1O2KA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2kA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2kA02
5DK1A 4Y8XA 3UNRA 3VPKA 1ELGA 3B23B 4ZUHA 2B5TB 1GI0A 4X0WU 5DP4A 1GJDB 3RMMH 1D3PB 4MPUA 1FLEE 1SLWB 2BY9X 1O31A 3LIWA 5H4IB 4A1XA 4NFFA 1TLDA 2GCTC 2QXGA 3LGTA 3SV6A 3ZZAA 1C1OA 3SHAH 1AI8H 3GOVB 1MQ5A 1TQ7B 2JETB 2ODYB 3UIRA 1GMCG 1NESE 2PUQH 3MU8A 2BOKA 1HAXB 2HNTE 4X8SH 1GJCB 3SI3H 5E2OA 2PKAB 1O3JA 1SOZA 6LPRA 1Z8JB 1GI4A 4MDSA 1F5LA 4MTBA 1Y3WA 4AG2A 3UQVA 1YM0A 5EXLA 4JZIA 1RTFB 3RXLA 2ZU1A 2PKAA 1O2TA 2QYIA 9ESTA 8LPRA 4HFPB 3BTWE 3DHKH 3HATH 1C5YB 1THRH 1NU7B 1Y8TA 3E0NB 2BDBA 1O5GH 4XE4A 1P2IA 4NZLA 3GICB 1DUAA 4JZEH 3SORA 1ZTJA 2VWNA 3ODFA 4BXSA 3TNTA 2C8ZB 3RXFA 4YLQH 3SI4H 2P8OB 2YOLA 1XKAC 1C1MA 4KGAA 4NG9H 2A5IA 1O3AA 1QB1A 4FUIA 2O8UA 2OC7A 2Z94A 1A1RA 5C5NA 2G51A 1FAXA 3M7TA 4AYYB 1BBRK 4H6SB 1AUTC 4LK4A 2ZFRH 3V0XA 2V3OH 2GDDA 4O3TA 4AYVB 1DSUA 2A4RA 1AU8A 3L6PA 4JZFH 3RC5A 3S9AA 3T28A 2G5VA 1E36B 1B7XB 2OLGA 1O2QA 1A3EH 1K28D 1FY4A 2VIPA 1AHTH 1MTNB 1P04A 5AVDA 3AAVA 1AY6H 1LHFH 2GT7A 3FZZA 3PYHA 3U8TH 2Z9LA 4DGJA 3A89A 2G4UA 2QIQA 7KMEH 1KXCA 1HXFH 2LNCA 1GJ4H 1S6HA 1CT0E 4WH8A 1NFXA 1WOFA 5E2PA 5I25A 5DO4H 1YPHE 3TJUA 2CF8H 1AFQB 1FPHH 2FS8A 1V3XA 1NTPA 3CP7A 1DVAH 4BAHB 3VXFH 4J2YB 1EZQA 2CN0H 2FOFA 2JH0D 1DY9A 4O03A 2QC2A 3TPIZ 1K22H 2G52A 1P8VC 1GHWH 3A84A 3SU5A 4AB9A 1EASA 1O2PA 2XRCA 3VB4A 1O5AB 2I6QA 1H8DH 1O2XA 1P11E 3LH1A 1CHGA 4BTTB 1AGJA 1PPEE 3U69H 1EZXC 1TB6H 5LGOA 3URCA 1UCYE 1QQUA 1CHOF 2C90B 4DG4A 4ABHA 2AEIH 2P59A 2Q6GA 4KTUA 4X6NA 2BDAA 1UTQA 3A7VA 1GVKB 2ZGCA 2FYQA 2QAAA 3ZVFA 3STJA 1AO5A 5FPYA 1C9PA 1CU1A 3ZVAA 4OGXA 1EB1H 1SLXB 1UTOA 1TE0A 1B0EA 5LH8A 4B75A 1C2IA 4TY7A 3BG4C 1A2CH 1ELAA 4CRAA 2VB0A 4RSPA 4AFQA 1RTKA 3MNSA 3O8CA 1C2JA 1XM1A 4YO9A 1QJ1B 1SGQE 4DW2U 4RKJB 1LQDB 3VB6A 2AGGX 1C2HA 4BAQB 5IDKA 2VH6A 1W11U 1EUFA 1L1JA 2H9HA 2UWPA 2EC9H 3UTUH 1C5NH 3QDZB 1NRQH 1P2QA 1RXPA 2FLRH 4R8TB 4ABIA 1K1LA 3UWJH 3LC5A 1C2LA 2B7DH 4E7RG 1LQEA 2TGTA 5DPAA 1BJVA 1V2WT 1XXDA 1AUJA 1QL9A 1EPTC 4B2AA 1BBRH 4E05H 2Q1JA 4IN1A 1LKBA 4JK5A 1V2QT 1BTUA 3MH6A 5C1YA 2J94A 1C5RA 1C2GA 1C2FA 1SI5H 4B2CA 3RXPA 3A8BA 4Y76A 1XUJA 2Y5FA 2ULLA 2BDIA 1QBNA 2CXVA 1A0HB 3HGNA 2JH6D 1M9UA 3QWCH 1C1PA 1P9UA 2ZU5A 3PMAB 1O2GH 3GY5A 1ELTA 2A45B 1QA7A 1P9SA 2R3YA 5F03A 2ZIQH 1O3DA 2W7SA 1MU6B 1HJ9A 1PQ8A 2ILNA 2A5AA 4Z6AH 2EEKA 1MKWK 2DE8A 3SU0A 4Y8ZA 4FXGH 3QLPH 2BXUH 1Y5BT 1SC8U 1VITF 3I78A 5F6MA 4CR9A 3PTBA 2ZDKA 2ZHDA 3TGIE 3ZZCA 2QF0A 1O2UA 3RXHA 2BVXH 1O32A 1GL1A 3QK1A 2P16A 5EOKA 3O8BA 1BTWA 2Y5HA 3MMGA 2WPJS 3VB5A 2Z3DA 1GPZA 4ISLA 4ZHAA 3RXJA 3U8OH 1K1IA 4B74A 1SHHB 2FI5E 3FAOA 1TAWA 2XYAA 3RXIA 3G01A 1JBUH 1RTLA 4GHQA 1P06A 2ZEBA 1L4ZA 3DT0H 1DE7H 1PPCE 2VVVA 5A8ZA 1K2I1 2A32A 2P3TB 4CRGA 3W94A 1O2LA 2AIQA 2PW8H 1CA8B 3BTFE 1FIZA 2R0LA 4OS5A 3M3SA 1KLJH 1ANBA 2HPQH 1GI2A 1IOEA 3A8CA 4WMFA 2FXRA 2XXLA 1SGTA 1IAUA 1LDTT 1PYTC 2BQ7B 3EA8A 5GWZA 1C5PA 1O5EH 2ANWA 1T4UH 5HMAA 2AH4X 2DUCA 1ZGVA 4NZQA 1P01A 2GZ8A 4XSKU 3RU4T 2OP9A 3SZNA 5GCHF 1W7GH 3UREA 2FTMA 1MZAA 1S85A 2OD3B 1FMGA 1C9TA 2PV9B 1GMDG 1IQIA 2ZDVH 3ATMA 1T7CA 3NXPA 3VXEH 2ZPRA 3B8JA 1D3QB 1HB0B 1QJ7B 1UTMA 1JIRA 1V6DA 4OS7A 4K5ZA 1HAHH 1IQHA 2QXHA 2ZKSA 5C1UA 1TA6A 3DD2H 3GY3A 1AVXA 1J17T 2ZP0H 4GUXA 1ZOMA 4YT7H 1QFKH 3A88A 2RA3A 3M5LA 1BTZA 2BLVA 3NWUA 1DXPA 1MBMA 1V2PT 3P8FA 5DKMA 2XWBI 1WU1A 1F0TA 2R9PA 2ZFPH 3DFLA 5K7RA 3D23A 1S0RA 4DVAU 2AGEX 1GBIA 3NKKA 2BVRH 1XX9A 2XWAA 2R2MB 5JPMH 2R0KA 1D3DB 4BTUB 2JETC 2PSXA 1ETTH 4IMZA 4K60A 3DA9B 1IQFA 1O2VA 2Z6BD 3BTGE 2VNTA 2F91A 3M7UA 1C4V2 2FODA 4Q7YA 1AZZA 2BXTH 2HRVA 1KLTA 3BTDE 1VZQH 1QL7A 1D6WA 2HNTF 3FP8E 1ELDE 5FBEA 3SJ9A 1YPKH 5DP6A 1XUKA 3Q3YA 2V6NA 1UJ1A 3SV7A 3EA7A 4CR5A 5A0BA 2Y5GA 1HRTH 1Y3YA 2ZF0H 1QGFA 1KTTB 3N7OA 3UR9A 1HBTH 5DP8A 3MO3A 1QURH 3PLBA 1SG8B 3TH4H 3LOXA 1BB0B 4K3JA 2SFAA 4RN6A 3ZV9A 2WYJA 2OTVA 2GTBA 1H9LB 2FS9A 1YPEH 4NA8A 1BTYA 3UQOA 4NSYA 2HNTC 4GCHG 1DUEA 4AORA 2SGPE 3T2NA 1E34B 2XBVA 1BRBE 1OYTH 1Q3XA 2UUYA 3LGIA 4ABGA 5E0HA 1D9IA 3A7WA 1GVLA 3ZZ6A 1QB9A 3F9GA 1O3EA 3SW2B 1Z71A 3GCHB 3SV9A 1MBQA 4NCYA 4FU9A 1GMHG 1EPTB 4CHAB 1IHSH 4TPYA 1XUHA 3TJOA 1K1OA 4XBBA 1ZSKA 2P3FH 1CVWH 3U98H 3TGJE 1S81A 3W95A 1FI8A 1DLKB 2G55A 2VJ1A 1TWXB 1EPTA 2BDYA 1C5LH 3NK8A 1MTNC 2A7JA 1PPZA 1QL8A 1BT7A 2FM2A 2BQWB 1YPJH 3OSYA 4AN7A 1V2ST 4LZ4B 2Z3EA 2R2WU 2ZGXH 2V35A 1HAYB 1OPHB 2HVXA 1SMFE 1JXPA 2FOBA 1QR3E 1SL3A 1UVUH 1OX1A 1Y3XA 5PTPA 1VITH 1RD3B 5EG4A 5A0AE 1OWHA 1EXFA 4ISHH 4MVNA 4MPXA 3SNEA 3SUGA 1AFQC 1GL0E 4YTAA 3KEEA 3F9FA 4NSVA 1VCPA 3EAJA 4CBOA 3I29A 1EATA 2EI6A 1P12E 1DPOA 1TX7A 1ESAA 4NFEA 5EQSA 3QX5H 4NIWA 5JBAS 1YP9A 1LHCH 3ZYEA 3SU6A 3E91A 4UONA 4BNRA 3BTME 5EPNA 4WWYA 1TNGA 5T6GA 1NRSH 4U2WA 2ZGBH 2B0FA 5EPYA 1OWJA 1YPHC 3KIDU 1A5HA 4DY7B 1ARBA 3K9XB 3S69A 1WTHD 3ATIA 1GCDA 2A4OA 1OS8A 1ZRKA 1WCZA 1SHYA 1HJAB 1W8BH 2FX4A 4TY6A 6ESTA 2BD9A 5ETXA 1LVMA 1MZDA 2BZ6H 2ODQA 2Y82A 3MNCA 3ZYDA 1EP6A 3CENA 2EI8A 3HPTB 1IQGA 1OP2A 5F8ZA 2AERH 3T26A 4UFGH 1P2OA 8GCHF 1OWKA 3ELAH 1EX3A 4FUFA 4CREA 1A5IA 2PUXB 3LPRA 3OX7U 3QZRA 1A7SA 3FZDA 2PR3A 5A2MH 3O8RA 1AWHB 4KTSA 5JB8S 5J4QA 1HCGA 1C5SA 1P09A 2UWOA 4Q7XA 2LPRA 5E0GA 4FUDA 1AD8H 5AF9H 4H4FA 1B5GH 1GI6A 1HPGA 1JRTA 1O2RA 3A7ZA 4YOJA 1NY22 3QGNB 1J14A 1GBTA 1XMNB 1ELBA 1OOKB 2BY8X 3MNXA 2FZZA 1DM4B 4CRBA 1CHOG 5EXMA 4GPGA 3SV8A 5TCAA 3PMHB 2FMJA 1NRRH 1UCYK 3TH2H 1MMJN 3P70B 1O2ZA 4FUJA 3KN2A 4O9VA 4AFSA 3UFAA 3MI4A 4ZAEA 4I31A 1DWDH 5CHAC 3WY8A 3P8NA 1WQSA 1XKBC 3OU0A 4E7NA 1FY1A 3QZQA 1F0UA 2BTCE 1ZR0A 4UD9H 1C2KA 1C5QA 4KTCA 4UFDH 1W3CA 4OS4A 1W13U 1LVBA 2GVFA 1FY5A 1HAVB 2D26C 1KXAA 2G00A 1AE5A 2F9NA 3RXGA 1ESTA 2AMQA 1VJAU 2SGAA 1SFQB 1UK2A 2F9OA 1HAVA 4WF8A 4ABJA 1TGNA 5EW1H 2BLWA 3ITIA 1O3BA 1TRMA 3RXCA 1MTUA 4VGCB 1RJXB 6GCHG 1N6XA 1TRYA 3BIUH 2QY0B 4IMQA 1HYLA 1CGJE 2QA9E 4Y6DA 3UOPA 1P0SH 5HYOA 2NU3E 3AAUA 1ABJH 3VB7A 4CRDA 1GBKA 3LT3A 4UDWH 1EOJA 3SJOA 1DDJA 2VU8E 1O33A 1BTPA 3BTTE 2FI4E 1DFPA 5EQRA 2BMGB 3QUMP 1MTWA 4GVUA 1EZUC 4WJG2 1L1GA 5GPIB 3QGJA 5B6OA 3SQEE 1SGFA 4CH2B 4IW4E 4IC5A 2VVCA 5A09A 4MPWA 1E37B 1OWIA 4BANB 5TJXA 4XBCA 1GI8B 4AFUA 4GAWA 3NCLA 2VWOA 1Z7KA 5EW2H 1H4WA 2IOTA 3DFJA 2F9BH 3K6YA 1A0LA 3RXUA 1MU8B 3MHWU 2ZO3H 4NWLA 3E0PB 1ZTKA 1GBAA 4X2WA 4X6MA 1QB6A 5HGGA 4B76A 1VITG 1GI9B 3CS0A 1P2KA 1SLUB 5T3HA 1DWCH 4OGYA 1TPAE 1Z8GA 2PTCE 1TGBA 4JCNA 5JBCS 3NZIA 1UCYH 3A87A 2V0BA 2OC0A 3TK6A 2HWLB 3RXRA 2ZFTA 3T27A 1GBHA 1C1TA 4X1RU 1DOJA 2C93B 3OY5U 3RXDA 2ALVA 3RXBA 4THNH 1O3IA 1CA0C 1CSOE 2NWNA 5K0HA 4I8GA 1GGDC 1HNEE 5EU8A 1XVOA 1J9CH 3LH3A 1E38B 1MCVA 1OWEA 1QCPA 2H9TH 2THFB 4PROA 2IPHA 3HK3B 2QCYA 4I32A 4MNXA 1O3CA 3T62A 1O2YA 3TK9A 1Z1JA 4LXBH 2WPLS 4Y11E 1MKXK 1V2LT 3UWIA 4AB8A 1DWEH 3MNBA 1YCPK 1HAPH 3SNAA 1QRXA 1A4WH 1F7ZA 3HK6B 3RC4A 2P95A 2QXIA 5ESBA 8ESTE 5GCHG 4Z0KA 1NM6A 4HTCH 3MH7A 5EXNA 1XUIA 1C1UH 1EP5A 1BOQA 2HOBA 2QXJA 2BD5A 4CRFA 2FO9A 1FY3A 4X8UH 1C1NA 1ORFA 3V12A 1A0JA 2CJIA 3UY9A 2WUBA 2VIVA 3GY6A 1CQQA 3A85A 1EZSC 2ASUB 2F3CE 1NFYA 4ZXYH 1ELCA 1C5TA 3PLPA 3FP6E 4BTIB 2XC4A 1ZHRA 2W5EA 1EOLA 2J95A 4ZROA 1GMCF 3GCHC 1GDQA 3STIA 1L0ZA 2WV4A 3V7TA 4Y0ZE 1P05A 2Z9GA 5DP3A 4CHAC 4NA9H 3OYPA 3E90B 1ANEA 4JYTA 1QRZA 3M3VA 5T6DA 1UTJA 1G3CA 4CBNA 4Y71A 2ZCKP 1DS2E 4J1YA 1FV9A 2H5DA 1A3BH 3BV9B 8KME2 4B73A 2ZCLP 4NIVA 3Q77A 4B2BA 1UTNA 3ZZBA 2B8OH 4WXIA 3KQEA 1TBQH 3TLOA 3SHCH 2GT8A 1MCTA 1Z8RA 5EGMA 2J92A 4IGDA 1MD8A 1SBWA 2GP9B 5CHAB 2NU2E 2W3IA 2QGRA 3SNDA 2ANKH 2ZDNA 1KLIH 1G2LA 1K1JA 2J38A 2F9VA 3F1SB 1AVGH 1TX8A 4HZHA 1B0FA 2XNIA 2OUAA 4IBLH 1ZLRA 4R0IA 2W7UA 3UOUA 2CGAA 3GCOA 4YT6H 1TNLA 5L2YH 3S9CA 4X1PU 3H7TA 1HAIH 3GISB 2ZFQH 1AB9B 4B1TA 1GHAF 2AIPA 2ZC9H 5G4BA 2SGEE 5FHTA 1C5VA 3UNQA 1J16A 1NRPH 1AKSB 1YPLH 2A1DB 3OTJE 5DP7A 3KQCA 1XUFA 3KNXA 3T29A 1GJ5H 1Z1IA 2ZHFH 1KDQA 1H9IE 3PWBA 1YF4A 4FUBA 1UVTH 2W3KA 3SUFA 4D8NA 1MKXH 1O30A 2GCHG 1CT2E 3MTYA 3JZ1B 1HJAC 1AKSA 1YCPH 4X2VA 1LPZB 1THPB 2ZGHA 3MH4A 3LJOA 3EQ0H 1C1RA 1YPMH 4RKOB 1XVMA 1ZHPA 1C5XB 1W10U 3ZZ8A 4BXWA 2ZTYA 1QQ4A 3R0FA 2BDCA 2G4TA 3Q00A 3TU7H 4D7FA 1GVZA 1BTXA 4WMEA 3RLWH 2TPIZ 3M7QA 4LZ1H 1BHXF 2SGDE 4ESTE 3MOCA 3K2UA 2F9UA 2I6SA 2O8WA 3UR6A 1ABIH 1O3PB 4NIXA 4A92A 2GZ7A 3SU1A 2Y81A 4H42U 1DICA 3SUDA 1OXGA 1AFEH 1ZZZA 4IN2A 1WQVH 3T25A 1LCYA 2GMTC 3B9FH 3LU9B 1KXFA 3E8LA 2A4QA 4YOGA 3TVJB 2ZDAH 3A7YA 2ZECA 1ETSH 2C3SA 3HKJB 2EA3A 1INCA 1KXBA 1CBWB 1W7XH 2FI3E 1DY8A 1GJAB 3SU3A 5J4SA 5L6NH 1V2MT 3O8DA 2AFQB 2ZCHP 4UEHH 5AFZH 3R3GB 2G5NA 2FOMB 3Q3XA 3BTHE 2AS9A 5JB9S 3KQDA 2EI7A 3GDUA 4WXVA 1UO6A 1V2JT 1O5DH 5C20A 4FUHA 2GV7A 1P57B 1CA0B 1TRNA 2PFEA 2VIQA 2SNVA 5FBIA 5FXLA 1FAKH 1T4VH 3ZVEA 1GGDB 2ANMH 4K2YA 1N8OB 3LDXH 1QJ6B 1ESBA 3BEUA 3RXAA 1HIAA 1MKWH 8GCHG 1DANH 3ESTA 2BD8A 4GHTA 2OQUA 2OXSA 3PWCA 1Z8IB 1FXYA 2BD3A 1G3EA 1NC6A 4H6TA 1UVOA 3A86A 3MO6A 3MO9A 3PO1B 3RXQA 1FQ3A 3ZVDA 1NT1A 2ZU2A 4TPIZ 1T8MA 4VGCC 3TK5A 7LPRA 3LGUA 1ZMJA 3ZZDA 5A0CA 3QTOH 3RU4D 2ZQ1A 1DSTA 1BMMH 3ZVGA 4ISNA 1HJ8A 2TGDA 1TPPA 2F9PA 1O38A 3PM3A 4JYVH 1G3BA 1W0YH 2FWWA 3HGPA 2A2XH 1O3NA 1SGIB 2OBQA 4X1NU 3MWIU 1IQMA 5FX5A 1D6RA 3GCTF 4NGAH 1Q2WA 2Y7XA 3RMNH 3KCGH 1U6QA 4AGJA 4MPVA 2FESH 1OP8A 2GV6A 3AASA 3ATLA 5JYIA 1GG6B 2FP7B 1GJ9B 1GI3A 1HGTH 1UHBB 1GHVH 1S84A 3U1JB 1SGPE 1RIWC 3KGPA 5HM9A 4MQAA 4I33A 1AVWA 4DT7B 1QHRB 1YCPM 1GBDA 2PWXA 2H1UA 1UHBA 2ZNKH 3ZVBA 7GCHF 2TRMA 1F5KU 2WPMS 2C8XB 2FLBH 2GD4B 2IJOB 5HXFA 3PMJA 2PGQB 1A61H 1EJMA 2PHBA 4UFEH 4Y8YA 2SGFE 3RXMA 5DGJA 5I46H 3L3TA 4ZMAH 2RDLA 1O2IA 1YLDA 2A2QH 1SGCA 2FYRA 2XBWA 3MYWA 4I8KA 1O5FH 1T8NA 2ZPQA 1TQ0B 3E1XB 2HGTH 2FEQH 1UTLM 4E06H 1VJ9U 3RXKA 1NFUA 3F9EA 4INKA 3SV2H 4FU8A 1RS0A 2ZWLH 3F6UH 1GHBF 1RGQA 3MU5A 1OSSA 1AWFH 2P93A 1D3TB 3SGQE 3DUXH 3RUOA 2UUFB 1TBZH 1HAZB 1UK3A 1P2JA 1PPBH 4ABAA 1PYTD 2GKVE 4Q2KA 1AQ7A 3LC3A 5JBBS 4KP0A 1GMDF 3L33A 1MAYA 5C5OA 1V2OT 1SQTA 4OS6A 1TPSA 2BY6X 1FPCH 4I8JA 3SNCA 2ZZUH 1IQEA 3M35A 1O3KA 3A82A 3Q76A 2TGPZ 4FUCA 1GBJA 1TNJA 2J34A 1TNIA 4BAMB 3SN8A 5ESTE 1SQOA 1G36A 1RRKA 1BRCE 1ZMLA 1WYKA 2GX4A 9LPRA 1ETRH 4HGCA 4AX9H 3RMOH 4Y0YE 1TX6A 2PKSC 4MG3A 1NU9A 1E35B 1FZZA 3KF2A 4SGBE 1JRSA 2FOGA 3S7KB 1SGDE 1SGRE 1O2NA 1TPOA 3BN9A 1KYNA 1AN1E 3V3MA 1BHXB 2Y7ZA 3GY4A 2GMTB 1OWDA 3BTQE 1CGHA 1CO7E 1VR1H 3VEQB 1HDTH 1O2SA 1LMWB 2GGVB 2FX6A 1EJAA 2XTTB 5EODA 3RLYH 3SQHE 1J8AA 4NA7A 1GDUA 2Y80A 1AIXH 1VCQA 3V13A 2ANYA 3URDA 3RC6A 1O3HA 1BCUH 1F92A 4AGKA 2WPKS 2ZU3A 1DWBH 3E6PH 1EAXA 5JDUB 1PQAA 2UUJB 1W2KH 1YPGH 4A1VA 1FY8E 3UNSA 1YGCH 2FOAA 1LTOA 1SFIA 1HLTH 3UPEA 1Q31A 1WV7H 1Y5UT 1DLEA 1G32B 3RDZA 2BX4A 2H9EH 4WH6A 3H7OA 1O3MA 5FPSA 2RCEA 2ZHWH 1O0DH 1IHTH 1GMHF 4NWKA 5LPRA 1AB9C 1XUGA 1YLCA 4ZKNU 1C2MA 5T6FA 1FNIA 2M5TA 3I77A 2Q6DA 4X8TH 2BX3A 2OC8A 1SGNE 1W12U 2FOEA 2TGAA 4A6LA 2ZI2H 2ZU4A 2PLXA 1O5CB 2DE9A 3ENSB 1GBEA 2QF3A 4X1SU 4AG1A 1GJ6A 4U01A 5L30H 1TONA 3RM2H 2A5KA 1O2OA 4AFZA 5SGAE 1F0RA 1HV7A 3D62A 2A7HA 1GBLA 3A8DA 4K8YA 2BHGA 1V2NT 4F4OC 2WYGA 3K65B 2XCFA 2CF9H 3U8RH 1TIOA 3U1IB 4ABFA 2CHAC 5F8TA 2BOHB 2Z9KA 3T5FH 1S83A 2W26A 1EAWA 1SLVB 1N1LA 3AW1A 3PMBB 4TYDA 1RIWB 1FDPA 3M37A 3GYLB 5CE1A 1Z6EA 1FIWA 2R3UA 1VGCC 1GHZA 1TABE 5BRRE 1K9OE 1IQJA 1H9HE 1GBMA 5FPTA 1THSH 2GDEH 1O3GA 1LPKB 2VVUA 2BLOA 1L1NA 1W0ZU 1ZSLA 4D9QA 1LHGH 1GHAG 2ZTXA 1F5RA 1WAYB 1LKAA 1UK4A 4Y7BA 2AYWA 4UE7H 1CBWC 1QRWA 2WPIS 3TJNA 2VGCC 1O3OA 1LVOA 2UWLA 4Y7AA 1YYY1 3KQBA 3LJJA 3FFGA 3VGCC 3EDXB 4JZDH 3FANA 5C2ZA 1K1PA 1C5UA 3ZZ4A 3ATKA 1ELFA 1GDNA 1QA0A 2VH0A 1G37A 3FP7E 2BB4A 4YM9A 1N8OC 2ZPSA 4A1TA 3GYMA 1SVPA 2P94A 4KKDA 1SB1H 1P3CA 1DX5M 4XDEA 1PPGE 3BSQA 4INHA 1P3EA 3SJKA 2Y6TA 1GCTB 4BAOB 1K21H 4AZ2B 4Y10E 3RXTA 3PO1C 1WSSH 2BD7A 3SGAE 1T31A 1O3FA 1DXWA 4JZ1A 1BRAA 1C2DA 1LHDH 1TNHA 1TNKA 4ZXXH 1V2UT 2BZAA 2OINA 1Y3VA 1ZMNA 2WPHS 2C8YB 1JMOH 2VIWA 3LGYA 5GJ4B 2PTNA 2VIDA 1TGTA 2FTLE 4ZHLU 1TGSZ 3RM0H 2TIOA 1J15A 1ZJKA 1ELVA 1C4U2 4YLUA 1BITA 1HFDA 3M5OA 2PKSB 4YOIA 3QTVH 2GZ9A 4IS5A 1V2RT 4ZKOU 2BD4A 2G8TA 4F49A 2WINI 3VFEA 4DIIH 1BUIA 1GG6C 4UFFH 1H1BA 4D7GA 3GDSA 4K8BA 3ZVCA 1QTFA 1BJUA 3SU4A 4ABDA 2H5CA 2OCVB 3MU1A 4FVBA 2AMPA 3A8AA 2WUCA 4TWWA 1JIMA 1JOUB 3A81A 1ZSJA 1O2HA 4YZUA 2J9NA 4GSOA 1GHYH 4U30A 2XW9A 1HAGE 3MH5A 3PV4A 1XXFA 1KXEA 3RXOA 1HAOH 6GCHF 5EQQA 3A83A 2RA0A 1V2KT 4K1EA 1ZGIA 1T8LA 1MH0A 4X1QU 2FOCA 1A46H 2BVSH 2ALPA 3M3TA 1BIOA 5GXPA 1SGFG 4GLYA 1ELEE 2SGQE 6CHAB 2G81E 4K69A 3RP2A 3KL6A 4XBDA 1EAUA 1JWTA 4ISOA 1S5SA 4DJZB 1EQ9A 1BBRE 4JMYA 4A5TS 3P17H 1O2WA 4BOHA 3VB3A 4DCDA 1YC0A 4DOQA 4O3UA 1AZ8A 2ZG0H 4X6PA 1EAIA 3RMLH 1KDQB 5F8XA 2GCTB 2PSYA 3GCTG 5LPEA 1L4DA 2SNWA 5ABWA 4Y79A 1TFXA 4ISIH 3A7TA 3BF6H 3P8OA 2NU4E 1UMAH 1UTPA 3SNBA 3M36A 3PLKA 4IC6A 3EGKH 4X8VH 3IITA 4BAKB 3S9BA 2Z9JA 1MD7A 2H6MA 5DJ7A 1K1NA 2BY5X 4CRCA 1KY9A 5FCRA 3AVZA 1KIGH 3MFJA 5L2ZH 2BY7X 7GCHG 1ZPZA 1LHEH 3GY8A 3FVFB 2CMYA 2XBYA 1GJBB 3RXEA 2HLCA 1PPHE 5DG6A 5BPEA 1C5MD 1QBVH 2KAIB 2CHAB 3SUEA 1C4Y2 1YKTA 4KELA 1BA8B 2BQ6B 5C3NA 3UUZA 2PGBB 5DP9A 1T8OA 1WUNH 2C8WB 1TGCA 2KAIA 3C27B 5FX6A 2O8MA 1V2TT 3P92A 1Y59T 1ZRBA 4FU7A 1SPJA 2VWLA 2STBE 1O34A 1SQAA 3SGBE 1VGCB 1KXDA 3ATWA 1FN8A 2J2UA 1N6YA 7ESTE 4FVDA 3JZ2B 4WY3A 1EJNA 1DITH 1UTKA 1VCWA 1BMNH 1GHBG 1KSNA 1DT2A 2OBOA 1GBBA 1C5OH 1ACBE 1WTGH 2CV3A 1G9IE 3TJVA 5GDSH 1F2SE 1ZYOA 2BDHA 4OS2A 1O5BB 1MAXA 1FN6A 2ZDMA 4SGAE 4WVPE 3QO6A 3ZZ9A 3GDVA 1P03A 2VGCB 2XC5A 1QIXB 1IQNA 2WV5A 1G2MA 3A80A 2ZHQH 3MU0A 1AMHA 2ZQ2A 3RXVA 1TA2A 3VGCB 5GIBA 2ESTE 4X2YA 1SGEE 3NPSA 3Q3KA 2VWMA 5DP5A 1NN6A 1HIAB 3SOSA 2B9LA 1WBGB 3SJIA 2ZGJA 1V2VT 4I8LA 1O35A 2XC0A 1TOMH 4K1TA 3ZZ5A 2O8TA 4YESB 1ARCA 2ZFFH 5A8YA 1MTVA 4D76A 1C1WH 4FUEA 1BZXE 3P95A 1H8IH 1C5WB 1K1MA 1TYNA 2O8LA 3H5CB 1TMUH 1GI5A 2ZA5A 3MU4A 1BRUP 1NO9H 1X7AC 1GJ8B 1ZJDA 1BMLA 2F83A 1TMBH 4ZH8A 1MUEB 3AW0A 2OQ5A 4DIHH 1GBFA 1O2MA 4ASHA 1TMTH 1AE8H 3A7XA 3QN7A 1FJSA 2FOHA 3M5MA 1Y5AT 1UVPA 1O39A 3ZV8A 1C1QA 2H2ZA 3BG4B 3OY6U 4X2XA 2FIRH 1W14U 1EB2A 1PPFE 2D2DA 1GI7B 5FAHA 3KHVA 3BEIB 2ZFSA 1SGYE 1Z6JH 2AGIX 3BTEE 1O3LA 3LGWA 5CMXH 2D8WA 4ZKSU 4A7IB 1NZQH 1MTSA 3RU4E 1FUJA 5AHGH 1KTSB 1RFNA 2STAE 1PQ5A 3IG6B 1TBRH 2FPZA 2BM2A 3S0NA 2P8OC 4ZKRU 5LPFA 1SOTA 1C1VH 1P10A 3M5NA 2A0QB 4OS1A 2JH5D 1LVYA 2YNBA 2GCHF 1D4PB 5C1XA 3SO3A 4ABEA 1O36A 1ANDA 3PROA 1S82A 3RXSA 2ZHEH 4D9RA 1O37A 1BDAA 5IYTA 1CT4E 1CE5A 1T32A 2RG3A 2XCNA 3P6ZB 2NU0E 1GI1A 1SR5C 1P2NA 3D65E 1E0FD 1S6FA 3GCNA 1C2EA 5FCKA 1MQ6A 2D1JA 1C5ZB 1L2EA 2YNAA 3ODDA 3P8GA 4QT8C 3SJ8A 2TBSA 2ZDLA 4LOYH 4X6OA 3LONA 2FDAA 3D49H 1NPMA 3EE0B 4NIYA 3E3TA 1NRNH 1BMAA 4WMDA 1HUTH 1ANCA 2P3UB 3E16B 1S0QA 5A8XA 1O2KA 4MNYA 2BD2A 2ZTZA 4B71A 1Y3UA 3BG8A 2HALA 1ZTLA 5HM2A 1CGIE 4MLFB 1ZPCA 1GHXH 3EYDA 3PTNA 2QV1A 1GCTC 1G3DA 4K1SA 1OP0A 1GWAA 4ABBA 5C67A 4I7YH 3SU2A 1NROH 1QBOA 4FUGA 4HI3A 1EKBB 1GBCA 1SSXA 3IWMA 1G30B 2AMDA 3CS7A 2Z3CA 2IN2A 4I8HA 2BDGA 3TITA 4JK6A 1ID5H 1O2JA 5JBTA 4DURA 4Q80A 3TIUA 3BIVH 3F9HA 3TNSA 1OYQA 2VINA 2JKHA 3LKWA 3SBKA 3U9AH 1QNJA 3EA9A 1LO6A 3GY2A 2ODPA 4M7GA 3TH3H 2Z7FE 4TWYA 2C4FH 1LPGB 4MNVA 2O9QA 1IQLA 5E8EH 1TALA 4XOJA 1NFWA 1TOCB 4MNWA 2HPPH 3S7HB 1A5GH 3TGKE 3PB1E 2XBXA 2BYAX 3ZZ3A 2K1QA 2V3HH 2A31A 4U32A 4ZHMU 1P2MA 1PQ7A 1F0SA 2BLQA 1QY6A 3NUMA 1P02A 1FONA 1IQKA 1GJ7B 1PJPA 4AOQA 4Q7ZA 1C1SA 1PFXC 1HXEH 4XFQA 1ZHMA 1UVSH 2Q6FA 3BTKE 1BQYA 3F68H 2OC1A 4JYUH 2Z9IA 2J4IA 2A4GA 2UUKB 2A7CA 3HKIB 3GY7A 3M61U 2VIOA 1BTHH 3LGVA 4INLA 1NS3A 4GCHF 2QN5T 4CH8B 3C1KA 1ZPBA 3ZZ7A 5E0JA 6CHAC 3BEFB 5TCCA 4O97A 3K6ZA 5AFYH 1OKXA 1YBWA 2NU1E
chains in the Genus database with same CATH superfamily
5DK1A 4Y8XA 3UNRA 3VPKA 1ELGA 3B23B 4ZUHA 2B5TB 1GI0A 4X0WU 5DP4A 1GJDB 3RMMH 1D3PB 4MPUA 1FLEE 1SLWB 2BY9X 1O31A 3LIWA 5H4IB 4A1XA 4NFFA 1TLDA 2GCTC 2QXGA 3LGTA 3SV6A 3ZZAA 1C1OA 3SHAH 5DSFA 1AI8H 3GOVB 1MQ5A 1TQ7B 2JETB 2ODYB 3UIRA 1GMCG 1NESE 2PUQH 3MU8A 2BOKA 2KCAA 1HAXB 2HNTE 4X8SH 1GJCB 3SI3H 5E2OA 2PKAB 1O3JA 4Q4LA 1SOZA 6LPRA 1Z8JB 1GI4A 4MDSA 1F5LA 4MTBA 1Y3WA 4AG2A 3UQVA 1YM0A 5EXLA 4JZIA 1RTFB 3RXLA 2ZU1A 2PKAA 1O2TA 2QYIA 9ESTA 8LPRA 4HFPB 3BTWE 3DHKH 3HATH 1C5YB 1THRH 1NU7B 5KECA 1Y8TA 3E0NB 2BDBA 1O5GH 4XE4A 1P2IA 4NZLA 3GICB 1DUAA 4JZEH 3SORA 1ZTJA 2VWNA 3ODFA 4BXSA 3TNTA 2C8ZB 3RXFA 4YLQH 3SI4H 2P8OB 2YOLA 3GS9A 1XKAC 1C1MA 4KGAA 4NG9H 2A5IA 1O3AA 1QB1A 4FUIA 2O8UA 2OC7A 2Z94A 1A1RA 5C5NA 2G51A 1FAXA 3M7TA 4AYYB 1BBRK 4H6SB 1AUTC 4LK4A 2ZFRH 3V0XA 2V3OH 2GDDA 4O3TA 4AYVB 1DSUA 2A4RA 1AU8A 3L6PA 4JZFH 3RC5A 3S9AA 3T28A 2G5VA 1E36B 1B7XB 2OLGA 1O2QA 1A3EH 1K28D 1FY4A 2VIPA 1AHTH 1MTNB 1P04A 5AVDA 3AAVA 1AY6H 1LHFH 2GT7A 3FZZA 3PYHA 3U8TH 2Z9LA 4DGJA 3A89A 2G4UA 2QIQA 7KMEH 1KXCA 1HXFH 2LNCA 1GJ4H 1S6HA 1CT0E 4WH8A 1NFXA 1WOFA 2PP6A 5E2PA 5I25A 5DO4H 1YPHE 3TJUA 2CF8H 1AFQB 1FPHH 2FS8A 1V3XA 1NTPA 3CP7A 1DVAH 4BAHB 3VXFH 4J2YB 1EZQA 2CN0H 2FOFA 2JH0D 1DY9A 4O03A 2QC2A 2IPQX 3TPIZ 1K22H 2G52A 1P8VC 1GHWH 3A84A 3SU5A 4AB9A 1EASA 1O2PA 2XRCA 3VB4A 1O5AB 2I6QA 1H8DH 1O2XA 1P11E 3LH1A 5EJZA 1CHGA 4BTTB 1AGJA 1PPEE 3U69H 1EZXC 1TB6H 5LGOA 3URCA 1UCYE 1QQUA 1CHOF 2C90B 4DG4A 4ABHA 2AEIH 2P59A 2Q6GA 4KTUA 4X6NA 2BDAA 1UTQA 3A7VA 1GVKB 2ZGCA 2FYQA 2QAAA 3ZVFA 3STJA 1AO5A 5FPYA 1C9PA 1CU1A 3ZVAA 4OGXA 1EB1H 1SLXB 1UTOA 1TE0A 1B0EA 5LH8A 4B75A 1C2IA 4TY7A 3BG4C 1A2CH 1ELAA 2LELA 4CRAA 2L6OA 2VB0A 4RSPA 4AFQA 1RTKA 3MNSA 3O8CA 1C2JA 1XM1A 4YO9A 1QJ1B 1SGQE 4DW2U 4RKJB 1LQDB 3VB6A 2AGGX 1C2HA 4BAQB 5IDKA 2VH6A 1W11U 1EUFA 1L1JA 2H9HA 2UWPA 2EC9H 3UTUH 1C5NH 3QDZB 1NRQH 1P2QA 1RXPA 2FLRH 4R8TB 2V3MA 4ABIA 2QF5A 1K1LA 3UWJH 3LC5A 1C2LA 2B7DH 4E7RG 5GNDA 1LQEA 2TGTA 5DPAA 1BJVA 1V2WT 1XXDA 1AUJA 1QL9A 1EPTC 4B2AA 4FETA 1BBRH 4E05H 2Q1JA 4IN1A 1LKBA 4JK5A 1V2QT 1BTUA 3MH6A 5C1YA 2J94A 1C5RA 1C2GA 1C2FA 1SI5H 4B2CA 3RXPA 3A8BA 4Y76A 1XUJA 2Y5FA 2ULLA 2BDIA 1QBNA 2CXVA 3SYJA 1A0HB 3HGNA 3DSGA 2JH6D 1M9UA 3QWCH 1C1PA 1P9UA 2ZU5A 3PMAB 2LP6A 1O2GH 3GY5A 1ELTA 2A45B 1QA7A 1P9SA 2R3YA 5F03A 2ZIQH 1O3DA 2W7SA 1MU6B 1HJ9A 1PQ8A 2ILNA 2A5AA 4Z6AH 2EEKA 1MKWK 2DE8A 2JJ2D 3SU0A 4Y8ZA 4FXGH 3QLPH 2BXUH 1Y5BT 1SC8U 1VITF 3I78A 5F6MA 4CR9A 3PTBA 2ZDKA 2ZHDA 3TGIE 3ZZCA 2QF0A 1O2UA 3RXHA 2BVXH 1O32A 1GL1A 3QK1A 2P16A 5EOKA 3O8BA 1BTWA 2Y5HA 3MMGA 2WPJS 3VB5A 2Z3DA 1BMFD 1GPZA 4ISLA 4ZHAA 3RXJA 3U8OH 1K1IA 4B74A 1SHHB 2FI5E 3FAOA 1TAWA 2XYAA 3RXIA 3G01A 1JBUH 1RTLA 4GHQA 1P06A 2ZEBA 1L4ZA 3DT0H 1DE7H 1PPCE 2VVVA 5A8ZA 1K2I1 2A32A 2P3TB 4CRGA 3W94A 5IK2D 1O2LA 2AIQA 2PW8H 1CA8B 3WWBA 3BTFE 1FIZA 2R0LA 4OS5A 3M3SA 1KLJH 1ANBA 2HPQH 1GI2A 1IOEA 3A8CA 4WMFA 2FXRA 1QZ8A 2XXLA 1SGTA 1IAUA 1LDTT 1PYTC 2BQ7B 1E1QD 3EA8A 5GWZA 1C5PA 1O5EH 2ANWA 1T4UH 5HMAA 2AH4X 2DUCA 1ZGVA 4NZQA 1P01A 2GZ8A 4XSKU 3RU4T 2OP9A 3SZNA 5GCHF 1W7GH 1YY3A 3UREA 2FTMA 1MZAA 1S85A 2OD3B 1FMGA 1C9TA 2PV9B 1GMDG 1IQIA 2ZDVH 3ATMA 1T7CA 3NXPA 3VXEH 2ZPRA 3B8JA 5FL7D 1D3QB 1HB0B 1QJ7B 1UTMA 1JIRA 1V6DA 4OS7A 4K5ZA 1HAHH 1IQHA 2QXHA 4ASUD 2ZKSA 5C1UA 1TA6A 3DD2H 3GY3A 1AVXA 1J17T 2ZP0H 4GUXA 1ZOMA 4YT7H 4P02A 1QFKH 3A88A 2RA3A 3M5LA 1BTZA 2BLVA 3NWUA 1DXPA 4I86A 1MBMA 1V2PT 3P8FA 5DKMA 2JIZD 2XWBI 5KGOA 1WU1A 1F0TA 2R9PA 2ZFPH 3DFLA 5K7RA 3D23A 1S0RA 4DVAU 2AGEX 1GBIA 3NKKA 2BVRH 1XX9A 2XWAA 2R2MB 3F3BA 5JPMH 2R0KA 1D3DB 4BTUB 2JETC 3PRBA 2PSXA 1ETTH 4IMZA 4K60A 3DA9B 1IQFA 1O2VA 2Z6BD 3BTGE 2VNTA 2F91A 3M7UA 1C4V2 2FODA 4Q7YA 1AZZA 2BXTH 2HRVA 1KLTA 3BTDE 1VZQH 1QL7A 1D6WA 2HNTF 3FP8E 1ELDE 5FBEA 3SJ9A 1YPKH 5DP6A 1XUKA 3Q3YA 2V6NA 1UJ1A 3SV7A 3EA7A 4CR5A 5A0BA 2Y5GA 1HRTH 1Y3YA 2ZF0H 1QGFA 1KTTB 3N7OA 3UR9A 1HBTH 5DP8A 3MO3A 3FOAA 1QURH 3PLBA 1SG8B 3TH4H 3LOXA 1BB0B 4K3JA 2SFAA 4RN6A 3ZV9A 2WYJA 2OTVA 2GTBA 1H9LB 2FS9A 1YPEH 4NA8A 1BTYA 3UQOA 4NSYA 2HNTC 4GCHG 1DUEA 4AORA 2SGPE 3T2NA 1E34B 2XBVA 1BRBE 1OYTH 1Q3XA 2UUYA 2W6ID 3LGIA 3W1EA 4ABGA 5E0HA 1D9IA 3A7WA 1GVLA 3ZZ6A 1QB9A 3F9GA 1O3EA 3SW2B 1Z71A 3GCHB 3SV9A 1MBQA 4NCYA 4FU9A 1GMHG 1EPTB 4CHAB 1IHSH 4TPYA 1XUHA 3TJOA 1K1OA 4XBBA 1ZSKA 2P3FH 1CVWH 3U98H 3TGJE 1S81A 4XRNA 3W95A 1FI8A 1DLKB 2G55A 2VJ1A 1TWXB 1EPTA 2BDYA 1C5LH 3NK8A 1MTNC 2A7JA 1PPZA 1QL8A 1BT7A 2FM2A 2BQWB 1YPJH 3OSYA 4AN7A 1V2ST 4LZ4B 2Z3EA 2R2WU 2ZGXH 2V35A 1HAYB 1OPHB 2HVXA 1SMFE 1JXPA 2FOBA 1QR3E 1SL3A 1UVUH 1OX1A 1Y3XA 5PTPA 1VITH 1RD3B 5EG4A 5A0AE 1OWHA 1EXFA 4ISHH 4MVNA 4MPXA 3SNEA 3SUGA 1AFQC 1GL0E 4YTAA 3KEEA 3F9FA 4NSVA 1VCPA 3EAJA 4CBOA 3I29A 1EATA 2EI6A 1P12E 1DPOA 1TX7A 1ESAA 4NFEA 5EQSA 3QX5H 4NIWA 5JBAS 1YP9A 1LHCH 3ZYEA 3SU6A 3E91A 4UONA 4BNRA 3BTME 5EPNA 4WWYA 1TNGA 5T6GA 1NRSH 4U2WA 2ZGBH 2B0FA 5EPYA 1OWJA 1YPHC 3KIDU 1A5HA 4DY7B 1ARBA 3K9XB 3S69A 2J98A 1WTHD 3ATIA 1GCDA 2A4OA 1OS8A 1ZRKA 1WCZA 1SHYA 1HJAB 1W8BH 2FX4A 4TY6A 6ESTA 2BD9A 5ETXA 1LVMA 1MZDA 2BZ6H 2ODQA 2Y82A 3MNCA 3ZYDA 1EP6A 3CENA 2EI8A 3HPTB 1IQGA 1OP2A 5F8ZA 2AERH 3T26A 4UFGH 1P2OA 8GCHF 1OWKA 3ELAH 1EX3A 4FUFA 4CREA 1A5IA 2PUXB 3LPRA 3OX7U 3QZRA 1A7SA 3FZDA 2PR3A 5A2MH 3O8RA 1AWHB 4KTSA 5JB8S 5J4QA 1HCGA 1C5SA 1P09A 2UWOA 3OAAD 2WV9A 4Q7XA 2LPRA 5E0GA 3F2FA 4FUDA 4DT4A 1AD8H 1NBME 5AF9H 4H4FA 1B5GH 1GI6A 1HPGA 1JRTA 1O2RA 3MQKC 3A7ZA 4YOJA 1NY22 3QGNB 4FOUC 1J14A 1GBTA 1XMNB 1ELBA 1OOKB 2BY8X 3MNXA 2FZZA 1DM4B 3H09A 4CRBA 2QF4A 1CHOG 5EXMA 4GPGA 3SV8A 5TCAA 3PMHB 2FMJA 1NRRH 1UCYK 3TH2H 1MMJN 3P70B 1O2ZA 4FUJA 3KN2A 4O9VA 4AFSA 3UFAA 3MI4A 4ZAEA 4I31A 1DWDH 5CHAC 3WY8A 3P8NA 1WQSA 1XKBC 3OU0A 4E7NA 1FY1A 3QZQA 3UAIC 3UB0A 1F0UA 2BTCE 3OEHD 1ZR0A 4UD9H 1C2KA 1C5QA 4KTCA 4UFDH 1W3CA 5EJ1A 4OS4A 1W13U 1LVBA 3VG8A 2GVFA 1FY5A 1HAVB 2D26C 1KXAA 2G00A 1AE5A 2F9NA 3RXGA 1ESTA 2AMQA 1VJAU 2SGAA 1SFQB 1UK2A 2F9OA 5C0TA 1HAVA 4WF8A 4ABJA 1TGNA 5EW1H 2BLWA 3ITIA 1O3BA 1TRMA 3RXCA 1MTUA 4VGCB 1RJXB 6GCHG 1N6XA 1TRYA 3BIUH 2QY0B 4IMQA 1HYLA 1CGJE 2QA9E 4Y6DA 3UOPA 1P0SH 5HYOA 2NU3E 3AAUA 1ABJH 3VB7A 4CRDA 1GBKA 1KMHB 3LT3A 4UDWH 1EOJA 3SJOA 1DDJA 2VU8E 1O33A 1BTPA 2K0QA 3BTTE 2FI4E 1DFPA 5EQRA 2BMGB 3QUMP 1MTWA 4GVUA 1EZUC 4WJG2 1L1GA 5GPIB 3QGJA 5B6OA 3SQEE 1SGFA 4CH2B 4IW4E 4IC5A 2VVCA 5A09A 4MPWA 1E37B 1OWIA 1YWUA 4BANB 5TJXA 2KX4A 4XBCA 1GI8B 4AFUA 1K0HA 1E79D 4GAWA 3NCLA 2VWOA 1Z7KA 5EW2H 1H4WA 3WW7A 2IOTA 3DFJA 2F9BH 3K6YA 1A0LA 3RXUA 1MU8B 3MHWU 2ZO3H 4NWLA 1UW7A 3E0PB 1ZTKA 1GBAA 4X2WA 4X6MA 1QB6A 5HGGA 4B76A 1VITG 1GI9B 3CS0A 1P2KA 1SLUB 5T3HA 1DWCH 4OGYA 3KYFA 1TPAE 1Z8GA 2PTCE 1TGBA 4JCNA 5JBCS 2VBCA 3NZIA 1UCYH 3A87A 2V0BA 2OC0A 3TK6A 2HWLB 3RXRA 2ZFTA 3T27A 1GBHA 1C1TA 4X1RU 1DOJA 2C93B 3OY5U 3RXDA 3F2HA 2ALVA 3RXBA 4THNH 1O3IA 1CA0C 1CSOE 2NWNA 5K0HA 4I8GA 1GGDC 1HNEE 5EU8A 1XVOA 1J9CH 3LH3A 1E38B 1MCVA 1OWEA 1QCPA 2H9TH 2THFB 4PROA 2IPHA 3HK3B 2QCYA 4I32A 5F53A 4MNXA 1O3CA 3T62A 1O2YA 3TK9A 1Z1JA 4LXBH 2WPLS 4Y11E 1MKXK 1V2LT 3UWIA 4AB8A 1DWEH 3MNBA 1YCPK 4HG6A 1HAPH 3SNAA 1QRXA 1A4WH 1F7ZA 3HK6B 3RC4A 2P95A 2QXIA 5ESBA 8ESTE 5GCHG 4Z0KA 1NM6A 4HTCH 3MH7A 5EXNA 1XUIA 1C1UH 1EP5A 1BOQA 2HOBA 2QXJA 2BD5A 4CRFA 2FO9A 1FY3A 4X8UH 1C1NA 3F0PA 1ORFA 3V12A 1A0JA 2CJIA 3UY9A 2WUBA 2VIVA 3GY6A 2F43B 1CQQA 3A85A 2J97A 1EZSC 2ASUB 2F3CE 1NFYA 4ZXYH 1ELCA 1C5TA 3PLPA 3FP6E 4BTIB 2XC4A 1ZHRA 2W5EA 1EOLA 3EE7A 2J95A 4ZROA 1GMCF 3GCHC 1GDQA 3STIA 1L0ZA 2WV4A 3V7TA 4Y0ZE 1P05A 2Z9GA 5DP3A 4CHAC 4NA9H 3OYPA 3E90B 1ANEA 4JYTA 1QRZA 3M3VA 5T6DA 1UTJA 1G3CA 4CBNA 4Y71A 2ZCKP 1DS2E 4J1YA 1FV9A 2H5DA 1A3BH 3BV9B 1MABB 8KME2 4B73A 2ZCLP 4NIVA 3Q77A 4B2BA 1UTNA 3ZZBA 2B8OH 4WXIA 3KQEA 1TBQH 3ZIAD 3TLOA 3SHCH 2GT8A 1MCTA 1Z8RA 5EGMA 2J92A 4IGDA 1MD8A 2W6JD 1SBWA 2GP9B 5CHAB 4RT0A 2NU2E 1FX0B 2W3IA 2QGRA 3SNDA 2ANKH 2ZDNA 1KLIH 1G2LA 1K1JA 2J38A 2F9VA 3OE7D 3F1SB 1AVGH 1TX8A 4HZHA 1B0FA 2XNIA 2OUAA 4IBLH 1ZLRA 4R0IA 2W7UA 3UOUA 2CGAA 3GCOA 3PRDA 4YT6H 1TNLA 5L2YH 3PV5A 4X1PU 3H7TA 1HAIH 3GISB 3S9CA 2ZFQH 1AB9B 4B1TA 1GHAF 2AIPA 2ZC9H 5G4BA 2SGEE 5FHTA 1C5VA 3UNQA 1J16A 1NRPH 1AKSB 1YPLH 2A1DB 3OTJE 5DP7A 3KQCA 1XUFA 3KNXA 3T29A 1GJ5H 1Z1IA 2XOKD 2ZHFH 2KZ4A 1KDQA 2CK3D 1H9IE 3PWBA 1YF4A 4FUBA 1UVTH 2W3KA 3SUFA 4D8NA 1MKXH 1O30A 2GCHG 1CT2E 3MTYA 3JZ1B 1HJAC 1AKSA 1YCPH 4X2VA 1LPZB 1THPB 2ZGHA 3MH4A 2EY4C 3LJOA 3EQ0H 1C1RA 1YPMH 4RKOB 1XVMA 1ZHPA 1C5XB 1W10U 3ZZ8A 4BXWA 2ZTYA 1QQ4A 3R0FA 2BDCA 2G4TA 2XNDD 3Q00A 3TU7H 4D7FA 1GVZA 1BTXA 2J5UA 4WMEA 3RLWH 5DN6D 2TPIZ 3M7QA 4LZ1H 1BHXF 2SGDE 4ESTE 2KM0A 3MOCA 3K2UA 2JDID 2F9UA 2I6SA 2O8WA 3UR6A 1ABIH 1O3PB 4NIXA 4A92A 2GZ7A 3SU1A 2Y81A 4H42U 1DICA 3SUDA 1OXGA 1AFEH 1ZZZA 4IN2A 1WQVH 3T25A 1LCYA 2GMTC 2WSSD 3B9FH 3LU9B 3N7EA 1KXFA 3E8LA 2A4QA 4YOGA 3TVJB 2ZDAH 3A7YA 4XD7D 1EFRD 2ZECA 1ETSH 2C3SA 3HKJB 2EA3A 1INCA 1KXBA 1CBWB 1W7XH 2FI3E 1DY8A 1GJAB 3SU3A 5J4SA 5L6NH 1V2MT 3O8DA 2AFQB 2ZCHP 4UEHH 5AFZH 3R3GB 2G5NA 2FOMB 3Q3XA 3BTHE 2AS9A 5JB9S 3KQDA 2WPDD 5KEDA 2EI7A 3GDUA 4WXVA 1UO6A 1V2JT 1O5DH 5C20A 4FUHA 2GV7A 1P57B 1CA0B 1TRNA 2PFEA 2VIQA 2SNVA 5FBIA 5FXLA 1FAKH 1T4VH 3ZVEA 1GGDB 2GJGA 2KCOA 2ANMH 4K2YA 1N8OB 3LDXH 1QJ6B 1ESBA 3BEUA 3RXAA 1HIAA 1MKWH 8GCHG 1DANH 3ESTA 2BD8A 4GHTA 2OQUA 2OXSA 3PWCA 1Z8IB 1FXYA 2BD3A 1G3EA 1NC6A 2KR7A 4H6TA 1UVOA 3A86A 3MO6A 3MO9A 3PO1B 3RXQA 3KYGA 1FQ3A 3ZVDA 1NT1A 2ZU2A 4TPIZ 1T8MA 1SKYE 4VGCC 3TK5A 7LPRA 3LGUA 1ZMJA 3ZZDA 5A0CA 3QTOH 3RU4D 2ZQ1A 1DSTA 1BMMH 3ZVGA 4ISNA 2F4LA 2YMSB 1HJ8A 2TGDA 1TPPA 2F9PA 1O38A 3PM3A 4JYVH 1W0KD 3F2GA 1G3BA 1W0YH 2FWWA 3HGPA 2A2XH 1O3NA 1SGIB 2OBQA 4X1NU 3MWIU 1IQMA 5FX5A 1D6RA 3GCTF 4NGAH 4TT3D 1Q2WA 2Y7XA 3RMNH 3DSPA 2AHME 3KCGH 1U6QA 4AGJA 4MPVA 2FESH 1OP8A 2GV6A 3AASA 3ATLA 5JYIA 1GG6B 2FP7B 1GJ9B 1GI3A 1HGTH 1UHBB 1GHVH 1S84A 3U1JB 2RFKC 1SGPE 1RIWC 3KGPA 5HM9A 4MQAA 4I33A 1AVWA 4DT7B 1QHRB 1YCPM 1GBDA 2PWXA 2H1UA 1UHBA 2ZNKH 3ZVBA 7GCHF 2TRMA 1F5KU 2WPMS 2C8XB 2FLBH 2GD4B 2IJOB 5HXFA 3PMJA 2L74A 2PGQB 1A61H 1EJMA 2PHBA 4UFEH 4Y8YA 2SGFE 3RXMA 5DGJA 5I46H 3L3TA 4ZMAH 2RDLA 1O2IA 1YLDA 2A2QH 1SGCA 2FYRA 2XBWA 3MYWA 4I8KA 1O5FH 1T8NA 2ZPQA 1TQ0B 3E1XB 2HGTH 2FEQH 1UTLM 4E06H 3N99A 1VJ9U 3RXKA 1NFUA 3F9EA 4INKA 3SV2H 3SZEA 4FU8A 1RS0A 2ZWLH 3F6UH 4M9FA 1GHBF 1RGQA 3MU5A 1OSSA 5EIYA 1AWFH 2J98B 2P93A 3FKSD 1D3TB 3SGQE 4F55A 3DUXH 3RUOA 2UUFB 1TBZH 1HAZB 1UK3A 1P2JA 1PPBH 4ABAA 1PYTD 2GKVE 4Q2KA 1AQ7A 3LC3A 5JBBS 4KP0A 3FO8D 1GMDF 3L33A 1MAYA 5C5OA 1V2OT 1SQTA 4OS6A 1TPSA 2BY6X 1FPCH 4I8JA 3SNCA 2ZZUH 1IQEA 3M35A 1O3KA 3A82A 3DSOA 3Q76A 2TGPZ 4FUCA 1GBJA 1TNJA 2J34A 1TNIA 4BAMB 3SN8A 5ESTE 1SQOA 1W0JD 1G36A 1RRKA 1BRCE 1ZMLA 1WYKA 2WZQA 2GX4A 9LPRA 1ETRH 4OM9A 4HGCA 4AX9H 3RMOH 4Y0YE 1TX6A 2PKSC 4MG3A 1NU9A 1E35B 1FZZA 3KF2A 4SGBE 1JRSA 2FOGA 3S7KB 1SGDE 1SGRE 1O2NA 1TPOA 3BN9A 1KYNA 1AN1E 3V3MA 1BHXB 2Y7ZA 3GY4A 2GMTB 1OWDA 3BTQE 1CGHA 1CO7E 1VR1H 3VEQB 1HDTH 1O2SA 1LMWB 3PV2A 2GGVB 2FX6A 1EJAA 2XTTB 5EODA 3RLYH 3SQHE 1J8AA 4NA7A 1GDUA 2WHXA 2Y80A 1AIXH 1COWD 1VCQA 3OEED 2ANYA 3URDA 3V13A 3RC6A 1O3HA 1BCUH 1F92A 4AGKA 2WPKS 2ZU3A 1DWBH 3E6PH 1EAXA 5JDUB 1PQAA 2UUJB 1W2KH 1YPGH 4A1VA 1FY8E 3UNSA 1YGCH 2FOAA 1LTOA 1SFIA 1HLTH 3UPEA 1Q31A 1WV7H 1Y5UT 1DLEA 1G32B 3RDZA 2BX4A 1H8ED 2H9EH 4WH6A 3H7OA 1O3MA 5FPSA 2RCEA 2ZHWH 1O0DH 1IHTH 1GMHF 4NWKA 5LPRA 1AB9C 1XUGA 1YLCA 4ZKNU 1C2MA 5T6FA 1FNIA 2M5TA 1E1RD 3I77A 2IJD1 2Q6DA 4X8TH 5HKKD 2BX3A 2OC8A 1SGNE 1W12U 2FOEA 2TGAA 4A6LA 2ZI2H 2ZU4A 2PLXA 1O5CB 2DE9A 3ENSB 1GBEA 2QF3A 4X1SU 4AG1A 1GJ6A 4U01A 5L30H 4YXWD 1TONA 3RM2H 2A5KA 1O2OA 4AFZA 5SGAE 1F0RA 1HV7A 2OK5A 3D62A 2A7HA 1GBLA 3A8DA 4K8YA 2BHGA 5CHBA 1V2NT 4F4OC 2WYGA 3K65B 2XCFA 2CF9H 3U8RH 1TIOA 3U1IB 4ABFA 2CHAC 5F8TA 2BOHB 2Z9KA 3T5FH 1S83A 2W26A 1EAWA 1SLVB 1N1LA 3AW1A 3PMBB 1VKYA 4TYDA 1RIWB 1FDPA 3M37A 3GYLB 5CE1A 1Z6EA 1FIWA 2R3UA 1VGCC 1GHZA 1TABE 5BRRE 1K9OE 1IQJA 1H9HE 1GBMA 5FPTA 1THSH 2GDEH 1O3GA 1LPKB 3WWFA 2VVUA 2BLOA 2KCYA 1L1NA 1W0ZU 1ZSLA 4D9QA 1LHGH 1GHAG 2ZTXA 1F5RA 1WAYB 1LKAA 1UK4A 4Y7BA 2AYWA 4UE7H 1CBWC 1QRWA 2WPIS 3TJNA 4F48B 2VGCC 1O3OA 1LVOA 2UWLA 4Y7AA 1YYY1 1SQRA 3KQBA 3LJJA 3FFGA 3VGCC 3EDXB 4JZDH 3FANA 5C2ZA 1K1PA 1C5UA 3ZZ4A 3ATKA 2K8IA 1ELFA 1GDNA 1QA0A 2VH0A 1G37A 3FP7E 2BB4A 4YM9A 1N8OC 2ZPSA 4A1TA 3GYMA 1SVPA 2P94A 4KKDA 1SB1H 1P3CA 1DX5M 4XDEA 1PPGE 3BSQA 4INHA 1P3EA 3SJKA 2Y6TA 1GCTB 4BAOB 1K21H 4AZ2B 4Y10E 3RXTA 3PO1C 1WSSH 2BD7A 4ZCNA 3SGAE 1T31A 1O3FA 1DXWA 4JZ1A 1BRAA 1C2DA 1LHDH 1TNHA 1TNKA 3N7DA 4ZXXH 1V2UT 2BZAA 2OINA 1Y3VA 1ZMNA 2WPHS 2C8YB 1JMOH 2VIWA 3LGYA 5GJ4B 2PTNA 2VIDA 1TGTA 2YMSC 2FTLE 4ZHLU 1TGSZ 3RM0H 2TIOA 1J15A 1ZJKA 1ELVA 1C4U2 4YLUA 2V7QD 1BITA 1HFDA 3DCLA 2PKSB 3M5OA 3QTVH 4YOIA 2GZ9A 4IS5A 1V2RT 4ZKOU 2BD4A 2G8TA 4F49A 2WINI 3VFEA 4DIIH 4Q63A 1BUIA 1GG6C 4UFFH 1H1BA 4D7GA 3GDSA 4K8BA 3ZVCA 1QTFA 1BJUA 3SU4A 4ABDA 2H5CA 2OCVB 3MU1A 4FVBA 2AMPA 3A8AA 3U28C 2WUCA 4TWWA 1JIMA 1JOUB 3A81A 1ZSJA 1O2HA 4YZUA 2J9NA 4GSOA 1GHYH 4U30A 2XW9A 1HAGE 3MH5A 3PV4A 1XXFA 4Z1MD 1KXEA 3RXOA 1HAOH 6GCHF 5EQQA 3A83A 2RA0A 1V2KT 4K1EA 1ZGIA 1T8LA 1MH0A 4X1QU 2FOCA 1A46H 2BVSH 2ALPA 3M3TA 1BIOA 5GXPA 1SGFG 4GLYA 1ELEE 2SGQE 6CHAB 2G81E 4K69A 3RP2A 3KL6A 4XBDA 1EAUA 1JWTA 4ISOA 1S5SA 4DJZB 1EQ9A 3KQ5A 1BBRE 4JMYA 4A5TS 3P17H 1O2WA 4BOHA 3VB3A 4DCDA 1YC0A 4DOQA 2KFWA 4O3UA 1AZ8A 2ZG0H 4X6PA 1EAIA 3RMLH 1KDQB 5F8XA 2GCTB 2PSYA 3GCTG 5LPEA 1L4DA 2SNWA 5ABWA 4Y79A 1TFXA 4ISIH 3A7TA 3BF6H 3P8OA 2NU4E 1UMAH 4AC9A 1UTPA 3SNBA 3M36A 2JJ1D 3PLKA 4IC6A 3EGKH 4X8VH 3IITA 4BAKB 3S9BA 2Z9JA 1MD7A 2H6MA 5DJ7A 1K1NA 2BY5X 4CRCA 1KY9A 5FCRA 3AVZA 1KIGH 3MFJA 3OTPA 5L2ZH 2BY7X 7GCHG 1ZPZA 1LHEH 3GY8A 3FVFB 2CMYA 2XBYA 1GJBB 3RXEA 2HLCA 1PPHE 5DG6A 5BPEA 1C5MD 1QBVH 2KAIB 2CHAB 3SUEA 1C4Y2 1YKTA 4KELA 1BA8B 3F0OA 2BQ6B 5C3NA 3UUZA 2PGBB 5DP9A 1T8OA 1WUNH 2C8WB 1TGCA 2KAIA 3C27B 5FX6A 2O8MA 1V2TT 3P92A 1Y59T 1ZRBA 4FU7A 1SPJA 2VWLA 1WXRA 1OHHD 2STBE 1O34A 4RI0A 1SQAA 3SGBE 1VGCB 1KXDA 3ATWA 1FN8A 2J2UA 1N6YA 7ESTE 4FVDA 3JZ2B 4WY3A 1EJNA 1DITH 5C94A 1UTKA 1VCWA 1BMNH 1GHBG 1KSNA 1DT2A 2OBOA 1GBBA 1C5OH 1ACBE 1WTGH 2CV3A 1G9IE 3TJVA 5GDSH 1F2SE 1ZYOA 2BDHA 4OS2A 1O5BB 1MAXA 1FN6A 2ZDMA 4SGAE 4WVPE 3QO6A 3ZZ9A 3GDVA 1P03A 2VGCB 2XC5A 1QIXB 1IQNA 2WV5A 1G2MA 3A80A 2ZHQH 3MU0A 1AMHA 2ZQ2A 4B6FA 3RXVA 1TA2A 3VGCB 5GIBA 2ESTE 4X2YA 1SGEE 3NPSA 3Q3KA 2VWMA 5DP5A 1NN6A 1HIAB 3SOSA 2B9LA 1WBGB 3SJIA 2ZGJA 1V2VT 4I8LA 1O35A 2XC0A 1TOMH 2YMSD 4K1TA 3ZZ5A 2O8TA 3FN8A 1ARCA 2ZFFH 4YESB 5A8YA 1MTVA 4RT1A 4D76A 1C1WH 4FUEA 1BZXE 3P95A 1H8IH 1C5WB 1K1MA 1TYNA 2O8LA 3H5CB 1TMUH 1GI5A 2ZA5A 3MU4A 1BRUP 1NO9H 1X7AC 1S6LA 3AK5A 5HIZA 1GJ8B 1ZJDA 1BMLA 2F83A 1TMBH 4ZH8A 5T1VA 1MUEB 5CDFE 3AW0A 2OQ5A 4DIHH 1GBFA 1O2MA 4ASHA 1TMTH 1AE8H 3CNRA 3A7XA 3QN7A 1FJSA 2FOHA 3M5MA 1Y5AT 1UVPA 1O39A 3ZV8A 1C1QA 2H2ZA 3BG4B 3OY6U 4X2XA 2FIRH 1W14U 1EB2A 1PPFE 2D2DA 1GI7B 5FAHA 3KHVA 3BEIB 2ZFSA 1SGYE 1Z6JH 2AGIX 3BTEE 1H8HD 1O3LA 3LGWA 5CMXH 2D8WA 4ZKSU 1WDIA 4A7IB 1NZQH 1MTSA 3RU4E 1FUJA 5AHGH 1KTSB 1RFNA 2STAE 1PQ5A 3IG6B 1TBRH 2FPZA 2BM2A 3S0NA 2P8OC 4ZKRU 5LPFA 1SOTA 1C1VH 1P10A 3M5NA 2A0QB 4OS1A 2JH5D 1LVYA 2EQNA 2YNBA 2GCHF 1D4PB 5C1XA 3SO3A 4ABEA 1O36A 1ANDA 3PROA 3NRLA 1S82A 4B6EA 3RXSA 2ZHEH 4D9RA 1O37A 1BDAA 5IYTA 1CT4E 1CE5A 1T32A 2RG3A 2XCNA 3P6ZB 2NU0E 1GI1A 1SR5C 1P2NA 3D65E 1E0FD 1S6FA 3GCNA 1C2EA 4TSFD 5FCKA 1MQ6A 2D1JA 1C5ZB 1L2EA 2YNAA 3ODDA 3P8GA 4QT8C 3SJ8A 2TBSA 2RDEA 2ZDLA 4LOYH 3LONA 4X6OA 2FDAA 3D49H 1NPMA 3EE0B 4NIYA 2M2AA 3E3TA 1NRNH 1BMAA 4WMDA 1HUTH 1ANCA 2P3UB 3E16B 1S0QA 5A8XA 1O2KA 4MNYA 2BD2A 2ZTZA 4B71A 1Y3UA 3BG8A 2HALA 1ZTLA 1YLNA 5HM2A 1CGIE 4MLFB 1ZPCA 1GHXH 3EYDA 3PTNA 2QV1A 1GCTC 5C0UA 1G3DA 3OFND 4K1SA 1OP0A 1GWAA 4ABBA 5C67A 4I7YH 3SU2A 1NROH 1QBOA 4FUGA 4HI3A 1EKBB 1GBCA 1SSXA 5B6LA 3IWMA 1G30B 2AMDA 3CS7A 2Z3CA 2IN2A 4I8HA 2BDGA 3TITA 4JK6A 1ID5H 1O2JA 5JBTA 4DURA 4Q80A 3TIUA 3BIVH 2HLDD 3F9HA 3TNSA 1OYQA 2VINA 2JKHA 3LKWA 3SBKA 3U9AH 1QNJA 3EA9A 1LO6A 4P00A 3GY2A 2ODPA 4ACBA 4M7GA 3TH3H 2Z7FE 1NBMD 4TWYA 2C4FH 1LPGB 4MNVA 2O9QA 1IQLA 5E8EH 2HVYB 1TALA 4XOJA 5C17A 1NFWA 1TOCB 4MNWA 2HPPH 3S7HB 1A5GH 3TGKE 3PB1E 2XBXA 2BYAX 3ZZ3A 2K1QA 2V3HH 2A31A 4U32A 4ZHMU 1P2MA 1PQ7A 5HIYA 1F0SA 2BLQA 1QY6A 2QE7D 3NUMA 1P02A 1FONA 1IQKA 1GJ7B 1PJPA 4AOQA 4Q7ZA 1C1SA 1PFXC 1HXEH 4XFQA 1ZHMA 1UVSH 2Q6FA 3BTKE 1BQYA 3F68H 2OC1A 4JYUH 2Z9IA 2J4IA 2KCPA 2A4GA 2UUKB 2A7CA 3HKIB 3GY7A 3M61U 4ACAA 2VIOA 1BTHH 5EJLA 3LGVA 4INLA 1NS3A 4GCHF 2QN5T 4CH8B 3C1KA 1ZPBA 3ZZ7A 5E0JA 6CHAC 3BEFB 5TCCA 4O97A 3K6ZA 5AFYH 1OKXA 1YBWA 2NU1E
chains in the Genus database with same CATH topology
5DK1A 4Y8XA 3UNRA 3VPKA 1ELGA 3B23B 4ZUHA 2B5TB 1GI0A 4X0WU 5DP4A 1GJDB 3RMMH 1D3PB 4MPUA 1FLEE 1SLWB 2BY9X 1O31A 3LIWA 5H4IB 4A1XA 4NFFA 1TLDA 2GCTC 2QXGA 3LGTA 3SV6A 3ZZAA 1C1OA 3SHAH 1AI8H 3GOVB 1MQ5A 1TQ7B 2JETB 2ODYB 3UIRA 1GMCG 1NESE 2PUQH 3MU8A 2BOKA 1HAXB 2HNTE 4X8SH 1GJCB 3SI3H 5E2OA 2PKAB 1O3JA 1SOZA 6LPRA 1Z8JB 1GI4A 4MDSA 1F5LA 4MTBA 1Y3WA 4AG2A 3UQVA 1YM0A 5EXLA 4JZIA 1RTFB 3RXLA 2ZU1A 2PKAA 1O2TA 2QYIA 9ESTA 8LPRA 4HFPB 3BTWE 3DHKH 3HATH 1C5YB 1THRH 1NU7B 1Y8TA 3E0NB 2BDBA 1O5GH 4XE4A 1P2IA 4NZLA 3GICB 1DUAA 4JZEH 3SORA 1ZTJA 2VWNA 3ODFA 4BXSA 3TNTA 2C8ZB 3RXFA 4YLQH 3SI4H 2P8OB 2YOLA 1XKAC 1C1MA 4KGAA 4NG9H 2A5IA 1O3AA 1QB1A 4FUIA 2O8UA 2OC7A 2Z94A 1A1RA 5C5NA 2G51A 1FAXA 3M7TA 4AYYB 1BBRK 4H6SB 1AUTC 4LK4A 2ZFRH 3V0XA 2V3OH 2GDDA 4O3TA 4AYVB 1DSUA 2A4RA 1AU8A 3L6PA 4JZFH 3RC5A 3S9AA 3T28A 2G5VA 1E36B 1B7XB 2OLGA 1O2QA 1A3EH 1K28D 1FY4A 2VIPA 1AHTH 1MTNB 1P04A 5AVDA 3AAVA 1AY6H 1LHFH 2GT7A 3FZZA 3PYHA 3U8TH 2Z9LA 4DGJA 3A89A 2G4UA 2QIQA 7KMEH 1KXCA 1HXFH 2LNCA 1GJ4H 1S6HA 1CT0E 4WH8A 1NFXA 1WOFA 5E2PA 5I25A 5DO4H 1YPHE 3TJUA 2CF8H 1AFQB 1FPHH 2FS8A 1V3XA 1NTPA 3CP7A 1DVAH 4BAHB 3VXFH 4J2YB 1EZQA 2CN0H 2FOFA 2JH0D 1DY9A 4O03A 2QC2A 3TPIZ 1K22H 2G52A 1P8VC 1GHWH 3A84A 3SU5A 4AB9A 1EASA 1O2PA 2XRCA 3VB4A 1O5AB 2I6QA 1H8DH 1O2XA 1P11E 3LH1A 1CHGA 4BTTB 1AGJA 1PPEE 3U69H 1EZXC 1TB6H 5LGOA 3URCA 1UCYE 1QQUA 1CHOF 2C90B 4DG4A 4ABHA 2AEIH 2P59A 2Q6GA 4KTUA 4X6NA 2BDAA 1UTQA 3A7VA 1GVKB 2ZGCA 2FYQA 2QAAA 3ZVFA 3STJA 1AO5A 5FPYA 1C9PA 1CU1A 3ZVAA 4OGXA 1EB1H 1SLXB 1UTOA 1TE0A 1B0EA 5LH8A 4B75A 1C2IA 4TY7A 3BG4C 1A2CH 1ELAA 4CRAA 2VB0A 4RSPA 4AFQA 1RTKA 3MNSA 3O8CA 1C2JA 1XM1A 4YO9A 1QJ1B 1SGQE 4DW2U 4RKJB 1LQDB 3VB6A 2AGGX 1C2HA 4BAQB 5IDKA 2VH6A 1W11U 1EUFA 1L1JA 2H9HA 2UWPA 2EC9H 3UTUH 1C5NH 3QDZB 1NRQH 1P2QA 1RXPA 2FLRH 4R8TB 4ABIA 1K1LA 3UWJH 3LC5A 1C2LA 2B7DH 4E7RG 1LQEA 2TGTA 5DPAA 1BJVA 1V2WT 1XXDA 1AUJA 1QL9A 1EPTC 4B2AA 1BBRH 4E05H 2Q1JA 4IN1A 1LKBA 4JK5A 1V2QT 1BTUA 3MH6A 5C1YA 2J94A 1C5RA 1C2GA 1C2FA 1SI5H 4B2CA 3RXPA 3A8BA 4Y76A 1XUJA 2Y5FA 2ULLA 2BDIA 1QBNA 2CXVA 1A0HB 3HGNA 2JH6D 1M9UA 3QWCH 1C1PA 1P9UA 2ZU5A 3PMAB 1O2GH 3GY5A 1ELTA 2A45B 1QA7A 1P9SA 2R3YA 5F03A 2ZIQH 1O3DA 2W7SA 1MU6B 1HJ9A 1PQ8A 2ILNA 2A5AA 4Z6AH 2EEKA 1MKWK 2DE8A 3SU0A 4Y8ZA 4FXGH 3QLPH 2BXUH 1Y5BT 1SC8U 1VITF 3I78A 5F6MA 4CR9A 3PTBA 2ZDKA 2ZHDA 3TGIE 3ZZCA 2QF0A 1O2UA 3RXHA 2BVXH 1O32A 1GL1A 3QK1A 2P16A 5EOKA 3O8BA 1BTWA 2Y5HA 3MMGA 2WPJS 3VB5A 2Z3DA 1GPZA 4ISLA 4ZHAA 3RXJA 3U8OH 1K1IA 4B74A 1SHHB 2FI5E 3FAOA 1TAWA 2XYAA 3RXIA 3G01A 1JBUH 1RTLA 4GHQA 1P06A 2ZEBA 1L4ZA 3DT0H 1DE7H 1PPCE 2VVVA 5A8ZA 1K2I1 2A32A 2P3TB 4CRGA 3W94A 1O2LA 2AIQA 2PW8H 1CA8B 3BTFE 1FIZA 2R0LA 4OS5A 3M3SA 1KLJH 1ANBA 2HPQH 1GI2A 1IOEA 3A8CA 4WMFA 2FXRA 2XXLA 1SGTA 1IAUA 1LDTT 1PYTC 2BQ7B 3EA8A 5GWZA 1C5PA 1O5EH 2ANWA 1T4UH 5HMAA 2AH4X 2DUCA 1ZGVA 4NZQA 1P01A 2GZ8A 4XSKU 3RU4T 2OP9A 3SZNA 5GCHF 1W7GH 3UREA 2FTMA 1MZAA 1S85A 2OD3B 1FMGA 1C9TA 2PV9B 1GMDG 1IQIA 2ZDVH 3ATMA 1T7CA 3NXPA 3VXEH 2ZPRA 3B8JA 1D3QB 1HB0B 1QJ7B 1UTMA 1JIRA 1V6DA 4OS7A 4K5ZA 1HAHH 1IQHA 2QXHA 2ZKSA 5C1UA 1TA6A 3DD2H 3GY3A 1AVXA 1J17T 2ZP0H 4GUXA 1ZOMA 4YT7H 1QFKH 3A88A 2RA3A 3M5LA 1BTZA 2BLVA 3NWUA 1DXPA 1MBMA 1V2PT 3P8FA 5DKMA 2XWBI 1WU1A 1F0TA 2R9PA 2ZFPH 3DFLA 5K7RA 3D23A 1S0RA 4DVAU 2AGEX 1GBIA 3NKKA 2BVRH 1XX9A 2XWAA 2R2MB 5JPMH 2R0KA 1D3DB 4BTUB 2JETC 2PSXA 1ETTH 4IMZA 4K60A 3DA9B 1IQFA 1O2VA 2Z6BD 3BTGE 2VNTA 2F91A 3M7UA 1C4V2 2FODA 4Q7YA 1AZZA 2BXTH 2HRVA 1KLTA 3BTDE 1VZQH 1QL7A 1D6WA 2HNTF 3FP8E 1ELDE 5FBEA 3SJ9A 1YPKH 5DP6A 1XUKA 3Q3YA 2V6NA 1UJ1A 3SV7A 3EA7A 4CR5A 5A0BA 2Y5GA 1HRTH 1Y3YA 2ZF0H 1QGFA 1KTTB 3N7OA 3UR9A 1HBTH 5DP8A 3MO3A 1QURH 3PLBA 1SG8B 3TH4H 3LOXA 1BB0B 4K3JA 2SFAA 4RN6A 3ZV9A 2WYJA 2OTVA 2GTBA 1H9LB 2FS9A 1YPEH 4NA8A 1BTYA 3UQOA 4NSYA 2HNTC 4GCHG 1DUEA 4AORA 2SGPE 3T2NA 1E34B 2XBVA 1BRBE 1OYTH 1Q3XA 2UUYA 3LGIA 4ABGA 5E0HA 1D9IA 3A7WA 1GVLA 3ZZ6A 1QB9A 3F9GA 1O3EA 3SW2B 1Z71A 3GCHB 3SV9A 1MBQA 4NCYA 4FU9A 1GMHG 1EPTB 4CHAB 1IHSH 4TPYA 1XUHA 3TJOA 1K1OA 4XBBA 1ZSKA 2P3FH 1CVWH 3U98H 3TGJE 1S81A 3W95A 1FI8A 1DLKB 2G55A 2VJ1A 1TWXB 1EPTA 2BDYA 1C5LH 3NK8A 1MTNC 2A7JA 1PPZA 1QL8A 1BT7A 2FM2A 2BQWB 1YPJH 3OSYA 4AN7A 1V2ST 4LZ4B 2Z3EA 2R2WU 2ZGXH 2V35A 1HAYB 1OPHB 2HVXA 1SMFE 1JXPA 2FOBA 1QR3E 1SL3A 1UVUH 1OX1A 1Y3XA 5PTPA 1VITH 1RD3B 5EG4A 5A0AE 1OWHA 1EXFA 4ISHH 4MVNA 4MPXA 3SNEA 3SUGA 1AFQC 1GL0E 4YTAA 3KEEA 3F9FA 4NSVA 1VCPA 3EAJA 4CBOA 3I29A 1EATA 2EI6A 1P12E 1DPOA 1TX7A 1ESAA 4NFEA 5EQSA 3QX5H 4NIWA 5JBAS 1YP9A 1LHCH 3ZYEA 3SU6A 3E91A 4UONA 4BNRA 3BTME 5EPNA 4WWYA 1TNGA 5T6GA 1NRSH 4U2WA 2ZGBH 2B0FA 5EPYA 1OWJA 1YPHC 3KIDU 1A5HA 4DY7B 1ARBA 3K9XB 3S69A 1WTHD 3ATIA 1GCDA 2A4OA 1OS8A 1ZRKA 1WCZA 1SHYA 1HJAB 1W8BH 2FX4A 4TY6A 6ESTA 2BD9A 5ETXA 1LVMA 1MZDA 2BZ6H 2ODQA 2Y82A 3MNCA 3ZYDA 1EP6A 3CENA 2EI8A 3HPTB 1IQGA 1OP2A 5F8ZA 2AERH 3T26A 4UFGH 1P2OA 8GCHF 1OWKA 3ELAH 1EX3A 4FUFA 4CREA 1A5IA 2PUXB 3LPRA 3OX7U 3QZRA 1A7SA 3FZDA 2PR3A 5A2MH 3O8RA 1AWHB 4KTSA 5JB8S 5J4QA 1HCGA 1C5SA 1P09A 2UWOA 4Q7XA 2LPRA 5E0GA 4FUDA 1AD8H 5AF9H 4H4FA 1B5GH 1GI6A 1HPGA 1JRTA 1O2RA 3A7ZA 4YOJA 1NY22 3QGNB 1J14A 1GBTA 1XMNB 1ELBA 1OOKB 2BY8X 3MNXA 2FZZA 1DM4B 4CRBA 1CHOG 5EXMA 4GPGA 3SV8A 5TCAA 3PMHB 2FMJA 1NRRH 1UCYK 3TH2H 1MMJN 3P70B 1O2ZA 4FUJA 3KN2A 4O9VA 4AFSA 3UFAA 3MI4A 4ZAEA 4I31A 1DWDH 5CHAC 3WY8A 3P8NA 1WQSA 1XKBC 3OU0A 4E7NA 1FY1A 3QZQA 1F0UA 2BTCE 1ZR0A 4UD9H 1C2KA 1C5QA 4KTCA 4UFDH 1W3CA 4OS4A 1W13U 1LVBA 2GVFA 1FY5A 1HAVB 2D26C 1KXAA 2G00A 1AE5A 2F9NA 3RXGA 1ESTA 2AMQA 1VJAU 2SGAA 1SFQB 1UK2A 2F9OA 1HAVA 4WF8A 4ABJA 1TGNA 5EW1H 2BLWA 3ITIA 1O3BA 1TRMA 3RXCA 1MTUA 4VGCB 1RJXB 6GCHG 1N6XA 1TRYA 3BIUH 2QY0B 4IMQA 1HYLA 1CGJE 2QA9E 4Y6DA 3UOPA 1P0SH 5HYOA 2NU3E 3AAUA 1ABJH 3VB7A 4CRDA 1GBKA 3LT3A 4UDWH 1EOJA 3SJOA 1DDJA 2VU8E 1O33A 1BTPA 3BTTE 2FI4E 1DFPA 5EQRA 2BMGB 3QUMP 1MTWA 4GVUA 1EZUC 4WJG2 1L1GA 5GPIB 3QGJA 5B6OA 3SQEE 1SGFA 4CH2B 4IW4E 4IC5A 2VVCA 5A09A 4MPWA 1E37B 1OWIA 4BANB 5TJXA 4XBCA 1GI8B 4AFUA 4GAWA 3NCLA 2VWOA 1Z7KA 5EW2H 1H4WA 2IOTA 3DFJA 2F9BH 3K6YA 1A0LA 3RXUA 1MU8B 3MHWU 2ZO3H 4NWLA 3E0PB 1ZTKA 1GBAA 4X2WA 4X6MA 1QB6A 5HGGA 4B76A 1VITG 1GI9B 3CS0A 1P2KA 1SLUB 5T3HA 1DWCH 4OGYA 1TPAE 1Z8GA 2PTCE 1TGBA 4JCNA 5JBCS 3NZIA 1UCYH 3A87A 2V0BA 2OC0A 3TK6A 2HWLB 3RXRA 2ZFTA 3T27A 1GBHA 1C1TA 4X1RU 1DOJA 2C93B 3OY5U 3RXDA 2ALVA 3RXBA 4THNH 1O3IA 1CA0C 1CSOE 2NWNA 5K0HA 4I8GA 1GGDC 1HNEE 5EU8A 1XVOA 1J9CH 3LH3A 1E38B 1MCVA 1OWEA 1QCPA 2H9TH 2THFB 4PROA 2IPHA 3HK3B 2QCYA 4I32A 4MNXA 1O3CA 3T62A 1O2YA 3TK9A 1Z1JA 4LXBH 2WPLS 4Y11E 1MKXK 1V2LT 3UWIA 4AB8A 1DWEH 3MNBA 1YCPK 1HAPH 3SNAA 1QRXA 1A4WH 1F7ZA 3HK6B 3RC4A 2P95A 2QXIA 5ESBA 8ESTE 5GCHG 4Z0KA 1NM6A 4HTCH 3MH7A 5EXNA 1XUIA 1C1UH 1EP5A 1BOQA 2HOBA 2QXJA 2BD5A 4CRFA 2FO9A 1FY3A 4X8UH 1C1NA 1ORFA 3V12A 1A0JA 2CJIA 3UY9A 2WUBA 2VIVA 3GY6A 1CQQA 3A85A 1EZSC 2ASUB 2F3CE 1NFYA 4ZXYH 1ELCA 1C5TA 3PLPA 3FP6E 4BTIB 2XC4A 1ZHRA 2W5EA 1EOLA 2J95A 4ZROA 1GMCF 3GCHC 1GDQA 3STIA 1L0ZA 2WV4A 3V7TA 4Y0ZE 1P05A 2Z9GA 5DP3A 4CHAC 4NA9H 3OYPA 3E90B 1ANEA 4JYTA 1QRZA 3M3VA 5T6DA 1UTJA 1G3CA 4CBNA 4Y71A 2ZCKP 1DS2E 4J1YA 1FV9A 2H5DA 1A3BH 3BV9B 8KME2 4B73A 2ZCLP 4NIVA 3Q77A 4B2BA 1UTNA 3ZZBA 2B8OH 4WXIA 3KQEA 1TBQH 3TLOA 3SHCH 2GT8A 1MCTA 1Z8RA 5EGMA 2J92A 4IGDA 1MD8A 1SBWA 2GP9B 5CHAB 2NU2E 2W3IA 2QGRA 3SNDA 2ANKH 2ZDNA 1KLIH 1G2LA 1K1JA 2J38A 2F9VA 3F1SB 1AVGH 1TX8A 4HZHA 1B0FA 2XNIA 2OUAA 4IBLH 1ZLRA 4R0IA 2W7UA 3UOUA 2CGAA 3GCOA 4YT6H 1TNLA 5L2YH 3S9CA 4X1PU 3H7TA 1HAIH 3GISB 2ZFQH 1AB9B 4B1TA 1GHAF 2AIPA 2ZC9H 5G4BA 2SGEE 5FHTA 1C5VA 3UNQA 1J16A 1NRPH 1AKSB 1YPLH 2A1DB 3OTJE 5DP7A 3KQCA 1XUFA 3KNXA 3T29A 1GJ5H 1Z1IA 2ZHFH 1KDQA 1H9IE 3PWBA 1YF4A 4FUBA 1UVTH 2W3KA 3SUFA 4D8NA 1MKXH 1O30A 2GCHG 1CT2E 3MTYA 3JZ1B 1HJAC 1AKSA 1YCPH 4X2VA 1LPZB 1THPB 2ZGHA 3MH4A 3LJOA 3EQ0H