1O2KA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2kA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2kA02
4FU8A 1C1OA 1PJPA 1Y3WA 3MI4A 1XXFA 3T5FH 1KSNA 2OTVA 2EI6A 2ANWA 1BJUA 5E0HA 3VXFH 2OQ5A 4NIWA 3MNSA 1C1RA 3F68H 1A0HB 1XX9A 2FYRA 5DO4H 4Y79A 4NWLA 1UO6A 3P6ZB 3NPSA 1GVKB 1XKAC 2B7DH 1IQKA 2GV7A 1QURH 3LGIA 5C5NA 1F0TA 3A88A 1QNJA 2GCTC 3ODFA 2Q6DA 1WOFA 1TOMH 4H4FA 1PYTC 3MU5A 1RXPA 3SV8A 3A7YA 4NIXA 1SOZA 1IQMA 4YOIA 2FOHA 4XOJA 1W10U 3EA8A 1BUIA 5E2OA 1QB6A 1NRRH 1LMWB 1KY9A 2ZA5A 1DY9A 3RDZA 5T6DA 1NS3A 1FPCH 1ABIH 1WUNH 4MVNA 4X6MA 1WBGB 1HFDA 4AFUA 3BTWE 1GJDB 2ZTZA 2AIQA 3RMLH 1WQVH 3O8BA 3ZZ4A 1MD7A 3UOUA 4GSOA 1O3IA 2SFAA 5PTPA 2QY0B 3TGIE 1QY6A 1AD8H 1OX1A 4MPXA 4WMDA 2FI5E 4WJG2 3M61U 1PPHE 1TNHA 3ZVGA 1ESTA 1BTYA 2TGPZ 4K1EA 4ABGA 4Y6DA 4ZKOU 1SFQB 5EW2H 2J94A 3EQ0H 5JBCS 1N6XA 2SGAA 1A3EH 2PWXA 2FS8A 2FMJA 3CS7A 4OS6A 2GDDA 5HM2A 3ATLA 1EKBB 1P02A 2QIQA 3OU0A 3PMJA 2OD3B 3SI4H 1BA8B 1O3AA 3P8NA 1VCWA 1TRNA 4R8TB 2OBOA 4WMFA 1O5DH 4K2YA 1CT4E 1GGDC 1Y5BT 3MHWU 1OWEA 1YF4A 3ENSB 2ZCLP 3PTBA 1NFWA 1C2IA 3MH5A 2H9EH 3ZVDA 4ZKNU 8GCHF 2HLCA 3ATMA 3RXLA 1HJAB 2ZFRH 2XBYA 2B0FA 2CF9H 2P3FH 2OUAA 1FY8E 2ZI2H 2FOCA 2ZHWH 4BANB 4Y76A 5F8XA 3SUGA 2A5IA 2ZKSA 1O31A 5EPYA 2P59A 2ZFPH 3RUOA 1V2PT 2A32A 2FWWA 2VB0A 5DGJA 3RXGA 2PHBA 1M9UA 4FXGH 1BZXE 1ZTKA 4NWKA 1FONA 1VITG 1EATA 4CRGA 3PLKA 4HFPB 1ZMNA 4U01A 1QR3E 1K1PA 1C9TA 1GBBA 1X7AC 2QN5T 2V35A 2ZPRA 1NM6A 4ABJA 3F9FA 1BRBE 2VNTA 2WYGA 1DWEH 3EA9A 4FUFA 1DXWA 1BMLA 1L4ZA 3ZVFA 4X8SH 1SG8B 2A5KA 1UTOA 1OPHB 3KN2A 2W26A 3LKWA 3CP7A 2F9BH 1DPOA 4XE4A 2Q1JA 3MMGA 2YNAA 4ZAEA 1XUHA 2CF8H 4FUGA 2GDEH 4JK6A 3SU0A 1FI8A 2BY8X 4B71A 4LZ1H 5JYIA 2JETC 2VINA 1GJAB 1EAWA 1C5YB 1BTUA 3KGPA 1DY8A 8LPRA 3TJOA 1PFXC 1D6WA 3PLPA 2C8YB 2FOAA 1MBMA 2ZGJA 3TJNA 3K65B 1GMHF 4X8VH 1EPTA 2GCHG 5G4BA 2VH6A 3S9BA 2BD2A 4LK4A 3EA7A 1TPPA 2M5TA 2PKSC 3FZDA 4A6LA 2G81E 1NPMA 1FUJA 1MZDA 2PKAA 2HALA 1YPLH 2BVRH 1S84A 3A84A 1SGCA 2ZDKA 2ZZUH 3M35A 1TX6A 1B5GH 3K6ZA 1GDQA 1WTHD 2ZU4A 1AVWA 2V3OH 3UTUH 1ACBE 5AFZH 3O8RA 1BIOA 2ZO3H 4KKDA 1GBMA 4WVPE 1TPOA 1FIZA 2OP9A 3Q00A 1WU1A 2PGQB 5K7RA 4M7GA 1C5MD 1Z6EA 5J4QA 2UUYA 1O5EH 1C4Y2 3UFAA 5AFYH 1OS8A 1BRUP 1AWHB 1FY4A 3GCHB 5C1XA 4FU9A 7GCHF 2ZECA 1NRPH 1VJAU 1V2RT 1A5HA 1C5WB 2WPMS 3PWBA 1HAXB 2QF3A 5FBEA 4MNWA 5GCHG 3M5OA 3E0PB 4BNRA 1SVPA 2Z9GA 3NCLA 4IMZA 1PYTD 1F7ZA 1CA0C 4MNYA 1GHAG 1AQ7A 3T28A 1THSH 4LZ4B 2GZ8A 4HTCH 1WAYB 1TNJA 1CT2E 1D3TB 1MTNC 1O32A 1SGPE 3QLPH 1O2UA 2HNTE 2R0KA 2FO9A 1LCYA 3IWMA 4AFZA 1XUGA 2SGPE 7ESTE 2WPHS 1HGTH 2OC8A 2BY7X 1O36A 3GDSA 4IN2A 1UVUH 1S6FA 5EW1H 2W7SA 4OS2A 2R2WU 3SGBE 4B76A 4YESB 4ABFA 3TGKE 2A4QA 2UWLA 1UVPA 3BTDE 3LOXA 2QXJA 1FV9A 2NWNA 2Y5HA 1K1IA 1P01A 3MU4A 1JIRA 1ZPBA 1T7CA 3V3MA 1T8MA 4D7GA 3LT3A 2FOEA 1EAIA 3BV9B 1CVWH 3RXUA 2ZDAH 2O9QA 3A8DA 2EA3A 4ZKRU 2ZNKH 1ETRH 5F6MA 3RC4A 3T26A 3PWCA 4NFEA 2AMQA 2STBE 1EB2A 1GMDG 2HPPH 2GCTB 1V2LT 1D3DB 1HIAB 1ID5H 2FZZA 2BY9X 1S5SA 1V2WT 3DFJA 1EZUC 3RXFA 3TH4H 4BXSA 3TU7H 5A0BA 2W7UA 4X2YA 3F9GA 1GJ5H 4I33A 2QF0A 1O30A 1TMBH 1L0ZA 1EJAA 4DGJA 5I25A 2H9TH 4X2WA 3FZZA 1SLXB 4J2YB 5HM9A 5FPTA 2GKVE 5AVDA 3T27A 1BTPA 3GDVA 1AIXH 1JIMA 5F03A 1Y3UA 1IQGA 1FZZA 3RXQA 2LPRA 4B75A 1O2RA 3UWIA 1O2MA 1QJ1B 2H2ZA 1S85A 1NRQH 1U6QA 4DIHH 6CHAC 1F92A 3Q3KA 2BLQA 4RN6A 4OGXA 2F9VA 1HJ8A 2NU3E 1ORFA 1CBWC 1ELFA 1SHHB 1P3CA 1O2GH 2F3CE 4NZQA 1LHEH 2ZU2A 4NGAH 5LH8A 1F5RA 3NXPA 4Y10E 5E0JA 3SNCA 1O33A 5FPSA 3SGAE 1W7GH 1MMJN 5JPMH 1DWDH 1UHBB 2A45B 3E91A 1D3QB 2CMYA 4GAWA 3SU6A 3ZZ6A 1TQ0B 1W0ZU 2PV9B 3A82A 2AGEX 2V0BA 5GPIB 5LGOA 1N6YA 2BLWA 2RA3A 1AE5A 1GGDB 1P2IA 4ABEA 1D6RA 3P92A 4J1YA 1O2ZA 1O2VA 1P0SH 2GP9B 4INKA 4UE7H 2V6NA 1BHXF 1AKSB 2HNTC 4IN1A 1GBFA 2Z7FE 1WYKA 4A1TA 1J8AA 1H8IH 3UR9A 2IN2A 1C5XB 1RIWC 5C2ZA 4RKJB 3UR6A 5EODA 4UFDH 4GVUA 4CBNA 2CHAC 2ALVA 2ODPA 5DP3A 3ZVAA 2QXGA 3MO9A 1HBTH 2H5CA 2XC4A 4IC6A 5EGMA 4NIVA 3F9HA 1MD8A 2ZCKP 1O2OA 3P8OA 3GCTF 3M5NA 1A2CH 1O3OA 3M7TA 3OX7U 4THNH 1EQ9A 3VB6A 1O2YA 2VIQA 1DICA 1C1NA 3TNSA 3QUMP 1Z1IA 3VGCC 1GBAA 1OYTH 4DVAU 3Q3YA 1H4WA 3QZRA 4DJZB 4ZHMU 2A0QB 5C20A 2BHGA 4FUHA 3SUDA 3QWCH 4CR5A 5EXNA 4NCYA 4TYDA 4JYVH 1FNIA 4I31A 1EAUA 2WPJS 1S83A 2DUCA 3GY6A 3BG4C 1GBLA 1EPTC 1QRWA 1OP0A 1SQTA 4LOYH 4WH6A 1LVYA 2OLGA 1KDQA 1W12U 1MZAA 3E6PH 1C2MA 4JZDH 1TABE 2LNCA 1RRKA 2JETB 5LPFA 1CGHA 3SU3A 3UNSA 3ZZ5A 2J4IA 1O35A 1C2HA 2PUXB 3GOVB 3K6YA 1C4U2 4XBDA 2O8WA 5T3HA 2A2XH 1ZMLA 1AUJA 1ZTLA 2VJ1A 5FX5A 1PQ5A 2FYQA 3PYHA 1GMCG 1O38A 1LVOA 3GY5A 1WSSH 4I7YH 3LU9B 1V2NT 2P93A 2PKSB 4DW2U 4FUJA 3MH4A 5ABWA 2G5NA 2HGTH 2ZDMA 4WH8A 3GYMA 1C1SA 4WXVA 2XNIA 4ZROA 2VIOA 1SL3A 3VXEH 1QQ4A 1PPFE 1DFPA 1GI8B 1GHBG 1C2JA 1C5UA 1IQIA 1SOTA 5GDSH 4E7RG 1C1MA 3O8CA 1RTFB 1TBZH 1CGJE 1YPEH 1UJ1A 1HAVA 1OWHA 1DWBH 3U1JB 4YOGA 2R3YA 1TNKA 1TNIA 2BZAA 2H6MA 2OINA 1TALA 4MPWA 3WY8A 9LPRA 5A2MH 3PMAB 1GVLA 5GJ4B 5K0HA 1GBHA 4I8KA 1SHYA 2BMGB 2BD3A 4I8HA 1G2LA 2KAIB 2BX4A 1DUEA 1ZHPA 1FLEE 2WV5A 3T25A 1XVOA 1ZPCA 1O2QA 1HAGE 1BMNH 1ANBA 3U69H 2BZ6H 1CA0B 3MU8A 4XDEA 3LJOA 2V3HH 1S0QA 1GBCA 3TGJE 1PPBH 1RD3B 2OQUA 3P95A 4ISHH 2ZPSA 4GCHF 1VITF 2I6SA 3BTFE 3TK5A 3LGUA 1EB1H 2BX3A 1GBKA 1BDAA 2F9PA 1N8OC 1EJNA 1KTSB 2XBVA 2IPHA 3OYPA 2FI4E 4TWYA 1BMMH 2A4RA 1T8NA 2ZFQH 4AFQA 4ZKSU 4FUIA 1C5QA 1O2LA 5FCKA 3RU4E 2VIWA 1LVMA 1LO6A 3RXVA 4IC5A 3C1KA 1ZLRA 1ZMJA 3OY5U 3E0NB 2F9UA 1GI0A 1HRTH 1LPGB 2ESTE 5CMXH 4BAKB 4O97A 3IG6B 2FP7B 2QAAA 3LJJA 3LC3A 3LC5A 4K1SA 1TOCB 4BTIB 3GICB 4XFQA 3KQDA 1LHCH 1UMAH 1MAXA 6ESTA 3BEUA 4HI3A 5DP9A 4Q80A 4MLFB 4X8TH 2ODQA 4KTSA 1AVGH 3U8TH 3M37A 1DLEA 1O0DH 1GWAA 4CRAA 1JBUH 1QRZA 4CBOA 5A0AE 3A87A 3BTME 4NA9H 2AYWA 1ANCA 1ELGA 1PQ8A 3LDXH 3TVJB 1G36A 3SJKA 1MTWA 3GCNA 5I46H 1ZSKA 3SV2H 3HKJB 2SGEE 2ZTXA 3MU0A 2PGBB 1H9IE 3SNDA 3RM0H 3ZZ7A 3ZZBA 2EI7A 3MYWA 4AGJA 4BAHB 1Z1JA 3RXKA 2UWOA 3ATIA 1S82A 1FXYA 3SU2A 1O3HA 4ISIH 8ESTE 3O8DA 1A61H 4HGCA 2D8WA 3SNBA 5CE1A 1MTVA 1QL7A 5DJ7A 3ZYDA 1O3CA 4KGAA 1O2WA 3I29A 1ZSLA 3ZZ9A 1TGBA 3ELAH 4FUBA 6CHAB 1SGRE 4MNXA 3I77A 5BRRE 4H42U 1LVBA 1CBWB 3MO6A 4AG1A 1T4UH 4CR9A 1HAHH 4X1RU 5EQSA 5E8EH 4K60A 1V2KT 2TIOA 3LIWA 2ZCHP 4TY6A 2XTTB 4KP0A 1LHDH 2W5EA 2PUQH 5FCRA 2G55A 2Q6GA 1GG6C 2SNVA 1GHAF 3A8BA 4DCDA 3A81A 1GBDA 4Q2KA 4B73A 3EGKH 1GJ7B 1FQ3A 3W95A 1DX5M 1S0RA 2BD7A 3H7TA 2NU1E 5T6GA 1SBWA 4A1XA 5GIBA 3D49H 5DP4A 2P94A 1AY6H 2QCYA 1DLKB 1P06A 3TJVA 3T29A 1T4VH 2Y82A 3BIUH 2GTBA 1TMTH 1FDPA 1IQFA 1RIWB 2HRVA 5DP5A 4ZHLU 1NESE 4FU7A 1OOKB 2C93B 1KIGH 2UUKB 2JH5D 2ZWLH 2CHAB 4DG4A 3RXAA 2C8ZB 5EQQA 1IOEA 4E05H 3NKKA 1TPAE 2TGDA 1SGYE 3P70B 3NK8A 2HPQH 3MOCA 1SR5C 1DWCH 4BAMB 4UDWH 1GJ6A 5A8XA 3SHAH 3S0NA 3BSQA 1TLDA 2NU0E 2FPZA 1TA2A 1HJ9A 1GDNA 3VGCB 4ZXYH 3R0FA 1CHOG 1L1GA 1C5VA 1K2I1 3QTOH 3ATWA 3M3VA 1ZHRA 2J38A 1CSOE 1NRNH 2UUFB 1E38B 3PB1E 1MCTA 2ZQ2A 4O03A 2Z6BD 1PPEE 1V2QT 3D62A 1XKBC 2CN0H 3RC5A 1F0SA 4OS5A 4YTAA 1YP9A 5ESBA 3OTJE 1MQ6A 1JRSA 3BG4B 1O3NA 1EPTB 3EE0B 1VJ9U 4F4OC 4I8LA 3ZZAA 3A7VA 1K9OE 1C5PA 1ZRKA 3MU1A 5DP8A 1NU7B 1ZZZA 4ISOA 1FMGA 3A8CA 1ARCA 1SGFG 3VB5A 2XCFA 4OS4A 3E90B 1TWXB 3SZNA 4AFSA 3MTYA 2PKAB 2ZFSA 1C5LH 2ZU3A 2FXRA 3V0XA 1Y59T 4ZH8A 1YBWA 1YC0A 2AGIX 2BB4A 4MPUA 2A7CA 1Q3XA 1FAXA 3U9AH 4GUXA 3N7OA 1OXGA 3LPRA 3STIA 1ZHMA 3DHKH 3ZZ8A 3HATH 1V2ST 1K28D 4TWWA 1ZTJA 4F49A 8GCHG 2ILNA 4MTBA 1E35B 3ZVBA 1CGIE 4FVDA 3BEFB 1QA7A 3UOPA 1DT2A 3TPIZ 4AX9H 2STAE 1ZOMA 1NFXA 3A86A 3ATKA 2B8OH 7KMEH 1O2KA 2ZGCA 4YZUA 4JYUH 3ZZCA 4ZXXH 1UTKA 3LONA 1O3BA 2A1DB 3S7KB 2G52A 2QGRA 4I8GA 1MKXK 2PFEA 2G5VA 1QBNA 3DT0H 2QXIA 1DUAA 1ZGVA 3PM3A 2J9NA 4JYTA 1AFQC 1XMNB 5LPEA 3GY4A 3MNXA 1EUFA 2VWNA 4Z6AH 4X0WU 1P04A 3R3GB 1BOQA 4IBLH 4B74A 1ZJDA 1HAYB 5L30H 4K8BA 4B2AA 1IHSH 3VB3A 5A09A 1W13U 5FBIA 4CHAC 1IHTH 2BDIA 3RXBA 3GY7A 1A3BH 3NWUA 4ABBA 1DSUA 1ABJH 1GL0E 1A4WH 4YO9A 2BQ6B 1C1TA 1BRAA 1XUJA 3KNXA 3L6PA 3U8OH 1A0JA 1QL8A 1YCPM 1NT1A 4RKOB 1O3KA 2IJOB 1GI7B 4UEHH 1N8OB 2C8WB 1HLTH 4Y11E 3HGNA 1BBRK 2EC9H 1EZQA 1NO9H 2FODA 1SGNE 3CENA 4Y0ZE 5GWZA 1TX8A 2GGVB 1BMAA 2J92A 1O5BB 1GMHG 1Y8TA 3GY2A 1AO5A 1TBRH 2P3TB 2Y81A 1DDJA 5L6NH 2QA9E 2O8LA 3B23B 3SJ9A 4MNVA 2BVSH 2B5TB 3BTHE 3LGWA 1TONA 1B0FA 1EASA 4NA8A 5TCCA 1GHVH 3SN8A 5FAHA 3A8AA 1AB9C 3KIDU 1C5OH 1QB1A 2VGCC 2WINI 3QTVH 4ISLA 1FAKH 3U98H 1BB0B 3UWJH 1C2FA 1C2DA 2XWAA 3A83A 3BTQE 3U8RH 4X2XA 1Z71A 2OC0A 3F9EA 3QDZB 4ASHA 4RSPA 3GISB 4WY3A 3ZV8A 2J34A 1SQAA 6GCHG 4CRFA 2PW8H 3QO6A 3PLBA 1ELEE 3RXDA 2UUJB 1MKXH 3F6UH 2G00A 1MCVA 2Z9JA 5C1YA 4D7FA 1GJCB 1HUTH 2WUBA 3E16B 3HGPA 4Y0YE 1YPKH 3RU4D 1AU8A 1W7XH 2QC2A 3E3TA 4JZEH 4MQAA 1BBRE 2Y5GA 1W3CA 1IQNA 4JZ1A 1D9IA 3KL6A 4WF8A 5IYTA 1SLWB 1Z8GA 4OS7A 1EOJA 2Y80A 1W11U 1UVSH 1TNLA 1Y5AT 2F91A 4X6OA 1LKBA 5DP7A 4K3JA 2ZGXH 3HKIB 2CV3A 1O2TA 4MPVA 1INCA 1Z6JH 3ZZDA 6LPRA 1IQHA 5JBBS 2C3SA 1BBRH 1AZ8A 2C4FH 2CJIA 3DA9B 1TQ7B 1DS2E 1YLCA 1C5ZB 4O9VA 2SNWA 4ABAA 1C1QA 4TPYA 2ZTYA 1BCUH 2YNBA 1T8OA 1TRYA 1V2MT 1DE7H 2BQ7B 2AGGX 1W0YH 1LPZB 1LHFH 1V2OT 3E8LA 3UPEA 1GG6B 1O3EA 4X6PA 1FN6A 1SI5H 1XUKA 2Z9KA 1A0LA 2AMDA 1J15A 3MNCA 3RMNH 5HYOA 2O8MA 3PROA 1ELAA 2BDBA 3A80A 2AH4X 1KLIH 3M3TA 5J4SA 3SORA 1SPJA 4GHQA 3RXMA 2D1JA 1C5SA 2Q6FA 1W8BH 3FANA 1ESAA 1MAYA 3KHVA 2NU4E 1DITH 2BVXH 3AASA 1E37B 4IS5A 1ANEA 2ZHQH 4YM9A 1GJ9B 1P11E 4Z0KA 1LPKB 1K1OA 4Y7AA 3BEIB 2DE8A 3TLOA 2WYJA 1G3EA 1SGQE 2A5AA 4MDSA 1MKWK 3T2NA 2VIPA 1HYLA 2XYAA 3F1SB 1HV7A 1P8VC 1A7SA 3VB7A 1YGCH 1O3FA 3LH1A 3A89A 1VR1H 1AZZA 1VCQA 2VU8E 1Z8JB 4OS1A 4K1TA 1KDQB 4TPIZ 4A7IB 5HGGA 4UONA 3QGJA 4NIYA 1MTSA 1AI8H 4INLA 1AN1E 2BOKA 5AHGH 1KYNA 1QL9A 3V12A 1VITH 2ZU5A 1GI6A 4DIIH 1GBJA 1J9CH 1D4PB 4U30A 2F9NA 4Y8YA 3D65E 4I8JA 3TH3H 1SFIA 2A4GA 2AEIH 2TPIZ 2FOFA 3RXTA 2XWBI 1P2MA 4A92A 1E34B 3Q77A 3ITIA 2R3UA 1E0FD 1EP6A 2SGQE 1C5NH 1GBIA 4VGCC 1CQQA 1FY5A 5FXLA 4LXBH 2ZIQH 1VCPA 2J2UA 2BM2A 1Z8IB 4INHA 2VIDA 1CHGA 1VGCC 2DE9A 1C1VH 3SV9A 2YOLA 1T31A 1Y5UT 1HAOH 1O5GH 1P9UA 1PPGE 3SQHE 1GJBB 3ESTA 5FX6A 4X1QU 4D9RA 2BYAX 3RXRA 1KXAA 3BG8A 3E1XB 3SUFA 2ZEBA 1V3XA 5L2YH 1YCPK 1HAVB 1TGSZ 5EPNA 3RM2H 1FJSA 1C1PA 1LQDB 1HNEE 4D9QA 1SSXA 1O2HA 3HK6B 4IMQA 1GDUA 2ZHFH 1OWIA 3BTTE 1PPZA 2FX4A 1FIWA 1GJ4H 2Z9LA 2ZQ1A 3RXEA 1UK2A 3FP8E 4JZFH 4JZIA 3BTEE 2BTCE 3SNEA 2A2QH 3MWIU 1MTNB 1MKWH 1NTPA 4H6TA 5ETXA 5F8ZA 5FPYA 2JKHA 3SBKA 4Q7XA 2ASUB 1LHGH 2XXLA 1ZJKA 3GCTG 4FVBA 3T62A 2VH0A 3A7TA 1EP5A 1IQEA 1AFQB 3VEQB 1B7XB 1UVOA 1XXDA 2GD4B 2PTCE 3V7TA 4D76A 3QGNB 1YPGH 1Y3YA 3M5MA 5C67A 5IDKA 3GDUA 1S81A 2FLBH 5HMAA 4CHAB 3RXPA 1GI3A 2BXUH 1LDTT 1ZR0A 4XBBA 1SC8U 2BY5X 2ZDNA 1P09A 2AIPA 2K1QA 3AAVA 2R2MB 1BQYA 5LPRA 1SGDE 2UWPA 4D8NA 1O2SA 1J17T 1QRXA 2W3KA 1P10A 1MTUA 1T8LA 1CHOF 2GCHF 2OCVB 4X1SU 3IITA 1MU8B 4R0IA 4NSVA 1KLJH 2I6QA 2R9PA 2P95A 2AERH 1AGJA 1TGNA 1JWTA 3L33A 1T32A 4IW4E 2ZF0H 3Q76A 2CXVA 4CRDA 4YT7H 4X6NA 1PPCE 1YCPH 2Y5FA 1HPGA 2B9LA 3CS0A 1W14U 1F2SE 1GL1A 1KTTB 1ZRBA 4AOQA 3KQCA 1Z7KA 3P8FA 1BT7A 1JRTA 1SB1H 1AB9B 2Z3CA 1GHWH 2VGCB 2TBSA 1RTKA 5DK1A 5F8TA 3RLWH 1HB0B 1OYQA 1UTNA 1EZSC 2FTLE 4X1PU 1YM0A 4ISNA 1AHTH 3MH6A 2ZHEH 4UD9H 3KQEA 1HDTH 1FY1A 2H5DA 3UQOA 3P8GA 1FY3A 2Y7ZA 2R0LA 3BF6H 4PROA 3GYLB 3V13A 2BD4A 3RC6A 2A7JA 1F0UA 2BDCA 5GCHF 2Y6TA 2Z9IA 2OXSA 2P8OC 4U32A 3K9XB 4Y8ZA 4FUDA 3UY9A 5CHAC 5JBAS 1QTFA 3RU4T 2BD8A 2ZFTA 2IOTA 4KTUA 4BOHA 5EOKA 4Q7YA 2G8TA 4X2VA 3SHCH 2ZC9H 3RMOH 1ELVA 5JDUB 2FESH 4QT8C 1TNGA 1OP2A 4ESTE 1SGEE 1K1JA 1LQEA 1ANDA 2QXHA 2TRMA 3D23A 2JH0D 1LTOA 1G9IE 2Y7XA 3Q3XA 2BD5A 2GV6A 2J95A 1BITA 2ANMH 4GCHG 1QA0A 1TGCA 3EYDA 4AG2A 1O5FH 1TPSA 1V2TT 1TRMA 3VFEA 4K5ZA 2GVFA 1AE8H 5JB9S 1EOLA 2C90B 5AF9H 1UTQA 1SGTA 3AAUA 2HVXA 2CGAA 1K1NA 1BHXB 3MNBA 1A46H 3UNRA 2ZHDA 1KXFA 3ZYEA 1YKTA 1BTHH 4GPGA 2PSXA 5L2ZH 2FI3E 1ETSH 1GI2A 1K21H 1HAPH 1UTJA 4ABIA 1J14A 3AW0A 1ELDE 3B9FH 2XW9A 3RXCA 3TITA 1KXCA 2FDAA 1GMDF 3TIUA 2PLXA 1FPHH 4KTCA 3LGVA 4AYVB 1GCTC 4MG3A 1QBVH 2GMTC 3M5LA 2OC7A 3QX5H 4ABHA 1Z8RA 1JMOH 3K2UA 2GZ7A 3NZIA 1Y3VA 2P16A 3SU4A 4KELA 2ANYA 1L4DA 1C2LA 5TCAA 4NG9H 1NFUA 4SGBE 2XBXA 1BTZA 1OWKA 1JXPA 3SV6A 1TAWA 3MO3A 4DT7B 5EQRA 1TFXA 1C5RA 1MUEB 4AB9A 1P2NA 1ARBA 1MH0A 4CH2B 1P9SA 4FUEA 2OBQA 3BN9A 3UNQA 2AMPA 3JZ2B 2BLVA 4U2WA 1P2JA 2VWLA 1D3PB 1A5IA 3AW1A 2ZFFH 6GCHF 1GHYH 1E36B 1IQJA 2ZU1A 2THFB 2EEKA 1YPMH 1DM4B 2QYIA 4IGDA 1O3GA 2VVVA 3SQEE 1WTGH 4BXWA 1QBOA 4B2BA 4B2CA 1RGQA 2WPIS 1P2KA 2ANKH 1S6HA 4JK5A 1UCYK 5BPEA 2EI8A 1DANH 3M7QA 1ZPZA 1AVXA 2F83A 1O3JA 4WWYA 5A0CA 4VGCB 4E06H 1QJ7B 1GI4A 1P3EA 3A7XA 3TK6A 4BAQB 1ESBA 3PO1C 3VB4A 3FVFB 2BLOA 4Y71A 1VGCB 1FN8A 2OC1A 4Y7BA 2O8TA 1N1LA 1SGIB 1HAIH 3DUXH 3PTNA 3GY3A 2RA0A 1TYNA 3G01A 1CE5A 2D26C 1KXBA 4I32A 1O5CB 3A7WA 1C9PA 1CU1A 3I78A 1C1WH 1WV7H 2A7HA 1F5KU 3H7OA 1H9HE 1EZXC 4WMEA 1Q2WA 2VWMA 2GT8A 3ZVCA 2HOBA 5DPAA 4A5TS 1KXEA 1G3DA 1SLVB 1F5LA 1UTPA 3TH2H 1QIXB 4ZUHA 3UUZA 2FLRH 1AFEH 2PSYA 1AUTC 4WXIA 2WPKS 2Z94A 3OY6U 4NSYA 5E0GA 2XCNA 2FOBA 1O2IA 3PMBB 1EAXA 4HZHA 1C2GA 2BOHB 4CRCA 2FOGA 1BRCE 3SJIA 1XVMA 1DXPA 3LH3A 1TA6A 5T6FA 1A1RA 1NY22 3JZ1B 3RMMH 4NZLA 1ELTA 4BAOB 4XSKU 1F0RA 3URCA 3RP2A 2BDHA 3RLYH 2SGFE 1GHXH 3BTKE 1L2EA 1TIOA 1UCYE 9ESTA 2VVCA 3L3TA 5B6OA 3EAJA 3SJ8A 2JH6D 5E2PA 2FIRH 1TX7A 3SOSA 4YLQH 1HIAA 2FTMA 5DKMA 2GX4A 5SGAE 4UFFH 1ZYOA 1H1BA 1TMUH 3KCGH 5JBTA 3M36A 3A85A 1G37A 2BDAA 2H9HA 1BTWA 3HK3B 3UREA 3RXHA 5C3NA 1O2NA 4A1VA 1P2QA 1ELBA 1HXFH 1Q31A 4BTTB 2ZDVH 1LKAA 2TGAA 3LGYA 1EX3A 2Z3DA 1UCYH 4CH8B 3BIVH 5FHTA 3RXOA 3PMHB 1MU6B 1L1JA 4AB8A 3SJOA 1NFYA 1YPHE 1V2UT 1THRH 3S69A 5TJXA 4K8YA 1O3DA 2SGDE 2W3IA 3BTGE 5C5OA 1IAUA 1GMCF 1H9LB 1G3CA 5EXMA 3TNTA 1QFKH 2D2DA 4DURA 1TE0A 4GLYA 4XBCA 1C2EA 7GCHG 1OSSA 4NFFA 3VPKA 1NC6A 3S9CA 1ZGIA 1BTXA 1YLDA 1GVZA 2AS9A 1HJAC 3AVZA 3A7ZA 3FAOA 2ZG0H 1EXFA 1UHBA 1OWDA 1P2OA 1UTLM 2ODYB 1KXDA 1H8DH 1GHBF 1V2VT 1WQSA 1XM1A 4ZMAH 2PR3A 4H6SB 2HWLB 4B1TA 2ZGBH 5EG4A 1CO7E 3B8JA 2HNTF 4JMYA 1SGFA 4YT6H 2QV1A 4GHTA 1B0EA 4CRBA 1L1NA 1AKSA 3UIRA 1O2XA 2ZPQA 4JCNA 1GI9B 3P17H 1SQOA 2G51A 5GXPA 1YPJH 2XRCA 1C1UH 1O5AB 1QCPA 4K69A 2C8XB 2P8OB 1J16A 2ZP0H 1QB9A 3STJA 4UFGH 1DSTA 1O39A 1PQAA 2XBWA 3FP7E 1NN6A 1XUFA 3H5CB 3KEEA 5CHAB 3RXIA 1V2JT 1MQ5A 1RJXB 3RXSA 2BDYA 1GPZA 2F9OA 1A5GH 3QK1A 4AYYB 1G32B 3S9AA 4X1NU 2FX6A 3QN7A 4O3UA 5EU8A 4AGKA 2GZ9A 3U1IB 4NA7A 2BQWB 1C2KA 5C1UA 3GY8A 2VWOA 1OKXA 2GT7A 1CA8B 3ZVEA 1NROH 1RS0A 1AMHA 3SO3A 2ZDLA 5H4IB 5A8ZA 1WCZA 5DP6A 1GHZA 2RCEA 4AORA 1GBTA 3FFGA 3HPTB 1ELCA 1QJ6B 2XC5A 4DOQA 1BJVA 2BY6X 2ALPA 3TJUA 1G3BA 3SGQE 3GCOA 4YLUA 3W94A 1SMFE 4AN7A 1HXEH 2VIVA 2P3UB 1G30B 2WV4A 1UK4A 1ETTH 1DVAH 2WUCA 2NU2E 5EXLA 1O2JA 4DY7B 2VVUA 1K22H 1SLUB 3M7UA 1HAZB 1K1MA 3TK9A 3MH7A 2G4UA 8KME2 3C27B 3M3SA 3NUMA 1ZSJA 1YPHC 1PQ7A 1HCGA 3ODDA 3SU1A 3OSYA 3DFLA 1GCDA 2TGTA 1GJ8B 1GI5A 5DG6A 1O3LA 3SV7A 1TB6H 1GI1A 2RG3A 2Z3EA 2WPLS 1GCTB 1UVTH 1THPB 2GMTB 3EDXB 1OP8A 1KLTA 2FM2A 2ZGHA 3GCHC 1OWJA 4CREA 3SNAA 1C4V2 3RXJA 2O8UA 3LGTA 2BXTH 4BTUB 1CT0E 1AWFH 1Y3XA 3KQBA 4O3TA 2ULLA 1RTLA 1P57B 2PTNA 1VZQH 1DOJA 3S7HB 3PV4A 1O3MA 1QGFA 4X8UH 3MFJA 3URDA 2H1UA 3KF2A 1NU9A 1GBEA 2AFQB 1IQLA 2FS9A 5HXFA 1RFNA 1YYY1 4E7NA 2FOMB 1K1LA 5JB8S 1UK3A 2BD9A 1G2MA 1MBQA 4FUCA 4AZ2B 7LPRA 4OGYA 4YOJA 4ZHAA 3UQVA 3DD2H 1O3PB 3FP6E 2KAIA 1O37A 1C5TA 4ABDA 1V6DA 1NRSH 2BDGA 1O34A 1UTMA 2A31A 1P12E 1NZQH 3ZZ3A 4SGAE 1JOUB 1P03A 4Q7ZA 2A4OA 1W2KH 3SUEA 1EJMA 4TY7A 1P05A 3SI3H 3ZV9A 4UFEH 2FEQH 1TGTA 2G4TA 1QHRB 1QQUA 2RDLA 1O2PA 5A8YA 1XUIA 2XC0A 4Y8XA 3PO1B 5ESTE 3SU5A 1TBQH 3SW2B 3QZQA
chains in the Genus database with same CATH superfamily
4FU8A 1C1OA 1PJPA 1Y3WA 5T1VA 2JIZD 3MI4A 1XXFA 3T5FH 1KSNA 3SZEA 2OTVA 2EI6A 2ANWA 1BJUA 5E0HA 3VXFH 2OQ5A 4NIWA 3MNSA 1C1RA 3F68H 1A0HB 1XX9A 2FYRA 5DO4H 4Y79A 4NWLA 1UO6A 3P6ZB 3NPSA 1GVKB 1XKAC 2B7DH 1IQKA 2GV7A 1QURH 3LGIA 5C5NA 1F0TA 3A88A 1QNJA 2GCTC 3ODFA 2Q6DA 1WOFA 1TOMH 4H4FA 1PYTC 3MU5A 1RXPA 3SV8A 3A7YA 4NIXA 1SOZA 1IQMA 4YOIA 2FOHA 4XOJA 1W10U 3EA8A 4F55A 1BUIA 5E2OA 1QB6A 1NRRH 1LMWB 1KY9A 2ZA5A 1DY9A 3RDZA 5T6DA 1NS3A 1FPCH 1ABIH 1WUNH 4MVNA 4X6MA 1WBGB 1HFDA 4AFUA 3BTWE 1GJDB 2ZTZA 2AIQA 3RMLH 1WQVH 3O8BA 3ZZ4A 1MD7A 3UOUA 3OE7D 4GSOA 1O3IA 2SFAA 5PTPA 2QY0B 3TGIE 1QY6A 1AD8H 1OX1A 4MPXA 4WMDA 2FI5E 4WJG2 3M61U 1PPHE 1TNHA 3ZVGA 1ESTA 1BTYA 2TGPZ 4K1EA 4ABGA 4Y6DA 3F3BA 4ZKOU 1SFQB 5EW2H 2J94A 3EQ0H 2F43B 5JBCS 1N6XA 2SGAA 1A3EH 2PWXA 2FS8A 2FMJA 3CS7A 4OS6A 2GDDA 1NBME 5HM2A 4ACBA 3ATLA 1EKBB 1P02A 2QIQA 3OU0A 3PMJA 2OD3B 3SI4H 1BA8B 1O3AA 3P8NA 1VCWA 1TRNA 2RDEA 4R8TB 2OBOA 4WMFA 1O5DH 3PRDA 4K2YA 1CT4E 1GGDC 1Y5BT 3MHWU 1OWEA 1YF4A 3ENSB 2ZCLP 3PTBA 1NFWA 1C2IA 3MH5A 2H9EH 3ZVDA 4ZKNU 8GCHF 2HLCA 3ATMA 3RXLA 1HJAB 2ZFRH 2XBYA 2B0FA 2CF9H 2P3FH 3OTPA 2OUAA 4RT0A 1FY8E 3F2FA 2ZI2H 2FOCA 2ZHWH 4BANB 4Y76A 5F8XA 3SUGA 2A5IA 2ZKSA 1O31A 5EPYA 2P59A 2ZFPH 3RUOA 1V2PT 2OK5A 2A32A 2FWWA 2VB0A 5DGJA 3RXGA 2PHBA 1M9UA 4FXGH 1BZXE 1ZTKA 4NWKA 1FONA 1VITG 1EATA 2KFWA 4CRGA 3PLKA 4HFPB 1ZMNA 4U01A 1QR3E 1K1PA 1C9TA 1GBBA 1X7AC 2QN5T 2V35A 2ZPRA 1NM6A 4ABJA 3F9FA 1BRBE 2VNTA 2WYGA 1DWEH 3EA9A 4FUFA 1DXWA 1BMLA 1L4ZA 3ZVFA 4X8SH 1SG8B 2A5KA 5DSFA 1UTOA 1OPHB 3KN2A 2W26A 3LKWA 3MQKC 3CP7A 2F9BH 1DPOA 4XE4A 2Q1JA 3MMGA 2YNAA 4ZAEA 1XUHA 2CF8H 4FUGA 2GDEH 4JK6A 3SU0A 1FI8A 2BY8X 4B71A 4LZ1H 1E1RD 1YY3A 5JYIA 2JETC 2VINA 1GJAB 1EAWA 1C5YB 1BTUA 3KGPA 1DY8A 8LPRA 3TJOA 1PFXC 5EJ1A 1D6WA 3PLPA 2C8YB 2FOAA 1MBMA 2ZGJA 3TJNA 3K65B 1GMHF 4X8VH 1EPTA 2L74A 2GCHG 5G4BA 2VH6A 3S9BA 2BD2A 4LK4A 3EA7A 1TPPA 2M5TA 2PKSC 3FZDA 4A6LA 2G81E 5C94A 1NPMA 1FUJA 1MZDA 2PKAA 2HALA 1YPLH 2BVRH 1S84A 3A84A 1SGCA 2ZDKA 2ZZUH 3M35A 1TX6A 1B5GH 3K6ZA 1GDQA 1WTHD 2ZU4A 1AVWA 2V3OH 3UTUH 1ACBE 5AFZH 3O8RA 1BIOA 2ZO3H 4KKDA 1GBMA 4WVPE 1TPOA 2LELA 1FIZA 2OP9A 3Q00A 1WU1A 2PGQB 5K7RA 4M7GA 4TT3D 1C5MD 1Z6EA 5J4QA 3FOAA 2UUYA 1O5EH 1C4Y2 3UFAA 5AFYH 1OS8A 3PV2A 1BRUP 1AWHB 1FY4A 3GCHB 5C1XA 4FU9A 7GCHF 2ZECA 1NRPH 1VJAU 1V2RT 1A5HA 1C5WB 2WPMS 3PWBA 1HAXB 2QF3A 5FBEA 4MNWA 5GCHG 3M5OA 3E0PB 4BNRA 1SVPA 2Z9GA 3NCLA 4IMZA 1PYTD 1F7ZA 2WZQA 1CA0C 4MNYA 1GHAG 1AQ7A 3T28A 2K8IA 1THSH 4LZ4B 2GZ8A 4HTCH 1WAYB 1TNJA 1CT2E 1D3TB 1MTNC 1O32A 1SGPE 3QLPH 1O2UA 2HNTE 2R0KA 2FO9A 1LCYA 3IWMA 4AFZA 1XUGA 2SGPE 4M9FA 7ESTE 2WPHS 1HGTH 2OC8A 2BY7X 1O36A 3GDSA 4IN2A 1UVUH 1S6FA 5EW1H 2W7SA 4OS2A 2R2WU 3SGBE 4B76A 4YESB 4ABFA 3TGKE 2A4QA 2UWLA 1UVPA 3BTDE 3LOXA 2QXJA 1FV9A 2NWNA 2Y5HA 1K1IA 1P01A 3MU4A 1JIRA 1ZPBA 1T7CA 3V3MA 1T8MA 4D7GA 3LT3A 2FOEA 1EAIA 3BV9B 1CVWH 2KCAA 1E79D 3RXUA 2ZDAH 2O9QA 3A8DA 2EA3A 4ZKRU 2ZNKH 1ETRH 5F6MA 4P02A 3RC4A 3T26A 3PWCA 4NFEA 2AMQA 2STBE 1EB2A 1GMDG 2HPPH 2GCTB 1V2LT 1D3DB 1HIAB 2JJ1D 1ID5H 5HIZA 2FZZA 2BY9X 1S5SA 1V2WT 3DFJA 1EZUC 3RXFA 3TH4H 4BXSA 3TU7H 5A0BA 2W7UA 4X2YA 3F9GA 1GJ5H 4ZCNA 1W0KD 5EJLA 4I33A 2QF0A 1O30A 1TMBH 1L0ZA 1EJAA 4DGJA 5I25A 2H9TH 4X2WA 3FZZA 1SLXB 4J2YB 5HM9A 2KR7A 5FPTA 2GKVE 5AVDA 3T27A 3KQ5A 1BTPA 3GDVA 1AIXH 1JIMA 5F03A 1Y3UA 1IQGA 1FZZA 3RXQA 2LPRA 4B75A 3DSOA 1O2RA 3UWIA 1O2MA 1QJ1B 2H2ZA 1S85A 1NRQH 2CK3D 5C0UA 1U6QA 4DIHH 6CHAC 1F92A 3Q3KA 2BLQA 4RN6A 4OGXA 2F9VA 1HJ8A 1ORFA 1CBWC 1ELFA 2NU3E 1SHHB 1H8ED 1P3CA 1O2GH 2F3CE 4NZQA 1LHEH 2ZU2A 4NGAH 5LH8A 1F5RA 3NXPA 4Y10E 5E0JA 3SNCA 1O33A 5FPSA 3SGAE 1W7GH 1MMJN 5JPMH 1DWDH 1UHBB 2A45B 2K0QA 3E91A 1D3QB 2CMYA 4GAWA 3SU6A 3ZZ6A 1TQ0B 1W0ZU 2PV9B 3A82A 2AGEX 2V0BA 5GPIB 5LGOA 1N6YA 2BLWA 2RA3A 1AE5A 1GGDB 1P2IA 4ABEA 1D6RA 3P92A 4J1YA 4RT1A 1O2ZA 1O2VA 1P0SH 2GP9B 4INKA 4UE7H 3FKSD 2V6NA 3KYGA 1BHXF 1AKSB 2HNTC 4IN1A 1GBFA 2Z7FE 1WYKA 4A1TA 1J8AA 1H8IH 3UR9A 2IN2A 3N7DA 1C5XB 1RIWC 5C2ZA 4RKJB 3UR6A 5EODA 2WHXA 4UFDH 4GVUA 4CBNA 2CHAC 2ALVA 2ODPA 5DP3A 3ZVAA 2QXGA 3MO9A 1HBTH 2H5CA 2XC4A 4IC6A 5EGMA 4NIVA 3F9HA 1MD8A 2ZCKP 1O2OA 3P8OA 3GCTF 3M5NA 1A2CH 1O3OA 3M7TA 3OX7U 4THNH 1NBMD 1EQ9A 3VB6A 4I86A 1O2YA 2VIQA 1DICA 1C1NA 3TNSA 3QUMP 1Z1IA 3VGCC 1GBAA 1OYTH 4DVAU 3Q3YA 1H4WA 3QZRA 4DJZB 4ZHMU 2A0QB 5C20A 2BHGA 4FUHA 3SUDA 3QWCH 4CR5A 5EXNA 4NCYA 4TYDA 4JYVH 1FNIA 4I31A 1EAUA 2WPJS 1S83A 2DUCA 3GY6A 3BG4C 1GBLA 1EPTC 1QRWA 1OP0A 1SQTA 4LOYH 4WH6A 3F0PA 1LVYA 2OLGA 1KDQA 1W12U 1MZAA 3E6PH 1C2MA 4JZDH 1TABE 2LNCA 1RRKA 2JETB 5LPFA 1CGHA 3SU3A 4HG6A 3UNSA 3ZZ5A 2J4IA 1O35A 3AK5A 2W6ID 1C2HA 2PUXB 3GOVB 3K6YA 1C4U2 4XBDA 2O8WA 5T3HA 2A2XH 1ZMLA 1AUJA 1ZTLA 2VJ1A 5FX5A 1PQ5A 1SKYE 2FYQA 3PYHA 1GMCG 1O38A 1LVOA 2XNDD 3GY5A 1WSSH 4I7YH 3LU9B 1V2NT 2P93A 2PKSB 4DW2U 4FUJA 3MH4A 5ABWA 2G5NA 2HGTH 2ZDMA 4WH8A 3GYMA 1C1SA 4WXVA 2XNIA 4ZROA 4DT4A 2VIOA 1SL3A 3VXEH 1QQ4A 2V3MA 1PPFE 1DFPA 1GI8B 1GHBG 1C2JA 2KCPA 1C5UA 1IQIA 1SOTA 5GDSH 4E7RG 1C1MA 3O8CA 4Q63A 1RTFB 1TBZH 1CGJE 1YPEH 1UJ1A 1HAVA 1OWHA 1DWBH 3U1JB 4YOGA 2R3YA 1TNKA 1TNIA 2BZAA 2H6MA 2OINA 1TALA 4MPWA 3WY8A 9LPRA 5A2MH 3PMAB 3F2HA 1GVLA 5GJ4B 5K0HA 1GBHA 4I8KA 1SHYA 2BMGB 2BD3A 4I8HA 1G2LA 2KAIB 2BX4A 1DUEA 1ZHPA 2AHME 1FLEE 2WV5A 3T25A 1XVOA 1ZPCA 1O2QA 1HAGE 1BMNH 1ANBA 3U69H 2BZ6H 2EY4C 1CA0B 1WDIA 3MU8A 4XDEA 3LJOA 2V3HH 1S0QA 1GBCA 3TGJE 1PPBH 1RD3B 2OQUA 3P95A 4ISHH 2ZPSA 4GCHF 1VITF 2I6SA 3BTFE 3TK5A 3LGUA 1EB1H 2BX3A 1GBKA 1BDAA 2F9PA 1N8OC 1EJNA 1KTSB 2XBVA 2IPHA 3OYPA 2FI4E 4TWYA 1BMMH 2A4RA 1T8NA 2ZFQH 4AFQA 4ZKSU 4FUIA 1C5QA 1O2LA 5FCKA 3RU4E 2VIWA 1LVMA 1LO6A 3RXVA 4IC5A 3C1KA 1ZLRA 1ZMJA 3OY5U 3E0NB 2F9UA 1GI0A 1HRTH 1LPGB 5C0TA 2ESTE 5CMXH 4BAKB 4O97A 3IG6B 2FP7B 2QAAA 3LJJA 3LC3A 3LC5A 4K1SA 1TOCB 4BTIB 2LP6A 3GICB 4XFQA 3KQDA 1LHCH 1UMAH 1MAXA 6ESTA 3BEUA 4HI3A 5DP9A 4Q80A 4MLFB 4X8TH 2ODQA 4KTSA 1AVGH 3U8TH 3M37A 1DLEA 1O0DH 5CDFE 1GWAA 4CRAA 1COWD 1JBUH 1QRZA 4CBOA 5A0AE 3A87A 3BTME 4NA9H 2AYWA 1ANCA 1ELGA 1PQ8A 3LDXH 3TVJB 1G36A 3SJKA 1MTWA 3GCNA 5I46H 3CNRA 1ZSKA 3SV2H 3HKJB 2SGEE 2ZTXA 3MU0A 2PGBB 1H9IE 3SNDA 5EIYA 3RM0H 3ZZ7A 3ZZBA 2EI7A 3MYWA 5KEDA 4AGJA 4BAHB 1Z1JA 3RXKA 2UWOA 3ATIA 1S82A 1FXYA 3SU2A 1O3HA 4ISIH 8ESTE 3O8DA 1A61H 4HGCA 2D8WA 4FOUC 3SNBA 5CE1A 1MTVA 1QL7A 5DJ7A 3ZYDA 1O3CA 4KGAA 1O2WA 3I29A 1ZSLA 3ZZ9A 1TGBA 3ELAH 4FUBA 6CHAB 1SGRE 4MNXA 3I77A 3EE7A 5BRRE 4H42U 1LVBA 1CBWB 3MO6A 4AG1A 1T4UH 4CR9A 1HAHH 4X1RU 5EQSA 5E8EH 4K60A 1V2KT 2TIOA 3LIWA 2ZCHP 4TY6A 2XTTB 1WXRA 4KP0A 1LHDH 2W5EA 2PUQH 5FCRA 2G55A 2Q6GA 1GG6C 2SNVA 1GHAF 3UAIC 2WV9A 3A8BA 4DCDA 3A81A 1GBDA 4Q2KA 4B73A 3EGKH 1GJ7B 1FQ3A 3W95A 1DX5M 1S0RA 2BD7A 3H7TA 2NU1E 5T6GA 1SBWA 4A1XA 2HVYB 5GIBA 3D49H 5DP4A 2P94A 1AY6H 2QCYA 2WSSD 1DLKB 1P06A 3TJVA 3T29A 1T4VH 2Y82A 3BIUH 2GTBA 1TMTH 1FDPA 1IQFA 1RIWB 2HRVA 5DP5A 4ZHLU 2J98B 1NESE 4FU7A 1OOKB 1H8HD 3WWBA 2C93B 1KIGH 2UUKB 2JH5D 2ZWLH 2CHAB 4DG4A 3RXAA 2C8ZB 5EQQA 1IOEA 4E05H 3NKKA 1TPAE 2TGDA 1SGYE 3P70B 3NK8A 2HPQH 3MOCA 1SR5C 1DWCH 4BAMB 4UDWH 1GJ6A 5A8XA 3SHAH 3S0NA 3BSQA 1TLDA 2NU0E 2FPZA 1TA2A 1HJ9A 1GDNA 3VGCB 4ZXYH 3R0FA 1CHOG 1L1GA 1C5VA 1K2I1 3QTOH 3ATWA 3M3VA 1ZHRA 2J38A 1CSOE 1NRNH 1UW7A 1E38B 2UUFB 3PB1E 1MCTA 2ZQ2A 4O03A 2Z6BD 1PPEE 1V2QT 3D62A 1XKBC 2CN0H 3RC5A 1F0SA 4OS5A 4YTAA 1YP9A 5ESBA 3OTJE 1MQ6A 1JRSA 3BG4B 1O3NA 1EPTB 3EE0B 1VJ9U 4F4OC 4I8LA 4F48B 3ZZAA 3A7VA 1K9OE 1C5PA 1ZRKA 3MU1A 5DP8A 1NU7B 1ZZZA 4ISOA 1FMGA 3A8CA 1ARCA 1SGFG 3VB5A 2XCFA 4OS4A 3E90B 1TWXB 3SZNA 4AFSA 3MTYA 2PKAB 2ZFSA 1C5LH 2ZU3A 2FXRA 3V0XA 1Y59T 4ZH8A 1YBWA 1YC0A 2AGIX 2BB4A 4MPUA 2A7CA 1Q3XA 1FAXA 3U9AH 4GUXA 3N7OA 1OXGA 3LPRA 3STIA 1ZHMA 3DHKH 3ZZ8A 3HATH 1V2ST 1K28D 4Z1MD 5IK2D 4TWWA 1ZTJA 4F49A 3NRLA 8GCHG 2ILNA 4MTBA 1E35B 5FL7D 1CGIE 3ZVBA 4FVDA 3BEFB 1QA7A 3UOPA 1DT2A 3TPIZ 4AX9H 2STAE 1ZOMA 1NFXA 3A86A 3ATKA 2B8OH 7KMEH 1O2KA 2ZGCA 4YZUA 4JYUH 4ASUD 3ZZCA 4ZXXH 1UTKA 3LONA 1O3BA 2A1DB 3S7KB 2G52A 2QGRA 4I8GA 1MKXK 3DSPA 2PFEA 2G5VA 1QBNA 3DT0H 2QXIA 1DUAA 1ZGVA 3PM3A 2J9NA 4JYTA 1AFQC 1XMNB 5LPEA 3GY4A 3MNXA 1EUFA 2VWNA 4Z6AH 2KCYA 4X0WU 1P04A 3R3GB 1BOQA 4IBLH 4B74A 1ZJDA 1HAYB 5L30H 4K8BA 4B2AA 1IHSH 3VB3A 5A09A 4OM9A 1W13U 5FBIA 2WPDD 1IHTH 2BDIA 4CHAC 3RXBA 3GY7A 1A3BH 3NWUA 4ABBA 1DSUA 1ABJH 1GL0E 1A4WH 4YO9A 2BQ6B 1C1TA 1BRAA 1XUJA 3KNXA 3L6PA 3U8OH 1A0JA 1QL8A 1YCPM 1NT1A 4RKOB 1O3KA 2IJOB 1GI7B 4UEHH 1N8OB 2C8WB 1HLTH 4Y11E 3HGNA 1BBRK 2F4LA 2EC9H 1EZQA 1NO9H 2FODA 1SGNE 3CENA 4Y0ZE 5GWZA 1TX8A 2GGVB 1BMAA 2J92A 1O5BB 1GMHG 1Y8TA 3GY2A 1AO5A 1TBRH 2P3TB 2Y81A 1DDJA 5L6NH 2QA9E 2O8LA 3B23B 3SJ9A 4MNVA 2BVSH 3OAAD 2B5TB 3BTHE 3LGWA 1TONA 1B0FA 1EASA 4NA8A 1E1QD 5TCCA 1GHVH 3SN8A 5FAHA 3A8AA 1AB9C 3KIDU 1C5OH 1QB1A 2VGCC 2WINI 3QTVH 4ISLA 1FAKH 2KX4A 1BB0B 3U98H 1C2FA 1C2DA 3UWJH 2XWAA 3A83A 3BTQE 3U8RH 4X2XA 1Z71A 2OC0A 2QF4A 3F9EA 3QDZB 4ASHA 4RSPA 3GISB 4WY3A 3ZV8A 2J34A 1SQAA 6GCHG 4CRFA 2PW8H 3QO6A 3PLBA 1ELEE 3RXDA 2UUJB 1MKXH 3F6UH 2G00A 1MCVA 2Z9JA 5C1YA 4D7FA 1GJCB 1HUTH 2WUBA 3E16B 3HGPA 4Y0YE 1YPKH 3RU4D 1AU8A 1W7XH 2QC2A 3E3TA 4JZEH 4MQAA 1BBRE 2Y5GA 1W3CA 1IQNA 4JZ1A 1D9IA 3KL6A 4WF8A 5IYTA 1SLWB 1Z8GA 4OS7A 1KMHB 1EOJA 2Y80A 1W11U 1UVSH 1TNLA 1Y5AT 2F91A 4X6OA 1LKBA 5DP7A 4K3JA 2ZGXH 3HKIB 2CV3A 1O2TA 4MPVA 1INCA 1Z6JH 3ZZDA 6LPRA 1IQHA 5JBBS 2C3SA 1BBRH 1AZ8A 2C4FH 2CJIA 3DA9B 1TQ7B 1DS2E 1YLCA 1C5ZB 4O9VA 2SNWA 4ABAA 1C1QA 4TPYA 2ZTYA 1BCUH 2YNBA 1T8OA 1TRYA 1V2MT 1DE7H 2BQ7B 2AGGX 1W0YH 1LPZB 1LHFH 1V2OT 3E8LA 3UPEA 1GG6B 4P00A 1O3EA 4X6PA 1FN6A 1SI5H 1XUKA 2Z9KA 3FN8A 1A0LA 2AMDA 1J15A 3MNCA 3RMNH 5HYOA 2O8MA 3PROA 1ELAA 2BDBA 3A80A 3KYFA 2AH4X 1KLIH 3M3TA 5J4SA 3SORA 1SPJA 4GHQA 3RXMA 2D1JA 1C5SA 2Q6FA 1W8BH 3FANA 1ESAA 1MAYA 3KHVA 2NU4E 1DITH 2BVXH 3AASA 1E37B 4IS5A 1ANEA 2J5UA 2ZHQH 4YM9A 1GJ9B 1P11E 4Z0KA 5DN6D 1LPKB 1K1OA 4Y7AA 3BEIB 2DE8A 3TLOA 2WYJA 1G3EA 1SGQE 2A5AA 4MDSA 1MKWK 3T2NA 2VIPA 1HYLA 2XYAA 3F1SB 1HV7A 1P8VC 1A7SA 3VB7A 1YGCH 1O3FA 3LH1A 3A89A 1VR1H 1AZZA 1VCQA 1YWUA 2VU8E 1Z8JB 4OS1A 4K1TA 1KDQB 4TPIZ 4A7IB 5HGGA 4UONA 3QGJA 4NIYA 1MTSA 1AI8H 4INLA 1AN1E 2BOKA 5AHGH 1KYNA 1QL9A 3V12A 1VITH 2ZU5A 1GI6A 4DIIH 1GBJA 1J9CH 1D4PB 4U30A 2F9NA 4Y8YA 3D65E 4I8JA 3TH3H 1SFIA 3UB0A 2A4GA 2AEIH 2TPIZ 2FOFA 3RXTA 2XWBI 1P2MA 4A92A 1E34B 3Q77A 3ITIA 2R3UA 1E0FD 1EP6A 2SGQE 1C5NH 1GBIA 4VGCC 1CQQA 1FY5A 5FXLA 4LXBH 2ZIQH 1VCPA 2J2UA 2BM2A 1Z8IB 4INHA 2VIDA 1CHGA 1VGCC 2DE9A 1C1VH 3SV9A 2YOLA 1T31A 1Y5UT 1HAOH 1O5GH 1P9UA 1PPGE 3SQHE 1GJBB 3ESTA 5FX6A 4X1QU 3FO8D 4D9RA 2BYAX 2KM0A 3RXRA 1KXAA 3BG8A 4YXWD 3E1XB 3SUFA 2ZEBA 1V3XA 5L2YH 1YCPK 1HAVB 1TGSZ 1VKYA 5EPNA 3RM2H 1FJSA 2YMSC 1C1PA 1LQDB 3PRBA 1HNEE 4D9QA 2RFKC 1SSXA 1O2HA 3HK6B 4IMQA 1GDUA 2ZHFH 1OWIA 3BTTE 1PPZA 2FX4A 1FIWA 1GJ4H 4AC9A 2Z9LA 2ZQ1A 3RXEA 1UK2A 3FP8E 4JZFH 4JZIA 3BTEE 2BTCE 2XOKD 3SNEA 2A2QH 3MWIU 1MTNB 4B6EA 1MKWH 1NTPA 4H6TA 5ETXA 5F8ZA 5FPYA 2JKHA 3SBKA 4Q7XA 2ASUB 1LHGH 2XXLA 1ZJKA 3DSGA 3GCTG 4FVBA 3T62A 2VH0A 3A7TA 1EP5A 1IQEA 1AFQB 3VEQB 1B7XB 1UVOA 1XXDA 2GD4B 2PTCE 3V7TA 2VBCA 4D76A 3QGNB 1YPGH 2V7QD 1Y3YA 3M5MA 5C67A 5IDKA 3GDUA 1S81A 2FLBH 5HMAA 3F0OA 3RXPA 4CHAB 1GI3A 2BXUH 1LDTT 1ZR0A 4XBBA 1SC8U 2BY5X 2ZDNA 1P09A 2AIPA 2K1QA 5KECA 3AAVA 2R2MB 4B6FA 1BQYA 5LPRA 1SGDE 2UWPA 3VG8A 4D8NA 1O2SA 1J17T 1QRXA 3GS9A 5HIYA 3ZIAD 2W3KA 1P10A 1MTUA 1T8LA 1CHOF 2GCHF 2OCVB 4X1SU 3IITA 1MU8B 4R0IA 4NSVA 2IPQX 1KLJH 2I6QA 2R9PA 2P95A 2AERH 1AGJA 1TGNA 1JWTA 3L33A 1T32A 4IW4E 2ZF0H 3Q76A 2CXVA 4CRDA 4YT7H 4X6NA 1PPCE 1YCPH 2Y5FA 2JDID 1HPGA 2B9LA 3CS0A 1W14U 1F2SE 1GL1A 1KTTB 1ZRBA 4AOQA 3KQCA 1Z7KA 3P8FA 1BT7A 1JRTA 1SB1H 1AB9B 2Z3CA 1GHWH 2VGCB 2TBSA 1RTKA 2PP6A 5DK1A 5F8TA 3RLWH 1HB0B 1OYQA 1UTNA 1EZSC 2FTLE 4X1PU 1YM0A 4ISNA 1AHTH 3PV5A 3MH6A 2ZHEH 4UD9H 3KQEA 2H5DA 1FY1A 1HDTH 3N7EA 3UQOA 3P8GA 1FY3A 2Y7ZA 2R0LA 3BF6H 4PROA 3GYLB 3V13A 2BD4A 3RC6A 2A7JA 1F0UA 2BDCA 5GCHF 2Y6TA 2Z9IA 2OXSA 2P8OC 3U28C 4U32A 3K9XB 4Y8ZA 4FUDA 3UY9A 5CHAC 5JBAS 1QTFA 3RU4T 2BD8A 2ZFTA 2IOTA 4KTUA 4BOHA 5EOKA 4Q7YA 2G8TA 4X2VA 3SHCH 2ZC9H 3RMOH 1ELVA 5JDUB 2FESH 4QT8C 1TNGA 1OP2A 4ESTE 1SGEE 1K1JA 2IJD1 1LQEA 1ANDA 2QXHA 2TRMA 3D23A 2JH0D 1LTOA 1G9IE 2Y7XA 3Q3XA 2BD5A 2GV6A 2J95A 1BITA 2ANMH 4GCHG 1QA0A 1TGCA 3EYDA 4AG2A 1O5FH 3OEED 5B6LA 3N99A 1TPSA 1V2TT 1TRMA 3VFEA 4K5ZA 2J98A 2GVFA 1AE8H 5JB9S 1EOLA 2C90B 4FETA 5AF9H 1UTQA 1SGTA 3AAUA 2HVXA 3H09A 2CGAA 1K1NA 5HKKD 1BHXB 3MNBA 4ACAA 5EJZA 1A46H 3UNRA 2ZHDA 1KXFA 3ZYEA 1YKTA 1BTHH 4GPGA 2PSXA 1W0JD 5L2ZH 2FI3E 1ETSH 1GI2A 5GNDA 1K21H 2EQNA 1HAPH 1UTJA 4ABIA 1J14A 3AW0A 1ELDE 5C17A 3B9FH 2XW9A 3OFND 3RXCA 3TITA 1KXCA 2FDAA 1GMDF 3TIUA 2PLXA 1FPHH 4KTCA 3LGVA 4AYVB 1GCTC 4MG3A 1QBVH 2GMTC 3M5LA 2OC7A 3QX5H 4ABHA 1Z8RA 1JMOH 3DCLA 2GZ7A 3K2UA 3NZIA 1Y3VA 2P16A 3SU4A 4KELA 2ANYA 1L4DA 1C2LA 5TCAA 4NG9H 1NFUA 4SGBE 2XBXA 2YMSD 1BTZA 1OWKA 1JXPA 3SV6A 1TAWA 3MO3A 4DT7B 2W6JD 5EQRA 1TFXA 1C5RA 1MUEB 4AB9A 1P2NA 1ARBA 1MH0A 4CH2B 1P9SA 4FUEA 2OBQA 3BN9A 3UNQA 2AMPA 3JZ2B 2BLVA 4U2WA 1P2JA 2VWLA 1D3PB 1A5IA 3AW1A 2ZFFH 6GCHF 1GHYH 1E36B 1IQJA 2ZU1A 2THFB 2M2AA 2EEKA 1YPMH 1DM4B 2QYIA 4IGDA 1O3GA 2VVVA 3SQEE 1WTGH 4BXWA 1QBOA 4B2BA 4B2CA 1RGQA 2WPIS 1P2KA 2ANKH 1S6HA 4JK5A 1UCYK 5BPEA 2EI8A 4RI0A 1DANH 3M7QA 1ZPZA 1AVXA 2F83A 1O3JA 4WWYA 5A0CA 4VGCB 4E06H 1QJ7B 1GI4A 1P3EA 3A7XA 3TK6A 4BAQB 1ESBA 3PO1C 3VB4A 3FVFB 2BLOA 4Y71A 1VGCB 1FN8A 2OC1A 4Y7BA 2O8TA 1N1LA 1SGIB 1HAIH 3DUXH 3PTNA 3GY3A 2RA0A 1TYNA 5KGOA 3G01A 1CE5A 2D26C 1KXBA 4I32A 1O5CB 4TSFD 3A7WA 1C9PA 1CU1A 3I78A 1C1WH 1WV7H 2A7HA 1F5KU 3H7OA 1H9HE 1EZXC 4WMEA 2YMSB 1Q2WA 2VWMA 2GT8A 3ZVCA 2HOBA 5DPAA 4A5TS 1KXEA 1G3DA 3SYJA 1SLVB 1F5LA 1UTPA 3TH2H 1QIXB 4ZUHA 3UUZA 2FLRH 1AFEH 2PSYA 1AUTC 4WXIA 2WPKS 2Z94A 3OY6U 1SQRA 4NSYA 5E0GA 2XCNA 2FOBA 1O2IA 3PMBB 1EAXA 4HZHA 1C2GA 2BOHB 4CRCA 2FOGA 1BRCE 3SJIA 1QZ8A 1XVMA 1DXPA 3LH3A 1TA6A 5T6FA 1A1RA 1NY22 3JZ1B 3RMMH 4NZLA 2J97A 1ELTA 4BAOB 4XSKU 1F0RA 3URCA 3RP2A 2BDHA 4XD7D 2QF5A 3RLYH 2SGFE 1GHXH 3BTKE 1L2EA 1TIOA 1UCYE 1BMFD 2VVCA 3L3TA 9ESTA 5B6OA 3EAJA 3SJ8A 2JH6D 5E2PA 2FIRH 2GJGA 1TX7A 3SOSA 4YLQH 1HIAA 2FTMA 5DKMA 2GX4A 5SGAE 4UFFH 1ZYOA 1H1BA 1TMUH 3KCGH 1EFRD 3M36A 5JBTA 3A85A 1G37A 2BDAA 2H9HA 1BTWA 3HK3B 3UREA 4XRNA 3RXHA 5C3NA 1O2NA 4A1VA 1P2QA 1ELBA 1HXFH 1Q31A 3WW7A 4BTTB 2ZDVH 1LKAA 2TGAA 3LGYA 1EX3A 2Z3DA 1UCYH 4CH8B 3BIVH 5FHTA 3RXOA 3PMHB 1MU6B 1L1JA 4AB8A 3SJOA 1NFYA 1YPHE 1V2UT 1THRH 3S69A 5TJXA 4K8YA 1O3DA 2SGDE 2W3IA 3BTGE 5C5OA 1IAUA 1GMCF 1H9LB 1G3CA 2JJ2D 5EXMA 3TNTA 1QFKH 3WWFA 2D2DA 4DURA 1TE0A 4GLYA 1K0HA 4XBCA 1C2EA 7GCHG 1OSSA 4NFFA 3VPKA 1NC6A 3S9CA 1ZGIA 1BTXA 1YLDA 1GVZA 2AS9A 1HJAC 3AVZA 3A7ZA 3FAOA 2ZG0H 1EXFA 1UHBA 1OWDA 1P2OA 1UTLM 2ODYB 1KXDA 1H8DH 1GHBF 1V2VT 1WQSA 1XM1A 4ZMAH 2PR3A 4H6SB 2HWLB 4B1TA 2ZGBH 5EG4A 1CO7E 3B8JA 2HNTF 4JMYA 1SGFA 3OEHD 4YT6H 2QV1A 4GHTA 1B0EA 2HLDD 4CRBA 1L1NA 1AKSA 3UIRA 1O2XA 2ZPQA 4JCNA 1GI9B 2L6OA 3P17H 1SQOA 2G51A 5GXPA 1YPJH 2XRCA 1C1UH 1O5AB 1QCPA 4K69A 2C8XB 2P8OB 1J16A 2ZP0H 1QB9A 3STJA 4UFGH 1DSTA 1O39A 1PQAA 2XBWA 3FP7E 1NN6A 1XUFA 3H5CB 3KEEA 5CHAB 3RXIA 1V2JT 1MQ5A 1RJXB 3RXSA 2BDYA 4Q4LA 1GPZA 2F9OA 1A5GH 3QK1A 4AYYB 1G32B 3S9AA 4X1NU 2FX6A 3QN7A 4O3UA 5EU8A 4AGKA 2GZ9A 3U1IB 4NA7A 2BQWB 1C2KA 5C1UA 3GY8A 2VWOA 1OKXA 2GT7A 1CA8B 3ZVEA 1NROH 1RS0A 1AMHA 3SO3A 2ZDLA 5H4IB 5A8ZA 1WCZA 5DP6A 3F2GA 1GHZA 2RCEA 4AORA 1GBTA 3FFGA 3HPTB 1ELCA 1QJ6B 2QE7D 2XC5A 4DOQA 1BJVA 2BY6X 2ALPA 3TJUA 1G3BA 3SGQE 3GCOA 4YLUA 3W94A 1SMFE 4AN7A 1HXEH 2VIVA 2P3UB 1G30B 2WV4A 1UK4A 1ETTH 1DVAH 2WUCA 2NU2E 5EXLA 1O2JA 5F53A 4DY7B 2VVUA 1K22H 1SLUB 3M7UA 1MABB 1HAZB 1K1MA 3TK9A 3MH7A 2G4UA 8KME2 3C27B 3M3SA 3NUMA 1ZSJA 1YPHC 1PQ7A 1HCGA 3ODDA 3SU1A 3OSYA 3DFLA 1GCDA 2KZ4A 2TGTA 1GJ8B 1GI5A 5DG6A 1O3LA 3SV7A 1TB6H 1OHHD 1GI1A 2RG3A 2Z3EA 2WPLS 1GCTB 1UVTH 1THPB 1S6LA 2GMTB 3EDXB 1OP8A 1KLTA 2FM2A 2ZGHA 3GCHC 1OWJA 4CREA 3SNAA 1C4V2 3RXJA 5CHBA 2O8UA 3LGTA 2BXTH 4BTUB 1CT0E 1AWFH 1Y3XA 3KQBA 1FX0B 4O3TA 2ULLA 1RTLA 1P57B 2PTNA 1VZQH 1DOJA 3S7HB 3PV4A 1O3MA 1QGFA 4X8UH 3MFJA 3URDA 2H1UA 3KF2A 1NU9A 1GBEA 2AFQB 1IQLA 2FS9A 5HXFA 1RFNA 1YYY1 4E7NA 1YLNA 2FOMB 1K1LA 5JB8S 1UK3A 2BD9A 1G2MA 1MBQA 4FUCA 4AZ2B 7LPRA 4OGYA 4YOJA 4ZHAA 3UQVA 3DD2H 1O3PB 3FP6E 2KAIA 1O37A 1C5TA 4ABDA 1V6DA 1NRSH 2BDGA 1O34A 1UTMA 2A31A 1P12E 1NZQH 3ZZ3A 4SGAE 1JOUB 1P03A 4Q7ZA 2A4OA 1W2KH 3SUEA 1EJMA 4TY7A 1P05A 3SI3H 3W1EA 4UFEH 3ZV9A 2FEQH 1TGTA 2G4TA 1QHRB 1QQUA 2RDLA 1O2PA 5A8YA 1XUIA 2XC0A 4Y8XA 3PO1B 2KCOA 5ESTE 3SU5A 1TBQH 3SW2B 3QZQA
chains in the Genus database with same CATH topology
4FU8A 1C1OA 1PJPA 1Y3WA 3MI4A 1XXFA 3T5FH 1KSNA 2OTVA 2EI6A 2ANWA 1BJUA 5E0HA 3VXFH 2OQ5A 4NIWA 3MNSA 1C1RA 3F68H 1A0HB 1XX9A 2FYRA 5DO4H 4Y79A 4NWLA 1UO6A 3P6ZB 3NPSA 1GVKB 1XKAC 2B7DH 1IQKA 2GV7A 1QURH 3LGIA 5C5NA 1F0TA 3A88A 1QNJA 2GCTC 3ODFA 2Q6DA 1WOFA 1TOMH 4H4FA 1PYTC 3MU5A 1RXPA 3SV8A 3A7YA 4NIXA 1SOZA 1IQMA 4YOIA 2FOHA 4XOJA 1W10U 3EA8A 1BUIA 5E2OA 1QB6A 1NRRH 1LMWB 1KY9A 2ZA5A 1DY9A 3RDZA 5T6DA 1NS3A 1FPCH 1ABIH 1WUNH 4MVNA 4X6MA 1WBGB 1HFDA 4AFUA 3BTWE 1GJDB 2ZTZA 2AIQA 3RMLH 1WQVH 3O8BA 3ZZ4A 1MD7A 3UOUA 4GSOA 1O3IA 2SFAA 5PTPA 2QY0B 3TGIE 1QY6A 1AD8H 1OX1A 4MPXA 4WMDA 2FI5E 4WJG2 3M61U 1PPHE 1TNHA 3ZVGA 1ESTA 1BTYA 2TGPZ 4K1EA 4ABGA 4Y6DA 4ZKOU 1SFQB 5EW2H 2J94A 3EQ0H 5JBCS 1N6XA 2SGAA 1A3EH 2PWXA 2FS8A 2FMJA 3CS7A 4OS6A 2GDDA 5HM2A 3ATLA 1EKBB 1P02A 2QIQA 3OU0A 3PMJA 2OD3B 3SI4H 1BA8B 1O3AA 3P8NA 1VCWA 1TRNA 4R8TB 2OBOA 4WMFA 1O5DH 4K2YA 1CT4E 1GGDC 1Y5BT 3MHWU 1OWEA 1YF4A 3ENSB 2ZCLP 3PTBA 1NFWA 1C2IA 3MH5A 2H9EH 3ZVDA 4ZKNU 8GCHF 2HLCA 3ATMA 3RXLA 1HJAB 2ZFRH 2XBYA 2B0FA 2CF9H 2P3FH 2OUAA 1FY8E 2ZI2H 2FOCA 2ZHWH 4BANB 4Y76A 5F8XA 3SUGA 2A5IA 2ZKSA 1O31A 5EPYA 2P59A 2ZFPH 3RUOA 1V2PT 2A32A 2FWWA 2VB0A 5DGJA 3RXGA 2PHBA 1M9UA 4FXGH 1BZXE 1ZTKA 4NWKA 1FONA 1VITG 1EATA 4CRGA 3PLKA 4HFPB 1ZMNA 4U01A 1QR3E 1K1PA 1C9TA 1GBBA 1X7AC 2QN5T 2V35A 2ZPRA 1NM6A 4ABJA 3F9FA 1BRBE 2VNTA 2WYGA 1DWEH 3EA9A 4FUFA 1DXWA 1BMLA 1L4ZA 3ZVFA 4X8SH 1SG8B 2A5KA 1UTOA 1OPHB 3KN2A 2W26A 3LKWA 3CP7A 2F9BH 1DPOA 4XE4A 2Q1JA 3MMGA 2YNAA 4ZAEA 1XUHA 2CF8H 4FUGA 2GDEH 4JK6A 3SU0A 1FI8A 2BY8X 4B71A 4LZ1H 5JYIA 2JETC 2VINA 1GJAB 1EAWA 1C5YB 1BTUA 3KGPA 1DY8A 8LPRA 3TJOA 1PFXC 1D6WA 3PLPA 2C8YB 2FOAA 1MBMA 2ZGJA 3TJNA 3K65B 1GMHF 4X8VH 1EPTA 2GCHG 5G4BA 2VH6A 3S9BA 2BD2A 4LK4A 3EA7A 1TPPA 2M5TA 2PKSC 3FZDA 4A6LA 2G81E 1NPMA 1FUJA 1MZDA 2PKAA 2HALA 1YPLH 2BVRH 1S84A 3A84A 1SGCA 2ZDKA 2ZZUH 3M35A 1TX6A 1B5GH 3K6ZA 1GDQA 1WTHD 2ZU4A 1AVWA 2V3OH 3UTUH 1ACBE 5AFZH 3O8RA 1BIOA 2ZO3H 4KKDA 1GBMA 4WVPE 1TPOA 1FIZA 2OP9A 3Q00A 1WU1A 2PGQB 5K7RA 4M7GA 1C5MD 1Z6EA 5J4QA 2UUYA 1O5EH 1C4Y2 3UFAA 5AFYH 1OS8A 1BRUP 1AWHB 1FY4A 3GCHB 5C1XA 4FU9A 7GCHF 2ZECA 1NRPH 1VJAU 1V2RT 1A5HA 1C5WB 2WPMS 3PWBA 1HAXB 2QF3A 5FBEA 4MNWA 5GCHG 3M5OA 3E0PB 4BNRA 1SVPA 2Z9GA 3NCLA 4IMZA 1PYTD 1F7ZA 1CA0C 4MNYA 1GHAG 1AQ7A 3T28A 1THSH 4LZ4B 2GZ8A 4HTCH 1WAYB 1TNJA 1CT2E 1D3TB 1MTNC 1O32A 1SGPE 3QLPH 1O2UA 2HNTE 2R0KA 2FO9A 1LCYA 3IWMA 4AFZA 1XUGA 2SGPE 7ESTE 2WPHS 1HGTH 2OC8A 2BY7X 1O36A 3GDSA 4IN2A 1UVUH 1S6FA 5EW1H 2W7SA 4OS2A 2R2WU 3SGBE 4B76A 4YESB 4ABFA 3TGKE 2A4QA 2UWLA 1UVPA 3BTDE 3LOXA 2QXJA 1FV9A 2NWNA 2Y5HA 1K1IA 1P01A 3MU4A 1JIRA 1ZPBA 1T7CA 3V3MA 1T8MA 4D7GA 3LT3A 2FOEA 1EAIA 3BV9B 1CVWH 3RXUA 2ZDAH 2O9QA 3A8DA 2EA3A 4ZKRU 2ZNKH 1ETRH 5F6MA 3RC4A 3T26A 3PWCA 4NFEA 2AMQA 2STBE 1EB2A 1GMDG 2HPPH 2GCTB 1V2LT 1D3DB 1HIAB 1ID5H 2FZZA 2BY9X 1S5SA 1V2WT 3DFJA 1EZUC 3RXFA 3TH4H 4BXSA 3TU7H 5A0BA 2W7UA 4X2YA 3F9GA 1GJ5H 4I33A 2QF0A 1O30A 1TMBH 1L0ZA 1EJAA 4DGJA 5I25A 2H9TH 4X2WA 3FZZA 1SLXB 4J2YB 5HM9A 5FPTA 2GKVE 5AVDA 3T27A 1BTPA 3GDVA 1AIXH 1JIMA 5F03A 1Y3UA 1IQGA 1FZZA 3RXQA 2LPRA 4B75A 1O2RA 3UWIA 1O2MA 1QJ1B 2H2ZA 1S85A 1NRQH 1U6QA 4DIHH 6CHAC 1F92A 3Q3KA 2BLQA 4RN6A 4OGXA 2F9VA 1HJ8A 2NU3E 1ORFA 1CBWC 1ELFA 1SHHB 1P3CA 1O2GH 2F3CE 4NZQA 1LHEH 2ZU2A 4NGAH 5LH8A 1F5RA 3NXPA 4Y10E 5E0JA 3SNCA 1O33A 5FPSA 3SGAE 1W7GH 1MMJN 5JPMH 1DWDH 1UHBB 2A45B 3E91A 1D3QB 2CMYA 4GAWA 3SU6A 3ZZ6A 1TQ0B 1W0ZU 2PV9B 3A82A 2AGEX 2V0BA 5GPIB 5LGOA 1N6YA 2BLWA 2RA3A 1AE5A 1GGDB 1P2IA 4ABEA 1D6RA 3P92A 4J1YA 1O2ZA 1O2VA 1P0SH 2GP9B 4INKA 4UE7H 2V6NA 1BHXF 1AKSB 2HNTC 4IN1A 1GBFA 2Z7FE 1WYKA 4A1TA 1J8AA 1H8IH 3UR9A 2IN2A 1C5XB 1RIWC 5C2ZA 4RKJB 3UR6A 5EODA 4UFDH 4GVUA 4CBNA 2CHAC 2ALVA 2ODPA 5DP3A 3ZVAA 2QXGA 3MO9A 1HBTH 2H5CA 2XC4A 4IC6A 5EGMA 4NIVA 3F9HA 1MD8A 2ZCKP 1O2OA 3P8OA 3GCTF 3M5NA 1A2CH 1O3OA 3M7TA 3OX7U 4THNH 1EQ9A 3VB6A 1O2YA 2VIQA 1DICA 1C1NA 3TNSA 3QUMP 1Z1IA 3VGCC 1GBAA 1OYTH 4DVAU 3Q3YA 1H4WA 3QZRA 4DJZB 4ZHMU 2A0QB 5C20A 2BHGA 4FUHA 3SUDA 3QWCH 4CR5A 5EXNA 4NCYA 4TYDA 4JYVH 1FNIA 4I31A 1EAUA 2WPJS 1S83A 2DUCA 3GY6A 3BG4C 1GBLA 1EPTC 1QRWA 1OP0A 1SQTA 4LOYH 4WH6A 1LVYA 2OLGA 1KDQA 1W12U 1MZAA 3E6PH 1C2MA 4JZDH 1TABE 2LNCA 1RRKA 2JETB 5LPFA 1CGHA 3SU3A 3UNSA 3ZZ5A 2J4IA 1O35A 1C2HA 2PUXB 3GOVB 3K6YA 1C4U2 4XBDA 2O8WA 5T3HA 2A2XH 1ZMLA 1AUJA 1ZTLA 2VJ1A 5FX5A 1PQ5A 2FYQA 3PYHA 1GMCG 1O38A 1LVOA 3GY5A 1WSSH 4I7YH 3LU9B 1V2NT 2P93A 2PKSB 4DW2U 4FUJA 3MH4A 5ABWA 2G5NA 2HGTH 2ZDMA 4WH8A 3GYMA 1C1SA 4WXVA 2XNIA 4ZROA 2VIOA 1SL3A 3VXEH 1QQ4A 1PPFE 1DFPA 1GI8B 1GHBG 1C2JA 1C5UA 1IQIA 1SOTA 5GDSH 4E7RG 1C1MA 3O8CA 1RTFB 1TBZH 1CGJE 1YPEH 1UJ1A 1HAVA 1OWHA 1DWBH 3U1JB 4YOGA 2R3YA 1TNKA 1TNIA 2BZAA 2H6MA 2OINA 1TALA 4MPWA 3WY8A 9LPRA 5A2MH 3PMAB 1GVLA 5GJ4B 5K0HA 1GBHA 4I8KA 1SHYA 2BMGB 2BD3A 4I8HA 1G2LA 2KAIB 2BX4A 1DUEA 1ZHPA 1FLEE 2WV5A 3T25A 1XVOA 1ZPCA 1O2QA 1HAGE 1BMNH 1ANBA 3U69H 2BZ6H 1CA0B 3MU8A 4XDEA 3LJOA 2V3HH 1S0QA 1GBCA 3TGJE 1PPBH 1RD3B 2OQUA 3P95A 4ISHH 2ZPSA 4GCHF 1VITF 2I6SA 3BTFE 3TK5A 3LGUA 1EB1H 2BX3A 1GBKA 1BDAA 2F9PA 1N8OC 1EJNA 1KTSB 2XBVA 2IPHA 3OYPA 2FI4E 4TWYA 1BMMH 2A4RA 1T8NA 2ZFQH 4AFQA 4ZKSU 4FUIA 1C5QA 1O2LA 5FCKA 3RU4E 2VIWA 1LVMA 1LO6A 3RXVA 4IC5A 3C1KA 1ZLRA 1ZMJA 3OY5U 3E0NB 2F9UA 1GI0A 1HRTH 1LPGB 2ESTE 5CMXH 4BAKB 4O97A 3IG6B 2FP7B 2QAAA 3LJJA 3LC3A 3LC5A 4K1SA 1TOCB 4BTIB 3GICB 4XFQA 3KQDA 1LHCH 1UMAH 1MAXA 6ESTA 3BEUA 4HI3A 5DP9A 4Q80A 4MLFB 4X8TH 2ODQA 4KTSA 1AVGH 3U8TH 3M37A 1DLEA 1O0DH 1GWAA 4CRAA 1JBUH 1QRZA 4CBOA 5A0AE 3A87A 3BTME 4NA9H 2AYWA 1ANCA 1ELGA 1PQ8A 3LDXH 3TVJB 1G36A 3SJKA 1MTWA 3GCNA 5I46H 1ZSKA 3SV2H 3HKJB 2SGEE 2ZTXA 3MU0A 2PGBB 1H9IE 3SNDA 3RM0H 3ZZ7A 3ZZBA 2EI7A 3MYWA 4AGJA 4BAHB 1Z1JA 3RXKA 2UWOA 3ATIA 1S82A 1FXYA 3SU2A 1O3HA 4ISIH 8ESTE 3O8DA 1A61H 4HGCA 2D8WA 3SNBA 5CE1A 1MTVA 1QL7A 5DJ7A 3ZYDA 1O3CA 4KGAA 1O2WA 3I29A 1ZSLA 3ZZ9A 1TGBA 3ELAH 4FUBA 6CHAB 1SGRE 4MNXA 3I77A 5BRRE 4H42U 1LVBA 1CBWB 3MO6A 4AG1A 1T4UH 4CR9A 1HAHH 4X1RU 5EQSA 5E8EH 4K60A 1V2KT 2TIOA 3LIWA 2ZCHP 4TY6A 2XTTB 4KP0A 1LHDH 2W5EA 2PUQH 5FCRA 2G55A 2Q6GA 1GG6C 2SNVA 1GHAF 3A8BA 4DCDA 3A81A 1GBDA 4Q2KA 4B73A 3EGKH 1GJ7B 1FQ3A 3W95A 1DX5M 1S0RA 2BD7A 3H7TA 2NU1E 5T6GA 1SBWA 4A1XA 5GIBA 3D49H 5DP4A 2P94A 1AY6H 2QCYA 1DLKB 1P06A 3TJVA 3T29A 1T4VH 2Y82A 3BIUH 2GTBA 1TMTH 1FDPA 1IQFA 1RIWB 2HRVA 5DP5A 4ZHLU 1NESE 4FU7A 1OOKB 2C93B 1KIGH 2UUKB 2JH5D 2ZWLH 2CHAB 4DG4A 3RXAA 2C8ZB 5EQQA 1IOEA 4E05H 3NKKA 1TPAE 2TGDA 1SGYE 3P70B 3NK8A 2HPQH 3MOCA 1SR5C 1DWCH 4BAMB 4UDWH 1GJ6A 5A8XA 3SHAH 3S0NA 3BSQA 1TLDA 2NU0E 2FPZA 1TA2A 1HJ9A 1GDNA 3VGCB 4ZXYH 3R0FA 1CHOG 1L1GA 1C5VA 1K2I1 3QTOH 3ATWA 3M3VA 1ZHRA 2J38A 1CSOE 1NRNH 2UUFB 1E38B 3PB1E 1MCTA 2ZQ2A 4O03A 2Z6BD 1PPEE 1V2QT 3D62A 1XKBC 2CN0H 3RC5A 1F0SA 4OS5A 4YTAA 1YP9A 5ESBA 3OTJE 1MQ6A 1JRSA 3BG4B 1O3NA 1EPTB 3EE0B 1VJ9U 4F4OC 4I8LA 3ZZAA 3A7VA 1K9OE 1C5PA 1ZRKA 3MU1A 5DP8A 1NU7B 1ZZZA 4ISOA 1FMGA 3A8CA 1ARCA 1SGFG 3VB5A 2XCFA 4OS4A 3E90B 1TWXB 3SZNA 4AFSA 3MTYA 2PKAB 2ZFSA 1C5LH 2ZU3A 2FXRA 3V0XA 1Y59T 4ZH8A 1YBWA 1YC0A 2AGIX 2BB4A 4MPUA 2A7CA 1Q3XA 1FAXA 3U9AH 4GUXA 3N7OA 1OXGA 3LPRA 3STIA 1ZHMA 3DHKH 3ZZ8A 3HATH 1V2ST 1K28D 4TWWA 1ZTJA 4F49A 8GCHG 2ILNA 4MTBA 1E35B 3ZVBA 1CGIE 4FVDA 3BEFB 1QA7A 3UOPA 1DT2A 3TPIZ 4AX9H 2STAE 1ZOMA 1NFXA 3A86A 3ATKA 2B8OH 7KMEH 1O2KA 2ZGCA 4YZUA 4JYUH 3ZZCA 4ZXXH 1UTKA 3LONA 1O3BA 2A1DB 3S7KB 2G52A 2QGRA 4I8GA 1MKXK 2PFEA 2G5VA 1QBNA 3DT0H 2QXIA 1DUAA 1ZGVA 3PM3A 2J9NA 4JYTA 1AFQC 1XMNB 5LPEA 3GY4A 3MNXA 1EUFA 2VWNA 4Z6AH 4X0WU 1P04A 3R3GB 1BOQA 4IBLH 4B74A 1ZJDA 1HAYB 5L30H 4K8BA 4B2AA 1IHSH 3VB3A 5A09A 1W13U 5FBIA 4CHAC 1IHTH 2BDIA 3RXBA 3GY7A 1A3BH 3NWUA 4ABBA 1DSUA 1ABJH 1GL0E 1A4WH 4YO9A 2BQ6B 1C1TA 1BRAA 1XUJA 3KNXA 3L6PA 3U8OH 1A0JA 1QL8A 1YCPM 1NT1A 4RKOB 1O3KA 2IJOB 1GI7B 4UEHH 1N8OB 2C8WB 1HLTH 4Y11E 3HGNA 1BBRK