4FUHA

Crystal structure of the urokinase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fuhA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fuhA01
1P09A 1RTFB 1UK3A 3E91A 5EPNA 4ZXYH 5GWZA 1TABE 2Q6DA 1AKSA 1NO9H 5DPAA 1LQDB 1ZYOA 4ZKSU 1KLJH 3UNSA 1SC8U 1YKTA 3GY8A 1UMAH 3RC4A 1UK4A 5HM2A 2Q6FA 1BOQA 2FXRA 4CRGA 1F0RA 1QB1A 3JZ2B 2ZZUH 1QBVH 1K1JA 4ABEA 2Z9GA 4X1PU 2Q1JA 3H5CB 4IGDA 4K60A 5L30H 3RXFA 3QUMP 5C3NA 4H6TA 3V7TA 1T32A 3Q3YA 2AGGX 1QBNA 4INLA 1UK2A 3BTKE 2XWAA 4I31A 2SNVA 4JYUH 1C1TA 1QJ6B 2NU4E 2HWLB 1X7AC 5EG4A 1FAKH 4YT7H 2EA3A 1GI3A 4HTCH 3OU0A 1SGIB 4ZKRU 1BZXE 2BD4A 8LPRA 1LQEA 1M9UA 1LHEH 2GTBA 3NWUA 3SU3A 2ZFTA 4FUGA 1A5HA 2BZ6H 4HFPB 1XUKA 3E0NB 2CV3A 2ANYA 1UVTH 5DP9A 1VCWA 4WMEA 1AE8H 1UVOA 2QF0A 2A32A 2SNWA 2O8WA 3VFEA 4B75A 1PYTD 1YPGH 1T4VH 2NU3E 4MNWA 3ESTA 4FU7A 4X0WU 2JETC 3FP8E 5A0BA 2Z3EA 1HRTH 1BITA 5A8ZA 5BPEA 3BTME 5HYOA 3SN8A 1P9SA 4JYTA 3LONA 1C9TA 1L1NA 1EAUA 5FX6A 4CRDA 4RKOB 1CA8B 3M7TA 3ZVDA 1O3KA 1TMUH 2BDBA 5GCHG 2ZU1A 3D49H 1EZUC 1HAVB 1MQ6A 3UIRA 1O2PA 6CHAB 1MTUA 1O3JA 4X2VA 4I7YH 1HIAB 4NIYA 5A0CA 1KDQA 2ZFSA 3PWCA 3GY7A 3PO1B 2OP9A 4D8NA 1KSNA 2ZDMA 3A7YA 1XX9A 2FODA 1GL1A 4YOGA 2R0KA 4DY7B 2FI5E 4NFFA 1HAGE 2FOBA 3RDZA 1D9IA 1YPJH 2HOBA 3MO6A 1FXYA 1LPGB 2XC0A 1DUEA 3SZNA 4X2XA 1WOFA 3RXGA 2V3HH 4ABBA 4M7GA 1O2OA 3S9AA 3RP2A 3A7VA 3A8BA 1CU1A 1C2FA 3A83A 2HRVA 3ZZ3A 1MU8B 1QBOA 1YM0A 2J4IA 2UWPA 3LOXA 1DWBH 4AFSA 2GMTC 3HATH 2PTCE 1Y8TA 1O2VA 1O3DA 3GISB 2HNTF 2FMJA 1EOLA 1CHOG 1EB1H 1JRSA 3NXPA 5F03A 4JZIA 1RS0A 2BDAA 3SHAH 1GJ5H 1UTMA 2VWLA 4MLFB 2A31A 5EOKA 1AQ7A 1LVOA 3ZZ6A 4X6OA 4DJZB 3MU0A 1TPOA 4AG2A 1ARBA 1YYY1 1A0JA 1CO7E 3V3MA 6LPRA 1GHAF 1PPCE 2XYAA 1AKSB 1SFQB 4NWKA 2PUQH 2ZO3H 4HI3A 1O2MA 1ELAA 1K9OE 4SGBE 1HJ9A 3TPIZ 2H5CA 1RJXB 2F3CE 2G51A 2AGEX 1SGCA 2W3IA 4IC5A 1WCZA 1HAOH 3ZV9A 1OP0A 1SQAA 5E2OA 3SO3A 1C1UH 4TWYA 2Y82A 1S84A 3ZVCA 3IWMA 1TONA 1P2KA 2FOMB 2G4TA 5DG6A 4MQAA 1ANEA 2J2UA 2FI3E 3QZRA 1CA0B 1DXPA 3IG6B 3SW2B 2CF8H 1RFNA 1ZPBA 4MPXA 4E06H 1ABIH 2WPHS 1DITH 2H1UA 1SI5H 5K7RA 1OKXA 2D8WA 5C20A 1NRRH 2ZA5A 4JK6A 4BAOB 5HGGA 5EXLA 1J8AA 2EC9H 1GMDG 3O8RA 5L2ZH 3ZYEA 4WY3A 3QN7A 5DO4H 1VJ9U 5ESTE 3LJJA 2ZNKH 4F49A 1DT2A 4LXBH 1FN8A 1LKAA 2PGQB 2FS8A 3P8OA 1O3BA 2OC0A 4D7GA 1UTOA 1ESBA 2BDGA 1O39A 1S0RA 1FY8E 3E3TA 3UR9A 3G01A 2C4FH 3ZVBA 2B0FA 1NESE 2QN5T 1G3CA 1OPHB 5FHTA 1G3BA 1PFXC 2Z7FE 4JCNA 4Q7ZA 4B2CA 1CE5A 2SGPE 5EW1H 4AB8A 2PWXA 1T8OA 1NFWA 1O2HA 1OYTH 2OXSA 2WINI 1TNKA 2F91A 3BG4C 4HZHA 4UFEH 1KDQB 4FUEA 5I25A 2G4UA 4BAKB 1KTSB 1K22H 5E0HA 4BNRA 3D65E 2C8YB 2ZGCA 3B9FH 3DUXH 3GY3A 2VJ1A 4WWYA 3DFLA 2OLGA 2VWNA 1HAXB 1WSSH 4H4FA 2QY0B 1HAHH 3KN2A 1EXFA 2BDIA 5L2YH 1ELFA 2W7UA 1YPHC 2WUCA 4X1RU 1NC6A 1S6HA 3VB4A 1BQYA 1TRNA 1DY9A 3P17H 2YNAA 4NFEA 7GCHG 2J92A 1QFKH 1O2GH 5JPMH 3A85A 1GBBA 2ZIQH 4Y0ZE 2EI6A 3ZV8A 2P94A 2QXJA 3E0PB 3F6UH 4PROA 1K1PA 1S0QA 2ZGXH 5C5NA 2Z6BD 1C1SA 3M3SA 1O2ZA 3M7UA 3M3TA 2VNTA 3SJKA 1L4DA 2BX3A 2OC1A 3FP6E 3T2NA 2Z9LA 1CBWC 1NU7B 1MCTA 1BRCE 3OY5U 3RXPA 1N6XA 1EATA 1FPCH 1B7XB 2QXHA 2QF3A 1FMGA 2ZF0H 1O37A 1DXWA 1IQJA 1C5PA 1TX6A 2CF9H 2A4OA 5JB8S 4LZ1H 3BV9B 1KXCA 2AMPA 2PLXA 4I8KA 4NIWA 3E8LA 2ZDKA 1T7CA 1UTPA 1TPPA 1YC0A 5EW2H 2AS9A 2ZFQH 3M3VA 1C5UA 2D2DA 2FYRA 3O8BA 4UFFH 1PPEE 2ASUB 3PWBA 2VGCC 3P8NA 4K1EA 2ZGHA 2CJIA 3OTJE 1KIGH 4AOQA 4X8TH 1UVUH 1W3CA 3I77A 3LGTA 3BTEE 4CH8B 1D6WA 2BQ6B 1D6RA 4I32A 1V2RT 4B73A 1HUTH 1O33A 2BLVA 2XBYA 1YBWA 3M5LA 5E8EH 1IQLA 2QIQA 2BD8A 1BJUA 4YZUA 5JBTA 1XVMA 1D3DB 3SV9A 1ZPCA 3RU4E 1IQIA 1P57B 1SLVB 2Q6GA 1O2QA 2NU2E 2ULLA 2VIWA 2PKAA 4NSYA 3SOSA 3ELAH 5DJ7A 3TLOA 1BMMH 1TQ0B 3QDZB 2BD5A 4X8SH 2B9LA 4FVDA 1T8LA 3LGWA 3LKWA 3ZZAA 1GI9B 1ZOMA 4I8GA 2J34A 2BX4A 3URDA 3F9FA 1V2TT 1ABJH 3ZZ7A 2ZKSA 4K69A 4B71A 7KMEH 1OX1A 1PQ8A 1B5GH 1G30B 1E0FD 2WPJS 3UFAA 1AY6H 3RXHA 4E7NA 2P16A 2BYAX 1TE0A 5FCRA 1O3PB 1KLIH 1YP9A 1O3AA 1EP6A 5FX5A 3S69A 1GGDB 1V2LT 1ZHRA 2SGDE 3BSQA 5EQQA 1NRQH 2Y5HA 3L6PA 5I46H 2WPIS 1C2DA 4GHQA 3I29A 1ANCA 1GI0A 1Y5AT 1XUJA 4DT7B 3GY5A 3VXEH 4CRBA 2PHBA 1THRH 1E34B 2Y81A 1O2KA 1DWDH 1GJ7B 1O5BB 4ZHMU 2BM2A 3VXFH 2GZ9A 1S6FA 1GI5A 1DVAH 3VB7A 3LT3A 5T6FA 1TX7A 1J9CH 3QGNB 5PTPA 2A1DB 3F68H 3P95A 1SGQE 5T6GA 3A82A 2FYQA 5TCCA 1TMTH 3ZZ5A 2XC4A 1NU9A 1QHRB 4RSPA 3ODDA 4CHAB 1B0FA 2O8UA 2XBXA 3BIVH 4AFQA 1WBGB 1A2CH 3HPTB 3D23A 2XBWA 4ESTE 2VWMA 2HGTH 1SQTA 4CH2B 3MFJA 1UHBA 1UTLM 3BIUH 1A46H 5FCKA 1AWFH 3MH6A 5FPTA 1KXEA 1L4ZA 1JBUH 4OGYA 1K2I1 3TITA 2P3TB 1C1NA 3QZQA 3QTVH 5ETXA 1GMHG 5DP3A 4XDEA 3A87A 3GYMA 3SNDA 3KNXA 3RM0H 1GHXH 3V0XA 1GHBF 4FUJA 4WMDA 3Q76A 2BY5X 1TA6A 2RCEA 1P04A 1AIXH 3ZZBA 1C1PA 1ZTLA 1BB0B 1AO5A 3C1KA 2CXVA 1GVZA 3TGIE 1H9LB 1G3DA 1P12E 4LOYH 2STAE 4GCHF 1XVOA 1JMOH 1GL0E 1NFXA 5A2MH 4B2AA 1AI8H 1IQHA 1VZQH 5FBEA 9ESTA 1TYNA 3O8DA 5TCAA 4ISIH 1JOUB 4UFDH 1VITG 3RU4D 1O3HA 2NU0E 1UTJA 3ZVFA 1V2KT 5EU8A 1DSUA 1YGCH 1GJAB 2PKAB 3A88A 2DUCA 1AWHB 3LGYA 2XCFA 4O9VA 2JH5D 2BTCE 3NUMA 1QL9A 1SHHB 1ELCA 1SMFE 1TNLA 2JETB 2ESTE 4FUFA 2A2QH 1EJMA 2BDHA 3EGKH 4BAQB 5FAHA 3ZZ4A 1XXDA 1P2JA 2ZCHP 3M5MA 3ZVAA 5C1XA 1NRSH 2P8OC 3M36A 4BTTB 2GCHG 4TY7A 2F9BH 1GJDB 1H4WA 3I78A 4Y8XA 1P3CA 1TFXA 5AF9H 4SGAE 3F9GA 2W26A 4IMZA 2W5EA 1N6YA 3SGBE 2FOFA 1JRTA 1O2TA 2P59A 3ZZCA 1C5LH 1OP8A 4GSOA 4YT6H 1IQNA 2OD3B 3ZVGA 1FUJA 1XKBC 3S9BA 1V2NT 1GJ4H 2P93A 4LZ4B 4TYDA 3VB3A 2PUXB 1O2YA 2XTTB 1GBJA 2G55A 3T29A 4DG4A 1LMWB 2VIVA 4R0IA 4U32A 1LPZB 2VH6A 2GT8A 2VB0A 1WTGH 4IN1A 1GBHA 4NA7A 1MTWA 4OS4A 2UUYA 1O2NA 1IAUA 4FVBA 2GV7A 5L6NH 3ATWA 2ZGBH 4INHA 2ZU2A 1H8IH 1QA0A 4IC6A 1TPSA 1GBTA 1RRKA 2V35A 2AEIH 1C2GA 4JK5A 1OSSA 4NCYA 2HNTC 1F0SA 3TK5A 2FOHA 4OS2A 3T62A 3FFGA 4AB9A 1XUHA 2JH0D 2VVVA 1MBMA 3RXKA 3ODFA 3PLKA 2GMTB 2GVFA 4O3TA 1H9IE 3U1JB 1O5GH 4FUBA 1O3NA 1UCYK 4IN2A 1GDNA 4J2YB 4U2WA 1V2WT 1QGFA 1J14A 1TAWA 4XOJA 3D62A 5B6OA 2BLQA 1GDUA 2GKVE 1OWDA 4GLYA 1UHBB 1BDAA 1EUFA 3SI3H 3MWIU 2TPIZ 1O34A 5A09A 3UNQA 2BMGB 5FXLA 1NT1A 4B1TA 1FZZA 1J16A 4UFGH 4MPWA 2TGDA 3SNAA 1C5ZB 1PQ5A 2GV6A 4KTUA 2BXTH 4B2BA 1IQMA 3QTOH 2H9HA 1AB9C 3CP7A 1EJAA 2IJOB 1S81A 1WQSA 1O3GA 2FDAA 1EX3A 1FPHH 1OWJA 2VVCA 3SJ8A 1ZMLA 4O3UA 3RXTA 1TGSZ 5SGAE 2BOHB 3EDXB 3RMLH 3SQHE 3RXQA 1D3PB 4XBDA 3E90B 1MMJN 2VWOA 3M35A 3Q3KA 1HBTH 2BY9X 1HAYB 2WV5A 1GJBB 2ZDLA 2BVSH 5GCHF 3DT0H 1P8VC 2FOAA 1C2LA 2ODYB 3MNXA 1ELVA 1TOMH 5DK1A 4FU9A 3SGQE 3BTFE 5JDUB 1Z8IB 1ZGVA 1ACBE 4NIVA 1BTXA 1YPEH 3MO3A 1EAXA 2UUFB 1ZZZA 1YLCA 2PGBB 2PV9B 1F0UA 1G3EA 4Z0KA 3BTDE 1O2JA 2ANMH 1RXPA 2QYIA 4I33A 2YNBA 1O5CB 2Y5GA 3NPSA 1PYTC 1WTHD 3JZ1B 2BDYA 1FI8A 2ODQA 1UTNA 1W12U 3BTQE 2TBSA 1A4WH 1BMNH 1YPMH 2C8ZB 1N8OC 2FO9A 2TGAA 2BLWA 4K8YA 1Q31A 1LHFH 2XW9A 4XE4A 5DP6A 3M5OA 3PB1E 3SUEA 3RLYH 2A5AA 1SLWB 3SV6A 4BAHB 2F9OA 1OWEA 3LIWA 1BCUH 2M5TA 3BG4B 4YOIA 2O8MA 5IYTA 1V2UT 2BD7A 1BJVA 4OS7A 1NTPA 1C5XB 4ZHAA 2SFAA 1MTVA 4O97A 3HGPA 3FP7E 3LC5A 1CHOF 3RXVA 1UCYE 3N7OA 1MKXH 1SLUB 1DWEH 1FIWA 1QA7A 2XXLA 1T31A 2ZDNA 4MNYA 2NU1E 1EPTC 1P2IA 3PMAB 2AERH 2SGAA 3KQEA 4NZLA 1SQOA 4IMQA 2SGFE 1H9HE 2FS9A 1C1MA 2ZFRH 1DUAA 1GI6A 1FN6A 3RU4T 1C5MD 1TBQH 4X8VH 2JH6D 2AIPA 1QRXA 5LH8A 3P8GA 1ELEE 1D3QB 2ANWA 4XBCA 3BEFB 1BRBE 2FP7B 1ESAA 3UUZA 1C5OH 1P05A 1OP2A 1EOJA 3BN9A 4YLQH 5HM9A 2BQ7B 1FLEE 1G32B 4ZUHA 2TGTA 4IBLH 3RXEA 1ZRKA 1IQGA 4AGJA 3NCLA 2BLOA 4I8JA 1FNIA 2H9TH 1HAPH 4UDWH 1NS3A 1Z6EA 2ZQ2A 3FAOA 3UWIA 1HV7A 1Z8JB 3U8TH 3UQOA 2R2WU 1CBWB 3U8OH 3SV8A 4AFZA 2GZ8A 3M37A 1LHGH 4K5ZA 3GCHB 3PLPA 3LH3A 1GMDF 4YESB 3K6YA 3MNBA 4BTIB 2VH0A 1QR3E 1SBWA 1TLDA 2A7CA 3V13A 3EA8A 5C1YA 5AFYH 4JYVH 3MI4A 1THSH 1KXAA 5LPEA 2J95A 3UOPA 1XXFA 3Q00A 4TPYA 5AFZH 4UD9H 1HCGA 1NM6A 1W14U 2VGCB 1HGTH 3SU2A 1K1LA 1QQUA 1XMNB 1GBAA 1QCPA 1S5SA 4ISNA 4X1SU 1HJAC 1A0LA 4UONA 1O5EH 1V2OT 8ESTE 2ZCLP 3SJ9A 3KQBA 3UR6A 4WMFA 1P10A 1TMBH 1TA2A 3TNTA 2PW8H 4ZHLU 5C1UA 3FVFB 5DP4A 2GCTC 2R2MB 3AW1A 1LHDH 4WXIA 4AZ2B 3SV7A 3IITA 2TIOA 5ESBA 2Z3CA 1LVYA 1H1BA 3MH4A 4Y10E 3LGVA 1P0SH 5JBCS 1F92A 2C8XB 1TNGA 4J1YA 2AFQB 2BY8X 4XSKU 1O35A 5F8XA 3U8RH 1F2SE 2D26C 2IOTA 1AZ8A 3PMHB 3CS0A 2P95A 1V2PT 2A0QB 2DE8A 1BMLA 1HXFH 6ESTA 4ABJA 1C1QA 2FESH 2ANKH 2PTNA 4GHTA 1O36A 3KCGH 5FPSA 1C4Y2 1HNEE 4O03A 3Q3XA 1V2JT 3SJIA 3H7OA 4A1TA 4H42U 2XBVA 3U1IB 3KGPA 3TH4H 5EGMA 4A1XA 1DLKB 1OWKA 4U01A 3SI4H 1JIMA 3QLPH 3MU5A 3GY4A 2FX4A 3LGIA 1MD7A 2BVXH 3VB6A 1GBKA 2ZGJA 1A7SA 8GCHG 3A84A 1ESTA 4X6PA 1UVSH 3T28A 2BQWB 1CVWH 1WYKA 1NFYA 1P2NA 1FONA 1W0ZU 1NY22 1MU6B 4AFUA 1Y5BT 3OSYA 3RXDA 1V2VT 2ZQ1A 1GBIA 3LH1A 5J4QA 4F4OC 4ZAEA 3UQVA 2R3UA 2J94A 1ZRBA 1UCYH 1C2MA 1UO6A 1HDTH 3GCNA 6GCHF 1HAZB 1S83A 1EASA 1O38A 3F1SB 1OWIA 1BTYA 1U6QA 3SQEE 2CN0H 4X8UH 1GCTC 1W8BH 2QA9E 2GD4B 4Y79A 4YO9A 1THPB 1O5FH 4IW4E 1HXEH 4HGCA 1GVLA 2EI7A 1BTZA 2OC8A 3MNSA 3OY6U 3HKIB 1BRAA 1QB9A 1FJSA 1W10U 1VITH 3OX7U 4Q2KA 4VGCC 1EP5A 3SHCH 3GDSA 3S7KB 4K3JA 4AYVB 4BAMB 4E05H 1GMCG 2G81E 3ZYDA 3KL6A 4AGKA 5C67A 2FEQH 2OC7A 3GCTG 3PYHA 1UVPA 2ZTYA 4JMYA 1GWAA 4BOHA 1WV7H 2ZHDA 1LVMA 1AFQC 1ZSKA 2H5DA 5JBAS 2AMDA 1Q3XA 2A4GA 5AHGH 2C90B 5GXPA 4MVNA 2PFEA 1GCDA 3F9HA 3RUOA 1LTOA 4I8LA 1ZR0A 2XC5A 1SPJA 2QC2A 4GUXA 1QJ1B 4DOQA 1C1VH 1A3EH 2HVXA 4ABGA 1V2QT 3PV4A 2BB4A 1MQ5A 2GT7A 2BXUH 1KXBA 1C2IA 3RMMH 1E37B 1SHYA 2ZU5A 1SGNE 2IPHA 5AVDA 1MKXK 3NZIA 1O3MA 3TH3H 4B76A 4A92A 1O2IA 1TIOA 1J17T 2GGVB 3EQ0H 5EXMA 3UPEA 2OCVB 3A7WA 5CHAC 4ABHA 2ZU4A 1CT2E 4GAWA 2ODPA 1DM4B 1O3CA 1GG6C 2XCNA 5K0HA 1WU1A 1HFDA 2P8OB 1ZHMA 2V3OH 2B7DH 4A5TS 3MH7A 1O3LA 3SU1A 2BD3A 1XUFA 4ZMAH 4GPGA 3A8AA 2VIQA 1S82A 4ASHA 1P2OA 4Q7XA 3KIDU 3RMOH 4RKJB 1DLEA 1ETRH 4WH6A 1V3XA 1A3BH 2OQ5A 1O3EA 1FY4A 2CHAC 5FPYA 3TVJB 1F5RA 1RD3B 2A4RA 1GJ6A 2AGIX 3RXCA 1SGYE 2H9EH 1GI8B 1TGTA 3V12A 1O2LA 2VINA 4THNH 3PMJA 4AORA 4WXVA 4MNVA 3H7TA 3RXIA 4Z6AH 1EPTA 2SGEE 1PPZA 1S85A 3DD2H 3TK6A 2FTLE 4NZQA 1Q2WA 2Z94A 4D9QA 1G2MA 1ARCA 3AASA 1IQEA 1A0HB 3PROA 1GMHF 1HLTH 1RTKA 4KTCA 1C2HA 4TPIZ 3W94A 1GI7B 2PR3A 3L3TA 4E7RG 1O32A 1SGTA 1PQ7A 4ABFA 1OXGA 2ALPA 2FOGA 2ZPSA 3M7QA 4WVPE 4DIHH 3T26A 3LU9B 2BHGA 3ATLA 2Y7ZA 1MBQA 2WPLS 1O31A 3BEUA 1MZAA 1C5TA 4YOJA 3AAVA 1QRZA 2Y7XA 3A8DA 1DE7H 2ALVA 3SGAE 3VGCC 7ESTE 2VIDA 3MU8A 4KELA 4AG1A 1GJ8B 1KXFA 4WJG2 3U69H 4OS1A 1VGCC 1AB9B 1K1NA 4Y8ZA 1G36A 1WUNH 2UWOA 2FM2A 4TY6A 1RTLA 1BHXB 2HPQH 1LVBA 1RIWC 1AVGH 5JYIA 1MTNC 1SLXB 4K2YA 4QT8C 5EQRA 4ZKOU 3FZZA 3P70B 2HALA 1ZLRA 1TALA 2UUKB 2NWNA 2GCHF 2KAIA 2AH4X 1OYQA 1Z7KA 3QO6A 4CRAA 1MZDA 5G4BA 1E36B 3E1XB 1FAXA 2WUBA 2ZHEH 3RXSA 3B8JA 1K1IA 1ANBA 1QIXB 1Z71A 2FLRH 3SU5A 1L0ZA 1V2MT 3A7TA 1P3EA 4CBNA 1C1RA 4D76A 1G2LA 2OQUA 3K6ZA 1C5NH 3MHWU 1KYNA 3BF6H 2FOCA 3M61U 1W7XH 1GJCB 1A61H 1PPFE 1EB2A 1A5GH 1TGBA 1CGIE 2Y6TA 2OTVA 1K28D 3A86A 4RN6A 1ZSJA 3A81A 1AZZA 1LPKB 2ZDVH 1AHTH 2F9NA 4B74A 4ISHH 3RXRA 2W7SA 2ZECA 1C4U2 1TWXB 3UY9A 1N8OB 3AVZA 2GX4A 1FIZA 3TJOA 2A7HA 2PKSC 1GBLA 1Z8RA 2D1JA 1AMHA 1L1JA 4R8TB 3S0NA 1SR5C 4JZFH 2LPRA 4KGAA 1YPHE 1V2ST 1SG8B 1AD8H 5F8TA 1MUEB 2ZWLH 1BTUA 7LPRA 1A5IA 1B0EA 3VEQB 4JZDH 2TRMA 1TNIA 5DP5A 2B8OH 1O5DH 1QRWA 4Y0YE 4K1SA 5GIBA 2JKHA 1O3FA 1LCYA 1TPAE 2ZC9H 3RXLA 2FZZA 3NKKA 3SUFA 2ZFFH 1NRNH 4UE7H 3STIA 1MAYA 1ZTJA 1SGFG 1EPTB 3HK3B 4MPUA 3GDUA 1VJAU 4XFQA 1ETTH 3CENA 1QNJA 1H8DH 3BTWE 1CQQA 1BBRK 3P8FA 1GHZA 4K8BA 2Z9JA 1GVKB 1ID5H 1ZSLA 2QGRA 1BIOA 2ZEBA 3ZZ8A 1O2WA 2YOLA 1IQFA 4A6LA 3RC6A 1QJ7B 3C27B 3BTTE 2ZTZA 3LGUA 1BT7A 3TJVA 1TGNA 1WAYB 1GBEA 5GJ4B 3ATIA 5IDKA 1YCPH 1NN6A 3GDVA 1G37A 1GHWH 4OGXA 4Y76A 1BUIA 2BVRH 3T27A 1P06A 1TRMA 1ZMJA 2G8TA 4X2WA 2I6QA 2ZU3A 3S9CA 1DFPA 1D4PB 2F9VA 3ITIA 2V0BA 1SOTA 1Y3WA 2ZHFH 1TBZH 1OS8A 2F83A 3SV2H 5DP8A 4YLUA 4X6NA 2VVUA 3TIUA 3TK9A 1EQ9A 1GHAG 4BXWA 1MKWH 1BRUP 3FANA 4Y8YA 3RXOA 5FBIA 1DANH 1HJAB 4X6MA 1DY8A 2C3SA 1BMAA 3ATMA 2KAIB 4ABAA 1C4V2 1P02A 1HB0B 3LJOA 1ZJKA 4NGAH 1TBRH 5A0AE 3TGJE 5LPFA 1O2RA 5ABWA 4ISOA 2C8WB 2GCTB 2HLCA 3P92A 3VPKA 1QL8A 5F8ZA 1Y3YA 2ZFPH 2WYJA 1SGRE 2BOKA 1C1WH 3W95A 1FQ3A 1O2XA 1YCPM 2C93B 3KQCA 2F9UA 2RG3A 1Y3XA 4MNXA 3KEEA 1YPKH 5HMAA 2OUAA 1SL3A 4AN7A 4KP0A 4U30A 3RXMA 3E16B 4NA9H 1ZGIA 6CHAC 2WV4A 1C5RA 2HPPH 2PSXA 2RDLA 4BTUB 2OBOA 1P2MA 2Z3DA 3PO1C 3M5NA 1EAIA 1JWTA 3BTGE 5BRRE 1EZQA 1BHXF 1DPOA 1MCVA 1P01A 4LK4A 4BANB 3TJUA 2BD9A 1GI2A 2QXGA 2O8LA 2Y5FA 1C5YB 1BBRE 1Z8GA 3SU0A 1GHVH 3VB5A 1C5SA 2A5IA 3EAJA 2QCYA 4Y7BA 3URCA 1NZQH 1E38B 1OWHA 1D3TB 4IS5A 1O3OA 4K1TA 1T4UH 2FI4E 1TX8A 1W2KH 2B5TB 1XUGA 3HGNA 3OYPA 2BD2A 1FY5A 3R0FA 1C5VA 3MU4A 4A1VA 1CHGA 3ZVEA 5C2ZA 2I6SA 1G9IE 1CT0E 4FXGH 1QB6A 3AAUA 5GPIB 1EKBB 1F0TA 4OS5A 1CGJE 1C2KA 1ZMNA 1JXPA 1ORFA 3GCOA 3LDXH 1AGJA 3TJNA 1L2EA 1PPGE 1P11E 1F7ZA 3EA7A 1K1OA 5T3HA 2V6NA 1TNJA 2UUJB 4ZROA 3ZZDA 2ZDAH 4FUIA 1NPMA 2ZP0H 3SJOA 3QGJA 1DX5M 1AN1E 2A45B 2DE9A 5JB9S 4MG3A 1GCTB 3SBKA 3MMGA 5CE1A 3A80A 2THFB 2IN2A 2ZPQA 2XWBI 1K21H 1TOCB 1AFEH 2EI8A 1LHCH 1O2SA 2A4QA 1C1OA 3DA9B 3PTBA 5TJXA 2ZTXA 1Y3VA 4X1NU 3A7XA 2FPZA 1Y3UA 4OS6A 4CREA 4VGCB 3GICB 1SGPE 1IHSH 1XKAC 4Y71A 2A7JA 1SGFA 4I8HA 1O0DH 1CA0C 3QK1A 3DHKH 1KXDA 2CGAA 1FY1A 4MDSA 4Y11E 3Q77A 1DSTA 1ELGA 7GCHF 3HK6B 2RA3A 1L1GA 4JZEH 4KKDA 1AFQB 1TQ7B 8KME2 3EA9A 1NFUA 2ZG0H 1RGQA 5C5OA 4BXSA 1A1RA 3P6ZB 3KF2A 5CMXH 5E0GA 1Y5UT 1HPGA 4JZ1A 1C9PA 1N1LA 5EQSA 4NSVA 4NWLA 3PLBA 1P2QA 2PSYA 2QV1A 5JBBS 1NROH 1MH0A 3MU1A 3F9EA 1KLTA 4CRFA 1O30A 4UEHH 3GCHC 4MTBA 2A5KA 3RXJA 1F5KU 4DGJA 3DFJA 1DS2E 1JIRA 3RMNH 3ATKA 4XBBA 3MYWA 1GBDA 2GP9B 5J4SA 3SUGA 4YTAA 1SB1H 1VR1H 1Z1IA 5CHAB 1LKBA 2QAAA 1CGHA 2R3YA 3T25A 1F5LA 3SU6A 4Q7YA 6GCHG 2WYGA 2Z9KA 8GCHF 3MH5A 1W13U 5DGJA 1GG6B 1BTHH 2AYWA 4MPVA 3KHVA 2BY6X 2AMQA 1AUTC 3GY6A 3MO9A 4Q80A 2Y80A 3L33A 2EEKA 2R0LA 4ISLA 3QWCH 3HKJB 1DOJA 2SGQE 1KTTB 5HXFA 1GDQA 2G5VA 4Y7AA 5E2PA 2ZHQH 2ZPRA 2ZCKP 1YCPK 2HNTE 2CHAB 2ZHWH 2ZI2H 1GI4A 3UTUH 1HJ8A 4A7IB 3LC3A 4FUDA 3PMBB 3MNCA 1PPBH 1Z6JH 2G00A 2P3UB 1C5QA 1C2JA 1LDTT 3EE0B 5A8YA 1VCPA 3GYLB 4GVUA 1EAWA 1QTFA 2XNIA 1EZXC 2P3FH 4DURA 3S7HB 1PQAA 3AW0A 4FUCA 2LNCA 1BBRH 5F6MA 3STJA 5LPRA 4NIXA 2UWLA 3B23B 3GY2A 2ILNA 4ZKNU 4NA8A 3UREA 2FLBH 4WF8A 1QY6A 1LO6A 1GMCF 1QL7A 1MKWK 1GJ9B 1ELTA 3BTHE 3PM3A 3SNEA 1MD8A 3SNCA 3GCTF 3A89A 3TNSA 1GBMA 5H4IB 3U98H 2XRCA 1TB6H 3GOVB 1XUIA 2H2ZA 1WQVH 3EYDA 1SGEE 1GPZA 5EPYA 4YM9A 1V6DA 3MTYA 3A7ZA 1EZSC 3TH2H 5A8XA 2VIOA 2QXIA 4H6SB 1TRYA 1PPHE 1SOZA 3ZZ9A 4WH8A 1XM1A 1MTSA 3RC5A 1AVXA 1AUJA 1IOEA 2WPMS 4ABDA 2VIPA 1Y59T 4FU8A 5DP7A 3VGCB 1VCQA 2GZ7A 4DW2U 2K1QA 1DICA 1FDPA 2STBE 4AX9H 1TGCA 3U9AH 2RA0A 2FWWA 1INCA 2FTMA 3RLWH 1QURH 2F9PA 1ZPZA 1ZHPA 1EJNA 1HAIH 1VGCB 2AIQA 3UNRA 5EXNA 1P03A 3ENSB 2OINA 1YPLH 1J15A 1RIWB 1E35B 2O8TA 1T8MA 1FV9A 1SVPA 3RXUA 3UOUA 1MTNB 3T5FH 3SNBA 3K9XB 3NK8A 5EODA 4X2YA 1BTPA 1W11U 2FX6A 1W0YH 1ELDE 1DDJA 1GBFA 3E6PH 1DWCH 4ZH8A 1O5AB 5GDSH 3TU7H 1P9UA 1BTWA 3RXAA 2Z9IA 2BY7X 1ANDA 1BA8B 1GHBG 2OBQA 1SGDE 1O3IA 1IQKA 1UTKA 3SORA 2R9PA 1ZJDA 2G52A 3QX5H 5T6DA 1HYLA 2O9QA 2GDDA 1NRPH 1IHTH 1C2EA 1O2UA 4DVAU 3TGKE 4CBOA 1CT4E 2BZAA 4TWWA 4ABIA 1AVWA 1C5WB 4GCHG 1ZTKA 1MAXA 4Y6DA 4DIIH 2FIRH 1SSXA 4D9RA 2WPKS 1HAVA 3BEIB 1AU8A 1YLDA 2J38A 3RM2H 9LPRA 4AYYB 4ZXXH 5LGOA 5DKMA 1HIAA 1GGDC 1QQ4A 3UWJH 1GI1A 2W3KA 4INKA 1CSOE 5E0JA 1TNHA 4CRCA 4CR5A 3O8CA 1FY3A 3SU4A 3BG8A 3KQDA 3LPRA 1Z1JA 2H6MA 2J9NA 4D7FA 3RXBA 4CR9A 3CS7A 2CMYA 2PKSB 1ETSH 1T8NA 1PJPA 3MOCA 3SUDA 3A8CA 4DCDA 2FOEA 1GBCA 1UTQA 1OOKB 1VITF 2GDEH 4KTSA 3WY8A 1ELBA 1W7GH 2VU8E 3FZDA 4X1QU 1UJ1A 1YF4A 3PTNA 2A2XH 3K65B 1AE5A 4CHAC 2G5NA 1K1MA 1SFIA 4NG9H 1KY9A 3K2UA 1GHYH 2BDCA 4FUHA 3R3GB 2TGPZ
chains in the Genus database with same CATH superfamily
1P09A 1RTFB 1UK3A 3E91A 5EPNA 4ZXYH 5GWZA 1TABE 2Q6DA 1AKSA 1NO9H 5DPAA 1LQDB 3UB0A 1ZYOA 4ZKSU 3UAIC 1KLJH 3UNSA 3F0PA 1SC8U 4XD7D 1YKTA 3GY8A 1UMAH 3RC4A 1UK4A 5HM2A 2Q6FA 1BOQA 2FXRA 4CRGA 1F0RA 1QB1A 3JZ2B 2ZZUH 1QBVH 1K1JA 4ABEA 2Z9GA 4X1PU 2Q1JA 3H5CB 4IGDA 4K60A 5L30H 3RXFA 3QUMP 4RT1A 5C3NA 4H6TA 3V7TA 1T32A 3Q3YA 2AGGX 1QBNA 4INLA 1UK2A 3BTKE 2XWAA 4I31A 2SNVA 4JYUH 1C1TA 1QJ6B 2NU4E 2HWLB 1X7AC 3PV2A 5EG4A 1FAKH 4YT7H 2EA3A 1GI3A 2XNDD 4HTCH 3OU0A 1SGIB 4ZKRU 1BZXE 2BD4A 8LPRA 1LQEA 1M9UA 1LHEH 2GTBA 3NWUA 3SU3A 2ZFTA 4FUGA 1A5HA 2BZ6H 4HFPB 1XUKA 3E0NB 2CV3A 2ANYA 1UVTH 5DP9A 1VCWA 4WMEA 1AE8H 1UVOA 2QF0A 2A32A 2SNWA 2O8WA 3VFEA 4B75A 1PYTD 1YPGH 1T4VH 2NU3E 4MNWA 3ESTA 4FU7A 4X0WU 2JETC 3FP8E 5A0BA 2Z3EA 1HRTH 1BITA 5A8ZA 5BPEA 3BTME 5HYOA 3SN8A 1P9SA 4JYTA 3LONA 1C9TA 1L1NA 1EAUA 5FX6A 4CRDA 4RKOB 1CA8B 3M7TA 3ZVDA 2KR7A 1O3KA 1TMUH 2BDBA 5GCHG 5HIZA 2ZU1A 3D49H 1EZUC 1HAVB 1MQ6A 3UIRA 1O2PA 6CHAB 5C0TA 1MTUA 1O3JA 4X2VA 4I7YH 1HIAB 4NIYA 5A0CA 1KDQA 2ZFSA 3PWCA 3GY7A 3PO1B 2OP9A 4FOUC 4D8NA 1KSNA 2ZDMA 3A7YA 1XX9A 2FODA 1GL1A 4YOGA 1OHHD 2R0KA 4DY7B 2FI5E 4NFFA 1HAGE 2FOBA 3RDZA 4ACAA 1D9IA 1YPJH 2HOBA 3MO6A 1FXYA 1LPGB 2XC0A 2JJ2D 1DUEA 3SZNA 4X2XA 1WOFA 3RXGA 2V3HH 4ABBA 4M7GA 1O2OA 3FN8A 3S9AA 3RP2A 3A7VA 3A8BA 1CU1A 1C2FA 3A83A 2HRVA 3ZZ3A 1MU8B 1QBOA 3N7EA 1YM0A 2J4IA 2UWPA 2PP6A 3LOXA 1DWBH 4AFSA 2GMTC 3HATH 2PTCE 2CK3D 5EJ1A 1Y8TA 1O2VA 1O3DA 3GISB 2HNTF 2FMJA 1EOLA 1CHOG 1EB1H 1JRSA 3NXPA 5F03A 4JZIA 1RS0A 2BDAA 3SHAH 1GJ5H 1UTMA 2VWLA 4MLFB 2A31A 5EOKA 1AQ7A 1LVOA 3ZZ6A 4X6OA 4DJZB 3MU0A 1TPOA 4AG2A 1ARBA 1YYY1 1A0JA 1CO7E 3V3MA 2WHXA 1GHAF 6LPRA 1PPCE 2XYAA 1AKSB 1SFQB 4NWKA 2PUQH 2ZO3H 4HI3A 1O2MA 1ELAA 1K9OE 4SGBE 1HJ9A 3TPIZ 2H5CA 1RJXB 2F3CE 2G51A 2AGEX 1COWD 1SGCA 2W3IA 4IC5A 1WCZA 1HAOH 3ZV9A 1OP0A 1SQAA 5E2OA 3SO3A 1C1UH 2YMSB 4TWYA 2Y82A 1S84A 3ZVCA 3IWMA 1TONA 1P2KA 2FOMB 2G4TA 5DG6A 4MQAA 1ANEA 2J2UA 2FI3E 3QZRA 1CA0B 1DXPA 3IG6B 3SW2B 2CF8H 1RFNA 1ZPBA 4MPXA 4E06H 1ABIH 2WPHS 1DITH 2H1UA 1SI5H 5K7RA 1OKXA 2D8WA 5C20A 1NRRH 2ZA5A 4JK6A 4BAOB 4TSFD 5HGGA 5EXLA 1J8AA 2EC9H 1GMDG 3O8RA 5L2ZH 3ZYEA 4WY3A 3QN7A 5DO4H 3F2GA 1VJ9U 5ESTE 3LJJA 2ZNKH 4F49A 1DT2A 2L74A 4LXBH 1FN8A 1LKAA 2PGQB 2FS8A 3P8OA 1O3BA 2OC0A 4D7GA 1UTOA 1ESBA 2BDGA 1O39A 1S0RA 1FY8E 3E3TA 3UR9A 3G01A 2C4FH 3ZVBA 2B0FA 1NBME 1NESE 2QN5T 1G3CA 1OPHB 5FHTA 1G3BA 1PFXC 2Z7FE 4JCNA 4Q7ZA 4B2CA 1CE5A 2SGPE 5EW1H 4AB8A 2PWXA 1T8OA 1NFWA 1O2HA 3EE7A 1OYTH 2OXSA 2WINI 1TNKA 2F91A 3BG4C 2IJD1 3H09A 4HZHA 4UFEH 1KDQB 4FUEA 5I25A 2G4UA 4BAKB 1KTSB 1K22H 5E0HA 3SZEA 4BNRA 3D65E 2C8YB 2ZGCA 3B9FH 3DUXH 3GY3A 2VJ1A 4WWYA 2V3MA 3DFLA 2OLGA 2VWNA 1HAXB 1WSSH 4H4FA 2QY0B 1HAHH 3KN2A 1EXFA 2BDIA 5L2YH 1ELFA 2W7UA 1YPHC 2WUCA 4X1RU 1NC6A 1S6HA 3VB4A 1BQYA 1TRNA 1DY9A 3P17H 2YNAA 4NFEA 7GCHG 2J92A 1QFKH 1O2GH 5JPMH 3A85A 1GBBA 2ZIQH 4Y0ZE 2EI6A 3ZV8A 2P94A 2QXJA 3E0PB 3F6UH 4PROA 1K1PA 1S0QA 2ZGXH 5C5NA 2Z6BD 1C1SA 3M3SA 1O2ZA 3M7UA 3M3TA 2VNTA 3SJKA 1L4DA 2BX3A 2OC1A 3FP6E 3T2NA 3PRDA 2Z9LA 1CBWC 1NU7B 1MCTA 5C94A 1BRCE 3OY5U 3RXPA 1N6XA 1EATA 1FPCH 1B7XB 2QXHA 2QF3A 1FMGA 2ZF0H 1O37A 1DXWA 1IQJA 1C5PA 1TX6A 2CF9H 2A4OA 5JB8S 4LZ1H 3BV9B 5C17A 1KXCA 2AMPA 2PLXA 4I8KA 4NIWA 3E8LA 2ZDKA 1T7CA 1UTPA 1TPPA 1YC0A 5EW2H 2AS9A 2ZFQH 3M3VA 1C5UA 2D2DA 2FYRA 3O8BA 4UFFH 1PPEE 2ASUB 3PWBA 2VGCC 3P8NA 4K1EA 2ZGHA 2CJIA 3OTJE 1E79D 1KIGH 4AOQA 4X8TH 1UVUH 1W3CA 3I77A 3LGTA 3BTEE 4CH8B 1D6WA 2BQ6B 1D6RA 4I32A 1V2RT 4B73A 1HUTH 1O33A 2BLVA 2XBYA 1YBWA 3M5LA 5E8EH 1IQLA 2QIQA 2BD8A 1BJUA 4YZUA 5JBTA 1XVMA 1D3DB 3SV9A 1ZPCA 3RU4E 1IQIA 1P57B 1SLVB 2Q6GA 1O2QA 2NU2E 2ULLA 5DN6D 2VIWA 2PKAA 4NSYA 3SOSA 3ELAH 5DJ7A 3TLOA 1BMMH 1TQ0B 3QDZB 2BD5A 4X8SH 2B9LA 4FVDA 1T8LA 3LGWA 3LKWA 3ZZAA 1GI9B 1ZOMA 4I8GA 2J34A 2BX4A 3URDA 3F9FA 1V2TT 1ABJH 3ZZ7A 2ZKSA 2XOKD 4K69A 4B71A 2VBCA 7KMEH 3MQKC 1OX1A 1PQ8A 1B5GH 1G30B 1E0FD 2WPJS 3UFAA 1AY6H 3RXHA 4E7NA 2P16A 2BYAX 1TE0A 5FCRA 1O3PB 1KLIH 1YP9A 1O3AA 1EP6A 5FX5A 3S69A 1GGDB 1V2LT 1ZHRA 2SGDE 3BSQA 5EQQA 1NRQH 2Y5HA 1EFRD 3L6PA 5I46H 2WPIS 1C2DA 4GHQA 3I29A 1ANCA 1GI0A 1Y5AT 1XUJA 4DT7B 3GY5A 3VXEH 4CRBA 2PHBA 3U28C 1THRH 1E34B 2Y81A 1O2KA 1DWDH 1GJ7B 1O5BB 4ZHMU 2BM2A 3VXFH 2GZ9A 1S6FA 1GI5A 1DVAH 3VB7A 3LT3A 5T6FA 1TX7A 1J9CH 3QGNB 5PTPA 2A1DB 3F68H 3P95A 1SGQE 5T6GA 3A82A 2FYQA 5TCCA 1TMTH 3ZZ5A 2XC4A 1NU9A 1QHRB 4RSPA 3ODDA 4CHAB 1B0FA 2O8UA 1W0JD 2XBXA 3BIVH 4TT3D 4AFQA 1WBGB 1A2CH 3HPTB 3D23A 2XBWA 4ESTE 2VWMA 2HGTH 1SQTA 4CH2B 3MFJA 1UHBA 1UTLM 3BIUH 1A46H 5FCKA 1AWFH 3MH6A 5FPTA 1KXEA 1L4ZA 1JBUH 4OGYA 1K2I1 3TITA 2P3TB 1C1NA 3QZQA 3QTVH 5ETXA 1GMHG 3PRBA 5DP3A 4XDEA 5EJLA 3A87A 3GYMA 3SNDA 3KNXA 3RM0H 1GHXH 3V0XA 3OE7D 1GHBF 4FUJA 4WMDA 3Q76A 2BY5X 1TA6A 2RCEA 1P04A 1AIXH 3ZZBA 1C1PA 1ZTLA 2KZ4A 1BB0B 1AO5A 3C1KA 2CXVA 1GVZA 3W1EA 1H9LB 1G3DA 3TGIE 1P12E 4LOYH 2STAE 4XRNA 4GCHF 1XVOA 1JMOH 1GL0E 2RFKC 1NFXA 5A2MH 4B2AA 1AI8H 1IQHA 1VZQH 5FBEA 9ESTA 1TYNA 3AK5A 3O8DA 5TCAA 4ISIH 1JOUB 4UFDH 1VITG 3RU4D 4ACBA 1O3HA 3WWFA 2KCOA 2NU0E 1UTJA 3ZVFA 1V2KT 5EU8A 1DSUA 1YGCH 1H8ED 1GJAB 2PKAB 3A88A 2DUCA 1AWHB 3LGYA 2XCFA 4O9VA 2JH5D 2BTCE 3NUMA 1QL9A 1SHHB 1ELCA 1SMFE 1TNLA 1UW7A 2JETB 2ESTE 4FUFA 3DCLA 4Z1MD 2A2QH 1EJMA 2BDHA 3EGKH 4BAQB 5FAHA 3ZZ4A 1XXDA 1P2JA 2ZCHP 3M5MA 3ZVAA 5C1XA 1NRSH 2P8OC 3M36A 4BTTB 2GCHG 4TY7A 2F9BH 1GJDB 1H4WA 3I78A 4Y8XA 5CHBA 1P3CA 1TFXA 5AF9H 4SGAE 3F9GA 2W26A 4IMZA 2W5EA 3FOAA 1N6YA 3SGBE 2FOFA 1JRTA 1O2TA 2P59A 3ZZCA 1C5LH 1OP8A 2KX4A 4GSOA 1IQNA 2OD3B 4YT6H 3ZVGA 1FUJA 1XKBC 3KYGA 3S9BA 5KGOA 2KCYA 1V2NT 1GJ4H 2P93A 4LZ4B 4TYDA 3VB3A 2PUXB 1S6LA 1O2YA 2XTTB 2LELA 1GBJA 2G55A 3T29A 4DG4A 1LMWB 2VIVA 4R0IA 4U32A 1LPZB 2VH6A 2GT8A 2VB0A 1WTGH 4IN1A 1GBHA 4NA7A 1MTWA 4OS4A 2UUYA 1O2NA 1IAUA 4FVBA 2GV7A 5L6NH 3ATWA 2ZGBH 4INHA 2ZU2A 1H8IH 1QA0A 4IC6A 1TPSA 1GBTA 1RRKA 2V35A 2AEIH 1C2GA 4JK5A 1OSSA 4NCYA 2HNTC 1F0SA 3TK5A 2FOHA 4OS2A 3T62A 3FFGA 4AB9A 1XUHA 2JH0D 2VVVA 1MBMA 3RXKA 3ODFA 3PLKA 2GMTB 2GVFA 4O3TA 1H9IE 3U1JB 1O5GH 4FUBA 1O3NA 1UCYK 4IN2A 1GDNA 3N99A 4J2YB 4U2WA 1V2WT 1QGFA 1J14A 1TAWA 4XOJA 3D62A 5B6OA 2BLQA 1GDUA 2GKVE 1OWDA 4GLYA 1UHBB 1BDAA 1EUFA 3SI3H 3MWIU 2TPIZ 1O34A 5A09A 3UNQA 2BMGB 5FXLA 1NT1A 4B1TA 1FZZA 1J16A 4UFGH 4MPWA 2TGDA 3SNAA 1C5ZB 1PQ5A 2GV6A 4KTUA 2BXTH 4B2BA 1IQMA 3QTOH 2H9HA 1AB9C 3CP7A 1EJAA 2IJOB 1S81A 1WQSA 1O3GA 2FDAA 1EX3A 1FPHH 1OWJA 2VVCA 3SJ8A 1ZMLA 4O3UA 3RXTA 1TGSZ 5SGAE 2BOHB 3EDXB 3RMLH 3SQHE 3RXQA 1D3PB 4XBDA 3E90B 1MMJN 2VWOA 3M35A 3Q3KA 1HBTH 2BY9X 1HAYB 2WV5A 1GJBB 2ZDLA 2BVSH 5GCHF 3F2FA 3DT0H 3OTPA 1P8VC 2FOAA 1C2LA 2ODYB 3MNXA 1ELVA 1TOMH 5DK1A 4FU9A 3SGQE 2K8IA 3BTFE 5JDUB 1Z8IB 1ZGVA 1ACBE 4NIVA 1BTXA 1YPEH 3MO3A 1EAXA 2UUFB 1ZZZA 1YLCA 2PGBB 2PV9B 1F0UA 1G3EA 4Z0KA 1SQRA 3BTDE 1O2JA 2ANMH 1RXPA 2QYIA 4I33A 2YNBA 1O5CB 2Y5GA 3NPSA 1PYTC 1WTHD 3JZ1B 2BDYA 1FI8A 2ODQA 1UTNA 1W12U 3BTQE 2TBSA 1A4WH 1BMNH 1YPMH 2C8ZB 1N8OC 2FO9A 2TGAA 4M9FA 2BLWA 4K8YA 1Q31A 3WW7A 4RT0A 1LHFH 2XW9A 4XE4A 5DP6A 3M5OA 3PB1E 3SUEA 3RLYH 2A5AA 1SLWB 3SV6A 4BAHB 2F9OA 1OWEA 3LIWA 1BCUH 2M5TA 3BG4B 4YOIA 2O8MA 5IYTA 1V2UT 2BD7A 1BJVA 4OS7A 4AC9A 1NTPA 1C5XB 4ZHAA 2SFAA 1MTVA 4O97A 3HGPA 3FP7E 3LC5A 1CHOF 3RXVA 1UCYE 3N7OA 1MKXH 1SLUB 1DWEH 1FIWA 1QA7A 2XXLA 1T31A 2ZDNA 4MNYA 2NU1E 1EPTC 1P2IA 3PMAB 2AERH 2SGAA 3KQEA 4NZLA 1SQOA 4IMQA 2SGFE 1H9HE 2FS9A 1C1MA 2ZFRH 1DUAA 1GI6A 1FN6A 3RU4T 1C5MD 1TBQH 4X8VH 2JH6D 2AIPA 1QRXA 5LH8A 5EIYA 3P8GA 1ELEE 1D3QB 2ANWA 4XBCA 3BEFB 1BRBE 2FP7B 1ESAA 3UUZA 1C5OH 1P05A 1OP2A 1EOJA 3BN9A 4YLQH 5HM9A 2BQ7B 4B6FA 3KQ5A 1FLEE 1G32B 4ZUHA 2TGTA 4IBLH 3RXEA 1ZRKA 1IQGA 4AGJA 3NCLA 2YMSD 2BLOA 4I8JA 1FNIA 2H9TH 1HAPH 4UDWH 1NS3A 1Z6EA 2ZQ2A 3FAOA 3UWIA 1HV7A 1Z8JB 1YLNA 3OFND 3U8TH 3UQOA 2R2WU 1CBWB 3U8OH 3SV8A 4AFZA 2GZ8A 3M37A 1LHGH 4K5ZA 3GCHB 3PLPA 3LH3A 1GMDF 4YESB 3K6YA 3MNBA 4BTIB 2VH0A 1QR3E 1SBWA 1TLDA 2A7CA 3V13A 3EA8A 5C1YA 5AFYH 4JYVH 3MI4A 1THSH 1KXAA 5LPEA 2J95A 3UOPA 1XXFA 2KCPA 3Q00A 4TPYA 5AFZH 4UD9H 1HCGA 1NM6A 1W14U 5KECA 2VGCB 1HGTH 3SU2A 1K1LA 2QE7D 5F53A 1QQUA 1XMNB 1GBAA 1QCPA 1S5SA 4ISNA 4X1SU 1HJAC 1A0LA 4UONA 1O5EH 1V2OT 8ESTE 2ZCLP 3SJ9A 3KQBA 3UR6A 4WMFA 1P10A 1TMBH 2KCAA 1TA2A 3TNTA 2PW8H 4ZHLU 5C1UA 3FVFB 5DP4A 2GCTC 2R2MB 3AW1A 3VG8A 1LHDH 4WXIA 4AZ2B 3SV7A 3ZIAD 3IITA 2TIOA 5ESBA 2Z3CA 1LVYA 1H1BA 3MH4A 4Y10E 3LGVA 1P0SH 5JBCS 1F92A 2C8XB 1TNGA 4J1YA 2AFQB 2BY8X 4XSKU 1O35A 5F8XA 3U8RH 1F2SE 2D26C 2IOTA 1AZ8A 4HG6A 3PMHB 3CS0A 2P95A 1V2PT 2A0QB 2DE8A 1BMLA 1HXFH 4DT4A 6ESTA 4ABJA 1C1QA 2FESH 2ANKH 2OK5A 2PTNA 4GHTA 1O36A 3KCGH 5FPSA 4F55A 1C4Y2 1HNEE 4O03A 3Q3XA 1V2JT 3SJIA 3H7OA 4A1TA 4H42U 2XBVA 3U1IB 3KGPA 3TH4H 5EGMA 4A1XA 1DLKB 1FX0B 1OWKA 4U01A 3SI4H 1JIMA 3QLPH 3MU5A 3GY4A 2FX4A 3LGIA 1MD7A 2BVXH 3VB6A 1GBKA 2ZGJA 1A7SA 8GCHG 3A84A 2KFWA 1ESTA 4X6PA 1UVSH 3T28A 2BQWB 1H8HD 1CVWH 1WYKA 1NFYA 1P2NA 1FONA 1W0ZU 2HLDD 1NY22 1MU6B 4AFUA 1Y5BT 3OSYA 3RXDA 1V2VT 4RI0A 2ZQ1A 1GBIA 3LH1A 5J4QA 4F4OC 4ZAEA 3UQVA 2R3UA 2J94A 1ZRBA 1UCYH 1C2MA 1UO6A 1HDTH 3GCNA 6GCHF 1HAZB 1S83A 1EASA 1O38A 2F43B 3F1SB 1OWIA 1BTYA 1MABB 1U6QA 3SQEE 2CN0H 4X8UH 1GCTC 1W8BH 2QA9E 2GD4B 4Y79A 4YO9A 1THPB 1O5FH 4IW4E 1HXEH 4HGCA 1GVLA 2EI7A 1BTZA 2OC8A 5B6LA 3MNSA 3OY6U 3HKIB 1BRAA 1QB9A 1FJSA 1W10U 1VITH 3OX7U 4Q2KA 4VGCC 1EP5A 3SHCH 3GDSA 3S7KB 4K3JA 4AYVB 4BAMB 4E05H 1GMCG 2G81E 3ZYDA 3KL6A 4AGKA 5C67A 2FEQH 2OC7A 3GCTG 3PYHA 1UVPA 4I86A 2ZTYA 4JMYA 3KYFA 1GWAA 4BOHA 1WV7H 2ZHDA 1LVMA 1AFQC 1WXRA 1ZSKA 2H5DA 5JBAS 2AMDA 1Q3XA 2A4GA 5AHGH 2C90B 5GXPA 4MVNA 2PFEA 1GCDA 3F9HA 3RUOA 1LTOA 4I8LA 1ZR0A 2XC5A 1SPJA 2QC2A 1WDIA 4GUXA 1QJ1B 4DOQA 1C1VH 1A3EH 2HVXA 4ABGA 1V2QT 3PV4A 2BB4A 1MQ5A 2GT7A 2BXUH 1KXBA 1C2IA 3RMMH 1E37B 1SHYA 2ZU5A 1SGNE 2IPHA 5AVDA 1MKXK 3NZIA 1O3MA 3TH3H 4B76A 4A92A 1O2IA 1TIOA 1J17T 2GGVB 3EQ0H 5EXMA 3UPEA 2OCVB 3A7WA 3PV5A 5CHAC 4ABHA 2ZU4A 1CT2E 4GAWA 2ODPA 1DM4B 1O3CA 1GG6C 2XCNA 5K0HA 1WU1A 1HFDA 2RDEA 2P8OB 1ZHMA 2V3OH 2B7DH 4A5TS 3MH7A 1O3LA 3SU1A 2BD3A 1XUFA 4ZMAH 4GPGA 3A8AA 2VIQA 1S82A 4ASHA 1P2OA 4Q7XA 3KIDU 2EY4C 3RMOH 4RKJB 1DLEA 1ETRH 4WH6A 4Q63A 1V3XA 1A3BH 2OQ5A 1O3EA 1FY4A 2CHAC 5FPYA 3TVJB 1F5RA 1RD3B 1W0KD 2A4RA 1GJ6A 2AGIX 3RXCA 1SGYE 2H9EH 1GI8B 1TGTA 3V12A 1O2LA 2VINA 4THNH 3PMJA 4AORA 4WXVA 4MNVA 1E1RD 1SKYE 3H7TA 3RXIA 4Z6AH 1EPTA 2SGEE 1PPZA 1S85A 3DD2H 3TK6A 2FTLE 4NZQA 1Q2WA 2Z94A 4D9QA 1G2MA 1ARCA 3AASA 1IQEA 1A0HB 3PROA 1GMHF 1HLTH 1RTKA 4KTCA 1C2HA 4TPIZ 3W94A 1GI7B 2PR3A 3L3TA 5FL7D 4E7RG 1O32A 1SGTA 2WV9A 1PQ7A 4ABFA 1OXGA 2ALPA 2FOGA 2ZPSA 3M7QA 4WVPE 4DIHH 3T26A 3LU9B 2BHGA 3ATLA 2Y7ZA 1MBQA 2WPLS 1O31A 3BEUA 1MZAA 1C5TA 4YOJA 3AAVA 1QRZA 2Y7XA 3A8DA 1DE7H 2ALVA 3SGAE 3VGCC 7ESTE 3N7DA 2W6ID 2VIDA 3MU8A 4KELA 4AG1A 1GJ8B 1KXFA 4WJG2 3U69H 4OS1A 1VGCC 1AB9B 1K1NA 4Y8ZA 1G36A 1WUNH 2UWOA 2FM2A 4TY6A 1RTLA 1BHXB 2JJ1D 2HPQH 2L6OA 1LVBA 1RIWC 1AVGH 5JYIA 1MTNC 1SLXB 4K2YA 4QT8C 5EQRA 4ZKOU 3FZZA 3P70B 2HALA 1ZLRA 1TALA 2UUKB 2NWNA 2GCHF 2KAIA 2AH4X 1OYQA 1Z7KA 3QO6A 4CRAA 1MZDA 5G4BA 1E36B 3E1XB 1FAXA 2WUBA 2ZHEH 3RXSA 3B8JA 1K1IA 1BMFD 1ANBA 1QIXB 1Z71A 2FLRH 3SU5A 1L0ZA 1V2MT 2V7QD 3A7TA 1P3EA 4CBNA 1C1RA 4D76A 1G2LA 2OQUA 3K6ZA 1C5NH 3MHWU 1KYNA 3BF6H 2FOCA 3M61U 2JIZD 1W7XH 1GJCB 1A61H 1PPFE 1EB2A 1A5GH 1TGBA 1CGIE 2Y6TA 2OTVA 1K28D 3A86A 4RN6A 1ZSJA 3A81A 1AZZA 1LPKB 2ZDVH 1AHTH 2F9NA 4B74A 4ISHH 3RXRA 2W7SA 2ZECA 1C4U2 1TWXB 4Q4LA 3UY9A 1N8OB 3AVZA 2GX4A 1FIZA 3TJOA 2A7HA 1GBLA 1Z8RA 2PKSC 2D1JA 1AMHA 2AHME 4P00A 1L1JA 4R8TB 3S0NA 1SR5C 4JZFH 2LPRA 4KGAA 1YPHE 1V2ST 1SG8B 1AD8H 5F8TA 1MUEB 2ZWLH 1BTUA 7LPRA 1A5IA 1B0EA 3VEQB 4JZDH 2TRMA 2KM0A 1TNIA 5DP5A 2B8OH 1O5DH 1QRWA 4Y0YE 4K1SA 5GIBA 2JKHA 1O3FA 1LCYA 1TPAE 2ZC9H 3RXLA 2FZZA 3NKKA 3SUFA 2ZFFH 1NRNH 4UE7H 3STIA 1MAYA 1ZTJA 1SGFG 1EPTB 3HK3B 4MPUA 4YXWD 3GDUA 1VJAU 4XFQA 1ETTH 3CENA 1QNJA 3CNRA 1H8DH 3BTWE 1CQQA 1BBRK 4OM9A 3P8FA 1GHZA 4K8BA 2Z9JA 1GVKB 1ID5H 1ZSLA 2QGRA 1BIOA 2ZEBA 3ZZ8A 1O2WA 2YOLA 1IQFA 4A6LA 3RC6A 1QJ7B 3C27B 3BTTE 2ZTZA 3LGUA 1BT7A 3TJVA 1KMHB 1TGNA 1WAYB 1GBEA 5GJ4B 3ATIA 5IDKA 1YCPH 1NN6A 3GDVA 1G37A 1GHWH 4OGXA 4Y76A 1BUIA 2BVRH 3T27A 1P06A 1TRMA 1ZMJA 2G8TA 4X2WA 2I6QA 5IK2D 2ZU3A 3S9CA 1DFPA 1D4PB 2F9VA 3ITIA 2V0BA 1SOTA 1Y3WA 2ZHFH 1TBZH 1OS8A 4ZCNA 2F83A 3SV2H 5DP8A 4YLUA 4X6NA 2VVUA 3TIUA 3TK9A 1EQ9A 1GHAG 4BXWA 1MKWH 1BRUP 3FANA 4Y8YA 3RXOA 5FBIA 2HVYB 2QF5A 1DANH 1HJAB 4X6MA 1DY8A 2C3SA 1BMAA 3ATMA 2KAIB 4ABAA 1C4V2 1P02A 1HB0B 3LJOA 1ZJKA 2WZQA 4NGAH 1TBRH 5A0AE 3TGJE 5LPFA 1O2RA 5ABWA 4ISOA 2C8WB 2GCTB 2HLCA 3P92A 3VPKA 1QL8A 5F8ZA 1Y3YA 2ZFPH 2WYJA 1SGRE 2BOKA 1C1WH 3W95A 1FQ3A 1O2XA 1YCPM 2C93B 3KQCA 2K0QA 2F9UA 2RG3A 1Y3XA 4MNXA 3KEEA 1YPKH 5KEDA 5HMAA 2OUAA 1SL3A 4AN7A 4KP0A 4U30A 3RXMA 3E16B 4NA9H 1ZGIA 5C0UA 6CHAC 2WV4A 1C5RA 2HPPH 2PSXA 2RDLA 3OEHD 4BTUB 2OBOA 1P2MA 2Z3DA 4ASUD 3PO1C 3M5NA 1EAIA 1JWTA 3BTGE 5BRRE 1EZQA 5T1VA 1BHXF 1DPOA 1MCVA 1P01A 5EJZA 4LK4A 4BANB 3TJUA 2BD9A 1GI2A 2QXGA 2O8LA 2Y5FA 1C5YB 1BBRE 1Z8GA 3SU0A 1GHVH 3VB5A 1C5SA 2A5IA 3EAJA 5CDFE 2QCYA 4Y7BA 3URCA 1NZQH 1E38B 1YY3A 1OWHA 1D3TB 4IS5A 1O3OA 4K1TA 1T4UH 2FI4E 2IPQX 1TX8A 1W2KH 2B5TB 1XUGA 3HGNA 3OYPA 2BD2A 1FY5A 3R0FA 1C5VA 3MU4A 4A1VA 1CHGA 3ZVEA 2QF4A 5C2ZA 2I6SA 1G9IE 1CT0E 4FXGH 1QB6A 3AAUA 5GPIB 1EKBB 1F0TA 4OS5A 1CGJE 1C2KA 1ZMNA 1JXPA 1ORFA 3GCOA 3LDXH 1AGJA 3TJNA 1L2EA 1PPGE 1P11E 1F7ZA 3EA7A 1K1OA 5T3HA 2V6NA 1TNJA 2UUJB 4ZROA 3ZZDA 2ZDAH 4FUIA 1NPMA 2ZP0H 3SJOA 3QGJA 1DX5M 1AN1E 2A45B 2DE9A 5JB9S 4MG3A 1GCTB 3SBKA 3MMGA 5CE1A 3A80A 2THFB 2IN2A 2ZPQA 2XWBI 1K21H 1TOCB 1AFEH 2EI8A 1LHCH 1O2SA 2A4QA 1C1OA 3DA9B 3PTBA 5TJXA 2ZTXA 1Y3VA 2YMSC 4X1NU 3A7XA 2FPZA 1Y3UA 4OS6A 4CREA 4VGCB 3GICB 1SGPE 1IHSH 1XKAC 4Y71A 2A7JA 1SGFA 4I8HA 1O0DH 1CA0C 3QK1A 3DHKH 1KXDA 2CGAA 1FY1A 4MDSA 4Y11E 5HIYA 1VKYA 3Q77A 1DSTA 1ELGA 7GCHF 3HK6B 3SYJA 3F3BA 2RA3A 1L1GA 4JZEH 4KKDA 1AFQB 1TQ7B 8KME2 3EA9A 1NFUA 2ZG0H 1RGQA 2W6JD 5C5OA 1A1RA 3P6ZB 4BXSA 3DSOA 2JDID 3KF2A 5CMXH 5E0GA 1Y5UT 1HPGA 4JZ1A 1C9PA 1N1LA 5EQSA 4NSVA 4NWLA 2J97A 1P2QA 2PSYA 2QV1A 3PLBA 5JBBS 1NROH 1MH0A 3MU1A 3F9EA 1KLTA 4CRFA 1O30A 4UEHH 3GCHC 4MTBA 2A5KA 3RXJA 1F5KU 4DGJA 3DFJA 2J5UA 1DS2E 1JIRA 3RMNH 3ATKA 4XBBA 3MYWA 1GBDA 2GP9B 5J4SA 2LP6A 3SUGA 4YTAA 1SB1H 1VR1H 1Z1IA 5CHAB 1LKBA 2QAAA 1CGHA 2R3YA 2WSSD 3T25A 1F5LA 3SU6A 4Q7YA 6GCHG 2WYGA 2Z9KA 8GCHF 3MH5A 1W13U 5DGJA 3DSGA 1GG6B 1BTHH 2AYWA 4MPVA 3KHVA 2BY6X 2AMQA 3OAAD 1AUTC 3GY6A 3MO9A 4Q80A 2Y80A 3L33A 2EEKA 2R0LA 4ISLA 3QWCH 3F0OA 3HKJB 2J98A 1DOJA 2SGQE 1KTTB 5HXFA 2F4LA 1GDQA 2G5VA 4Y7AA 5E2PA 2ZHQH 2ZPRA 2ZCKP 3FKSD 1YCPK 2HNTE 2CHAB 2ZHWH 2ZI2H 1GI4A 3UTUH 4B6EA 5HKKD 1HJ8A 4A7IB 3LC3A 4FUDA 3PMBB 3MNCA 1PPBH 3NRLA 1Z6JH 2G00A 2P3UB 1C5QA 1C2JA 1LDTT 3EE0B 5A8YA 1VCPA 3GYLB 4GVUA 1EAWA 1QTFA 2XNIA 1EZXC 2P3FH 4F48B 4DURA 3S7HB 1PQAA 3AW0A 4FUCA 2LNCA 1BBRH 1YWUA 5F6MA 3STJA 5LPRA 4NIXA 2UWLA 3B23B 3GY2A 1NBMD 2ILNA 4ZKNU 4NA8A 3UREA 2FLBH 4WF8A 1QY6A 1LO6A 1GMCF 1QL7A 1MKWK 1GJ9B 1ELTA 3BTHE 3PM3A 3SNEA 1MD8A 3SNCA 3GCTF 3A89A 3TNSA 1GBMA 1QZ8A 5H4IB 3U98H 2XRCA 1TB6H 3GOVB 1XUIA 2H2ZA 1WQVH 3EYDA 1SGEE 1K0HA 1GPZA 5EPYA 4YM9A 1V6DA 3MTYA 3A7ZA 1EZSC 3TH2H 5A8XA 2GJGA 2QXIA 2VIOA 4H6SB 1TRYA 1PPHE 5DSFA 1SOZA 3ZZ9A 4WH8A 1XM1A 1MTSA 3RC5A 1AVXA 1AUJA 1IOEA 2WPMS 4ABDA 2VIPA 1Y59T 4FU8A 5DP7A 3VGCB 1VCQA 2GZ7A 4DW2U 2K1QA 1DICA 1FDPA 2STBE 4AX9H 1TGCA 3U9AH 5GNDA 2RA0A 2FWWA 1INCA 2FTMA 3RLWH 1QURH 3WWBA 2F9PA 1ZPZA 1ZHPA 1EJNA 1HAIH 1VGCB 2AIQA 3UNRA 3DSPA 5EXNA 1P03A 3ENSB 2OINA 1YPLH 1J15A 1RIWB 1E35B 2O8TA 1T8MA 1FV9A 1SVPA 3RXUA 3UOUA 1MTNB 3T5FH 3SNBA 3K9XB 3NK8A 5EODA 4X2YA 1BTPA 1W11U 2FX6A 1W0YH 1ELDE 1DDJA 1GBFA 3E6PH 1DWCH 4ZH8A 1O5AB 5GDSH 3TU7H 1P9UA 1BTWA 3RXAA 2Z9IA 2BY7X 1ANDA 1BA8B 1GHBG 2OBQA 1SGDE 1O3IA 1IQKA 1UTKA 3SORA 2R9PA 1ZJDA 2G52A 3QX5H 5T6DA 1HYLA 2O9QA 2GDDA 1NRPH 1IHTH 1C2EA 1O2UA 4DVAU 3TGKE 4CBOA 1CT4E 2BZAA 4TWWA 4ABIA 1AVWA 1C5WB 4GCHG 1ZTKA 1MAXA 4Y6DA 4DIIH 2FIRH 1SSXA 4D9RA 2WPKS 4P02A 1HAVA 3BEIB 1AU8A 1YLDA 2J38A 3RM2H 9LPRA 4AYYB 4ZXXH 5LGOA 5DKMA 1HIAA 1GGDC 1QQ4A 3UWJH 1GI1A 2W3KA 4INKA 1CSOE 3FO8D 5E0JA 1TNHA 4CRCA 4CR5A 3O8CA 1FY3A 3SU4A 3BG8A 3KQDA 3LPRA 1Z1JA 2H6MA 2J9NA 4D7FA 3RXBA 4CR9A 3CS7A 2WPDD 2CMYA 2PKSB 1ETSH 1T8NA 2EQNA 1PJPA 3MOCA 3SUDA 2J98B 3A8CA 4DCDA 4FETA 2FOEA 1GBCA 1UTQA 1OOKB 1VITF 2GDEH 3GS9A 4KTSA 2M2AA 3WY8A 1ELBA 1W7GH 2VU8E 3FZDA 4X1QU 1UJ1A 1YF4A 3PTNA 2A2XH 3K65B 1AE5A 4CHAC 3OEED 2G5NA 1K1MA 1SFIA 1E1QD 4NG9H 1KY9A 3K2UA 1GHYH 2BDCA 4FUHA 3F2HA 3R3GB 2TGPZ
chains in the Genus database with same CATH topology
1P09A 1RTFB 1UK3A 3E91A 5EPNA 4ZXYH 5GWZA 1TABE 2Q6DA 1AKSA 1NO9H 5DPAA 1LQDB 1ZYOA 4ZKSU 1KLJH 3UNSA 1SC8U 1YKTA 3GY8A 1UMAH 3RC4A 1UK4A 5HM2A 2Q6FA 1BOQA 2FXRA 4CRGA 1F0RA 1QB1A 3JZ2B 2ZZUH 1QBVH 1K1JA 4ABEA 2Z9GA 4X1PU 2Q1JA 3H5CB 4IGDA 4K60A 5L30H 3RXFA 3QUMP 5C3NA 4H6TA 3V7TA 1T32A 3Q3YA 2AGGX 1QBNA 4INLA 1UK2A 3BTKE 2XWAA 4I31A 2SNVA 4JYUH 1C1TA 1QJ6B 2NU4E 2HWLB 1X7AC 5EG4A 1FAKH 4YT7H 2EA3A 1GI3A 4HTCH 3OU0A 1SGIB 4ZKRU 1BZXE 2BD4A 8LPRA 1LQEA 1M9UA 1LHEH 2GTBA 3NWUA 3SU3A 2ZFTA 4FUGA 1A5HA 2BZ6H 4HFPB 1XUKA 3E0NB 2CV3A 2ANYA 1UVTH 5DP9A 1VCWA 4WMEA 1AE8H 1UVOA 2QF0A 2A32A 2SNWA 2O8WA 3VFEA 4B75A 1PYTD 1YPGH 1T4VH 2NU3E 4MNWA 3ESTA 4FU7A 4X0WU 2JETC 3FP8E 5A0BA 2Z3EA 1HRTH 1BITA 5A8ZA 5BPEA 3BTME 5HYOA 3SN8A 1P9SA 4JYTA 3LONA 1C9TA 1L1NA 1EAUA 5FX6A 4CRDA 4RKOB 1CA8B 3M7TA 3ZVDA 1O3KA 1TMUH 2BDBA 5GCHG 2ZU1A 3D49H 1EZUC 1HAVB 1MQ6A 3UIRA 1O2PA 6CHAB 1MTUA 1O3JA 4X2VA 4I7YH 1HIAB 4NIYA 5A0CA 1KDQA 2ZFSA 3PWCA 3GY7A 3PO1B 2OP9A 4D8NA 1KSNA 2ZDMA 3A7YA 1XX9A 2FODA 1GL1A 4YOGA 2R0KA 4DY7B 2FI5E 4NFFA 1HAGE 2FOBA 3RDZA 1D9IA 1YPJH 2HOBA 3MO6A 1FXYA 1LPGB 2XC0A 1DUEA 3SZNA 4X2XA 1WOFA 3RXGA 2V3HH 4ABBA 4M7GA 1O2OA 3S9AA 3RP2A 3A7VA 3A8BA 1CU1A 1C2FA 3A83A 2HRVA 3ZZ3A 1MU8B 1QBOA 1YM0A 2J4IA 2UWPA 3LOXA 1DWBH 4AFSA 2GMTC 3HATH 2PTCE 1Y8TA 1O2VA 1O3DA 3GISB 2HNTF 2FMJA 1EOLA 1CHOG 1EB1H 1JRSA 3NXPA 5F03A 4JZIA 1RS0A 2BDAA 3SHAH 1GJ5H 1UTMA 2VWLA 4MLFB 2A31A 5EOKA 1AQ7A 1LVOA 3ZZ6A 4X6OA 4DJZB 3MU0A 1TPOA 4AG2A 1ARBA 1YYY1 1A0JA 1CO7E 3V3MA 6LPRA 1GHAF 1PPCE 2XYAA 1AKSB 1SFQB 4NWKA 2PUQH 2ZO3H 4HI3A 1O2MA 1ELAA 1K9OE 4SGBE 1HJ9A 3TPIZ 2H5CA 1RJXB 2F3CE 2G51A 2AGEX 1SGCA 2W3IA 4IC5A 1WCZA 1HAOH 3ZV9A 1OP0A 1SQAA 5E2OA 3SO3A 1C1UH 4TWYA 2Y82A 1S84A 3ZVCA 3IWMA 1TONA 1P2KA 2FOMB 2G4TA 5DG6A 4MQAA 1ANEA 2J2UA 2FI3E 3QZRA 1CA0B 1DXPA 3IG6B 3SW2B 2CF8H 1RFNA 1ZPBA 4MPXA 4E06H 1ABIH 2WPHS 1DITH 2H1UA 1SI5H 5K7RA 1OKXA 2D8WA 5C20A 1NRRH 2ZA5A 4JK6A 4BAOB 5HGGA 5EXLA 1J8AA 2EC9H 1GMDG 3O8RA 5L2ZH 3ZYEA 4WY3A 3QN7A 5DO4H 1VJ9U 5ESTE 3LJJA 2ZNKH 4F49A 1DT2A 4LXBH 1FN8A 1LKAA 2PGQB 2FS8A 3P8OA 1O3BA 2OC0A 4D7GA 1UTOA 1ESBA 2BDGA 1O39A 1S0RA 1FY8E 3E3TA 3UR9A 3G01A 2C4FH 3ZVBA 2B0FA 1NESE 2QN5T 1G3CA 1OPHB 5FHTA 1G3BA 1PFXC 2Z7FE 4JCNA 4Q7ZA 4B2CA 1CE5A 2SGPE 5EW1H 4AB8A 2PWXA 1T8OA 1NFWA 1O2HA 1OYTH 2OXSA 2WINI 1TNKA 2F91A 3BG4C 4HZHA 4UFEH 1KDQB 4FUEA 5I25A 2G4UA 4BAKB 1KTSB 1K22H 5E0HA 4BNRA 3D65E 2C8YB 2ZGCA 3B9FH 3DUXH 3GY3A 2VJ1A 4WWYA 3DFLA 2OLGA 2VWNA 1HAXB 1WSSH 4H4FA 2QY0B 1HAHH 3KN2A 1EXFA 2BDIA 5L2YH 1ELFA 2W7UA 1YPHC 2WUCA 4X1RU 1NC6A 1S6HA 3VB4A 1BQYA 1TRNA 1DY9A 3P17H 2YNAA 4NFEA 7GCHG 2J92A 1QFKH 1O2GH 5JPMH 3A85A 1GBBA 2ZIQH 4Y0ZE 2EI6A 3ZV8A 2P94A 2QXJA 3E0PB 3F6UH 4PROA 1K1PA 1S0QA 2ZGXH 5C5NA 2Z6BD 1C1SA 3M3SA 1O2ZA 3M7UA 3M3TA 2VNTA 3SJKA 1L4DA 2BX3A 2OC1A 3FP6E 3T2NA 2Z9LA 1CBWC 1NU7B 1MCTA 1BRCE 3OY5U 3RXPA 1N6XA 1EATA 1FPCH 1B7XB 2QXHA 2QF3A 1FMGA 2ZF0H 1O37A 1DXWA 1IQJA 1C5PA 1TX6A 2CF9H 2A4OA 5JB8S 4LZ1H 3BV9B 1KXCA 2AMPA 2PLXA 4I8KA 4NIWA 3E8LA 2ZDKA 1T7CA 1UTPA 1TPPA 1YC0A 5EW2H 2AS9A 2ZFQH 3M3VA 1C5UA 2D2DA 2FYRA 3O8BA 4UFFH 1PPEE 2ASUB 3PWBA 2VGCC 3P8NA 4K1EA 2ZGHA 2CJIA 3OTJE 1KIGH 4AOQA 4X8TH 1UVUH 1W3CA 3I77A 3LGTA 3BTEE 4CH8B 1D6WA 2BQ6B 1D6RA 4I32A 1V2RT 4B73A 1HUTH 1O33A 2BLVA 2XBYA 1YBWA 3M5LA 5E8EH 1IQLA 2QIQA 2BD8A 1BJUA 4YZUA 5JBTA 1XVMA 1D3DB 3SV9A 1ZPCA 3RU4E 1IQIA 1P57B 1SLVB 2Q6GA 1O2QA 2NU2E 2ULLA 2VIWA 2PKAA 4NSYA 3SOSA 3ELAH 5DJ7A 3TLOA 1BMMH 1TQ0B 3QDZB 2BD5A 4X8SH 2B9LA 4FVDA 1T8LA 3LGWA 3LKWA 3ZZAA 1GI9B 1ZOMA 4I8GA 2J34A 2BX4A 3URDA 3F9FA 1V2TT 1ABJH 3ZZ7A 2ZKSA 4K69A 4B71A 7KMEH 1OX1A 1PQ8A 1B5GH 1G30B 1E0FD 2WPJS 3UFAA 1AY6H 3RXHA 4E7NA 2P16A 2BYAX 1TE0A 5FCRA 1O3PB 1KLIH 1YP9A 1O3AA 1EP6A 5FX5A 3S69A 1GGDB 1V2LT 1ZHRA 2SGDE 3BSQA 5EQQA 1NRQH 2Y5HA 3L6PA 5I46H 2WPIS 1C2DA 4GHQA 3I29A 1ANCA 1GI0A 1Y5AT 1XUJA 4DT7B 3GY5A 3VXEH 4CRBA 2PHBA 1THRH 1E34B 2Y81A 1O2KA 1DWDH 1GJ7B 1O5BB 4ZHMU 2BM2A 3VXFH 2GZ9A 1S6FA 1GI5A 1DVAH 3VB7A 3LT3A 5T6FA 1TX7A 1J9CH 3QGNB 5PTPA 2A1DB 3F68H 3P95A 1SGQE 5T6GA 3A82A 2FYQA 5TCCA 1TMTH 3ZZ5A 2XC4A 1NU9A 1QHRB 4RSPA 3ODDA 4CHAB 1B0FA 2O8UA 2XBXA 3BIVH 4AFQA 1WBGB 1A2CH 3HPTB 3D23A 2XBWA 4ESTE 2VWMA 2HGTH 1SQTA 4CH2B 3MFJA 1UHBA 1UTLM 3BIUH 1A46H 5FCKA 1AWFH 3MH6A 5FPTA 1KXEA 1L4ZA 1JBUH 4OGYA 1K2I1 3TITA 2P3TB 1C1NA 3QZQA 3QTVH 5ETXA 1GMHG 5DP3A 4XDEA 3A87A 3GYMA 3SNDA 3KNXA 3RM0H 1GHXH 3V0XA 1GHBF 4FUJA 4WMDA 3Q76A 2BY5X 1TA6A 2RCEA 1P04A 1AIXH 3ZZBA 1C1PA 1ZTLA 1BB0B 1AO5A 3C1KA 2CXVA 1GVZA 3TGIE 1H9LB 1G3DA 1P12E 4LOYH 2STAE 4GCHF 1XVOA 1JMOH 1GL0E 1NFXA 5A2MH 4B2AA 1AI8H 1IQHA 1VZQH 5FBEA 9ESTA 1TYNA 3O8DA 5TCAA 4ISIH 1JOUB 4UFDH 1VITG 3RU4D 1O3HA 2NU0E 1UTJA 3ZVFA 1V2KT 5EU8A 1DSUA 1YGCH 1GJAB 2PKAB 3A88A 2DUCA 1AWHB 3LGYA 2XCFA 4O9VA 2JH5D 2BTCE 3NUMA 1QL9A 1SHHB 1ELCA 1SMFE 1TNLA 2JETB 2ESTE 4FUFA 2A2QH 1EJMA 2BDHA 3EGKH 4BAQB 5FAHA 3ZZ4A 1XXDA 1P2JA 2ZCHP 3M5MA 3ZVAA 5C1XA 1NRSH 2P8OC 3M36A 4BTTB 2GCHG 4TY7A 2F9BH 1GJDB 1H4WA 3I78A 4Y8XA 1P3CA 1TFXA 5AF9H 4SGAE 3F9GA 2W26A 4IMZA 2W5EA 1N6YA 3SGBE 2FOFA 1JRTA 1O2TA 2P59A 3ZZCA 1C5LH 1OP8A 4GSOA 4YT6H 1IQNA 2OD3B 3ZVGA 1FUJA 1XKBC 3S9BA 1V2NT 1GJ4H 2P93A 4LZ4B 4TYDA 3VB3A 2PUXB 1O2YA 2XTTB 1GBJA 2G55A 3T29A 4DG4A 1LMWB 2VIVA 4R0IA 4U32A 1LPZB 2VH6A 2GT8A 2VB0A 1WTGH 4IN1A 1GBHA 4NA7A 1MTWA 4OS4A 2UUYA 1O2NA 1IAUA 4FVBA 2GV7A 5L6NH 3ATWA 2ZGBH 4INHA 2ZU2A 1H8IH 1QA0A 4IC6A 1TPSA 1GBTA 1RRKA 2V35A 2AEIH 1C2GA 4JK5A 1OSSA 4NCYA 2HNTC 1F0SA 3TK5A 2FOHA 4OS2A 3T62A 3FFGA 4AB9A 1XUHA 2JH0D 2VVVA 1MBMA 3RXKA 3ODFA 3PLKA 2GMTB 2GVFA 4O3TA 1H9IE 3U1JB 1O5GH 4FUBA 1O3NA 1UCYK 4IN2A 1GDNA 4J2YB 4U2WA 1V2WT 1QGFA 1J14A 1TAWA 4XOJA 3D62A 5B6OA 2BLQA 1GDUA 2GKVE 1OWDA 4GLYA 1UHBB 1BDAA 1EUFA 3SI3H 3MWIU 2TPIZ 1O34A 5A09A 3UNQA 2BMGB 5FXLA 1NT1A 4B1TA 1FZZA 1J16A 4UFGH 4MPWA 2TGDA 3SNAA 1C5ZB 1PQ5A 2GV6A 4KTUA 2BXTH 4B2BA 1IQMA 3QTOH 2H9HA 1AB9C 3CP7A 1EJAA 2IJOB 1S81A 1WQSA 1O3GA 2FDAA 1EX3A 1FPHH 1OWJA 2VVCA 3SJ8A 1ZMLA 4O3UA 3RXTA 1TGSZ 5SGAE 2BOHB 3EDXB 3RMLH 3SQHE 3RXQA 1D3PB 4XBDA 3E90B 1MMJN 2VWOA 3M35A 3Q3KA 1HBTH 2BY9X 1HAYB 2WV5A 1GJBB 2ZDLA 2BVSH 5GCHF 3DT0H 1P8VC 2FOAA 1C2LA 2ODYB 3MNXA 1ELVA 1TOMH 5DK1A 4FU9A 3SGQE 3BTFE 5JDUB 1Z8IB 1ZGVA 1ACBE 4NIVA 1BTXA 1YPEH 3MO3A 1EAXA 2UUFB 1ZZZA 1YLCA 2PGBB 2PV9B 1F0UA 1G3EA 4Z0KA 3BTDE 1O2JA 2ANMH 1RXPA 2QYIA 4I33A 2YNBA 1O5CB 2Y5GA 3NPSA 1PYTC 1WTHD 3JZ1B 2BDYA 1FI8A 2ODQA 1UTNA 1W12U 3BTQE 2TBSA 1A4WH 1BMNH 1YPMH 2C8ZB 1N8OC 2FO9A 2TGAA 2BLWA 4K8YA 1Q31A 1LHFH 2XW9A 4XE4A 5DP6A 3M5OA 3PB1E 3SUEA 3RLYH 2A5AA 1SLWB 3SV6A 4BAHB 2F9OA 1OWEA 3LIWA 1BCUH 2M5TA 3BG4B 4YOIA 2O8MA 5IYTA 1V2UT 2BD7A 1BJVA 4OS7A 1NTPA 1C5XB 4ZHAA 2SFAA 1MTVA 4O97A 3HGPA 3FP7E 3LC5A 1CHOF 3RXVA 1UCYE 3N7OA 1MKXH 1SLUB 1DWEH 1FIWA 1QA7A 2XXLA 1T31A 2ZDNA 4MNYA 2NU1E 1EPTC 1P2IA 3PMAB 2AERH 2SGAA 3KQEA 4NZLA 1SQOA 4IMQA 2SGFE 1H9HE 2FS9A 1C1MA 2ZFRH 1DUAA 1GI6A 1FN6A 3RU4T 1C5MD 1TBQH 4X8VH 2JH6D 2AIPA 1QRXA 5LH8A 3P8GA 1ELEE 1D3QB 2ANWA 4XBCA 3BEFB 1BRBE 2FP7B 1ESAA 3UUZA 1C5OH 1P05A 1OP2A 1EOJA 3BN9A 4YLQH 5HM9A 2BQ7B 1FLEE 1G32B 4ZUHA 2TGTA 4IBLH 3RXEA 1ZRKA 1IQGA 4AGJA 3NCLA 2BLOA 4I8JA 1FNIA 2H9TH 1HAPH 4UDWH 1NS3A 1Z6EA 2ZQ2A 3FAOA 3UWIA 1HV7A 1Z8JB 3U8TH 3UQOA 2R2WU 1CBWB 3U8OH 3SV8A 4AFZA 2GZ8A 3M37A 1LHGH 4K5ZA 3GCHB 3PLPA 3LH3A 1GMDF 4YESB 3K6YA 3MNBA 4BTIB 2VH0A 1QR3E 1SBWA 1TLDA 2A7CA 3V13A 3EA8A 5C1YA 5AFYH 4JYVH 3MI4A 1THSH 1KXAA 5LPEA 2J95A 3UOPA 1XXFA 3Q00A 4TPYA 5AFZH 4UD9H 1HCGA 1NM6A 1W14U 2VGCB 1HGTH 3SU2A 1K1LA 1QQUA 1XMNB 1GBAA 1QCPA 1S5SA 4ISNA 4X1SU 1HJAC 1A0LA 4UONA 1O5EH 1V2OT 8ESTE 2ZCLP 3SJ9A 3KQBA 3UR6A 4WMFA 1P10A 1TMBH 1TA2A 3TNTA 2PW8H 4ZHLU 5C1UA 3FVFB 5DP4A 2GCTC 2R2MB 3AW1A 1LHDH 4WXIA 4AZ2B 3SV7A 3IITA 2TIOA 5ESBA 2Z3CA 1LVYA 1H1BA 3MH4A 4Y10E 3LGVA 1P0SH 5JBCS 1F92A 2C8XB 1TNGA 4J1YA 2AFQB 2BY8X