2ZECA

Potent, nonpeptide inhibitors of human mast cell tryptase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
242
structure length
242
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase beta 2
publication title Potent, nonpeptide inhibitors of human mast cell tryptase. Synthesis and biological evaluation of novel spirocyclic piperidine amide derivatives
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 53
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2007-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zecA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zecA01
1DWDH 5C3NA 1GHBF 3QZQA 1NU7B 1T7CA 1O5CB 2HRVA 2GDDA 5TJXA 1EB2A 3MU5A 4B2CA 3SV7A 2F9BH 1GBMA 3LH1A 3MNCA 4YOGA 1KXCA 2P16A 1O2IA 3VXEH 2I6SA 3RC4A 4DY7B 1BHXF 1OP0A 1ACBE 1H9LB 4K8BA 3SV2H 3E90B 2QYIA 1WAYB 1AE8H 1RIWB 4OGXA 3T25A 1MU8B 3QLPH 3E91A 1N6XA 4B2BA 1Z6JH 2PR3A 2TRMA 3DT0H 1TGSZ 3LGVA 3CP7A 4QT8C 5HXFA 3T29A 2CXVA 2O8LA 3HKJB 4O3TA 2PTCE 1H9IE 1XVOA 2QF3A 4XOJA 2Z9JA 5A8ZA 2B0FA 3RXIA 3TGIE 2SGAA 1K1JA 2G51A 5GXPA 1UCYE 2OINA 1IAUA 4WF8A 3A84A 4AN7A 4CRCA 3OSYA 1SPJA 2P3TB 1RTFB 1WU1A 1PFXC 3UFAA 2IOTA 1TRYA 1ANEA 2OLGA 3ZVFA 3BTHE 1V2JT 2ZFFH 1C5XB 1UVTH 3ELAH 2UUYA 1DWCH 2H1UA 3S7KB 1GBIA 1V2LT 1AKSA 3RXEA 1DLKB 1KTTB 3QGNB 3ZZAA 1O2HA 1P02A 3SI4H 4SGBE 1QRXA 4Y7BA 4RKJB 3QWCH 4I32A 1YM0A 1TWXB 1S82A 2AFQB 2ZGBH 4K8YA 1BQYA 4NFEA 2VIOA 1NZQH 1MTUA 2FI4E 1QL9A 2FDAA 4RSPA 2XBVA 1VZQH 1ZJDA 1O5FH 3V0XA 1WOFA 1ANCA 7LPRA 1OS8A 1GL0E 1O3FA 3NPSA 5E0GA 4BNRA 1CGJE 1LCYA 3BEUA 1A3EH 3DUXH 1LVOA 5CHAB 4AOQA 3Q76A 3BTFE 3IG6B 4O03A 3RLYH 4MTBA 1RFNA 3Q00A 3BEFB 1C2EA 3PM3A 2FLBH 1AWHB 3MO3A 4OS4A 5E8EH 3L33A 1QJ7B 2W7SA 2Y82A 3VXFH 4A1VA 1UTKA 3A89A 3QDZB 2GZ9A 1O2YA 1SLVB 1O2NA 5GDSH 5TCAA 5EU8A 4BXWA 2Z9GA 3GDVA 1C4U2 1W7XH 1C1OA 5C1YA 2ZDKA 4YOJA 1SFIA 2PWXA 2ZG0H 3E0NB 1TYNA 2FYRA 3M3VA 5A8YA 3U9AH 3P8GA 3STIA 1BA8B 5GJ4B 2VWMA 1O3NA 1O3AA 3OYPA 1HAXB 1XXDA 3ESTA 2IN2A 1OYQA 2R2WU 1HAGE 2ZDAH 1ZMJA 2BZAA 5FPSA 4TWWA 3UWIA 5I46H 2G52A 1CHGA 4YM9A 5DKMA 1TGCA 1HXEH 1LMWB 1FLEE 1UTJA 2CF8H 3A7TA 1Z6EA 2WPIS 1HCGA 1GJAB 2HPPH 1GL1A 4Y76A 1YPGH 3F9EA 5FAHA 4NIWA 1T4VH 1YP9A 5JBTA 2XXLA 3PWCA 4OS2A 3A80A 4B75A 1IHSH 1AMHA 1V2MT 4YTAA 3HATH 1O38A 3F6UH 2JH5D 4JK5A 1QB9A 3EQ0H 3E0PB 4JK6A 1W10U 1HB0B 1RS0A 4H42U 4D8NA 1O3EA 4WMFA 3ZZ3A 5DK1A 2F9UA 1NPMA 1A0JA 5EOKA 1MD7A 4BAQB 5FCRA 1EQ9A 1IQMA 1DVAH 1GWAA 5JBCS 3HK6B 3JZ1B 1GI9B 1GJ8B 5LPRA 2G5VA 1WCZA 1C5TA 1NC6A 3A8AA 1TAWA 1HNEE 5FBEA 3AW0A 4I8KA 5CE1A 1ESAA 1PQ5A 1YLCA 1BMMH 1NFXA 2J9NA 1GHAG 2BTCE 3SQEE 2G5NA 3PROA 1CT0E 4TY7A 1MD8A 3MFJA 2D26C 1UCYH 2BXTH 4LXBH 3TH4H 1B5GH 3T28A 3TPIZ 1V2QT 4XSKU 3ODDA 3VFEA 1O3GA 2Y5HA 1TIOA 1C5SA 4AG2A 3V12A 1V2NT 4KTSA 4GCHF 1GJBB 1K28D 2PSXA 4ZXXH 2OUAA 2FI5E 1S6HA 1F5RA 2DUCA 1LPKB 1GDQA 2SNVA 4OS7A 2FOCA 1Q2WA 3RC5A 1XM1A 3RU4T 4O97A 1YKTA 1DFPA 3EA8A 1XMNB 1BRBE 1MH0A 1SGQE 3UY9A 1JRTA 3ZYEA 5JYIA 2FTLE 2J92A 3U1IB 3UUZA 1DLEA 1PPCE 4ABAA 3PMBB 1AU8A 3SV9A 3SU1A 4JYUH 1S81A 2QF0A 1UHBB 4X2XA 3S0NA 2OC8A 1O5EH 3RXBA 4YOIA 5JPMH 1XUJA 2PLXA 3KEEA 4K1TA 4THNH 3SJ9A 4DVAU 1NFWA 5LPFA 3M5OA 1NRSH 3SU0A 4OGYA 4NIXA 5TCCA 1RJXB 4O9VA 2BOKA 1GMHG 3MHWU 4TYDA 4B1TA 1HFDA 3GY3A 4JZEH 1MMJN 1AVGH 4X1NU 4FUDA 4ABGA 1W3CA 3LKWA 3D65E 3PO1C 2R0LA 3M61U 2CGAA 1YPKH 4K3JA 1HJ8A 4H6SB 2CMYA 5EQRA 2J38A 2P59A 1KYNA 3QTVH 1V2OT 4IC5A 1GBKA 2XBWA 4INKA 4WH6A 1SGTA 3E6PH 4HZHA 2AH4X 3MH5A 1NN6A 4AFZA 3UR9A 1K1LA 1KXFA 2VWNA 1CBWB 1W0ZU 2ZFSA 3PTNA 3Q3YA 5EXNA 1LHFH 3ENSB 4WXIA 1O5DH 1C5VA 1FY1A 1TLDA 4Y6DA 3SV6A 1MKXK 1C2KA 4X8VH 3TJUA 1CSOE 3KN2A 2ASUB 2FO9A 2ALPA 1O35A 2ANWA 3UREA 1ZTKA 2SGPE 3UOPA 2Y5GA 3M35A 1HJAC 4Z0KA 2BZ6H 1T31A 1SOTA 1NROH 2C8WB 2STBE 1QTFA 4ZKNU 1AVXA 1SHHB 3RUOA 3A83A 2BDCA 3QN7A 4AGKA 1GDNA 1GI2A 4CRAA 2BQ7B 1HAOH 1P11E 3SNAA 1TNJA 1LQDB 1LVMA 3GICB 3RXGA 4ESTE 3A81A 2OBQA 2GZ8A 4Y0YE 1IQKA 3AW1A 2GZ7A 4I8HA 1V2KT 2Y7XA 4UFDH 2WINI 4A1XA 4KELA 4AB8A 1AN1E 1UK4A 1MTWA 4E06H 1QB6A 1QBOA 1GVLA 1CU1A 5CMXH 1L4DA 1ZHMA 1GJ5H 1LKBA 3PB1E 3U8OH 2BLWA 2ODYB 1EPTA 1A46H 3RXPA 1TPPA 1KXBA 4X1SU 3PO1B 5EXMA 1AVWA 1CGHA 4KKDA 3Q3KA 3OX7U 1UTNA 1C1SA 3NCLA 3R3GB 4U01A 3SJKA 4Q80A 1AZZA 2R3YA 4GUXA 2TIOA 5EGMA 3E3TA 5FBIA 3MI4A 4ISLA 1C5UA 2OBOA 1OXGA 2VINA 2C4FH 4MLFB 4B2AA 4WVPE 1YGCH 4BAMB 2ODPA 3IITA 3M3TA 4NIYA 5IYTA 4ZROA 1BRUP 4PROA 3P8FA 3SNEA 3DA9B 1BTXA 2AMQA 3QK1A 1P2QA 3NUMA 4GLYA 3W94A 3A8CA 1Q3XA 1G36A 1C9PA 2SFAA 3E8LA 1ABIH 2R2MB 2EA3A 3M5LA 4BOHA 2Z3EA 1UHBA 1UTMA 2ZGXH 3MNSA 4Q7XA 1ELDE 4WH8A 2WPHS 3PMAB 3DFJA 4UFEH 3P8OA 4JMYA 1GMDG 1C2HA 1O2UA 2NU1E 2WUCA 2PHBA 2QXGA 5LH8A 3TGKE 4HFPB 3Q3XA 1O2RA 1CA0C 3OTJE 4DOQA 1MQ5A 3K6YA 4UFFH 4Y79A 2PGQB 1SHYA 3O8RA 1MCVA 1AFQC 2F91A 3D62A 1BIOA 1GBTA 1TALA 2RCEA 3PYHA 2GV7A 1O3JA 2YOLA 3RXVA 1BB0B 1OP8A 2HPQH 4IBLH 4AYYB 1QRWA 1GGDC 2NWNA 1P04A 1O2JA 5JBBS 1AO5A 1NRPH 1VJAU 1KY9A 3LGTA 2FPZA 1IQFA 1MAYA 1HXFH 3SU3A 4GVUA 4I8LA 1G3EA 2XWAA 2QXJA 1CE5A 3KQCA 2J4IA 1O5BB 2BLQA 2GMTC 1TPAE 5FX6A 4HI3A 5FX5A 1O3BA 2FX4A 2FS9A 1HAYB 1TNLA 1NESE 1FIWA 1T8NA 1GJ4H 3A7XA 3FP8E 3HGPA 1HLTH 4GAWA 2CN0H 1DPOA 4NSYA 1TNHA 1A2CH 2GV6A 3G01A 2V3OH 1UK3A 1K1MA 1J9CH 1A4WH 1DX5M 2WPLS 3A88A 3SW2B 4AFSA 4BTIB 2OQUA 1O30A 1TMTH 5F8TA 1EJNA 1K1IA 1YLDA 4I33A 2BDAA 1O3DA 1BDAA 4ZHLU 1SB1H 3SHCH 4DGJA 3BN9A 5C5NA 7GCHF 1GHBG 1HRTH 1Y59T 2H9EH 1HBTH 2V3HH 4Y8YA 1J17T 3RXRA 2EI8A 4YLUA 2VWLA 1EOLA 3PLBA 2ZECA 2KAIA 3GCTG 5ESBA 5L2YH 2SNWA 1CA0B 1P10A 3PV4A 2ZTZA 1AFQB 4ZMAH 1AGJA 4B74A 1BHXB 1O2VA 4FUIA 2BVRH 3KQEA 7KMEH 1N6YA 3N7OA 1PJPA 4FVDA 2QY0B 1FV9A 2OXSA 1C2FA 1ZSJA 4HTCH 1VJ9U 2QA9E 4JZFH 1BTZA 1TBZH 1HJ9A 2A0QB 1YC0A 1SGFG 2ZTYA 5E0JA 1KLIH 1E0FD 2AEIH 1TX7A 1UJ1A 5DG6A 1GVZA 1ZJKA 4MQAA 2F9VA 3GCTF 5FPTA 3CENA 2GMTB 4R0IA 4NZQA 3RXLA 3RM2H 2XC5A 2VH6A 5B6OA 2ZEBA 1O2TA 4AX9H 3MH6A 4JCNA 1TBQH 1THSH 2ZP0H 2BYAX 1OWHA 2FOBA 1ELTA 1TMUH 2HWLB 2PGBB 1MBMA 1TBRH 1F0RA 2ZA5A 4OS1A 3TNTA 2XC4A 2ZO3H 1P8VC 1Z8JB 2PV9B 5I25A 1GBHA 1MKWK 2XNIA 2UWPA 1GHXH 1H8IH 2BDIA 2BD8A 1O2QA 1W13U 2AGGX 1C1NA 1TGNA 2Z6BD 1O3KA 4Y10E 1FDPA 1V2PT 1WV7H 1UVSH 1VR1H 5F8XA 3E1XB 3RXFA 1S0QA 2A7HA 2THFB 2Y5FA 2YNAA 2NU2E 1E35B 1Y3UA 3I78A 1EAWA 1O3MA 2Q6DA 3ZZ7A 2AERH 1O36A 1EJMA 3DHKH 3RXAA 5EXLA 3TK6A 2ZKSA 1MTVA 5EQSA 3K65B 2F9PA 2ZHEH 2EEKA 1WUNH 3FP6E 3F1SB 3KNXA 1GBAA 5LGOA 1Z8RA 3KGPA 4IN1A 1FZZA 3LC3A 3A7YA 3GY4A 4MNXA 1HYLA 1UTOA 8GCHF 1SGEE 2GCTC 2ZHFH 4K69A 1S0RA 2TGDA 1BTWA 3QX5H 3AVZA 2FOFA 4NSVA 4ZHMU 1WTHD 3BV9B 2H5DA 2BD5A 1CHOF 1D3DB 4AYVB 3PTBA 1UTPA 3NWUA 1PPEE 2SGDE 1T4UH 4NGAH 4ISIH 1P2IA 1C5RA 1GHZA 1M9UA 1OWDA 1GJDB 2P3UB 1GBBA 1P01A 2BDGA 3AASA 5HMAA 5T6GA 1C5QA 4WY3A 2J95A 3UPEA 4BAOB 1SFQB 1EOJA 1PYTC 4VGCC 1YPMH 2K1QA 2NU3E 2J34A 1P3CA 4X0WU 3TIUA 2BY7X 1LKAA 1OSSA 2D8WA 1FY5A 1ZPZA 4UONA 1GJ6A 3SUEA 2V0BA 1BMNH 3U8TH 1MAXA 3PLPA 1XVMA 2STAE 3TH3H 2B5TB 2H6MA 1O2OA 1IQNA 1A0HB 3O8CA 3S9CA 3C1KA 2BD9A 4ZAEA 3BTEE 3Q77A 4NA9H 1DANH 1D3PB 5C1XA 3U1JB 3V3MA 3OY6U 2FTMA 1Z1IA 4FUCA 2SGEE 1GI5A 3A82A 3EGKH 1K1NA 1G9IE 3LJJA 1C9TA 1Y3VA 4Y8XA 1CT4E 3MO9A 2GCTB 1G2MA 3SN8A 1P03A 3UTUH 1BBRE 1P05A 1QGFA 1C2DA 1V6DA 3TLOA 1AHTH 1GI4A 4BAKB 1QA7A 3A7WA 3F9HA 3ZYDA 5EPYA 2BM2A 3MU8A 2BY9X 3ZZDA 2ZU5A 1TA2A 1IQLA 1T8MA 3LGUA 2BD3A 5FXLA 1O3HA 3GISB 9LPRA 1J14A 3UOUA 2BVXH 3ATWA 4GCHG 1UVOA 2ALVA 2P3FH 3PLKA 1PPBH 3GY8A 3LT3A 3M37A 3M5MA 2Z94A 2HOBA 4FVBA 1H4WA 2C3SA 5DPAA 1GI1A 2QXIA 2PW8H 3B23B 3T26A 1P2NA 4X6NA 4BXSA 3MWIU 2FOMB 1NO9H 1PPFE 1AZ8A 2ILNA 3TU7H 4VGCB 2M5TA 4WJG2 1XUKA 2Z9KA 1TNIA 3MMGA 4MPWA 1ELGA 1NT1A 3RXTA 4BANB 4K5ZA 2AYWA 1LHEH 3KL6A 1AQ7A 4BTTB 1Y3WA 4SGAE 1IHTH 2Y6TA 4X8TH 1GG6C 2WPJS 2PSYA 2ZPRA 1ZTLA 3FP7E 1SLWB 5C20A 1ANBA 3VPKA 2XW9A 5DP5A 3RXOA 2O8TA 4FUEA 2BDHA 3ZZCA 1JXPA 1YCPH 1K9OE 2Z9IA 4FUFA 1LO6A 1SGDE 4XBCA 2Z3CA 1U6QA 3RXMA 3TJVA 3LH3A 2I6QA 4DG4A 3EE0B 2A7JA 3RMLH 3STJA 2GKVE 2TGPZ 1EKBB 1YCPM 4MNYA 1D4PB 1O2SA 3T5FH 2CHAC 2UUJB 4MPXA 3LOXA 5GPIB 5FPYA 1WQVH 1VITG 5BPEA 3RXHA 3F9GA 1TA6A 1G32B 1C1WH 1ETRH 3SHAH 1YPEH 4WMDA 1C5LH 3BIVH 1BITA 1TPOA 3VB3A 5ETXA 4DURA 4KTUA 1BOQA 5HM2A 1MTNC 5DJ7A 4E05H 2ZCLP 3GYMA 1IQEA 3HKIB 2WUBA 1T32A 1T8LA 4AB9A 1SGCA 2F83A 4E7RG 3CS0A 4M7GA 1C4Y2 1FQ3A 2VIQA 1FY4A 4FUGA 1S6FA 2FXRA 1WBGB 3MOCA 1AUTC 1LPGB 1EAXA 4ZKOU 3BTME 5HGGA 4Y7AA 1VITF 3U69H 3UQOA 2Q6GA 1P2KA 1ID5H 1GG6B 1FN8A 1BRAA 1OX1A 1Y5AT 3NXPA 4ABBA 2FYQA 5GIBA 2QV1A 4XBBA 3GDSA 1MBQA 5DO4H 1QJ1B 2O9QA 3GY5A 2BOHB 4RKOB 3RU4E 3MO6A 2A4RA 2Q6FA 1D3TB 4KP0A 1W14U 3BTKE 1SR5C 5JBAS 2P95A 1YPHC 3SNCA 4AGJA 1EB1H 1AFEH 3ZVGA 2BD4A 4WMEA 4MPVA 2Z9LA 1V2ST 4JZIA 5GWZA 1P06A 4X6MA 1CT2E 1H1BA 2CJIA 3SUDA 3L3TA 2UUFB 4JYVH 2G55A 3M3SA 5HM9A 1EP5A 2ODQA 2FP7B 2CHAB 3BG4C 3MU4A 1P12E 1UMAH 2P8OC 1BBRH 2ZPQA 1HUTH 2IPHA 4TWYA 1FPHH 1C5NH 4XFQA 2A31A 5FHTA 2OC1A 2OTVA 1WTGH 1G2LA 2ANYA 1Y3YA 3SGQE 1HIAB 2GVFA 2JETC 2PKAB 3LGIA 2G4TA 1BZXE 4ISNA 1MTNB 3VB6A 8LPRA 1TRMA 5C67A 1A0LA 1AIXH 2FOHA 1A7SA 1DSTA 3KIDU 2ZGCA 3SU5A 2D2DA 1YF4A 2WYJA 3DFLA 2A2XH 1S83A 1ZPBA 1HGTH 1O2LA 3VGCC 1ETSH 1GVKB 2A4OA 2FM2A 4NA8A 4ABIA 1OWJA 1P2OA 1O5GH 1SSXA 1Y5BT 2VVVA 4CHAC 2ZGJA 1Z8IB 1EJAA 3M5NA 1KLJH 1CO7E 1GI6A 2FOEA 4ISOA 1UCYK 3RMMH 3A7VA 1EZSC 2FOGA 3T2NA 5E2PA 3A85A 1DT2A 1RXPA 4H4FA 3HGNA 1ZOMA 1DUAA 3ZZ9A 1GDUA 3RXQA 1FY3A 2QC2A 1DUEA 1FUJA 5GCHF 2BLVA 1DXPA 1VCQA 1ZRBA 3H7TA 1GI8B 1W8BH 1HJAB 4MVNA 3SJOA 1OP2A 3VB4A 1NFUA 1C5MD 1QB1A 1C1PA 3D23A 4ZXYH 3ODFA 1PPZA 3BTTE 3P8NA 4CH8B 3B8JA 1V2TT 5A0AE 2ZFPH 1BCUH 3O8DA 1ORFA 2GGVB 1KSNA 1NFYA 1EP6A 1RTKA 1W2KH 1EZXC 2HNTE 1V3XA 2HNTF 4X2YA 1F0TA 2JETB 1HAHH 1YPHE 1XUHA 4ZHAA 2BVSH 1LDTT 1UTQA 5G4BA 4BTUB 2DE9A 1JIRA 2ZQ1A 1ARBA 1OWEA 1JIMA 3BF6H 1C4V2 1O5AB 3OY5U 4YO9A 2GCHF 1W0YH 3URCA 5K7RA 1QQUA 3ZZ4A 5T6FA 1XUFA 3TJOA 1AB9C 1P0SH 4Q7YA 2QCYA 2ZHDA 1SGNE 1THRH 2ZC9H 1C1MA 3SU2A 1QRZA 4NWKA 4U2WA 1IQIA 2H9TH 2XYAA 3VGCB 1QURH 2R3UA 2RA3A 7GCHG 5EG4A 2FODA 3UNSA 4JZDH 1IQGA 1FAKH 2Y7ZA 1GMCF 4DIIH 2SGFE 5DGJA 4CHAB 2ZCKP 5A8XA 5AFZH 3LPRA 2FI3E 1O2PA 2G8TA 3EYDA 4ZKSU 1FMGA 1P2JA 3V13A 2EC9H 3EDXB 3SNBA 1TGTA 3A7ZA 4GHTA 1DS2E 1AY6H 1XKBC 1K2I1 1MZAA 3BTGE 4R8TB 1GBLA 1HIAA 1K1OA 1UVUH 3ZV9A 2PKAA 1ZGVA 1ZHRA 1Z1JA 1F2SE 4FU8A 1MUEB 1ZSLA 1ELVA 4FU7A 3LU9B 1EUFA 1HAVB 3ZZBA 4K2YA 3M7QA 1TX6A 1ELFA 2ZNKH 1O2XA 4X1PU 1Z71A 4IW4E 2C8XB 2H2ZA 3ZZ8A 3NK8A 1C1VH 3SQHE 4X8UH 4FUBA 3M36A 2XCFA 8ESTE 1BMLA 2BD7A 1EASA 5A0BA 2HVXA 1DE7H 2W3IA 2AGIX 1B0EA 4Y8ZA 1ESTA 4D9QA 1ELBA 2Q1JA 3A8DA 1GGDB 2JKHA 1AB9B 4FUJA 2BD2A 1Z7KA 2AIQA 2ZQ2A 2H5CA 1ELEE 3A87A 1FPCH 2GTBA 1PQ8A 1A1RA 1RRKA 2VH0A 2HLCA 3MNXA 2BY5X 2VJ1A 4ISHH 2BDBA 1UTLM 2GT8A 1PPGE 1GBDA 3PMJA 1MZDA 3V7TA 5DP3A 1ZMLA 2AS9A 2ESTE 1SI5H 3SI3H 1L0ZA 1SGPE 3SNDA 1XUIA 2OC0A 1MTSA 1L1GA 4FUHA 5JDUB 3RDZA 1L1NA 3MU0A 2BB4A 3ATIA 4A92A 1GI0A 2J2UA 1K1PA 2UWOA 4DCDA 2BXUH 1W7GH 1P09A 3BG8A 1BJVA 5BRRE 4K60A 1OPHB 3SGAE 1B0FA 2XWBI 2F3CE 4TPYA 2FWWA 1O3IA 1DSUA 2WYGA 4NZLA 1V2UT 2ZU2A 3ZZ6A 2FS8A 1RD3B 1K21H 1S84A 5CHAC 4TY6A 3SU6A 2PKSC 8GCHG 1Z8GA 2BQ6B 1F92A 1LTOA 4JYTA 4Z6AH 1E36B 4NWLA 4D9RA 1KXEA 2QAAA 4OS6A 1P3EA 3GCHC 3WY8A 3RXCA 1CHOG 3MH7A 3LGYA 3FZZA 1A5GH 1P9UA 2BDYA 1E34B 3S69A 4DIHH 1C5ZB 1W11U 4X2WA 4O3UA 1Y5UT 2NU0E 3QUMP 2DE8A 3BTQE 3UR6A 1JRSA 1XUGA 1GBEA 1CA8B 4KGAA 3RLWH 3RXUA 5ESTE 1BUIA 1FNIA 4CRGA 1SLXB 1O0DH 4UE7H 1G30B 1LVBA 2LNCA 2TGAA 3UIRA 1ZLRA 1IQJA 1LHDH 2ZTXA 2B8OH 4AG1A 5PTPA 1N1LA 3K9XB 1D9IA 3TK9A 1KTSB 2ULLA 2F9NA 2BY8X 1WYKA 5EW1H 2ZU4A 3I77A 1HAZB 3FANA 4D7FA 3W95A 1D3QB 2QXHA 4Q7ZA 1TRNA 4RN6A 1HAVA 2FEQH 3L6PA 1Y3XA 1H9HE 1AWFH 1DXWA 2AGEX 4INLA 2QIQA 2OCVB 1GCTC 1AE5A 4NIVA 1KDQB 1SC8U 1OKXA 1F7ZA 1SGYE 1O33A 2FLRH 3SUFA 4A1TA 5EW2H 4CH2B 4YT6H 1O2ZA 4X1QU 1TGBA 2FOAA 4WXVA 5T6DA 3A8BA 3C27B 4J1YA 1INCA 2Y81A 1TPSA 1PQAA 1QR3E 2PKSB 1GI7B 1NRNH 2VIVA 1SQAA 1KXAA 4DW2U 1SLUB 4HGCA 1SMFE 1SGFA 4U30A 4Y11E 1V2VT 1ZYOA 4ABDA 2VU8E 2J94A 4INHA 2AMPA 1F5LA 3U98H 1FXYA 5A2MH 3GCHB 3UWJH 2O8MA 2JH0D 1GCDA 2AIPA 5J4QA 1ESBA 2ZFQH 1EAUA 3QZRA 1GBJA 4Y0ZE 4CREA 1HAPH 3H7OA 1UVPA 4JZ1A 3FFGA 3KHVA 2PUQH 3EA7A 1BTUA 1C1UH 1FI8A 1LHGH 2R0KA 5DP6A 4XE4A 2XBXA 4I8JA 3SOSA 1ZGIA 2VB0A 3ATMA 1MKXH 4B71A 3BTDE 4MNVA 1EPTC 5IDKA 1NM6A 1ZR0A 1FAXA 2WPMS 3LJOA 2PTNA 1O32A 2ZGHA 1F0SA 4MPUA 4LZ4B 1G3CA 3AAVA 3DD2H 1TQ7B 4ABEA 4CRDA 2W3KA 2C8YB 1CQQA 4XDEA 4NCYA 4ZH8A 3UNQA 3NKKA 4KTCA 2TGTA 2V6NA 3TGJE 1X7AC 2PUXB 1DWEH 1OYTH 3PMHB 1PPHE 1O34A 2XC0A 1JWTA 3RMOH 2ANMH 1QL7A 2BX4A 1KIGH 1J8AA 3GY2A 4MG3A 1XKAC 1TNGA 3TITA 1C5OH 1NS3A 1GCTB 2W7UA 2LPRA 1GJ7B 2GX4A 1FN6A 6CHAC 1D6RA 1MU6B 4GSOA 3P95A 4D7GA 4TPIZ 1QHRB 2A2QH 1O2GH 4CBOA 4K1SA 3HPTB 1TX8A 1QQ4A 1EATA 1C1QA 3HK3B 1SG8B 3MYWA 4UFGH 2A32A 4E7NA 5JB8S 4U32A 2A5AA 6ESTA 1QBVH 3GOVB 1QIXB 1TMBH 2P93A 1D6WA 1O3CA 4OS5A 1WSSH 3K6ZA 1LQEA 2Z7FE 3MH4A 3SJIA 1KXDA 1VGCC 1AD8H 3P92A 1JMOH 3VB5A 5JB9S 3ZVEA 3GY7A 3H5CB 1DITH 3T62A 2OD3B 2ZIQH 3FAOA 4DT7B 2BMGB 3TVJB 1HPGA 1FY8E 1AI8H 2C93B 2ZDNA 2BY6X 2FMJA 2VWOA 2ZU1A 1CBWC 1EPTB 1C5YB 1E37B 3PWBA 5EQQA 1THPB 4FXGH 3UNRA 1A5HA 1O37A 5F03A 5T3HA 2YNBA 1C2GA 4ABJA 4XBDA 2BX3A 2A4GA 1FIZA 2AMDA 5EPNA 1KDQA 3GCNA 1DM4B 3P6ZB 1GHAF 1W12U 2R9PA 5DP8A 4CR5A 2VIDA 5C1UA 4LOYH 1VCWA 1MQ6A 1TOCB 4UEHH 2FX6A 1KLTA 1DWBH 2ZDLA 4GHQA 2VVUA 1TONA 1ABJH 3URDA 4F4OC 2ZFRH 1O3OA 2RG3A 2IJOB 3SJ8A 4NFFA 1LHCH 3GY6A 2BHGA 3RXKA 5C2ZA 1EAIA 4IN2A 6CHAB 3GDUA 3KQDA 2ZDMA 4ZUHA 4YT7H 1QBNA 3SU4A 1BJUA 4IGDA 3M7UA 2VIWA 1P9SA 7ESTE 4X6OA 5K0HA 5LPEA 1E38B 1OWKA 3T27A 1ZMNA 1SQOA 1SVPA 4CBNA 1SGIB 1O39A 2QN5T 1C5PA 2W26A 1JOUB 1IOEA 1VGCB 4X6PA 3RP2A 4A7IB 1QFKH 3F68H 3QTOH 4F49A 1HAIH 1H8DH 3QO6A 3SBKA 2HNTC 1SOZA 3FZDA 2A1DB 1QA0A 1SBWA 1GBFA 1GPZA 1GJ9B 1RTLA 4AFUA 2C8ZB 2SGQE 1TOMH 1CVWH 3CS7A 4A5TS 3TNSA 4CRBA 3GCOA 1OWIA 1O3PB 3RM0H 1BTPA 1TQ0B 1ZTJA 1MCTA 1QNJA 3MNBA 3NZIA 1LPZB 1F0UA 1QJ6B 3LIWA 3P70B 1ELCA 1NY22 2VIPA 1DY8A 2ANKH 2VVCA 3UQVA 1GMHF 1C2MA 1LVYA 3ITIA 1L1JA 3O8BA 3RXSA 2P94A 1B7XB 2ZZUH 1S85A 2D1JA 2B7DH 3SZNA 1L4ZA 2ZF0H 3E16B 1ZSKA 3RC6A 2A4QA 3TJNA 2ZWLH 1ZPCA 1K22H 2A45B 3U8RH 4B73A 3RXDA 1BRCE 1TABE 1C2LA 3SORA 2G00A 4NG9H 1C1RA 2JH6D 2CF9H 4YLQH 1HDTH 4IMZA 1YYY1 1C5WB 1EX3A 2GP9B 3GYLB 1SGRE 1S5SA 5GCHG 2BQWB 4Y71A 4A6LA 1G3DA 1TNKA 3I29A 2VNTA 1N8OC 1SQTA 4Q2KA 4LZ1H 2XBYA 5DP4A 2A7CA 2HALA 5AHGH 1BTYA 1XXFA 3ZZ5A 4ABFA 1YPLH 1AUJA 2XRCA 3SGBE 1GI3A 3ZV8A 4AFQA 2FESH 1C2IA 3KQBA 1HV7A 3KCGH 2TPIZ 4I7YH 4ASHA 3MTYA 2KAIB 4J2YB 1QCPA 1DY9A 5AF9H 1ZRKA 8KME2 1G3BA 1YPJH 4WWYA 2XTTB 2OC7A 2VGCC 3SV8A 1GJCB 1O2KA 2ZPSA 4IC6A 1C2JA 4K1EA 3VB7A 3MU1A 1GBCA 1TFXA 1EZUC 3ZVCA 1IQHA 1JBUH 3TK5A 2W5EA 3BSQA 2Y80A 2GCHG 2ZI2H 2A5IA 1YCPK 3S7HB 2UUKB 1FJSA 4H6TA 1SL3A 6LPRA 3OU0A 2O8WA 5EODA 5SGAE 1GHWH 4CR9A 1O2MA 1QY6A 3BG4B 1MKWH 2OQ5A 2P8OB 5FCKA 1NTPA 2RA0A 1PYTD 1O2WA 3VEQB 4NA7A 3BEIB 1FONA 1J15A 2PFEA 4DJZB 2A5KA 2BLOA 1T8OA 3ZVAA 3LONA 5J4SA 5DP7A 1GMCG 1V2RT 1BTHH 1A5IA 3FVFB 3IWMA 3R0FA 4AZ2B 2CV3A 2C90B 4D76A 6GCHG 3ZVDA 4I31A 3BIUH 1DICA 3AAUA 5HYOA 1EXFA 1Q31A 1A3BH 3K2UA 1O3LA 2GT7A 3RXJA 2B9LA 1Y8TA 4X1RU 4FU9A 4I8GA 4ZKRU 4BAHB 1C1TA 1P2MA 2UWLA 2O8UA 5L2ZH 1GHYH 4YESB 1VITH 1A61H 1N8OB 2XCNA 5ABWA 2ZDVH 1P57B 1PQ7A 2WV4A 1UK2A 5AFYH 2Z3DA 5A0CA 2ZU3A 1DOJA 3EAJA 3SO3A 2WPKS 1L2EA 2EI6A 1ANDA 1TE0A 6GCHF 4X2VA 1V2WT 5L6NH 4IS5A 3ZVBA 2QGRA 1VCPA 4YZUA 1GMDF 5H4IB 2VGCB 3KF2A 3SUGA 2EI7A 3QGJA 3S9AA 2FIRH 1RGQA 5DP9A 2GDEH 1BMAA 5E0HA 1AKSB 1ARCA 1UO6A 5A09A 1ZHPA 1NRQH 4ABHA 1F5KU 3EA9A 1DDJA 1ETTH 2ZFTA 2HGTH 4UDWH 2G81E 3LGWA 3RU4D 1NU9A 1RIWC 4MDSA 5L30H 3ATLA 4AORA 4CRFA 1ZZZA 4GPGA 5C5OA 3S9BA 2WV5A 4LK4A 1GHVH 1NRRH 3TH2H 1OOKB 2G4UA 1EZQA 4IMQA 5F8ZA 3P17H 3ATKA 3D49H 1BBRK 5E2OA 4X8SH 2RDLA 2ZHQH 1G37A 3JZ2B 4UD9H 1O31A 3LDXH 3BTWE 9ESTA 2FZZA 3RMNH 2ZHWH 2F9OA 1XX9A 4MNWA 2OP9A 3M7TA 4B76A 1WQSA 1CGIE 1BT7A 1TB6H 5F6MA 3F9FA 3LC5A 2H9HA 3A86A 2ZCHP 1J16A 1ELAA 2NU4E 3B9FH 2GD4B 2V35A 1QL8A 5AVDA 1YBWA 2TBSA
chains in the Genus database with same CATH superfamily
1DWDH 5C3NA 1GHBF 3QZQA 1NU7B 1T7CA 1O5CB 2HRVA 5CHBA 2GDDA 5TJXA 1EB2A 3MU5A 4Z1MD 4B2CA 2RFKC 3SV7A 2F9BH 1GBMA 3LH1A 3MNCA 4YOGA 1KXCA 2P16A 1O2IA 3VXEH 2I6SA 3RC4A 4DY7B 1BHXF 4TSFD 1OP0A 1ACBE 1H9LB 4K8BA 3SV2H 3E90B 2QYIA 4OM9A 1WAYB 1AE8H 1RIWB 4OGXA 3T25A 1MU8B 3QLPH 3E91A 3OEHD 1K0HA 1N6XA 4B2BA 1Z6JH 2PR3A 2TRMA 3DT0H 1TGSZ 3LGVA 3CP7A 4QT8C 5HXFA 3T29A 2CXVA 2O8LA 3HKJB 4O3TA 2PTCE 1H9IE 1XVOA 2QF3A 4XOJA 2KCOA 2Z9JA 5A8ZA 2B0FA 5EJZA 3RXIA 3TGIE 2SGAA 1K1JA 2G51A 5GXPA 1UCYE 2OINA 1IAUA 4WF8A 3A84A 4AN7A 4CRCA 3OSYA 2J97A 1SPJA 2P3TB 1RTFB 1WU1A 1PFXC 3UFAA 2IOTA 1TRYA 1ANEA 2OLGA 3ZVFA 3BTHE 2OK5A 1V2JT 2ZFFH 1C5XB 1YWUA 4ACBA 1UVTH 3ELAH 2UUYA 1DWCH 2H1UA 3S7KB 1GBIA 1V2LT 1AKSA 2WHXA 3RXEA 1DLKB 1KTTB 3QGNB 3ZZAA 1O2HA 1P02A 3SI4H 4SGBE 1QRXA 4Y7BA 4RKJB 3QWCH 4I32A 1YM0A 1TWXB 1S82A 2AFQB 2ZGBH 4K8YA 1WDIA 1BQYA 3SYJA 4NFEA 2VIOA 1NZQH 1MTUA 2FI4E 1QL9A 2FDAA 1MABB 4RSPA 2XBVA 1VZQH 1ZJDA 1O5FH 3V0XA 1WOFA 1ANCA 7LPRA 1OS8A 1GL0E 1O3FA 3NPSA 5E0GA 4BNRA 1CGJE 1LCYA 3BEUA 1A3EH 3DUXH 1LVOA 5CHAB 4AOQA 3Q76A 3BTFE 3IG6B 4O03A 3RLYH 4MTBA 1RFNA 3Q00A 3BEFB 1C2EA 3PM3A 2FLBH 1AWHB 3MO3A 4OS4A 5E8EH 3L33A 1QJ7B 2W7SA 2Y82A 3VXFH 4A1VA 1UTKA 3A89A 3QDZB 2W6JD 2GZ9A 1O2YA 2XNDD 1W0KD 1SLVB 1O2NA 5GDSH 5TCAA 5EU8A 4RT1A 4BXWA 2Z9GA 2GJGA 3GDVA 1C4U2 1W7XH 1C1OA 5C1YA 2ZDKA 4YOJA 1SFIA 2PWXA 2ZG0H 3E0NB 1TYNA 2FYRA 3M3VA 5A8YA 3U9AH 5C0TA 3P8GA 3STIA 1BA8B 5GJ4B 2VWMA 1O3NA 1O3AA 3OYPA 1HAXB 1XXDA 3ESTA 2IN2A 1OYQA 2R2WU 1HAGE 2ZDAH 1ZMJA 4B6FA 2BZAA 5FPSA 4TWWA 3UWIA 5I46H 2G52A 1CHGA 2W6ID 4YM9A 5DKMA 1TGCA 1HXEH 1LMWB 1FLEE 1UTJA 2CF8H 3A7TA 1Z6EA 2WPIS 1HCGA 1GJAB 2HPPH 1GL1A 4Y76A 1YPGH 3F9EA 5FAHA 4NIWA 1T4VH 1YP9A 5JBTA 2XXLA 3PWCA 4OS2A 3A80A 4B75A 1IHSH 1AMHA 1V2MT 4YTAA 3HATH 1O38A 3F6UH 2JH5D 2V7QD 4JK5A 1QB9A 3EQ0H 3E0PB 4JK6A 1W10U 1HB0B 1RS0A 4H42U 4D8NA 1O3EA 4WMFA 2L74A 3ZZ3A 5DK1A 2F9UA 1NPMA 1A0JA 5EOKA 1MD7A 3F2FA 4BAQB 5FCRA 1EQ9A 1IQMA 1DVAH 1GWAA 5JBCS 3HK6B 3JZ1B 1GI9B 1GJ8B 3OFND 5LPRA 2G5VA 1WCZA 1C5TA 1NC6A 3A8AA 1TAWA 1HNEE 5FBEA 3AW0A 4I8KA 1SKYE 5CE1A 1ESAA 1PQ5A 1YLCA 1BMMH 1NFXA 2J9NA 1GHAG 2BTCE 3SQEE 2G5NA 3PROA 1CT0E 4TY7A 1MD8A 3MFJA 2D26C 1UCYH 2BXTH 4LXBH 3TH4H 1B5GH 3T28A 3TPIZ 1V2QT 4XSKU 3ODDA 5HIZA 3VFEA 1O3GA 2Y5HA 1TIOA 1C5SA 4AG2A 3V12A 1V2NT 4KTSA 4GCHF 1GJBB 1K28D 2PSXA 4ZXXH 2OUAA 3FN8A 2FI5E 1S6HA 5C17A 1F5RA 2DUCA 1LPKB 1GDQA 2SNVA 4OS7A 2FOCA 1Q2WA 3RC5A 1XM1A 3RU4T 2V3MA 4O97A 1YKTA 1COWD 1DFPA 3EA8A 1XMNB 1BRBE 1MH0A 1SGQE 3UY9A 1JRTA 4TT3D 3ZYEA 5JYIA 2FTLE 2J92A 3U1IB 3UUZA 2EY4C 1DLEA 1PPCE 4ABAA 3PMBB 1AU8A 3SV9A 3SU1A 3UB0A 4JYUH 1S81A 2QF0A 1UHBB 4X2XA 3S0NA 2OC8A 1O5EH 3RXBA 4YOIA 5JPMH 1XUJA 2PLXA 3KEEA 4K1TA 4THNH 3SJ9A 4DVAU 1NFWA 5LPFA 3M5OA 1NRSH 3SU0A 4OGYA 4NIXA 5C0UA 5TCCA 1RJXB 4O9VA 2BOKA 1GMHG 3MHWU 4TYDA 4B1TA 1HFDA 3GY3A 4JZEH 1MMJN 1AVGH 4X1NU 4FUDA 4ABGA 1W3CA 3LKWA 3D65E 3PO1C 2R0LA 3M61U 2CGAA 1YPKH 4K3JA 1HJ8A 4H6SB 2CMYA 5EQRA 2J38A 2P59A 1KYNA 3QTVH 1V2OT 4IC5A 1GBKA 2XBWA 4INKA 4WH6A 1SGTA 3E6PH 4HZHA 2AH4X 3MH5A 1NN6A 4AFZA 3UR9A 1K1LA 1KXFA 2VWNA 1CBWB 1W0ZU 2ZFSA 3PTNA 3Q3YA 5EXNA 1LHFH 3ENSB 4WXIA 1O5DH 1C5VA 1FY1A 1TLDA 4Y6DA 3SV6A 1MKXK 1C2KA 4X8VH 3TJUA 1CSOE 3KN2A 2ASUB 2FO9A 2ALPA 1O35A 2ANWA 2CK3D 3UREA 1ZTKA 2SGPE 3UOPA 2Y5GA 3PV2A 3M35A 1HJAC 4Z0KA 2BZ6H 1T31A 1SOTA 1NROH 2C8WB 2STBE 1QTFA 4ZKNU 1AVXA 1SHHB 3RUOA 3A83A 2BDCA 3QN7A 1NBMD 4AGKA 1GDNA 3SZEA 1GI2A 4CRAA 2BQ7B 2YMSC 1HAOH 1P11E 3SNAA 1TNJA 1LQDB 1LVMA 3GICB 3RXGA 4ESTE 3A81A 2OBQA 5DN6D 2GZ8A 4Y0YE 1IQKA 3AW1A 2GZ7A 4I8HA 1V2KT 2Y7XA 3F2HA 4UFDH 2WINI 4A1XA 4KELA 4AB8A 1AN1E 1UK4A 1MTWA 4E06H 1QB6A 1QBOA 1GVLA 1CU1A 5CMXH 1L4DA 1ZHMA 1GJ5H 1LKBA 3PB1E 3U8OH 2BLWA 2ODYB 1EPTA 1A46H 3RXPA 1TPPA 1KXBA 4X1SU 3PO1B 2EQNA 5EXMA 1AVWA 1CGHA 4KKDA 3Q3KA 3OX7U 1UTNA 1C1SA 3NCLA 3R3GB 4U01A 3SJKA 4Q80A 1AZZA 2R3YA 4P00A 4GUXA 2TIOA 5EGMA 3E3TA 2QF5A 5FBIA 3MI4A 4ISLA 1C5UA 2OBOA 1OXGA 2VINA 2C4FH 4MLFB 4B2AA 4WVPE 1YGCH 4BAMB 2ODPA 3IITA 3M3TA 4NIYA 5IYTA 4ZROA 2LP6A 2KR7A 1BRUP 4PROA 3P8FA 3SNEA 3DA9B 1BTXA 2AMQA 3QK1A 1P2QA 1YLNA 3NUMA 4GLYA 3W94A 3A8CA 1Q3XA 1G36A 1C9PA 2SFAA 3E8LA 1ABIH 2R2MB 2EA3A 3M5LA 4BOHA 2Z3EA 1UHBA 1UTMA 2ZGXH 3MNSA 4Q7XA 1ELDE 4WH8A 2WPHS 3PMAB 3DFJA 4UFEH 3P8OA 4JMYA 1GMDG 1C2HA 5EJLA 1WXRA 1O2UA 2NU1E 2WUCA 2PHBA 2QXGA 5LH8A 3TGKE 4HFPB 3Q3XA 1O2RA 2YMSB 1CA0C 3OTJE 4DOQA 1MQ5A 3K6YA 4UFFH 4Y79A 2PGQB 1SHYA 3O8RA 1MCVA 1AFQC 2F91A 3D62A 1BIOA 1GBTA 1TALA 2RCEA 3PYHA 2GV7A 5EIYA 1O3JA 2YOLA 3RXVA 1OHHD 1BB0B 1OP8A 2HPQH 4IBLH 4AYYB 1QRWA 1GGDC 2NWNA 1P04A 1O2JA 5JBBS 1AO5A 1NRPH 1VJAU 1KY9A 3LGTA 2FPZA 1IQFA 1MAYA 1HXFH 3SU3A 4GVUA 4I8LA 1G3EA 2XWAA 2QXJA 1CE5A 4RT0A 3KQCA 2J4IA 1O5BB 2BLQA 2J98B 2GMTC 2F4LA 1TPAE 5FX6A 4HI3A 5FX5A 1O3BA 2FX4A 2FS9A 1HAYB 1TNLA 1NESE 1FIWA 1T8NA 1GJ4H 3A7XA 3FP8E 2F43B 3HGPA 1HLTH 4GAWA 2CN0H 1DPOA 4NSYA 1TNHA 1A2CH 3DSPA 2GV6A 3G01A 2V3OH 1UK3A 1K1MA 1J9CH 1A4WH 1DX5M 2WPLS 3A88A 3SW2B 4AFSA 4BTIB 2OQUA 1O30A 1TMTH 5F8TA 1EJNA 1K1IA 1YLDA 4I33A 2PP6A 2BDAA 1O3DA 1BDAA 4ZHLU 1KMHB 1SB1H 3SHCH 4DGJA 3BN9A 5C5NA 7GCHF 3CNRA 1GHBG 1HRTH 1Y59T 2H9EH 1HBTH 2V3HH 4Y8YA 1J17T 5CDFE 3RXRA 2EI8A 4YLUA 2VWLA 1EOLA 3PLBA 2ZECA 2KAIA 3GCTG 5ESBA 5L2YH 2SNWA 1CA0B 1P10A 3PV4A 2ZTZA 1AFQB 4ZMAH 1AGJA 4B74A 1BHXB 1O2VA 4FUIA 2BVRH 3KQEA 7KMEH 1N6YA 3N7OA 1PJPA 4FVDA 2QY0B 1FV9A 1W0JD 2OXSA 1C2FA 1ZSJA 4HTCH 1VJ9U 2QA9E 4JZFH 1BTZA 1TBZH 1HJ9A 2A0QB 1YC0A 1SGFG 2ZTYA 5E0JA 1KLIH 1E0FD 3KYGA 2AEIH 1TX7A 1UJ1A 2XOKD 5DG6A 1GVZA 1ZJKA 4MQAA 2F9VA 3GCTF 5FPTA 3CENA 2GMTB 4R0IA 4NZQA 3RXLA 3RM2H 2XC5A 2VH6A 5B6OA 2ZEBA 1O2TA 4AX9H 3MH6A 4JCNA 1TBQH 1THSH 2ZP0H 2BYAX 1OWHA 2FOBA 1ELTA 2JJ1D 1TMUH 1FX0B 2HWLB 2PGBB 1MBMA 1TBRH 1F0RA 2ZA5A 4OS1A 3TNTA 2XC4A 2ZO3H 1P8VC 1Z8JB 2PV9B 5I25A 1GBHA 1MKWK 2XNIA 2UWPA 1GHXH 1H8IH 2BDIA 2BD8A 1O2QA 1W13U 1UW7A 1C1NA 1TGNA 2AGGX 1O3KA 2Z6BD 4Y10E 5T1VA 1FDPA 1V2PT 1WV7H 1UVSH 1VR1H 5F8XA 3E1XB 3RXFA 1S0QA 2A7HA 2THFB 2Y5FA 2YNAA 2NU2E 1E35B 3N7DA 1Y3UA 3I78A 1EAWA 1O3MA 2Q6DA 3ZZ7A 2AERH 1O36A 1EJMA 3DHKH 3RXAA 5EXLA 3TK6A 2ZKSA 1MTVA 2J98A 5EQSA 3K65B 2F9PA 2ZHEH 2EEKA 1WUNH 3FP6E 3F1SB 3KNXA 1GBAA 5LGOA 1Z8RA 3KGPA 4IN1A 1FZZA 3LC3A 3A7YA 3GY4A 4MNXA 1HYLA 1UTOA 8GCHF 1SGEE 2GCTC 2ZHFH 4K69A 1S0RA 2TGDA 1BTWA 3QX5H 3AVZA 2FOFA 4NSVA 4ZHMU 1WTHD 3BV9B 2H5DA 2BD5A 1CHOF 1D3DB 4AYVB 3PTBA 1UTPA 3NWUA 1PPEE 2SGDE 1T4UH 4NGAH 4ISIH 1P2IA 2WZQA 1C5RA 1GHZA 1M9UA 1OWDA 1GJDB 2P3UB 1GBBA 1P01A 2BDGA 3AASA 5HMAA 5T6GA 1C5QA 4WY3A 2J95A 3UPEA 4BAOB 1SFQB 1EOJA 1PYTC 4VGCC 1YPMH 2K1QA 2NU3E 2J34A 1P3CA 4X0WU 3TIUA 2BY7X 1LKAA 1OSSA 2D8WA 1FY5A 1ZPZA 4UONA 1GJ6A 3SUEA 2V0BA 1BMNH 3U8TH 1MAXA 3PLPA 1XVMA 2STAE 3TH3H 2B5TB 2H6MA 1O2OA 1IQNA 1A0HB 3O8CA 3S9CA 3C1KA 2BD9A 4ZAEA 3BTEE 3Q77A 4NA9H 1DANH 1D3PB 5C1XA 3U1JB 3V3MA 3OY6U 2FTMA 1Z1IA 4FUCA 2SGEE 1GI5A 3A82A 3EGKH 1K1NA 1G9IE 3LJJA 2WPDD 2WSSD 1C9TA 1Y3VA 4Y8XA 1CT4E 2K0QA 3MO9A 2GCTB 1G2MA 3SN8A 1P03A 3UTUH 1BBRE 1P05A 1QGFA 1C2DA 1V6DA 3TLOA 1AHTH 1GI4A 4BAKB 1QA7A 3A7WA 3F9HA 3ZYDA 5EPYA 2BM2A 3MU8A 2BY9X 3ZZDA 2ZU5A 1TA2A 1IQLA 1T8MA 3LGUA 2BD3A 5FXLA 1O3HA 3GISB 9LPRA 1J14A 3UOUA 2BVXH 3ATWA 4GCHG 1UVOA 2ALVA 2P3FH 3PLKA 1PPBH 3GY8A 3LT3A 3M37A 3M5MA 2Z94A 2HOBA 4FVBA 1H4WA 2C3SA 5DPAA 1GI1A 2QXIA 1E1RD 2PW8H 3B23B 3T26A 1P2NA 4X6NA 4BXSA 3MWIU 2FOMB 1NO9H 1PPFE 1AZ8A 2ILNA 3TU7H 5B6LA 4VGCB 2M5TA 4WJG2 1XUKA 2Z9KA 1TNIA 3MMGA 4MPWA 1ELGA 1NT1A 3RXTA 4BANB 4K5ZA 2AYWA 1LHEH 3KL6A 1AQ7A 4BTTB 1Y3WA 4SGAE 1IHTH 2Y6TA 4X8TH 1GG6C 2WPJS 2PSYA 2ZPRA 1ZTLA 3OEED 3FP7E 1SLWB 5C20A 1ANBA 3VPKA 2XW9A 5DP5A 3RXOA 2O8TA 4FUEA 2BDHA 3ZZCA 1JXPA 1YCPH 1K9OE 2Z9IA 4FUFA 1LO6A 1SGDE 4XBCA 2Z3CA 1U6QA 3RXMA 3TJVA 3LH3A 2I6QA 4DG4A 3EE0B 2A7JA 3RMLH 3STJA 2GKVE 2TGPZ 1EKBB 1YCPM 4MNYA 1D4PB 1O2SA 3T5FH 2CHAC 2UUJB 4MPXA 3LOXA 3DCLA 1H8HD 3F0PA 5GPIB 5FPYA 2J5UA 1WQVH 1VITG 5BPEA 3RXHA 3F9GA 1TA6A 1G32B 1C1WH 1ETRH 1SQRA 3SHAH 3F2GA 1YPEH 4WMDA 1C5LH 3BIVH 1BITA 1TPOA 3VB3A 5ETXA 4DURA 4KTUA 1BOQA 5HM2A 1MTNC 5DJ7A 4E05H 2ZCLP 3GYMA 1IQEA 3HKIB 2WUBA 1T32A 1T8LA 4AB9A 1SGCA 2F83A 2RDEA 4E7RG 3CS0A 2IJD1 4M7GA 1C4Y2 1FQ3A 2VIQA 1FY4A 4Q63A 4FUGA 1S6FA 2FXRA 1WBGB 3MOCA 1AUTC 1LPGB 1EAXA 4ZKOU 3BTME 5HGGA 4Y7AA 1VITF 3U69H 3UQOA 2L6OA 2Q6GA 1P2KA 3NRLA 1ID5H 1GG6B 3W1EA 1FN8A 1BRAA 1OX1A 1Y5AT 3NXPA 4ABBA 2FYQA 5GIBA 2QV1A 2JIZD 3OTPA 4XBBA 3MQKC 3GDSA 1MBQA 5DO4H 1QJ1B 2O9QA 3GY5A 2BOHB 4RKOB 3RU4E 3MO6A 2A4RA 2Q6FA 1D3TB 4KP0A 1W14U 3BTKE 1SR5C 5JBAS 2P95A 1YPHC 3SNCA 4AGJA 1EB1H 1AFEH 4FETA 3ZVGA 2BD4A 4WMEA 4MPVA 2Z9LA 1V2ST 4JZIA 2HLDD 5GWZA 1P06A 4X6MA 1CT2E 1H1BA 2CJIA 3SUDA 3L3TA 2UUFB 3FOAA 4JYVH 2G55A 3M3SA 5HM9A 1EP5A 2ODQA 2FP7B 2CHAB 3BG4C 3MU4A 1P12E 1UMAH 2P8OC 1BBRH 2ZPQA 3KQ5A 4F48B 1HUTH 2IPHA 2KCPA 1FPHH 3EE7A 4FOUC 1C5NH 4TWYA 4XFQA 2A31A 5FHTA 2OC1A 2OTVA 1WTGH 1G2LA 2ANYA 1Y3YA 3SGQE 1HIAB 2GVFA 2JETC 2PKAB 5EJ1A 3LGIA 2G4TA 1BZXE 4ISNA 1MTNB 3VB6A 8LPRA 1TRMA 5C67A 1A0LA 1AIXH 2FOHA 1A7SA 1DSTA 3KIDU 2ZGCA 3SU5A 2D2DA 1YF4A 2WYJA 3DFLA 2A2XH 1S83A 1ZPBA 1HGTH 1O2LA 3VGCC 1ETSH 1GVKB 2A4OA 2FM2A 4NA8A 4ABIA 1OWJA 1P2OA 1O5GH 1SSXA 1Y5BT 2VVVA 5GNDA 4CHAC 2ZGJA 1Z8IB 1EJAA 3M5NA 1KLJH 1CO7E 4AC9A 1GI6A 2FOEA 4ISOA 1UCYK 4XD7D 3RMMH 3A7VA 1EZSC 2FOGA 3T2NA 5E2PA 3A85A 1DT2A 1RXPA 4H4FA 3HGNA 1ZOMA 1DUAA 3ZZ9A 1GDUA 3RXQA 1FY3A 2QC2A 1DUEA 1FUJA 5GCHF 2BLVA 1DXPA 1VCQA 1ZRBA 3H7TA 1GI8B 1W8BH 1HJAB 4MVNA 3SJOA 1OP2A 3VB4A 1NFUA 1C5MD 1QB1A 1C1PA 3D23A 4ZXYH 3ODFA 4DT4A 1PPZA 3BTTE 3P8NA 4CH8B 3B8JA 1V2TT 5A0AE 2ZFPH 1BCUH 3O8DA 1ORFA 2GGVB 1KSNA 1NFYA 1EP6A 1RTKA 1W2KH 1EZXC 2HNTE 2KZ4A 1V3XA 2HNTF 4X2YA 1VKYA 1F0TA 2JETB 1HAHH 1YPHE 1XUHA 4ZHAA 2BVSH 1LDTT 1UTQA 5G4BA 4BTUB 2DE9A 1JIRA 2ZQ1A 1ARBA 1OWEA 1JIMA 3BF6H 1C4V2 1O5AB 3OY5U 4YO9A 2GCHF 1W0YH 3URCA 4XRNA 1QQUA 3ZZ4A 5K7RA 5T6FA 1XUFA 3TJOA 1AB9C 1P0SH 4Q7YA 2QCYA 2ZHDA 1SGNE 1THRH 2ZC9H 1C1MA 3SU2A 1QRZA 4NWKA 4U2WA 1IQIA 2H9TH 2XYAA 3VGCB 1QURH 2R3UA 2RA3A 7GCHG 5EG4A 2FODA 3UNSA 4JZDH 1IQGA 1FAKH 2Y7ZA 1GMCF 4DIIH 2SGFE 5DGJA 4CHAB 2ZCKP 5A8XA 5AFZH 3LPRA 2FI3E 2KM0A 1O2PA 2G8TA 3EYDA 4ZKSU 1FMGA 1P2JA 3V13A 2EC9H 3EDXB 3SNBA 4YXWD 1TGTA 3A7ZA 4GHTA 1DS2E 1AY6H 1XKBC 1K2I1 1MZAA 3BTGE 4R8TB 1GBLA 1HIAA 1K1OA 1UVUH 3ZV9A 2PKAA 1ZGVA 1ZHRA 1Z1JA 1F2SE 4FU8A 1MUEB 1ZSLA 1ELVA 4FU7A 3LU9B 1EUFA 1HAVB 3ZZBA 4K2YA 3M7QA 1TX6A 1ELFA 2ZNKH 1O2XA 4X1PU 1Z71A 4IW4E 2C8XB 2H2ZA 3ZZ8A 3NK8A 1C1VH 3SQHE 4X8UH 4FUBA 3FO8D 3M36A 2XCFA 4Q4LA 8ESTE 1BMLA 2BD7A 1EASA 5A0BA 2HVXA 1DE7H 2W3IA 2AGIX 1B0EA 4Y8ZA 1ESTA 4D9QA 1ELBA 2Q1JA 3A8DA 1GGDB 2JKHA 1AB9B 2KFWA 4FUJA 2BD2A 1Z7KA 2AIQA 2ZQ2A 2H5CA 1ELEE 3A87A 1FPCH 2GTBA 1PQ8A 1A1RA 1RRKA 2VH0A 2WV9A 3FKSD 2HLCA 3MNXA 2BY5X 2VJ1A 4ISHH 2BDBA 1UTLM 2GT8A 2VBCA 1PPGE 1GBDA 3PMJA 1MZDA 3V7TA 5DP3A 1ZMLA 2AS9A 2ESTE 1SI5H 3SI3H 1L0ZA 1SGPE 4M9FA 1XUIA 2OC0A 1MTSA 3SNDA 1L1GA 4FUHA 5JDUB 3RDZA 1L1NA 3MU0A 2BB4A 3ATIA 4A92A 1GI0A 2J2UA 1K1PA 2UWOA 4DCDA 2BXUH 1W7GH 1P09A 3BG8A 1BJVA 5BRRE 4K60A 1OPHB 3SGAE 1B0FA 2XWBI 2F3CE 4TPYA 2FWWA 1O3IA 1DSUA 2WYGA 4NZLA 1V2UT 2ZU2A 3ZZ6A 2FS8A 1RD3B 1K21H 1S84A 2M2AA 5CHAC 4TY6A 3SU6A 2PKSC 4HG6A 8GCHG 1Z8GA 2BQ6B 1F92A 1LTOA 4JYTA 4Z6AH 1E36B 3GS9A 4NWLA 4D9RA 1KXEA 2QAAA 3KYFA 1BMFD 4OS6A 1P3EA 3GCHC 3WY8A 3RXCA 1CHOG 3MH7A 3LGYA 3FZZA 1A5GH 1P9UA 2BDYA 1E34B 3S69A 4DIHH 1C5ZB 1W11U 4X2WA 4O3UA 1Y5UT 2NU0E 3QUMP 2DE8A 3BTQE 3UR6A 1JRSA 1XUGA 1GBEA 1CA8B 2KCYA 4KGAA 3RLWH 3RXUA 5ESTE 1BUIA 1FNIA 4CRGA 1S6LA 1SLXB 1O0DH 4UE7H 1G30B 1LVBA 2LNCA 2TGAA 3UIRA 1ZLRA 1IQJA 2K8IA 1LHDH 2ZTXA 2B8OH 4AG1A 5PTPA 1N1LA 3K9XB 1D9IA 3TK9A 1KTSB 2ULLA 2F9NA 2BY8X 1WYKA 5EW1H 2ZU4A 3I77A 1HAZB 3FANA 4D7FA 3W95A 1D3QB 2QXHA 4Q7ZA 1TRNA 4RN6A 1HAVA 2FEQH 3L6PA 2YMSD 3PRDA 1Y3XA 1H9HE 1AWFH 5KEDA 1DXWA 2AGEX 4INLA 2QIQA 2OCVB 1GCTC 1AE5A 4NIVA 4B6EA 1KDQB 1SC8U 1YY3A 1OKXA 1F7ZA 1SGYE 1O33A 2FLRH 3SUFA 4A1TA 5EW2H 3H09A 3UAIC 4CH2B 4YT6H 1O2ZA 4X1QU 1TGBA 3PV5A 2FOAA 4WXVA 5T6DA 3A8BA 3C27B 4J1YA 4RI0A 1INCA 2Y81A 1TPSA 1PQAA 1QR3E 2JDID 2PKSB 1GI7B 1NRNH 2VIVA 1SQAA 1KXAA 4DW2U 1SLUB 4HGCA 1SMFE 1SGFA 4U30A 4Y11E 1V2VT 1ZYOA 4ABDA 2VU8E 2J94A 4INHA 2AMPA 1F5LA 3U98H 1FXYA 5A2MH 3GCHB 3UWJH 2O8MA 2JH0D 1GCDA 2AIPA 5J4QA 4P02A 1ESBA 2ZFQH 1EAUA 3QZRA 1GBJA 4Y0ZE 4CREA 1HAPH 3H7OA 1UVPA 4JZ1A 3FFGA 3KHVA 2PUQH 3EA7A 1BTUA 1C1UH 1FI8A 1LHGH 2R0KA 5DP6A 4XE4A 2XBXA 4I8JA 3N99A 3SOSA 1ZGIA 2VB0A 3ATMA 1MKXH 4B71A 3BTDE 4MNVA 1EPTC 5IDKA 1NM6A 1ZR0A 1FAXA 2WPMS 3LJOA 2PTNA 1O32A 2ZGHA 1F0SA 4MPUA 4LZ4B 1G3CA 3AAVA 3DD2H 1TQ7B 4ABEA 4CRDA 1NBME 2W3KA 2C8YB 1CQQA 4XDEA 4NCYA 4ZH8A 3UNQA 3NKKA 4KTCA 2TGTA 2V6NA 3TGJE 1X7AC 2PUXB 1DWEH 1OYTH 3PMHB 1PPHE 1O34A 2KX4A 2XC0A 1JWTA 3RMOH 2ANMH 1QL7A 2BX4A 1KIGH 1J8AA 3GY2A 4MG3A 1XKAC 1TNGA 3TITA 1C5OH 1NS3A 1GCTB 2W7UA 2LPRA 1GJ7B 2GX4A 1FN6A 6CHAC 1D6RA 1MU6B 4GSOA 5KECA 3P95A 3N7EA 4D7GA 4TPIZ 1QHRB 2A2QH 1O2GH 4CBOA 4K1SA 2IPQX 1TX8A 3HPTB 1QQ4A 1EATA 1C1QA 3HK3B 1SG8B 3MYWA 4UFGH 2A32A 4E7NA 5JB8S 4U32A 2A5AA 6ESTA 1QBVH 3GOVB 1QIXB 1TMBH 2P93A 3WWFA 2HVYB 1D6WA 4ASUD 1O3CA 4OS5A 1WSSH 3K6ZA 1LQEA 2Z7FE 3MH4A 3SJIA 1KXDA 1VGCC 1AD8H 3P92A 1JMOH 3VB5A 5JB9S 3ZVEA 3GY7A 3H5CB 1DITH 3T62A 2OD3B 5HKKD 2ZIQH 1EFRD 3FAOA 4DT7B 2BMGB 3TVJB 1HPGA 3ZIAD 1FY8E 1AI8H 2C93B 2ZDNA 2BY6X 2AHME 2FMJA 2VWOA 2ZU1A 1CBWC 1EPTB 1C5YB 1E37B 3PWBA 5EQQA 1THPB 4FXGH 3UNRA 1A5HA 1O37A 5F03A 5T3HA 2YNBA 1C2GA 4ABJA 4XBDA 2BX3A 2A4GA 1FIZA 2AMDA 2JJ2D 5EPNA 1KDQA 5HIYA 3GCNA 1DM4B 1E79D 3P6ZB 1GHAF 1W12U 2R9PA 5DP8A 4CR5A 2VIDA 5C1UA 4LOYH 3AK5A 1VCWA 1MQ6A 1TOCB 4UEHH 2FX6A 1KLTA 1DWBH 2ZDLA 4GHQA 2VVUA 1TONA 1ABJH 3URDA 4F4OC 2ZFRH 1O3OA 2RG3A 2IJOB 3SJ8A 4NFFA 1LHCH 3GY6A 2BHGA 3RXKA 5C2ZA 1EAIA 4IN2A 6CHAB 3GDUA 3KQDA 2ZDMA 4ZUHA 4YT7H 1QBNA 3SU4A 1BJUA 4IGDA 3M7UA 2VIWA 1P9SA 2KCAA 7ESTE 4X6OA 5K0HA 5LPEA 1E38B 1OWKA 3T27A 1ZMNA 1SQOA 1SVPA 4CBNA 1SGIB 1O39A 2QN5T 1C5PA 2W26A 1JOUB 1IOEA 1VGCB 4X6PA 3RP2A 4A7IB 1QFKH 3F68H 3QTOH 4F49A 1HAIH 1H8DH 3QO6A 3SBKA 2HNTC 1SOZA 3FZDA 2A1DB 1QA0A 1SBWA 1GBFA 1GPZA 1GJ9B 1RTLA 4AFUA 2C8ZB 3DSOA 2SGQE 4ACAA 1TOMH 1CVWH 3CS7A 4A5TS 3TNSA 4CRBA 3GCOA 1OWIA 1O3PB 3RM0H 1BTPA 1TQ0B 1ZTJA 1MCTA 1QNJA 3MNBA 3NZIA 1LPZB 1F0UA 1QJ6B 3LIWA 3P70B 1ELCA 1NY22 2VIPA 1DY8A 2ANKH 2VVCA 3UQVA 1GMHF 4I86A 1C2MA 1LVYA 3ITIA 1L1JA 3O8BA 3RXSA 2P94A 1B7XB 2ZZUH 1S85A 2D1JA 3OAAD 2B7DH 3SZNA 1L4ZA 2ZF0H 3E16B 1ZSKA 5F53A 3RC6A 2A4QA 3TJNA 2ZWLH 1ZPCA 1K22H 2A45B 3U8RH 4B73A 3RXDA 1BRCE 1TABE 1C2LA 3SORA 2G00A 4NG9H 1C1RA 2JH6D 2CF9H 4YLQH 3DSGA 1HDTH 4IMZA 1YYY1 1C5WB 1EX3A 2GP9B 3GYLB 1SGRE 1S5SA 5GCHG 2BQWB 4Y71A 4A6LA 1G3DA 1TNKA 3I29A 2VNTA 1N8OC 1SQTA 4Q2KA 4LZ1H 2XBYA 5DP4A 2A7CA 2HALA 5AHGH 1BTYA 1XXFA 3ZZ5A 4ABFA 1YPLH 1AUJA 2XRCA 2QE7D 3SGBE 1GI3A 3ZV8A 4AFQA 2FESH 1C2IA 3KQBA 1HV7A 3KCGH 2TPIZ 4I7YH 4ASHA 3MTYA 2KAIB 4J2YB 1QCPA 1DY9A 5AF9H 1ZRKA 8KME2 1G3BA 1YPJH 4WWYA 2XTTB 2OC7A 2VGCC 3SV8A 1GJCB 1O2KA 2ZPSA 4IC6A 1C2JA 4K1EA 3VB7A 3MU1A 1GBCA 1TFXA 1EZUC 3U28C 3ZVCA 1IQHA 1JBUH 3TK5A 2W5EA 3BSQA 2Y80A 2GCHG 2ZI2H 2A5IA 1YCPK 3S7HB 2UUKB 1FJSA 4H6TA 1SL3A 6LPRA 3OU0A 2O8WA 5EODA 5SGAE 1GHWH 4CR9A 1O2MA 1QY6A 3BG4B 1MKWH 2OQ5A 2P8OB 5FCKA 1NTPA 2RA0A 1PYTD 1O2WA 3VEQB 4NA7A 3BEIB 1FONA 1J15A 2PFEA 4DJZB 2A5KA 2BLOA 1T8OA 5C94A 3ZVAA 3LONA 5J4SA 5DP7A 1GMCG 1V2RT 1BTHH 1A5IA 3FVFB 3IWMA 1E1QD 3R0FA 4AZ2B 2CV3A 2C90B 4D76A 6GCHG 3ZVDA 4I31A 3BIUH 1DICA 3AAUA 5HYOA 5IK2D 1EXFA 1Q31A 1A3BH 3K2UA 1O3LA 2GT7A 3RXJA 2B9LA 1Y8TA 3F3BA 4X1RU 4FU9A 4I8GA 4ZKRU 4BAHB 1C1TA 1P2MA 2UWLA 2O8UA 5L2ZH 1GHYH 4YESB 1VITH 1A61H 1N8OB 2XCNA 5ABWA 2ZDVH 2QF4A 1P57B 1PQ7A 2WV4A 1UK2A 5AFYH 2Z3DA 5A0CA 2ZU3A 1DOJA 5KGOA 3EAJA 3SO3A 2WPKS 1L2EA 2EI6A 1ANDA 1TE0A 3WW7A 6GCHF 4X2VA 1V2WT 5L6NH 4IS5A 3VG8A 3ZVBA 2QGRA 1VCPA 4YZUA 1GMDF 5H4IB 2VGCB 3KF2A 3SUGA 1H8ED 2EI7A 3QGJA 5FL7D 3S9AA 2FIRH 3PRBA 1RGQA 5DP9A 2GDEH 1BMAA 5E0HA 4F55A 1AKSB 1ARCA 1UO6A 5A09A 1ZHPA 1NRQH 4ABHA 4ZCNA 1F5KU 3EA9A 1DDJA 1ETTH 2ZFTA 2HGTH 4UDWH 2G81E 3LGWA 3RU4D 1NU9A 3F0OA 1RIWC 4MDSA 5L30H 3ATLA 4AORA 4CRFA 1ZZZA 4GPGA 5C5OA 3S9BA 2LELA 2WV5A 4LK4A 1GHVH 1NRRH 3TH2H 3OE7D 3WWBA 1OOKB 2G4UA 1EZQA 4IMQA 5F8ZA 3P17H 3ATKA 3D49H 1BBRK 5E2OA 4X8SH 2RDLA 2ZHQH 1G37A 1QZ8A 3JZ2B 4UD9H 5DSFA 1O31A 3LDXH 3BTWE 9ESTA 2FZZA 3RMNH 2ZHWH 2F9OA 1XX9A 4MNWA 2OP9A 3M7TA 4B76A 1WQSA 1CGIE 1BT7A 1TB6H 5F6MA 3F9FA 3LC5A 2H9HA 3A86A 2ZCHP 1J16A 1ELAA 2NU4E 3B9FH 2GD4B 2V35A 1QL8A 5AVDA 1YBWA 2TBSA
chains in the Genus database with same CATH topology
1DWDH 5C3NA 1GHBF 3QZQA 1NU7B 1T7CA 1O5CB 2HRVA 2GDDA 5TJXA 1EB2A 3MU5A 4B2CA 3SV7A 2F9BH 1GBMA 3LH1A 3MNCA 4YOGA 1KXCA 2P16A 1O2IA 3VXEH 2I6SA 3RC4A 4DY7B 1BHXF 1OP0A 1ACBE 1H9LB 4K8BA 3SV2H 3E90B 2QYIA 1WAYB 1AE8H 1RIWB 4OGXA 3T25A 1MU8B 3QLPH 3E91A 1N6XA 4B2BA 1Z6JH 2PR3A 2TRMA 3DT0H 1TGSZ 3LGVA 3CP7A 4QT8C 5HXFA 3T29A 2CXVA 2O8LA 3HKJB 4O3TA 2PTCE 1H9IE 1XVOA 2QF3A 4XOJA 2Z9JA 5A8ZA 2B0FA 3RXIA 3TGIE 2SGAA 1K1JA 2G51A 5GXPA 1UCYE 2OINA 1IAUA 4WF8A 3A84A 4AN7A 4CRCA 3OSYA 1SPJA 2P3TB 1RTFB 1WU1A 1PFXC 3UFAA 2IOTA 1TRYA 1ANEA 2OLGA 3ZVFA 3BTHE 1V2JT 2ZFFH 1C5XB 1UVTH 3ELAH 2UUYA 1DWCH 2H1UA 3S7KB 1GBIA 1V2LT 1AKSA 3RXEA 1DLKB 1KTTB 3QGNB 3ZZAA 1O2HA 1P02A 3SI4H 4SGBE 1QRXA 4Y7BA 4RKJB 3QWCH 4I32A 1YM0A 1TWXB 1S82A 2AFQB 2ZGBH 4K8YA 1BQYA 4NFEA 2VIOA 1NZQH 1MTUA 2FI4E 1QL9A 2FDAA 4RSPA 2XBVA 1VZQH 1ZJDA 1O5FH 3V0XA 1WOFA 1ANCA 7LPRA 1OS8A 1GL0E 1O3FA 3NPSA 5E0GA 4BNRA 1CGJE 1LCYA 3BEUA 1A3EH 3DUXH 1LVOA 5CHAB 4AOQA 3Q76A 3BTFE 3IG6B 4O03A 3RLYH 4MTBA 1RFNA 3Q00A 3BEFB 1C2EA 3PM3A 2FLBH 1AWHB 3MO3A 4OS4A 5E8EH 3L33A 1QJ7B 2W7SA 2Y82A 3VXFH 4A1VA 1UTKA 3A89A 3QDZB 2GZ9A 1O2YA 1SLVB 1O2NA 5GDSH 5TCAA 5EU8A 4BXWA 2Z9GA 3GDVA 1C4U2 1W7XH 1C1OA 5C1YA 2ZDKA 4YOJA 1SFIA 2PWXA 2ZG0H 3E0NB 1TYNA 2FYRA 3M3VA 5A8YA 3U9AH 3P8GA 3STIA 1BA8B 5GJ4B 2VWMA 1O3NA 1O3AA 3OYPA 1HAXB 1XXDA 3ESTA 2IN2A 1OYQA 2R2WU 1HAGE 2ZDAH 1ZMJA 2BZAA 5FPSA 4TWWA 3UWIA 5I46H 2G52A 1CHGA 4YM9A 5DKMA 1TGCA 1HXEH 1LMWB 1FLEE 1UTJA 2CF8H 3A7TA 1Z6EA 2WPIS 1HCGA 1GJAB 2HPPH 1GL1A 4Y76A 1YPGH 3F9EA 5FAHA 4NIWA 1T4VH 1YP9A 5JBTA 2XXLA 3PWCA 4OS2A 3A80A 4B75A 1IHSH 1AMHA 1V2MT 4YTAA 3HATH 1O38A 3F6UH 2JH5D 4JK5A 1QB9A 3EQ0H 3E0PB 4JK6A 1W10U 1HB0B 1RS0A 4H42U 4D8NA 1O3EA 4WMFA 3ZZ3A 5DK1A 2F9UA 1NPMA 1A0JA 5EOKA 1MD7A 4BAQB 5FCRA 1EQ9A 1IQMA 1DVAH 1GWAA 5JBCS 3HK6B 3JZ1B 1GI9B 1GJ8B 5LPRA 2G5VA 1WCZA 1C5TA 1NC6A 3A8AA 1TAWA 1HNEE 5FBEA 3AW0A 4I8KA 5CE1A 1ESAA 1PQ5A 1YLCA 1BMMH 1NFXA 2J9NA 1GHAG 2BTCE 3SQEE 2G5NA 3PROA 1CT0E 4TY7A 1MD8A 3MFJA 2D26C 1UCYH 2BXTH 4LXBH 3TH4H 1B5GH 3T28A 3TPIZ 1V2QT 4XSKU 3ODDA 3VFEA 1O3GA 2Y5HA 1TIOA 1C5SA 4AG2A 3V12A 1V2NT 4KTSA 4GCHF 1GJBB 1K28D 2PSXA 4ZXXH 2OUAA 2FI5E 1S6HA 1F5RA 2DUCA 1LPKB 1GDQA 2SNVA 4OS7A 2FOCA 1Q2WA 3RC5A 1XM1A 3RU4T 4O97A 1YKTA 1DFPA 3EA8A 1XMNB 1BRBE 1MH0A 1SGQE 3UY9A 1JRTA 3ZYEA 5JYIA 2FTLE 2J92A 3U1IB 3UUZA 1DLEA 1PPCE 4ABAA 3PMBB 1AU8A 3SV9A 3SU1A 4JYUH 1S81A 2QF0A 1UHBB 4X2XA 3S0NA 2OC8A 1O5EH 3RXBA 4YOIA 5JPMH 1XUJA 2PLXA 3KEEA 4K1TA 4THNH 3SJ9A 4DVAU 1NFWA 5LPFA 3M5OA 1NRSH 3SU0A 4OGYA 4NIXA 5TCCA 1RJXB 4O9VA 2BOKA 1GMHG 3MHWU 4TYDA 4B1TA 1HFDA 3GY3A 4JZEH 1MMJN 1AVGH 4X1NU 4FUDA 4ABGA 1W3CA 3LKWA 3D65E 3PO1C 2R0LA 3M61U 2CGAA 1YPKH 4K3JA 1HJ8A 4H6SB 2CMYA 5EQRA 2J38A 2P59A 1KYNA 3QTVH 1V2OT 4IC5A 1GBKA 2XBWA 4INKA 4WH6A 1SGTA 3E6PH 4HZHA 2AH4X 3MH5A 1NN6A 4AFZA 3UR9A 1K1LA 1KXFA 2VWNA 1CBWB 1W0ZU 2ZFSA 3PTNA 3Q3YA 5EXNA 1LHFH 3ENSB 4WXIA 1O5DH 1C5VA 1FY1A 1TLDA 4Y6DA 3SV6A 1MKXK 1C2KA 4X8VH 3TJUA 1CSOE 3KN2A 2ASUB 2FO9A 2ALPA 1O35A 2ANWA 3UREA 1ZTKA 2SGPE 3UOPA 2Y5GA 3M35A 1HJAC 4Z0KA 2BZ6H 1T31A 1SOTA 1NROH 2C8WB 2STBE 1QTFA 4ZKNU 1AVXA 1SHHB 3RUOA 3A83A 2BDCA 3QN7A 4AGKA 1GDNA 1GI2A 4CRAA 2BQ7B 1HAOH 1P11E 3SNAA 1TNJA 1LQDB 1LVMA 3GICB 3RXGA 4ESTE 3A81A 2OBQA 2GZ8A 4Y0YE 1IQKA 3AW1A 2GZ7A 4I8HA 1V2KT 2Y7XA 4UFDH 2WINI 4A1XA 4KELA 4AB8A 1AN1E 1UK4A 1MTWA 4E06H 1QB6A 1QBOA 1GVLA 1CU1A 5CMXH 1L4DA 1ZHMA 1GJ5H 1LKBA 3PB1E 3U8OH 2BLWA 2ODYB 1EPTA 1A46H 3RXPA 1TPPA 1KXBA 4X1SU 3PO1B 5EXMA 1AVWA 1CGHA 4KKDA 3Q3KA 3OX7U 1UTNA 1C1SA 3NCLA 3R3GB 4U01A 3SJKA 4Q80A 1AZZA 2R3YA 4GUXA 2TIOA 5EGMA 3E3TA 5FBIA 3MI4A 4ISLA 1C5UA 2OBOA 1OXGA 2VINA 2C4FH 4MLFB 4B2AA 4WVPE 1YGCH 4BAMB 2ODPA 3IITA 3M3TA 4NIYA 5IYTA 4ZROA 1BRUP 4PROA 3P8FA 3SNEA 3DA9B 1BTXA 2AMQA 3QK1A 1P2QA 3NUMA 4GLYA 3W94A 3A8CA 1Q3XA 1G36A 1C9PA 2SFAA 3E8LA 1ABIH 2R2MB 2EA3A 3M5LA 4BOHA 2Z3EA 1UHBA 1UTMA 2ZGXH 3MNSA 4Q7XA 1ELDE 4WH8A 2WPHS 3PMAB 3DFJA 4UFEH 3P8OA 4JMYA 1GMDG 1C2HA 1O2UA 2NU1E 2WUCA 2PHBA 2QXGA 5LH8A 3TGKE 4HFPB 3Q3XA 1O2RA 1CA0C 3OTJE 4DOQA 1MQ5A 3K6YA 4UFFH 4Y79A 2PGQB 1SHYA 3O8RA 1MCVA 1AFQC 2F91A 3D62A 1BIOA 1GBTA 1TALA 2RCEA 3PYHA 2GV7A 1O3JA 2YOLA 3RXVA 1BB0B 1OP8A 2HPQH 4IBLH 4AYYB 1QRWA 1GGDC 2NWNA 1P04A 1O2JA 5JBBS 1AO5A 1NRPH 1VJAU 1KY9A 3LGTA 2FPZA 1IQFA 1MAYA 1HXFH 3SU3A 4GVUA 4I8LA 1G3EA 2XWAA 2QXJA 1CE5A 3KQCA 2J4IA 1O5BB 2BLQA 2GMTC 1TPAE 5FX6A 4HI3A 5FX5A 1O3BA 2FX4A 2FS9A 1HAYB 1TNLA 1NESE 1FIWA 1T8NA 1GJ4H 3A7XA 3FP8E 3HGPA 1HLTH 4GAWA 2CN0H 1DPOA 4NSYA 1TNHA 1A2CH 2GV6A 3G01A 2V3OH 1UK3A 1K1MA 1J9CH 1A4WH 1DX5M 2WPLS 3A88A 3SW2B 4AFSA 4BTIB 2OQUA 1O30A 1TMTH 5F8TA 1EJNA 1K1IA 1YLDA 4I33A 2BDAA 1O3DA 1BDAA 4ZHLU 1SB1H 3SHCH 4DGJA 3BN9A 5C5NA 7GCHF 1GHBG 1HRTH 1Y59T 2H9EH 1HBTH 2V3HH 4Y8YA 1J17T 3RXRA 2EI8A 4YLUA 2VWLA 1EOLA 3PLBA 2ZECA 2KAIA 3GCTG 5ESBA 5L2YH 2SNWA 1CA0B 1P10A 3PV4A 2ZTZA 1AFQB 4ZMAH 1AGJA 4B74A 1BHXB 1O2VA 4FUIA 2BVRH 3KQEA 7KMEH 1N6YA 3N7OA 1PJPA 4FVDA 2QY0B 1FV9A 2OXSA 1C2FA 1ZSJA 4HTCH 1VJ9U 2QA9E 4JZFH 1BTZA 1TBZH 1HJ9A 2A0QB 1YC0A 1SGFG 2ZTYA 5E0JA 1KLIH 1E0FD 2AEIH 1TX7A 1UJ1A 5DG6A 1GVZA 1ZJKA 4MQAA 2F9VA 3GCTF 5FPTA 3CENA 2GMTB 4R0IA 4NZQA 3RXLA 3RM2H 2XC5A 2VH6A 5B6OA 2ZEBA 1O2TA 4AX9H 3MH6A 4JCNA 1TBQH 1THSH 2ZP0H 2BYAX 1OWHA 2FOBA 1ELTA 1TMUH 2HWLB 2PGBB 1MBMA 1TBRH 1F0RA 2ZA5A 4OS1A 3TNTA 2XC4A 2ZO3H 1P8VC 1Z8JB 2PV9B 5I25A 1GBHA 1MKWK 2XNIA 2UWPA 1GHXH 1H8IH 2BDIA 2BD8A 1O2QA 1W13U 2AGGX 1C1NA 1TGNA 2Z6BD 1O3KA 4Y10E 1FDPA 1V2PT 1WV7H 1UVSH 1VR1H 5F8XA 3E1XB 3RXFA 1S0QA 2A7HA 2THFB 2Y5FA 2YNAA 2NU2E 1E35B 1Y3UA 3I78A 1EAWA 1O3MA 2Q6DA 3ZZ7A 2AERH 1O36A 1EJMA 3DHKH 3RXAA 5EXLA 3TK6A 2ZKSA 1MTVA 5EQSA 3K65B 2F9PA 2ZHEH 2EEKA 1WUNH 3FP6E 3F1SB 3KNXA 1GBAA 5LGOA 1Z8RA 3KGPA 4IN1A 1FZZA 3LC3A 3A7YA 3GY4A 4MNXA 1HYLA 1UTOA 8GCHF 1SGEE 2GCTC 2ZHFH 4K69A 1S0RA 2TGDA 1BTWA 3QX5H 3AVZA 2FOFA 4NSVA 4ZHMU 1WTHD 3BV9B 2H5DA 2BD5A 1CHOF 1D3DB 4AYVB 3PTBA 1UTPA 3NWUA 1PPEE 2SGDE 1T4UH 4NGAH 4ISIH 1P2IA 1C5RA 1GHZA 1M9UA 1OWDA 1GJDB 2P3UB 1GBBA 1P01A 2BDGA 3AASA 5HMAA 5T6GA 1C5QA 4WY3A 2J95A 3UPEA 4BAOB 1SFQB 1EOJA 1PYTC 4VGCC 1YPMH 2K1QA 2NU3E 2J34A 1P3CA 4X0WU 3TIUA 2BY7X 1LKAA 1OSSA 2D8WA 1FY5A 1ZPZA 4UONA 1GJ6A 3SUEA 2V0BA 1BMNH 3U8TH 1MAXA 3PLPA 1XVMA 2STAE 3TH3H 2B5TB 2H6MA 1O2OA 1IQNA 1A0HB 3O8CA 3S9CA 3C1KA 2BD9A 4ZAEA 3BTEE 3Q77A 4NA9H 1DANH 1D3PB 5C1XA 3U1JB 3V3MA 3OY6U 2FTMA 1Z1IA 4FUCA 2SGEE 1GI5A 3A82A 3EGKH 1K1NA 1G9IE 3LJJA 1C9TA 1Y3VA 4Y8XA 1CT4E 3MO9A 2GCTB 1G2MA 3SN8A 1P03A 3UTUH 1BBRE 1P05A 1QGFA 1C2DA 1V6DA 3TLOA 1AHTH 1GI4A 4BAKB 1QA7A 3A7WA 3F9HA 3ZYDA 5EPYA 2BM2A 3MU8A 2BY9X 3ZZDA 2ZU5A 1TA2A 1IQLA 1T8MA 3LGUA 2BD3A 5FXLA 1O3HA 3GISB 9LPRA 1J14A 3UOUA 2BVXH 3ATWA 4GCHG 1UVOA 2ALVA 2P3FH 3PLKA 1PPBH 3GY8A 3LT3A 3M37A 3M5MA 2Z94A 2HOBA 4FVBA 1H4WA 2C3SA 5DPAA 1GI1A 2QXIA 2PW8H 3B23B 3T26A 1P2NA 4X6NA 4BXSA 3MWIU 2FOMB 1NO9H 1PPFE 1AZ8A 2ILNA 3TU7H 4VGCB 2M5TA 4WJG2 1XUKA 2Z9KA 1TNIA 3MMGA 4MPWA 1ELGA 1NT1A 3RXTA 4BANB 4K5ZA 2AYWA 1LHEH 3KL6A 1AQ7A 4BTTB 1Y3WA 4SGAE 1IHTH 2Y6TA 4X8TH 1GG6C 2WPJS 2PSYA 2ZPRA 1ZTLA 3FP7E 1SLWB 5C20A 1ANBA 3VPKA 2XW9A 5DP5A 3RXOA 2O8TA 4FUEA 2BDHA 3ZZCA 1JXPA 1YCPH 1K9OE 2Z9IA 4FUFA 1LO6A 1SGDE 4XBCA 2Z3CA 1U6QA 3RXMA 3TJVA 3LH3A 2I6QA 4DG4A 3EE0B 2A7JA 3RMLH 3STJA 2GKVE 2TGPZ 1EKBB 1YCPM 4MNYA 1D4PB 1O2SA 3T5FH 2CHAC 2UUJB 4MPXA 3LOXA 5GPIB 5FPYA 1WQVH 1VITG 5BPEA 3RXHA 3F9GA 1TA6A 1G32B 1C1WH 1ETRH 3SHAH 1YPEH 4WMDA 1C5LH 3BIVH 1BITA 1TPOA 3VB3A 5ETXA 4DURA 4KTUA 1BOQA 5HM2A 1MTNC 5DJ7A 4E05H 2ZCLP 3GYMA 1IQEA 3HKIB 2WUBA 1T32A 1T8LA 4AB9A 1SGCA 2F83A 4E7RG 3CS0A 4M7GA 1C4Y2 1FQ3A 2VIQA 1FY4A 4FUGA 1S6FA 2FXRA 1WBGB 3MOCA 1AUTC 1LPGB 1EAXA 4ZKOU 3BTME 5HGGA 4Y7AA 1VITF 3U69H 3UQOA 2Q6GA 1P2KA 1ID5H 1GG6B 1FN8A 1BRAA 1OX1A 1Y5AT 3NXPA 4ABBA 2FYQA 5GIBA 2QV1A