2ZECA

Potent, nonpeptide inhibitors of human mast cell tryptase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
242
structure length
242
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tryptase beta 2
publication title Potent, nonpeptide inhibitors of human mast cell tryptase. Synthesis and biological evaluation of novel spirocyclic piperidine amide derivatives
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2007-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zecA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zecA01
1OWJA 1TX7A 1VCQA 2P59A 3F68H 2UWLA 5GCHF 3QGNB 2W26A 1ZGVA 1OWIA 3M7TA 1GGDC 1AKSB 1DUEA 2VIQA 4ABHA 3UNRA 3VB7A 4AN7A 1OXGA 1V2WT 4Y11E 5TCCA 5GJ4B 1NY22 3RMOH 4ABJA 1PQAA 1EZXC 3BEIB 1O2XA 1O3NA 3UPEA 1PPHE 3CENA 1LVOA 2ANMH 3WY8A 2ASUB 1N8OB 3UOUA 1QL8A 2V3OH 3QDZB 4DG4A 5BPEA 5C2ZA 2ZGCA 3JZ2B 4AG1A 4JZEH 1FAKH 1FJSA 5SGAE 1MCTA 1AMHA 1L1NA 3HKIB 1F7ZA 3SGAE 3RXBA 3V7TA 1FPCH 4Y0YE 4Q7XA 4HI3A 3UNQA 4FU9A 1ARCA 2ODPA 1EZQA 2OC1A 1LHDH 3KL6A 1VITH 2C4FH 3RXCA 4BAMB 2ZDLA 1NPMA 4X8VH 4Y71A 1ZJKA 1V2NT 3L3TA 4ABDA 1IQIA 1O30A 3TITA 1GI6A 1GWAA 3P95A 1BHXB 3SU1A 4ZKSU 4NWKA 3KQBA 4MPXA 3GDSA 3RXGA 3VB5A 3QK1A 3A80A 3V13A 1DSTA 1IAUA 3T62A 1N1LA 2VU8E 4X2VA 4MNWA 2W7UA 2GCHF 1SGPE 1GDUA 1AZZA 1NRPH 1A4WH 3T26A 4D9QA 1ABJH 2AGEX 5DP4A 1HPGA 3JZ1B 1ETTH 1V3XA 4NZQA 2P3FH 3RMNH 1YLCA 3MU0A 1LQEA 4FU7A 1Y3XA 1FUJA 4DIIH 5PTPA 4I8LA 1Z71A 2F9OA 5C1UA 3NKKA 1O3LA 4YT7H 1NN6A 3UOPA 2VWMA 1J9CH 4IN2A 1UJ1A 1MBQA 3BTHE 1C2LA 2XRCA 1V2OT 1NZQH 1P2OA 5C67A 3G01A 4Q7ZA 4HFPB 1WU1A 5DG6A 1PJPA 1O3IA 2WPJS 3F9GA 2A4OA 1YBWA 4AFSA 7GCHG 3RU4E 1HAOH 1S84A 5FX5A 4KELA 2GP9B 1CT0E 1RTKA 2TGDA 3K65B 1TOCB 2BX4A 3DFJA 1HAHH 3PMJA 1GJ5H 1XUGA 2JH5D 3CS0A 1AGJA 2GCTC 3H7OA 1FIWA 4OS1A 2B7DH 4BAQB 3E16B 3A85A 2CV3A 4DY7B 1ZMLA 2H2ZA 3STJA 5JB8S 1P2KA 4CRBA 5L6NH 4ISIH 1RRKA 4H6SB 4O03A 1IHTH 1D3QB 1E37B 2QXIA 1EAUA 1GVZA 1EJMA 4FUHA 2OC7A 2QCYA 1GBHA 1FY3A 2ZEBA 3F9HA 1AU8A 4YZUA 4BTIB 2P8OC 2GMTC 1ANEA 3Q77A 1SG8B 1ACBE 3LIWA 3KQDA 4TPYA 3TH3H 3A8AA 4TY7A 3TJNA 1AI8H 5DK1A 4FVBA 4YLQH 1XVMA 1TPOA 2BDYA 1P12E 5K7RA 2H9EH 4U2WA 4ZH8A 1CA0B 1CSOE 1JIMA 2JH0D 1IOEA 5EODA 1GL0E 1CGIE 2A4QA 2H6MA 4X1SU 4SGBE 3RDZA 1UCYK 2SFAA 3GYLB 3RM0H 1CVWH 1Z6JH 3Q3YA 1TMBH 4AGJA 1Z1IA 4A1TA 3URCA 3RXIA 1P2JA 4YESB 3ZZDA 3SNBA 5L2YH 1QR3E 2VGCC 4OS2A 4CBNA 1NRQH 1JRTA 5C5NA 1SHHB 1Y3YA 5A0CA 2B5TB 2KAIB 1EJAA 3FP8E 1DITH 1LQDB 2OTVA 2J9NA 2ODQA 1DXPA 3UFAA 4FUBA 1O5FH 4Y10E 3RUOA 1ZRKA 3EYDA 1V2JT 1XUKA 5HXFA 1G32B 2BD2A 1F0TA 1SR5C 1BRUP 3KGPA 3RXPA 4JCNA 1BJVA 1DPOA 1G30B 3QLPH 2ZFFH 3ODDA 1QRWA 4XBCA 2XW9A 3BEFB 2LNCA 3AVZA 2AMQA 1FAXA 4UFDH 1SOTA 1UMAH 3SNCA 5TJXA 3SV7A 1GBJA 2Q6GA 1GHZA 5LPEA 2BTCE 4CBOA 5DPAA 3UQOA 1QA0A 2THFB 4JZFH 2Z3CA 1W11U 3GCTG 3TJUA 2QF0A 1FY4A 2F3CE 4WXVA 5AFYH 5CE1A 3RLYH 2PW8H 3SBKA 3A8BA 4PROA 3LJOA 3P8GA 3OSYA 3TNSA 2FX6A 1A3BH 3A7TA 3T25A 2OINA 3Q76A 1UHBA 2PGQB 1GG6C 4CRFA 4CH8B 1OYTH 4CREA 1PPGE 3PROA 3V0XA 1C5ZB 4FUDA 1DLKB 1K28D 1ZLRA 1O2JA 2P93A 2BVXH 2FOHA 1OWDA 3MNBA 2FESH 5AHGH 1GHVH 3E1XB 1FV9A 1UK2A 1VITF 1P3CA 1WV7H 3KNXA 4BAHB 2NU3E 1U6QA 1V2PT 3BTKE 4A5TS 1NFXA 1C5SA 2HNTC 1JXPA 3S9CA 2A45B 3ZZ7A 3STIA 2EI8A 4YTAA 3ZVEA 2ZHDA 2C3SA 5LGOA 2PKSB 2A0QB 5FAHA 3SU4A 2GZ8A 2YNBA 4BXWA 2R3UA 2VWOA 3I78A 1TNIA 1O2YA 3E0NB 1HAIH 1TGNA 1MMJN 2R9PA 1IQLA 4R0IA 1SBWA 3ELAH 3HGPA 1LKAA 1LVYA 1MUEB 1W0ZU 1SGFG 1GI7B 1AZ8A 1C2EA 4XOJA 1C5QA 2XBVA 2ZFSA 1SC8U 3DHKH 4NG9H 1TB6H 1W7GH 1DM4B 1EAXA 2BD7A 3BN9A 3MNSA 4ABGA 1KXAA 3BEUA 3GISB 1Y59T 1BRAA 2F9VA 3MU5A 2A31A 4A92A 3MYWA 5L30H 1TBRH 6GCHG 1SVPA 4WY3A 3VGCC 1N6XA 2BQ7B 1L2EA 2GT7A 2AMPA 3TGIE 1O2GH 2XCNA 4MPVA 5DJ7A 3RXVA 1OP2A 1P57B 3F1SB 1GCTB 4FVDA 4HTCH 1TGTA 2ZFRH 1E36B 1C4Y2 3SW2B 1D3DB 2BLQA 4UFFH 3MOCA 4MPUA 1F0UA 1TIOA 4B76A 1TFXA 2TGTA 3LU9B 2FOCA 1TGCA 2FOFA 2ZCHP 1GJ6A 2CXVA 1MAXA 2RDLA 1OWEA 1QJ1B 3SGBE 1XVOA 1BOQA 1ESBA 1Q3XA 3ZYDA 5C3NA 5T6DA 1G37A 7KMEH 2UUKB 3BTGE 1Y3UA 5F8ZA 2IPHA 4IW4E 5ETXA 2FODA 1SQTA 1Z8IB 1O34A 1P9UA 1TRYA 1XM1A 1ZTJA 1HJ8A 1GBTA 9ESTA 3SGQE 1TLDA 1KDQA 1NESE 2Y5HA 5DP8A 3HK3B 5EU8A 2FOMB 2UWOA 1DT2A 3MNCA 4X1PU 1IHSH 3ESTA 3E90B 1OYQA 3SJ8A 1VGCC 2J2UA 2ZQ2A 5E0JA 2ZGBH 3TJOA 1WTGH 3E6PH 2ZG0H 3SU5A 1BBRH 3U1JB 2WV4A 3BG4B 2Z3EA 2FP7B 1E35B 2FS8A 2ZHWH 2Y5FA 1TPAE 1A5HA 3T5FH 5EQQA 2ZU4A 4ZXYH 1O32A 2C93B 2O8WA 1MH0A 1EXFA 4FUFA 2I6SA 1O3EA 5I46H 5EQRA 1O2HA 5T3HA 1TNJA 2A5KA 3PWCA 1ZTKA 4AZ2B 4F4OC 2A4GA 3ATKA 1CO7E 4F49A 1DS2E 1C1NA 1CT2E 3PB1E 3AAUA 4CR9A 1TRMA 2K1QA 4ABBA 1RFNA 4I32A 1S0RA 1P2MA 4XBBA 4DIHH 2DUCA 4I7YH 1G3DA 2WPKS 1E34B 1A5IA 4O3UA 2Z6BD 1NM6A 1IQJA 2NWNA 4YOGA 5GCHG 1CQQA 2C90B 3MH5A 4GVUA 1IQNA 1HAPH 2ZIQH 1C1PA 2XBXA 2QAAA 2ZU1A 1ZSJA 1GMCF 1HIAB 1W3CA 4MNYA 3GYMA 2FI5E 4AYVB 3A7YA 4YLUA 2HPPH 2HNTF 1V6DA 3RM2H 1AHTH 1LKBA 1LHEH 2CGAA 5DO4H 3SZNA 1BTXA 1OWKA 1FY8E 1ARBA 1L4DA 2J94A 4WMDA 4CHAC 1BTZA 2CJIA 1KLIH 2G51A 2HRVA 1K2I1 1GJ4H 2QYIA 1ESAA 5CHAC 1MTNB 4NIYA 8GCHF 1FNIA 3TJVA 4IS5A 1C1SA 5HGGA 1GBBA 1GHAG 4ZUHA 5F8XA 5A8XA 3A81A 4B73A 3H5CB 3SNEA 2XC4A 3MWIU 1YPKH 1EP6A 1DWCH 1S82A 1F92A 1TMUH 5AF9H 3S7HB 3ODFA 2ZO3H 3HKJB 4MNXA 1LTOA 2QN5T 5FPYA 1YCPH 3M7QA 5E2PA 4NIVA 2Y82A 3Q00A 1GI1A 2PKAA 1TA6A 4TPIZ 1JBUH 1DX5M 1CU1A 1BBRE 2FPZA 1DVAH 2GGVB 3T28A 8ESTE 1O37A 2Q6FA 2ZNKH 5F03A 2WUCA 3LOXA 2P3UB 2VVCA 4NIWA 2BDBA 2CHAB 1SGNE 2GZ7A 2Z9LA 2ZCLP 4UFEH 4K3JA 3SN8A 4KKDA 1MKWH 1ZR0A 1CBWB 5F6MA 3PM3A 1H4WA 4I33A 1D4PB 1EPTA 1UK3A 5E2OA 4AB9A 2AIPA 1YKTA 1GHBG 3P17H 2RCEA 3ZVGA 1QTFA 1BB0B 5FX6A 3B9FH 4B71A 3OX7U 1FQ3A 1AIXH 3V3MA 4GLYA 3S9BA 2CF8H 1LVBA 2FOAA 1C5NH 1C1VH 1XUHA 1GMDF 3BTEE 1GHWH 1HAVB 4Y7AA 5C1XA 1WAYB 3GCHC 2GDDA 1FY1A 1ZHPA 3RP2A 1BQYA 1DE7H 3ATLA 2ZWLH 2FLRH 1L4ZA 4ESTE 1GBMA 2ALPA 1TQ0B 1QGFA 3FP6E 5HMAA 3M5LA 1QHRB 3AW0A 2ZF0H 2SGPE 4Z0KA 3S7KB 2BYAX 3RXSA 1P2IA 2PSXA 1P05A 3PTNA 2AIQA 4YOJA 1K9OE 2BB4A 2BY7X 2FYQA 1C2IA 2ZU3A 1O3KA 3UWIA 2GX4A 2JETB 1D3PB 1GI9B 2Y81A 4GCHF 1Z1JA 1K22H 2A32A 1AN1E 3PMBB 1GBFA 3RXQA 1EP5A 4H42U 2VWNA 1OP0A 5LH8A 1IQEA 1O2WA 4BTTB 1BTYA 2ZHEH 1S6HA 4Y6DA 3O8BA 1S83A 2AERH 1O3OA 3D62A 4K8YA 1ZPCA 3H7TA 4JYVH 3MTYA 5JBTA 4WF8A 1EKBB 3N7OA 4DOQA 3P70B 3S9AA 3MH6A 1VJ9U 2Z7FE 1CGHA 1DICA 1GBEA 1X7AC 2A2QH 3M3SA 3U8OH 1O38A 1NROH 1O3GA 3NZIA 2W3IA 5DGJA 2W7SA 1W13U 1HV7A 2WUBA 3EA7A 3SV6A 2V3HH 4KGAA 3PLPA 4MTBA 3UY9A 1HAXB 4KTSA 2FLBH 3LT3A 4Z6AH 2SGEE 3M61U 2VINA 5I25A 3KIDU 1VJAU 1RJXB 1O2QA 1GGDB 5FCRA 1FIZA 4GHQA 3ZZ5A 1T8MA 3MFJA 2G5VA 1O3DA 4O97A 1QL9A 1NT1A 1TNLA 1TPSA 1O2KA 3NWUA 1ANBA 3C27B 1TA2A 5IDKA 3U8RH 1TAWA 3LGVA 3VXEH 1TX6A 1V2VT 1C9TA 1S81A 4ZHMU 2BD4A 2ZDMA 3ZZBA 1HYLA 2GD4B 1O3BA 4IN1A 3KQCA 1UTKA 1P3EA 5AVDA 3F6UH 1QBVH 1BDAA 3EE0B 2PV9B 1YC0A 1AUTC 2ANKH 1HRTH 1YPMH 4Y0ZE 1SLXB 1KXEA 1NRRH 1D6WA 3RXTA 4ABFA 1KXFA 1Z8JB 4K1SA 2BM2A 3GY8A 3SUEA 1O33A 5C1YA 1FN8A 5A0AE 2VIDA 4GSOA 5L2ZH 4K2YA 3TPIZ 3KEEA 1E0FD 4DGJA 3MH7A 4A7IB 3W95A 2SGDE 1SSXA 1ZOMA 3I77A 2VIOA 4U30A 4THNH 2OCVB 4X6NA 3A83A 5GIBA 4AGKA 1A46H 3MU4A 3E8LA 3LDXH 2TBSA 2BOHB 2GKVE 2V0BA 1O2UA 1THRH 3K6ZA 1FN6A 1O3CA 1GJ9B 2VIVA 3B23B 4XSKU 2IJOB 1BMNH 2B0FA 1VITG 1O5BB 3MO9A 5LPFA 1ZRBA 1OKXA 2OP9A 4ISOA 4IGDA 1IQHA 1UTJA 2Q6DA 3LONA 3BG8A 2YOLA 2R0LA 2HLCA 1K1IA 3A8DA 1KTSB 1O3AA 3PTBA 4RKJB 2NU0E 3A7VA 1PPBH 3U98H 1AD8H 3HPTB 2XWAA 2FWWA 4ISLA 4K1EA 1DY9A 2ZC9H 5JYIA 3U1IB 4AORA 3NK8A 2BDGA 2XC0A 1C1UH 1S5SA 2HVXA 4WJG2 2ZPSA 2AGIX 3A7WA 1DSUA 1FONA 4FUJA 1S0QA 2ZI2H 2FI4E 1RTLA 1NO9H 1TQ7B 4M7GA 1UVPA 1ZPZA 2Y5GA 1D9IA 4FUEA 2V35A 3RU4D 1DLEA 1EPTC 2EC9H 3UNSA 1A2CH 3SU6A 3O8RA 1PYTC 2G4TA 4X1QU 1K1LA 6CHAC 1NTPA 2PGBB 1C5RA 1E38B 5A2MH 2ZU5A 4O9VA 2A4RA 2ZGJA 3T2NA 4ISNA 1YM0A 2IOTA 4ZHAA 1V2KT 5GXPA 3MO6A 1GMHF 4CH2B 2GCTB 3E3TA 3ZZ3A 4FUIA 4BAOB 1GPZA 1EZUC 1FLEE 1SLUB 4X1NU 1PQ7A 3HGNA 5EQSA 1A7SA 1O31A 4H4FA 1J8AA 1C4U2 4UD9H 2ANYA 2GTBA 1KXCA 3RXMA 2GV6A 1IQKA 1MQ5A 1J17T 1MTUA 1AKSA 1GI5A 2BD5A 2P8OB 2OXSA 3M35A 4INLA 4DT7B 2GMTB 3TIUA 1TE0A 1BTHH 1O2VA 2GDEH 3AAVA 2ZQ1A 1TMTH 4YOIA 2ZFQH 2ZTXA 1UTPA 3LGIA 1AUJA 1P02A 2VB0A 3KHVA 1W14U 1ZMJA 4A6LA 1BTUA 4K1TA 2ZZUH 1C5WB 5DKMA 2H9HA 1F2SE 1L1JA 2BXUH 4TWYA 4JZIA 4ABIA 4MQAA 1CHOG 5HM2A 1A61H 1PQ5A 2VNTA 1KSNA 1KLTA 2VWLA 2VJ1A 4WH6A 3SUFA 1LCYA 4I8KA 3FANA 3FFGA 3GOVB 1IQGA 1C2DA 1N6YA 1GL1A 1YPHE 1QCPA 4DCDA 2PTCE 1XKAC 2XYAA 2VGCB 4FXGH 4MDSA 1V2MT 1EX3A 1QBNA 1Y5AT 2ZPQA 3PV4A 1C2GA 1OSSA 3NXPA 2BD8A 2AYWA 1Y8TA 3GDVA 4GAWA 1NU7B 1GJBB 4NA8A 2ZDAH 4QT8C 2O8MA 2BY8X 3NPSA 1C2FA 3HK6B 3D65E 8KME2 3GY3A 4IBLH 3LGUA 5IYTA 1GI4A 1H8IH 1QBOA 1TOMH 1C5PA 3M37A 2XCFA 4D7GA 1QQUA 1SLVB 4Y76A 2EA3A 1PPZA 3RC6A 1JWTA 2QC2A 3QZQA 1VCWA 1SI5H 1HCGA 3L33A 5E0HA 4AFQA 4DURA 2F91A 1O2NA 1O0DH 5JBAS 3QGJA 3ZZ4A 4DW2U 3RXFA 2XC5A 3PO1C 1O5AB 1GCDA 2XBYA 2WPMS 2ZTYA 1W2KH 1UCYH 1C5XB 1WYKA 2A1DB 1CHGA 1AY6H 1FY5A 3M3TA 1P03A 1XKBC 3ATWA 1ANDA 5JPMH 1P06A 4NFEA 1C1RA 1GG6B 1GJAB 1GMCG 4DVAU 2O8TA 1MZDA 3GCTF 3GY6A 1ELTA 2EI7A 2OC0A 3VB3A 1HBTH 3A7XA 1F5LA 1YCPK 3GY4A 4VGCC 3EAJA 1LHGH 4FUCA 2GV7A 3MU8A 2M5TA 3PWBA 5H4IB 2BDCA 1XXDA 1YPGH 4B2AA 1BT7A 2ESTE 1MKXH 5EW1H 3F9FA 1BCUH 5TCAA 4BNRA 1MAYA 1UTOA 3UWJH 5CMXH 3TGKE 1C5UA 2ZU2A 3ZVFA 1TBQH 2BLWA 1GBAA 8LPRA 2FMJA 4I8JA 4SGAE 2SGQE 1GDQA 2BMGB 3SHAH 8GCHG 5EG4A 3RXAA 4YM9A 4OS7A 1HJAC 2ZHQH 3PLKA 3P92A 1LPZB 1C1OA 1MKWK 1XXFA 2R2MB 2BY5X 1QRXA 3LGYA 4MLFB 4ZMAH 1NFYA 2AFQB 4NZLA 1RIWC 4NFFA 1L1GA 1HB0B 3SNDA 4B74A 2FO9A 4K69A 3VEQB 3VPKA 1G3CA 2D26C 1AB9C 1KTTB 4JZ1A 3OU0A 3RC4A 4K5ZA 1F0SA 4HGCA 2FTMA 1GBLA 1XUJA 3EA9A 1AFQC 1D3TB 5EXLA 1SB1H 1TYNA 4JMYA 2A2XH 1C5LH 2ALVA 3VGCB 2BY9X 1PQ8A 2STAE 5A8YA 4GHTA 1VR1H 1XUFA 1Y3WA 1GI0A 1SGTA 5T6FA 1ELFA 1DWDH 2ZECA 2F9BH 2XWBI 4BXSA 1Z8RA 1C2JA 2QXJA 1AO5A 2BQWB 6GCHF 3SV8A 1JMOH 1BZXE 1EJNA 3ZVBA 1HNEE 4OS4A 3MU1A 1GBIA 2BLVA 3DA9B 1O2TA 4D76A 4X2YA 1ELCA 1V2UT 2PUQH 1SGQE 1HAYB 3K6YA 1THPB 3QTOH 4B2BA 1O2LA 1BRCE 1HAZB 3UR6A 1DY8A 2HWLB 2FS9A 3SNAA 3A8CA 2F9UA 1UCYE 4ISHH 4X6MA 1QIXB 3C1KA 2RG3A 3SV2H 4FUGA 3B8JA 1BMAA 1O2SA 1A5GH 2G8TA 3M36A 1AVWA 2R2WU 1WBGB 1Y5UT 2AS9A 3LGTA 1H9IE 1NFUA 1OOKB 1UVSH 5JBBS 3DFLA 1S6FA 1NRSH 4NGAH 5EW2H 4GUXA 3O8CA 2HOBA 1N8OC 1W0YH 4MG3A 1W8BH 1PPFE 1PFXC 1W7XH 1VGCB 2PTNA 5FXLA 3E91A 1P04A 2PHBA 5DP6A 5FHTA 2BX3A 5BRRE 2BVRH 1K1MA 1C5MD 2P94A 2ZPRA 1TWXB 3MH4A 5EXMA 2EEKA 1QNJA 1WUNH 4CRGA 1C1TA 5GDSH 3RLWH 2SGFE 1Z8GA 4GCHG 1DXWA 3FVFB 4K8BA 1BTWA 1O2OA 2ZFPH 2DE9A 3NCLA 1LMWB 2PUXB 4Y79A 3EDXB 1AFQB 4Q2KA 2GCHG 1AQ7A 1Z7KA 2XTTB 2H9TH 2Z3DA 2QGRA 4TWWA 4IMZA 3SO3A 1SFQB 1DWBH 1SPJA 1TX8A 1M9UA 3D49H 1EOLA 1SLWB 3RXKA 2CN0H 1P01A 1NS3A 3TK6A 2QF3A 3SU2A 3M5MA 4X1RU 3BV9B 3RMLH 3SU0A 3UQVA 4YO9A 3GICB 1FI8A 1VCPA 1TPPA 3ZV9A 1MU8B 1ETSH 3LPRA 5DP9A 1JIRA 3A82A 3VFEA 2WPIS 1A3EH 3K2UA 2QY0B 1GBKA 1O5EH 1UO6A 3MNXA 3QN7A 4I8HA 3PYHA 1NFWA 1GBCA 1KXDA 1LHFH 4AG2A 1KY9A 1BA8B 2JH6D 4Y7BA 5FBEA 1W10U 1EAWA 2D8WA 5DP3A 5ESTE 3RXDA 3ZZ6A 1SGFA 3RXEA 1BUIA 3QX5H 1O36A 1KLJH 2ULLA 4CHAB 3BTTE 1UHBB 1VZQH 3LC3A 5C20A 5CHAB 3FAOA 5GPIB 1RTFB 1GHXH 1BJUA 3AASA 5E0GA 2TPIZ 1UTMA 4X2WA 1Z6EA 2BDHA 3K9XB 2YNAA 4NA7A 5AFZH 3ZZ8A 4CRCA 2AEIH 2HPQH 2XBWA 4Y8ZA 1YPLH 1HXFH 2FYRA 1SMFE 1UTNA 1O35A 1GHAF 3P8OA 4AFUA 3GDUA 1WSSH 2Y80A 4CR5A 3QUMP 4O3TA 1O3PB 5A09A 1ZJDA 2FTLE 1QA7A 3EGKH 2Y7ZA 1K1NA 3BTWE 4RN6A 2NU1E 3A89A 1O2RA 1EAIA 3SORA 1C9PA 3I29A 1RD3B 2FI3E 1IQMA 3LH1A 1YPEH 3GCOA 2AMDA 1FPHH 3BF6H 3ZZCA 3ATMA 1SHYA 1T4VH 3Q3XA 1ELAA 4WMFA 4XBDA 5A0BA 1INCA 2FEQH 4B2CA 1SGIB 1V2TT 2D2DA 1C5TA 2F83A 1B0EA 6ESTA 4LOYH 2LPRA 1CA0C 1SGCA 4FU8A 4ZXXH 3SJIA 2ZGXH 4MNVA 4AFZA 1GHYH 4UFGH 2ZDKA 2ANWA 4X6OA 3SJKA 1B0FA 3RXUA 1DDJA 3LGWA 2RA0A 1HUTH 1SFIA 2ODYB 5JB9S 3ZVAA 1GI8B 1ETRH 4ZKNU 2XNIA 1LHCH 1EB2A 4RKOB 1K1OA 3URDA 3ITIA 1GHBF 5E8EH 5EOKA 2G4UA 1TABE 1GBDA 3AW1A 2CF9H 3GCHB 1ESTA 1UTLM 2C8XB 4MVNA 4WXIA 1GI3A 1UVTH 1ELEE 3RC5A 1BRBE 4X8UH 3QZRA 1QB9A 1AWHB 1EASA 5EXNA 4XDEA 1V2QT 2R3YA 2BHGA 1GMHG 3RXLA 3HATH 2RA3A 3QWCH 1A0LA 3O8DA 3SQEE 4U32A 4ZAEA 3S0NA 3IWMA 3OY5U 2BLOA 3M5NA 1SQOA 5J4QA 2OC8A 1TNGA 3TH4H 2BD9A 1KDQB 1UTQA 2VVUA 1D6RA 3SV9A 3OY6U 3RXRA 2P16A 5LPRA 1ID5H 1HIAA 5JBCS 3KCGH 1LPKB 2F9PA 2QV1A 1P09A 4LZ1H 2XXLA 4JK5A 4ZKRU 1C1WH 1BMLA 1YPJH 3QO6A 1BHXF 3P8NA 4E7NA 1ANCA 2WPHS 3QTVH 5J4SA 2TGPZ 4BAKB 3RXJA 1SL3A 3VB6A 1KYNA 3U8TH 1O3FA 1WQVH 1YCPM 4AYYB 1QL7A 1IQFA 1P0SH 2G00A 2JKHA 4JYTA 2FOGA 2OUAA 2VH0A 2GT8A 1ZSLA 3T27A 3MO3A 2BZ6H 2ZKSA 2OBQA 1H1BA 4J1YA 5ESBA 2HGTH 3BIVH 1G2MA 1T8LA 1O5CB 1C5YB 3RXOA 3TU7H 1A0HB 1JOUB 2FDAA 2A7HA 2AH4X 4UONA 2J95A 4WVPE 4OS6A 2Z9KA 3IG6B 4J2YB 2VIPA 3L6PA 1H9HE 3D23A 4RSPA 4YT6H 1MTWA 2ZHFH 4HZHA 1ZSKA 2PKSC 3GY2A 2PFEA 1YPHC 1ELVA 1TRNA 4NSYA 3SUGA 1ZYOA 5HM9A 1J16A 3ZVCA 4B75A 1Y5BT 3TK9A 1QB6A 4I31A 3EA8A 3FP7E 1NC6A 2SNVA 1UVOA 1XX9A 1ELGA 4E7RG 2FXRA 1MD7A 3DD2H 3NUMA 4ABAA 3KF2A 5HYOA 5FPTA 4JYUH 1LDTT 5EPYA 4AOQA 1MKXK 2OLGA 1UVUH 3A86A 2FX4A 4UDWH 2IN2A 1ELBA 1FMGA 1P8VC 1GJ8B 5GWZA 1T4UH 1O3HA 3BTDE 7GCHF 1YF4A 4JK6A 1HLTH 1KXBA 3RMMH 1C1QA 1QB1A 2Z9IA 1O5GH 1PPCE 2J38A 3M5OA 2B8OH 3P6ZB 5EGMA 3BSQA 1C5OH 3SI3H 1PPEE 4NWLA 1SGYE 2Q1JA 5ABWA 1O2PA 2F9NA 1BBRK 1EATA 2NU2E 3UTUH 3BTME 1A0JA 2W5EA 4NIXA 3SJOA 1P10A 2G55A 4XE4A 3BTQE 1V2RT 2OBOA 1GCTC 1ZTLA 4UEHH 1C4V2 1HAVA 2VVVA 1G36A 1TNHA 3RXHA 2BVSH 1L0ZA 1GJ7B 3A88A 1TALA 1GJDB 1CGJE 3KQEA 4OGXA 3SOSA 2PKAB 4IMQA 2FOEA 2QIQA 2OQ5A 5FBIA 5FPSA 2ILNA 2BY6X 1BIOA 1O39A 1DANH 2G81E 2P3TB 1C5VA 4DJZB 1P11E 1JRSA 1YGCH 3ZVDA 2WINI 1GVLA 2TIOA 4D7FA 1NU9A 1QJ6B 4B1TA 2FOBA 1Q31A 1CE5A 4XFQA 1H9LB 2VH6A 2GZ9A 1MBMA 4WWYA 1S85A 2H1UA 4X8SH 4KTUA 3TNTA 3UIRA 1C2HA 1UK4A 1MTSA 1BITA 2BZAA 2QXGA 3PMAB 3DT0H 4U01A 1ELDE 3R0FA 1EPTB 4Y8YA 1MU6B 1QRZA 1OS8A 1V2ST 3BG4C 1W12U 6CHAB 2BOKA 5A8ZA 2ZGHA 1DFPA 1RGQA 2BXTH 4CRAA 3VB4A 4BANB 3TGJE 1DWEH 4GPGA 4WH8A 4X6PA 3EQ0H 1EB1H 1FZZA 2PSYA 2BDAA 1LPGB 2VIWA 2ZCKP 3LJJA 2FM2A 4A1VA 3TVJB 3LC5A 3TH2H 1DOJA 1MZAA 4INHA 1F5KU 1T32A 5B6OA 3M7UA 5DP7A 1YLDA 3KN2A 2ZA5A 4INKA 1Y3VA 1QURH 4ZKOU 2Z9JA 2CMYA 1F5RA 4Q80A 3F9EA 4AB8A 3ATIA 1RS0A 1AE5A 3UREA 1O3MA 3GCNA 3SJ9A 2J4IA 2ZDNA 2D1JA 3P8FA 3R3GB 2AGGX 1ABIH 4TY6A 3S69A 3IITA 1QQ4A 3T29A 2PWXA 1AE8H 1BMMH 3U9AH 1EQ9A 1O2MA 2HNTE 1CT4E 5JDUB 1O2ZA 1QY6A 1GDNA 1WQSA 4D8NA 5FCKA 3Q3KA 1TONA 3M3VA 4E05H 3ZV8A 3ZZAA 2UWPA 1HDTH 1SGRE 2J34A 1ZZZA 1MCVA 4D9RA 2ZP0H 2NU4E 2TRMA 1ZGIA 2C8ZB 2OQUA 1CHOF 1PYTD 2TGAA 1K1JA 3BIUH 1MTNC 4OS5A 4ZROA 1V2LT 5C5OA 1HFDA 3LH3A 1AWFH 1NRNH 1YYY1 2ZDVH 1B7XB 1T7CA 5DP5A 1WCZA 1J15A 4X2XA 4LZ4B 3MHWU 1OWHA 4A1XA 2FIRH 1XMNB 1T8OA 1RXPA 4JZDH 5T6GA 1SOZA 4KTCA 1ZPBA 2V6NA 1TGSZ 4CRDA 3SUDA 1THSH 1SGDE 4K60A 1BTPA 1T31A 4WMEA 3A87A 4MPWA 4E06H 5K0HA 2C8WB 1TBZH 2A7JA 1C2KA 1FXYA 1T8NA 2WYGA 3PO1B 1EUFA 2P95A 9LPRA 4R8TB 1SGEE 1J14A 2H5DA 1C1MA 3BTFE 1P9SA 2CHAC 2GVFA 2QXHA 3CS7A 3U69H 3GY7A 2SGAA 1C2MA 4BOHA 1K1PA 1MQ6A 1EZSC 2KAIA 2OD3B 5EPNA 1HGTH 3FZDA 3UR9A 2WPLS 2G52A 3RU4T 2EI6A 1CBWC 2UUYA 2Y7XA 1HXEH 2Y6TA 1ZHMA 1ORFA 1GVKB 3ZZ9A 4H6TA 4VGCB 1GMDG 1B5GH 2ZTZA 5G4BA 2R0KA 3SU3A 1TGBA 3ZYEA 3UUZA 3PMHB 4IC6A 1G2LA 1TNKA 4ASHA 7LPRA 2O8UA 1OX1A 4UE7H 3A7ZA 3FZZA 3MMGA 2Z94A 3CP7A 4NSVA 1HAGE 3V12A 2A5AA 3GY5A 4X0WU 2HALA 3LKWA 1HJAB 1LVMA 1OP8A 1AVXA 1WTHD 2B9LA 3DUXH 4TYDA 4Q7YA 1SQAA 3TK5A 1G9IE 3SQHE 2J92A 3A84A 4KP0A 1P2QA 1O5DH 2C8YB 1MTVA 1P2NA 2BDIA 2FZZA 1AFEH 1RIWB 4NCYA 2DE8A 2BD3A 5F8TA 3W94A 3OYPA 2WV5A 2Z9GA 3OTJE 1O2IA 2W3KA 4AX9H 1G3BA 2O9QA 4ZHLU 1AB9B 1QJ7B 1GI2A 1Q2WA 1A1RA 1O3JA 2WYJA 2JETC 1KIGH 1XUIA 2PR3A 2UUJB 4Y8XA 4OGYA 1QFKH 3SI4H 1EOJA 1LO6A 2STBE 2BQ6B 1WOFA 3E0PB 4LXBH 2UUFB 2PLXA 3PLBA 4X8TH 4IC5A 1AVGH 4BTUB 1DUAA 1ZMNA 2O8LA 1FDPA 1CA8B 1GJCB 1K21H 3VXFH 1YP9A 1HJ9A 1OPHB 1ZHRA 2QA9E 2SNWA 1F0RA 4I8GA 4NA9H 2I6QA 2G5NA 3MI4A 6LPRA 1G3EA 1MD8A 2A7CA 2ZFTA 3ENSB 3TLOA 4LK4A 3SHCH 2A5IA 4ABEA 7ESTE 1H8DH 2H5CA
chains in the Genus database with same CATH superfamily
1OWJA 4ACBA 1TX7A 1VCQA 2P59A 3F68H 2UWLA 5GCHF 3QGNB 2W26A 1ZGVA 1OWIA 3M7TA 1GGDC 1AKSB 1DUEA 2VIQA 4ABHA 3UNRA 3VB7A 4AN7A 1OXGA 1V2WT 4Y11E 5TCCA 5GJ4B 1NY22 3RMOH 4ABJA 1PQAA 1EZXC 3BEIB 3DSOA 1O2XA 1O3NA 3UPEA 1PPHE 3CENA 1LVOA 2ANMH 3WY8A 2ASUB 1N8OB 3UOUA 1QL8A 2V3OH 3QDZB 4DG4A 5BPEA 3PRDA 5C2ZA 2ZGCA 3JZ2B 3ZIAD 4AG1A 4JZEH 1FAKH 1FJSA 5SGAE 1MCTA 1AMHA 1L1NA 4B6FA 3HKIB 1F7ZA 5EJLA 3SGAE 3RXBA 3V7TA 4P02A 1FPCH 4Y0YE 4Q7XA 4HI3A 3UNQA 4FU9A 1ARCA 2ODPA 1EZQA 4FOUC 2M2AA 2OC1A 1LHDH 3KL6A 1VITH 5KEDA 2C4FH 3RXCA 4BAMB 2ZDLA 1NPMA 4X8VH 4Y71A 1ZJKA 1V2NT 3L3TA 4ABDA 1IQIA 1O30A 3TITA 1GI6A 1GWAA 3P95A 1BHXB 3SU1A 4ZKSU 4NWKA 3KQBA 4MPXA 3GDSA 3RXGA 3VB5A 3QK1A 3A80A 3V13A 1DSTA 1IAUA 3T62A 1N1LA 2VU8E 4X2VA 4MNWA 2W7UA 2GCHF 1SGPE 1GDUA 1AZZA 1NRPH 1A4WH 3T26A 4D9QA 1ABJH 2AGEX 5DP4A 1HPGA 3JZ1B 1ETTH 1V3XA 4NZQA 2P3FH 3RMNH 1YLCA 3MU0A 1LQEA 4FU7A 1Y3XA 1FUJA 4DIIH 5PTPA 4I8LA 1Z71A 2F9OA 5C1UA 3NKKA 1O3LA 4YT7H 1NN6A 3UOPA 2VWMA 3OFND 1J9CH 4IN2A 1UJ1A 1MBQA 3BTHE 1C2LA 2XRCA 1V2OT 1NZQH 1P2OA 2XOKD 5C67A 3G01A 4Q7ZA 4HFPB 1WU1A 5DG6A 1PJPA 1O3IA 2WPJS 3F9GA 2A4OA 1YBWA 3PV5A 4AFSA 7GCHG 3RU4E 1HAOH 1S84A 5FX5A 4KELA 2GP9B 1CT0E 1RTKA 2TGDA 3K65B 1TOCB 2BX4A 3DFJA 1HAHH 3PMJA 1GJ5H 1XUGA 2JH5D 3CS0A 1AGJA 2GCTC 3H7OA 1FIWA 3NRLA 4OS1A 2B7DH 4BAQB 3E16B 3A85A 2CV3A 4DY7B 1ZMLA 2H2ZA 3FKSD 3STJA 5JB8S 1P2KA 4CRBA 5L6NH 4ISIH 1RRKA 4H6SB 4O03A 1IHTH 1D3QB 1E37B 2QXIA 1EAUA 1GVZA 1EJMA 4FUHA 2OC7A 3EE7A 2QCYA 1GBHA 1FY3A 2ZEBA 3F9HA 1AU8A 4YZUA 4BTIB 2P8OC 4I86A 2GMTC 1ANEA 3Q77A 1SG8B 1ACBE 3LIWA 3FO8D 3KQDA 4TPYA 3A8AA 3TH3H 4TY7A 3TJNA 1AI8H 5DK1A 4FVBA 4YLQH 1XVMA 1TPOA 2BDYA 1P12E 5K7RA 2H9EH 4U2WA 2HLDD 4ZH8A 1CA0B 1CSOE 1JIMA 2JH0D 1IOEA 5EODA 1GL0E 1CGIE 2A4QA 2H6MA 4X1SU 4SGBE 3RDZA 5EJZA 1UCYK 2SFAA 3GYLB 3RM0H 1CVWH 1Z6JH 3Q3YA 1TMBH 4ACAA 4AGJA 1Z1IA 4A1TA 5CHBA 3URCA 3H09A 3RXIA 1P2JA 4YESB 3ZZDA 3SNBA 1BMFD 5L2YH 1QR3E 2VGCC 4OS2A 4CBNA 1NRQH 1JRTA 5C5NA 1SHHB 1NBMD 1Y3YA 5A0CA 2B5TB 2KAIB 1EJAA 3FP8E 1DITH 1LQDB 2OTVA 1WDIA 2J9NA 2ODQA 1DXPA 3UFAA 4FUBA 1O5FH 4Y10E 3RUOA 1ZRKA 3EYDA 1V2JT 1XUKA 5HXFA 2GJGA 1G32B 2BD2A 1F0TA 1SR5C 1BRUP 3KGPA 3RXPA 4JCNA 1BJVA 1DPOA 1G30B 3QLPH 2ZFFH 3ODDA 1QRWA 4XBCA 4HG6A 2XW9A 3BEFB 2LNCA 3AVZA 2AMQA 1FAXA 4DT4A 4UFDH 1SOTA 1UMAH 3SNCA 5TJXA 3SV7A 1GBJA 2Q6GA 1GHZA 5LPEA 2BTCE 4CBOA 5DPAA 3AK5A 3UQOA 1QA0A 2THFB 4JZFH 2Z3CA 1W11U 3GCTG 3TJUA 2QF0A 1FY4A 2F3CE 4WXVA 5AFYH 5CE1A 3RLYH 2PW8H 3SBKA 3A8BA 4PROA 3LJOA 3P8GA 3OSYA 3TNSA 2FX6A 1A3BH 3A7TA 3T25A 2OINA 3KYFA 3Q76A 1UHBA 2PGQB 1GG6C 4CRFA 4CH8B 1OYTH 4CREA 1PPGE 3PROA 3V0XA 1C5ZB 4FUDA 1DLKB 1K28D 1ZLRA 1O2JA 2P93A 2BVXH 2FOHA 1OWDA 3MNBA 2FESH 5AHGH 1GHVH 3E1XB 1FV9A 1UK2A 1VITF 1P3CA 1WV7H 3KNXA 4BAHB 2NU3E 1U6QA 1V2PT 3BTKE 4A5TS 1WXRA 1NFXA 3W1EA 1C5SA 2HNTC 1JXPA 3S9CA 2A45B 3ZZ7A 3STIA 2EI8A 4YTAA 3ZVEA 2ZHDA 2C3SA 5LGOA 2PKSB 2A0QB 5FAHA 3SU4A 2GZ8A 2YNBA 3OE7D 4BXWA 2R3UA 2WV9A 2VWOA 4XRNA 3I78A 1TNIA 1O2YA 3E0NB 1HAIH 1TGNA 1MMJN 2R9PA 1IQLA 4R0IA 1SBWA 3ELAH 3HGPA 1LKAA 1LVYA 1MUEB 1W0ZU 1SGFG 1GI7B 1AZ8A 1C2EA 4XOJA 1C5QA 2XBVA 2ZFSA 1SC8U 3DHKH 4NG9H 1TB6H 1W7GH 1DM4B 1EAXA 2BD7A 3BN9A 3MNSA 4ABGA 1KXAA 3BEUA 3GISB 1Y59T 1BRAA 2F9VA 3MU5A 2A31A 4A92A 3MYWA 5L30H 1TBRH 6GCHG 1SVPA 4WY3A 3VGCC 1N6XA 2BQ7B 1L2EA 2GT7A 2AMPA 3TGIE 1O2GH 2XCNA 4MPVA 5DJ7A 3RXVA 5T1VA 1OP2A 1P57B 3F1SB 3SYJA 1GCTB 4FVDA 4HTCH 1TGTA 2ZFRH 1E36B 1C4Y2 3SW2B 1D3DB 2BLQA 4UFFH 2XNDD 3MOCA 4MPUA 1F0UA 1TIOA 4B76A 1TFXA 2TGTA 3LU9B 2FOCA 1TGCA 2VBCA 2FOFA 2ZCHP 1GJ6A 2CXVA 1MAXA 2RDLA 1OWEA 1QJ1B 3SGBE 1XVOA 1BOQA 1ESBA 1Q3XA 3ZYDA 5C94A 5C3NA 5T6DA 1G37A 7KMEH 1KMHB 2UUKB 3BTGE 1Y3UA 5F8ZA 2IPHA 4IW4E 5ETXA 3PRBA 2FODA 1SQTA 1Z8IB 1O34A 1P9UA 1TRYA 1XM1A 1ZTJA 1HJ8A 1GBTA 9ESTA 3SGQE 1TLDA 1KDQA 1NESE 2Y5HA 5DP8A 3HK3B 4Q4LA 3UB0A 2J98A 5EU8A 2FOMB 2UWOA 1DT2A 3MNCA 4X1PU 1IHSH 3ESTA 3E90B 1OYQA 3SJ8A 2JJ2D 1VGCC 2J2UA 2ZQ2A 5E0JA 2ZGBH 3TJOA 1WTGH 3E6PH 2ZG0H 3SU5A 1BBRH 3U1JB 2WV4A 3BG4B 2Z3EA 2FP7B 1E35B 4M9FA 2FS8A 2ZHWH 2Y5FA 1TPAE 1A5HA 3T5FH 5EQQA 2ZU4A 4ZXYH 1O32A 2C93B 2O8WA 1MH0A 1EXFA 4FUFA 2I6SA 1O3EA 2KCAA 3WWBA 5I46H 5EQRA 2J5UA 1O2HA 5T3HA 1TNJA 2A5KA 1H8ED 3PWCA 1ZTKA 4AZ2B 4F4OC 2A4GA 3ATKA 1CO7E 4F49A 1DS2E 3SZEA 1C1NA 1CT2E 3PB1E 3AAUA 4CR9A 1TRMA 5HIZA 2K1QA 4RT0A 4ABBA 1RFNA 4I32A 1S0RA 1P2MA 4XBBA 4DIHH 2DUCA 4I7YH 2WZQA 1G3DA 2WPKS 1E34B 1A5IA 4O3UA 2Z6BD 1NM6A 1IQJA 2NWNA 4YOGA 5GCHG 1CQQA 2C90B 3MH5A 4GVUA 1IQNA 1HAPH 2ZIQH 1C1PA 2XBXA 2QAAA 2ZU1A 1ZSJA 1GMCF 1HIAB 1W3CA 4MNYA 3GYMA 2FI5E 4AYVB 3A7YA 4YLUA 2HPPH 2HNTF 1V6DA 3RM2H 1AHTH 1LKBA 1LHEH 2KCOA 2CGAA 5DO4H 3SZNA 1BTXA 1OWKA 1FY8E 1ARBA 1L4DA 2J94A 4WMDA 4CHAC 1BTZA 2CJIA 1KLIH 2G51A 2HRVA 1K2I1 1GJ4H 2QYIA 1ESAA 5CHAC 1MTNB 4NIYA 8GCHF 1FNIA 3TJVA 4IS5A 1C1SA 5HGGA 1GBBA 1GHAG 4ZUHA 5F8XA 5A8XA 3A81A 4B73A 3H5CB 3SNEA 2XC4A 3MWIU 1YPKH 1EP6A 1DWCH 1S82A 1F92A 1TMUH 5AF9H 3S7HB 3ODFA 2ZO3H 3HKJB 4MNXA 1LTOA 2QN5T 5FPYA 1YCPH 2IPQX 3M7QA 5E2PA 4NIVA 2Y82A 2KCPA 1GI1A 2PKAA 3Q00A 1TA6A 4TPIZ 1JBUH 1DX5M 1YWUA 1CU1A 1BBRE 2KCYA 2FPZA 3WW7A 1DVAH 2GGVB 3T28A 8ESTE 1O37A 4Z1MD 2Q6FA 2ZNKH 1SKYE 5F03A 2WUCA 3LOXA 2P3UB 2VVCA 4NIWA 2BDBA 2CHAB 5EIYA 1SGNE 2GZ7A 2YMSC 2Z9LA 2ZCLP 4UFEH 4K3JA 3SN8A 4KKDA 1MKWH 1ZR0A 1CBWB 5F6MA 3PM3A 1H4WA 1YLNA 4I33A 1D4PB 1EPTA 1UK3A 5E2OA 4AB9A 2AIPA 1YKTA 1GHBG 3P17H 2RCEA 3ZVGA 1QTFA 1BB0B 5FX6A 3B9FH 4B71A 3OX7U 1FQ3A 1AIXH 3V3MA 4GLYA 3S9BA 2CF8H 2KR7A 1LVBA 4Q63A 2FOAA 1C5NH 1C1VH 1XUHA 1GMDF 3BTEE 4RI0A 1GHWH 1HAVB 4Y7AA 5C1XA 1WAYB 3GCHC 2GDDA 1FY1A 1ZHPA 3RP2A 1BQYA 1DE7H 3ATLA 2ZWLH 2FLRH 1L4ZA 4ESTE 1GBMA 2ALPA 1TQ0B 1QGFA 3FP6E 5HMAA 3M5LA 1QHRB 2JDID 3AW0A 2ZF0H 2SGPE 4Z0KA 3S7KB 2BYAX 3RXSA 1P2IA 2W6JD 2PSXA 1P05A 3PTNA 2AIQA 4YOJA 1K9OE 2BB4A 2BY7X 2KZ4A 2FYQA 1C2IA 2ZU3A 1O3KA 3UWIA 2GX4A 2JETB 1D3PB 1GI9B 2Y81A 4GCHF 1Z1JA 1K22H 3FN8A 2A32A 1AN1E 3PMBB 1GBFA 3RXQA 1EP5A 4H42U 2VWNA 1OP0A 5LH8A 1IQEA 1O2WA 4BTTB 1BTYA 2ZHEH 1S6HA 4Y6DA 3O8BA 1S83A 2AERH 1O3OA 3D62A 4K8YA 1ZPCA 3H7TA 4JYVH 3MTYA 5JBTA 4WF8A 2RFKC 1EKBB 3N7OA 4DOQA 3P70B 3S9AA 3MH6A 1VJ9U 2Z7FE 1CGHA 1DICA 3WWFA 1GBEA 1X7AC 2A2QH 3M3SA 3N7DA 3U8OH 1O38A 1NROH 1O3GA 3NZIA 2W3IA 5DGJA 2W7SA 1W13U 1HV7A 2WUBA 2YMSB 3EA7A 3SV6A 2V3HH 4KGAA 3PLPA 4MTBA 3UY9A 1HAXB 4KTSA 2FLBH 3LT3A 4Z6AH 2SGEE 3M61U 2VINA 5I25A 3KIDU 1VJAU 1RJXB 1O2QA 1GGDB 3F2HA 5FCRA 3PV2A 1FIZA 4GHQA 3ZZ5A 1T8MA 3OEED 3MFJA 2G5VA 1O3DA 4O97A 1QL9A 1NT1A 1TNLA 1TPSA 1O2KA 3NWUA 2EY4C 1ANBA 3C27B 1TA2A 5IDKA 3U8RH 1TAWA 3LGVA 3VXEH 1TX6A 1V2VT 1C9TA 1S81A 4ZHMU 2BD4A 2QF5A 2ZDMA 3ZZBA 1HYLA 2GD4B 1O3BA 4IN1A 3KQCA 1UTKA 4ASUD 1P3EA 5AVDA 3F6UH 1QBVH 1BDAA 3EE0B 2PV9B 1YC0A 1AUTC 2ANKH 1HRTH 4ZCNA 1YPMH 4Y0ZE 1SLXB 4YXWD 1KXEA 1NRRH 4P00A 1D6WA 3RXTA 4ABFA 1KXFA 1Z8JB 4K1SA 2BM2A 3GY8A 3SUEA 1O33A 5C1YA 1FN8A 5A0AE 2VIDA 4GSOA 5L2ZH 4K2YA 3TPIZ 3KEEA 5FL7D 1E0FD 4DGJA 3MH7A 4A7IB 3W95A 2SGDE 1SSXA 5IK2D 1ZOMA 3I77A 2VIOA 4U30A 4THNH 2OCVB 4X6NA 3A83A 5GIBA 4AGKA 3F2FA 1A46H 3MU4A 3E8LA 3LDXH 2L74A 2TBSA 2BOHB 2YMSD 2GKVE 5DN6D 2V0BA 1O2UA 1THRH 3K6ZA 1FN6A 1O3CA 1GJ9B 2VIVA 3B23B 3F0PA 4XSKU 2IJOB 1BMNH 2B0FA 1VITG 1O5BB 3MO9A 5B6LA 5LPFA 1ZRBA 1OKXA 2OP9A 4ISOA 4IGDA 1IQHA 1UTJA 2Q6DA 3LONA 2LELA 3BG8A 2YOLA 2R0LA 5C0TA 2HLCA 1K1IA 3A8DA 1KTSB 1O3AA 3PTBA 4RKJB 2NU0E 3A7VA 1PPBH 3U98H 1AD8H 3HPTB 2XWAA 2FWWA 4ISLA 4K1EA 1DY9A 2ZC9H 5JYIA 3U1IB 4AORA 3NK8A 2BDGA 2XC0A 1C1UH 1S5SA 2HVXA 4WJG2 2ZPSA 2AGIX 3A7WA 1DSUA 1FONA 4FUJA 1S0QA 2ZI2H 2FI4E 1RTLA 1NO9H 1TQ7B 4M7GA 1UVPA 1ZPZA 2Y5GA 1D9IA 4FUEA 2V35A 3RU4D 1DLEA 1QZ8A 1EPTC 2EC9H 3UNSA 1A2CH 3SU6A 3O8RA 1PYTC 2G4TA 4X1QU 1K1LA 6CHAC 1NTPA 2PGBB 1C5RA 1E38B 5A2MH 2ZU5A 4O9VA 2A4RA 2ZGJA 3T2NA 4ISNA 1YM0A 2IOTA 4ZHAA 1V2KT 5GXPA 3MO6A 1GMHF 4CH2B 2GCTB 3VG8A 3E3TA 3ZZ3A 4FUIA 4BAOB 1GPZA 1EZUC 1FLEE 1SLUB 4X1NU 1PQ7A 3HGNA 5EQSA 1A7SA 1O31A 4H4FA 1J8AA 1C4U2 4UD9H 2ANYA 2GTBA 1KXCA 2L6OA 3RXMA 2GV6A 1IQKA 1MQ5A 1J17T 1MTUA 1AKSA 1GI5A 2BD5A 2P8OB 2OXSA 3M35A 4INLA 4DT7B 2GMTB 3TIUA 1TE0A 1BTHH 1O2VA 2GDEH 3AAVA 2ZQ1A 1TMTH 4YOIA 2ZFQH 1E1RD 2ZTXA 1UTPA 3DSPA 3DSGA 1AUJA 1P02A 2VB0A 3KHVA 1W14U 3LGIA 4TT3D 1ZMJA 4A6LA 1BTUA 4K1TA 2ZZUH 1C5WB 5DKMA 2H9HA 1F2SE 1L1JA 2BXUH 4TSFD 4TWYA 4JZIA 4ABIA 4MQAA 1CHOG 3OEHD 5HM2A 1A61H 1PQ5A 2VNTA 1KSNA 1KLTA 2VWLA 2VJ1A 4WH6A 3SUFA 1LCYA 4I8KA 3FANA 3FFGA 3GOVB 1IQGA 1C2DA 1N6YA 1GL1A 1YPHE 1QCPA 4DCDA 2PTCE 1XKAC 2XYAA 2VGCB 3F0OA 4FXGH 4MDSA 1V2MT 1EX3A 1QBNA 1Y5AT 2ZPQA 3PV4A 1C2GA 1OSSA 3NXPA 1SQRA 2BD8A 2AYWA 1Y8TA 3GDVA 4GAWA 1NU7B 1GJBB 3OAAD 4NA8A 2ZDAH 4QT8C 2O8MA 2BY8X 3NPSA 1C2FA 3UAIC 3HK6B 3D65E 8KME2 3GY3A 4IBLH 3LGUA 5IYTA 1GI4A 1H8IH 1QBOA 1TOMH 1C5PA 3M37A 2XCFA 4D7GA 1QQUA 1SLVB 4Y76A 2IJD1 2EA3A 1PPZA 3RC6A 1JWTA 2QC2A 3QZQA 1VCWA 1SI5H 1HCGA 3L33A 5E0HA 4AFQA 4DURA 2F91A 1O2NA 1O0DH 5JBAS 3QGJA 3ZZ4A 4DW2U 3RXFA 2XC5A 3PO1C 1O5AB 1GCDA 2XBYA 2WPMS 2ZTYA 1W2KH 1UCYH 1C5XB 1WYKA 2A1DB 1CHGA 1AY6H 1FY5A 3M3TA 1P03A 1XKBC 3ATWA 1ANDA 5JPMH 1P06A 4NFEA 1C1RA 1GG6B 1GJAB 1GMCG 4DVAU 2O8TA 1MZDA 3GCTF 3GY6A 1ELTA 5CDFE 2EI7A 2OC0A 3VB3A 1HBTH 3A7XA 1F5LA 1YCPK 3GY4A 4VGCC 3EAJA 1LHGH 4FUCA 2GV7A 3MU8A 2M5TA 3PWBA 5H4IB 2BDCA 1XXDA 1YPGH 4B2AA 1BT7A 2ESTE 1MKXH 5EW1H 3F9FA 1BCUH 5TCAA 4BNRA 2WHXA 2F43B 1MAYA 1UTOA 3UWJH 5CMXH 3TGKE 1C5UA 2ZU2A 3ZVFA 1TBQH 2BLWA 1GBAA 8LPRA 2FMJA 4I8JA 4SGAE 2SGQE 1GDQA 2BMGB 3SHAH 8GCHG 5EG4A 3RXAA 4YM9A 4OS7A 1HJAC 2ZHQH 3PLKA 3P92A 1LPZB 1C1OA 1MKWK 1XXFA 2R2MB 4B6EA 2BY5X 1QRXA 3LGYA 4MLFB 4ZMAH 1NFYA 2AFQB 4NZLA 1RIWC 2K0QA 4NFFA 1L1GA 1HB0B 3SNDA 4B74A 2FO9A 4K69A 3VEQB 3VPKA 1G3CA 2D26C 1AB9C 1KTTB 4JZ1A 3OU0A 3RC4A 4K5ZA 1F0SA 4HGCA 2FTMA 1GBLA 1XUJA 3EA9A 1AFQC 1D3TB 1YY3A 5EXLA 1SB1H 1TYNA 4JMYA 2A2XH 1C5LH 2ALVA 3VGCB 2BY9X 1PQ8A 2STAE 5A8YA 4GHTA 1VR1H 1XUFA 1Y3WA 1GI0A 1SGTA 5T6FA 1ELFA 1DWDH 2ZECA 2F9BH 2XWBI 4BXSA 1Z8RA 1C2JA 2QXJA 1AO5A 2BQWB 6GCHF 3SV8A 1JMOH 1BZXE 1EJNA 3ZVBA 1HNEE 4OS4A 3MU1A 1GBIA 2BLVA 3DA9B 1O2TA 4XD7D 4D76A 4X2YA 1ELCA 1V2UT 2PUQH 1SGQE 1HAYB 3K6YA 1THPB 3QTOH 4B2BA 1O2LA 1BRCE 1HAZB 3UR6A 1DY8A 2HWLB 2FS9A 3SNAA 3A8CA 2F9UA 1UCYE 4ISHH 4X6MA 1QIXB 3C1KA 4OM9A 2EQNA 2RG3A 3SV2H 4FUGA 3B8JA 1BMAA 1O2SA 1A5GH 2G8TA 3M36A 1AVWA 2R2WU 1WBGB 1Y5UT 5C0UA 2AS9A 3LGTA 1H9IE 1NFUA 1OOKB 1UVSH 5JBBS 3DFLA 1S6FA 1NRSH 4NGAH 5EW2H 4GUXA 3O8CA 2HOBA 1N8OC 1W0YH 4MG3A 1W8BH 1PPFE 1PFXC 1W7XH 1VGCB 2PTNA 5FXLA 3E91A 1P04A 2PHBA 5DP6A 5FHTA 2BX3A 5BRRE 5KECA 2BVRH 1K1MA 1C5MD 2P94A 2ZPRA 1TWXB 3MH4A 5EXMA 2EEKA 1QNJA 1WUNH 4CRGA 1C1TA 5GDSH 3RLWH 2SGFE 2KFWA 1Z8GA 4GCHG 1DXWA 2HVYB 3FVFB 4K8BA 1BTWA 1O2OA 2ZFPH 2DE9A 3NCLA 1LMWB 2PUXB 4Y79A 3EDXB 1AFQB 4Q2KA 2GCHG 1AQ7A 1Z7KA 2XTTB 2H9TH 2Z3DA 2QGRA 4TWWA 4IMZA 3SO3A 1SFQB 1DWBH 1SPJA 1TX8A 1K0HA 1M9UA 3D49H 1EOLA 1SLWB 3RXKA 2CN0H 1P01A 1NS3A 3TK6A 2QF3A 3SU2A 3M5MA 4X1RU 3BV9B 3RMLH 4RT1A 3SU0A 3UQVA 4YO9A 3GICB 1FI8A 1VCPA 1TPPA 2F4LA 3ZV9A 1MU8B 1ETSH 3LPRA 5DP9A 1JIRA 3A82A 3VFEA 2WPIS 1A3EH 4F48B 3K2UA 2QY0B 1GBKA 1O5EH 1UO6A 3MNXA 3QN7A 4I8HA 3PYHA 5C17A 1NFWA 1GBCA 1KXDA 1LHFH 4AG2A 1COWD 1KY9A 1BA8B 2JH6D 2WSSD 4Y7BA 5FBEA 1W10U 1EAWA 2D8WA 5DP3A 5ESTE 3RXDA 3ZZ6A 1SGFA 3RXEA 3N99A 1BUIA 3QX5H 1O36A 1KLJH 2ULLA 4CHAB 3BTTE 1UHBB 1VZQH 3LC3A 5C20A 5CHAB 3FAOA 5GPIB 1RTFB 1GHXH 3DCLA 1BJUA 3AASA 5E0GA 2TPIZ 1UTMA 4X2WA 1Z6EA 2BDHA 3K9XB 2YNAA 4NA7A 5AFZH 3ZZ8A 4CRCA 3OTPA 2AEIH 2HPQH 2XBWA 4Y8ZA 1YPLH 1HXFH 2FYRA 1SMFE 1UTNA 1O35A 1GHAF 3P8OA 4AFUA 3GDUA 1WSSH 2Y80A 4CR5A 3QUMP 4O3TA 1O3PB 5A09A 1ZJDA 2FTLE 1QA7A 3EGKH 2Y7ZA 1K1NA 3BTWE 4RN6A 2NU1E 3A89A 1O2RA 1EAIA 3SORA 1C9PA 3I29A 1OHHD 1RD3B 2FI3E 1IQMA 3LH1A 1YPEH 3GCOA 5KGOA 2AMDA 1FPHH 3CNRA 3BF6H 3ZZCA 3ATMA 1SHYA 1T4VH 3Q3XA 1ELAA 4WMFA 4XBDA 5A0BA 1INCA 2FEQH 4B2CA 1SGIB 1V2TT 2D2DA 1C5TA 2F83A 1B0EA 2J97A 6ESTA 4LOYH 2LPRA 1CA0C 1SGCA 4FU8A 4ZXXH 3SJIA 2ZGXH 4MNVA 4AFZA 1GHYH 4UFGH 2ZDKA 2ANWA 4X6OA 3SJKA 1B0FA 3RXUA 1DDJA 3LGWA 2RA0A 1HUTH 1SFIA 2ODYB 5JB9S 3ZVAA 1GI8B 1ETRH 4ZKNU 2XNIA 1LHCH 1EB2A 4RKOB 1K1OA 3URDA 3ITIA 1GHBF 5E8EH 5EOKA 2G4UA 1TABE 1GBDA 3AW1A 2CF9H 3GCHB 1ESTA 1UTLM 2C8XB 4MVNA 4WXIA 5HIYA 1GI3A 1UVTH 1ELEE 3RC5A 1NBME 1BRBE 4X8UH 3QZRA 1QB9A 1AWHB 1EASA 5EXNA 4XDEA 1V2QT 2R3YA 2BHGA 1GMHG 3RXLA 3HATH 2RA3A 3QWCH 1A0LA 3O8DA 3SQEE 4U32A 4ZAEA 3S0NA 3IWMA 3OY5U 2BLOA 3M5NA 1SQOA 5J4QA 2OC8A 1TNGA 3TH4H 2BD9A 1KDQB 1UTQA 2VVUA 1D6RA 2J98B 3SV9A 3OY6U 3RXRA 2P16A 5LPRA 1ID5H 1HIAA 5JBCS 3KCGH 4AC9A 1EFRD 1LPKB 2F9PA 5F53A 2QV1A 1P09A 4LZ1H 2XXLA 4JK5A 4ZKRU 1C1WH 1BMLA 1YPJH 3QO6A 1BHXF 3P8NA 4E7NA 1ANCA 2WPHS 3QTVH 5J4SA 2TGPZ 4BAKB 3RXJA 1SL3A 3VB6A 1KYNA 3U8TH 1O3FA 1WQVH 1YCPM 4AYYB 1QL7A 2PP6A 1IQFA 1P0SH 2G00A 2JKHA 4JYTA 2FOGA 2OUAA 2VH0A 2GT8A 1ZSLA 3T27A 3MO3A 2BZ6H 2AHME 2ZKSA 2OBQA 1H1BA 4J1YA 5ESBA 2HGTH 3BIVH 1G2MA 1T8LA 1O5CB 1C5YB 1E1QD 3RXOA 1S6LA 1A0HB 1JOUB 2FDAA 2A7HA 2AH4X 3TU7H 4UONA 2J95A 4WVPE 4OS6A 2Z9KA 3IG6B 4J2YB 2VIPA 3L6PA 1H9HE 3D23A 4RSPA 4YT6H 1MTWA 2ZHFH 4HZHA 1ZSKA 2JJ1D 2PKSC 3GY2A 2PFEA 1YPHC 1ELVA 1TRNA 4NSYA 3SUGA 1ZYOA 5HM9A 1J16A 3ZVCA 4B75A 1Y5BT 3TK9A 1QB6A 4I31A 3EA8A 3FP7E 1NC6A 2SNVA 1UVOA 1XX9A 1ELGA 4E7RG 2FXRA 1MD7A 3DD2H 3NUMA 4ABAA 3KF2A 5HYOA 5FPTA 3KYGA 4JYUH 3F2GA 1LDTT 5EPYA 4AOQA 3MQKC 1MKXK 2OLGA 1UVUH 3A86A 2FX4A 4UDWH 2IN2A 1ELBA 1FMGA 1P8VC 1GJ8B 5GWZA 1T4UH 1O3HA 3BTDE 7GCHF 1YF4A 1E79D 4JK6A 1HLTH 1KXBA 3RMMH 1C1QA 1QB1A 2Z9IA 1O5GH 1PPCE 1VKYA 2J38A 3M5OA 2B8OH 3P6ZB 5EGMA 3BSQA 1C5OH 3SI3H 1PPEE 4NWLA 1SGYE 2Q1JA 5ABWA 1O2PA 2F9NA 1BBRK 2WPDD 1EATA 2NU2E 3UTUH 3BTME 1A0JA 2W5EA 4NIXA 3SJOA 1P10A 2G55A 4XE4A 3BTQE 1V2RT 2OBOA 1GCTC 1ZTLA 4UEHH 1C4V2 1HAVA 2VVVA 1G36A 1TNHA 3RXHA 2BVSH 1L0ZA 1GJ7B 3A88A 1TALA 1GJDB 1CGJE 3KQEA 4OGXA 3SOSA 2PKAB 4IMQA 2FOEA 2QIQA 2OQ5A 3FOAA 2OK5A 5FBIA 5FPSA 2ILNA 2BY6X 3N7EA 1BIOA 1O39A 1DANH 2G81E 2P3TB 1C5VA 4DJZB 1P11E 1JRSA 1YGCH 3GS9A 3ZVDA 2WINI 1GVLA 2TIOA 4D7FA 1NU9A 1QJ6B 4B1TA 2FOBA 1Q31A 1CE5A 4XFQA 1H9LB 2VH6A 2GZ9A 1MBMA 4WWYA 1S85A 2H1UA 4X8SH 4KTUA 3TNTA 3UIRA 1C2HA 1UK4A 1MTSA 1BITA 2BZAA 2QXGA 3PMAB 3DT0H 4U01A 1ELDE 3R0FA 1EPTB 4Y8YA 1MU6B 1QRZA 1OS8A 1V2ST 3BG4C 1W12U 6CHAB 2BOKA 2CK3D 5A8ZA 2ZGHA 1DFPA 1RGQA 2BXTH 4CRAA 3VB4A 4BANB 3TGJE 1DWEH 4GPGA 4WH8A 4X6PA 3EQ0H 1EB1H 1FZZA 2PSYA 2BDAA 1LPGB 2VIWA 2ZCKP 3LJJA 2FM2A 4A1VA 3TVJB 3LC5A 4FETA 3TH2H 1DOJA 1MZAA 4INHA 1F5KU 1T32A 5B6OA 3M7UA 5DP7A 1YLDA 3KN2A 2ZA5A 4INKA 1Y3VA 1QURH 4ZKOU 2Z9JA 2CMYA 1F5RA 4Q80A 3F9EA 4AB8A 3ATIA 1RS0A 1AE5A 3UREA 1O3MA 3GCNA 3SJ9A 2J4IA 2ZDNA 2D1JA 3P8FA 3R3GB 2AGGX 1ABIH 4TY6A 3S69A 3IITA 1QQ4A 3T29A 2PWXA 1AE8H 1BMMH 2QF4A 2V7QD 3U9AH 1EQ9A 1O2MA 2HNTE 1CT4E 5JDUB 1O2ZA 1QY6A 1GDNA 1WQSA 4D8NA 5FCKA 3Q3KA 1TONA 3M3VA 4E05H 3ZV8A 3ZZAA 1H8HD 2UWPA 2KM0A 1HDTH 1SGRE 2J34A 1ZZZA 1MCVA 4D9RA 2ZP0H 2NU4E 2TRMA 5EJ1A 1ZGIA 2C8ZB 2OQUA 1CHOF 1PYTD 2TGAA 1K1JA 3BIUH 1MTNC 4OS5A 4ZROA 1V2LT 5C5OA 1HFDA 2JIZD 3LH3A 1AWFH 1NRNH 1YYY1 2ZDVH 1B7XB 1T7CA 5DP5A 1WCZA 1J15A 4X2XA 5DSFA 4LZ4B 3MHWU 1MABB 1OWHA 4A1XA 2FIRH 1XMNB 1T8OA 1RXPA 4JZDH 5T6GA 1SOZA 4KTCA 3F3BA 1ZPBA 2V6NA 1TGSZ 4CRDA 3SUDA 1THSH 1SGDE 4K60A 1BTPA 1T31A 4WMEA 3A87A 4MPWA 4E06H 5K0HA 2C8WB 1TBZH 2A7JA 3KQ5A 1C2KA 1FXYA 1T8NA 2WYGA 3PO1B 1EUFA 2P95A 9LPRA 4R8TB 1SGEE 1J14A 2H5DA 1C1MA 3BTFE 1P9SA 2CHAC 2GVFA 2QXHA 3CS7A 3U69H 3GY7A 2SGAA 1C2MA 4BOHA 1K1PA 1MQ6A 1EZSC 2KAIA 2OD3B 5EPNA 1HGTH 3FZDA 3UR9A 2WPLS 2G52A 2QE7D 3RU4T 2EI6A 1CBWC 2UUYA 2Y7XA 1HXEH 2Y6TA 1ZHMA 1ORFA 1GVKB 3ZZ9A 4H6TA 4VGCB 1UW7A 1GMDG 1B5GH 2KX4A 2ZTZA 5G4BA 2R0KA 3SU3A 1TGBA 3ZYEA 1FX0B 3UUZA 3PMHB 4IC6A 3U28C 1G2LA 1TNKA 4ASHA 7LPRA 2O8UA 1OX1A 4UE7H 3A7ZA 3FZZA 3MMGA 2Z94A 3CP7A 4NSVA 1HAGE 3V12A 2A5AA 3GY5A 4X0WU 2HALA 3LKWA 1HJAB 1LVMA 1OP8A 1AVXA 1WTHD 2B9LA 2W6ID 3DUXH 4TYDA 4Q7YA 1SQAA 3TK5A 1G9IE 3SQHE 2J92A 3A84A 5HKKD 4KP0A 1P2QA 1O5DH 2C8YB 1MTVA 1P2NA 2BDIA 2FZZA 1AFEH 1RIWB 4NCYA 2DE8A 2BD3A 5F8TA 3W94A 3OYPA 2WV5A 2Z9GA 2K8IA 3OTJE 1O2IA 2W3KA 4AX9H 1G3BA 2O9QA 4ZHLU 1AB9B 1QJ7B 1W0KD 1GI2A 1Q2WA 4F55A 1A1RA 1O3JA 2WYJA 2JETC 1KIGH 1XUIA 2PR3A 2UUJB 4Y8XA 4OGYA 1QFKH 3SI4H 1EOJA 1LO6A 2STBE 2BQ6B 1WOFA 3E0PB 4LXBH 2UUFB 2PLXA 3PLBA 4X8TH 4IC5A 1AVGH 4BTUB 1W0JD 1DUAA 1ZMNA 2O8LA 5GNDA 1FDPA 1CA8B 1GJCB 1K21H 2RDEA 3VXFH 1YP9A 1HJ9A 1OPHB 1ZHRA 2QA9E 2SNWA 1F0RA 4I8GA 4NA9H 2I6QA 2V3MA 2G5NA 3MI4A 2LP6A 6LPRA 1G3EA 1MD8A 2A7CA 2ZFTA 3ENSB 3TLOA 4LK4A 3SHCH 2A5IA 4ABEA 7ESTE 1H8DH 2H5CA
chains in the Genus database with same CATH topology
1OWJA 1TX7A 1VCQA 2P59A 3F68H 2UWLA 5GCHF 3QGNB 2W26A 1ZGVA 1OWIA 3M7TA 1GGDC 1AKSB 1DUEA 2VIQA 4ABHA 3UNRA 3VB7A 4AN7A 1OXGA 1V2WT 4Y11E 5TCCA 5GJ4B 1NY22 3RMOH 4ABJA 1PQAA 1EZXC 3BEIB 1O2XA 1O3NA 3UPEA 1PPHE 3CENA 1LVOA 2ANMH 3WY8A 2ASUB 1N8OB 3UOUA 1QL8A 2V3OH 3QDZB 4DG4A 5BPEA 5C2ZA 2ZGCA 3JZ2B 4AG1A 4JZEH 1FAKH 1FJSA 5SGAE 1MCTA 1AMHA 1L1NA 3HKIB 1F7ZA 3SGAE 3RXBA 3V7TA 1FPCH 4Y0YE 4Q7XA 4HI3A 3UNQA 4FU9A 1ARCA 2ODPA 1EZQA 2OC1A 1LHDH 3KL6A 1VITH 2C4FH 3RXCA 4BAMB 2ZDLA 1NPMA 4X8VH 4Y71A 1ZJKA 1V2NT 3L3TA 4ABDA 1IQIA 1O30A 3TITA 1GI6A 1GWAA 3P95A 1BHXB 3SU1A 4ZKSU 4NWKA 3KQBA 4MPXA 3GDSA 3RXGA 3VB5A 3QK1A 3A80A 3V13A 1DSTA 1IAUA 3T62A 1N1LA 2VU8E 4X2VA 4MNWA 2W7UA 2GCHF 1SGPE 1GDUA 1AZZA 1NRPH 1A4WH 3T26A 4D9QA 1ABJH 2AGEX 5DP4A 1HPGA 3JZ1B 1ETTH 1V3XA 4NZQA 2P3FH 3RMNH 1YLCA 3MU0A 1LQEA 4FU7A 1Y3XA 1FUJA 4DIIH 5PTPA 4I8LA 1Z71A 2F9OA 5C1UA 3NKKA 1O3LA 4YT7H 1NN6A 3UOPA 2VWMA 1J9CH 4IN2A 1UJ1A 1MBQA 3BTHE 1C2LA 2XRCA 1V2OT 1NZQH 1P2OA 5C67A 3G01A 4Q7ZA 4HFPB 1WU1A 5DG6A 1PJPA 1O3IA 2WPJS 3F9GA 2A4OA 1YBWA 4AFSA 7GCHG 3RU4E 1HAOH 1S84A 5FX5A 4KELA 2GP9B 1CT0E 1RTKA 2TGDA 3K65B 1TOCB 2BX4A 3DFJA 1HAHH 3PMJA 1GJ5H 1XUGA 2JH5D 3CS0A 1AGJA 2GCTC 3H7OA 1FIWA 4OS1A 2B7DH 4BAQB 3E16B 3A85A 2CV3A 4DY7B 1ZMLA 2H2ZA 3STJA 5JB8S 1P2KA 4CRBA 5L6NH 4ISIH 1RRKA 4H6SB 4O03A 1IHTH 1D3QB 1E37B 2QXIA 1EAUA 1GVZA 1EJMA 4FUHA 2OC7A 2QCYA 1GBHA 1FY3A 2ZEBA 3F9HA 1AU8A 4YZUA 4BTIB 2P8OC 2GMTC 1ANEA 3Q77A 1SG8B 1ACBE 3LIWA 3KQDA 4TPYA 3TH3H 3A8AA 4TY7A 3TJNA 1AI8H 5DK1A 4FVBA 4YLQH 1XVMA 1TPOA 2BDYA 1P12E 5K7RA 2H9EH 4U2WA 4ZH8A 1CA0B 1CSOE 1JIMA 2JH0D 1IOEA 5EODA 1GL0E 1CGIE 2A4QA 2H6MA 4X1SU 4SGBE 3RDZA 1UCYK 2SFAA 3GYLB 3RM0H 1CVWH 1Z6JH 3Q3YA 1TMBH 4AGJA 1Z1IA 4A1TA 3URCA 3RXIA 1P2JA 4YESB 3ZZDA 3SNBA 5L2YH 1QR3E 2VGCC 4OS2A 4CBNA 1NRQH 1JRTA 5C5NA 1SHHB 1Y3YA 5A0CA 2B5TB 2KAIB 1EJAA 3FP8E 1DITH 1LQDB 2OTVA 2J9NA 2ODQA 1DXPA 3UFAA 4FUBA 1O5FH 4Y10E 3RUOA 1ZRKA 3EYDA 1V2JT 1XUKA 5HXFA 1G32B 2BD2A 1F0TA 1SR5C 1BRUP 3KGPA 3RXPA 4JCNA 1BJVA 1DPOA 1G30B 3QLPH 2ZFFH 3ODDA 1QRWA 4XBCA 2XW9A 3BEFB 2LNCA 3AVZA 2AMQA 1FAXA 4UFDH 1SOTA 1UMAH 3SNCA 5TJXA 3SV7A 1GBJA 2Q6GA 1GHZA 5LPEA 2BTCE 4CBOA 5DPAA 3UQOA 1QA0A 2THFB 4JZFH 2Z3CA 1W11U 3GCTG 3TJUA 2QF0A 1FY4A 2F3CE 4WXVA 5AFYH 5CE1A 3RLYH 2PW8H 3SBKA 3A8BA 4PROA 3LJOA 3P8GA 3OSYA 3TNSA 2FX6A 1A3BH 3A7TA 3T25A 2OINA 3Q76A 1UHBA 2PGQB 1GG6C 4CRFA 4CH8B 1OYTH 4CREA 1PPGE 3PROA 3V0XA 1C5ZB 4FUDA 1DLKB 1K28D 1ZLRA 1O2JA 2P93A 2BVXH 2FOHA 1OWDA 3MNBA 2FESH 5AHGH 1GHVH 3E1XB 1FV9A 1UK2A 1VITF 1P3CA 1WV7H 3KNXA 4BAHB 2NU3E 1U6QA 1V2PT 3BTKE 4A5TS 1NFXA 1C5SA 2HNTC 1JXPA 3S9CA 2A45B 3ZZ7A 3STIA 2EI8A 4YTAA 3ZVEA 2ZHDA 2C3SA 5LGOA 2PKSB 2A0QB 5FAHA 3SU4A 2GZ8A 2YNBA 4BXWA 2R3UA 2VWOA 3I78A 1TNIA 1O2YA 3E0NB 1HAIH 1TGNA 1MMJN 2R9PA 1IQLA 4R0IA 1SBWA 3ELAH 3HGPA 1LKAA 1LVYA 1MUEB 1W0ZU 1SGFG 1GI7B 1AZ8A 1C2EA 4XOJA 1C5QA 2XBVA 2ZFSA 1SC8U 3DHKH 4NG9H 1TB6H 1W7GH 1DM4B 1EAXA 2BD7A 3BN9A 3MNSA 4ABGA 1KXAA 3BEUA 3GISB 1Y59T 1BRAA 2F9VA 3MU5A 2A31A 4A92A 3MYWA 5L30H 1TBRH 6GCHG 1SVPA 4WY3A 3VGCC 1N6XA 2BQ7B 1L2EA 2GT7A 2AMPA 3TGIE 1O2GH 2XCNA 4MPVA 5DJ7A 3RXVA 1OP2A 1P57B 3F1SB 1GCTB 4FVDA 4HTCH 1TGTA 2ZFRH 1E36B 1C4Y2 3SW2B 1D3DB 2BLQA 4UFFH 3MOCA 4MPUA 1F0UA 1TIOA 4B76A 1TFXA 2TGTA 3LU9B 2FOCA 1TGCA 2FOFA 2ZCHP 1GJ6A 2CXVA 1MAXA 2RDLA 1OWEA 1QJ1B 3SGBE 1XVOA 1BOQA 1ESBA 1Q3XA 3ZYDA 5C3NA 5T6DA 1G37A 7KMEH 2UUKB 3BTGE 1Y3UA 5F8ZA 2IPHA 4IW4E 5ETXA 2FODA 1SQTA 1Z8IB 1O34A 1P9UA 1TRYA 1XM1A 1ZTJA 1HJ8A 1GBTA 9ESTA 3SGQE 1TLDA 1KDQA 1NESE 2Y5HA 5DP8A 3HK3B 5EU8A 2FOMB 2UWOA 1DT2A 3MNCA 4X1PU 1IHSH 3ESTA 3E90B 1OYQA 3SJ8A 1VGCC 2J2UA 2ZQ2A 5E0JA 2ZGBH 3TJOA 1WTGH 3E6PH 2ZG0H 3SU5A 1BBRH 3U1JB 2WV4A 3BG4B 2Z3EA 2FP7B 1E35B 2FS8A 2ZHWH 2Y5FA 1TPAE 1A5HA 3T5FH 5EQQA 2ZU4A 4ZXYH 1O32A 2C93B 2O8WA 1MH0A 1EXFA 4FUFA 2I6SA 1O3EA 5I46H 5EQRA 1O2HA 5T3HA 1TNJA 2A5KA 3PWCA 1ZTKA 4AZ2B 4F4OC 2A4GA 3ATKA 1CO7E 4F49A 1DS2E 1C1NA 1CT2E 3PB1E 3AAUA 4CR9A 1TRMA 2K1QA 4ABBA 1RFNA 4I32A 1S0RA 1P2MA 4XBBA 4DIHH 2DUCA 4I7YH 1G3DA 2WPKS 1E34B 1A5IA 4O3UA 2Z6BD 1NM6A 1IQJA 2NWNA 4YOGA 5GCHG 1CQQA 2C90B 3MH5A 4GVUA 1IQNA 1HAPH 2ZIQH 1C1PA 2XBXA 2QAAA 2ZU1A 1ZSJA 1GMCF 1HIAB 1W3CA 4MNYA 3GYMA 2FI5E 4AYVB 3A7YA 4YLUA 2HPPH 2HNTF 1V6DA 3RM2H 1AHTH 1LKBA 1LHEH 2CGAA 5DO4H 3SZNA 1BTXA 1OWKA 1FY8E 1ARBA 1L4DA 2J94A 4WMDA 4CHAC 1BTZA 2CJIA 1KLIH 2G51A 2HRVA 1K2I1 1GJ4H 2QYIA 1ESAA 5CHAC 1MTNB 4NIYA 8GCHF 1FNIA 3TJVA 4IS5A 1C1SA 5HGGA 1GBBA 1GHAG 4ZUHA 5F8XA 5A8XA 3A81A 4B73A 3H5CB 3SNEA 2XC4A 3MWIU 1YPKH 1EP6A 1DWCH 1S82A 1F92A 1TMUH 5AF9H 3S7HB 3ODFA 2ZO3H 3HKJB 4MNXA 1LTOA 2QN5T 5FPYA 1YCPH 3M7QA 5E2PA 4NIVA 2Y82A 3Q00A 1GI1A 2PKAA 1TA6A 4TPIZ 1JBUH 1DX5M 1CU1A 1BBRE 2FPZA 1DVAH 2GGVB 3T28A 8ESTE 1O37A 2Q6FA 2ZNKH 5F03A 2WUCA 3LOXA 2P3UB 2VVCA 4NIWA 2BDBA 2CHAB 1SGNE 2GZ7A 2Z9LA 2ZCLP 4UFEH 4K3JA 3SN8A 4KKDA 1MKWH 1ZR0A 1CBWB 5F6MA 3PM3A 1H4WA 4I33A 1D4PB 1EPTA 1UK3A 5E2OA 4AB9A 2AIPA 1YKTA 1GHBG 3P17H 2RCEA 3ZVGA 1QTFA 1BB0B 5FX6A 3B9FH 4B71A 3OX7U 1FQ3A 1AIXH 3V3MA 4GLYA 3S9BA 2CF8H 1LVBA 2FOAA 1C5NH 1C1VH 1XUHA 1GMDF 3BTEE 1GHWH 1HAVB 4Y7AA 5C1XA 1WAYB 3GCHC 2GDDA 1FY1A 1ZHPA 3RP2A 1BQYA 1DE7H 3ATLA 2ZWLH 2FLRH 1L4ZA 4ESTE 1GBMA 2ALPA 1TQ0B 1QGFA 3FP6E 5HMAA 3M5LA 1QHRB 3AW0A 2ZF0H 2SGPE 4Z0KA 3S7KB 2BYAX 3RXSA 1P2IA 2PSXA 1P05A 3PTNA 2AIQA 4YOJA 1K9OE 2BB4A 2BY7X 2FYQA 1C2IA 2ZU3A 1O3KA 3UWIA 2GX4A 2JETB 1D3PB 1GI9B 2Y81A 4GCHF 1Z1JA 1K22H 2A32A 1AN1E 3PMBB 1GBFA 3RXQA 1EP5A 4H42U 2VWNA 1OP0A 5LH8A 1IQEA 1O2WA 4BTTB 1BTYA 2ZHEH 1S6HA 4Y6DA 3O8BA 1S83A 2AERH 1O3OA 3D62A 4K8YA 1ZPCA 3H7TA 4JYVH 3MTYA 5JBTA 4WF8A 1EKBB 3N7OA 4DOQA 3P70B 3S9AA 3MH6A 1VJ9U 2Z7FE 1CGHA 1DICA 1GBEA 1X7AC 2A2QH 3M3SA 3U8OH 1O38A 1NROH 1O3GA 3NZIA 2W3IA 5DGJA 2W7SA 1W13U 1HV7A 2WUBA 3EA7A 3SV6A 2V3HH 4KGAA 3PLPA 4MTBA 3UY9A 1HAXB 4KTSA 2FLBH 3LT3A 4Z6AH 2SGEE 3M61U 2VINA 5I25A 3KIDU 1VJAU 1RJXB 1O2QA 1GGDB 5FCRA 1FIZA 4GHQA 3ZZ5A 1T8MA 3MFJA 2G5VA 1O3DA 4O97A 1QL9A 1NT1A 1TNLA 1TPSA 1O2KA 3NWUA 1ANBA 3C27B 1TA2A 5IDKA 3U8RH 1TAWA 3LGVA 3VXEH 1TX6A 1V2VT 1C9TA 1S81A 4ZHMU 2BD4A 2ZDMA 3ZZBA 1HYLA 2GD4B 1O3BA 4IN1A 3KQCA 1UTKA 1P3EA 5AVDA 3F6UH 1QBVH 1BDAA 3EE0B 2PV9B 1YC0A 1AUTC 2ANKH 1HRTH 1YPMH 4Y0ZE 1SLXB 1KXEA 1NRRH 1D6WA 3RXTA 4ABFA 1KXFA 1Z8JB 4K1SA 2BM2A 3GY8A 3SUEA 1O33A 5C1YA 1FN8A 5A0AE 2VIDA 4GSOA 5L2ZH 4K2YA 3TPIZ 3KEEA 1E0FD 4DGJA 3MH7A 4A7IB 3W95A 2SGDE 1SSXA 1ZOMA 3I77A 2VIOA 4U30A 4THNH 2OCVB 4X6NA 3A83A 5GIBA 4AGKA 1A46H 3MU4A 3E8LA 3LDXH 2TBSA 2BOHB 2GKVE 2V0BA 1O2UA 1THRH 3K6ZA 1FN6A 1O3CA 1GJ9B 2VIVA 3B23B 4XSKU 2IJOB 1BMNH 2B0FA 1VITG 1O5BB 3MO9A 5LPFA 1ZRBA 1OKXA 2OP9A 4ISOA 4IGDA 1IQHA 1UTJA 2Q6DA 3LONA 3BG8A 2YOLA 2R0LA 2HLCA 1K1IA 3A8DA 1KTSB 1O3AA 3PTBA 4RKJB 2NU0E 3A7VA 1PPBH 3U98H 1AD8H 3HPTB 2XWAA 2FWWA 4ISLA 4K1EA 1DY9A 2ZC9H 5JYIA 3U1IB 4AORA 3NK8A 2BDGA 2XC0A 1C1UH 1S5SA 2HVXA 4WJG2 2ZPSA 2AGIX 3A7WA 1DSUA 1FONA 4FUJA 1S0QA 2ZI2H 2FI4E 1RTLA 1NO9H 1TQ7B 4M7GA 1UVPA 1ZPZA 2Y5GA 1D9IA 4FUEA 2V35A 3RU4D 1DLEA 1EPTC 2EC9H 3UNSA 1A2CH 3SU6A 3O8RA 1PYTC 2G4TA 4X1QU 1K1LA 6CHAC 1NTPA 2PGBB 1C5RA 1E38B 5A2MH 2ZU5A 4O9VA 2A4RA 2ZGJA 3T2NA 4ISNA 1YM0A 2IOTA 4ZHAA 1V2KT 5GXPA 3MO6A 1GMHF 4CH2B 2GCTB 3E3TA 3ZZ3A 4FUIA 4BAOB 1GPZA 1EZUC 1FLEE 1SLUB 4X1NU 1PQ7A 3HGNA 5EQSA 1A7SA 1O31A 4H4FA 1J8AA 1C4U2 4UD9H 2ANYA 2GTBA 1KXCA 3RXMA 2GV6A 1IQKA 1MQ5A 1J17T 1MTUA 1AKSA 1GI5A 2BD5A 2P8OB 2OXSA 3M35A 4INLA 4DT7B 2GMTB 3TIUA 1TE0A 1BTHH 1O2VA 2GDEH 3AAVA 2ZQ1A 1TMTH 4YOIA 2ZFQH 2ZTXA 1UTPA 3LGIA 1AUJA 1P02A 2VB0A 3KHVA 1W14U 1ZMJA 4A6LA 1BTUA 4K1TA 2ZZUH 1C5WB 5DKMA 2H9HA 1F2SE 1L1JA 2BXUH 4TWYA 4JZIA 4ABIA 4MQAA 1CHOG 5HM2A 1A61H 1PQ5A 2VNTA 1KSNA 1KLTA 2VWLA 2VJ1A 4WH6A 3SUFA 1LCYA 4I8KA 3FANA 3FFGA 3GOVB 1IQGA 1C2DA 1N6YA 1GL1A 1YPHE 1QCPA 4DCDA 2PTCE 1XKAC