4FUHA

Crystal structure of the urokinase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fuhA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fuhA01
3N7OA 4K8YA 2BVRH 3C27B 4DIHH 1ELFA 1SQAA 3GCHB 1QNJA 5EG4A 1A5HA 1MCVA 2PFEA 1S81A 1BTPA 3Q3KA 3M5LA 1W12U 2HLCA 3RXBA 3NCLA 3RXCA 3VGCC 3OYPA 1QB9A 5E0JA 4AN7A 2ZZUH 3NKKA 1BHXF 3SQEE 5JB9S 1C2HA 2J94A 2PKSC 2PKSB 2AMDA 4BTTB 1NT1A 4WWYA 1FN8A 2BLVA 1EKBB 2PWXA 2FOBA 2A5KA 3SV8A 4ZXYH 2FYQA 2YNAA 4BAMB 1LPKB 4INLA 4OS7A 1WAYB 3EGKH 1K1MA 1OYTH 3SZNA 1FIWA 1VITG 1SOZA 2OXSA 3T25A 1ESAA 4LZ4B 1XX9A 8KME2 3ZVGA 3S9BA 4U2WA 4IMQA 5FXLA 1GI7B 2TBSA 1GBDA 2W7SA 1SVPA 1GG6C 1EAXA 1K22H 5A8YA 3SI3H 3RC5A 1XKAC 1GHAF 1O0DH 2QA9E 3S0NA 1ANBA 1HJ9A 2RA0A 3B9FH 3MH7A 1AN1E 4RKJB 2PUQH 2OBQA 2QXJA 1TNLA 5F8TA 3MWIU 1Z7KA 1P01A 1P09A 2ZHQH 1UCYE 4JCNA 3OU0A 3KEEA 3GDUA 3P6ZB 3SUFA 5GCHF 2O9QA 3RLWH 1WU1A 4HGCA 2FS8A 3AAVA 3MH6A 4O97A 3LH1A 1O3HA 1ANDA 1TALA 1OWIA 1M9UA 1T32A 1O3CA 2A7CA 2OC8A 1O5GH 1FUJA 1TA2A 1DM4B 3B8JA 1P0SH 2EC9H 1WV7H 4FUBA 1O5EH 2Z94A 1GBEA 2PKAA 4ESTE 3MU1A 5C67A 1DSUA 1QL7A 2Y6TA 1U6QA 1RTFB 2ZWLH 1P03A 2H2ZA 2ZPQA 3PWCA 3FVFB 1O3MA 1DFPA 3SJ8A 3UNRA 3RXAA 4JZEH 4Y8ZA 2ZCLP 1H8DH 1XUHA 1G2MA 3SV9A 2Y5HA 3PLBA 1NU9A 3T5FH 1JMOH 4Q7XA 1RTLA 2BZAA 1SGEE 3SHAH 3M7TA 1Z8IB 2A5IA 1O34A 3T27A 3RXUA 1T31A 5F6MA 2RA3A 1P9UA 1AO5A 2Z9GA 3TK6A 1EJMA 4U32A 1GVLA 1PQ8A 3SV2H 1SLUB 1UK4A 1P2MA 1QJ7B 4JZFH 1JBUH 1MH0A 2BD7A 1O2PA 2BMGB 3OX7U 1YPLH 3ITIA 5L2ZH 4X8TH 5AFYH 1FPHH 2ZU2A 4YOJA 5K0HA 5HYOA 1ZTLA 3ZZ4A 1O3OA 2C4FH 2WV4A 5EXMA 3V12A 3RXIA 4NA9H 2CXVA 3ENSB 2OBOA 4XE4A 4MNXA 4ABGA 1Z8RA 1PPHE 2BDYA 1GDNA 1NM6A 1CGHA 1C1UH 1A61H 4TYDA 1BTYA 1ZSLA 2ZPRA 3K65B 1LQDB 2WYJA 4BXWA 2P95A 1V2UT 2ZFFH 1D3TB 1WOFA 1EOLA 4YLQH 1RD3B 4MPWA 2H9TH 2R2WU 2V6NA 5K7RA 3E0NB 3Q00A 1MQ5A 1TNGA 9LPRA 1KTSB 1HUTH 3RXPA 1TPSA 1AUJA 2ZDLA 2TPIZ 4RKOB 3EYDA 1BHXB 4YOGA 3QTVH 5CHAC 5FAHA 3SI4H 1O2JA 1ARBA 4OGYA 5LGOA 1QA0A 1MBQA 1CA0C 2TGPZ 1PQ5A 2FLRH 1GI6A 3K9XB 3TH3H 2G5VA 4YTAA 2P8OB 2P8OC 1IHTH 1CT4E 2AMPA 1ZMJA 1Z8JB 4X1QU 2A32A 1GVZA 4THNH 4ISHH 3SU5A 1SLVB 1V3XA 4Y6DA 1O37A 4BNRA 2WINI 1Z1JA 1TGTA 2XC4A 2Q6FA 5HM2A 1IHSH 1O2YA 4FU9A 5JDUB 2Z7FE 4MNWA 4WMFA 4E7NA 2ZQ1A 3BTFE 3PMJA 2ILNA 2A2QH 3RXEA 2J92A 1MTVA 1UVOA 4AOQA 1TABE 1RRKA 1P04A 1V2OT 1C9TA 1ZPBA 1VJAU 1C5SA 3DD2H 1L4ZA 4YOIA 1NRQH 1P9SA 1AY6H 4Q2KA 3BTKE 4Y8YA 5GIBA 5EXLA 5DP6A 1MU6B 1BUIA 2D26C 3SGBE 2GCHF 1DWCH 1OP0A 4K1EA 1TIOA 3LU9B 3SV6A 1BMMH 1O3IA 2P3FH 1N8OC 1KSNA 1BMNH 2ZTXA 4DIIH 2FWWA 1N6YA 1PYTC 2WPMS 4CREA 1PPEE 4WY3A 5EPNA 1EASA 2AERH 4GVUA 1LCYA 3ESTA 5DG6A 3GY7A 1C2IA 2Z3CA 3FANA 1YPKH 1VGCC 5E2PA 1AZ8A 1Y5AT 2Q6DA 1EPTC 4B2CA 1BJVA 3EA9A 3PB1E 4NGAH 1BMAA 2ZGBH 2BM2A 1J15A 1Y5BT 2O8WA 3NPSA 2XCFA 4ABAA 1CT2E 1F5RA 3UOUA 1V2JT 3M5OA 5DGJA 1DWBH 5GXPA 3SGAE 1C5PA 1NO9H 3TJUA 4UE7H 1BT7A 2BY7X 3KCGH 3RC4A 1C5QA 1TBZH 4I8JA 1EQ9A 4X1PU 3GCOA 4KGAA 1Y3YA 2ZA5A 1G37A 3T29A 2BLOA 4OS1A 4D9QA 1NROH 3TGJE 2BDAA 3HKIB 4UFFH 5ETXA 3KGPA 1Z71A 2HWLB 2JKHA 1V6DA 3C1KA 1QY6A 1Y59T 5FPSA 1NRPH 1ELVA 2A4OA 2AMQA 1OX1A 3U9AH 2A4GA 1HLTH 2DUCA 1YBWA 3S69A 7GCHF 4NFFA 3ATKA 1TBRH 1K21H 1FY8E 4MDSA 4AFUA 1DLEA 1P12E 2JH6D 2PW8H 2QXGA 3MH5A 3A84A 3FFGA 4AYVB 1XXDA 3RMOH 2OC7A 1C9PA 4DGJA 2BD5A 3MOCA 1AE8H 1NFUA 4X2VA 3U69H 1IOEA 1SQTA 2IOTA 1H1BA 3U8TH 1AGJA 2UUFB 1TMBH 3HATH 2P94A 1GGDC 4F4OC 2FTMA 1TRYA 5A8ZA 4AGJA 2W3KA 4AFZA 1V2MT 1TRMA 1HBTH 1O2QA 1QURH 2FPZA 5DJ7A 1AFQC 3UWJH 1ORFA 2FP7B 1BJUA 3PLPA 4H6TA 1P57B 1QCPA 1PPCE 1T8LA 3V7TA 1XVOA 1D4PB 1ZTKA 2HALA 1RIWB 2BDBA 2GCTC 1EAWA 4B2BA 3LJOA 1NZQH 2VVCA 4CBNA 1O35A 4ZAEA 2DE8A 5FCKA 1Y5UT 3JZ2B 3OY6U 1BB0B 1BBRE 1DXPA 1VZQH 1J17T 4Y0YE 3QUMP 3QTOH 1ELCA 4F49A 1Y3WA 1WQSA 3QX5H 3AW0A 5EQRA 5F8ZA 1TBQH 2P59A 2F83A 1JXPA 2R3UA 1QRWA 1O2MA 1HAVA 2A0QB 5A2MH 3S9AA 1O3GA 4GHTA 1W7GH 4MG3A 3T28A 1LPGB 2FI4E 1NN6A 5FBIA 2C93B 1EB1H 1H8IH 4BTIB 1TX8A 3VB5A 1SG8B 2FODA 3EE0B 3V0XA 1YPGH 5EODA 1YCPK 2O8MA 2ZFPH 4HI3A 2PLXA 1HAHH 4IBLH 4AFQA 2VWLA 2XWBI 4K69A 1MTWA 2ZP0H 1WTHD 3RXGA 2BDCA 8LPRA 1GMCF 4GCHG 1LHDH 3ZZ5A 2AS9A 1YF4A 3U1IB 1ESBA 1O2KA 1GBFA 3VB3A 1AD8H 2NU1E 2XC5A 4J1YA 3PLKA 4NA8A 2FOCA 3DA9B 2R2MB 1HDTH 1XVMA 2EI7A 3KF2A 3LOXA 6CHAB 5EW2H 3RMNH 1FMGA 3T2NA 1HYLA 1ARCA 1LKAA 1VCWA 2O8TA 1BZXE 1GBIA 2PSXA 3K6ZA 3A80A 4X8UH 1S5SA 5JB8S 5LH8A 1UO6A 3TJNA 4IC5A 5C2ZA 1C5TA 1TGCA 4DOQA 5CE1A 3HKJB 3S9CA 4J2YB 1NY22 1C5XB 2ZFSA 1K2I1 1ID5H 1P11E 3PO1B 5FBEA 2OC1A 2PGBB 1OWEA 1S0QA 2WPJS 2VH0A 4MPUA 3BG4B 1OP2A 1RTKA 4I8HA 2ZHDA 3RMLH 1O3NA 2TGAA 2OD3B 1C2KA 3S7HB 5G4BA 3MI4A 5FX5A 1N1LA 3HK6B 2NU3E 6GCHF 1FY5A 5H4IB 2UUYA 4ZHAA 5FPYA 2BD3A 1OWJA 3DT0H 1CGIE 1W10U 4ZKNU 2GGVB 1C1QA 3CS7A 5B6OA 3M3VA 2F9VA 2FO9A 2WPLS 4D8NA 3SNCA 4CBOA 4M7GA 4D9RA 2A5AA 1DUAA 3BEFB 5A0CA 1TGSZ 3CS0A 1O2UA 3PROA 1SL3A 2G81E 1AVXA 1ABIH 1SI5H 3HPTB 1VCQA 3ZYDA 1ETTH 3P70B 2WPHS 1QA7A 1HXEH 2B8OH 1GBCA 2QY0B 3UOPA 3E8LA 1BDAA 1C2DA 3RXVA 5A8XA 3GY4A 2QV1A 3LDXH 2QN5T 3MU5A 4A1TA 3STIA 1VITH 1ZR0A 1XUFA 5HMAA 3ZZDA 2GZ8A 5FX6A 1TQ7B 1LVBA 3H7TA 3TLOA 3LC5A 2GX4A 3A8AA 1AMHA 1ZGIA 4A1XA 3U8RH 2TGTA 1MMJN 5HM9A 3BV9B 1SGTA 1T8MA 1A4WH 4UEHH 1EZUC 2ZHEH 5E2OA 2HNTC 1S85A 4TY7A 2CF9H 3U8OH 3E3TA 3SV7A 3TH4H 1SLWB 1YKTA 1Z1IA 1HNEE 3MO6A 3ZVDA 1SHHB 3MU8A 3UUZA 4ZUHA 1BIOA 1L1NA 5EQQA 3M5NA 3VGCB 1GBKA 1P8VC 2Z9JA 4K3JA 1DITH 1Q31A 1CBWC 1CBWB 1GL0E 3SQHE 1HPGA 1K1OA 1DY8A 1GJDB 1O2TA 2VJ1A 3ZZ3A 2HVXA 4K5ZA 3UY9A 1F7ZA 1C1WH 4ABIA 3RP2A 1GMHF 1T4UH 1GBMA 1JOUB 3MU0A 4D7GA 3BTDE 4BANB 2AEIH 2BXUH 2RCEA 3GYLB 3IG6B 5EXNA 1GJ6A 1V2PT 1MU8B 3F9EA 3VXFH 1GI9B 3VB7A 1C1OA 1H9HE 1O3JA 3M36A 1AWHB 4LK4A 3O8BA 1OS8A 1HAVB 1BITA 1GG6B 1G9IE 1DXWA 2Z6BD 2G5NA 1EJAA 3CENA 3SN8A 1SHYA 4OS2A 3I78A 1P2QA 1QIXB 1C5RA 3I77A 2QGRA 3CP7A 1HRTH 2SGPE 1ZZZA 5JBTA 1THSH 3K2UA 2VGCC 1QRZA 3E90B 3H5CB 1UMAH 2ZHWH 4OS4A 2FI3E 4PROA 3RU4E 4I33A 4VGCC 3SU0A 2CMYA 1ELDE 1SGFA 3Q76A 1TQ0B 2C90B 1C1TA 2BLWA 2YOLA 4XOJA 3ZZ9A 2OP9A 3RXOA 2GD4B 4NWLA 4FVBA 1UTPA 1QGFA 1Z6JH 2C8WB 3PM3A 1B5GH 1MKWH 3O8DA 4O03A 5JPMH 2ZGXH 2BY6X 2GZ9A 2H5DA 4KTUA 1OWDA 5J4SA 3ZYEA 1BMLA 1GHBF 1NFYA 3DFLA 1ETSH 4KP0A 2THFB 1S6FA 2B5TB 2BLQA 2WV5A 2VINA 1SR5C 2QCYA 1TRNA 2H1UA 4XDEA 1O3AA 4O3UA 1AUTC 1H9LB 3V13A 2KAIA 3TVJB 4WF8A 1AVGH 4XBCA 1IQJA 3K6YA 1DANH 1BRCE 4LXBH 4JYVH 3D62A 3P8OA 3RXKA 4D76A 1TAWA 8GCHG 2FDAA 2ZEBA 4I31A 3LJJA 3P17H 3U1JB 2FTLE 2GMTB 2GMTC 4SGBE 3GDSA 4FUIA 3RM0H 1VCPA 2A2XH 1EZSC 2GP9B 3UR6A 2H9EH 1AZZA 1KYNA 5EPYA 1GHWH 1OSSA 2XBWA 5EQSA 3BTEE 2QF3A 5JBBS 3ZZ6A 2AGEX 3BF6H 4H42U 2F3CE 1DWEH 1QBVH 3LPRA 2OQ5A 1KLJH 2EEKA 2ODQA 1DVAH 1GJ4H 5BPEA 1QJ1B 1TMUH 3M3SA 1CHOF 1GVKB 5I46H 2WPIS 1ZGVA 5C5OA 5A0AE 2BQ6B 1WCZA 1C5LH 4B2AA 3RMMH 4UDWH 1EZXC 3ATLA 2SNVA 1B7XB 1A2CH 2HGTH 4GLYA 5EOKA 2FI5E 1Z6EA 1YCPM 1DUEA 3SOSA 1FJSA 1UTNA 2PTCE 3EA7A 4NZQA 1C1MA 1O2WA 1E0FD 1NTPA 2C8XB 5CHAB 1Z8GA 1AVWA 1GBJA 1ZPZA 4WMDA 1BRUP 5TCAA 1A3BH 1CA0B 1IQMA 3WY8A 3AASA 3FP7E 4X6NA 5DP3A 4B75A 1XXFA 3QGJA 1CSOE 1ZTJA 3RU4D 4DURA 4B73A 2ZNKH 1AKSA 1HAIH 1KLTA 1O31A 2PV9B 1GHYH 1ANEA 2FOAA 5DP7A 1AB9C 3O8RA 1NRNH 1XUGA 1UTJA 1W13U 1A0JA 1RJXB 5DP5A 1WYKA 2GZ7A 4FUJA 2A45B 1SC8U 2GV6A 1W0ZU 2JH5D 2ANMH 3SO3A 2NU4E 5EU8A 4Y79A 1ZYOA 1LTOA 1TMTH 1G32B 1BTZA 3BTME 1ETRH 3RXJA 4A6LA 3LGTA 1A0LA 1GHVH 1V2LT 4NIXA 4Z6AH 1VITF 1CU1A 4A1VA 1AI8H 2GVFA 4TY6A 1G30B 4QT8C 1FY1A 2WYGA 4ZHMU 3LGVA 1A0HB 5EGMA 2QAAA 3SU3A 2SGAA 2BD4A 2UUKB 3B23B 3SNDA 3LH3A 1FONA 1FY3A 1CVWH 2ZHFH 4NG9H 4CRDA 2A31A 1ELBA 3EA8A 2J38A 2M5TA 2VWMA 4ZXXH 1O32A 1TGNA 1K28D 1N8OB 3NZIA 1F5LA 2BD2A 1QJ6B 1HV7A 1UVPA 1KY9A 3RU4T 1T4VH 1SGCA 4IMZA 3KN2A 1BTXA 1B0FA 1C2GA 1HJ8A 3ELAH 1K1IA 3BSQA 1A1RA 1VGCB 1MZAA 5JYIA 4WJG2 5DPAA 1V2WT 2TIOA 1EPTB 1F0UA 1GCDA 2VVVA 1TX6A 3QGNB 2F9NA 2Z9LA 3S7KB 1BRAA 3TJVA 3URDA 3MNSA 1SGPE 4I8GA 2OTVA 1OXGA 3IITA 1UTKA 3RM2H 3NUMA 2JETC 1L2EA 4AZ2B 2XC0A 3M5MA 2BB4A 6LPRA 4BAQB 2EA3A 1LVOA 2ZDKA 2H5CA 1KXEA 3E0PB 4Q7ZA 1ANCA 5DO4H 2CF8H 3BIVH 1AFEH 1OKXA 1C5UA 2GT8A 2SGDE 4X6MA 3VPKA 4TWWA 4ISLA 1ABJH 3SJIA 4KKDA 1EP6A 4MPVA 1PPBH 1V2NT 3UTUH 3ZVEA 3GY6A 1O30A 1SBWA 3QN7A 1J16A 4ABJA 2IPHA 3ATWA 1O2LA 1GI0A 2HPPH 1C1NA 4LZ1H 3LKWA 1JIRA 2KAIB 2ZFQH 1C4Y2 1F0RA 1GBLA 4X0WU 4ZKSU 2GV7A 3PMHB 4A5TS 2ZPSA 1DX5M 5I25A 1GBAA 3SW2B 3LGIA 2Y5GA 4Z0KA 3ZZ7A 4DG4A 2PTNA 1C5WB 1IQKA 8GCHF 1C2JA 1HIAA 1LVMA 1ZMLA 4ZHLU 1P2OA 1MTNC 3SUGA 5J4QA 3ODDA 3GCTG 1GI2A 4WXVA 4X2XA 3L3TA 4FU7A 3BEIB 1HAXB 1FXYA 2QXHA 3F9GA 1FN6A 2FZZA 1MZDA 4GAWA 4Y7BA 4YT6H 3O8CA 3AVZA 2BHGA 3BTWE 1LDTT 1FV9A 2R0KA 2BDIA 3A7YA 1KDQA 1XM1A 1O2XA 2CV3A 1GGDB 1O3DA 1CE5A 4NFEA 3FZZA 3D23A 1AFQB 3GDVA 4IN1A 3ZZ8A 4CH8B 4YESB 1GCTB 1GCTC 3SHCH 2YNBA 2AYWA 2ZC9H 1CQQA 3D65E 1EB2A 4AB8A 1GI5A 1NS3A 2GCTB 5AFZH 4KELA 7LPRA 3L6PA 3SUDA 2Z3DA 3MNBA 2Y7ZA 4ZMAH 4ISOA 1C5NH 3BTGE 1YPHC 1GL1A 3ZZCA 1O2OA 2HNTF 2PSYA 5AF9H 2AH4X 1MUEB 4WXIA 1GJ7B 2GDDA 1QQ4A 2SFAA 3UPEA 1EATA 1ZPCA 3LC3A 1XUKA 5CMXH 5BRRE 2G55A 1J8AA 4SGAE 2SGFE 3KQCA 1AKSB 1C5ZB 2STAE 1O36A 4H6SB 2ZTZA 5PTPA 5FPTA 1S6HA 1QL8A 1UHBA 3VXEH 1ELTA 1S0RA 3NXPA 1L4DA 3UNQA 1K1JA 3PTNA 4E7RG 1BBRH 1AE5A 2A7JA 2D2DA 2K1QA 1QBNA 5AHGH 4X8SH 4NSVA 3GY5A 4AX9H 2B0FA 1V2VT 1MD7A 2ZGJA 2PUXB 4CRGA 1LHFH 2GDEH 2R9PA 4NIWA 5HGGA 2FX6A 1DICA 1GHAG 1O5CB 1YYY1 3OTJE 3R3GB 2G8TA 4XBBA 1MCTA 3MMGA 4GSOA 3E1XB 3SU2A 1WBGB 3D49H 3TPIZ 2V35A 1WSSH 3A7WA 3Q3XA 2FESH 1VJ9U 1ZMNA 1F0TA 1IQFA 1P02A 2ZDVH 2XYAA 1QL9A 4ISIH 5ESTE 2QXIA 2ZG0H 5E0HA 1EAIA 1CGJE 1K1PA 1O2SA 1HGTH 2ZFTA 4R0IA 1O2ZA 1ZOMA 4JZIA 2QIQA 1V2KT 1D3PB 3DUXH 2JH0D 1P3CA 2C8YB 4CRAA 3H7OA 1UTQA 3UNSA 2DE9A 1C1RA 3KHVA 1ACBE 4GUXA 2ESTE 5SGAE 6ESTA 2B9LA 1YC0A 2ZGCA 2C3SA 1HJAC 2J2UA 1H4WA 3A86A 2VIOA 1S82A 1GJ8B 3TK9A 4XFQA 1FDPA 5C1UA 2FOFA 2ZU3A 5C20A 1A7SA 1IQIA 1TE0A 5C5NA 1JRSA 2V0BA 1S83A 4DW2U 3EQ0H 1S84A 1C5YB 5A09A 1TNHA 2J34A 4WMEA 1PFXC 1FLEE 4U30A 4AGKA 3UWIA 1P2JA 1YP9A 2BX4A 1ZRBA 4A7IB 1G3CA 2P93A 1QB1A 1NFWA 1YM0A 1K1LA 2G4TA 1SGRE 2C8ZB 3P95A 4AG1A 4CRBA 2FOMB 2SNWA 1TFXA 1F92A 1UK2A 3BTQE 4IC6A 1C2MA 3P8FA 4AFSA 2BX3A 2EI6A 2ASUB 4JMYA 3E16B 4BAOB 4DT7B 1W11U 1W3CA 4D7FA 1P2NA 4H4FA 3MO3A 3AAUA 1BQYA 1ZHPA 3RXMA 4X6OA 1TOMH 1GJAB 1MTUA 4K60A 4IN2A 1HIAB 3ZVBA 1GI4A 3GYMA 1MD8A 1SMFE 2XW9A 2G51A 3GCTF 4CHAB 4CHAC 2OC0A 4FUEA 3UIRA 1ESTA 2STBE 1Y8TA 1DWDH 2V3HH 4K8BA 2BY5X 5HXFA 1KDQB 3QK1A 3F9HA 4JZ1A 3MH4A 2AGGX 1IQEA 1GJ5H 5E0GA 2FOGA 3VFEA 1ELAA 2Y5FA 4X2YA 4I32A 3M3TA 2CN0H 2ZDMA 4RSPA 3ZVCA 4YO9A 1CT0E 3G01A 1DT2A 4UFDH 2XTTB 3STJA 5DP8A 4DY7B 2OUAA 1XUIA 5C3NA 3NWUA 3Q77A 2G4UA 3GCHC 2J95A 2VH6A 3MNCA 3A89A 1VR1H 3ZVAA 7KMEH 4HFPB 1GI1A 3RXSA 1QTFA 2BD8A 1O2NA 1C2FA 4BXSA 1E35B 3GY3A 1TNJA 5TJXA 4TPYA 2ZFRH 3LONA 2BDHA 3HGNA 3PMAB 3LGUA 3KNXA 2ZCKP 3M7UA 2XBVA 3PYHA 1UHBB 1GHZA 5T6DA 2AFQB 2F9BH 2H6MA 1MAYA 4HTCH 1G3EA 1AHTH 3P92A 4OGXA 2VIPA 1L0ZA 3A81A 1D6RA 3I29A 1QB6A 3ZVFA 2BYAX 2GKVE 3SNEA 3KQDA 1DPOA 3LIWA 4XBDA 2VGCB 1ZHRA 8ESTE 2GCHG 1C1SA 1DSTA 2BTCE 1D6WA 1GWAA 4Q80A 3LGWA 4VGCB 1UTOA 1RFNA 1PQAA 2ZO3H 2ZDAH 5AVDA 4GCHF 1EPTA 1UCYH 1SGIB 3VB6A 4JZDH 1E38B 2PHBA 1SGDE 1PPZA 3MO9A 1O2GH 1W7XH 2OQUA 3TITA 3SJKA 2XNIA 4E06H 2W7UA 1NC6A 1B0EA 1THPB 4MTBA 2F91A 1F0SA 2R0LA 3A82A 5T6FA 3PMBB 2Z3EA 2HPQH 4I8LA 1KXBA 4Y71A 4NWKA 2NU2E 1H9IE 3M37A 2I6QA 1LPZB 1O3PB 1GJCB 1Q3XA 4X8VH 2ANWA 1UCYK 1OOKB 4YM9A 4UD9H 1C4U2 2ALPA 5GWZA 3M61U 3MU4A 2FOHA 4AYYB 4I7YH 4X1NU 2HNTE 2ZECA 1K1NA 1D3DB 1MKWK 1LHCH 3W94A 1FPCH 1O5DH 3SJOA 4TPIZ 4X6PA 4O9VA 2Y82A 1O33A 1FZZA 1SOTA 4A92A 5F8XA 2ZQ2A 1BRBE 4BAHB 5IDKA 1CHGA 2WUCA 1PQ7A 3FAOA 7GCHG 1V2QT 1OPHB 2RDLA 4CR9A 3RXRA 1Q2WA 2FS9A 1P10A 1DE7H 3VB4A 1P06A 2QF0A 1O3LA 3BN9A 4Y8XA 3L33A 5C1XA 1G2LA 1C5VA 2I6SA 4FUCA 1C2EA 3TGIE 3UREA 1SPJA 3P8NA 1GDQA 2BVSH 3SNAA 4MNVA 1GI3A 2ULLA 4K1SA 4UFEH 1WUNH 1Y3XA 2P3TB 4DJZB 1MTSA 3A7TA 2H9HA 3MTYA 4Y76A 1IAUA 1HB0B 1UJ1A 3BEUA 4AORA 2ZKSA 1FY4A 1EZQA 2ANKH 2BY9X 1SGQE 2HRVA 3GCNA 1C1PA 3RXDA 1INCA 1GMDG 3GY8A 3KQBA 1SFIA 3SBKA 4FUFA 3EAJA 1W14U 3A87A 1EX3A 4JK5A 1BTUA 2G00A 1O3BA 3F6UH 1LHGH 2FX4A 1GBHA 2TGDA 1G36A 1AWFH 1KXDA 1FI8A 1O2RA 2GT7A 1FAXA 1UTMA 2VB0A 3KQEA 2ZTYA 4BOHA 5FCRA 1AB9B 3GOVB 1GBBA 1LVYA 1KLIH 1O5FH 3DHKH 1QQUA 2FM2A 1V2ST 2W26A 1YLCA 1A5IA 2QC2A 1C4V2 1EJNA 2ZIQH 3A7XA 1UK3A 3A88A 3JZ1B 3QWCH 4GHQA 1OYQA 3TJOA 3NK8A 2UUJB 1NU7B 1Y3UA 1MKXH 5A0BA 5LPRA 2P3UB 2FMJA 3ZZBA 4MVNA 1GPZA 2O8LA 1TX7A 2ODYB 3RDZA 1UTLM 2VIWA 2A7HA 1FAKH 2ZU4A 1DS2E 5LPEA 1A46H 5DP4A 1W0YH 4WH8A 1P3EA 5ESBA 4YT7H 2VNTA 1P2KA 3FZDA 1TNKA 3ZZAA 3FP8E 5IYTA 1AIXH 1GMCG 1UVTH 1FIZA 1Y3VA 4UFGH 5EW1H 2J4IA 3ATMA 3BIUH 4WH6A 1HAYB 2RG3A 4R8TB 3QLPH 1EAUA 2D8WA 1MKXK 3RC6A 4NIYA 2OLGA 1J14A 1SSXA 5E8EH 1D9IA 1TWXB 2VVUA 4OS6A 2AIQA 5TCCA 2ZDNA 1YPJH 1NRSH 4YLUA 2BY8X 1PJPA 3R0FA 4NSYA 1O3KA 4ABHA 3A8CA 4ISNA 1RXPA 2FYRA 1LKBA 3TGKE 2JETB 1F5KU 5ABWA 1ZLRA 1YPEH 3LT3A 1TB6H 3SU6A 1ELGA 1C2LA 4NCYA 4CRFA 4FUGA 1T8NA 1ZHMA 4FUDA 4ZROA 3GICB 3SJ9A 3UQOA 3TK5A 3HGPA 2WPKS 2PKAB 4X1SU 3ATIA 2Y7XA 3QZRA 1TPOA 4ZKRU 5GDSH 1WQVH 1W8BH 2UWLA 3UQVA 3T26A 2BQ7B 1TOCB 6GCHG 4Y0ZE 3FP6E 1O2HA 1BTWA 2Z9IA 1BCUH 4MPXA 4OS5A 1DOJA 1TYNA 3MFJA 1ZSJA 2QYIA 1EUFA 4YZUA 1KIGH 1GDUA 3MHWU 1RGQA 2XBYA 1W2KH 3E91A 1ZJKA 2ZCHP 2ALVA 1HAZB 3ZV9A 1JIMA 4FU8A 1C1VH 1FNIA 1DDJA 1MTNB 3TIUA 1HFDA 1JRTA 5L6NH 3E6PH 2SGEE 1GBTA 1O5BB 4I8KA 4ABDA 2Z9KA 5T6GA 9ESTA 2IN2A 1TGBA 5DKMA 1SB1H 1TLDA 4FVDA 1ZSKA 5GPIB 3MYWA 4O3TA 2LPRA 3RXFA 1YLDA 3UFAA 1ZJDA 1D3QB 2UWPA 3PTBA 4IW4E 3GY2A 3QDZB 1FQ3A 4HZHA 1IQLA 1UVSH 1SLXB 5FHTA 1MQ6A 4KTCA 2F9PA 4NIVA 2LNCA 2BDGA 1LHEH 4ABFA 1KXAA 3SGQE 4B76A 2G52A 3KL6A 4BTUB 4JYUH 4RN6A 1QR3E 3PWBA 2D1JA 1QHRB 1LQEA 4IGDA 2P16A 1YPMH 2ANYA 2FXRA 2F9UA 2ZI2H 3QZQA 3URCA 2XCNA 1SFQB 4Y10E 5F03A 3P8GA 1GMDF 1A3EH 3VEQB 5JBCS 3F1SB 1RIWC 3ZV8A 1KXFA 3W95A 5DP9A 1HXFH 2W5EA 3PV4A 7ESTE 4DCDA 2PR3A 4ASHA 4TWYA 1GMHG 1UVUH 1IQHA 1YCPH 2PGQB 2IJOB 1DY9A 2XWAA 2FOEA 2CJIA 2ZF0H 2F9OA 3TNSA 1V2TT 3F68H 2BOKA 2O8UA 5L2YH 1PPFE 4ZH8A 1THRH 3M35A 3RUOA 3KIDU 4JYTA 1BOQA 1A5GH 1O2VA 1QBOA 1T7CA 5DK1A 5JBAS 2B7DH 1G3DA 1PPGE 2TRMA 2ZU5A 1O3FA 1NRRH 2XBXA 4K2YA 3LGYA 2BOHB 1GJ9B 2NU0E 1GHXH 1MBMA 2ZGHA 1OWKA 4X1RU 2FIRH 3A8DA 1TONA 1AQ7A 2Q6GA 2CHAB 2CHAC 2VWOA 5GJ4B 5GCHG 1O2IA 1WTGH 1ELEE 5LPFA 3A83A 1BBRK 1EXFA 4KTSA 2NWNA 1K9OE 2R3YA 3A7ZA 1N6XA 1O5AB 1SQOA 2HOBA 4MQAA 1T8OA 1HAOH 3U98H 1O39A 1TPAE 1X7AC 3SU1A 1OWHA 2GTBA 4K1TA 2A4QA 1XUJA 1EOJA 3V3MA 1V2RT 3AW1A 2CGAA 4BAKB 3MNXA 3RXTA 4ABEA 3HK3B 2UWOA 3OY5U 1KXCA 3RXQA 6CHAC 4ZKOU 2BZ6H 1E34B 1P05A 1XMNB 3BTTE 4B74A 1EP5A 1HJAB 1IQGA 1QFKH 1IQNA 2Q1JA 2XRCA 4CRCA 1C5OH 1TNIA 4U01A 1SGFG 3BG8A 1J9CH 2VU8E 4NZLA 1GHBG 1BA8B 1O38A 4X2WA 3RLYH 3TNTA 1CA8B 3RXHA 3TH2H 2VIQA 3T62A 1NESE 3PO1C 1HAPH 2AIPA 3BG4C 3RXLA 1SGYE 1MAXA 4IS5A 1L1JA 1O3EA 2Y80A 1RS0A 2BVXH 3F9FA 1ZRKA 3A7VA 1YPHE 1BTHH 4B71A 3ODFA 1E36B 4INHA 1NFXA 5L30H 4ABBA 1PYTD 4FUHA 3BTHE 1JWTA 2VIVA 3TU7H 2ODPA 2J9NA 4LOYH 3IWMA 4MNYA 1E37B 4Q7YA 4AG2A 4CH2B 1LMWB 1OP8A 3SORA 3DFJA 4MLFB 3Q3YA 3UR9A 4WVPE 2XXLA 4B1TA 1CO7E 2OCVB 5T3HA 1AU8A 4E05H 3A85A 1GJBB 2Y81A 3GISB 1TPPA 3SUEA 1F2SE 2SGQE 1CHOG 2WUBA 1GI8B 2AGIX 2FEQH 2EI8A 1QRXA 2BQWB 1C5MD 1HAGE 1LO6A 4Y7AA 2VIDA 4JK6A 1KTTB 1XKBC 1DLKB 3SNBA 2A1DB 2W3IA 2A4RA 1L1GA 1P2IA 2BD9A 1G3BA 3A8BA 4XSKU 3SU4A 4NA7A 1NPMA 1SGNE 2BXTH 2FLBH 4CR5A 1YGCH 4UONA 4AB9A 2V3OH 4INKA 2VWNA 3OSYA 2OINA 3M7QA 1HCGA 1TA6A 2ZU1A 4FXGH 4GPGA 3EDXB 3QO6A 5C1YA 4DVAU 4Y11E
chains in the Genus database with same CATH superfamily
3N7OA 4M9FA 4K8YA 2BVRH 3C27B 4DIHH 1ELFA 1SQAA 3GCHB 1QNJA 5EG4A 1A5HA 1MCVA 2PFEA 1S81A 3KYFA 3WWBA 1SQRA 1BTPA 3Q3KA 3M5LA 1W12U 2HLCA 3RXBA 3NCLA 3RXCA 3VGCC 3OYPA 1QB9A 5E0JA 4AN7A 2EQNA 2ZZUH 3NKKA 1BHXF 3SQEE 5JB9S 1C2HA 2J94A 2PKSC 2PKSB 2AMDA 4BTTB 1NT1A 4WWYA 1FN8A 2BLVA 1EKBB 2PWXA 2FOBA 2A5KA 3SV8A 4ZXYH 2M2AA 2FYQA 2YNAA 4BAMB 1LPKB 1YLNA 4INLA 4OS7A 1WAYB 2WZQA 3EGKH 1K1MA 1OYTH 3SZNA 1FIWA 1VITG 1SOZA 2OXSA 3T25A 1ESAA 4LZ4B 2RFKC 1XX9A 8KME2 3ZVGA 3S9BA 4U2WA 4IMQA 5FXLA 5HKKD 1GI7B 2TBSA 1GBDA 2W7SA 1SVPA 1GG6C 1EAXA 5B6LA 1K22H 5A8YA 3SI3H 2HLDD 3RC5A 1XKAC 1GHAF 1O0DH 2QA9E 3S0NA 1ANBA 1HJ9A 2RA0A 3B9FH 3MH7A 1AN1E 4RKJB 2PUQH 2OBQA 1H8ED 2QXJA 1TNLA 5F8TA 3MWIU 1Z7KA 1P01A 1P09A 2ZHQH 1UCYE 4JCNA 3OU0A 3KEEA 3GDUA 3P6ZB 3SUFA 2L6OA 5GCHF 2O9QA 3RLWH 1WU1A 4HGCA 2FS8A 3AAVA 3MH6A 4O97A 3LH1A 1O3HA 1ANDA 1TALA 1OWIA 1M9UA 1T32A 1O3CA 2A7CA 2OC8A 1O5GH 1FUJA 1TA2A 1DM4B 3B8JA 1P0SH 2EC9H 1WV7H 4FUBA 1O5EH 2Z94A 1GBEA 2PKAA 4ESTE 3MU1A 5C67A 1DSUA 1QL7A 2Y6TA 1U6QA 1RTFB 2ZWLH 1P03A 2H2ZA 2ZPQA 3PWCA 3FVFB 1O3MA 1DFPA 3SJ8A 3UNRA 3NRLA 3RXAA 4JZEH 4Y8ZA 2ZCLP 1H8DH 1XUHA 1G2MA 3SV9A 2Y5HA 3PLBA 1NU9A 3T5FH 1JMOH 3N99A 3OFND 4Q7XA 1RTLA 2BZAA 1SGEE 3SHAH 3M7TA 1Z8IB 2A5IA 1O34A 3T27A 3RXUA 1T31A 3U28C 5F6MA 4AC9A 2RA3A 1P9UA 1AO5A 2Z9GA 3TK6A 1EJMA 4U32A 1GVLA 3H09A 1PQ8A 3SV2H 1SLUB 1UK4A 1P2MA 1QJ7B 4JZFH 1JBUH 1MH0A 2BD7A 1O2PA 2BMGB 3OX7U 1YPLH 3ITIA 5L2ZH 4X8TH 5AFYH 1FPHH 4ACAA 2ZU2A 4F55A 4YOJA 5K0HA 5HYOA 1ZTLA 3ZZ4A 1O3OA 2C4FH 2WV4A 5EXMA 3V12A 3RXIA 2QE7D 4NA9H 2CXVA 3ENSB 2OBOA 4XE4A 4MNXA 4ABGA 1Z8RA 1PPHE 2BDYA 1GDNA 1NM6A 1CGHA 1C1UH 1A61H 4TYDA 1BTYA 1ZSLA 2ZPRA 3K65B 1LQDB 2WYJA 4BXWA 2P95A 1V2UT 2ZFFH 1D3TB 1WOFA 1EOLA 4YLQH 1RD3B 4MPWA 2H9TH 2R2WU 2V6NA 5K7RA 3E0NB 3Q00A 1MQ5A 1TNGA 9LPRA 1KTSB 1HUTH 3RXPA 1TPSA 1AUJA 2ZDLA 2TPIZ 4RKOB 5KECA 3F2GA 3EYDA 1BHXB 4YOGA 3QTVH 5CHAC 5FAHA 3SI4H 1O2JA 1ARBA 4OGYA 5LGOA 1QA0A 1MBQA 1CA0C 2TGPZ 1PQ5A 2FLRH 1GI6A 3K9XB 3TH3H 2G5VA 4YTAA 2P8OB 2P8OC 1IHTH 1CT4E 2AMPA 1ZMJA 2KCAA 1Z8JB 4X1QU 2A32A 1GVZA 4THNH 4ISHH 3SU5A 1SLVB 1V3XA 4Y6DA 1O37A 4BNRA 2WINI 1Z1JA 1TGTA 2XC4A 2Q6FA 5HM2A 1IHSH 1O2YA 4FU9A 5JDUB 2Z7FE 4MNWA 4WMFA 4E7NA 2ZQ1A 3BTFE 3CNRA 2ILNA 3PMJA 2A2QH 3RXEA 2J92A 1MTVA 1UVOA 4AOQA 1TABE 1RRKA 1P04A 2J97A 1V2OT 1C9TA 1ZPBA 1VJAU 1C5SA 3DD2H 1L4ZA 3KQ5A 4YOIA 1NRQH 3OEHD 1P9SA 4OM9A 1AY6H 4Q2KA 3BTKE 4Y8YA 5GIBA 5EXLA 5DP6A 1MU6B 1BUIA 2KX4A 2D26C 3SGBE 2GCHF 1DWCH 1OP0A 4K1EA 1TIOA 3LU9B 3SV6A 1BMMH 1O3IA 2P3FH 1N8OC 1KSNA 1BMNH 2ZTXA 4DIIH 2FWWA 1N6YA 1PYTC 2WPMS 1WDIA 4CREA 1PPEE 4WY3A 5EPNA 1EASA 2AERH 4GVUA 1LCYA 3ESTA 5DG6A 5C17A 3GY7A 1C2IA 2Z3CA 3FANA 1YPKH 1VGCC 1NBME 5E2PA 1AZ8A 1Y5AT 2Q6DA 1EPTC 4B2CA 1BJVA 3EA9A 3PB1E 4NGAH 1BMAA 2ZGBH 2BM2A 1J15A 1Y5BT 2O8WA 3NPSA 2XCFA 4ABAA 1CT2E 1F5RA 3UOUA 1V2JT 3M5OA 5DGJA 1DWBH 5GXPA 3SGAE 1C5PA 1NO9H 3TJUA 4UE7H 1BT7A 2BY7X 3KCGH 3RC4A 1C5QA 1TBZH 4I8JA 1EQ9A 4X1PU 3GCOA 4Q4LA 4KGAA 1Y3YA 2ZA5A 1G37A 3T29A 2BLOA 4OS1A 4D9QA 1NROH 3TGJE 2BDAA 3HKIB 4UFFH 5ETXA 3KGPA 1Z71A 2HWLB 2JKHA 1V6DA 3C1KA 1QY6A 1Y59T 5FPSA 2V3MA 1NRPH 1ELVA 2A4OA 2AMQA 1OX1A 3U9AH 2A4GA 1HLTH 2DUCA 1YBWA 3S69A 7GCHF 4NFFA 3ATKA 1TBRH 1K21H 1FY8E 4MDSA 4AFUA 1DLEA 1P12E 2JH6D 2PW8H 2QXGA 3MH5A 3A84A 3FFGA 4AYVB 1XXDA 3RMOH 2OC7A 1C9PA 4DGJA 2BD5A 3MOCA 1AE8H 1NFUA 3MQKC 4X2VA 3OAAD 3U69H 1IOEA 1SQTA 2IOTA 1H1BA 3U8TH 1AGJA 2UUFB 1TMBH 3HATH 2P94A 1GGDC 4F4OC 2FTMA 1TRYA 5A8ZA 4AGJA 2W3KA 4AFZA 1V2MT 1TRMA 1HBTH 1O2QA 1QURH 2FPZA 5DJ7A 1AFQC 3UWJH 1ORFA 2FP7B 1BJUA 3PLPA 4H6TA 1P57B 1QCPA 1PPCE 1T8LA 3V7TA 3SYJA 1XVOA 1D4PB 1ZTKA 2HALA 1RIWB 2BDBA 2GCTC 1EAWA 4B2BA 3LJOA 1NZQH 2VVCA 4CBNA 1O35A 4ZAEA 2DE8A 5FCKA 2HVYB 1Y5UT 3JZ2B 4P02A 3OY6U 1BB0B 2WV9A 1BBRE 1DXPA 1VZQH 1J17T 4Y0YE 3QUMP 1H8HD 3PV5A 3QTOH 1ELCA 4F49A 1Y3WA 1WQSA 3QX5H 3AW0A 5EQRA 5F8ZA 1TBQH 1NBMD 2P59A 2F83A 1JXPA 2R3UA 1QRWA 1O2MA 2AHME 1HAVA 2A0QB 5A2MH 3S9AA 1O3GA 4GHTA 1W7GH 4MG3A 3T28A 1LPGB 3PRBA 2FI4E 1NN6A 5FBIA 2C93B 1EB1H 1H8IH 4BTIB 1TX8A 3VB5A 1SG8B 2FODA 3EE0B 3V0XA 1YPGH 5EODA 1YCPK 2O8MA 2WPDD 2ZFPH 4HI3A 2PLXA 1HAHH 4IBLH 4AFQA 2VWLA 2XWBI 4K69A 3N7EA 1MTWA 2ZP0H 1WTHD 3RXGA 2BDCA 8LPRA 4F48B 1GMCF 1YY3A 1LHDH 4GCHG 3ZZ5A 2AS9A 1YF4A 3U1IB 1ESBA 1O2KA 1GBFA 3VB3A 1AD8H 2NU1E 2XC5A 4J1YA 3PLKA 4NA8A 2EY4C 2FOCA 3DA9B 2R2MB 1HDTH 1XVMA 2EI7A 4ACBA 3KF2A 3LOXA 6CHAB 5EW2H 3RMNH 1FMGA 3T2NA 1HYLA 1ARCA 1LKAA 1VCWA 2O8TA 2J98B 1BZXE 1GBIA 2PSXA 3K6ZA 3A80A 4X8UH 1S5SA 5JB8S 5LH8A 1UO6A 3TJNA 4IC5A 5C2ZA 1C5TA 1TGCA 4DOQA 5CE1A 3HKJB 3S9CA 4J2YB 1NY22 1C5XB 2RDEA 2ZFSA 3FOAA 1K2I1 1ID5H 1P11E 3PO1B 5FBEA 2OC1A 2PGBB 1OWEA 1S0QA 2WPJS 2VH0A 4MPUA 3BG4B 1OP2A 1RTKA 4I8HA 2ZHDA 3RMLH 1O3NA 2TGAA 5EJZA 1E1QD 2OD3B 1C2KA 3S7HB 5G4BA 3MI4A 5FX5A 1N1LA 2L74A 3HK6B 2NU3E 6GCHF 5GNDA 2JJ2D 1FY5A 5H4IB 2UUYA 4ZHAA 5FPYA 2BD3A 1OWJA 3DT0H 1CGIE 1W10U 4ZKNU 2GGVB 1C1QA 3CS7A 5B6OA 3M3VA 2F9VA 2FO9A 2WPLS 4D8NA 1KMHB 3SNCA 4CBOA 4M7GA 4D9RA 1MABB 2A5AA 1DUAA 4ASUD 3BEFB 5A0CA 1TGSZ 3CS0A 1O2UA 3PROA 1SL3A 2G81E 1AVXA 1ABIH 1SI5H 3HPTB 1VCQA 3ZYDA 1ETTH 3P70B 2WPHS 1QA7A 1HXEH 2B8OH 1GBCA 2QY0B 3UOPA 5DN6D 3E8LA 1BDAA 1C2DA 3RXVA 5A8XA 3GY4A 2QV1A 3LDXH 2QN5T 3MU5A 4A1TA 3STIA 1VITH 1ZR0A 1XUFA 5HMAA 3ZZDA 2GZ8A 5FX6A 2KFWA 1TQ7B 1LVBA 3H7TA 3TLOA 3LC5A 2GX4A 3OTPA 2IJD1 3A8AA 1AMHA 1ZGIA 4A1XA 3U8RH 3FO8D 2TGTA 1MMJN 5HM9A 3BV9B 1SGTA 1T8MA 1A4WH 4UEHH 1EZUC 2ZHEH 5E2OA 2HNTC 1S85A 4TY7A 2CF9H 3U8OH 3E3TA 3GS9A 3SV7A 3TH4H 1SLWB 1YKTA 1Z1IA 1HNEE 3MO6A 3ZVDA 1SHHB 3MU8A 3UUZA 4ZUHA 1BIOA 1L1NA 5EQQA 3M5NA 3VGCB 2WHXA 1GBKA 1P8VC 2Z9JA 4K3JA 1DITH 1Q31A 1CBWC 1CBWB 1GL0E 3SQHE 1HPGA 1K1OA 1DY8A 1GJDB 1O2TA 2VJ1A 3ZZ3A 2HVXA 4K5ZA 3UY9A 1F7ZA 1C1WH 4ABIA 3RP2A 1GMHF 1T4UH 1GBMA 1JOUB 3MU0A 4D7GA 3BTDE 4BANB 2AEIH 2BXUH 2RCEA 3GYLB 3IG6B 5EXNA 1GJ6A 1V2PT 1MU8B 3F9EA 3VXFH 1GI9B 3VB7A 1C1OA 1H9HE 1O3JA 3M36A 1AWHB 4LK4A 3O8BA 1OS8A 1HAVB 1BITA 1GG6B 1G9IE 1DXWA 2KM0A 3UB0A 2Z6BD 3F3BA 2G5NA 1EJAA 3CENA 3SN8A 1SHYA 4OS2A 3I78A 1P2QA 1QIXB 1C5RA 5EJ1A 3I77A 2QGRA 3CP7A 1HRTH 2SGPE 1ZZZA 5JBTA 2PP6A 1THSH 3K2UA 2VGCC 1QRZA 3E90B 3H5CB 1UMAH 2ZHWH 4OS4A 2FI3E 4PROA 3RU4E 4I33A 4VGCC 3SU0A 2CMYA 1ELDE 1SGFA 2V7QD 3Q76A 1TQ0B 2C90B 1C1TA 2BLWA 2YOLA 4XOJA 3ZZ9A 2OP9A 3RXOA 2GD4B 4NWLA 4FVBA 1UTPA 5F53A 1QGFA 1Z6JH 2C8WB 3PM3A 1B5GH 4FOUC 1MKWH 3O8DA 4O03A 5JPMH 2ZGXH 2BY6X 2GZ9A 2H5DA 4KTUA 1OWDA 5J4SA 3ZYEA 2YMSD 1BMLA 1GHBF 1NFYA 3DFLA 1ETSH 4KP0A 2W6ID 2THFB 1S6FA 2B5TB 1E79D 2BLQA 2WV5A 2VINA 1SR5C 2QCYA 1TRNA 2H1UA 4XDEA 1O3AA 4O3UA 1AUTC 1H9LB 3V13A 2KAIA 3OE7D 3TVJB 4WF8A 1AVGH 4XBCA 1IQJA 3K6YA 1DANH 1BRCE 4LXBH 4JYVH 3D62A 3P8OA 3RXKA 4D76A 1TAWA 8GCHG 2FDAA 2ZEBA 4I31A 3LJJA 3P17H 3U1JB 2FTLE 2GMTB 2GMTC 4SGBE 3GDSA 4FUIA 3RM0H 1VCPA 2A2XH 1EZSC 2GP9B 3UR6A 2H9EH 1AZZA 1KYNA 5EPYA 1GHWH 1OSSA 2XBWA 5EQSA 3BTEE 2QF3A 5JBBS 3ZZ6A 2AGEX 3BF6H 4H42U 2F3CE 1DWEH 1QBVH 3LPRA 2OQ5A 1KLJH 2EEKA 2ODQA 1DVAH 1GJ4H 5BPEA 1QJ1B 1TMUH 3M3SA 1CHOF 1GVKB 5I46H 2WPIS 1ZGVA 5C5OA 5A0AE 2BQ6B 1WCZA 1C5LH 4B2AA 3RMMH 4UDWH 1EZXC 3ATLA 2SNVA 1B7XB 1A2CH 2HGTH 4GLYA 5EOKA 2FI5E 1Z6EA 1YCPM 1DUEA 3SOSA 1FJSA 1UTNA 2PTCE 3EA7A 4NZQA 1C1MA 1O2WA 1E0FD 1NTPA 2C8XB 5CHAB 2XOKD 1Z8GA 1AVWA 1GBJA 1ZPZA 4WMDA 1BRUP 5TCAA 1A3BH 1CA0B 1IQMA 5DSFA 3WY8A 2W6JD 3AASA 3FP7E 4X6NA 5DP3A 4B75A 1XXFA 3QGJA 1CSOE 1ZTJA 3RU4D 4DURA 4B73A 2ZNKH 1AKSA 1HAIH 1KLTA 1O31A 2PV9B 1GHYH 1ANEA 2FOAA 5DP7A 1AB9C 2LELA 3O8RA 1NRNH 1XUGA 1UTJA 1W13U 1A0JA 1RJXB 5DP5A 1WYKA 3DSGA 2CK3D 2GZ7A 4FUJA 2A45B 1SC8U 2GV6A 1W0ZU 4RT1A 2JH5D 2ANMH 3SO3A 2NU4E 5EU8A 4Y79A 1ZYOA 1LTOA 1TMTH 1G32B 1BTZA 3BTME 1ETRH 3RXJA 4A6LA 3LGTA 1A0LA 1GHVH 1V2LT 4NIXA 4Z6AH 1VITF 1CU1A 4A1VA 1AI8H 2GVFA 4TY6A 1G30B 4QT8C 1FY1A 2WYGA 4ZHMU 3LGVA 1A0HB 5EGMA 2QAAA 3SU3A 2SGAA 2BD4A 2UUKB 3B23B 3SNDA 3LH3A 1FONA 1FY3A 1CVWH 2VBCA 2ZHFH 4NG9H 4CRDA 1K0HA 2A31A 1ELBA 3EA8A 2J38A 2XNDD 2M5TA 2VWMA 2J98A 4ZXXH 1O32A 1TGNA 1K28D 1N8OB 3NZIA 1F5LA 2BD2A 1QJ6B 1HV7A 1UVPA 1KY9A 3RU4T 1T4VH 1SGCA 4IMZA 3KN2A 1BTXA 1B0FA 1C2GA 1HJ8A 3ELAH 1K1IA 3BSQA 1A1RA 1VGCB 1MZAA 5JYIA 4WJG2 5DPAA 1V2WT 2TIOA 1EPTB 1F0UA 1GCDA 2VVVA 1TX6A 3QGNB 2F9NA 2Z9LA 3S7KB 1BRAA 3TJVA 3URDA 3MNSA 1SGPE 4I8GA 2OTVA 1OXGA 3IITA 1UTKA 3RM2H 3NUMA 5KGOA 2JETC 1L2EA 4AZ2B 2XC0A 3M5MA 2BB4A 6LPRA 4BAQB 2EA3A 1LVOA 2ZDKA 4TT3D 2H5CA 1KXEA 3E0PB 4Q7ZA 1ANCA 5DO4H 2CF8H 3BIVH 1AFEH 1OKXA 1C5UA 2GT8A 2SGDE 3F2FA 4X6MA 3VPKA 4TWWA 4ISLA 1ABJH 3SJIA 4KKDA 1EP6A 4MPVA 1PPBH 1V2NT 3UTUH 3ZVEA 3GY6A 1O30A 1SBWA 3QN7A 1J16A 4ABJA 2IPHA 3ATWA 1O2LA 1GI0A 5IK2D 2HPPH 1C1NA 4LZ1H 3LKWA 1JIRA 2KAIB 2ZFQH 1C4Y2 1F0RA 1GBLA 1OHHD 3F2HA 4X0WU 4ZKSU 2GV7A 3PMHB 4A5TS 2ZPSA 1DX5M 5I25A 1GBAA 3SW2B 3LGIA 2Y5GA 4Z0KA 3ZZ7A 4DG4A 2PTNA 1C5WB 1IQKA 8GCHF 1C2JA 1HIAA 1LVMA 1ZMLA 4ZHLU 1P2OA 1MTNC 3SUGA 5J4QA 3ODDA 3GCTG 1GI2A 4WXVA 4X2XA 3L3TA 4FU7A 3BEIB 1HAXB 1FXYA 2QXHA 3F9GA 3AK5A 1FN6A 2FZZA 1MZDA 4GAWA 4Y7BA 4YT6H 3O8CA 3AVZA 2BHGA 3BTWE 1LDTT 3OEED 1FV9A 2R0KA 2BDIA 3A7YA 1KDQA 1XM1A 1O2XA 2CV3A 1GGDB 1O3DA 1CE5A 4NFEA 3FZZA 3D23A 1AFQB 3GDVA 4IN1A 3ZZ8A 4CH8B 3PV2A 3FKSD 4YESB 1GCTB 1GCTC 3SHCH 2JIZD 2YNBA 2AYWA 2ZC9H 1CQQA 3D65E 1EB2A 4AB8A 1GI5A 1NS3A 2GCTB 5AFZH 4KELA 7LPRA 1BMFD 3L6PA 3SUDA 2Z3DA 3MNBA 2Y7ZA 4ZMAH 1QZ8A 4ISOA 1C5NH 3BTGE 1YPHC 1GL1A 3ZZCA 1O2OA 2HNTF 2PSYA 3UAIC 5AF9H 2AH4X 1MUEB 4WXIA 1GJ7B 2GDDA 1QQ4A 2SFAA 3UPEA 1EATA 1ZPCA 3LC3A 1XUKA 5CMXH 5BRRE 2G55A 1J8AA 4SGAE 2SGFE 4FETA 3KQCA 1AKSB 1C5ZB 2STAE 1O36A 4H6SB 2ZTZA 5PTPA 5FPTA 1S6HA 1QL8A 1UHBA 3VXEH 1ELTA 1S0RA 3NXPA 1L4DA 3UNQA 1K1JA 3PTNA 5HIZA 4E7RG 1BBRH 1AE5A 3WW7A 2A7JA 2D2DA 2K1QA 1QBNA 5AHGH 4X8SH 4NSVA 3GY5A 4AX9H 2B0FA 1V2VT 1MD7A 2ZGJA 2PUXB 4CRGA 1LHFH 2GDEH 2R9PA 4NIWA 4YXWD 5HGGA 2FX6A 1DICA 1GHAG 1O5CB 1YYY1 2YMSC 1W0KD 3OTJE 3R3GB 2G8TA 4XBBA 1MCTA 3MMGA 4GSOA 3E1XB 3SU2A 1WBGB 3D49H 3TPIZ 2V35A 1WSSH 3A7WA 4Z1MD 3Q3XA 2FESH 1VJ9U 1ZMNA 1F0TA 1IQFA 1P02A 2ZDVH 2XYAA 1QL9A 4ISIH 5ESTE 2QXIA 2ZG0H 5E0HA 1EAIA 1CGJE 1K1PA 1O2SA 1HGTH 2ZFTA 4R0IA 1O2ZA 1ZOMA 4JZIA 3SZEA 2QIQA 1V2KT 1D3PB 3DUXH 2JH0D 1P3CA 2C8YB 4CRAA 3H7OA 5C0UA 1UTQA 3UNSA 2DE9A 3DCLA 1C1RA 3KHVA 1ACBE 4GUXA 2ESTE 5SGAE 6ESTA 2B9LA 1YC0A 2ZGCA 2C3SA 1HJAC 2J2UA 1H4WA 3A86A 2VIOA 1S82A 1GJ8B 3TK9A 4XFQA 1FDPA 5C1UA 2FOFA 2ZU3A 5C20A 4HG6A 4P00A 1A7SA 1IQIA 1TE0A 5C5NA 1JRSA 2V0BA 1S83A 4DW2U 5T1VA 3EQ0H 1S84A 1C5YB 5A09A 1TNHA 2J34A 4WMEA 1PFXC 1FLEE 4U30A 4AGKA 3UWIA 1P2JA 1YP9A 2BX4A 1ZRBA 4A7IB 1G3CA 2P93A 1QB1A 1NFWA 1YM0A 2K8IA 1K1LA 2G4TA 1SGRE 2C8ZB 3P95A 4AG1A 4CRBA 2FOMB 2SNWA 1TFXA 1F92A 1UK2A 3BTQE 4IC6A 1C2MA 3P8FA 4AFSA 2BX3A 1E1RD 1UW7A 2EI6A 2ASUB 4JMYA 3E16B 4BAOB 4DT7B 1W11U 1W3CA 3WWFA 4D7FA 1P2NA 4H4FA 3MO3A 3AAUA 1BQYA 1ZHPA 3RXMA 4X6OA 1TOMH 1GJAB 1MTUA 4K60A 4IN2A 1HIAB 3ZVBA 1GI4A 3GYMA 5HIYA 1MD8A 1SMFE 1FX0B 2XW9A 2G51A 3GCTF 4CHAB 4CHAC 2OC0A 4FUEA 3UIRA 1ESTA 2KCPA 2STBE 3KYGA 1Y8TA 1DWDH 2V3HH 4K8BA 2BY5X 5HXFA 1KDQB 1W0JD 3F9HA 3QK1A 4JZ1A 3MH4A 2AGGX 1IQEA 1GJ5H 5E0GA 2FOGA 3VFEA 1ELAA 2Y5FA 3EE7A 4X2YA 4I32A 3M3TA 2CN0H 2ZDMA 4RSPA 3ZVCA 4YO9A 1CT0E 3G01A 1DT2A 4UFDH 2XTTB 3STJA 5DP8A 4DY7B 2OUAA 1XUIA 5C3NA 3NWUA 3Q77A 2G4UA 3GCHC 2J95A 2VH6A 3MNCA 3A89A 1VR1H 3ZVAA 1YWUA 4HFPB 7KMEH 1GI1A 3RXSA 1QTFA 2BD8A 1O2NA 1C2FA 4BXSA 1E35B 3GY3A 1TNJA 5TJXA 4TPYA 2ZFRH 3LONA 2BDHA 3HGNA 3PMAB 3LGUA 3KNXA 2ZCKP 3M7UA 2XBVA 2JDID 3PYHA 1UHBB 1GHZA 5T6DA 2AFQB 2F9BH 2H6MA 1MAYA 4HTCH 1G3EA 3DSPA 1AHTH 3P92A 4OGXA 2VIPA 2WSSD 1L0ZA 3PRDA 3A81A 1D6RA 3I29A 1QB6A 3ZVFA 5CDFE 2BYAX 2GKVE 3SNEA 3KQDA 1DPOA 3LIWA 4XBDA 2VGCB 1ZHRA 8ESTE 2GCHG 1C1SA 1DSTA 2BTCE 1D6WA 1GWAA 4Q80A 3LGWA 4VGCB 1UTOA 1RFNA 1PQAA 2ZO3H 2ZDAH 5AVDA 4GCHF 1EPTA 1UCYH 1SGIB 3VB6A 4JZDH 1E38B 2PHBA 1SGDE 1PPZA 3MO9A 1O2GH 1W7XH 2OQUA 3TITA 3SJKA 2XNIA 4E06H 2W7UA 1NC6A 1B0EA 1EFRD 1THPB 4MTBA 2F91A 1F0SA 2R0LA 3A82A 5T6FA 3PMBB 2Z3EA 2HPQH 4I8LA 1KXBA 4Y71A 4NWKA 2NU2E 4RT0A 1H9IE 3M37A 2I6QA 1LPZB 1O3PB 1GJCB 1Q3XA 4X8VH 2ANWA 1UCYK 1OOKB 4YM9A 4UD9H 1C4U2 2ALPA 5GWZA 3M61U 3MU4A 2FOHA 4AYYB 4I7YH 4X1NU 2KCOA 2HNTE 2ZECA 2F4LA 1K1NA 1D3DB 1MKWK 1LHCH 3W94A 1FPCH 1O5DH 3SJOA 4TPIZ 4X6PA 4O9VA 2Y82A 1O33A 1FZZA 1SOTA 4A92A 5F8XA 2ZQ2A 1BRBE 4BAHB 5IDKA 1CHGA 2WUCA 1PQ7A 3FAOA 7GCHG 1V2QT 1OPHB 2RDLA 4XD7D 4CR9A 3RXRA 3ZIAD 1Q2WA 2FS9A 1P10A 5FL7D 1DE7H 3VB4A 1P06A 4B6FA 2QF0A 1O3LA 3BN9A 4Y8XA 3L33A 5C1XA 1G2LA 1C5VA 2I6SA 3VG8A 4ZCNA 4FUCA 1C2EA 3TGIE 3UREA 1SPJA 3P8NA 4DT4A 1GDQA 2BVSH 3SNAA 4MNVA 1GI3A 5EIYA 2ULLA 4K1SA 4UFEH 1WUNH 1Y3XA 2P3TB 2KZ4A 4DJZB 1MTSA 3A7TA 2H9HA 3MTYA 4Y76A 1IAUA 1HB0B 1UJ1A 3BEUA 4AORA 2ZKSA 1FY4A 1EZQA 2ANKH 2BY9X 1SGQE 2HRVA 3GCNA 1C1PA 3RXDA 1INCA 1GMDG 3GY8A 3KQBA 1SFIA 3SBKA 4FUFA 3EAJA 1W14U 3A87A 1EX3A 4JK5A 1BTUA 2G00A 1O3BA 4B6EA 3F6UH 1LHGH 2FX4A 2GJGA 1GBHA 2TGDA 1G36A 1AWFH 1KXDA 1FI8A 1O2RA 2GT7A 1FAXA 1UTMA 2VB0A 3KQEA 2ZTYA 4BOHA 5FCRA 1AB9B 3GOVB 1GBBA 1LVYA 1KLIH 1O5FH 3DHKH 1QQUA 2FM2A 1V2ST 2W26A 1YLCA 1A5IA 2QC2A 1C4V2 1EJNA 2ZIQH 3A7XA 1UK3A 3A88A 3JZ1B 3QWCH 4GHQA 1OYQA 3TJOA 3NK8A 2UUJB 1NU7B 1Y3UA 1MKXH 5A0BA 5LPRA 2P3UB 5CHBA 2FMJA 3ZZBA 4MVNA 1GPZA 2O8LA 1TX7A 2ODYB 3RDZA 1UTLM 2VIWA 2A7HA 1FAKH 2ZU4A 1DS2E 5LPEA 1A46H 5DP4A 1W0YH 4WH8A 1P3EA 5ESBA 4YT7H 2VNTA 1P2KA 3FZDA 1TNKA 3ZZAA 2K0QA 3FP8E 5IYTA 1AIXH 1GMCG 5C94A 1UVTH 1FIZA 1Y3VA 4UFGH 5EW1H 2J4IA 3ATMA 3BIUH 4WH6A 1HAYB 2RG3A 4R8TB 3QLPH 1EAUA 2D8WA 1MKXK 3RC6A 4NIYA 2OLGA 1J14A 1SSXA 5E8EH 1D9IA 1TWXB 2VVUA 4OS6A 2AIQA 5TCCA 2ZDNA 1S6LA 1YPJH 1NRSH 4YLUA 2BY8X 1PJPA 3R0FA 4NSYA 1O3KA 4ABHA 3A8CA 4ISNA 1RXPA 2FYRA 1LKBA 3TGKE 2JETB 1F5KU 5ABWA 1ZLRA 1YPEH 3LT3A 3F0PA 1TB6H 3SU6A 1ELGA 1C2LA 4NCYA 4CRFA 4FUGA 1T8NA 1ZHMA 4FUDA 4ZROA 3GICB 3SJ9A 3UQOA 3TK5A 3HGPA 2WPKS 5EJLA 2PKAB 4X1SU 3ATIA 2Y7XA 3QZRA 1TPOA 4ZKRU 5GDSH 1WQVH 1W8BH 2UWLA 3W1EA 3UQVA 3T26A 2BQ7B 1TOCB 6GCHG 4Y0ZE 3FP6E 1O2HA 1BTWA 2Z9IA 1BCUH 4MPXA 4OS5A 1COWD 1DOJA 1TYNA 3MFJA 1ZSJA 2QYIA 1EUFA 4YZUA 1KIGH 1GDUA 3MHWU 1RGQA 2XBYA 1W2KH 3E91A 1ZJKA 2ZCHP 2ALVA 1HAZB 3ZV9A 1JIMA 4FU8A 1C1VH 1FNIA 1DDJA 1MTNB 3TIUA 1HFDA 1JRTA 1VKYA 5L6NH 3E6PH 2SGEE 1GBTA 1O5BB 5C0TA 4I8KA 4ABDA 2Z9KA 5T6GA 9ESTA 2IN2A 1TGBA 5DKMA 1SB1H 1TLDA 4FVDA 1ZSKA 5GPIB 3MYWA 4O3TA 2LPRA 3RXFA 1YLDA 3UFAA 1ZJDA 1D3QB 2UWPA 3PTBA 4IW4E 3GY2A 3QDZB 1FQ3A 4HZHA 1IQLA 1UVSH 1SLXB 5FHTA 1MQ6A 4KTCA 2F9PA 4NIVA 2LNCA 2BDGA 1LHEH 4ABFA 1KXAA 3SGQE 4B76A 2QF5A 2G52A 3KL6A 4BTUB 1WXRA 4JYUH 4RN6A 1QR3E 2KR7A 3PWBA 2D1JA 1QHRB 1LQEA 4IGDA 2P16A 1YPMH 4TSFD 2ANYA 2FXRA 2F9UA 2ZI2H 3QZQA 3URCA 2XCNA 2F43B 1SFQB 4RI0A 4Y10E 5F03A 3P8GA 1GMDF 1A3EH 3VEQB 5JBCS 3F1SB 1RIWC 4XRNA 3ZV8A 1KXFA 3W95A 5DP9A 1HXFH 2W5EA 3PV4A 7ESTE 4DCDA 2PR3A 3DSOA 4ASHA 4TWYA 1GMHG 1UVUH 1IQHA 1YCPH 2PGQB 2IJOB 1DY9A 2XWAA 2FOEA 2CJIA 2ZF0H 2F9OA 3TNSA 1V2TT 3F68H 2BOKA 2O8UA 5L2YH 1PPFE 4ZH8A 1THRH 3M35A 3RUOA 3KIDU 4JYTA 1BOQA 1A5GH 1O2VA 1QBOA 5KEDA 1T7CA 5DK1A 5JBAS 2B7DH 1G3DA 1PPGE 2TRMA 2ZU5A 2YMSB 1O3FA 1NRRH 2XBXA 4K2YA 2J5UA 2JJ1D 3LGYA 2BOHB 1GJ9B 2NU0E 1GHXH 1MBMA 2ZGHA 1OWKA 4X1RU 2FIRH 3A8DA 2QF4A 1TONA 1AQ7A 2Q6GA 2CHAB 2CHAC 2VWOA 5GJ4B 5GCHG 1O2IA 1WTGH 1ELEE 5LPFA 3A83A 1BBRK 1EXFA 4KTSA 2NWNA 1K9OE 2R3YA 3A7ZA 1N6XA 1O5AB 1SQOA 2HOBA 4MQAA 1T8OA 1HAOH 3U98H 1O39A 1TPAE 1X7AC 3SU1A 1OWHA 2GTBA 4K1TA 2A4QA 1XUJA 1EOJA 3V3MA 1V2RT 3AW1A 2CGAA 4BAKB 3MNXA 3RXTA 4ABEA 3HK3B 2UWOA 3OY5U 1KXCA 3RXQA 6CHAC 4ZKOU 2BZ6H 1E34B 1P05A 1XMNB 3BTTE 4B74A 1EP5A 1HJAB 4Q63A 1IQGA 1QFKH 1IQNA 2Q1JA 2XRCA 4CRCA 1C5OH 1TNIA 3N7DA 4U01A 1SGFG 3BG8A 1J9CH 2VU8E 4NZLA 3F0OA 1GHBG 3FN8A 1BA8B 1O38A 4X2WA 3RLYH 3TNTA 1CA8B 1SKYE 2LP6A 3RXHA 3TH2H 2VIQA 3T62A 1NESE 3PO1C 1HAPH 2AIPA 3BG4C 3RXLA 1SGYE 1MAXA 4IS5A 1L1JA 1O3EA 2Y80A 1RS0A 2BVXH 3F9FA 1ZRKA 3A7VA 1YPHE 1BTHH 4B71A 3ODFA 1E36B 4INHA 1NFXA 5L30H 4ABBA 1PYTD 4FUHA 3BTHE 1JWTA 2VIVA 3TU7H 2ODPA 2J9NA 4LOYH 3IWMA 4MNYA 1E37B 2IPQX 4Q7YA 4AG2A 4CH2B 1LMWB 1OP8A 3SORA 3DFJA 4MLFB 3Q3YA 3UR9A 4WVPE 2XXLA 4B1TA 1CO7E 2OCVB 5T3HA 1AU8A 2OK5A 3A85A 1GJBB 2Y81A 4E05H 3GISB 1TPPA 3SUEA 1F2SE 2SGQE 1CHOG 2WUBA 1GI8B 2AGIX 2FEQH 2EI8A 1QRXA 2BQWB 1C5MD 1HAGE 1LO6A 4Y7AA 2VIDA 4JK6A 1KTTB 1XKBC 1DLKB 3SNBA 2A1DB 2W3IA 2A4RA 1L1GA 1P2IA 2BD9A 1G3BA 3A8BA 4XSKU 3SU4A 4NA7A 1NPMA 1SGNE 2BXTH 4I86A 2FLBH 4CR5A 2KCYA 1YGCH 4UONA 4AB9A 2V3OH 4INKA 2VWNA 3OSYA 2OINA 3M7QA 1HCGA 1TA6A 2ZU1A 4FXGH 4GPGA 3EDXB 3QO6A 5C1YA 4DVAU 4Y11E
chains in the Genus database with same CATH topology
3N7OA 4K8YA 2BVRH 3C27B 4DIHH 1ELFA 1SQAA 3GCHB 1QNJA 5EG4A 1A5HA 1MCVA 2PFEA 1S81A 1BTPA 3Q3KA 3M5LA 1W12U 2HLCA 3RXBA 3NCLA 3RXCA 3VGCC 3OYPA 1QB9A 5E0JA 4AN7A 2ZZUH 3NKKA 1BHXF 3SQEE 5JB9S 1C2HA 2J94A 2PKSC 2PKSB 2AMDA 4BTTB 1NT1A 4WWYA 1FN8A 2BLVA 1EKBB 2PWXA 2FOBA 2A5KA 3SV8A 4ZXYH 2FYQA 2YNAA 4BAMB 1LPKB 4INLA 4OS7A 1WAYB 3EGKH 1K1MA 1OYTH 3SZNA 1FIWA 1VITG 1SOZA 2OXSA 3T25A 1ESAA 4LZ4B 1XX9A 8KME2 3ZVGA 3S9BA 4U2WA 4IMQA 5FXLA 1GI7B 2TBSA 1GBDA 2W7SA 1SVPA 1GG6C 1EAXA 1K22H 5A8YA 3SI3H 3RC5A 1XKAC 1GHAF 1O0DH 2QA9E 3S0NA 1ANBA 1HJ9A 2RA0A 3B9FH 3MH7A 1AN1E 4RKJB 2PUQH 2OBQA 2QXJA 1TNLA 5F8TA 3MWIU 1Z7KA 1P01A 1P09A 2ZHQH 1UCYE 4JCNA 3OU0A 3KEEA 3GDUA 3P6ZB 3SUFA 5GCHF 2O9QA 3RLWH 1WU1A 4HGCA 2FS8A 3AAVA 3MH6A 4O97A 3LH1A 1O3HA 1ANDA 1TALA 1OWIA 1M9UA 1T32A 1O3CA 2A7CA 2OC8A 1O5GH 1FUJA 1TA2A 1DM4B 3B8JA 1P0SH 2EC9H 1WV7H 4FUBA 1O5EH 2Z94A 1GBEA 2PKAA 4ESTE 3MU1A 5C67A 1DSUA 1QL7A 2Y6TA 1U6QA 1RTFB 2ZWLH 1P03A 2H2ZA 2ZPQA 3PWCA 3FVFB 1O3MA 1DFPA 3SJ8A 3UNRA 3RXAA 4JZEH 4Y8ZA 2ZCLP 1H8DH 1XUHA 1G2MA 3SV9A 2Y5HA 3PLBA 1NU9A 3T5FH 1JMOH 4Q7XA 1RTLA 2BZAA 1SGEE 3SHAH 3M7TA 1Z8IB 2A5IA 1O34A 3T27A 3RXUA 1T31A 5F6MA 2RA3A 1P9UA 1AO5A 2Z9GA 3TK6A 1EJMA 4U32A 1GVLA 1PQ8A 3SV2H 1SLUB 1UK4A 1P2MA 1QJ7B 4JZFH 1JBUH 1MH0A 2BD7A 1O2PA 2BMGB 3OX7U 1YPLH 3ITIA 5L2ZH 4X8TH 5AFYH 1FPHH 2ZU2A 4YOJA 5K0HA 5HYOA 1ZTLA 3ZZ4A 1O3OA 2C4FH 2WV4A 5EXMA 3V12A 3RXIA 4NA9H 2CXVA 3ENSB 2OBOA 4XE4A 4MNXA 4ABGA 1Z8RA 1PPHE 2BDYA 1GDNA 1NM6A 1CGHA 1C1UH 1A61H 4TYDA 1BTYA 1ZSLA 2ZPRA 3K65B 1LQDB 2WYJA 4BXWA 2P95A 1V2UT 2ZFFH 1D3TB 1WOFA 1EOLA 4YLQH 1RD3B 4MPWA 2H9TH 2R2WU 2V6NA 5K7RA 3E0NB 3Q00A 1MQ5A 1TNGA 9LPRA 1KTSB 1HUTH 3RXPA 1TPSA 1AUJA 2ZDLA 2TPIZ 4RKOB 3EYDA 1BHXB 4YOGA 3QTVH 5CHAC 5FAHA 3SI4H 1O2JA 1ARBA 4OGYA 5LGOA 1QA0A 1MBQA 1CA0C 2TGPZ 1PQ5A 2FLRH 1GI6A 3K9XB 3TH3H 2G5VA 4YTAA 2P8OB 2P8OC 1IHTH 1CT4E 2AMPA 1ZMJA 1Z8JB 4X1QU 2A32A 1GVZA 4THNH 4ISHH 3SU5A 1SLVB 1V3XA 4Y6DA 1O37A 4BNRA 2WINI 1Z1JA 1TGTA 2XC4A 2Q6FA 5HM2A 1IHSH 1O2YA 4FU9A 5JDUB 2Z7FE 4MNWA 4WMFA 4E7NA 2ZQ1A 3BTFE 3PMJA 2ILNA 2A2QH 3RXEA 2J92A 1MTVA 1UVOA 4AOQA 1TABE 1RRKA 1P04A 1V2OT 1C9TA 1ZPBA 1VJAU 1C5SA 3DD2H 1L4ZA 4YOIA 1NRQH 1P9SA 1AY6H 4Q2KA 3BTKE 4Y8YA 5GIBA 5EXLA 5DP6A 1MU6B 1BUIA 2D26C 3SGBE 2GCHF 1DWCH 1OP0A 4K1EA 1TIOA 3LU9B 3SV6A 1BMMH 1O3IA 2P3FH 1N8OC 1KSNA 1BMNH 2ZTXA 4DIIH 2FWWA 1N6YA 1PYTC 2WPMS 4CREA 1PPEE 4WY3A 5EPNA 1EASA 2AERH 4GVUA 1LCYA 3ESTA 5DG6A 3GY7A 1C2IA 2Z3CA 3FANA 1YPKH 1VGCC 5E2PA 1AZ8A 1Y5AT 2Q6DA 1EPTC 4B2CA 1BJVA 3EA9A 3PB1E 4NGAH 1BMAA 2ZGBH 2BM2A 1J15A 1Y5BT 2O8WA 3NPSA 2XCFA 4ABAA 1CT2E 1F5RA 3UOUA 1V2JT 3M5OA 5DGJA 1DWBH 5GXPA 3SGAE 1C5PA 1NO9H 3TJUA 4UE7H 1BT7A 2BY7X 3KCGH 3RC4A 1C5QA 1TBZH 4I8JA 1EQ9A 4X1PU 3GCOA 4KGAA 1Y3YA 2ZA5A 1G37A 3T29A 2BLOA 4OS1A 4D9QA 1NROH 3TGJE 2BDAA 3HKIB 4UFFH 5ETXA 3KGPA 1Z71A 2HWLB 2JKHA 1V6DA 3C1KA 1QY6A 1Y59T 5FPSA 1NRPH 1ELVA 2A4OA 2AMQA 1OX1A 3U9AH 2A4GA 1HLTH 2DUCA 1YBWA 3S69A 7GCHF 4NFFA 3ATKA 1TBRH 1K21H 1FY8E 4MDSA 4AFUA 1DLEA 1P12E 2JH6D 2PW8H 2QXGA 3MH5A 3A84A 3FFGA 4AYVB 1XXDA 3RMOH 2OC7A 1C9PA 4DGJA 2BD5A 3MOCA 1AE8H 1NFUA 4X2VA 3U69H 1IOEA 1SQTA 2IOTA 1H1BA 3U8TH 1AGJA 2UUFB 1TMBH 3HATH 2P94A 1GGDC 4F4OC 2FTMA 1TRYA 5A8ZA 4AGJA 2W3KA 4AFZA 1V2MT 1TRMA 1HBTH 1O2QA 1QURH 2FPZA 5DJ7A 1AFQC 3UWJH 1ORFA 2FP7B 1BJUA 3PLPA 4H6TA 1P57B 1QCPA 1PPCE 1T8LA 3V7TA 1XVOA 1D4PB 1ZTKA 2HALA 1RIWB 2BDBA 2GCTC 1EAWA 4B2BA 3LJOA 1NZQH 2VVCA 4CBNA 1O35A 4ZAEA 2DE8A 5FCKA 1Y5UT 3JZ2B 3OY6U 1BB0B 1BBRE 1DXPA 1VZQH 1J17T 4Y0YE 3QUMP 3QTOH 1ELCA 4F49A 1Y3WA 1WQSA 3QX5H 3AW0A 5EQRA 5F8ZA 1TBQH 2P59A 2F83A 1JXPA 2R3UA 1QRWA 1O2MA 1HAVA 2A0QB 5A2MH 3S9AA 1O3GA 4GHTA 1W7GH 4MG3A 3T28A 1LPGB 2FI4E 1NN6A 5FBIA 2C93B 1EB1H 1H8IH 4BTIB 1TX8A 3VB5A 1SG8B 2FODA 3EE0B 3V0XA 1YPGH 5EODA 1YCPK 2O8MA 2ZFPH 4HI3A 2PLXA 1HAHH 4IBLH 4AFQA 2VWLA 2XWBI 4K69A 1MTWA 2ZP0H 1WTHD 3RXGA 2BDCA 8LPRA 1GMCF 4GCHG 1LHDH 3ZZ5A 2AS9A 1YF4A 3U1IB 1ESBA 1O2KA 1GBFA 3VB3A 1AD8H 2NU1E 2XC5A 4J1YA 3PLKA 4NA8A 2FOCA 3DA9B 2R2MB 1HDTH 1XVMA 2EI7A 3KF2A 3LOXA 6CHAB 5EW2H 3RMNH 1FMGA 3T2NA 1HYLA 1ARCA 1LKAA 1VCWA 2O8TA 1BZXE 1GBIA 2PSXA 3K6ZA 3A80A 4X8UH 1S5SA 5JB8S 5LH8A 1UO6A 3TJNA 4IC5A 5C2ZA 1C5TA 1TGCA 4DOQA 5CE1A 3HKJB 3S9CA 4J2YB 1NY22 1C5XB 2ZFSA 1K2I1 1ID5H 1P11E 3PO1B 5FBEA 2OC1A 2PGBB 1OWEA 1S0QA 2WPJS 2VH0A 4MPUA 3BG4B 1OP2A 1RTKA 4I8HA 2ZHDA 3RMLH 1O3NA 2TGAA 2OD3B 1C2KA 3S7HB 5G4BA 3MI4A 5FX5A 1N1LA 3HK6B 2NU3E 6GCHF 1FY5A 5H4IB 2UUYA 4ZHAA 5FPYA 2BD3A 1OWJA 3DT0H 1CGIE 1W10U 4ZKNU 2GGVB 1C1QA 3CS7A 5B6OA 3M3VA 2F9VA 2FO9A 2WPLS 4D8NA 3SNCA 4CBOA 4M7GA 4D9RA 2A5AA 1DUAA 3BEFB 5A0CA 1TGSZ 3CS0A 1O2UA 3PROA 1SL3A 2G81E 1AVXA 1ABIH 1SI5H 3HPTB 1VCQA 3ZYDA 1ETTH 3P70B 2WPHS 1QA7A 1HXEH 2B8OH 1GBCA 2QY0B 3UOPA 3E8LA 1BDAA 1C2DA 3RXVA 5A8XA 3GY4A 2QV1A 3LDXH 2QN5T 3MU5A 4A1TA 3STIA 1VITH 1ZR0A 1XUFA 5HMAA 3ZZDA 2GZ8A 5FX6A 1TQ7B 1LVBA 3H7TA 3TLOA 3LC5A 2GX4A 3A8AA 1AMHA 1ZGIA 4A1XA 3U8RH 2TGTA 1MMJN 5HM9A 3BV9B 1SGTA 1T8MA 1A4WH 4UEHH 1EZUC 2ZHEH 5E2OA 2HNTC 1S85A 4TY7A 2CF9H 3U8OH 3E3TA 3SV7A 3TH4H 1SLWB 1YKTA 1Z1IA 1HNEE 3MO6A 3ZVDA 1SHHB 3MU8A 3UUZA 4ZUHA 1BIOA 1L1NA 5EQQA 3M5NA 3VGCB 1GBKA 1P8VC 2Z9JA 4K3JA 1DITH 1Q31A 1CBWC 1CBWB 1GL0E 3SQHE 1HPGA 1K1OA 1DY8A 1GJDB 1O2TA 2VJ1A 3ZZ3A 2HVXA 4K5ZA 3UY9A 1F7ZA 1C1WH 4ABIA 3RP2A 1GMHF 1T4UH 1GBMA 1JOUB 3MU0A 4D7GA 3BTDE 4BANB 2AEIH 2BXUH 2RCEA 3GYLB 3IG6B 5EXNA 1GJ6A 1V2PT 1MU8B 3F9EA 3VXFH 1GI9B 3VB7A 1C1OA 1H9HE 1O3JA 3M36A 1AWHB 4LK4A 3O8BA 1OS8A 1HAVB 1BITA 1GG6B 1G9IE 1DXWA 2Z6BD 2G5NA 1EJAA 3CENA 3SN8A 1SHYA 4OS2A 3I78A 1P2QA 1QIXB 1C5RA 3I77A 2QGRA 3CP7A 1HRTH 2SGPE 1ZZZA 5JBTA 1THSH 3K2UA 2VGCC 1QRZA 3E90B 3H5CB 1UMAH 2ZHWH 4OS4A 2FI3E 4PROA 3RU4E 4I33A 4VGCC 3SU0A 2CMYA 1ELDE 1SGFA 3Q76A 1TQ0B 2C90B 1C1TA 2BLWA 2YOLA 4XOJA 3ZZ9A 2OP9A 3RXOA 2GD4B 4NWLA 4FVBA 1UTPA 1QGFA 1Z6JH 2C8WB 3PM3A 1B5GH 1MKWH 3O8DA 4O03A 5JPMH 2ZGXH 2BY6X 2GZ9A 2H5DA 4KTUA 1OWDA 5J4SA 3ZYEA 1BMLA 1GHBF 1NFYA 3DFLA 1ETSH 4KP0A 2THFB 1S6FA 2B5TB 2BLQA 2WV5A 2VINA 1SR5C 2QCYA 1TRNA 2H1UA 4XDEA 1O3AA 4O3UA 1AUTC 1H9LB 3V13A 2KAIA 3TVJB 4WF8A 1AVGH 4XBCA 1IQJA 3K6YA 1DANH 1BRCE 4LXBH 4JYVH 3D62A 3P8OA 3RXKA 4D76A 1TAWA 8GCHG 2FDAA 2ZEBA 4I31A 3LJJA 3P17H 3U1JB 2FTLE 2GMTB 2GMTC 4SGBE 3GDSA 4FUIA 3RM0H 1VCPA 2A2XH 1EZSC 2GP9B 3UR6A 2H9EH 1AZZA 1KYNA 5EPYA 1GHWH 1OSSA 2XBWA 5EQSA 3BTEE 2QF3A 5JBBS 3ZZ6A 2AGEX 3BF6H 4H42U 2F3CE 1DWEH 1QBVH 3LPRA 2OQ5A 1KLJH 2EEKA 2ODQA 1DVAH 1GJ4H 5BPEA 1QJ1B 1TMUH 3M3SA 1CHOF 1GVKB 5I46H 2WPIS 1ZGVA 5C5OA 5A0AE 2BQ6B 1WCZA 1C5LH 4B2AA 3RMMH 4UDWH 1EZXC 3ATLA 2SNVA 1B7XB 1A2CH 2HGTH 4GLYA 5EOKA 2FI5E 1Z6EA 1YCPM 1DUEA 3SOSA 1FJSA 1UTNA 2PTCE 3EA7A 4NZQA 1C1MA 1O2WA 1E0FD 1NTPA 2C8XB 5CHAB 1Z8GA 1AVWA 1GBJA 1ZPZA 4WMDA 1BRUP 5TCAA 1A3BH 1CA0B 1IQMA 3WY8A 3AASA 3FP7E 4X6NA 5DP3A 4B75A 1XXFA 3QGJA 1CSOE 1ZTJA 3RU4D 4DURA 4B73A 2ZNKH 1AKSA 1HAIH 1KLTA 1O31A 2PV9B 1GHYH 1ANEA 2FOAA 5DP7A 1AB9C 3O8RA 1NRNH 1XUGA 1UTJA 1W13U 1A0JA 1RJXB 5DP5A 1WYKA 2GZ7A 4FUJA 2A45B 1SC8U 2GV6A 1W0ZU 2JH5D 2ANMH 3SO3A 2NU4E 5EU8A 4Y79A 1ZYOA 1LTOA 1TMTH 1G32B 1BTZA 3BTME 1ETRH 3RXJA 4A6LA 3LGTA 1A0LA 1GHVH 1V2LT 4NIXA 4Z6AH 1VITF 1CU1A 4A1VA 1AI8H 2GVFA 4TY6A 1G30B 4QT8C 1FY1A 2WYGA 4ZHMU 3LGVA 1A0HB 5EGMA 2QAAA 3SU3A 2SGAA 2BD4A 2UUKB 3B23B 3SNDA 3LH3A 1FONA 1FY3A 1CVWH 2ZHFH 4NG9H 4CRDA 2A31A 1ELBA 3EA8A 2J38A 2M5TA 2VWMA 4ZXXH 1O32A 1TGNA 1K28D 1N8OB 3NZIA 1F5LA 2BD2A 1QJ6B 1HV7A 1UVPA 1KY9A 3RU4T 1T4VH 1SGCA 4IMZA 3KN2A 1BTXA 1B0FA 1C2GA 1HJ8A 3ELAH 1K1IA 3BSQA 1A1RA 1VGCB 1MZAA 5JYIA 4WJG2 5DPAA 1V2WT 2TIOA 1EPTB 1F0UA 1GCDA 2VVVA 1TX6A 3QGNB 2F9NA 2Z9LA 3S7KB 1BRAA 3TJVA 3URDA 3MNSA 1SGPE 4I8GA 2OTVA 1OXGA 3IITA 1UTKA 3RM2H 3NUMA 2JETC 1L2EA 4AZ2B 2XC0A 3M5MA 2BB4A 6LPRA 4BAQB 2EA3A 1LVOA 2ZDKA 2H5CA 1KXEA 3E0PB 4Q7ZA 1ANCA 5DO4H 2CF8H 3BIVH