1O3FA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3fA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3fA02
1G3BA 2BD7A 3MYWA 5LPFA 1P8VC 1LHFH 4WWYA 2EI7A 2XCFA 4INLA 3TPIZ 4JMYA 3ZZCA 3RXEA 3UR6A 1K28D 1QURH 3PTBA 5BRRE 1YF4A 1DLEA 1O0DH 2FI5E 1UTJA 1GCDA 4IN1A 1VGCB 1EX3A 1O5CB 1ZGIA 4XSKU 4Y8ZA 1Y5UT 3SJ8A 1O3JA 1SC8U 2ZF0H 2XBYA 1XX9A 4TY6A 1TNIA 2RA3A 4X8UH 5TJXA 3MH7A 3FAOA 1KDQB 2BTCE 3RC5A 4YM9A 4WXVA 1P0SH 4CHAB 4CBOA 3SU3A 4JYVH 4AGJA 1G2MA 2BDGA 1AFQB 2QIQA 1M9UA 1C5XB 2VNTA 3O8DA 3QZRA 1TX7A 1FZZA 3LC5A 1MKXK 4Y7BA 3RXUA 4NWKA 1SOZA 2G8TA 5L2YH 1O2UA 3P8GA 4DOQA 1HJAC 1E38B 3I77A 4NSYA 1C2EA 1NS3A 1HLTH 4X8SH 1RFNA 4ZH8A 3E6PH 2GZ9A 2ZI2H 1QRZA 2BLOA 2Z9IA 2AYWA 2Y82A 3RXFA 2A5KA 3GCNA 3LT3A 2PKSC 3PM3A 1WQSA 2P59A 2UWPA 3OYPA 1HDTH 1EP5A 4AG2A 4NWLA 4WMFA 2GDEH 1BB0B 2OCVB 2PUXB 4ZMAH 1DT2A 1LVMA 3ZVCA 1S0RA 4BTUB 1OWIA 7ESTE 3KIDU 3PTNA 1KDQA 2EEKA 2ODYB 3NXPA 1OP2A 2OC8A 1OYQA 2EA3A 3LKWA 3E0PB 1EJNA 3TJNA 1S84A 3BTHE 3K9XB 4MDSA 3I29A 1AWHB 4AOQA 2GMTC 2XTTB 1P10A 2VH6A 4U32A 1MBQA 3M7QA 1AVXA 4DIHH 1GDNA 2QGRA 1C5VA 4I8HA 1TONA 3LDXH 1S81A 2ZDNA 5GDSH 3MH6A 4NG9H 3A82A 5HYOA 3R3GB 5EOKA 2XBWA 4CRCA 1DOJA 5L30H 1RTKA 8GCHG 1GHYH 4OGYA 1YPHE 2G52A 1OOKB 3B23B 1GBKA 2FOEA 5C20A 3AAUA 2O8TA 2TBSA 4FVDA 1P04A 3SZNA 1MBMA 1TGCA 1XUKA 3SV9A 1O2JA 2ZP0H 5PTPA 4B2BA 1XKAC 1S6FA 1GI4A 6CHAC 1P3CA 1P2MA 8ESTE 5C2ZA 3ZZ6A 1G3EA 3QX5H 4UFEH 1AI8H 1D6RA 3P8OA 1ZMNA 1QB1A 1A5IA 3SGAE 1SGYE 2I6QA 1AU8A 1C2GA 1AZ8A 3A8CA 3RXDA 3ZVEA 1UTOA 2SFAA 1O2XA 2FZZA 1J14A 1EPTB 5DKMA 3UWIA 4YOJA 4ABJA 5AFYH 1IQIA 1FUJA 1NRQH 2G4TA 1GMCG 1TPAE 5E2OA 2BZAA 3CENA 3IITA 4IC6A 1ZPBA 3RXMA 3AASA 1DWEH 1BQYA 2OC7A 2J34A 1HXFH 1O2IA 4HGCA 3VGCB 2XWAA 2Y7ZA 1O2VA 2ZDMA 3BTEE 1V2KT 3ZYDA 1CGHA 2GKVE 3ATLA 5E0HA 1GVKB 1ELDE 1MAXA 1DX5M 1EAWA 1GI2A 3SNCA 2WPIS 2ZTYA 3MWIU 3MNSA 2D1JA 1T7CA 1KIGH 1SLUB 2FEQH 2HPPH 2VWMA 1UTMA 3TGKE 3A8AA 1A7SA 1P2KA 3ZZ9A 1ZSKA 3FZDA 3SV7A 4K8BA 4DT7B 2FLRH 3LJOA 4RKOB 3BTFE 5LPEA 3HGNA 1EPTA 1UTPA 4DJZB 3M7UA 1TGBA 1ESTA 1E36B 1O3LA 2VWLA 3OY6U 2I6SA 4FUJA 3MH5A 3RXSA 2THFB 1GBFA 4ABGA 3UIRA 6GCHG 1TE0A 2BOKA 3RXQA 3ESTA 2EI8A 4Y8YA 3EA8A 1W0ZU 2PSXA 1V2RT 1JRSA 4X6PA 5T6FA 2OP9A 2Y5FA 4GSOA 2Y80A 3OX7U 1EATA 4X6OA 2ZCHP 4DW2U 2O8WA 4I31A 2SNVA 4HTCH 4NA9H 1S0QA 3KL6A 1O2YA 1BJUA 3MU0A 3E8LA 2A31A 2W5EA 4ISLA 1CGJE 2D26C 4BTTB 2FTLE 1NN6A 4A6LA 3PO1B 1BTUA 2FPZA 1Q3XA 3BG8A 5F8TA 1KXBA 1XUHA 2OLGA 1AB9B 1T4VH 1ELFA 3M5NA 3RXBA 1AGJA 3GCTG 2Q6GA 2NU1E 3T27A 2FESH 1EASA 1PJPA 1V2VT 2BYAX 1O2RA 3SUEA 3KQCA 1HJ9A 3RMMH 3KQDA 1HAPH 3A83A 4R0IA 1XM1A 2DE9A 1Q31A 2OQ5A 3QGNB 1C1VH 4X2YA 3TNSA 3V7TA 4H4FA 2CF9H 1CBWB 2BQWB 3KQBA 4BOHA 3RLWH 5AF9H 2H9TH 2R2MB 1H9HE 1UCYK 1LHCH 1VITF 1A3EH 1NO9H 1C5ZB 3PWCA 1O5BB 3GY4A 1V2PT 1S82A 2R2WU 1O2KA 2WINI 2F9PA 3UY9A 1OP0A 1GJ8B 2BD3A 3ATIA 3CS7A 1HYLA 2EI6A 3WY8A 3A7TA 4DY7B 1EQ9A 4WMDA 2UWLA 2F9NA 2B7DH 2G51A 4JYUH 5FPYA 3RXRA 1TGNA 4CH2B 1BTXA 5EODA 1O34A 2ANWA 1NRSH 1ZTLA 3RXPA 1GJDB 1LCYA 4IS5A 1BOQA 2XBVA 3V3MA 2VIVA 1X7AC 2WPMS 1C5QA 5GCHG 1HAVB 2P8OB 1F7ZA 4I7YH 1EJMA 1JIMA 2GCHF 4LZ4B 2HNTC 1IQEA 5DPAA 2BX4A 1AIXH 1DS2E 4NZQA 3STJA 1K1MA 2F91A 4X2VA 3ZZ5A 1BTYA 5CHAB 3SV2H 1T8LA 1FPHH 1SGEE 3ZZ8A 1K9OE 3MNBA 2Z3DA 3STIA 2QXJA 3UNQA 2G4UA 4AB9A 2VIOA 1SG8B 5EXNA 3Q76A 2AGEX 1OKXA 1YP9A 3BTGE 3SU4A 3LH3A 4MG3A 3VXEH 2VIQA 1HUTH 2GV7A 1F0TA 1JXPA 2G5VA 4ASHA 3T28A 1C9TA 1HXEH 3GDUA 1LQDB 3PMAB 2PTNA 1XUIA 3CS0A 2Z9GA 2W7SA 1P57B 1U6QA 4ZHMU 3SNEA 4AG1A 1O3GA 4B1TA 1EZXC 2TIOA 1HAVA 3QDZB 1F92A 2GCTC 1SFQB 1WSSH 1CT4E 1LDTT 3LIWA 5TCCA 3SOSA 3GOVB 4GCHG 3UFAA 4H6TA 3H7TA 5F8ZA 4UEHH 1QL7A 5JBTA 2ZQ2A 1OPHB 3AAVA 5JYIA 1RD3B 3BF6H 2ZC9H 1TB6H 2CMYA 2ZNKH 1BIOA 1SBWA 5HM9A 1OSSA 1A5GH 1PQ8A 1TABE 1Z8IB 4B74A 1VGCC 1QL8A 5T6GA 3FP6E 1C5OH 1F2SE 3T2NA 1AO5A 4KGAA 3VB4A 1PPCE 1E34B 6LPRA 1ABJH 2R3UA 5T3HA 3RC4A 2QXIA 2H2ZA 2WUCA 1ARCA 2XYAA 5JBAS 1TPSA 1TBQH 2P16A 2Z7FE 1YPLH 5DJ7A 2ZU5A 3B9FH 1SGPE 2QYIA 4Q7XA 1NU7B 3QTOH 2GZ7A 4CHAC 1LVBA 4I32A 1HAIH 4JZIA 2YOLA 1AFQC 4WY3A 4MPWA 3SHCH 4MNYA 1J17T 2J38A 1ESBA 1O2TA 4B71A 1JIRA 3SI3H 4ZXXH 4K60A 5FAHA 2ZIQH 3SNAA 1KXEA 3A7XA 5EXLA 1FY3A 2YNBA 1GHZA 2AGIX 3SORA 1A0JA 3LJJA 2ZGHA 4A1XA 2VGCB 3NKKA 4ZKNU 1F0SA 1TALA 1ZMLA 1O2HA 1ZZZA 3DFLA 2NU4E 1TRMA 2ALVA 3NK8A 2FS9A 5IDKA 2OBQA 3SO3A 1W3CA 3M5MA 1GG6B 1GBCA 3C1KA 1YPMH 2J92A 3FZZA 2RA0A 3UREA 4AGKA 1MKWH 3KHVA 4J1YA 1BMLA 1MD8A 1P2NA 1PFXC 1K1IA 4K3JA 3JZ2B 2ZFFH 3RXLA 2CHAB 1L4DA 1SGCA 1YC0A 1QA7A 5ESBA 1HB0B 2ZTXA 3VB7A 1HJ8A 2YNAA 1FN8A 4MLFB 2R0KA 2J94A 2TGAA 3Q77A 1YKTA 1E0FD 5C67A 4AN7A 4MPUA 2BY9X 1HFDA 1ZPZA 1MQ6A 2PV9B 2W7UA 1ESAA 4OS7A 4NA7A 1MZAA 4WMEA 4FVBA 1GL0E 1Z71A 1G37A 1W13U 1WQVH 2ZCLP 3RMOH 4VGCB 1ZJDA 1QJ6B 1JOUB 5C3NA 3TJOA 3SU5A 1SGFA 2XCNA 3Q3YA 4YOIA 5GIBA 1DICA 1TX6A 2PTCE 2O8MA 1BJVA 2Y7XA 3UOPA 1GJCB 2H9HA 3URCA 3BEFB 3GYMA 3QTVH 1SLVB 1ZOMA 1YYY1 1LO6A 4OS6A 4A5TS 3LH1A 4IW4E 2AEIH 3ZZ4A 2ZU2A 3UQOA 1B0EA 2WPJS 3RU4D 1HAXB 2AH4X 4K1TA 3ZV8A 3SN8A 3KN2A 1N8OC 4JZEH 2XXLA 1YPKH 2VH0A 3URDA 1G3CA 1NRPH 3MHWU 1ZHRA 4Q7YA 4BAQB 5JPMH 3VB3A 2ANYA 2HWLB 2RG3A 3MU8A 1DSUA 1TRYA 4CR9A 1IQLA 3C27B 4DURA 5DP4A 2PSYA 1TQ0B 2A4QA 3ELAH 5DP7A 1ELCA 1O3OA 1ABIH 1HAZB 1AQ7A 1EPTC 4ESTE 4MVNA 1HBTH 3RLYH 1HCGA 1QBVH 3GICB 3IG6B 3RXVA 4K2YA 1GBBA 3M35A 2GX4A 2FDAA 3TGIE 2PGQB 3HKIB 8KME2 2XWBI 3NPSA 1O30A 4WXIA 2A0QB 4MTBA 1K1NA 1W2KH 1QGFA 1IAUA 2OUAA 4K69A 2V3HH 4MNXA 4ZAEA 3TH4H 4H42U 2H5CA 3HGPA 3E0NB 1RGQA 3BEIB 1DWBH 1NFXA 2GP9B 1EOJA 2Y6TA 2JH0D 1N1LA 3TITA 1QBNA 4IMZA 3SV8A 3A7YA 3OTJE 1DUAA 2A2QH 4YLUA 3UTUH 1GHBG 2H5DA 1O3EA 1P03A 1YPHC 3VB6A 2CV3A 1C2FA 4Q80A 5ABWA 1UO6A 1ARBA 1XUGA 2QA9E 1K21H 2ZHWH 2A32A 3LU9B 4BANB 4GLYA 1N6YA 2ODQA 3DD2H 2VIWA 1AVGH 4CR5A 5L6NH 3MOCA 8LPRA 1DWCH 1OWDA 1W14U 4XE4A 2BY6X 2GD4B 2AIPA 3TIUA 1CA0C 4GVUA 1B0FA 1YGCH 4B2CA 2V3OH 3D62A 3RUOA 2CN0H 3H7OA 1KY9A 2UUJB 1FY8E 3K65B 2P95A 4K1EA 3A8DA 4AZ2B 3GY2A 1GHAF 3LPRA 4OS5A 1OWHA 3LOXA 2CJIA 4JK6A 4DGJA 1BBRH 3RXIA 1BRUP 2P3TB 2WPLS 2ZG0H 3AW1A 4U2WA 3PO1C 4ABFA 1CSOE 1OYTH 1SI5H 1Z1IA 1D3QB 4AB8A 1THSH 1Z8RA 1UVUH 2ZGJA 3UNSA 4TPIZ 1P2QA 2NU3E 4JZFH 1AE5A 1GJ4H 9ESTA 3P6ZB 1AN1E 1JWTA 4HI3A 2W3KA 3A89A 3TH3H 1UVSH 1O2GH 1CU1A 2BXUH 1ELGA 1ZGVA 1OP8A 4X1PU 1WU1A 2O8UA 3A7ZA 1GHXH 3M5LA 1JBUH 1BT7A 1CBWC 1AUJA 1A0LA 1ETTH 3NCLA 1BDAA 1SB1H 4XDEA 2XC5A 1GBLA 3GY3A 4ISOA 1JRTA 4CBNA 2G00A 1PPHE 3BTQE 3FP7E 4D7GA 3FFGA 1PQ7A 1V6DA 3RM2H 4D8NA 1J8AA 1EUFA 5ETXA 2F9BH 1UHBB 2Z3EA 3VPKA 4INKA 1VCPA 2PLXA 3A84A 3EA9A 3W94A 3T26A 1QCPA 3PLBA 5LPRA 1TNKA 4F49A 2P8OC 4XBCA 3RXCA 2BD8A 2IN2A 3UUZA 4IBLH 2D2DA 2C8XB 1GMCF 1KYNA 3SNBA 2SGEE 2A4GA 2BVRH 1VITH 2W26A 3FVFB 4MPXA 3V12A 2TRMA 1BBRE 5CHAC 1C1OA 1H9IE 1O3KA 4E7NA 4RSPA 1FAKH 3QGJA 2ZFQH 2Y81A 4ISNA 1QB9A 1EAUA 1XVOA 1LKBA 1V2UT 3D65E 2Q6DA 4J2YB 1SLWB 2BDIA 3U8TH 6ESTA 3T29A 4DIIH 2GV6A 4Z6AH 7GCHF 1L2EA 3SW2B 1UHBA 1O5DH 1A5HA 4Y0ZE 3S0NA 4FU9A 2XBXA 2G81E 2A7HA 1SGDE 1QR3E 3GY5A 2A2XH 3QUMP 4X6MA 1MMJN 1O31A 3A7VA 4TWYA 2F9OA 2A4RA 1FY1A 5CE1A 2BD9A 2BDHA 1GI1A 3AVZA 3U1IB 4FUFA 3A81A 4I33A 2BB4A 1GGDB 3G01A 4NCYA 1P02A 2O9QA 3BG4B 1WV7H 2ZGBH 4BAMB 6GCHF 4TY7A 3MO9A 1L4ZA 3PB1E 2UUFB 4X1QU 1T31A 3Q00A 4O3UA 4R8TB 5C1UA 3S9CA 2P94A 1HRTH 1W10U 5C1YA 1CHGA 1C5NH 1FIWA 4NGAH 1O3PB 4GPGA 2ZDLA 3GY6A 2A1DB 1C4V2 1GMDG 4CRGA 3SQEE 1Z7KA 4FUHA 1OXGA 1C5RA 2OC0A 2CGAA 1KLTA 1EB2A 1ACBE 4UFFH 5L2ZH 5LGOA 4NZLA 5LH8A 3BEUA 2A45B 2BM2A 3M3SA 1GBIA 1SL3A 1SFIA 3GCTF 2VVUA 3S9AA 3S9BA 3OY5U 4A1VA 3BV9B 1S83A 1S85A 2FP7B 3QO6A 3K6YA 3TJVA 5EW2H 3VEQB 1RTLA 1SGTA 4ISHH 2C93B 4WH6A 3KNXA 4WF8A 3A8BA 2BXTH 4Y7AA 1F0UA 1TGTA 3ZZ7A 1EAXA 1O3NA 1BMNH 2PUQH 3HK6B 1T8OA 1QRXA 1NFWA 1NY22 2ZGXH 3MI4A 2VGCC 1WTHD 2ZQ1A 4XFQA 1PPZA 1RIWC 2ZHDA 3MNXA 2VWOA 3SJKA 4AFQA 1RS0A 2PHBA 2ZFSA 1SPJA 4BXSA 1TQ7B 1CGIE 4D7FA 1T4UH 1TLDA 1GG6C 1AZZA 1K1OA 4MNWA 4DVAU 1UTKA 1QL9A 2A5AA 4NA8A 1FMGA 1MU6B 3P8FA 1MD7A 1YM0A 1MQ5A 4KP0A 3Q3XA 5EGMA 1P12E 5EQSA 1C5PA 3P17H 2CHAC 3SBKA 2AMPA 1C1TA 1KXFA 3U8OH 1BZXE 4IGDA 1QNJA 1Z1JA 1ELTA 3ZVDA 5FBIA 3RXHA 2BHGA 3GCHB 3RMLH 4B73A 1KLIH 4GHQA 3PLPA 5C5NA 3T25A 2HVXA 2ZTZA 2C8YB 1RRKA 1C4U2 1UVOA 2AGGX 4VGCC 1NC6A 1EOLA 4ZKSU 5I25A 1SQAA 2ANMH 2WPHS 2XRCA 1GCTB 1LPGB 1SQOA 1K1LA 3MFJA 4A7IB 1F5KU 1GHWH 1O2MA 1IQGA 2C8WB 1O2LA 1C5UA 1XKBC 3A87A 3ZZ3A 1ELVA 3EGKH 1MTNC 1OWJA 3HKJB 4MQAA 1D9IA 1D4PB 2ILNA 3M5OA 5E2PA 2H6MA 1AVWA 4K1SA 3M7TA 4LOYH 5T6DA 4NFEA 1FI8A 2XC0A 3GISB 4E05H 4YESB 1C5TA 1EZSC 4Z0KA 1O5FH 1CVWH 1V2JT 1AD8H 5A2MH 1XVMA 3RXOA 2FLBH 5CMXH 1HPGA 2QN5T 2GTBA 4BAHB 5EW1H 4GCHF 2ZKSA 3F9GA 1NRRH 5BPEA 1FONA 1C1NA 1CHOG 5JBCS 1GBJA 2HPQH 3I78A 4JZ1A 1QQUA 4X1RU 1OWEA 1O3BA 1LVOA 1THRH 4JZDH 2J4IA 3AW0A 4X2WA 3RXJA 1LPZB 2BLWA 1NZQH 1GI6A 1EJAA 2VIPA 2BY5X 2QV1A 1QFKH 1ZSJA 4U01A 1GMHF 4U30A 1Y8TA 1LHGH 2PGBB 2B8OH 4AFSA 4CREA 2NWNA 3NWUA 2P3UB 1Y3VA 4FUDA 1Y5AT 3EE0B 3EDXB 1CT2E 1EKBB 2JETB 5G4BA 4O97A 3UR9A 1NPMA 3MU1A 1LHDH 3F6UH 2UWOA 1XXFA 2ALPA 3BTKE 1O39A 1AY6H 4WVPE 1DPOA 3N7OA 7LPRA 3S7KB 4BXWA 3K6ZA 1F5LA 2FOMB 1TWXB 3RP2A 3ZVBA 1Y59T 1TAWA 1GL1A 3M3TA 2BDAA 3ODDA 4HZHA 3UQVA 2HALA 4UFGH 4DCDA 4JYTA 4D76A 1GPZA 2ZFRH 3BTWE 1TFXA 1FAXA 1A3BH 1YLCA 5A8XA 4I8JA 4O3TA 1C9PA 5ESTE 1WBGB 2VINA 2C4FH 1FIZA 1HAOH 3CP7A 1TOCB 3O8CA 1SLXB 1YCPH 3SHAH 1O3DA 1BTZA 1OWKA 3E90B 3NUMA 4Q7ZA 1A46H 3GDVA 5J4SA 5GXPA 3ZV9A 2GT7A 2HNTF 1WAYB 3KQEA 4FU8A 3ZZBA 1YPGH 3TGJE 4X1NU 5A8YA 4IN2A 1FQ3A 2QCYA 5EQRA 1W11U 1PPBH 5H4IB 1GJ9B 2ZPSA 2FYQA 4BTIB 2A7CA 4KTSA 5F03A 1VJ9U 4ZKOU 1TGSZ 2OXSA 3RXAA 1GBHA 5FPTA 3KF2A 1QIXB 4NIVA 4Q2KA 1MCTA 2XNIA 1C1MA 2BOHB 1NFUA 1GBDA 2OD3B 2ZGCA 2ZZUH 3PWBA 1C2DA 1ZR0A 2ZA5A 1Q2WA 4WH8A 1BRBE 5GPIB 3TK6A 1DY9A 3FP8E 1H8DH 4I8KA 1WUNH 2Z9KA 1PYTD 1C2LA 2C8ZB 4GAWA 1S6HA 1G36A 3DT0H 1C5WB 2VIDA 2SGQE 3U1JB 3GDSA 1IQNA 1GJAB 1WYKA 3S69A 1MKWK 4Y71A 2PKAB 2FX4A 3SJOA 1KLJH 2ZU4A 3BIVH 5K0HA 4KTUA 1QTFA 3BTDE 4B76A 2VU8E 1K22H 3QN7A 1FJSA 3P92A 1WCZA 1ZLRA 4WJG2 1ZTJA 1Z6JH 5EU8A 1NFYA 4THNH 4ZROA 1EB1H 1W8BH 2QF0A 1L1NA 4INHA 3BN9A 3LGIA 1O3MA 1O2NA 1SHHB 1O33A 1P2OA 5FCRA 3HATH 1KXCA 1AHTH 1ANEA 3A88A 4X8VH 5F6MA 3ZVAA 1Y3XA 4Y0YE 1O2PA 4X1SU 1W0YH 1HIAB 4Y8XA 5DP8A 1MTSA 1O38A 3ZVFA 5FX5A 3IWMA 1IHTH 1C1RA 2WV4A 2FOCA 1MKXH 3UWJH 3M3VA 2KAIB 4ABBA 1QQ4A 2WUBA 2ANKH 4NIXA 3KEEA 2FIRH 2VWNA 5EQQA 2PKAA 3ATMA 1NM6A 2STBE 4D9RA 3GCOA 5AFZH 3SU6A 4UDWH 4ISIH 4GHTA 2BY8X 3VGCC 3A86A 1NU9A 3L3TA 1C1QA 4CRDA 2W3IA 1UMAH 3DFJA 1BUIA 1FN6A 5EG4A 5J4QA 1EZUC 1PPEE 4IC5A 4Y6DA 5A09A 3R0FA 1WTGH 1MH0A 2ODPA 3U9AH 1AKSB 1GHBF 3ENSB 1AWFH 1O32A 1YBWA 3BSQA 1FPCH 1O3HA 1EP6A 3A85A 5E8EH 1GBAA 1ETSH 2WPKS 3EA7A 2IPHA 1SGRE 1RJXB 3RXKA 1DVAH 4JCNA 1YCPM 3F9HA 1HIAA 5GJ4B 4X6NA 2J9NA 1HNEE 2PW8H 2BQ7B 1ANDA 1GGDC 4HFPB 4X8TH 3A80A 4GUXA 3BG4C 3VFEA 1ZRKA 3P95A 2KAIA 2BMGB 3TK9A 2FI4E 1ETRH 4YZUA 1W7GH 3SNDA 4ZXYH 1UTQA 3TJUA 1FY4A 1HAYB 2BLQA 3VB5A 3RXGA 1MAYA 1G32B 1C1WH 2BD2A 1SHYA 2SGFE 1BMAA 1B5GH 3ATWA 1GBMA 3QZQA 3SJIA 1AKSA 3LGWA 3W95A 2UUYA 4QT8C 1O37A 3E91A 5B6OA 2AMDA 2WV5A 3LC3A 3D49H 1SGIB 1AB9C 1MTVA 2ZO3H 3UNRA 2GZ8A 5JB8S 1Y3WA 5TCAA 1P11E 1GI5A 2XW9A 2SGPE 3QWCH 1GHAG 1TPOA 1ZYOA 3ZYEA 1KTSB 1RXPA 2RCEA 2ZPQA 8GCHF 1PPGE 3LGYA 5A0BA 2P93A 1Y5BT 1LHEH 2Z94A 5AVDA 5FHTA 3SU2A 4YOGA 2O8LA 3TK5A 2HRVA 4MPVA 2R0LA 3SU0A 3MO3A 3LGVA 1P05A 1V2ST 1K1JA 2PWXA 3SU1A 1UTNA 2BY7X 2AS9A 2M5TA 2D8WA 2R3YA 3UOUA 1UVTH 2FOFA 1BBRK 4Y76A 1D3PB 5JBBS 4KELA 1CT0E 2Z9LA 4RKJB 1BA8B 1EXFA 1TBZH 2ZHQH 3PMBB 1BTWA 2OTVA 4FUEA 1SR5C 1C5LH 1NT1A 9LPRA 1GDUA 2HLCA 3F9FA 3TVJB 1BITA 2B9LA 4YT6H 1DFPA 3MU4A 2ZHFH 5A8ZA 1N8OB 1MTWA 5EPYA 4O03A 3GCHC 1TNLA 1BRCE 1OS8A 3F1SB 2VVCA 1C2JA 1LTOA 3B8JA 1KXDA 2LNCA 5DGJA 1HAHH 2NU2E 3S7HB 1O3FA 1LVYA 1ZPCA 1FY5A 1SSXA 4UE7H 1GVLA 4FUIA 2JH5D 1O3IA 3ITIA 5EPNA 1DY8A 3L33A 2LPRA 5IYTA 1GCTC 1NTPA 1Y3UA 3ZZAA 1AE8H 1LQEA 1O36A 4BNRA 5DP6A 2PR3A 2G5NA 2WYJA 1ANCA 1BRAA 3ATKA 1P01A 1HAGE 2ZDKA 3K2UA 1Z8GA 1YLDA 4E7RG 2G55A 1TX8A 4X0WU 1F0RA 2PFEA 1C1SA 4XBDA 4FU7A 3T62A 3TH2H 2TGPZ 3LONA 2JKHA 1TRNA 2ZDAH 4FUCA 2A4OA 4F4OC 2FWWA 1Z8JB 2QAAA 4IMQA 1BTHH 2ZFPH 4AX9H 2OQUA 2TGTA 1O3CA 4UONA 1H8IH 1P09A 3LGTA 5DO4H 1VZQH 3E16B 2IOTA 1O2WA 2QXHA 1ORFA 1C5MD 1GVZA 5DP9A 3HPTB 2FOHA 1QJ7B 1PQAA 7GCHG 4BAKB 4FXGH 1XMNB 1HJAB 1L0ZA 4OS2A 3F9EA 4ABEA 1DE7H 1GJ6A 1SGQE 3PV4A 5FCKA 4SGAE 2OBOA 1GMDF 4B2AA 3JZ1B 1A0HB 1DM4B 2F9UA 5A0CA 3RM0H 1CQQA 2FXRA 4UD9H 2ZWLH 5FXLA 5DK1A 5K7RA 2PKSB 1DWDH 4NIWA 2TPIZ 1GWAA 2JETC 4NIYA 1CA0B 2V0BA 1J15A 1UTLM 1FV9A 4OGXA 4DG4A 1QA0A 3MTYA 4Y79A 1UCYH 1GJBB 1Y3YA 1SQTA 1P3EA 4FUBA 1KSNA 5A0AE 1BCUH 1P9SA 1XUFA 3GY7A 1G30B 1IOEA 1TIOA 2QY0B 3MNCA 2F3CE 4E06H 1ELEE 1SOTA 5AHGH 1D3DB 4OS4A 1O5AB 2GMTB 1G9IE 3SUGA 1GJ5H 2ZU3A 1MCVA 2FO9A 1WOFA 3O8BA 2FS8A 1B7XB 1LPKB 2FODA 1V2TT 1DDJA 1UJ1A 4A92A 5E0GA 2F9VA 1TBRH 5F8XA 2QXGA 4LZ1H 4FUGA 1EZQA 3U8RH 5JB9S 1V2QT 2GVFA 2ZDVH 3QLPH 1D6WA 3OSYA 1RTFB 1N6XA 4AFZA 1DSTA 1ELAA 4I8GA 2BX3A 1MU8B 1TNGA 4Y11E 2AFQB 2J2UA 1QJ1B 4CH8B 3GYLB 3RDZA 1VCWA 5GCHF 4ABHA 4LXBH 4D9QA 2ASUB 2ZCKP 4ABIA 1TOMH 1TMBH 3M36A 3U69H 3RMNH 2BVXH 3DUXH 1VITG 3LGUA 1GBEA 2ZPRA 3MH4A 2C90B 3M37A 1V2WT 4X2XA 4AYVB 1THPB 1PPFE 1QBOA 2HGTH 1S5SA 4NSVA 2H1UA 6CHAB 1C4Y2 2FOAA 1PQ5A 2VVVA 4PROA 4JK5A 4I8LA 2A7JA 1DLKB 1DUEA 2FOGA 4ZHLU 5EXMA 1O3AA 5E0JA 2STAE 3A7WA 1K1PA 1O2SA 3FANA 2Z3CA 1UCYE 4AYYB 3SUDA 1O2OA 4Y10E 1V2LT 4AORA 1TMTH 2GCHG 1ZMJA 4YT7H 1OX1A 2ZFTA 1HGTH 3L6PA 1ZHPA 2BDYA 5HMAA 1DXPA 1FLEE 2FMJA 5JDUB 5DP5A 1ZTKA 1GDQA 3D23A 1C1PA 3PLKA 1CHOF 1ZSLA 7KMEH 1Z6EA 2ZECA 4XBBA 1PYTC 2Q6FA 2FTMA 2Y5HA 1ZRBA 1FDPA 1IQJA 1TYNA 1VCQA 2XC4A 3V13A 2F83A 1DITH 1VR1H 3HK3B 3F68H 2Z6BD 5FPSA 1H1BA 1O5EH 1NESE 1A4WH 2NU0E 4TPYA 2GT8A 2Y5GA 3EQ0H 1V2MT 2SGAA 4XOJA 1E37B 5HXFA 1YPEH 3RC6A 1GI9B 3BIUH 3M61U 1J16A 2VB0A 2CXVA 3TNTA 1JMOH 2VJ1A 4M7GA 2ESTE 1MUEB 2B0FA 1UVPA 3E1XB 2FOBA 4AFUA 1T8NA 5FX6A 3EYDA 3SV6A 1V2OT 4UFDH 2K1QA 3H5CB 2R9PA 1NROH 2DUCA 2OC1A 1AMHA 2UUKB 4TYDA 2Z9JA 1EAIA 4CRFA 2Q1JA 1O2QA 3DA9B 3RU4T 2DE8A 3QK1A 1C2HA 1E35B 1P06A 1D3TB 1P2JA 1XUJA 1O2ZA 1T32A 1UK2A 1INCA 4KTCA 5C5OA 3MO6A 3UPEA 1A1RA 1GBTA 4NFFA 2ZHEH 1MTUA 1NRNH 1J9CH 2B5TB 1SGFG 2ULLA 2HNTE 1GMHG 1LMWB 3P8NA 2EC9H 1FNIA 3RXTA 1L1JA 5GWZA 3BTME 5FBEA 3KGPA 1W7XH 3DHKH 1KTTB 1G3DA 1DANH 1ZHMA 5I46H 2V6NA 2BD4A 1SMFE 5DG6A 4H6SB 1TNJA 2HOBA 3O8RA 1AUTC 2IJOB 1MZDA 1A61H 1IQHA 1LKAA 1ZJKA 3SI4H 4ZKRU 1P2IA 2BDCA 2QF3A 1YPJH 1W12U 2OINA 2AMQA 2SNWA 2WYGA 3SGBE 1RIWB 1C2MA 4OS1A 3SGQE 2H9EH 2FX6A 1QY6A 1V2NT 2JH6D 1O35A 3SQHE 1IQMA 3OU0A 3ODFA 1TMUH 1TA2A 1C1UH 1IQFA 2BDBA 3BTTE 1FXYA 1CA8B 2BD5A 2C3SA 2A5IA 2QC2A 3Q3KA 1C5SA 1TA6A 1V3XA 1A2CH 2BLVA 1GI8B 4TWWA 1QHRB 2BQ6B 4KKDA 3T5FH 2P3FH 1IHSH 1F5RA 3EAJA 4ZUHA 1C2KA 1BHXF 2GGVB 3MU5A 4B75A 1QRWA 3RU4E 2TGDA 1H9LB 1VJAU 2AIQA 4ABDA 1YCPK 3MMGA 3P70B 2AERH 1K2I1 2ZU1A 3PROA 2CF8H 2FM2A 1H4WA 2FYRA 1GI0A 1HV7A 2V35A 2SGDE 3E3TA 4MNVA 3PYHA 5HM2A 1L1GA 1SGNE 4CRAA 4CRBA 1KXAA 3KCGH 4YO9A 4SGBE 4BAOB 1XXDA 1T8MA 5SGAE 1TPPA 4RN6A 1AFEH 5C1XA 3VXFH 3GY8A 1GHVH 2GDDA 5HGGA 1CE5A 3PMHB 1CO7E 4O9VA 1QB6A 3U98H 3NZIA 1ELBA 1MTNB 1GI3A 4LK4A 3V0XA 1IQKA 1UK3A 1TNHA 1GI7B 3ZVGA 4ABAA 1DXWA 1BMMH 2BVSH 1P9UA 1BHXB 4YTAA 4K5ZA 4ZHAA 3TU7H 2FI3E 1UK4A 1BTPA 2ZEBA 5DP3A 1SVPA 4YLQH 3PMJA 1ANBA 1G2LA 2RDLA 3ZZDA 2GCTB 1GJ7B 3TLOA 1C5YB 2BZ6H 3SUFA 4A1TA 3SJ9A 4K8YA 1ID5H 1C2IA 1O5GH 2J95A
chains in the Genus database with same CATH superfamily
1G3BA 2BD7A 3MYWA 1KMHB 5LPFA 1P8VC 2XNDD 1LHFH 4WWYA 2EI7A 2XCFA 4INLA 3TPIZ 4JMYA 3ZZCA 3RXEA 3UR6A 1K28D 1QURH 3PTBA 5BRRE 1YF4A 1DLEA 1O0DH 3EE7A 2FI5E 1UTJA 1GCDA 4IN1A 1VGCB 1EX3A 1O5CB 1ZGIA 4XSKU 4Y8ZA 1Y5UT 3SJ8A 1O3JA 1SC8U 2ZF0H 2WHXA 2XBYA 1XX9A 4TY6A 1TNIA 2RA3A 4X8UH 2HLDD 5TJXA 3MH7A 3FAOA 1KDQB 2BTCE 3RC5A 4YM9A 4WXVA 1P0SH 4CHAB 4CBOA 3SU3A 4JYVH 4AGJA 1G2MA 2BDGA 1AFQB 2QIQA 1M9UA 1C5XB 2VNTA 3KYGA 3O8DA 3QZRA 1TX7A 1FZZA 3LC5A 1MKXK 4Y7BA 3RXUA 5C94A 4NWKA 1SOZA 2G8TA 5L2YH 1O2UA 3P8GA 4DOQA 1HJAC 1E38B 3I77A 4NSYA 1C2EA 1NS3A 1HLTH 4X8SH 1RFNA 4ZH8A 3E6PH 2GZ9A 2ZI2H 1QRZA 2BLOA 2Z9IA 2AYWA 2Y82A 3RXFA 2A5KA 3GCNA 3LT3A 2PKSC 3PM3A 1WQSA 2P59A 2UWPA 3OYPA 1HDTH 1EP5A 4AG2A 4NWLA 4WMFA 2GDEH 1BB0B 2OCVB 2PUXB 4ZMAH 1DT2A 1LVMA 3ZVCA 1S0RA 4BTUB 1OWIA 7ESTE 3KIDU 3PTNA 1KDQA 2EEKA 2ODYB 3NXPA 1OP2A 2OC8A 1OYQA 2EA3A 3LKWA 3E0PB 1EJNA 3TJNA 1S84A 3BTHE 3K9XB 4MDSA 3I29A 1AWHB 4AOQA 2GMTC 2XTTB 1P10A 2VH6A 4U32A 1MBQA 2F4LA 4Z1MD 3M7QA 1AVXA 4DIHH 1GDNA 2QGRA 1C5VA 4I8HA 1TONA 3LDXH 1S81A 2ZDNA 5GDSH 3MH6A 4NG9H 3A82A 5HYOA 3R3GB 5EOKA 2XBWA 4CRCA 1DOJA 5L30H 1RTKA 8GCHG 2KCYA 1GHYH 4OGYA 4YXWD 1YPHE 2G52A 1OOKB 3B23B 1GBKA 2FOEA 5C20A 3AAUA 2O8TA 2TBSA 4FVDA 1P04A 3SZNA 1MBMA 1TGCA 1XUKA 3SV9A 1O2JA 2ZP0H 5PTPA 4B2BA 1XKAC 1S6FA 1GI4A 6CHAC 1P3CA 1P2MA 8ESTE 5C2ZA 3ZZ6A 1G3EA 3QX5H 4UFEH 1AI8H 1D6RA 3P8OA 2KFWA 1ZMNA 1QB1A 1A5IA 3SGAE 1SGYE 2I6QA 1AU8A 1C2GA 1AZ8A 3A8CA 3RXDA 3ZVEA 1UTOA 2SFAA 1O2XA 2FZZA 3DSGA 3UAIC 1J14A 1EPTB 5DKMA 3UWIA 4YOJA 4ABJA 5AFYH 1IQIA 3N7DA 1FUJA 1NRQH 2G4TA 1GMCG 1TPAE 5E2OA 2BZAA 3CENA 3IITA 4IC6A 1ZPBA 3RXMA 3AASA 1DWEH 1BQYA 2OC7A 2J34A 1HXFH 1O2IA 4HGCA 2WSSD 3VGCB 2XWAA 2Y7ZA 1O2VA 2ZDMA 3BTEE 1V2KT 1E1QD 3ZYDA 1CGHA 2GKVE 3ATLA 5E0HA 1GVKB 1ELDE 1MAXA 1DX5M 1EAWA 1GI2A 3SNCA 2WPIS 2ZTYA 3MWIU 3MNSA 4ZCNA 2D1JA 1T7CA 1KIGH 1SLUB 2FEQH 2HPPH 2VWMA 1UTMA 3TGKE 3A8AA 1A7SA 1P2KA 2RDEA 3ZZ9A 1ZSKA 3FZDA 3SV7A 4K8BA 4DT7B 2FLRH 3LJOA 4RKOB 3BTFE 3VG8A 5LPEA 3HGNA 1EPTA 5FL7D 1UTPA 4DJZB 3M7UA 1TGBA 1ESTA 1E36B 1O3LA 2VWLA 3OY6U 2I6SA 4FUJA 3MH5A 3RXSA 2THFB 1GBFA 4ABGA 3UIRA 6GCHG 1TE0A 2BOKA 3RXQA 4ASUD 3ESTA 2EI8A 4Y8YA 3EA8A 1W0ZU 2PSXA 1V2RT 1JRSA 4X6PA 5T6FA 5F53A 2OP9A 2Y5FA 4GSOA 2Y80A 3OX7U 1EATA 4X6OA 2ZCHP 4DW2U 2O8WA 4I31A 2SNVA 4HTCH 4NA9H 1S0QA 3KL6A 1O2YA 1BJUA 3MU0A 3E8LA 1MABB 3OEED 2WV9A 2A31A 2W5EA 4ISLA 1CGJE 2D26C 3WWBA 2FTLE 1NN6A 4A6LA 4BTTB 3PO1B 1BTUA 2FPZA 1Q3XA 3CNRA 3BG8A 5F8TA 1KXBA 1XUHA 2OLGA 1AB9B 1T4VH 1ELFA 3M5NA 3RXBA 1AGJA 3GCTG 2Q6GA 2NU1E 3T27A 2FESH 1EASA 1PJPA 4RT0A 1V2VT 2BYAX 1O2RA 3SUEA 3KQCA 1HJ9A 1H8ED 3RMMH 3KQDA 1HAPH 3A83A 4R0IA 1XM1A 3DCLA 2DE9A 1Q31A 2OQ5A 3QGNB 1C1VH 4X2YA 3TNSA 3V7TA 4H4FA 2CF9H 1CBWB 2BQWB 3KQBA 4BOHA 3RLWH 5AF9H 2H9TH 2R2MB 1H9HE 1UCYK 1LHCH 1VITF 1A3EH 1NO9H 1C5ZB 3PWCA 1O5BB 3GY4A 1V2PT 1S82A 2R2WU 1H8HD 1O2KA 2WINI 2F9PA 3UY9A 1OP0A 1GJ8B 2BD3A 3ATIA 3CS7A 1HYLA 2EI6A 3WY8A 3A7TA 4DY7B 1EQ9A 4WMDA 2UWLA 2F9NA 2B7DH 2G51A 4JYUH 5FPYA 3RXRA 1TGNA 4CH2B 2V7QD 5DN6D 1BTXA 5EODA 1O34A 2ANWA 1NRSH 1ZTLA 3RXPA 1GJDB 1LCYA 4IS5A 1BOQA 2XBVA 3V3MA 2VIVA 1X7AC 2WPMS 1C5QA 5GCHG 1HAVB 2P8OB 1F7ZA 4I7YH 1EJMA 1JIMA 2GCHF 4LZ4B 2HNTC 1IQEA 5DPAA 2BX4A 1AIXH 1DS2E 4NZQA 3STJA 1K1MA 2F91A 4X2VA 3ZZ5A 1BTYA 5CHAB 3SV2H 1T8LA 1FPHH 1SGEE 3ZZ8A 1K9OE 2W6ID 2Z3DA 2CK3D 3MNBA 3STIA 2QXJA 3UNQA 2G4UA 4AB9A 2V3MA 2VIOA 1SG8B 5EXNA 3Q76A 2AGEX 1OKXA 1YP9A 3BTGE 3SU4A 3LH3A 4MG3A 3VXEH 2VIQA 1HUTH 2GV7A 1F0TA 1JXPA 2G5VA 4ASHA 3T28A 4TSFD 1C9TA 1HXEH 3GDUA 1LQDB 3PMAB 3WWFA 2PTNA 1XUIA 3CS0A 2Z9GA 2W7SA 1P57B 1U6QA 4ZHMU 3SNEA 4AG1A 1O3GA 4B1TA 1EZXC 2TIOA 1HAVA 5B6LA 3QDZB 1F92A 2GCTC 1SFQB 1WSSH 4FETA 1CT4E 1LDTT 3LIWA 5TCCA 3SOSA 3GOVB 4GCHG 3UFAA 4H6TA 3H7TA 5F8ZA 4UEHH 1QL7A 5JBTA 2ZQ2A 5HIYA 1OPHB 3AAVA 5JYIA 1RD3B 3BF6H 2ZC9H 1TB6H 2CMYA 2ZNKH 1BIOA 1SBWA 2W6JD 5HM9A 1OSSA 1A5GH 1PQ8A 1TABE 2YMSB 3MQKC 1Z8IB 4B74A 1NBME 1VGCC 1QL8A 5T6GA 3FP6E 1C5OH 1F2SE 3T2NA 1AO5A 4KGAA 3VB4A 1PPCE 1E34B 6LPRA 1ABJH 2R3UA 5T3HA 3RC4A 2QXIA 2H2ZA 2WUCA 1WXRA 1ARCA 2XYAA 5JBAS 1TPSA 1TBQH 2P16A 2Z7FE 1YPLH 5DJ7A 2ZU5A 3B9FH 1K0HA 1SGPE 2QYIA 4Q7XA 1NU7B 3QTOH 2GZ7A 4CHAC 1LVBA 4I32A 1HAIH 4JZIA 2YOLA 1AFQC 4WY3A 5T1VA 4MPWA 3SHCH 4MNYA 1J17T 2J38A 1ESBA 1O2TA 4B71A 1JIRA 3SI3H 4ZXXH 3NRLA 4K60A 5FAHA 2ZIQH 3SNAA 1KXEA 3A7XA 5EXLA 2HVYB 1FY3A 2YNBA 1GHZA 2AGIX 3SORA 1A0JA 3LJJA 2ZGHA 4A1XA 2VGCB 3NKKA 4ZKNU 1F0SA 1TALA 1ZMLA 1O2HA 1ZZZA 3DFLA 2NU4E 1TRMA 2ALVA 3NK8A 2FS9A 5IDKA 2OBQA 3SO3A 1W3CA 3M5MA 1GG6B 1GBCA 3C1KA 1YPMH 2J92A 3FZZA 2RA0A 3UREA 4AGKA 1MKWH 3KYFA 3KHVA 4J1YA 1BMLA 1MD8A 1P2NA 1PFXC 1K1IA 4K3JA 3JZ2B 4FOUC 2ZFFH 3RXLA 2CHAB 4F48B 1L4DA 1SGCA 1YC0A 1QA7A 5ESBA 2WPDD 1HB0B 2ZTXA 3VB7A 1HJ8A 2YNAA 1FN8A 4MLFB 2R0KA 2J94A 2TGAA 3Q77A 1YKTA 1E0FD 5C67A 4AN7A 4MPUA 2BY9X 1HFDA 1ZPZA 1MQ6A 2PV9B 2W7UA 1ESAA 2KR7A 3H09A 4OS7A 2KZ4A 4NA7A 1MZAA 4WMEA 4FVBA 1GL0E 1Z71A 1G37A 1W13U 1WQVH 2ZCLP 3RMOH 4VGCB 1ZJDA 1QJ6B 1JOUB 5C3NA 3TJOA 3SU5A 1SGFA 2XCNA 3Q3YA 4YOIA 5GIBA 1DICA 1TX6A 2PTCE 2O8MA 1BJVA 3F0OA 2Y7XA 3UOPA 5DSFA 1GJCB 2H9HA 3URCA 3BEFB 3GYMA 3QTVH 1SLVB 1ZOMA 1YYY1 1LO6A 4OS6A 4A5TS 3LH1A 4IW4E 2AEIH 2WZQA 3ZZ4A 2ZU2A 3UQOA 1B0EA 2WPJS 3RU4D 1HAXB 2AH4X 4K1TA 3ZV8A 3SN8A 3KN2A 1N8OC 4JZEH 2XXLA 1YPKH 2VH0A 3URDA 1G3CA 1NRPH 1QZ8A 3MHWU 1ZHRA 4Q7YA 4BAQB 5JPMH 3VB3A 5GNDA 2ANYA 2HWLB 2RG3A 3MU8A 1DSUA 1TRYA 4CR9A 1IQLA 1YWUA 2QF4A 3F2FA 3C27B 4DURA 5DP4A 2PSYA 1TQ0B 2A4QA 3ELAH 5DP7A 1ELCA 1O3OA 1ABIH 1HAZB 1OHHD 1AQ7A 1EPTC 4ESTE 4MVNA 1HBTH 3RLYH 1HCGA 1QBVH 2XOKD 3GICB 3IG6B 3RXVA 4K2YA 1GBBA 3M35A 2GX4A 2FDAA 3TGIE 2PGQB 3HKIB 8KME2 2XWBI 3NPSA 1O30A 4WXIA 2A0QB 4MTBA 1K1NA 1W2KH 1QGFA 1IAUA 2OUAA 4K69A 1COWD 2V3HH 4MNXA 4ZAEA 3TH4H 4H42U 2H5CA 3HGPA 3E0NB 1RGQA 5C0UA 3BEIB 3FN8A 1DWBH 1NFXA 3U28C 2GP9B 1EOJA 2Y6TA 2JH0D 1N1LA 3TITA 1QBNA 4IMZA 3SV8A 3WW7A 3A7YA 3OTJE 1DUAA 2A2QH 4YLUA 3UTUH 1E1RD 1GHBG 2H5DA 1O3EA 1P03A 1YPHC 3VB6A 2CV3A 1C2FA 4Q80A 5ABWA 1UO6A 1ARBA 1XUGA 2QA9E 1K21H 2ZHWH 2A32A 3LU9B 4BANB 4GLYA 1N6YA 2ODQA 3DD2H 2VIWA 1AVGH 4CR5A 5L6NH 3MOCA 8LPRA 1DWCH 1OWDA 1W14U 4XE4A 2BY6X 2GJGA 2GD4B 2AIPA 3TIUA 1CA0C 4GVUA 1B0FA 1YGCH 4B2CA 2V3OH 3D62A 3RUOA 2CN0H 3H7OA 1KY9A 2UUJB 1FY8E 2J98B 3K65B 2P95A 4K1EA 3A8DA 4AZ2B 3GY2A 1GHAF 3LPRA 4OS5A 1OWHA 3LOXA 2CJIA 4JK6A 4DGJA 1BBRH 3RXIA 1BRUP 2P3TB 2WPLS 2ZG0H 3AW1A 4U2WA 3PO1C 4ABFA 1CSOE 1OYTH 1SI5H 1Z1IA 1D3QB 4P00A 3F2GA 4AB8A 1THSH 1Z8RA 1UVUH 2ZGJA 3UNSA 4TPIZ 1P2QA 2NU3E 4JZFH 1AE5A 1GJ4H 9ESTA 3P6ZB 1AN1E 1JWTA 4HI3A 2W3KA 3A89A 3TH3H 1UVSH 1O2GH 1CU1A 2BXUH 1ELGA 1ZGVA 1OP8A 4X1PU 1WU1A 2O8UA 3A7ZA 1GHXH 3M5LA 1JBUH 1BT7A 1CBWC 1AUJA 1A0LA 1ETTH 4OM9A 4XD7D 3NCLA 1BDAA 2J98A 1SB1H 4XDEA 2XC5A 1GBLA 3GY3A 4ISOA 1JRTA 4CBNA 2G00A 5HKKD 1PPHE 3BTQE 3FP7E 4D7GA 3FFGA 3F0PA 1PQ7A 1V6DA 3RM2H 4D8NA 1J8AA 1EUFA 3FO8D 5ETXA 2F9BH 1UHBB 2Z3EA 3VPKA 4INKA 1VCPA 2PLXA 3A84A 2IPQX 3PRDA 3EA9A 3W94A 3T26A 1QCPA 3PLBA 5LPRA 3AK5A 1TNKA 4F49A 2P8OC 4XBCA 3RXCA 2BD8A 2IN2A 3UUZA 4IBLH 2D2DA 2C8XB 1GMCF 1KYNA 2JIZD 3SNBA 3N7EA 2SGEE 2A4GA 2IJD1 2BVRH 1VITH 2W26A 3FVFB 4MPXA 3V12A 2TRMA 1BBRE 5CHAC 1C1OA 1H9IE 2KCPA 1O3KA 4E7NA 4RSPA 1FAKH 3QGJA 2ZFQH 2Y81A 4ISNA 1QB9A 1EAUA 1XVOA 1LKBA 1V2UT 3D65E 2Q6DA 4J2YB 1SLWB 2BDIA 3U8TH 6ESTA 3T29A 4DIIH 2GV6A 4Z6AH 1FX0B 3SZEA 7GCHF 3DSOA 1L2EA 3SW2B 1UHBA 1O5DH 1A5HA 4Y0ZE 3S0NA 4FU9A 2XBXA 2G81E 2A7HA 1SGDE 1QR3E 3GY5A 2A2XH 3QUMP 4X6MA 1MMJN 1O31A 3A7VA 4TWYA 2F9OA 2A4RA 1FY1A 5CE1A 2BD9A 2BDHA 1GI1A 3AVZA 3U1IB 4FUFA 3A81A 4I33A 2BB4A 1GGDB 4DT4A 3G01A 4NCYA 1P02A 2O9QA 3BG4B 1WV7H 2ZGBH 4BAMB 6GCHF 4TY7A 3MO9A 1L4ZA 3PB1E 2UUFB 4X1QU 1T31A 3Q00A 4O3UA 4R8TB 5C1UA 3S9CA 2P94A 1HRTH 1W10U 5C1YA 1CHGA 5EJZA 1C5NH 1FIWA 4NGAH 1O3PB 4GPGA 2ZDLA 2RFKC 3GY6A 2A1DB 1C4V2 1GMDG 4CRGA 3SQEE 1Z7KA 4FUHA 1OXGA 1C5RA 2OC0A 2CGAA 1KLTA 1EB2A 1ACBE 4UFFH 5L2ZH 5LGOA 4NZLA 5LH8A 3BEUA 2A45B 2BM2A 3M3SA 1GBIA 1SL3A 1SFIA 3GCTF 2VVUA 3S9AA 3S9BA 3OY5U 4B6EA 4A1VA 3BV9B 1S83A 1S85A 2FP7B 3QO6A 3K6YA 3TJVA 5EW2H 3VEQB 1RTLA 1SGTA 3GS9A 4ISHH 2C93B 4WH6A 3KNXA 4WF8A 3A8BA 2BXTH 4Y7AA 1F0UA 1TGTA 3ZZ7A 1EAXA 1O3NA 3W1EA 1BMNH 2PUQH 3HK6B 1T8OA 1QRXA 1NFWA 1NY22 3FOAA 2ZGXH 3MI4A 2VGCC 1WTHD 2ZQ1A 4XFQA 1E79D 1PPZA 1RIWC 2LELA 2AHME 2LP6A 2ZHDA 3MNXA 2VWOA 3SJKA 4AFQA 1RS0A 2PHBA 2ZFSA 1SPJA 4BXSA 1TQ7B 1CGIE 5IK2D 4D7FA 1T4UH 1TLDA 1GG6C 1AZZA 1K1OA 4MNWA 4DVAU 1UTKA 1QL9A 2A5AA 4NA8A 1FMGA 1MU6B 3P8FA 3PRBA 1MD7A 1YM0A 1MQ5A 4KP0A 3Q3XA 5EGMA 1P12E 5EQSA 1C5PA 3P17H 2CHAC 3SBKA 2AMPA 1C1TA 1KXFA 3U8OH 1BZXE 4IGDA 1QNJA 1Z1JA 1ELTA 3ZVDA 3OAAD 5FBIA 3RXHA 2EY4C 2BHGA 3GCHB 3RMLH 4B73A 1KLIH 4GHQA 3PLPA 5C5NA 3T25A 2HVXA 2ZTZA 2C8YB 1RRKA 1C4U2 1UVOA 2AGGX 4VGCC 1NC6A 1EOLA 4ZKSU 5I25A 1SQAA 2ANMH 2L74A 2WPHS 2XRCA 5HIZA 1GCTB 1LPGB 1SQOA 1K1LA 3MFJA 4A7IB 1F5KU 1GHWH 1O2MA 1IQGA 2C8WB 1O2LA 1C5UA 1XKBC 3A87A 3ZZ3A 1ELVA 3EGKH 1MTNC 1OWJA 3HKJB 4MQAA 1D9IA 1D4PB 2ILNA 3M5OA 5E2PA 2H6MA 1AVWA 4K1SA 3M7TA 1BMFD 4LOYH 5T6DA 4NFEA 1FI8A 2XC0A 3GISB 4E05H 4YESB 1C5TA 1EZSC 4Z0KA 3PV2A 1O5FH 1CVWH 1V2JT 2YMSD 1AD8H 5A2MH 1XVMA 3RXOA 2FLBH 5CMXH 1HPGA 2QN5T 2GTBA 4BAHB 5EW1H 4GCHF 2ZKSA 3F9GA 1NRRH 5BPEA 1FONA 1C1NA 1CHOG 5JBCS 1GBJA 2HPQH 3I78A 2L6OA 4JZ1A 1QQUA 4X1RU 1OWEA 1O3BA 1LVOA 1THRH 4JZDH 5KECA 2J4IA 3AW0A 4X2WA 3RXJA 1LPZB 2BLWA 1NZQH 1GI6A 1EJAA 2VIPA 2BY5X 2QV1A 1QFKH 1ZSJA 4U01A 1GMHF 4U30A 1Y8TA 1LHGH 2PGBB 2B8OH 4AFSA 4CREA 2VBCA 2NWNA 3NWUA 2P3UB 1Y3VA 2J97A 4FUDA 1Y5AT 3EE0B 3EDXB 1CT2E 1EKBB 2JETB 5G4BA 4O97A 3UR9A 1NPMA 3MU1A 1LHDH 3F6UH 2UWOA 1XXFA 2ALPA 3BTKE 1O39A 1AY6H 4WVPE 1DPOA 3N7OA 7LPRA 3S7KB 4BXWA 3K6ZA 1F5LA 2FOMB 1TWXB 3RP2A 3ZVBA 1Y59T 1TAWA 1GL1A 3M3TA 2BDAA 3ODDA 4HZHA 3UQVA 2HALA 4UFGH 4DCDA 4JYTA 4D76A 1GPZA 2ZFRH 3BTWE 1TFXA 5EIYA 4P02A 1FAXA 1A3BH 1YLCA 5A8XA 4I8JA 4O3TA 1C9PA 5ESTE 1WBGB 2VINA 2C4FH 1FIZA 1HAOH 3CP7A 1TOCB 3O8CA 1SLXB 1NBMD 1YCPH 3SHAH 1O3DA 1BTZA 1OWKA 3E90B 3NUMA 4Q7ZA 1A46H 3GDVA 5J4SA 5GXPA 3ZV9A 2GT7A 2HNTF 1WAYB 3KQEA 4FU8A 3ZZBA 1YPGH 3TGJE 4X1NU 5A8YA 4IN2A 1FQ3A 2QCYA 5EQRA 1W11U 1PPBH 5H4IB 1GJ9B 2ZPSA 2FYQA 4BTIB 2A7CA 4KTSA 5F03A 1VJ9U 1EFRD 4ZKOU 1TGSZ 2OXSA 3RXAA 1GBHA 5FPTA 3KF2A 1QIXB 4NIVA 4Q2KA 1MCTA 2XNIA 1C1MA 2BOHB 1NFUA 1GBDA 2OD3B 2ZGCA 2ZZUH 3PWBA 1C2DA 1ZR0A 2ZA5A 1Q2WA 4WH8A 1BRBE 5GPIB 3TK6A 1DY9A 3FP8E 1H8DH 4I8KA 1WUNH 2Z9KA 1PYTD 1C2LA 2C8ZB 2KX4A 4GAWA 1S6HA 1G36A 3DT0H 1C5WB 2VIDA 2SGQE 3U1JB 1YLNA 3GDSA 1IQNA 1GJAB 1WYKA 3S69A 1MKWK 4Y71A 2PKAB 2FX4A 3SJOA 1KLJH 2ZU4A 3BIVH 5K0HA 4KTUA 2QF5A 1QTFA 3BTDE 4B76A 2VU8E 1K22H 3QN7A 1FJSA 3P92A 1WCZA 1ZLRA 4WJG2 1ZTJA 1Z6JH 5EU8A 1NFYA 4THNH 4ZROA 1EB1H 1W8BH 2QF0A 1L1NA 4INHA 3BN9A 3LGIA 1O3MA 1O2NA 1SHHB 1O33A 1P2OA 5FCRA 1YY3A 3HATH 1KXCA 1AHTH 1ANEA 3A88A 4X8VH 5F6MA 3ZVAA 1Y3XA 4Y0YE 1O2PA 4X1SU 1W0YH 1HIAB 4Y8XA 5DP8A 1MTSA 1O38A 1SQRA 5C0TA 3ZVFA 5FX5A 3IWMA 1IHTH 1C1RA 2WV4A 2FOCA 1MKXH 3UWJH 3M3VA 2KAIB 4ABBA 1QQ4A 2WUBA 2ANKH 4NIXA 3KEEA 2FIRH 2KM0A 2VWNA 5EQQA 4AC9A 2PKAA 3ATMA 1NM6A 2STBE 4D9RA 3GCOA 5AFZH 3SU6A 4UDWH 4ISIH 4GHTA 2BY8X 3VGCC 3A86A 1NU9A 3L3TA 1C1QA 4CRDA 2W3IA 1UMAH 3DFJA 1BUIA 1FN6A 5EG4A 5J4QA 1EZUC 1PPEE 4IC5A 4Y6DA 5A09A 3R0FA 1WTGH 1MH0A 2ODPA 3U9AH 1AKSB 1GHBF 3ENSB 1AWFH 1O32A 1YBWA 3BSQA 1FPCH 1O3HA 1EP6A 3A85A 5E8EH 4XRNA 1GBAA 1ETSH 2WPKS 3EA7A 2IPHA 2J5UA 1SGRE 1RJXB 3RXKA 1DVAH 4JCNA 1YCPM 3OFND 3F9HA 1HIAA 5GJ4B 4X6NA 2J9NA 1HNEE 2PW8H 2BQ7B 1ANDA 1GGDC 4HFPB 4X8TH 3A80A 4GUXA 3BG4C 3VFEA 1ZRKA 3P95A 2KAIA 2BMGB 3TK9A 2FI4E 1ETRH 4YZUA 1W7GH 3SNDA 4ZXYH 1UTQA 3TJUA 1FY4A 1HAYB 2BLQA 3VB5A 3RXGA 1MAYA 1G32B 1C1WH 2BD2A 1SHYA 2SGFE 1BMAA 3UB0A 1B5GH 3ATWA 1GBMA 2PP6A 3QZQA 3SJIA 1AKSA 3LGWA 3W95A 2UUYA 4QT8C 1O37A 3E91A 5B6OA 2AMDA 2WV5A 3LC3A 3D49H 1SGIB 4ACBA 1AB9C 1MTVA 2ZO3H 3UNRA 1UW7A 5C17A 2GZ8A 3OTPA 5JB8S 1Y3WA 5TCAA 2K0QA 1P11E 1GI5A 2XW9A 2SGPE 3QWCH 1GHAG 1TPOA 1ZYOA 3ZYEA 5EJ1A 4HG6A 1KTSB 1RXPA 2RCEA 2ZPQA 8GCHF 1PPGE 3LGYA 5A0BA 2P93A 1Y5BT 1LHEH 2Z94A 5AVDA 5FHTA 3SU2A 4YOGA 2O8LA 3TK5A 2HRVA 4MPVA 2R0LA 3SU0A 3MO3A 3LGVA 1P05A 1V2ST 1K1JA 2PWXA 3SU1A 1UTNA 2BY7X 2AS9A 2M5TA 2D8WA 2R3YA 3UOUA 1UVTH 2FOFA 1BBRK 4Y76A 1D3PB 5JBBS 4KELA 1CT0E 2Z9LA 4RKJB 2KCOA 1BA8B 1EXFA 1TBZH 2ZHQH 3PMBB 1BTWA 2OTVA 4FUEA 4I86A 1SR5C 1C5LH 1NT1A 9LPRA 1GDUA 2HLCA 3F9FA 3TVJB 1BITA 2B9LA 4RI0A 4YT6H 1DFPA 3MU4A 2ZHFH 5A8ZA 1N8OB 1MTWA 5EPYA 4O03A 3GCHC 4F55A 1TNLA 1BRCE 1OS8A 3F1SB 2VVCA 1C2JA 1LTOA 3B8JA 1KXDA 2LNCA 5DGJA 1HAHH 2NU2E 3S7HB 1O3FA 1LVYA 1ZPCA 1FY5A 1SSXA 4UE7H 1GVLA 4FUIA 2JH5D 1O3IA 3ITIA 5EPNA 1DY8A 3L33A 2LPRA 5IYTA 1GCTC 1NTPA 1Y3UA 3ZZAA 1AE8H 1LQEA 1O36A 4BNRA 5DP6A 2PR3A 2G5NA 2WYJA 1ANCA 1BRAA 3ATKA 1P01A 1HAGE 2ZDKA 3K2UA 1Z8GA 1YLDA 4E7RG 2G55A 1TX8A 4X0WU 1F0RA 2PFEA 1C1SA 4XBDA 4FU7A 3T62A 3TH2H 2TGPZ 3LONA 2JKHA 1TRNA 2ZDAH 4FUCA 2A4OA 4F4OC 2FWWA 1Z8JB 2QAAA 4IMQA 1BTHH 2ZFPH 4AX9H 2OQUA 2TGTA 1O3CA 4UONA 2OK5A 1H8IH 1P09A 3LGTA 5DO4H 1VZQH 3E16B 2IOTA 1O2WA 2QXHA 1ORFA 3KQ5A 1C5MD 1GVZA 5DP9A 3HPTB 2FOHA 3OE7D 1QJ7B 1PQAA 7GCHG 4BAKB 4FXGH 1XMNB 1HJAB 1L0ZA 4OS2A 3F9EA 4ABEA 1DE7H 1GJ6A 1SGQE 2YMSC 3PV4A 5FCKA 4SGAE 2OBOA 1GMDF 4B2AA 3JZ1B 1A0HB 1DM4B 2F9UA 2QE7D 5A0CA 3RM0H 1CQQA 2FXRA 4UD9H 1W0KD 2ZWLH 5DK1A 5FXLA 5K7RA 2PKSB 1DWDH 4NIWA 2TPIZ 1GWAA 2JETC 4NIYA 1CA0B 2V0BA 1J15A 1UTLM 1FV9A 4OGXA 4DG4A 1QA0A 3MTYA 4Y79A 1UCYH 4Q4LA 1GJBB 1Y3YA 1SQTA 1P3EA 4FUBA 1KSNA 5A0AE 1BCUH 1P9SA 1XUFA 3GY7A 1G30B 1IOEA 1TIOA 2QY0B 3MNCA 2F3CE 4E06H 1ELEE 1SOTA 5AHGH 1D3DB 4OS4A 1O5AB 2GMTB 1G9IE 3SUGA 1GJ5H 2ZU3A 1MCVA 2FO9A 1WOFA 3O8BA 2FS8A 1B7XB 1LPKB 2FODA 1V2TT 1DDJA 1UJ1A 4A92A 1SKYE 2JJ1D 5E0GA 2F9VA 1TBRH 5F8XA 2QXGA 4LZ1H 4FUGA 1EZQA 3U8RH 5JB9S 1V2QT 2GVFA 2ZDVH 2F43B 1D6WA 3OSYA 3QLPH 1RTFB 1N6XA 4AFZA 1DSTA 1ELAA 4I8GA 2BX3A 1MU8B 1TNGA 4Y11E 2JDID 2AFQB 2J2UA 1QJ1B 4ACAA 4CH8B 3GYLB 3RDZA 1VCWA 5GCHF 3SYJA 4ABHA 4LXBH 4D9QA 2ASUB 2ZCKP 4ABIA 5EJLA 1TOMH 1TMBH 3M36A 3U69H 3RMNH 2BVXH 3DUXH 1VITG 3LGUA 1GBEA 2ZPRA 3MH4A 2C90B 1VKYA 1V2WT 3M37A 4X2XA 4AYVB 1THPB 1PPFE 1QBOA 2HGTH 1S5SA 4NSVA 2H1UA 6CHAB 1C4Y2 2FOAA 1PQ5A 2VVVA 4PROA 4JK5A 4TT3D 4I8LA 2A7JA 1DLKB 1DUEA 2FOGA 4ZHLU 5EXMA 1O3AA 5E0JA 2STAE 3A7WA 1K1PA 1O2SA 3FANA 2Z3CA 1UCYE 4AYYB 3SUDA 1O2OA 3F3BA 4Y10E 1V2LT 5CDFE 4AORA 1TMTH 2GCHG 1ZMJA 4YT7H 1OX1A 2ZFTA 1HGTH 3L6PA 1ZHPA 2BDYA 1W0JD 5HMAA 1DXPA 1FLEE 2FMJA 5JDUB 5DP5A 1ZTKA 1GDQA 3D23A 1C1PA 3PLKA 1CHOF 1ZSLA 7KMEH 1Z6EA 2ZECA 4XBBA 1PYTC 2Q6FA 2FTMA 2Y5HA 1ZRBA 1FDPA 1IQJA 1TYNA 1VCQA 2XC4A 4RT1A 3V13A 2F83A 1DITH 1VR1H 3HK3B 2KCAA 3F68H 2Z6BD 5FPSA 1H1BA 1O5EH 1NESE 3OEHD 1A4WH 2NU0E 4TPYA 2GT8A 2Y5GA 3EQ0H 3ZIAD 1V2MT 2SGAA 4XOJA 1E37B 5HXFA 1YPEH 3RC6A 1GI9B 3BIUH 3M61U 1J16A 2VB0A 2CXVA 3TNTA 1JMOH 2VJ1A 4M7GA 4Q63A 2ESTE 3N99A 1MUEB 2B0FA 1UVPA 3E1XB 2FOBA 4AFUA 1T8NA 5FX6A 3EYDA 3SV6A 1V2OT 4UFDH 2K1QA 3H5CB 2R9PA 1NROH 2DUCA 2OC1A 1AMHA 2UUKB 4TYDA 2Z9JA 1EAIA 4CRFA 2Q1JA 1O2QA 3DA9B 3RU4T 2DE8A 3QK1A 1C2HA 1E35B 1P06A 1D3TB 1P2JA 1XUJA 1O2ZA 1T32A 1WDIA 1UK2A 1INCA 4KTCA 5C5OA 3MO6A 3UPEA 1A1RA 1GBTA 4NFFA 2ZHEH 1MTUA 1NRNH 1J9CH 2B5TB 1SGFG 2ULLA 2HNTE 1GMHG 4M9FA 1LMWB 3DSPA 3P8NA 2EC9H 1FNIA 3RXTA 1L1JA 5GWZA 3BTME 5FBEA 3KGPA 1W7XH 3DHKH 1KTTB 1G3DA 1DANH 1S6LA 1ZHMA 5I46H 4B6FA 2V6NA 2BD4A 1SMFE 5DG6A 5KEDA 4H6SB 1TNJA 2HOBA 3O8RA 1AUTC 2IJOB 1MZDA 1A61H 1IQHA 1LKAA 1ZJKA 3SI4H 4ZKRU 1P2IA 2BDCA 2QF3A 1YPJH 1W12U 2OINA 2AMQA 2SNWA 2WYGA 3SGBE 1RIWB 1C2MA 4OS1A 5KGOA 3SGQE 2H9EH 2FX6A 1QY6A 1V2NT 2JH6D 1O35A 3SQHE 1IQMA 3OU0A 2JJ2D 3ODFA 1TMUH 1TA2A 1C1UH 1IQFA 2BDBA 3BTTE 1FXYA 1CA8B 2M2AA 2BD5A 2K8IA 2C3SA 2A5IA 2QC2A 3Q3KA 1C5SA 1TA6A 1V3XA 1A2CH 2BLVA 1GI8B 4TWWA 1QHRB 2BQ6B 3PV5A 4KKDA 3T5FH 2P3FH 1IHSH 1F5RA 3EAJA 4ZUHA 1C2KA 1BHXF 2GGVB 3MU5A 4B75A 1QRWA 3RU4E 2EQNA 2TGDA 1H9LB 1VJAU 2AIQA 4ABDA 1YCPK 3MMGA 3P70B 2AERH 1K2I1 2ZU1A 3PROA 2CF8H 2FM2A 1H4WA 2FYRA 1GI0A 1HV7A 2V35A 2SGDE 3E3TA 4MNVA 3PYHA 5HM2A 1L1GA 1SGNE 4CRAA 4CRBA 1KXAA 3KCGH 4YO9A 4SGBE 4BAOB 1XXDA 1T8MA 5SGAE 1TPPA 4RN6A 1AFEH 5C1XA 3VXFH 3GY8A 1GHVH 2GDDA 5HGGA 1CE5A 3PMHB 1CO7E 4O9VA 1QB6A 3U98H 3NZIA 1ELBA 1MTNB 1GI3A 3FKSD 4LK4A 3V0XA 1IQKA 1UK3A 1TNHA 1GI7B 5CHBA 3ZVGA 4ABAA 1DXWA 1BMMH 2BVSH 1P9UA 1BHXB 4YTAA 4K5ZA 4ZHAA 3TU7H 2FI3E 1UK4A 1BTPA 2ZEBA 5DP3A 3F2HA 1SVPA 4YLQH 3PMJA 1ANBA 1G2LA 2RDLA 3ZZDA 2GCTB 1GJ7B 3TLOA 1C5YB 2BZ6H 3SUFA 4A1TA 3SJ9A 4K8YA 1ID5H 1C2IA 1O5GH 2J95A
chains in the Genus database with same CATH topology
1G3BA 2BD7A 3MYWA 5LPFA 1P8VC 1LHFH 4WWYA 2EI7A 2XCFA 4INLA 3TPIZ 4JMYA 3ZZCA 3RXEA 3UR6A 1K28D 1QURH 3PTBA 5BRRE 1YF4A 1DLEA 1O0DH 2FI5E 1UTJA 1GCDA 4IN1A 1VGCB 1EX3A 1O5CB 1ZGIA 4XSKU 4Y8ZA 1Y5UT 3SJ8A 1O3JA 1SC8U 2ZF0H 2XBYA 1XX9A 4TY6A 1TNIA 2RA3A 4X8UH 5TJXA 3MH7A 3FAOA 1KDQB 2BTCE 3RC5A 4YM9A 4WXVA 1P0SH 4CHAB 4CBOA 3SU3A 4JYVH 4AGJA 1G2MA 2BDGA 1AFQB 2QIQA 1M9UA 1C5XB 2VNTA 3O8DA 3QZRA 1TX7A 1FZZA 3LC5A 1MKXK 4Y7BA 3RXUA 4NWKA 1SOZA 2G8TA 5L2YH 1O2UA 3P8GA 4DOQA 1HJAC 1E38B 3I77A 4NSYA 1C2EA 1NS3A 1HLTH 4X8SH 1RFNA 4ZH8A 3E6PH 2GZ9A 2ZI2H 1QRZA 2BLOA 2Z9IA 2AYWA 2Y82A 3RXFA 2A5KA 3GCNA 3LT3A 2PKSC 3PM3A 1WQSA 2P59A 2UWPA 3OYPA 1HDTH 1EP5A 4AG2A 4NWLA 4WMFA 2GDEH 1BB0B 2OCVB 2PUXB 4ZMAH 1DT2A 1LVMA 3ZVCA 1S0RA 4BTUB 1OWIA 7ESTE 3KIDU 3PTNA 1KDQA 2EEKA 2ODYB 3NXPA 1OP2A 2OC8A 1OYQA 2EA3A 3LKWA 3E0PB 1EJNA 3TJNA 1S84A 3BTHE 3K9XB 4MDSA 3I29A 1AWHB 4AOQA 2GMTC 2XTTB 1P10A 2VH6A 4U32A 1MBQA 3M7QA 1AVXA 4DIHH 1GDNA 2QGRA 1C5VA 4I8HA 1TONA 3LDXH 1S81A 2ZDNA 5GDSH 3MH6A 4NG9H 3A82A 5HYOA 3R3GB 5EOKA 2XBWA 4CRCA 1DOJA 5L30H 1RTKA 8GCHG 1GHYH 4OGYA 1YPHE 2G52A 1OOKB 3B23B 1GBKA 2FOEA 5C20A 3AAUA 2O8TA 2TBSA 4FVDA 1P04A 3SZNA 1MBMA 1TGCA 1XUKA 3SV9A 1O2JA 2ZP0H 5PTPA 4B2BA 1XKAC 1S6FA 1GI4A 6CHAC 1P3CA 1P2MA 8ESTE 5C2ZA 3ZZ6A 1G3EA 3QX5H 4UFEH 1AI8H 1D6RA 3P8OA 1ZMNA 1QB1A 1A5IA 3SGAE 1SGYE 2I6QA 1AU8A 1C2GA 1AZ8A 3A8CA 3RXDA 3ZVEA 1UTOA 2SFAA 1O2XA 2FZZA 1J14A 1EPTB 5DKMA 3UWIA 4YOJA 4ABJA 5AFYH 1IQIA 1FUJA 1NRQH 2G4TA 1GMCG 1TPAE 5E2OA 2BZAA 3CENA 3IITA 4IC6A 1ZPBA 3RXMA 3AASA 1DWEH 1BQYA 2OC7A 2J34A 1HXFH 1O2IA 4HGCA 3VGCB 2XWAA 2Y7ZA 1O2VA 2ZDMA 3BTEE 1V2KT 3ZYDA 1CGHA 2GKVE 3ATLA 5E0HA 1GVKB 1ELDE 1MAXA 1DX5M 1EAWA 1GI2A 3SNCA 2WPIS 2ZTYA 3MWIU 3MNSA 2D1JA 1T7CA 1KIGH 1SLUB 2FEQH 2HPPH 2VWMA 1UTMA 3TGKE 3A8AA 1A7SA 1P2KA 3ZZ9A 1ZSKA 3FZDA 3SV7A 4K8BA 4DT7B 2FLRH 3LJOA 4RKOB 3BTFE 5LPEA 3HGNA 1EPTA 1UTPA 4DJZB 3M7UA 1TGBA 1ESTA 1E36B 1O3LA 2VWLA 3OY6U 2I6SA 4FUJA 3MH5A 3RXSA 2THFB 1GBFA 4ABGA 3UIRA 6GCHG 1TE0A 2BOKA 3RXQA 3ESTA 2EI8A 4Y8YA 3EA8A 1W0ZU 2PSXA 1V2RT 1JRSA 4X6PA 5T6FA 2OP9A 2Y5FA 4GSOA 2Y80A 3OX7U 1EATA 4X6OA 2ZCHP 4DW2U 2O8WA 4I31A 2SNVA 4HTCH 4NA9H 1S0QA 3KL6A 1O2YA 1BJUA 3MU0A 3E8LA 2A31A 2W5EA 4ISLA 1CGJE 2D26C 4BTTB 2FTLE 1NN6A 4A6LA 3PO1B 1BTUA 2FPZA 1Q3XA 3BG8A 5F8TA 1KXBA 1XUHA 2OLGA 1AB9B 1T4VH 1ELFA 3M5NA 3RXBA 1AGJA 3GCTG 2Q6GA 2NU1E 3T27A 2FESH 1EASA 1PJPA 1V2VT 2BYAX 1O2RA 3SUEA 3KQCA 1HJ9A 3RMMH 3KQDA 1HAPH 3A83A 4R0IA 1XM1A 2DE9A 1Q31A 2OQ5A 3QGNB 1C1VH 4X2YA 3TNSA 3V7TA 4H4FA 2CF9H 1CBWB 2BQWB 3KQBA 4BOHA 3RLWH 5AF9H 2H9TH 2R2MB 1H9HE 1UCYK 1LHCH 1VITF 1A3EH 1NO9H 1C5ZB 3PWCA 1O5BB 3GY4A 1V2PT 1S82A 2R2WU 1O2KA 2WINI 2F9PA 3UY9A 1OP0A 1GJ8B 2BD3A 3ATIA 3CS7A 1HYLA 2EI6A 3WY8A 3A7TA 4DY7B 1EQ9A 4WMDA 2UWLA 2F9NA 2B7DH 2G51A 4JYUH 5FPYA 3RXRA 1TGNA 4CH2B 1BTXA 5EODA 1O34A 2ANWA 1NRSH 1ZTLA 3RXPA 1GJDB 1LCYA 4IS5A 1BOQA 2XBVA 3V3MA 2VIVA 1X7AC 2WPMS 1C5QA 5GCHG 1HAVB 2P8OB 1F7ZA 4I7YH 1EJMA 1JIMA 2GCHF 4LZ4B 2HNTC 1IQEA 5DPAA 2BX4A 1AIXH 1DS2E 4NZQA 3STJA 1K1MA 2F91A 4X2VA 3ZZ5A 1BTYA 5CHAB 3SV2H 1T8LA 1FPHH 1SGEE 3ZZ8A 1K9OE 3MNBA 2Z3DA 3STIA 2QXJA 3UNQA 2G4UA 4AB9A 2VIOA 1SG8B 5EXNA 3Q76A 2AGEX 1OKXA 1YP9A 3BTGE 3SU4A 3LH3A 4MG3A 3VXEH 2VIQA 1HUTH 2GV7A 1F0TA 1JXPA 2G5VA 4ASHA 3T28A 1C9TA 1HXEH 3GDUA 1LQDB 3PMAB 2PTNA 1XUIA 3CS0A 2Z9GA 2W7SA 1P57B 1U6QA 4ZHMU 3SNEA 4AG1A 1O3GA 4B1TA 1EZXC 2TIOA 1HAVA 3QDZB 1F92A 2GCTC 1SFQB 1WSSH 1CT4E 1LDTT 3LIWA 5TCCA 3SOSA 3GOVB 4GCHG 3UFAA 4H6TA 3H7TA 5F8ZA 4UEHH 1QL7A 5JBTA 2ZQ2A 1OPHB 3AAVA 5JYIA 1RD3B 3BF6H 2ZC9H 1TB6H 2CMYA 2ZNKH 1BIOA 1SBWA 5HM9A 1OSSA 1A5GH 1PQ8A 1TABE 1Z8IB 4B74A 1VGCC 1QL8A 5T6GA 3FP6E 1C5OH 1F2SE 3T2NA 1AO5A 4KGAA 3VB4A 1PPCE 1E34B 6LPRA 1ABJH 2R3UA 5T3HA 3RC4A 2QXIA 2H2ZA 2WUCA 1ARCA 2XYAA 5JBAS 1TPSA 1TBQH 2P16A 2Z7FE 1YPLH 5DJ7A 2ZU5A 3B9FH 1SGPE 2QYIA 4Q7XA 1NU7B 3QTOH 2GZ7A 4CHAC 1LVBA 4I32A 1HAIH 4JZIA 2YOLA 1AFQC 4WY3A 4MPWA 3SHCH 4MNYA 1J17T 2J38A 1ESBA 1O2TA 4B71A 1JIRA 3SI3H 4ZXXH 4K60A 5FAHA 2ZIQH 3SNAA 1KXEA 3A7XA 5EXLA 1FY3A 2YNBA 1GHZA 2AGIX 3SORA 1A0JA 3LJJA 2ZGHA 4A1XA 2VGCB 3NKKA 4ZKNU 1F0SA 1TALA 1ZMLA 1O2HA 1ZZZA 3DFLA 2NU4E 1TRMA 2ALVA 3NK8A 2FS9A 5IDKA 2OBQA 3SO3A 1W3CA 3M5MA 1GG6B 1GBCA 3C1KA 1YPMH 2J92A 3FZZA 2RA0A 3UREA 4AGKA 1MKWH 3KHVA 4J1YA 1BMLA 1MD8A 1P2NA 1PFXC 1K1IA 4K3JA 3JZ2B 2ZFFH 3RXLA 2CHAB 1L4DA 1SGCA 1YC0A 1QA7A 5ESBA 1HB0B 2ZTXA 3VB7A 1HJ8A 2YNAA 1FN8A 4MLFB 2R0KA 2J94A 2TGAA 3Q77A 1YKTA 1E0FD 5C67A 4AN7A 4MPUA 2BY9X 1HFDA 1ZPZA 1MQ6A 2PV9B 2W7UA 1ESAA 4OS7A 4NA7A 1MZAA 4WMEA 4FVBA 1GL0E 1Z71A 1G37A 1W13U 1WQVH 2ZCLP 3RMOH 4VGCB 1ZJDA 1QJ6B 1JOUB 5C3NA 3TJOA 3SU5A 1SGFA 2XCNA 3Q3YA 4YOIA 5GIBA 1DICA 1TX6A 2PTCE 2O8MA 1BJVA 2Y7XA 3UOPA 1GJCB 2H9HA 3URCA 3BEFB 3GYMA 3QTVH 1SLVB 1ZOMA 1YYY1 1LO6A 4OS6A 4A5TS 3LH1A 4IW4E 2AEIH 3ZZ4A 2ZU2A 3UQOA 1B0EA 2WPJS 3RU4D 1HAXB 2AH4X 4K1TA 3ZV8A 3SN8A 3KN2A 1N8OC 4JZEH 2XXLA 1YPKH 2VH0A 3URDA 1G3CA 1NRPH 3MHWU 1ZHRA 4Q7YA 4BAQB 5JPMH 3VB3A 2ANYA 2HWLB 2RG3A 3MU8A 1DSUA 1TRYA 4CR9A 1IQLA 3C27B 4DURA 5DP4A 2PSYA 1TQ0B 2A4QA 3ELAH 5DP7A 1ELCA 1O3OA 1ABIH 1HAZB 1AQ7A 1EPTC 4ESTE 4MVNA 1HBTH 3RLYH 1HCGA 1QBVH 3GICB 3IG6B 3RXVA 4K2YA 1GBBA 3M35A 2GX4A 2FDAA 3TGIE 2PGQB 3HKIB 8KME2 2XWBI 3NPSA 1O30A 4WXIA 2A0QB 4MTBA 1K1NA 1W2KH 1QGFA 1IAUA 2OUAA 4K69A 2V3HH 4MNXA 4ZAEA 3TH4H 4H42U 2H5CA 3HGPA 3E0NB 1RGQA 3BEIB 1DWBH 1NFXA 2GP9B 1EOJA 2Y6TA 2JH0D 1N1LA 3TITA 1QBNA 4IMZA 3SV8A 3A7YA 3OTJE 1DUAA 2A2QH 4YLUA 3UTUH 1GHBG 2H5DA 1O3EA 1P03A 1YPHC 3VB6A 2CV3A 1C2FA 4Q80A 5ABWA 1UO6A 1ARBA 1XUGA 2QA9E 1K21H 2ZHWH 2A32A 3LU9B 4BANB 4GLYA 1N6YA 2ODQA 3DD2H 2VIWA 1AVGH 4CR5A 5L6NH 3MOCA 8LPRA 1DWCH 1OWDA 1W14U 4XE4A 2BY6X 2GD4B 2AIPA 3TIUA 1CA0C 4GVUA 1B0FA 1YGCH 4B2CA 2V3OH 3D62A 3RUOA 2CN0H 3H7OA 1KY9A 2UUJB 1FY8E 3K65B 2P95A 4K1EA 3A8DA 4AZ2B 3GY2A 1GHAF 3LPRA 4OS5A 1OWHA 3LOXA 2CJIA 4JK6A 4DGJA 1BBRH 3RXIA 1BRUP 2P3TB 2WPLS 2ZG0H 3AW1A 4U2WA 3PO1C 4ABFA 1CSOE 1OYTH 1SI5H 1Z1IA 1D3QB 4AB8A 1THSH 1Z8RA 1UVUH 2ZGJA 3UNSA 4TPIZ 1P2QA 2NU3E 4JZFH 1AE5A 1GJ4H 9ESTA 3P6ZB 1AN1E 1JWTA 4HI3A 2W3KA 3A89A 3TH3H 1UVSH 1O2GH 1CU1A 2BXUH 1ELGA 1ZGVA 1OP8A 4X1PU 1WU1A 2O8UA 3A7ZA 1GHXH 3M5LA 1JBUH 1BT7A 1CBWC 1AUJA 1A0LA 1ETTH 3NCLA 1BDAA 1SB1H 4XDEA 2XC5A 1GBLA 3GY3A 4ISOA 1JRTA 4CBNA 2G00A 1PPHE 3BTQE 3FP7E 4D7GA 3FFGA 1PQ7A 1V6DA 3RM2H 4D8NA 1J8AA 1EUFA 5ETXA 2F9BH 1UHBB 2Z3EA 3VPKA 4INKA 1VCPA 2PLXA 3A84A 3EA9A 3W94A 3T26A 1QCPA 3PLBA 5LPRA 1TNKA 4F49A 2P8OC 4XBCA 3RXCA 2BD8A 2IN2A 3UUZA 4IBLH 2D2DA 2C8XB 1GMCF 1KYNA 3SNBA 2SGEE 2A4GA 2BVRH 1VITH 2W26A 3FVFB 4MPXA 3V12A 2TRMA 1BBRE 5CHAC 1C1OA 1H9IE 1O3KA 4E7NA 4RSPA 1FAKH 3QGJA 2ZFQH 2Y81A 4ISNA 1QB9A 1EAUA 1XVOA 1LKBA 1V2UT 3D65E 2Q6DA 4J2YB 1SLWB 2BDIA 3U8TH 6ESTA 3T29A 4DIIH 2GV6A 4Z6AH 7GCHF 1L2EA 3SW2B 1UHBA 1O5DH 1A5HA 4Y0ZE 3S0NA 4FU9A 2XBXA 2G81E 2A7HA 1SGDE 1QR3E 3GY5A 2A2XH 3QUMP 4X6MA 1MMJN 1O31A 3A7VA 4TWYA 2F9OA 2A4RA 1FY1A 5CE1A 2BD9A 2BDHA 1GI1A 3AVZA 3U1IB 4FUFA 3A81A 4I33A 2BB4A 1GGDB 3G01A 4NCYA 1P02A 2O9QA 3BG4B 1WV7H 2ZGBH 4BAMB 6GCHF 4TY7A 3MO9A 1L4ZA 3PB1E 2UUFB 4X1QU 1T31A 3Q00A 4O3UA 4R8TB 5C1UA 3S9CA 2P94A 1HRTH 1W10U 5C1YA 1CHGA 1C5NH 1FIWA 4NGAH 1O3PB 4GPGA 2ZDLA 3GY6A 2A1DB 1C4V2 1GMDG 4CRGA 3SQEE 1Z7KA 4FUHA 1OXGA 1C5RA 2OC0A 2CGAA 1KLTA 1EB2A 1ACBE 4UFFH 5L2ZH 5LGOA 4NZLA 5LH8A 3BEUA 2A45B 2BM2A 3M3SA 1GBIA 1SL3A 1SFIA 3GCTF 2VVUA 3S9AA 3S9BA 3OY5U 4A1VA 3BV9B 1S83A 1S85A 2FP7B 3QO6A 3K6YA 3TJVA 5EW2H 3VEQB 1RTLA 1SGTA 4ISHH 2C93B 4WH6A 3KNXA 4WF8A 3A8BA 2BXTH 4Y7AA 1F0UA 1TGTA 3ZZ7A 1EAXA 1O3NA 1BMNH 2PUQH 3HK6B 1T8OA 1QRXA 1NFWA 1NY22 2ZGXH 3MI4A 2VGCC 1WTHD 2ZQ1A 4XFQA 1PPZA 1RIWC 2ZHDA 3MNXA 2VWOA 3SJKA 4AFQA 1RS0A 2PHBA 2ZFSA 1SPJA 4BXSA 1TQ7B 1CGIE 4D7FA 1T4UH 1TLDA 1GG6C 1AZZA 1K1OA 4MNWA 4DVAU 1UTKA 1QL9A 2A5AA 4NA8A 1FMGA 1MU6B 3P8FA