2ZECA

Potent, nonpeptide inhibitors of human mast cell tryptase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
242
structure length
242
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase beta 2
publication title Potent, nonpeptide inhibitors of human mast cell tryptase. Synthesis and biological evaluation of novel spirocyclic piperidine amide derivatives
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 53
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2007-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zecA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zecA01
1FDPA 1S0QA 2ZC9H 2Y7XA 3P8NA 3ODFA 4Y7BA 3RC5A 1RD3B 9LPRA 1EAUA 1TRYA 2AGIX 5JB8S 1X7AC 1GHZA 4X8TH 1KTTB 2BQWB 1QRZA 2R0KA 3VXFH 4ZHLU 3S7HB 2H9HA 2OTVA 3LIWA 1Y3XA 1ZZZA 4IC5A 4A92A 1C5YB 3K65B 4Z0KA 1HAXB 3GCHC 3QGJA 1TIOA 1TPSA 1ZRBA 2BX4A 1GBJA 2P3TB 1SHHB 1GJCB 5T6FA 1DANH 2D2DA 3MMGA 1OYTH 2J92A 1VGCB 2PR3A 3ZVEA 1KTSB 1XUKA 1SFQB 1AKSA 1H1BA 1T31A 1F5LA 4NIVA 1FPCH 2OC7A 4GSOA 1CE5A 4GLYA 2GTBA 4GUXA 1JIRA 1GHVH 1VJAU 1GI3A 1QURH 1O30A 1C1VH 5A0CA 1MUEB 2I6QA 4JYUH 3V12A 1QL9A 5T6DA 1O3KA 3A87A 2BD7A 3BTTE 2J4IA 1ZSLA 2CN0H 1EOJA 4Q2KA 3TVJB 1O3EA 2V35A 2LPRA 1UVPA 2FOEA 1UK4A 2IOTA 1AE8H 1BDAA 2QXIA 3LOXA 2A1DB 3O8CA 4OS5A 1E38B 5LGOA 4IGDA 1P04A 1IQMA 1O3JA 5HMAA 3ZV8A 5LPFA 1DS2E 3D23A 1HXFH 4ISNA 2NU3E 3GY3A 3SNBA 5E2OA 4D76A 9ESTA 1YCPM 3GISB 2O8WA 3F9EA 5EPYA 2FLRH 4AORA 4JCNA 2EI7A 1K21H 4I33A 1D9IA 1ANCA 1AB9C 3SHAH 3PMAB 2G81E 1V2VT 2C3SA 2TIOA 3CS0A 4YOIA 1DFPA 1TGNA 2G00A 2V3HH 4GPGA 2J34A 5JBCS 3B9FH 4YT6H 1EPTC 3KQBA 1UTMA 3PTNA 5DK1A 1QNJA 5EG4A 4UD9H 1LKBA 1SLWB 1AHTH 4GHQA 1O2QA 5GCHG 1QGFA 1D3PB 1EZSC 3AAUA 2QXJA 4UONA 1GVZA 4I8GA 3I78A 2GVFA 2SNVA 2ZHWH 2Z6BD 2A32A 2YNAA 2TGPZ 3F9GA 1Z7KA 1GG6B 2ZDVH 4IW4E 1YGCH 4OGXA 2HRVA 3ZVCA 3URDA 1FMGA 1GI8B 4TY6A 3TH2H 2A5IA 4ABHA 1KXBA 1TRMA 5FBEA 3ZV9A 4XSKU 2Q6GA 1QA0A 3NCLA 1HAPH 1S6HA 2FTLE 4RKJB 2UUYA 3SNEA 1TQ0B 1NT1A 5SGAE 5DP9A 1L1NA 3VPKA 1F0TA 3BG4B 1AUJA 2P8OB 3VEQB 4KTCA 2QCYA 4XBBA 5GCHF 2CXVA 1Q31A 1QFKH 3DD2H 1BTPA 2PV9B 1QQ4A 3MU0A 1PQ5A 1T32A 1HYLA 5A8ZA 2HLCA 1GL0E 3RC4A 2B7DH 2ANWA 3MO9A 3Q3YA 4YTAA 1BITA 1K1JA 3PLKA 1GJBB 1TX7A 3TPIZ 3M36A 2ZDAH 2ZTYA 4GHTA 2BY6X 3ZZ4A 3UNRA 1AVXA 5DP4A 3AW0A 4XBDA 1NFWA 3LGUA 1EAWA 1FPHH 4HFPB 1NZQH 1V3XA 1SQTA 4OS7A 3WY8A 2HPQH 1GCTB 3RXLA 2R0LA 1DM4B 4K60A 3PMBB 2CF9H 2NU1E 3RXVA 1ZPBA 2PWXA 4Q80A 5L2ZH 1HJAB 5DO4H 3TH3H 3H7OA 2F9UA 1Y3VA 1LDTT 4DY7B 1MU8B 1K9OE 2VVUA 3BN9A 1O3FA 5DP6A 1GDNA 2FZZA 3P8FA 3SUEA 2XRCA 2W26A 4ISOA 3LH3A 4K1SA 1AMHA 4KKDA 4WJG2 2UUKB 5GWZA 2AMPA 1E0FD 3MOCA 1GJ8B 1OWKA 1NRPH 4Y8XA 3RXUA 4E7NA 2O9QA 4LZ4B 5DJ7A 1D3DB 2FX6A 3MHWU 3KQDA 4RSPA 1O37A 2QN5T 1O35A 2ZGXH 3MO6A 4XE4A 1XXDA 1FY5A 1P2JA 4NZLA 1C2HA 3PROA 1SQAA 2VGCC 1MU6B 5H4IB 1AUTC 1AU8A 1PFXC 1SGFG 1TPPA 4AB9A 1P2MA 5A8XA 3LDXH 1AQ7A 2QAAA 3P70B 1GJ5H 1O2NA 2VIQA 5FPSA 1PPBH 1D3QB 1FUJA 2AH4X 1UVSH 4GVUA 3PMJA 4U30A 1UTOA 1TX8A 3QWCH 5FPTA 2BLVA 1T7CA 4CRCA 2AS9A 5C1YA 1AO5A 1O5DH 1K1LA 3BF6H 1GBLA 1ZHMA 1GBFA 1SMFE 4CBNA 1C5UA 2FM2A 1SI5H 3BEIB 3ZZ8A 3ZVDA 2AMQA 1Z1JA 4X8VH 2Z9JA 3A8AA 2THFB 3A7TA 5C1UA 5JYIA 1GBTA 1OP8A 1NY22 4ZKOU 1D6WA 1HFDA 1C4Y2 3E91A 1NN6A 5FX5A 1TALA 4K1TA 2AFQB 1KLTA 1GL1A 5AVDA 4SGBE 1OYQA 5HYOA 2ODPA 3IG6B 3VB3A 4AYYB 1NO9H 1W0ZU 4VGCB 4DOQA 3KQEA 1KSNA 1DLEA 1BTYA 2BQ6B 3LU9B 1IQJA 1O3BA 3HATH 1C1PA 3JZ2B 2EI8A 1GHXH 2C8XB 1SGFA 2Y82A 3D65E 1J14A 2C90B 5T6GA 1QL7A 5DP5A 2BTCE 1L1JA 3RU4E 2VIDA 1Y59T 4FUEA 4YESB 1K1MA 2XC4A 2PSXA 5JBTA 1Z6JH 2OD3B 1L2EA 1TA6A 3I29A 1LHDH 1C1QA 2G4UA 2ZHDA 1DDJA 1RGQA 3U98H 1CU1A 1BHXF 1HAHH 1QBNA 3HKIB 1GJ7B 1O3MA 2GGVB 3QZQA 1H4WA 2ZFSA 2ZFFH 4XOJA 3K6YA 1A0JA 1AVWA 1GBKA 2A4RA 4DG4A 1AE5A 4OS4A 4DJZB 4O3UA 5F03A 1K28D 1BBRK 3D49H 3DUXH 1GBIA 1BOQA 1CBWC 2WV5A 3L3TA 5C2ZA 1D4PB 2OBOA 1AD8H 1DT2A 1WYKA 3ATWA 2SGPE 3SV2H 3MWIU 1VITG 2AERH 3BTGE 4NA9H 4R8TB 2DE8A 1MCVA 2GZ9A 1OXGA 1P11E 4TWWA 2HGTH 2O8UA 1ELTA 1G32B 1C1OA 1DY8A 3ZZCA 3MNCA 2F9BH 4CBOA 1P12E 4XBCA 2PKSB 1BRBE 4JZEH 1SGRE 5A0BA 1AKSB 3GY8A 4ABFA 1T8NA 4CRBA 1FY4A 1G30B 2A4QA 4TPIZ 2Y7ZA 1B0EA 2GP9B 3OTJE 2RA3A 1EAXA 3FZDA 3SJIA 2F91A 1BUIA 1MBQA 1UTQA 2QXGA 2WINI 4UE7H 5TCAA 1C2IA 1ELAA 2QIQA 2Q6DA 3TGKE 4WXIA 4K1EA 1GHYH 3SUFA 1MZAA 1LPKB 3ESTA 1T8OA 3KL6A 3TJUA 2DE9A 3H7TA 4A1TA 4BTIB 3UUZA 3SV7A 2OQ5A 1S83A 2ZGBH 3M3SA 4DVAU 5LPRA 2SGEE 2CJIA 4I32A 2F83A 4MLFB 5LPEA 1D6RA 1O5EH 2PFEA 1PQ7A 1C4U2 2P59A 1VR1H 2ZG0H 3AASA 1CT0E 5DPAA 8LPRA 2WPLS 1F0UA 3UOPA 1BRCE 1GHAG 3MI4A 3ZZ9A 2ZGCA 1MD7A 4NSVA 1LVMA 2HNTF 1W10U 1W0YH 2ZFQH 2O8MA 1BTHH 1O2TA 3EAJA 1C1TA 4MDSA 5DP7A 1MD8A 2TRMA 2WPIS 1UTJA 1C2GA 1IQGA 3KNXA 3T28A 1H8IH 4Q7YA 4Q7ZA 4NWKA 1ELFA 3EA9A 1MTNB 1QL8A 1J9CH 2BXTH 2FMJA 2A7CA 1C1MA 1LQDB 3A80A 1TYNA 1OKXA 4NSYA 1TPOA 4HZHA 1MZDA 3T62A 3LKWA 3MH6A 4FUBA 5EU8A 2BD3A 1SG8B 1S84A 2GZ8A 5CMXH 3ZZ3A 1GHAF 3E6PH 1JRTA 3SU6A 2TGAA 4AG1A 1BJUA 4UDWH 3TLOA 5L2YH 1MH0A 1DXPA 3UTUH 3OX7U 4LZ1H 1WSSH 2SFAA 3DT0H 1GI2A 1ANEA 2BX3A 1CO7E 3L6PA 4MNWA 1CA0C 2GMTC 3TH4H 4UFEH 3T27A 2BYAX 4U01A 4ABJA 1EZXC 1SL3A 1LCYA 1TE0A 4BXWA 1HDTH 1TBZH 1ESTA 1C5QA 3CS7A 1EZUC 3M3TA 4Y8YA 3U69H 1THPB 1G2LA 2D1JA 1QJ7B 3GDUA 3HGPA 1YPEH 2XWBI 4LK4A 4NA8A 3UFAA 4Y0ZE 1GG6C 5EOKA 2AYWA 1TGTA 1WV7H 4I8JA 2FS8A 1LTOA 3DHKH 1BMLA 4A5TS 1Z71A 1K22H 1LQEA 1MAYA 5L30H 2RG3A 4TWYA 4FVDA 2Y81A 2OLGA 1S81A 3E3TA 1BBRH 1WAYB 1F5KU 3TU7H 4BNRA 3SQEE 1ETRH 4MPWA 1RIWC 3MNXA 1QJ6B 3ITIA 1LHCH 2UUFB 5DKMA 3TNTA 1O2HA 2OXSA 5L6NH 2IPHA 3LGVA 4AYVB 1DWBH 1KXAA 1EQ9A 1ZMJA 1QRWA 1EJMA 4SGAE 1FV9A 2PGBB 3E0NB 2GD4B 1TMUH 2VVVA 4FUDA 3RM2H 2B8OH 1PPZA 2SGDE 3C1KA 1O2PA 4THNH 3C27B 3BTEE 1FIWA 1GDUA 3BTQE 1PPHE 1C1NA 3W94A 3MU8A 3M5OA 1A0HB 3QX5H 1HCGA 2PLXA 5EW1H 2JH0D 1F2SE 1O2KA 1IQEA 1O2VA 3F9HA 1EPTA 3GOVB 3JZ1B 3A7XA 2ZFRH 2G52A 1HV7A 3UR9A 1IQLA 1H8DH 1G2MA 1LHFH 5J4SA 1AZ8A 2H9TH 1Y3UA 2O8LA 5IDKA 1VCPA 1XKAC 3TJOA 2OINA 2VU8E 2HNTC 1DXWA 4B2BA 1QBOA 4F49A 1AGJA 4INHA 1MAXA 1CGJE 2GV7A 3U8OH 4YOJA 1O2SA 5EPNA 3Q00A 5C67A 3RXTA 2PKAA 2ZO3H 2CHAC 2ULLA 2ZFPH 4X1QU 1TNLA 5EQSA 3BIVH 3OY6U 4O3TA 1UJ1A 4A6LA 1TGBA 1TMTH 4Y10E 3RXJA 1HAOH 1CQQA 2WPJS 1P3EA 2R2MB 4B74A 4X8UH 1LVBA 3CENA 1NFXA 1KXDA 2ILNA 3TK5A 4IMZA 1P0SH 3RLYH 1N6YA 1GBDA 1E37B 1DUAA 3S7KB 1ZHRA 3M7QA 1HAYB 4M7GA 2OQUA 4AG2A 1SSXA 1YLDA 1C9TA 2P94A 1KLIH 2Y5GA 1P8VC 2F3CE 1T8LA 3K6ZA 4YT7H 3HK3B 1UMAH 3SJKA 2GCTC 3K9XB 1SGTA 3STIA 1SGNE 3BEUA 4WWYA 3FVFB 3QZRA 1VITH 1L4DA 2A31A 1C2DA 1ZPZA 3MU1A 4H6TA 1GI1A 1ZR0A 3R0FA 4X6NA 1ZGIA 4TY7A 3IITA 1P05A 1FI8A 1A46H 1O3AA 2WV4A 1O31A 1JMOH 3OSYA 3V7TA 1O33A 2ZGHA 3M3VA 2Y5HA 5C5NA 4FUIA 1P09A 1TMBH 1O3GA 1XUHA 3RXCA 1C5TA 1O3CA 2W3IA 1XXFA 2BDBA 3VGCC 4MNVA 4X2XA 5HGGA 1E36B 1N8OB 4I7YH 4TPYA 1ELEE 1ESAA 1INCA 1ARCA 1IQKA 1VCQA 2BVRH 3AVZA 2EEKA 1C2EA 3E8LA 2OC1A 1SC8U 3LPRA 1O3LA 4J1YA 4YZUA 4ABBA 1LVYA 3P95A 3NXPA 1G37A 4UFGH 1GJ9B 2FDAA 4CRFA 1OX1A 1Y8TA 2BZAA 3M7UA 5CHAB 1ZGVA 1C5RA 4ISHH 2BD9A 1Y5BT 1IQIA 3RMLH 4ZKNU 1C5VA 2ZEBA 3NKKA 1O2YA 1FJSA 1HXEH 4Y11E 1A5IA 4MPXA 1GBEA 1QA7A 2QY0B 2VINA 7KMEH 5GIBA 1TNJA 2FESH 1T4VH 3RUOA 1TAWA 1Z8JB 2ANMH 1HIAB 2Z9LA 1G9IE 1JIMA 4X1RU 1FQ3A 3RMOH 1GGDB 4J2YB 5I25A 2KAIB 6CHAB 1M9UA 1LO6A 1O3HA 4MNXA 4XDEA 1HGTH 1HLTH 1O2RA 2FXRA 8GCHG 2AIPA 4FUCA 3VXEH 6GCHG 1DOJA 4BAQB 2H5CA 2BDIA 4KELA 1TGSZ 4I8KA 5EXLA 1ELDE 4U32A 3A8CA 1VZQH 4NWLA 1G36A 2BOHB 4JYTA 4MNYA 4CHAB 5F6MA 3LC3A 4BAKB 2ZP0H 1C1WH 1A3EH 2FTMA 4K8BA 1WCZA 3PO1C 2HNTE 4DIIH 3BTME 3ZVFA 4H42U 1GI4A 2WUBA 5ESBA 1YLCA 3GY4A 4AN7A 1O2ZA 1AFQB 2ZHEH 4YOGA 2TGTA 8GCHF 2H1UA 2VNTA 3ZYDA 1P2QA 6GCHF 2ZWLH 3HGNA 5GDSH 1TNGA 1NU7B 1UVUH 2Z3CA 4ZXYH 3ZVGA 3NK8A 2C8WB 4BANB 8KME2 3SUGA 1AZZA 3LGIA 2OCVB 2BDAA 1XVOA 2BVXH 1YPJH 1XMNB 1BA8B 2SGAA 1BCUH 2FIRH 4NGAH 5GJ4B 1QHRB 3STJA 2GDDA 1NRRH 5E0HA 3HK6B 1UVOA 1T4UH 1IQFA 2JH5D 2WPKS 3SN8A 2FI3E 2JETC 1SHYA 4D9QA 2FI5E 1BTUA 2O8TA 2OBQA 2ZU3A 3OY5U 2HOBA 2A7HA 4ZAEA 1EB2A 1W3CA 3ZVBA 4B1TA 1UCYK 1DICA 2Z9KA 3Q3XA 4K2YA 2A2XH 1W14U 2UUJB 2FP7B 2G5NA 3GY2A 5TJXA 1GJ6A 1P2IA 4WMEA 2FYRA 1PJPA 3LT3A 1SLVB 3BTDE 1ARBA 4Z6AH 2NU0E 1A3BH 3E90B 1K1PA 3U9AH 3RP2A 3HPTB 1EJAA 4JZIA 1ZSKA 3A83A 3MNBA 1P03A 1JWTA 3GY5A 1HBTH 1K2I1 1W2KH 3SGAE 4CR5A 1DWDH 4FU7A 3KEEA 4QT8C 3QK1A 2ANKH 2ZTZA 4NIWA 1ELBA 1TX6A 2BOKA 5HM2A 1ZTJA 4ISLA 4AOQA 4KGAA 5E0GA 1AB9B 4HGCA 1C5XB 1GWAA 3SU1A 1EXFA 1YCPK 4Y6DA 2G5VA 4IN1A 1OPHB 3SU4A 2P3UB 2FPZA 3RXOA 4INKA 4WMDA 1EPTB 3H5CB 4RKOB 3UPEA 1GBCA 4JMYA 1OWDA 1KIGH 3NUMA 1HUTH 1ZLRA 3U1IB 2GZ7A 4X1PU 1FLEE 1QQUA 3P6ZB 1MMJN 1W7XH 4FUHA 3M5MA 1O2IA 2CGAA 3EYDA 4JYVH 3FZZA 3BIUH 3RXBA 3VB6A 1JBUH 1GVLA 2Z94A 3RC6A 3V3MA 3RMNH 4B71A 3M5LA 1NPMA 3VFEA 5ABWA 1XUGA 3LJJA 3AAVA 4FU8A 1NU9A 3PYHA 2PKAB 2BD8A 3PLBA 1NRQH 1UTLM 1LHEH 2ANYA 1RRKA 4WVPE 1YPMH 2M5TA 3OYPA 1DWEH 1O3IA 4KTUA 1XM1A 3RXPA 4IS5A 2PGQB 4IBLH 3FP7E 2ZFTA 2SGFE 2BY5X 3SV6A 2C8ZB 2TPIZ 1FIZA 1YPGH 1HAGE 1EASA 3QO6A 4O9VA 3TIUA 4H4FA 1VITF 1A1RA 4JZDH 2FS9A 1V2LT 3EDXB 3SU5A 3PLPA 3PWBA 3ZZBA 4ISIH 3QGNB 1SLUB 4U2WA 3VB7A 5C5OA 4MQAA 3ZZAA 2R3UA 5HM9A 4YLUA 1AIXH 1VGCC 1AFEH 4UFFH 1HIAA 1DPOA 1QB1A 3I77A 1K1NA 3ATKA 2ZF0H 2J9NA 2JH6D 2ZCKP 2KAIA 3A88A 4X2YA 1P2KA 4CRDA 2ZZUH 2C93B 3VB4A 4FU9A 1V6DA 1PQAA 2GX4A 1NROH 1O0DH 3LC5A 2XW9A 1IHTH 2BDYA 3GDSA 4PROA 2BHGA 1ESBA 4WH8A 2ZA5A 3DA9B 2XBVA 1TABE 2FOCA 1ELVA 2AGGX 1F92A 4HI3A 1EZQA 1GDQA 3URCA 2VGCB 1UCYH 4ZXXH 4LOYH 5K0HA 1SBWA 4HTCH 1C5PA 3SHCH 3T5FH 4CRGA 1DLKB 1S6FA 2UWOA 3KGPA 2ZECA 4X2VA 1RXPA 1V2OT 3SI3H 1TFXA 5F8TA 2BVSH 1QIXB 2VVCA 1S5SA 2CV3A 1NTPA 2FODA 1RS0A 3TITA 1BRUP 2CF8H 4R0IA 1IQHA 2FEQH 4UEHH 3ODDA 3TJVA 5EW2H 2ZPRA 4A1XA 5B6OA 1V2WT 2HWLB 2W5EA 4E7RG 1C2JA 3F9FA 2P3FH 3P92A 2ZGJA 3ZZDA 2AIQA 1L0ZA 2ODYB 4X6PA 1AWHB 2H9EH 3TGJE 3MU4A 1ZPCA 1MTSA 4JK5A 1O5GH 2PHBA 2FOMB 1YCPH 2PW8H 4D8NA 2A0QB 2TGDA 5DGJA 1K1IA 1MKXK 1ZJDA 1V2TT 1P02A 3MH5A 2A2QH 1F7ZA 4O97A 1SGCA 2PTNA 1OSSA 2W7UA 1GI7B 2BD5A 3M35A 3ZZ6A 1TNKA 1XVMA 2BY8X 2XC5A 3UWIA 4ZHMU 1A2CH 3R3GB 1ACBE 4ZROA 3CP7A 4B2CA 2GV6A 5GPIB 3P8OA 2J95A 2BDHA 1KYNA 3BG4C 2ZDMA 1HAZB 2FX4A 2P8OC 5FCKA 1C5MD 4Y8ZA 1PYTC 1F5RA 4GCHG 3A84A 1QY6A 5DG6A 5FAHA 2HALA 3FP8E 3KHVA 1ELGA 5FHTA 1V2QT 2B0FA 1C2LA 2ZCLP 2G4TA 3FAOA 2K1QA 1TNIA 1GMHG 5G4BA 3LGTA 3SOSA 5GXPA 3MO3A 1O39A 1WQSA 4Y0YE 1CHOG 1O2OA 2XC0A 4WY3A 1GGDC 1KXFA 2UWPA 2Z3EA 3PM3A 4JZFH 1O38A 3ZZ7A 1NESE 3LGWA 5EODA 1CBWB 1O2GH 1GCTC 3LH1A 2IN2A 2GT7A 1OWHA 4ABDA 4GCHF 3RU4D 1MQ5A 1B0FA 1HJAC 2EI6A 2OC8A 3A7YA 2D8WA 2EA3A 3MH7A 1MTVA 1TRNA 2VH6A 3M61U 3TGIE 1G3DA 3T2NA 3RM0H 3U8RH 4ESTE 4AB8A 4CHAC 3SUDA 2QF3A 3SGBE 1W8BH 1ZRKA 1EX3A 1LHGH 1PPFE 1GBMA 1CHOF 1EUFA 1VJ9U 3KF2A 3FP6E 2UWLA 1P01A 1P57B 4Q7XA 3QLPH 4NG9H 4DURA 3QUMP 5I46H 1GI0A 2H5DA 1C2FA 1AFQC 2QXHA 4BTUB 3S0NA 1L1GA 4O03A 1DUEA 1SGIB 1YM0A 1TA2A 6ESTA 1SGEE 1O2XA 2YNBA 3SI4H 5CE1A 2HPPH 5C20A 1HNEE 2VIVA 2F9PA 1BBRE 5TCCA 4AX9H 1PPCE 1BZXE 4DCDA 1GBHA 4K69A 4K5ZA 3EGKH 2VIPA 1C5ZB 1A5GH 2RCEA 1UTNA 4ZH8A 5IYTA 1YPHC 1OWEA 1RTKA 4FVBA 1XX9A 4ASHA 2WPMS 1O2WA 1O5CB 3FANA 4D7FA 1BTZA 1FNIA 1GBBA 3RXQA 4RN6A 8ESTE 4WH6A 1NC6A 3TK6A 4ZHAA 1BQYA 1H9IE 4JK6A 4BAOB 4NFEA 2Q6FA 3A8BA 1RFNA 3MH4A 1FN8A 2BMGB 1LPZB 2ZHFH 7ESTE 1LKAA 1QCPA 2SNWA 2D26C 4WMFA 1IQNA 1D3TB 1OP2A 4I8LA 4OGYA 2ZTXA 1UTKA 2PUXB 1SGYE 2OUAA 4ABAA 1GVKB 2VWNA 1EATA 1SGDE 3V0XA 1QR3E 3UREA 1W13U 1FY1A 4E06H 3O8DA 3D62A 1V2RT 2LNCA 3RLWH 4VGCC 3RXAA 3QTOH 1TQ7B 4X6MA 1RTLA 3EA7A 1TBRH 2P16A 1UHBB 3QTVH 2BD2A 4DT7B 1MBMA 1SR5C 3QDZB 1MKXH 5FXLA 2Z3DA 1LVOA 3MU5A 3A85A 3GCTG 3LGYA 1FY3A 1IAUA 3ATIA 2QC2A 2ZPQA 1MKWK 3BV9B 3SO3A 3LJOA 1TLDA 1ABIH 1CHGA 1EAIA 4FUJA 1RJXB 1CA0B 2GMTB 1CA8B 2F9NA 4IN2A 3E0PB 1VCWA 4WF8A 5AFZH 4ZKSU 3SZNA 1K1OA 1GBAA 2ESTE 3PV4A 1BHXB 3V13A 2I6SA 1F0RA 2GDEH 2VB0A 2Y5FA 1A0LA 1HPGA 2FI4E 1MTUA 3UIRA 1KXCA 3W95A 4XFQA 1YPLH 3DFLA 1IHSH 4IMQA 1HAIH 3SJ8A 3GCTF 1FZZA 5EXNA 1KDQB 1FONA 2Y80A 1C5LH 2ALPA 1AWFH 1XUJA 3NWUA 3SNDA 3K2UA 1ZOMA 2VWMA 1LMWB 1NRNH 2PKSC 4Y71A 2C8YB 4MPUA 1V2PT 1UVTH 1O32A 3UQOA 1ETTH 1Z1IA 2ZDLA 3M7TA 4BOHA 1RIWB 4JZ1A 1OOKB 1TNHA 2Z9GA 4OS1A 4DGJA 1EJNA 4D7GA 2BY7X 3ZYEA 2B9LA 1ANBA 1YBWA 2ZHQH 4YM9A 1THSH 5DP3A 1KXEA 1CT2E 1HAVA 3B8JA 4NA7A 1J8AA 4MVNA 1C1UH 2FOBA 2HVXA 2WYJA 5AHGH 1C4V2 2BLOA 2WUCA 4YO9A 4NIYA 2BQ7B 2NWNA 1TOMH 1NS3A 3Q76A 7LPRA 1C1RA 3T29A 2FYQA 4B75A 3BTKE 1Y5UT 3ENSB 1NRSH 2VIWA 6LPRA 4CR9A 4ABGA 2ZI2H 1WQVH 5JPMH 2JKHA 3P17H 1SQOA 1O2MA 5ESTE 5F8ZA 4X1SU 1KY9A 1BTXA 3SNAA 3RXSA 1QBVH 4OS2A 2V3OH 3QN7A 2QA9E 2BXUH 2BLQA 5E0JA 3M37A 3UQVA 1P3CA 2AEIH 3EE0B 1WTGH 1G3CA 1UO6A 2XNIA 3L33A 2GCHG 3KN2A 4BAHB 1FY8E 2B5TB 3EA8A 4Y79A 3RU4T 1O2UA 3UY9A 2J2UA 3SBKA 7GCHG 3GCHB 5A0AE 2BY9X 1S82A 4ABEA 1MTNC 2PSYA 1YKTA 1QRXA 2BD4A 1V2KT 3GYMA 1JOUB 2P93A 5AF9H 1P9SA 3ATMA 1F0SA 1YPHE 2VIOA 2VJ1A 2CHAB 1BMAA 1BTWA 4X1NU 4Y7AA 3S69A 1BT7A 5FBIA 2AGEX 1J15A 2ZDKA 2ZU5A 1EP5A 4LXBH 3BEFB 4NIXA 1TOCB 1FAXA 3GICB 1TONA 2DUCA 5HXFA 4A7IB 1UK2A 1EB1H 1ORFA 3VB5A 1SOTA 3KQCA 5FX6A 2VH0A 4AFUA 1WTHD 1L4ZA 1TBQH 2GCHF 4H6SB 3BG8A 1SPJA 4FUGA 3SU0A 4E05H 3GYLB 2XYAA 7GCHF 3U1JB 4INLA 4I31A 1CVWH 3U8TH 4IC6A 1XKBC 2WPHS 1GPZA 1SGPE 1J16A 2XCNA 3GY6A 4WXVA 4F4OC 1ZJKA 2GCTB 3PWCA 4D9RA 1C5SA 1MKWH 1O5BB 3MYWA 3KIDU 4UFDH 1H9HE 3ATLA 3A81A 4MPVA 2P95A 3A7WA 1PPGE 1BMNH 1P2OA 3PB1E 5ETXA 1MQ6A 1WUNH 3RXDA 2ZU1A 2F9VA 3A89A 3NPSA 1S85A 3M5NA 2VWLA 1YC0A 1SLXB 1UTPA 3T25A 1DSTA 1ZMLA 1GJDB 3A86A 1TB6H 1QTFA 2V0BA 2XBWA 3SGQE 2A5KA 2A4GA 1XUIA 3MFJA 5EGMA 2FOAA 5DP8A 1GMDG 1T8MA 5K7RA 1Q2WA 2Q1JA 4NCYA 3VGCB 2Z9IA 1Z8IB 4DIHH 2STBE 1YPKH 1C5OH 3PTBA 2J38A 3F6UH 1Z6EA 1O3OA 1V2MT 1B7XB 4B76A 1C9PA 4AFQA 1ELCA 2XBXA 4B2AA 1UHBA 5C3NA 1TGCA 3SU2A 1O3PB 5F8XA 4A1VA 4AFSA 3DFJA 1V2ST 1ZTKA 1YF4A 3RXHA 5A2MH 1Y3WA 1IOEA 2H6MA 3RDZA 1JRSA 2FWWA 4TYDA 3E1XB 3P8GA 1FAKH 2XWAA 1TPAE 3EQ0H 1MCTA 4FXGH 3SJOA 1GJAB 1DY9A 3SORA 1Y5AT 1GMDF 2J94A 4YLQH 1XUFA 3UNQA 1DVAH 1E35B 5JBAS 3SV9A 3Q3KA 1LPGB 2A4OA 4X8SH 1UK3A 4GAWA 1GMCG 2QYIA 1MTWA 2F9OA 2CMYA 4B73A 1BIOA 2ZPSA 3F68H 3GDVA 1EOLA 1BJVA 1G3EA 3O8RA 2A7JA 3AW1A 1Q3XA 3SQHE 1P10A 2BZ6H 2QGRA 2Y6TA 4KTSA 3E16B 5JDUB 1A61H 1GHBG 1GI5A 2VWOA 1DITH 1C2KA 1HJ9A 1KDQA 2Z7FE 3S9CA 1THRH 4X0WU 1O34A 1ZSJA 1N1LA 3T26A 2ZDNA 3BTWE 1C1SA 1QB6A 1ABJH 2ALVA 1PYTD 1WU1A 1WBGB 1SFIA 1SOZA 4K3JA 1GI9B 1GMCF 2QV1A 4MTBA 2OC0A 2IJOB 5JBBS 1C2MA 1N6XA 4CRAA 2RDLA 1ETSH 3GCOA 5LH8A 1ANDA 3A82A 5A09A 3ELAH 2ZIQH 3GCNA 3SW2B 4AGKA 1WOFA 1O2LA 1U6QA 3PO1B 3GY7A 1EKBB 3UWJH 1G3BA 1GHBF 1FN6A 1RTFB 1A7SA 1O3NA 1OWJA 1Z8RA 2FLBH 1P06A 3MTYA 2R2WU 1ZHPA 1ZMNA 5C1XA 4FUFA 1O5FH 2XXLA 1J17T 1CGHA 2G51A 4X2WA 3IWMA 4NFFA 1SGQE 1DX5M 3TJNA 4BTTB 1FXYA 2BDGA 1V2JT 1SB1H 3RXMA 1AI8H 1C5WB 2FOGA 3RXKA 3UR6A 1EP6A 1GI6A 3RXEA 2PTCE 3UOUA 1QB9A 5T3HA 1P9UA 2NU4E 4OS6A 5PTPA 1HJ8A 1QJ1B 4CH2B 1TWXB 2JETB 3HKJB 4I8HA 4NZQA 2G8TA 1OS8A 3KCGH 3NZIA 1BRAA 2GKVE 3S9BA 4X6OA 3RXIA 3RXGA 1H9LB 1AVGH 2R3YA 2BLWA 3G01A 1N8OC 3MNSA 1HB0B 1C5NH 1O5AB 4ZMAH 1NFUA 2ZQ2A 3TNSA 1Z8GA 5FCRA 1V2NT 5AFYH 3ZVAA 1A4WH 4MG3A 4ZKRU 3SJ9A 1B5GH 1NFYA 1DSUA 1HRTH 1YP9A 2ZKSA 1GHWH 1OP0A 1HAVB 1W7GH 2A5AA 2ZQ1A 2ZU2A 2STAE 5E2PA 1NM6A 2ZU4A 1O3DA 1GJ4H 1AN1E 4ABIA 4AGJA 4Y76A 5CHAC 2NU2E 3F1SB 3ZZ5A 1O36A 1P2NA 3BTHE 2QF0A 3BTFE 3SV8A 5BPEA 5BRRE 1W11U 3N7OA 2XTTB 2WYGA 2BM2A 2W7SA 4K8YA 1A5HA 5J4QA 2H2ZA 1ZTLA 3RXRA 1CGIE 5JB9S 4ZUHA 1ID5H 2GT8A 1UCYE 3LONA 4DW2U 5EXMA 2G55A 1BB0B 1SVPA 2ODQA 3O8BA 2PUQH 2BB4A 2ZCHP 4AZ2B 4KP0A 2C4FH 3TK9A 2TBSA 6CHAC 1W12U 2AMDA 3RXFA 4CH8B 2R9PA 2SGQE 3SNCA 2BDCA 1JXPA 1E34B 5EQRA 3Q77A 1O2JA 3PMHB 1BMMH 2FOFA 1DWCH 2FO9A 1AY6H 1V2UT 2FOHA 2XCFA 3A7VA 3OU0A 1DE7H 4BXSA 1CT4E 4BAMB 2V6NA 5EQQA 2RA0A 1PQ8A 2ZNKH 2EC9H 1OWIA 5E8EH 3FFGA 2YOLA 1GCDA 2A45B 1KLJH 1GMHF 3A7ZA 4CREA 3S9AA 1S0RA 1Y3YA 1YYY1 3BSQA 5FPYA 1CSOE 1ZYOA 3A8DA 3UNSA 3RMMH 5A8YA 1PPEE 3SU3A 4AFZA 2XBYA 2W3KA 2OP9A 2ASUB 3B23B
chains in the Genus database with same CATH superfamily
1FDPA 1S0QA 2ZC9H 2Y7XA 3P8NA 3ODFA 4Y7BA 3RC5A 1RD3B 9LPRA 1EAUA 1TRYA 2AGIX 5JB8S 1X7AC 1GHZA 4X8TH 1KTTB 2BQWB 1QRZA 2R0KA 3VXFH 4ZHLU 3S7HB 2H9HA 2OTVA 3LIWA 1Y3XA 1ZZZA 4IC5A 4A92A 1C5YB 3K65B 4Z0KA 1HAXB 3GCHC 3QGJA 1TIOA 1TPSA 1ZRBA 1E1RD 2BX4A 1GBJA 2P3TB 1SHHB 1GJCB 5T6FA 2QF5A 1DANH 2D2DA 3MMGA 4B6EA 1OYTH 2J92A 1VGCB 2PR3A 3ZVEA 1KTSB 1XUKA 1SFQB 1AKSA 1H1BA 1T31A 1F5LA 4NIVA 1FPCH 2OC7A 4GSOA 4ACAA 1CE5A 4GLYA 2GTBA 4GUXA 1JIRA 1GHVH 1VJAU 1GI3A 1QURH 1O30A 1C1VH 5A0CA 1MUEB 2I6QA 4JYUH 3V12A 1QL9A 5T6DA 1O3KA 3A87A 2BD7A 3BTTE 2J4IA 1ZSLA 2CN0H 1EOJA 4Q2KA 3TVJB 1O3EA 2V35A 2LPRA 1UVPA 2FOEA 1UK4A 2IOTA 1AE8H 1BDAA 2QXIA 3LOXA 4FETA 2A1DB 3O8CA 4OS5A 2YMSC 1E38B 5LGOA 4IGDA 1P04A 1IQMA 1O3JA 5HMAA 3ZV8A 5LPFA 1DS2E 3D23A 1HXFH 4ISNA 2NU3E 3GY3A 3SNBA 5E2OA 4D76A 9ESTA 1YCPM 3GISB 2O8WA 3F9EA 3KQ5A 5EPYA 2FLRH 4AORA 4JCNA 2EI7A 1K21H 4I33A 1D9IA 1ANCA 1AB9C 3SHAH 3PMAB 2G81E 1V2VT 2C3SA 2TIOA 3CS0A 4YOIA 1DFPA 1TGNA 2G00A 2V3HH 4FOUC 4GPGA 2J34A 1QZ8A 3B9FH 5JBCS 4YT6H 1EPTC 3KQBA 1UTMA 3PTNA 5DK1A 1QNJA 5EG4A 4UD9H 1LKBA 1SLWB 1AHTH 4GHQA 1O2QA 5GCHG 1QGFA 1D3PB 1EZSC 2HLDD 3AAUA 2QXJA 2XOKD 1GVZA 4UONA 4I8GA 3I78A 2GVFA 2SNVA 2ZHWH 5FL7D 2Z6BD 2A32A 2YNAA 2TGPZ 3F9GA 1Z7KA 1GG6B 2ZDVH 4IW4E 1YGCH 4OGXA 2HRVA 3ZVCA 3URDA 1FMGA 1GI8B 4TY6A 3TH2H 2A5IA 4ABHA 1KXBA 1TRMA 5FBEA 1W0KD 3ZV9A 4XSKU 2Q6GA 1QA0A 3NCLA 1HAPH 1S6HA 2FTLE 4RKJB 2UUYA 3SNEA 1TQ0B 1NT1A 5SGAE 5DP9A 1L1NA 3VPKA 1F0TA 3BG4B 2IPQX 1AUJA 2P8OB 3VEQB 4KTCA 2QCYA 4XBBA 5GCHF 2CXVA 1Q31A 1QFKH 3DD2H 1BTPA 2PV9B 1QQ4A 2GJGA 3MU0A 1PQ5A 1T32A 1HYLA 5A8ZA 4Z1MD 2HLCA 1GL0E 3RC4A 2B7DH 2ANWA 3MO9A 3Q3YA 4YTAA 1BITA 1K1JA 3PLKA 1GJBB 1TX7A 3TPIZ 3M36A 2ZDAH 2ZTYA 4GHTA 2BY6X 2LELA 3ZZ4A 3UNRA 1AVXA 5DP4A 3AW0A 4XBDA 1NFWA 3LGUA 1EAWA 1FPHH 4HFPB 1NZQH 1V3XA 1SQTA 4OS7A 3WY8A 2HPQH 1GCTB 3RXLA 2R0LA 1DM4B 4K60A 3PMBB 2CF9H 2NU1E 3RXVA 1ZPBA 2PWXA 4Q80A 5L2ZH 1HJAB 5DO4H 3TH3H 3H7OA 2F9UA 1Y3VA 1LDTT 4DY7B 1MU8B 1K9OE 2VVUA 3BN9A 1O3FA 5DP6A 1GDNA 2FZZA 3P8FA 3SUEA 2XRCA 2RFKC 2W26A 3PRDA 4ISOA 3LH3A 4K1SA 2KZ4A 1AMHA 4KKDA 4WJG2 2UUKB 5GWZA 2AMPA 1E0FD 3MOCA 1GJ8B 1OWKA 1NRPH 4Y8XA 3RXUA 4E7NA 2O9QA 4LZ4B 5DJ7A 1D3DB 2FX6A 3MHWU 3KQDA 4RSPA 1O37A 2QN5T 1O35A 2ZGXH 3MO6A 4XE4A 1XXDA 1FY5A 1P2JA 4NZLA 1C2HA 3PROA 1SQAA 2VGCC 1MU6B 5H4IB 1AUTC 1AU8A 1PFXC 1SGFG 1TPPA 4AB9A 1P2MA 5A8XA 3LDXH 1AQ7A 2QAAA 3P70B 1GJ5H 1O2NA 2VIQA 5FPSA 1PPBH 1D3QB 1FUJA 2AH4X 1UVSH 4GVUA 3PMJA 4U30A 1UTOA 1TX8A 2KCPA 3QWCH 5FPTA 2BLVA 1T7CA 4CRCA 2AS9A 5C1YA 1AO5A 1O5DH 1K1LA 3BF6H 1GBLA 1ZHMA 1GBFA 1SMFE 4CBNA 1C5UA 2FM2A 1SI5H 3BEIB 3ZZ8A 3ZVDA 2AMQA 1Z1JA 4X8VH 2Z9JA 2J98A 2THFB 3A8AA 3A7TA 5C1UA 5JYIA 1GBTA 1OP8A 1NY22 4ZKOU 1D6WA 1HFDA 1C4Y2 3E91A 1NN6A 5FX5A 1TALA 4K1TA 2AFQB 1KLTA 1GL1A 5AVDA 4SGBE 1OYQA 5HYOA 2ODPA 3IG6B 3VB3A 4AYYB 1NO9H 1W0ZU 4VGCB 2CK3D 4DOQA 3KQEA 1KSNA 3CNRA 1DLEA 1BTYA 2BQ6B 3LU9B 1IQJA 2LP6A 1O3BA 3HATH 1C1PA 3JZ2B 2EI8A 1GHXH 2C8XB 1SGFA 2Y82A 3D65E 2KM0A 1J14A 3U28C 2C90B 5T6GA 1QL7A 5DP5A 2BTCE 1L1JA 3RU4E 3MQKC 2VIDA 1Y59T 4FUEA 4YESB 1K1MA 2XC4A 2PSXA 5JBTA 1Z6JH 2OD3B 1L2EA 1TA6A 3I29A 1LHDH 1C1QA 2G4UA 2ZHDA 1DDJA 1RGQA 3U98H 1CU1A 1BHXF 1HAHH 1QBNA 3HKIB 1GJ7B 1O3MA 2GGVB 3QZQA 1H4WA 2ZFSA 2ZFFH 4XOJA 3K6YA 1A0JA 1AVWA 1GBKA 1NBMD 2A4RA 4DG4A 1AE5A 4OS4A 4DJZB 4O3UA 5F03A 1K28D 1BBRK 3D49H 3DUXH 1GBIA 1BOQA 1CBWC 2WV5A 3L3TA 3OEHD 5C2ZA 1D4PB 2OBOA 1AD8H 1DT2A 1WYKA 3ATWA 2SGPE 3SV2H 3MWIU 1VITG 2WV9A 2AERH 3BTGE 4NA9H 4R8TB 2DE8A 1S6LA 1MCVA 2GZ9A 1OXGA 1P11E 4TWWA 2HGTH 2KX4A 2O8UA 1ELTA 1G32B 1C1OA 1DY8A 4P02A 3MNCA 3ZZCA 2F9BH 4CBOA 1P12E 4XBCA 2PKSB 1BRBE 4JZEH 1SGRE 5A0BA 3OFND 1AKSB 3GY8A 4ABFA 1T8NA 4CRBA 1FY4A 1G30B 2A4QA 4TPIZ 2Y7ZA 1B0EA 2GP9B 3OTJE 2RA3A 1EAXA 3FZDA 3SJIA 2F91A 1BUIA 1MBQA 1UTQA 2QXGA 2WINI 4UE7H 5TCAA 1C2IA 1ELAA 2QIQA 2Q6DA 3TGKE 4WXIA 4K1EA 1GHYH 3SUFA 1MZAA 1LPKB 3ESTA 1T8OA 3KL6A 1FX0B 3TJUA 2DE9A 3H7TA 4A1TA 4BTIB 3UUZA 3SV7A 1SQRA 2OQ5A 1S83A 2ZGBH 3M3SA 4DVAU 5LPRA 2SGEE 2CJIA 4I32A 2F83A 4MLFB 5LPEA 1D6RA 1O5EH 2PFEA 3ZIAD 1PQ7A 1C4U2 2P59A 1VR1H 2ZG0H 3AASA 1CT0E 5DPAA 8LPRA 2WPLS 1F0UA 3UOPA 1BRCE 1GHAG 3MI4A 3ZZ9A 2ZGCA 1MD7A 4NSVA 3OEED 1LVMA 2HNTF 1W10U 1W0YH 2ZFQH 1BTHH 2O8MA 1O2TA 3EAJA 1C1TA 3GS9A 4MDSA 5DP7A 4DT4A 1MD8A 2TRMA 2WPIS 1UTJA 1C2GA 1IQGA 3KNXA 3T28A 1H8IH 4Q7YA 1YY3A 4Q7ZA 4NWKA 1ELFA 3EA9A 1MTNB 5EJLA 1QL8A 1J9CH 2BXTH 2FMJA 2A7CA 1C1MA 1LQDB 3A80A 1TYNA 1OKXA 4NSYA 1TPOA 4HZHA 1MZDA 3T62A 3LKWA 3MH6A 4FUBA 5EU8A 2BD3A 1SG8B 1S84A 2GZ8A 5CMXH 3ZZ3A 1GHAF 3E6PH 1JRTA 3SU6A 2TGAA 4AG1A 1BJUA 4UDWH 3TLOA 5L2YH 1MH0A 1DXPA 3UTUH 3OX7U 4LZ1H 1WSSH 2SFAA 3DT0H 1GI2A 1ANEA 2BX3A 1CO7E 3L6PA 4MNWA 1CA0C 2GMTC 3TH4H 4UFEH 3T27A 2BYAX 4U01A 4ABJA 1EZXC 1SL3A 1LCYA 1TE0A 4BXWA 1HDTH 1TBZH 1ESTA 1C5QA 3CS7A 1EZUC 3M3TA 4Y8YA 3U69H 1THPB 1G2LA 2D1JA 1QJ7B 3GDUA 3HGPA 1YPEH 2XWBI 4LK4A 4NA8A 3UFAA 3WWBA 4Y0ZE 1GG6C 5EOKA 2AYWA 1TGTA 1WV7H 4I8JA 2FS8A 3DSGA 1LTOA 3DHKH 1BMLA 4A5TS 1Z71A 1K22H 1LQEA 1MAYA 5L30H 2RG3A 4TWYA 4FVDA 2Y81A 2OLGA 1S81A 3E3TA 1BBRH 1WAYB 1F5KU 3TU7H 4BNRA 3SQEE 1ETRH 4MPWA 3PRBA 1RIWC 3MNXA 1QJ6B 2W6ID 3ITIA 1LHCH 2UUFB 3N7DA 5DKMA 3TNTA 1O2HA 2OXSA 5L6NH 2IPHA 3LGVA 4AYVB 1DWBH 1KXAA 1EQ9A 1ZMJA 2YMSD 1QRWA 1EJMA 4SGAE 1FV9A 2PGBB 3E0NB 2GD4B 1TMUH 2VVVA 4FUDA 3RM2H 2B8OH 1PPZA 2SGDE 3C1KA 1O2PA 4THNH 3C27B 2KFWA 3BTEE 3EE7A 2JJ2D 1FIWA 1GDUA 3F2HA 3BTQE 1PPHE 1C1NA 3W94A 1VKYA 3MU8A 3M5OA 1A0HB 3QX5H 1HCGA 2PLXA 5EW1H 2JH0D 1F2SE 1O2KA 1IQEA 1O2VA 4F55A 3F9HA 1EPTA 3GOVB 3JZ1B 3A7XA 2ZFRH 2G52A 1HV7A 3UR9A 4Q63A 1EFRD 1IQLA 1H8DH 1G2MA 1LHFH 5J4SA 1AZ8A 2H9TH 1Y3UA 2O8LA 5IDKA 2RDEA 1VCPA 1XKAC 3TJOA 2OINA 2VU8E 2HNTC 1DXWA 4B2BA 1QBOA 4F49A 1AGJA 4INHA 1MAXA 3KYGA 1CGJE 2GV7A 3U8OH 4YOJA 3F3BA 1O2SA 2KR7A 2J98B 5EPNA 3Q00A 2K8IA 5C67A 3RXTA 2PKAA 2ZO3H 2CHAC 2ULLA 2ZFPH 4X1QU 1TNLA 5EQSA 5KECA 3BIVH 3OY6U 4O3TA 4ZCNA 1UJ1A 4A6LA 1TGBA 1TMTH 4Y10E 3RXJA 1HAOH 1CQQA 2WPJS 1P3EA 2R2MB 3H09A 1H8HD 4B74A 4X8UH 1LVBA 3CENA 1NFXA 1H8ED 1KXDA 2ILNA 3TK5A 4IMZA 1P0SH 3RLYH 1N6YA 1GBDA 1E37B 1DUAA 3S7KB 1ZHRA 3M7QA 1HAYB 4M7GA 2OQUA 4AG2A 1SSXA 1YLDA 1C9TA 2P94A 1KLIH 2Y5GA 1P8VC 2F3CE 1T8LA 3K6ZA 4YT7H 3HK3B 1UMAH 3SJKA 2GCTC 3K9XB 1SGTA 3STIA 1SGNE 3BEUA 4WWYA 3FVFB 3QZRA 1VITH 1L4DA 2A31A 1C2DA 1ZPZA 3MU1A 4H6TA 1GI1A 1ZR0A 3R0FA 4X6NA 1ZGIA 4TY7A 3IITA 1WDIA 1P05A 1FI8A 1A46H 1O3AA 2WV4A 1O31A 3W1EA 1JMOH 3OSYA 3V7TA 1O33A 2ZGHA 3M3VA 2Y5HA 5C5NA 4FUIA 1P09A 1TMBH 1O3GA 1XUHA 3RXCA 1C5TA 1O3CA 2W3IA 1XXFA 2BDBA 3VGCC 4MNVA 4X2XA 4XRNA 5HGGA 1E36B 1N8OB 4I7YH 4TPYA 1ELEE 1ESAA 1INCA 1ARCA 1IQKA 1VCQA 2BVRH 3AVZA 2EEKA 1C2EA 3E8LA 2OC1A 1SC8U 3FOAA 3LPRA 1O3LA 4J1YA 4YZUA 4ABBA 1LVYA 3P95A 3NXPA 1G37A 4UFGH 1GJ9B 2FDAA 4CRFA 1OX1A 1Y8TA 1OHHD 2BZAA 3M7UA 5CHAB 1ZGVA 1C5RA 4ISHH 2BD9A 1Y5BT 1IQIA 2KCAA 4ZKNU 3RMLH 1C5VA 2ZEBA 3NKKA 1O2YA 1FJSA 1HXEH 4Y11E 1A5IA 4MPXA 1GBEA 1QA7A 2QY0B 2VINA 7KMEH 5GIBA 1TNJA 2FESH 1T4VH 3RUOA 1TAWA 1Z8JB 1YLNA 2ANMH 1HIAB 2Z9LA 1G9IE 1JIMA 4X1RU 1FQ3A 3RMOH 1GGDB 4J2YB 5I25A 2KAIB 6CHAB 1M9UA 1LO6A 1O3HA 4MNXA 4XDEA 1HGTH 1HLTH 1O2RA 2FXRA 8GCHG 2AIPA 4FUCA 2L74A 3VXEH 6GCHG 5KGOA 1DOJA 4BAQB 2H5CA 2BDIA 3UB0A 4KELA 1TGSZ 1BMFD 4I8KA 5EXLA 1ELDE 4U32A 3A8CA 1VZQH 4NWLA 1G36A 2BOHB 4JYTA 4MNYA 4CHAB 5F6MA 3LC3A 4BAKB 2ZP0H 1C1WH 1A3EH 2FTMA 4K8BA 1WCZA 3PO1C 2HNTE 4DIIH 3BTME 3ZVFA 4H42U 1GI4A 2WUBA 5ESBA 1YLCA 3GY4A 4AN7A 1O2ZA 1AFQB 2ZHEH 4YOGA 2TGTA 8GCHF 2H1UA 2VNTA 3ZYDA 1P2QA 6GCHF 2ZWLH 3HGNA 5GDSH 1TNGA 1NU7B 1UVUH 2Z3CA 4ZXYH 3ZVGA 3NK8A 2C8WB 4BANB 8KME2 3SUGA 1AZZA 3LGIA 2OCVB 2BDAA 1XVOA 2BVXH 1YPJH 1XMNB 1BA8B 2SGAA 4YXWD 1BCUH 2FIRH 4NGAH 5GJ4B 5IK2D 1QHRB 3STJA 2GDDA 1NRRH 5E0HA 3HK6B 1UVOA 1T4UH 1IQFA 2JH5D 2WPKS 3SN8A 2FI3E 2JETC 1SHYA 4D9QA 2FI5E 1BTUA 2O8TA 2OBQA 2ZU3A 3OY5U 2HOBA 2A7HA 4ZAEA 1EB2A 1W3CA 2KCYA 3ZVBA 4B1TA 1UCYK 1DICA 2Z9KA 3Q3XA 1YWUA 4K2YA 2A2XH 1W14U 2UUJB 2FP7B 2G5NA 3GY2A 5TJXA 1GJ6A 1P2IA 4WMEA 2FYRA 1PJPA 3LT3A 1SLVB 3BTDE 1ARBA 4Z6AH 3WW7A 2NU0E 1A3BH 3E90B 1K1PA 1E1QD 3PV2A 3RP2A 3U9AH 3HPTB 1EJAA 4JZIA 1ZSKA 3A83A 3MNBA 1P03A 1JWTA 3GY5A 1HBTH 1K2I1 1W2KH 3FO8D 3SGAE 4HG6A 4CR5A 1DWDH 2YMSB 4FU7A 3KEEA 4QT8C 3QK1A 2ANKH 2ZTZA 4NIWA 1ELBA 1TX6A 2BOKA 2K0QA 5HM2A 1ZTJA 4ISLA 5EJZA 4KGAA 5E0GA 4AOQA 1AB9B 4HGCA 1C5XB 3UAIC 1GWAA 3SU1A 1EXFA 1YCPK 4Y6DA 2G5VA 4IN1A 5HIYA 1OPHB 3SU4A 2P3UB 2FPZA 3RXOA 4INKA 4WMDA 1EPTB 3H5CB 4RKOB 3UPEA 1GBCA 3OE7D 4JMYA 1OWDA 1KIGH 3NUMA 1HUTH 1ZLRA 3U1IB 2GZ7A 4X1PU 1FLEE 1QQUA 3P6ZB 1MMJN 1W7XH 4FUHA 3M5MA 1O2IA 2CGAA 3EYDA 4JYVH 3FZZA 3BIUH 3RXBA 3VB6A 1JBUH 1GVLA 2Z94A 3RC6A 3V3MA 3RMNH 4B71A 3M5LA 2HVYB 1NPMA 3VFEA 5ABWA 1XUGA 3LJJA 3AAVA 4FU8A 1NU9A 3PYHA 2PKAB 2BD8A 3PLBA 1NRQH 1UTLM 1LHEH 2ANYA 1RRKA 4WVPE 1YPMH 2M5TA 3OYPA 1DWEH 1O3IA 4KTUA 1XM1A 3RXPA 2OK5A 4IS5A 2PGQB 4IBLH 3FP7E 3N99A 2ZFTA 2SGFE 2BY5X 3SV6A 2C8ZB 2TPIZ 1FIZA 1YPGH 1HAGE 1EASA 3QO6A 4O9VA 3TIUA 1COWD 4H4FA 1VITF 1A1RA 4JZDH 2FS9A 1V2LT 3EDXB 3SU5A 3PLPA 3PWBA 4Q4LA 3ZZBA 4ISIH 3QGNB 1SLUB 4U2WA 3VB7A 5C5OA 4MQAA 3ZZAA 2R3UA 5HM9A 4YLUA 1AIXH 1VGCC 1AFEH 4UFFH 1HIAA 1DPOA 1QB1A 3I77A 1K1NA 3ATKA 2ZF0H 2J9NA 2JH6D 2ZCKP 2KAIA 3A88A 4X2YA 1P2KA 4CRDA 2ZZUH 4AC9A 2C93B 3VB4A 4FU9A 1V6DA 1PQAA 1SKYE 2GX4A 1NROH 1O0DH 3LC5A 2XW9A 1MABB 1IHTH 2V3MA 2BDYA 3GDSA 4PROA 2BHGA 1ESBA 4WH8A 2ZA5A 3DA9B 2XBVA 1TABE 2FOCA 1ELVA 2AGGX 1F92A 4HI3A 1EZQA 1GDQA 3URCA 2VGCB 1UCYH 4ZXXH 4LOYH 5K0HA 1SBWA 4HTCH 1C5PA 3SHCH 3T5FH 4CRGA 1DLKB 1S6FA 2UWOA 3KGPA 2ZECA 4X2VA 1RXPA 1V2OT 3SI3H 1TFXA 5CHBA 5F8TA 2BVSH 1QIXB 2VVCA 1S5SA 2CV3A 1NTPA 2FODA 1RS0A 3TITA 1BRUP 2CF8H 4R0IA 1IQHA 2FEQH 4UEHH 3ODDA 3TJVA 5EW2H 2ZPRA 4A1XA 5B6OA 1V2WT 2HWLB 2W5EA 4E7RG 1C2JA 3F9FA 2P3FH 3P92A 2ZGJA 3ZZDA 2AIQA 1L0ZA 2ODYB 4X6PA 1AWHB 2H9EH 3TGJE 3MU4A 1ZPCA 1MTSA 4JK5A 1O5GH 2PHBA 2FOMB 1YCPH 2PW8H 5C0TA 4D8NA 2A0QB 2TGDA 5DGJA 1K1IA 1MKXK 1ZJDA 1V2TT 1P02A 3MH5A 2A2QH 1F7ZA 4O97A 1SGCA 2PTNA 1OSSA 2W7UA 1GI7B 2BD5A 3SZEA 3M35A 3ZZ6A 1TNKA 1XVMA 2BY8X 2XC5A 3UWIA 4ZHMU 1A2CH 3R3GB 1ACBE 4RI0A 4ZROA 3CP7A 4B2CA 2GV6A 4M9FA 5GPIB 3P8OA 2J95A 2BDHA 2JIZD 1KYNA 3BG4C 2ZDMA 1HAZB 3PV5A 2FX4A 2P8OC 5FCKA 1C5MD 4Y8ZA 1PYTC 1F5RA 4GCHG 3A84A 1QY6A 5DG6A 4XD7D 5FAHA 2HALA 3FP8E 3KHVA 1ELGA 5FHTA 1V2QT 2B0FA 1C2LA 2ZCLP 2G4TA 3FAOA 2K1QA 1TNIA 1GMHG 5G4BA 3LGTA 3SOSA 2QF4A 5GXPA 3MO3A 1O39A 1WQSA 4Y0YE 1CHOG 1O2OA 2XC0A 4WY3A 1GGDC 1KXFA 2UWPA 2Z3EA 3PM3A 4JZFH 1O38A 3ZZ7A 1NESE 3LGWA 5EODA 1CBWB 1O2GH 1GCTC 3LH1A 2IN2A 2GT7A 1OWHA 4ABDA 4GCHF 3RU4D 1MQ5A 1B0FA 1HJAC 2EI6A 2OC8A 3A7YA 2D8WA 2EA3A 3MH7A 1MTVA 1TRNA 2VH6A 3M61U 5C94A 3KYFA 3WWFA 3TGIE 1G3DA 3T2NA 3RM0H 3U8RH 4ESTE 4AB8A 4CHAC 3SUDA 2QF3A 3SGBE 1W8BH 1ZRKA 1EX3A 1LHGH 1PPFE 1GBMA 1CHOF 1EUFA 1VJ9U 3KF2A 3FP6E 2UWLA 1P01A 5DSFA 1P57B 4Q7XA 3QLPH 4NG9H 4DURA 3QUMP 5I46H 1GI0A 2H5DA 1C2FA 1AFQC 2QXHA 3N7EA 4BTUB 1L1GA 3S0NA 4O03A 1DUEA 1SGIB 1YM0A 1TA2A 6ESTA 1SGEE 1O2XA 2YNBA 3SI4H 5CE1A 2HPPH 5C20A 3DCLA 1HNEE 2VIVA 2F9PA 4OM9A 1BBRE 5TCCA 4AX9H 1PPCE 1BZXE 4DCDA 1GBHA 4K69A 4K5ZA 3EGKH 2VIPA 1C5ZB 1A5GH 2RCEA 1UTNA 4ZH8A 5CDFE 5IYTA 3NRLA 1YPHC 1OWEA 1RTKA 4FVBA 1XX9A 4ASHA 2WPMS 1O2WA 1O5CB 3FANA 4D7FA 1BTZA 1FNIA 1GBBA 3RXQA 4RN6A 8ESTE 4WH6A 1NC6A 3TK6A 4ZHAA 1BQYA 1H9IE 4JK6A 4BAOB 4NFEA 2Q6FA 3A8BA 2PP6A 1RFNA 3MH4A 1FN8A 2BMGB 1LPZB 2ZHFH 7ESTE 1LKAA 1QCPA 2SNWA 2D26C 4WMFA 1IQNA 1D3TB 1OP2A 4I8LA 4OGYA 2ZTXA 5GNDA 1UTKA 2PUXB 1SGYE 2OUAA 4ABAA 1GVKB 3AK5A 2VWNA 1EATA 1SGDE 3V0XA 1QR3E 3UREA 1W13U 1FY1A 4E06H 3O8DA 3D62A 1V2RT 2LNCA 3RLWH 4VGCC 3RXAA 3QTOH 1TQ7B 4X6MA 1NBME 1RTLA 3F0OA 3EA7A 1TBRH 2P16A 1UHBB 2WHXA 3QTVH 2BD2A 4DT7B 1MBMA 1SR5C 3QDZB 1MKXH 5FXLA 2Z3DA 1LVOA 3MU5A 3A85A 3GCTG 3LGYA 1FY3A 1IAUA 3ATIA 2QC2A 2ZPQA 1MKWK 3BV9B 4RT0A 3SO3A 3LJOA 1TLDA 1ABIH 1CHGA 5HIZA 1EAIA 1K0HA 4FUJA 1RJXB 1CA0B 2GMTB 1CA8B 2F9NA 4IN2A 3E0PB 1VCWA 4WF8A 5AFZH 4ZKSU 3SZNA 1K1OA 1GBAA 2ESTE 3PV4A 1BHXB 3V13A 2I6SA 1F0RA 2GDEH 2VB0A 2Y5FA 1A0LA 1HPGA 2FI4E 1MTUA 3UIRA 1KXCA 3W95A 4XFQA 1YPLH 3DFLA 3SYJA 1IHSH 2J5UA 4IMQA 1HAIH 3SJ8A 3GCTF 1FZZA 5EXNA 1KDQB 1FONA 2Y80A 1C5LH 2ALPA 1AWFH 1XUJA 3NWUA 3SNDA 3K2UA 1ZOMA 2VWMA 1LMWB 1NRNH 2PKSC 2V7QD 4Y71A 1KMHB 2C8YB 4MPUA 1V2PT 1UVTH 1O32A 3UQOA 1ETTH 1Z1IA 2ZDLA 3M7TA 4BOHA 1RIWB 4JZ1A 1OOKB 1TNHA 2Z9GA 4OS1A 4DGJA 1EJNA 4D7GA 2BY7X 3ZYEA 2B9LA 1ANBA 1YBWA 2ZHQH 4YM9A 1THSH 5DP3A 1KXEA 1CT2E 1HAVA 3B8JA 4NA7A 1J8AA 4MVNA 1C1UH 2FOBA 2HVXA 2WYJA 5AHGH 1C4V2 2BLOA 2WUCA 4YO9A 4NIYA 2BQ7B 2NWNA 1TOMH 1NS3A 3Q76A 7LPRA 1C1RA 3T29A 2FYQA 4B75A 3BTKE 1Y5UT 3ENSB 1NRSH 2VIWA 6LPRA 4CR9A 4TSFD 4ABGA 2ZI2H 1WQVH 5JPMH 2JKHA 3P17H 1SQOA 1O2MA 5ESTE 5F8ZA 4X1SU 1KY9A 1BTXA 3OTPA 3RXSA 1QBVH 3SNAA 4OS2A 2V3OH 3QN7A 2QA9E 2BXUH 2BLQA 5E0JA 3M37A 3UQVA 1P3CA 2AEIH 3EE0B 1WTGH 1G3CA 1UO6A 2XNIA 3L33A 2XNDD 5HKKD 2GCHG 3KN2A 4BAHB 1FY8E 2B5TB 3EA8A 4Y79A 3RU4T 1O2UA 3UY9A 2J2UA 3SBKA 3VG8A 3GCHB 7GCHG 5A0AE 2BY9X 1S82A 4ABEA 1MTNC 2PSYA 1YKTA 1QRXA 2BD4A 1V2KT 3GYMA 1JOUB 2P93A 5AF9H 2IJD1 1P9SA 3ATMA 1F0SA 1YPHE 2VIOA 2VJ1A 2CHAB 1BMAA 1BTWA 4X1NU 4Y7AA 3S69A 1BT7A 5FBIA 2AGEX 1J15A 2ZDKA 2ZU5A 1EP5A 4LXBH 3BEFB 4NIXA 1TOCB 1FAXA 3GICB 1TONA 2DUCA 5HXFA 4A7IB 1UK2A 1EB1H 1ORFA 3VB5A 1SOTA 3KQCA 5FX6A 2VH0A 4AFUA 1WTHD 1L4ZA 1TBQH 2GCHF 4H6SB 3BG8A 1SPJA 4FUGA 3SU0A 4E05H 3GYLB 2XYAA 7GCHF 3U1JB 2JJ1D 4INLA 4I31A 1CVWH 3U8TH 4IC6A 1XKBC 2WPHS 1GPZA 1SGPE 1J16A 2XCNA 3GY6A 4WXVA 4F4OC 1ZJKA 2GCTB 3PWCA 4D9RA 1C5SA 1MKWH 1O5BB 3MYWA 3KIDU 4UFDH 1H9HE 3ATLA 3A81A 4MPVA 2P95A 3A7WA 1PPGE 1BMNH 1P2OA 3PB1E 5ETXA 1MQ6A 1WUNH 3RXDA 2ZU1A 2F9VA 3A89A 3NPSA 2EY4C 1S85A 3M5NA 4B6FA 2VWLA 1YC0A 1SLXB 1UTPA 3T25A 1DSTA 2L6OA 1ZMLA 1GJDB 3A86A 1TB6H 1QTFA 2V0BA 2XBWA 3SGQE 2A5KA 2A4GA 1XUIA 3OAAD 3MFJA 5EGMA 2FOAA 5DP8A 1GMDG 1T8MA 5K7RA 1Q2WA 2Q1JA 4NCYA 3VGCB 2Z9IA 1Z8IB 4DIHH 2STBE 1YPKH 1C5OH 3PTBA 2J38A 3F6UH 1Z6EA 2WZQA 1O3OA 1V2MT 4RT1A 1B7XB 4B76A 1C9PA 4AFQA 5T1VA 1ELCA 2XBXA 4B2AA 1UHBA 5C3NA 1TGCA 3SU2A 1O3PB 5F8XA 4A1VA 4AFSA 3DFJA 1V2ST 1ZTKA 1YF4A 3RXHA 5A2MH 1Y3WA 1IOEA 2H6MA 3RDZA 1JRSA 2FWWA 4TYDA 3E1XB 3P8GA 1FAKH 2XWAA 1TPAE 3EQ0H 1MCTA 4FXGH 3SJOA 1GJAB 1DY9A 3FKSD 3SORA 1Y5AT 1GMDF 2J94A 4YLQH 5DN6D 1XUFA 3UNQA 1DVAH 1E35B 5EJ1A 5JBAS 3SV9A 3Q3KA 1LPGB 2A4OA 4X8SH 1UK3A 4GAWA 1GMCG 2QYIA 1MTWA 2F9OA 2CMYA 1W0JD 4B73A 1BIOA 2ZPSA 3F68H 3GDVA 1EOLA 1BJVA 1G3EA 3O8RA 2A7JA 3AW1A 1Q3XA 3SQHE 1P10A 2BZ6H 2QGRA 2Y6TA 3F0PA 4KTSA 3E16B 5JDUB 1A61H 1GHBG 1GI5A 2VWOA 4ACBA 2JDID 4ASUD 1DITH 1C2KA 1HJ9A 1KDQA 1WXRA 2Z7FE 3S9CA 1THRH 4X0WU 1O34A 1ZSJA 1N1LA 3T26A 2ZDNA 3BTWE 1C1SA 1QB6A 1ABJH 2ALVA 1PYTD 1WU1A 1WBGB 3DSOA 1SFIA 1SOZA 4K3JA 1GI9B 1GMCF 2QV1A 4MTBA 2OC0A 2IJOB 2QE7D 2AHME 5JBBS 1C2MA 1N6XA 4CRAA 2RDLA 1ETSH 3GCOA 5LH8A 1ANDA 3A82A 2KCOA 5A09A 3ELAH 2ZIQH 3GCNA 3SW2B 4AGKA 1WOFA 1O2LA 1U6QA 3PO1B 3GY7A 1EKBB 5EIYA 3UWJH 1G3BA 1GHBF 1FN6A 1RTFB 1A7SA 1O3NA 1OWJA 1Z8RA 2FLBH 1P06A 3MTYA 2R2WU 1ZHPA 1ZMNA 5C1XA 4FUFA 1O5FH 2XXLA 1J17T 1CGHA 2W6JD 2G51A 4X2WA 3IWMA 4NFFA 1E79D 1SGQE 1DX5M 3TJNA 4BTTB 4I86A 1FXYA 2BDGA 1V2JT 1SB1H 3RXMA 1AI8H 1C5WB 2F43B 2FOGA 2WPDD 3RXKA 3UR6A 1EP6A 1GI6A 3RXEA 2PTCE 2EQNA 1QB9A 3UOUA 5T3HA 1P9UA 2NU4E 4OS6A 5PTPA 1HJ8A 1QJ1B 4CH2B 1TWXB 2JETB 3HKJB 4I8HA 4NZQA 2G8TA 1OS8A 3KCGH 3NZIA 1BRAA 2GKVE 3S9BA 4X6OA 3RXIA 3RXGA 1H9LB 1AVGH 2R3YA 2BLWA 3G01A 4F48B 1N8OC 5KEDA 3MNSA 1HB0B 1C5NH 1O5AB 4ZMAH 1NFUA 2J97A 2ZQ2A 3TNSA 1Z8GA 5FCRA 1V2NT 5AFYH 3ZVAA 1A4WH 4MG3A 4ZKRU 2M2AA 3SJ9A 1B5GH 1NFYA 1DSUA 1HRTH 1YP9A 2ZKSA 1GHWH 1OP0A 1HAVB 1W7GH 2A5AA 2ZQ1A 2ZU2A 2STAE 3FN8A 5E2PA 2WSSD 5C17A 1NM6A 2ZU4A 1O3DA 2VBCA 1GJ4H 1AN1E 4ABIA 4AGJA 4Y76A 5CHAC 1UW7A 2NU2E 3F1SB 3ZZ5A 1O36A 1P2NA 3BTHE 2QF0A 3BTFE 3SV8A 5BPEA 5BRRE 1W11U 3N7OA 2XTTB 2WYGA 2BM2A 2W7SA 4K8YA 1A5HA 5J4QA 2H2ZA 1ZTLA 3RXRA 1CGIE 5JB9S 4ZUHA 1ID5H 2GT8A 1UCYE 3LONA 5B6LA 4DW2U 5EXMA 2G55A 1BB0B 1SVPA 2ODQA 3O8BA 2PUQH 2BB4A 2ZCHP 4AZ2B 4KP0A 5C0UA 5F53A 2C4FH 3TK9A 2TBSA 6CHAC 1W12U 2AMDA 3RXFA 4CH8B 2R9PA 2SGQE 3SNCA 2BDCA 1JXPA 1E34B 5EQRA 3Q77A 1O2JA 3PMHB 1BMMH 2FOFA 1DWCH 2FO9A 1AY6H 3F2FA 1V2UT 2FOHA 2XCFA 3A7VA 3OU0A 1DE7H 4BXSA 1CT4E 4BAMB 2V6NA 5EQQA 2RA0A 4TT3D 1PQ8A 2ZNKH 2EC9H 1OWIA 3DSPA 3F2GA 5E8EH 3FFGA 2YOLA 1GCDA 2A45B 1KLJH 1GMHF 3A7ZA 4CREA 3S9AA 1S0RA 1Y3YA 1YYY1 3BSQA 5FPYA 1CSOE 1ZYOA 3A8DA 3UNSA 3RMMH 4P00A 5A8YA 1PPEE 3SU3A 4AFZA 2XBYA 2W3KA 2F4LA 2OP9A 2ASUB 3B23B
chains in the Genus database with same CATH topology
1FDPA 1S0QA 2ZC9H 2Y7XA 3P8NA 3ODFA 4Y7BA 3RC5A 1RD3B 9LPRA 1EAUA 1TRYA 2AGIX 5JB8S 1X7AC 1GHZA 4X8TH 1KTTB 2BQWB 1QRZA 2R0KA 3VXFH 4ZHLU 3S7HB 2H9HA 2OTVA 3LIWA 1Y3XA 1ZZZA 4IC5A 4A92A 1C5YB 3K65B 4Z0KA 1HAXB 3GCHC 3QGJA 1TIOA 1TPSA 1ZRBA 2BX4A 1GBJA 2P3TB 1SHHB 1GJCB 5T6FA 1DANH 2D2DA 3MMGA 1OYTH 2J92A 1VGCB 2PR3A 3ZVEA 1KTSB 1XUKA 1SFQB 1AKSA 1H1BA 1T31A 1F5LA 4NIVA 1FPCH 2OC7A 4GSOA 1CE5A 4GLYA 2GTBA 4GUXA 1JIRA 1GHVH 1VJAU 1GI3A 1QURH 1O30A 1C1VH 5A0CA 1MUEB 2I6QA 4JYUH 3V12A 1QL9A 5T6DA 1O3KA 3A87A 2BD7A 3BTTE 2J4IA 1ZSLA 2CN0H 1EOJA 4Q2KA 3TVJB 1O3EA 2V35A 2LPRA 1UVPA 2FOEA 1UK4A 2IOTA 1AE8H 1BDAA 2QXIA 3LOXA 2A1DB 3O8CA 4OS5A 1E38B 5LGOA 4IGDA 1P04A 1IQMA 1O3JA 5HMAA 3ZV8A 5LPFA 1DS2E 3D23A 1HXFH 4ISNA 2NU3E 3GY3A 3SNBA 5E2OA 4D76A 9ESTA 1YCPM 3GISB 2O8WA 3F9EA 5EPYA 2FLRH 4AORA 4JCNA 2EI7A 1K21H 4I33A 1D9IA 1ANCA 1AB9C 3SHAH 3PMAB 2G81E 1V2VT 2C3SA 2TIOA 3CS0A 4YOIA 1DFPA 1TGNA 2G00A 2V3HH 4GPGA 2J34A 5JBCS 3B9FH 4YT6H 1EPTC 3KQBA 1UTMA 3PTNA 5DK1A 1QNJA 5EG4A 4UD9H 1LKBA 1SLWB 1AHTH 4GHQA 1O2QA 5GCHG 1QGFA 1D3PB 1EZSC 3AAUA 2QXJA 4UONA 1GVZA 4I8GA 3I78A 2GVFA 2SNVA 2ZHWH 2Z6BD 2A32A 2YNAA 2TGPZ 3F9GA 1Z7KA 1GG6B 2ZDVH 4IW4E 1YGCH 4OGXA 2HRVA 3ZVCA 3URDA 1FMGA 1GI8B 4TY6A 3TH2H 2A5IA 4ABHA 1KXBA 1TRMA 5FBEA 3ZV9A 4XSKU 2Q6GA 1QA0A 3NCLA 1HAPH 1S6HA 2FTLE 4RKJB 2UUYA 3SNEA 1TQ0B 1NT1A 5SGAE 5DP9A 1L1NA 3VPKA 1F0TA 3BG4B 1AUJA 2P8OB 3VEQB 4KTCA 2QCYA 4XBBA 5GCHF 2CXVA 1Q31A 1QFKH 3DD2H 1BTPA 2PV9B 1QQ4A 3MU0A 1PQ5A 1T32A 1HYLA 5A8ZA 2HLCA 1GL0E 3RC4A 2B7DH 2ANWA 3MO9A 3Q3YA 4YTAA 1BITA 1K1JA 3PLKA 1GJBB 1TX7A 3TPIZ 3M36A 2ZDAH 2ZTYA 4GHTA 2BY6X 3ZZ4A 3UNRA 1AVXA 5DP4A 3AW0A 4XBDA 1NFWA 3LGUA 1EAWA 1FPHH 4HFPB 1NZQH 1V3XA 1SQTA 4OS7A 3WY8A 2HPQH 1GCTB 3RXLA 2R0LA 1DM4B 4K60A 3PMBB 2CF9H 2NU1E 3RXVA 1ZPBA 2PWXA 4Q80A 5L2ZH 1HJAB 5DO4H 3TH3H 3H7OA 2F9UA 1Y3VA 1LDTT 4DY7B 1MU8B 1K9OE 2VVUA 3BN9A 1O3FA 5DP6A 1GDNA 2FZZA 3P8FA 3SUEA 2XRCA 2W26A 4ISOA 3LH3A 4K1SA 1AMHA 4KKDA 4WJG2 2UUKB 5GWZA 2AMPA 1E0FD 3MOCA 1GJ8B 1OWKA 1NRPH 4Y8XA 3RXUA 4E7NA 2O9QA 4LZ4B 5DJ7A 1D3DB 2FX6A 3MHWU 3KQDA 4RSPA 1O37A 2QN5T 1O35A 2ZGXH 3MO6A 4XE4A 1XXDA 1FY5A 1P2JA 4NZLA 1C2HA 3PROA 1SQAA 2VGCC 1MU6B 5H4IB 1AUTC 1AU8A 1PFXC 1SGFG 1TPPA 4AB9A 1P2MA 5A8XA 3LDXH 1AQ7A 2QAAA 3P70B 1GJ5H 1O2NA 2VIQA 5FPSA 1PPBH 1D3QB 1FUJA 2AH4X 1UVSH 4GVUA 3PMJA 4U30A 1UTOA 1TX8A 3QWCH 5FPTA 2BLVA 1T7CA 4CRCA 2AS9A 5C1YA 1AO5A 1O5DH 1K1LA 3BF6H 1GBLA 1ZHMA 1GBFA 1SMFE 4CBNA 1C5UA 2FM2A 1SI5H 3BEIB 3ZZ8A 3ZVDA 2AMQA 1Z1JA 4X8VH 2Z9JA 3A8AA 2THFB 3A7TA 5C1UA 5JYIA 1GBTA 1OP8A 1NY22 4ZKOU 1D6WA 1HFDA 1C4Y2 3E91A 1NN6A 5FX5A 1TALA 4K1TA 2AFQB 1KLTA 1GL1A 5AVDA 4SGBE 1OYQA 5HYOA 2ODPA 3IG6B 3VB3A 4AYYB 1NO9H 1W0ZU 4VGCB 4DOQA 3KQEA 1KSNA 1DLEA 1BTYA 2BQ6B 3LU9B 1IQJA 1O3BA 3HATH 1C1PA 3JZ2B 2EI8A 1GHXH 2C8XB 1SGFA 2Y82A 3D65E 1J14A 2C90B 5T6GA 1QL7A 5DP5A 2BTCE 1L1JA 3RU4E 2VIDA 1Y59T 4FUEA 4YESB 1K1MA 2XC4A 2PSXA 5JBTA 1Z6JH 2OD3B 1L2EA 1TA6A 3I29A 1LHDH 1C1QA 2G4UA 2ZHDA 1DDJA 1RGQA 3U98H 1CU1A 1BHXF 1HAHH 1QBNA 3HKIB 1GJ7B 1O3MA 2GGVB 3QZQA 1H4WA 2ZFSA 2ZFFH 4XOJA 3K6YA 1A0JA 1AVWA 1GBKA 2A4RA 4DG4A 1AE5A 4OS4A 4DJZB 4O3UA 5F03A 1K28D 1BBRK 3D49H 3DUXH 1GBIA 1BOQA 1CBWC 2WV5A 3L3TA 5C2ZA 1D4PB 2OBOA 1AD8H 1DT2A 1WYKA 3ATWA 2SGPE 3SV2H 3MWIU 1VITG 2AERH 3BTGE 4NA9H 4R8TB 2DE8A 1MCVA 2GZ9A 1OXGA 1P11E 4TWWA 2HGTH 2O8UA 1ELTA 1G32B 1C1OA 1DY8A 3ZZCA 3MNCA 2F9BH 4CBOA 1P12E 4XBCA 2PKSB 1BRBE 4JZEH 1SGRE 5A0BA 1AKSB 3GY8A 4ABFA 1T8NA 4CRBA 1FY4A 1G30B 2A4QA 4TPIZ 2Y7ZA 1B0EA 2GP9B 3OTJE 2RA3A 1EAXA 3FZDA 3SJIA 2F91A 1BUIA 1MBQA 1UTQA 2QXGA 2WINI 4UE7H 5TCAA 1C2IA 1ELAA 2QIQA 2Q6DA 3TGKE 4WXIA 4K1EA 1GHYH 3SUFA 1MZAA 1LPKB 3ESTA 1T8OA 3KL6A 3TJUA 2DE9A 3H7TA 4A1TA 4BTIB 3UUZA 3SV7A 2OQ5A 1S83A 2ZGBH 3M3SA 4DVAU 5LPRA 2SGEE 2CJIA 4I32A 2F83A 4MLFB 5LPEA 1D6RA 1O5EH 2PFEA 1PQ7A 1C4U2 2P59A 1VR1H 2ZG0H 3AASA 1CT0E 5DPAA 8LPRA 2WPLS 1F0UA 3UOPA 1BRCE 1GHAG 3MI4A 3ZZ9A 2ZGCA 1MD7A 4NSVA 1LVMA 2HNTF 1W10U 1W0YH 2ZFQH 2O8MA 1BTHH 1O2TA 3EAJA 1C1TA 4MDSA 5DP7A 1MD8A 2TRMA 2WPIS 1UTJA 1C2GA 1IQGA 3KNXA 3T28A 1H8IH 4Q7YA 4Q7ZA 4NWKA 1ELFA 3EA9A 1MTNB 1QL8A 1J9CH 2BXTH 2FMJA 2A7CA 1C1MA 1LQDB 3A80A 1TYNA 1OKXA 4NSYA 1TPOA 4HZHA 1MZDA 3T62A 3LKWA 3MH6A 4FUBA 5EU8A 2BD3A 1SG8B 1S84A 2GZ8A 5CMXH 3ZZ3A 1GHAF 3E6PH 1JRTA 3SU6A 2TGAA 4AG1A 1BJUA 4UDWH 3TLOA 5L2YH 1MH0A 1DXPA 3UTUH 3OX7U 4LZ1H 1WSSH 2SFAA 3DT0H 1GI2A 1ANEA 2BX3A 1CO7E 3L6PA 4MNWA 1CA0C 2GMTC 3TH4H 4UFEH 3T27A 2BYAX 4U01A 4ABJA 1EZXC 1SL3A 1LCYA 1TE0A 4BXWA 1HDTH 1TBZH 1ESTA 1C5QA 3CS7A 1EZUC 3M3TA 4Y8YA 3U69H 1THPB 1G2LA 2D1JA 1QJ7B 3GDUA 3HGPA 1YPEH 2XWBI 4LK4A 4NA8A 3UFAA 4Y0ZE 1GG6C 5EOKA 2AYWA 1TGTA 1WV7H 4I8JA 2FS8A 1LTOA 3DHKH 1BMLA 4A5TS 1Z71A 1K22H 1LQEA 1MAYA 5L30H 2RG3A 4TWYA 4FVDA 2Y81A 2OLGA 1S81A 3E3TA 1BBRH 1WAYB 1F5KU 3TU7H 4BNRA 3SQEE 1ETRH 4MPWA 1RIWC 3MNXA 1QJ6B 3ITIA 1LHCH 2UUFB 5DKMA 3TNTA 1O2HA 2OXSA 5L6NH 2IPHA 3LGVA 4AYVB 1DWBH 1KXAA 1EQ9A 1ZMJA 1QRWA 1EJMA 4SGAE 1FV9A 2PGBB 3E0NB 2GD4B 1TMUH 2VVVA 4FUDA 3RM2H 2B8OH 1PPZA 2SGDE 3C1KA 1O2PA 4THNH 3C27B 3BTEE 1FIWA 1GDUA 3BTQE 1PPHE 1C1NA 3W94A 3MU8A 3M5OA 1A0HB 3QX5H 1HCGA 2PLXA 5EW1H 2JH0D 1F2SE 1O2KA 1IQEA 1O2VA 3F9HA 1EPTA 3GOVB 3JZ1B 3A7XA 2ZFRH 2G52A 1HV7A 3UR9A 1IQLA 1H8DH 1G2MA 1LHFH 5J4SA 1AZ8A 2H9TH 1Y3UA 2O8LA 5IDKA 1VCPA 1XKAC 3TJOA 2OINA 2VU8E 2HNTC 1DXWA 4B2BA 1QBOA 4F49A 1AGJA 4INHA 1MAXA 1CGJE 2GV7A 3U8OH 4YOJA 1O2SA 5EPNA 3Q00A 5C67A 3RXTA 2PKAA 2ZO3H 2CHAC 2ULLA 2ZFPH 4X1QU 1TNLA 5EQSA 3BIVH 3OY6U 4O3TA 1UJ1A 4A6LA 1TGBA 1TMTH 4Y10E 3RXJA 1HAOH 1CQQA 2WPJS 1P3EA 2R2MB 4B74A 4X8UH 1LVBA 3CENA 1NFXA 1KXDA 2ILNA 3TK5A 4IMZA 1P0SH 3RLYH 1N6YA 1GBDA 1E37B 1DUAA 3S7KB 1ZHRA 3M7QA 1HAYB 4M7GA 2OQUA 4AG2A 1SSXA 1YLDA 1C9TA 2P94A 1KLIH 2Y5GA 1P8VC 2F3CE 1T8LA 3K6ZA 4YT7H 3HK3B 1UMAH 3SJKA 2GCTC 3K9XB 1SGTA 3STIA 1SGNE 3BEUA 4WWYA 3FVFB 3QZRA 1VITH 1L4DA 2A31A 1C2DA 1ZPZA 3MU1A 4H6TA 1GI1A 1ZR0A 3R0FA 4X6NA 1ZGIA 4TY7A 3IITA 1P05A 1FI8A 1A46H 1O3AA 2WV4A 1O31A 1JMOH 3OSYA 3V7TA 1O33A 2ZGHA 3M3VA 2Y5HA 5C5NA 4FUIA 1P09A 1TMBH 1O3GA 1XUHA 3RXCA 1C5TA 1O3CA 2W3IA 1XXFA 2BDBA 3VGCC 4MNVA 4X2XA 5HGGA 1E36B 1N8OB 4I7YH 4TPYA 1ELEE 1ESAA 1INCA 1ARCA 1IQKA 1VCQA 2BVRH 3AVZA 2EEKA 1C2EA 3E8LA 2OC1A 1SC8U 3LPRA 1O3LA 4J1YA 4YZUA 4ABBA 1LVYA 3P95A 3NXPA 1G37A 4UFGH 1GJ9B 2FDAA 4CRFA 1OX1A 1Y8TA 2BZAA 3M7UA 5CHAB 1ZGVA 1C5RA 4ISHH 2BD9A 1Y5BT 1IQIA 3RMLH 4ZKNU 1C5VA 2ZEBA 3NKKA 1O2YA 1FJSA 1HXEH 4Y11E 1A5IA 4MPXA 1GBEA 1QA7A 2QY0B 2VINA 7KMEH 5GIBA 1TNJA 2FESH 1T4VH 3RUOA 1TAWA 1Z8JB 2ANMH 1HIAB 2Z9LA 1G9IE 1JIMA 4X1RU 1FQ3A 3RMOH 1GGDB 4J2YB 5I25A 2KAIB 6CHAB 1M9UA 1LO6A 1O3HA 4MNXA 4XDEA 1HGTH 1HLTH 1O2RA 2FXRA 8GCHG 2AIPA 4FUCA 3VXEH 6GCHG 1DOJA 4BAQB 2H5CA 2BDIA 4KELA 1TGSZ 4I8KA 5EXLA 1ELDE 4U32A 3A8CA 1VZQH 4NWLA 1G36A 2BOHB 4JYTA 4MNYA 4CHAB 5F6MA 3LC3A 4BAKB 2ZP0H 1C1WH 1A3EH 2FTMA 4K8BA 1WCZA 3PO1C 2HNTE 4DIIH 3BTME 3ZVFA 4H42U 1GI4A 2WUBA 5ESBA 1YLCA 3GY4A 4AN7A 1O2ZA 1AFQB 2ZHEH 4YOGA 2TGTA 8GCHF 2H1UA 2VNTA 3ZYDA 1P2QA 6GCHF 2ZWLH 3HGNA 5GDSH 1TNGA 1NU7B 1UVUH 2Z3CA 4ZXYH 3ZVGA 3NK8A 2C8WB 4BANB 8KME2 3SUGA 1AZZA 3LGIA 2OCVB 2BDAA 1XVOA 2BVXH 1YPJH 1XMNB 1BA8B 2SGAA 1BCUH 2FIRH 4NGAH 5GJ4B 1QHRB 3STJA 2GDDA 1NRRH 5E0HA 3HK6B 1UVOA 1T4UH 1IQFA 2JH5D 2WPKS 3SN8A 2FI3E 2JETC 1SHYA 4D9QA 2FI5E 1BTUA 2O8TA 2OBQA 2ZU3A 3OY5U 2HOBA 2A7HA 4ZAEA 1EB2A 1W3CA 3ZVBA 4B1TA 1UCYK 1DICA 2Z9KA 3Q3XA 4K2YA 2A2XH 1W14U 2UUJB 2FP7B 2G5NA 3GY2A 5TJXA 1GJ6A 1P2IA 4WMEA 2FYRA 1PJPA 3LT3A 1SLVB 3BTDE 1ARBA 4Z6AH 2NU0E 1A3BH 3E90B 1K1PA 3U9AH 3RP2A 3HPTB 1EJAA 4JZIA 1ZSKA 3A83A 3MNBA 1P03A 1JWTA 3GY5A 1HBTH 1K2I1 1W2KH 3SGAE 4CR5A 1DWDH 4FU7A 3KEEA 4QT8C 3QK1A 2ANKH 2ZTZA 4NIWA 1ELBA 1TX6A 2BOKA 5HM2A 1ZTJA 4ISLA 4AOQA 4KGAA 5E0GA 1AB9B 4HGCA 1C5XB 1GWAA 3SU1A 1EXFA 1YCPK