 1DWEH 4TPIZ 4XRNA 4YT6H 3W94A 1P06A 1GJ4H 2XCFA
chains in the Genus database with same CATH topology
4UONA 2ZPRA 2IN2A 4H42U 1GJ9B 3SI4H 1C2LA 2ODQA 3GOVB 3TK5A 3BTGE 1MTNC 4FUIA 3T62A 5GXPA 1TMUH 1SGRE 3ENSB 1K1IA 4ZKSU 2H5DA 2AMPA 5FPTA 3PMAB 1SI5H 3E1XB 1BJVA 1O38A 2ESTE 1LHCH 3MHWU 1MKWH 4I8GA 1C5TA 2GVFA 1ACBE 1ESAA 1KTSB 1C1SA 1B5GH 3UR6A 1ABJH 3RLWH 1OWIA 3K2UA 1GHAF 1B0EA 1V2VT 2ZFSA 2XCNA 1HJ9A 1BTUA 1O3GA 2WPMS 1V2RT 4Y11E 3V7TA 3SHCH 1AY6H 1TABE 1FNIA 2SGFE 1GI2A 5C1UA 4O97A 2XBXA 2WPJS 2OC7A 4YM9A 2ZU4A 4JZDH 1ABIH 2VB0A 4X8UH 3S9AA 1FI8A 3QX5H 1NU9A 1H8DH 2Z6BD 1ELVA 3A87A 2FI5E 2ALVA 3KIDU 2GV7A 1DSUA 4ZROA 2XC5A 2AMQA 1ANBA 2FDAA 4DGJA 2PKAA 3MNCA 1MD7A 3ESTA 3O8CA 3KNXA 4UD9H 3OY6U 1HAYB 4DG4A 5L30H 2VIVA 2A5IA 1BT7A 2VVCA 4BXSA 1INCA 2QN5T 3TGIE 1TB6H 3D23A 2ZDNA 4NWLA 3E0NB 1LKAA 4OGXA 5A8XA 2GV6A 1C1QA 2XC0A 2WPLS 1SMFE 1O34A 1SOZA 1OXGA 4X6PA 2GDDA 1HYLA 3AAUA 4DJZB 4Y76A 2WPHS 2CHAB 4MPWA 3A88A 1V2OT 4U2WA 4IMZA 3H7TA 4JZ1A 2H9HA 2XBWA 1FZZA 1L4ZA 1XUJA 3WY8A 1ZGVA 1TOMH 1BHXF 1QJ1B 3MNXA 2JH5D 4NIYA 4CHAB 4ISNA 4Y0YE 3TJVA 3RXIA 1SLUB 2BD9A 2FYRA 3SU0A 3TVJB 2GKVE 2PTNA 1TBRH 5CHAC 4LZ1H 3BG8A 5E2PA 1GGDB 1QQUA 1F5KU 2PWXA 1F0SA 3LDXH 3F9EA 1EZQA 1XUFA 3SU2A 1OWEA 3QZRA 3VB5A 1ZHPA 3HK3B 1W10U 4JMYA 3ZVDA 1W7GH 1C2DA 6CHAC 1G3BA 1O3NA 3QLPH 3DUXH 2R3YA 1GHYH 3RXPA 1D3DB 2ZQ1A 1E35B 1O3DA 2BY9X 2QIQA 4ABBA 3RXKA 3NXPA 2PW8H 2OC0A 2FPZA 1LKBA 1O35A 3UY9A 1GJAB 3LGUA 3RXDA 1KXEA 1ZTKA 4IN1A 1DPOA 8LPRA 5F6MA 3GY3A 3QGJA 4R8TB 3RU4T 1ZMJA 1OS8A 2AH4X 3TITA 1IQEA 1GBFA 1WSSH 2D1JA 1K1NA 1SQTA 1YGCH 1O31A 4MVNA 5IYTA 3ZZDA 1EOJA 2PKSC 1SGCA 3UNSA 3R3GB 1TGNA 4NFFA 4BXWA 3ZZAA 4MTBA 3TPIZ 5L6NH 2PLXA 1LQEA 3F9FA 4Y7BA 1SQAA 2R0KA 2ANWA 1CHGA 4HTCH 3VB7A 1C2GA 1YLCA 1ELTA 1T32A 5C3NA 1HFDA 3E90B 2ZIQH 5DP6A 2BVXH 2FLBH 4IMQA 1MAXA 1NRRH 4MPXA 1AB9B 4DCDA 2Y5FA 4KTCA 2ZP0H 3SU6A 3D62A 2ZPQA 2Q6GA 3UIRA 1OWHA 2NWNA 3BN9A 1DS2E 4NZLA 2FTLE 3GY5A 1ZTJA 5DP5A 2ZTXA 1ESBA 3VGCB 1HLTH 2DE8A 2JETB 1HGTH 1Z71A 1D6WA 2FEQH 2FP7B 2Z9JA 2J92A 2J38A 2J2UA 3T29A 4AGJA 1YYY1 3UNQA 2XBYA 4YT7H 4U01A 1TNLA 2UUJB 1GVKB 3IITA 4Y79A 1O2PA 4X1PU 4H6SB 3RU4D 2ZU1A 8KME2 3PMJA 7ESTE 1H8IH 1BMNH 1GVLA 2QXHA 2VJ1A 1LQDB 2D8WA 4CH8B 1OKXA 3SJKA 1GPZA 2BD7A 5F8TA 1Y3UA 3UTUH 3BG4C 1ZSLA 1CSOE 3GY4A 2ANYA 5JYIA 1CGHA 2FOBA 2J94A 4CRFA 3M5OA 4Y71A 1F7ZA 1A46H 1MBMA 2FXRA 3F68H 2YNAA 5E0HA 3BTTE 1MTNB 1EASA 4YO9A 4K60A 1HUTH 1GBIA 4BANB 2WYJA 1ZYOA 4ABHA 1QTFA 4YZUA 2CGAA 1Z1JA 1HB0B 1SG8B 4X2XA 3A81A 3S69A 1C2MA 3P8FA 4IS5A 3P95A 4FU8A 1WQSA 3GICB 3P17H 3GCOA 3EA7A 3GCTG 1XKAC 4XFQA 2HPPH 3RU4E 1OP8A 3QDZB 2DUCA 2WYGA 1ARBA 3SZNA 3LGWA 5SGAE 3A7YA 1OWKA 1NRSH 4AFZA 4JK5A 3NUMA 3LH1A 4AZ2B 1KTTB 4GLYA 1O5DH 3ZZ4A 2JKHA 1ELEE 3BTEE 3AVZA 1PPZA 4GPGA 1E38B 1RTKA 2ZPSA 3SGBE 1CVWH 4XOJA 2UUFB 1UCYE 2ZDAH 1FY1A 3A83A 1AZZA 2ZCLP 3AAVA 1C5YB 3A8DA 1ZRKA 2C90B 4UFEH 1G3EA 2BOHB 1SGYE 3RXUA 1KXCA 1ZRBA 2TBSA 4FUFA 4TWWA 4I8KA 1SSXA 2W7SA 4WMEA 1C1TA 3GCTF 1UK2A 2CN0H 9ESTA 2AERH 2O8LA 1T7CA 1A61H 5JB8S 2XC4A 1DY9A 1PYTD 1GG6C 1MZAA 1O0DH 2J34A 1A4WH 2F9UA 1C4V2 1MAYA 3LJOA 1P3EA 3S7HB 1SGIB 4K1SA 1EZUC 1T31A 3LU9B 4DVAU 4I31A 5K7RA 3ZVEA 1V2UT 4Y6DA 3P70B 4WXIA 8GCHF 1O33A 5DP4A 3NWUA 4OGYA 1O5FH 1UTLM 2NU1E 1TOCB 3A84A 1RIWC 2ZGJA 5I46H 1MKXK 1B0FA 1O3KA 2HPQH 4FU9A 1V2QT 3GDVA 4CRCA 4X0WU 1C5ZB 2VWLA 4FUDA 3RC6A 4CRGA 3KQDA 1VITH 2BX3A 3PO1C 1GJDB 4NSVA 1GMHF 4E7NA 4FUEA 2W5EA 1C2JA 2G4UA 5GPIB 1W14U 1OYTH 1P8VC 2G5VA 3SUDA 2ZQ2A 2A7JA 1Y3VA 3MTYA 6GCHG 4TWYA 5LPRA 4A6LA 1YPHE 2ZHQH 2O8MA 5T6DA 3IWMA 3LJJA 1F0UA 2C4FH 1AVWA 2BLVA 6CHAB 1ZZZA 1GHBG 5FCKA 1SGDE 1EUFA 2TGPZ 3U8OH 2G55A 1RFNA 2ZGBH 2ILNA 2FM2A 1ELDE 3VB6A 1G2LA 1CU1A 1NS3A 3H7OA 4AFSA 4Q2KA 2RG3A 4ZXYH 2V6NA 1C9TA 4YLUA 3GCHC 3RP2A 1SGFG 2ZFFH 2V0BA 5H4IB 5HMAA 1FLEE 3Q77A 1LDTT 1NO9H 3A7XA 3SV8A 3T26A 2P8OC 1O2YA 4FUHA 4AG1A 2Y7XA 2EI8A 4X8VH 4ABJA 7KMEH 1BTYA 5GIBA 2BD4A 1AZ8A 1TYNA 2TIOA 1IQKA 1YCPM 1BTWA 1PYTC 2PGQB 2Y80A 3QK1A 5JDUB 2NU0E 1PPGE 1GHBF 1QJ7B 3SU5A 1S6HA 3SUFA 2G51A 1CA8B 1G9IE 3MWIU 2STBE 3A80A 2CMYA 1P3CA 1RD3B 1HAOH 1BMAA 1O5CB 1AFQB 1FIWA 1QRWA 5DKMA 2OP9A 3S9CA 5FHTA 4INKA 4CBOA 1F5LA 1P02A 4WXVA 1XUGA 5K0HA 1VCPA 5AVDA 1C1PA 4NGAH 1TALA 2Q6FA 4D9RA 1GMDG 2BB4A 1TNGA 2CJIA 1UVUH 1UTJA 1DWDH 1O2UA 1SHYA 3VXFH 2B5TB 1BCUH 1UTKA 1BRCE 2HNTE 2TGDA 3MU0A 5GJ4B 1Y3XA 4UFFH 1K1JA 1FXYA 2GTBA 4B2AA 1RJXB 2Y5HA 3SI3H 1RRKA 3QO6A 2O8WA 3VPKA 4Y8YA 4KP0A 1H9LB 1O30A 1SB1H 5GWZA 2UUYA 3LH3A 3M7TA 4XE4A 5EOKA 1E34B 1GBEA 4K69A 1W0YH 1QA0A 5EW2H 4I8HA 1HJAB 2GD4B 3FP6E 1LHGH 2Z7FE 1UCYK 2QC2A 3Q3YA 4TY7A 1GJ5H 5FPYA 1GMDF 2I6SA 2C3SA 1LMWB 1O3FA 2GT7A 3BG4B 4A92A 1EB2A 2SGDE 1YPMH 4ZKNU 1SHHB 4NSYA 1NY22 3LC3A 1LPZB 2B9LA 3M5LA 3ZYDA 3PWBA 4CRBA 1TBQH 1O3EA 5TCCA 1SGNE 2F9VA 1VR1H 4LXBH 4Y8ZA 1C5UA 3RXVA 3M3VA 3MU8A 1GL0E 3SGAE 1N1LA 2A4OA 2ZU5A 2ZFPH 1WQVH 2OC1A 3ATIA 1AUTC 2BQ7B 1ARCA 1O2SA 3RC5A 1IQIA 3BTFE 1JWTA 1TMTH 3B9FH 2XTTB 1K1OA 4K1TA 1VJAU 3TJOA 1V2MT 3UFAA 4Z6AH 1MZDA 1HDTH 3N7OA 3PM3A 1LVBA 2JH6D 5TCAA 1NRNH 3RUOA 1D3PB 1Y8TA 3UOPA 2K1QA 5HGGA 4B2CA 1L4DA 5FBEA 3BV9B 4I8JA 2W7UA 1GBJA 2GZ7A 1V2WT 1ETSH 2Z94A 1L0ZA 1P11E 1WCZA 3UPEA 3CS0A 4M7GA 4D76A 5HXFA 2ZF0H 1TNJA 2VU8E 3TNTA 1TAWA 1O2VA 3SORA 1GI6A 1C5LH 2OUAA 1HXFH 1G3DA 3Q76A 2SGEE 1P0SH 4MNXA 4AORA 5T6FA 1XMNB 2CXVA 3BSQA 3ZZ8A 2R9PA 2BY7X 1E36B 3QUMP 4Y7AA 3GY6A 3KQBA 1BQYA 2FZZA 1GG6B 5EW1H 1KLTA 1O5GH 4ISHH 2GCTC 2NU3E 1WV7H 4WY3A 3F6UH 1CA0C 1ZSKA 1TFXA 2R0LA 1O5BB 4U30A 1TPAE 1Q2WA 1TQ7B 1C1UH 3U9AH 5DJ7A 2OQ5A 1C9PA 2OCVB 4D8NA 1HAZB 1NC6A 2FESH 1QFKH 3ZZ7A 1CE5A 1OOKB 3RXMA 2V3HH 2AGEX 5CMXH 1NRPH 1RIWB 2F9NA 3LOXA 3RXBA 3UOUA 1GJ6A 4JK6A 2HNTF 1TBZH 3T25A 4CREA 1EJAA 1QRZA 1CT4E 1C5MD 1DE7H 1NROH 1KYNA 3UWJH 3PO1B 3GISB 1HNEE 1FIZA 3PMBB 4NIXA 4ISLA 3ODDA 2BD3A 4IBLH 1K1LA 3A82A 1KSNA 1ZJKA 2F9OA 2OD3B 1FQ3A 1EZSC 2QAAA 3RMNH 3EAJA 4RSPA 3SV2H 1PQ7A 2PGBB 1Y5UT 4H6TA 3E8LA 1O39A 1EP6A 3OTJE 1O2HA 3HPTB 2HRVA 4D7FA 3NZIA 3NK8A 4DURA 1EAIA 1S0RA 2AGIX 3A86A 1YPKH 2Y5GA 4AYVB 3GCNA 2QY0B 1KXAA 4X6OA 5C1XA 3SBKA 1VCWA 3U98H 1UVTH 1WYKA 1LO6A 3ELAH 3LONA 3M5MA 4Q7XA 3TNSA 1AE5A 3RXEA 2P8OB 2GCHG 3RXHA 1DDJA 2EI6A 4X2YA 1GI1A 1HAVB 3ZZ3A 1IQNA 1BB0B 4B1TA 4HFPB 2GP9B 2A45B 4UEHH 4X6NA 2BQWB 1TPPA 1X7AC 5F8XA 5E0GA 3LPRA 4BAHB 4AGKA 1A5GH 1C5SA 3K65B 2BXUH 1O5EH 1RXPA 2F83A 1ZHRA 3LGTA 2FYQA 3PV4A 4KTSA 4FUJA 4NCYA 2XXLA 2Q6DA 4KKDA 2ZECA 1GJ7B 2BLQA 4VGCC 1CBWC 2ZTYA 3U8RH 3RXOA 1AUJA 3MU1A 3SGQE 2VWNA 2AS9A 1DX5M 1XUKA 2BY6X 3FANA 1QQ4A 1AWFH 2GCHF 1GJCB 5EXNA 3KQCA 1FN8A 1S84A 2AYWA 4X8SH 1KXDA 1HPGA 1PPHE 1O2WA 2EI7A 2WUBA 3ZV9A 1IQFA 4AOQA 1C5RA 2ZHWH 3M35A 5C2ZA 1MQ5A 1LVOA 8ESTE 1A0HB 5FXLA 3URDA 2VIOA 3AASA 2RA0A 2SGQE 1G3CA 1EAXA 2Y81A 1PPFE 1ZPCA 3M3SA 2TGTA 2QF3A 1XXFA 2PSYA 5I25A 1SGPE 3MNSA 1HV7A 1O2XA 4ISOA 1FY5A 1MUEB 3G01A 3QTOH 1D6RA 4MLFB 1A2CH 3K6ZA 2QXGA 4Q7YA 3QGNB 4OS1A 1A7SA 3SQEE 2ZNKH 1W8BH 1TRYA 1MKWK 2BQ6B 1UHBB 1H9HE 1SLWB 1ZGIA 1NESE 1NFUA 3RLYH 1J16A 2VNTA 2ZZUH 1DSTA 1HAVA 1BDAA 3TK6A 2HALA 4GHQA 1P2QA 5A09A 2YNBA 2ZGHA 1NRQH 4OS2A 1LHDH 1EOLA 1GDUA 1FDPA 4I7YH 2FOFA 1XUIA 3VEQB 3TH2H 1YBWA 3ZVGA 3TLOA 4LK4A 1Q31A 3GY7A 3SUEA 5ESBA 3VB4A 3V3MA 3QN7A 1QA7A 3SNCA 1HAGE 1JXPA 1DT2A 1G32B 4I32A 3FZDA 1G36A 1A5HA 1KY9A 1OWJA 1ID5H 3LT3A 2PTCE 3TGKE 3U1IB 1QBOA 1IOEA 3JZ1B 1K2I1 1QL9A 2QV1A 1QGFA 1UTNA 1EAUA 4GUXA 4NWKA 3QZQA 3SV7A 1LVYA 1DWCH 1TWXB 1XXDA 1GHWH 4DIIH 1NT1A 4A1XA 1IHSH 2A31A 5ESTE 1O2OA 2XWAA 5DP3A 1IQHA 1IQMA 1BHXB 2A1DB 1N6YA 3DA9B 3RXRA 3P8NA 4CRDA 5DPAA 1LHFH 2ZHEH 1DANH 1ANCA 1GL1A 1C5PA 1IQJA 2IOTA 2A0QB 5T3HA 4BAKB 4O03A 3TH4H 4NIVA 2SFAA 1TGSZ 9LPRA 1DOJA 3ZZ5A 1O3JA 1J9CH 1JBUH 3T27A 1C1NA 1V6DA 1YCPH 3M7QA 3UNRA 2Z3EA 1S5SA 2VIWA 5DP7A 2GCTB 4X1SU 1ELGA 2FI4E 1K1PA 3KF2A 5LGOA 1HAXB 1CA0B 1S0QA 3ZZ6A 1DUAA 3HKJB 1O2JA 1VJ9U 4I33A 1GBHA 2PSXA 2LPRA 4K8BA 2A4RA 1MU8B 2VIQA 8GCHG 1UHBA 2BXTH