4FUHA

Crystal structure of the urokinase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
total genus 56
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fuhA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fuhA01
1QGFA 1TYNA 2ZHWH 1GVLA 4TY7A 1RD3B 1GBBA 2ZWLH 1S85A 2CMYA 1VITF 2QC2A 3V7TA 2ANYA 3PMAB 4WMEA 1B0EA 2HPPH 1GHZA 3L33A 1HCGA 2BDGA 5EQQA 1O3GA 1VITH 1QL8A 1O34A 1W7GH 2XWBI 2VWNA 1FUJA 2RA3A 2PLXA 2CF9H 4X1QU 1F5RA 3NXPA 1OKXA 1GBCA 1HAYB 4IC6A 1G2MA 3LKWA 5LPRA 4CHAB 1FAKH 4B71A 1HAVA 1THRH 3Q00A 2IOTA 5HGGA 1LHEH 4BTUB 1MBQA 2ZFPH 1O2TA 4R8TB 1HRTH 4GCHF 3P70B 3GDVA 1MUEB 3NUMA 5K7RA 5HM9A 1TNLA 4BAHB 2W7SA 4Q7ZA 2A1DB 4Y11E 1Q31A 1SC8U 4MPXA 2FI5E 4KELA 1WTGH 1YBWA 1BMNH 3A7XA 1V2KT 1FPCH 3TGIE 1C9TA 2ZEBA 1QB9A 1GMCG 2O8TA 3LJOA 2DE9A 1C2HA 4AFZA 3TIUA 3UR9A 4CRFA 8ESTE 5ETXA 3RXQA 3GY3A 3A8DA 1CA0C 2WPHS 1ZTJA 2PKAB 1BHXB 1ZLRA 4K8BA 2XYAA 1DXPA 5DK1A 4DIIH 2AGIX 2GZ9A 2FZZA 1RRKA 4FUHA 5CHAB 1WOFA 1HJ9A 1NY22 2RCEA 3B23B 1TA6A 4ZMAH 1ZMLA 3PLBA 3TJVA 1LHFH 2GP9B 1GI5A 3TK9A 4ZHMU 3RM2H 2HPQH 4JCNA 3VXEH 3LU9B 3TH4H 1ZJKA 4B2BA 4WVPE 1Y3VA 4K1SA 1MAYA 3GCOA 3ZZ3A 4YOJA 6LPRA 1EUFA 2ZU2A 1ZTLA 1C5VA 3PMHB 1ZTKA 6CHAB 1O5BB 1UTNA 2P8OB 1GCDA 3UQOA 2O9QA 3QLPH 1XMNB 5CMXH 1F5LA 4FUBA 2AIQA 2TGPZ 4B75A 1NRQH 5FPTA 1YYY1 1C1MA 1GG6B 2VNTA 1ZYOA 1GMHF 1C2KA 3D23A 1YPKH 2EI6A 3PLPA 4Z6AH 2ZGCA 1QB6A 2ZCLP 2SGDE 1GVZA 2J38A 2GMTB 1SI5H 2GZ7A 4X6PA 2ZKSA 2FYRA 1LHCH 4TPIZ 2OC7A 4MPVA 5GCHF 3ENSB 1G37A 1SFIA 2STAE 1AD8H 2O8UA 1NFWA 1BT7A 3MI4A 2BDBA 3RXDA 4K69A 1IQKA 1O3BA 1D3PB 4I8KA 3KL6A 4OS5A 2FX4A 4BNRA 3KCGH 4FUGA 1C2FA 1GDNA 1FIWA 1C5UA 2A31A 2NWNA 1CT2E 4NWLA 2BY7X 3BTEE 4A5TS 1WCZA 3M5NA 2XCFA 1GJDB 1N1LA 3EYDA 3KNXA 1A4WH 1H1BA 5F8ZA 5EW1H 3KHVA 4MDSA 5I25A 3GDUA 4NFFA 2SFAA 3EGKH 2AMQA 3A87A 2QGRA 4DJZB 6GCHG 1S0QA 2A4GA 3KIDU 2VH0A 2ZFRH 1NC6A 3RM0H 2ODYB 2XC5A 5I46H 1P05A 2FOMB 1QJ1B 1C2MA 5DP6A 1LTOA 2FMJA 3SJ8A 1PQ5A 1VJ9U 1O32A 2QAAA 2Z94A 1O39A 5GJ4B 2G4UA 2BZ6H 2GCHG 3GCHC 3TGJE 3P8FA 3RLWH 1AY6H 1FMGA 1GWAA 3A80A 1V6DA 1VGCB 2Q1JA 5C67A 1YGCH 5DP9A 3RU4E 1O35A 2EA3A 1OP0A 1ANEA 5DP3A 3MH5A 1S6FA 1ZRKA 4RN6A 1P10A 1AVWA 1SGEE 1LVMA 1SBWA 4O3UA 3HGNA 3Q3KA 4JYTA 2ZG0H 4PROA 3BTDE 1QQUA 4HZHA 1EJNA 1JWTA 2NU1E 5F8TA 1WV7H 4MQAA 1AHTH 1IQMA 3UOUA 2ODQA 1CBWC 3RXVA 2BDIA 1SGTA 2QF0A 2ZQ1A 3A7ZA 4AGKA 2FWWA 4X2XA 1GBKA 1FAXA 1K1MA 2A5AA 2OTVA 1GBDA 1DWCH 1AB9C 1T7CA 5EQRA 1O2GH 1GHVH 1SGYE 1ARBA 1K2I1 2BVXH 2BD8A 3S9AA 2K1QA 3MHWU 5HM2A 4UFFH 3PWCA 3M7QA 3CP7A 2ZPSA 2OBOA 1N6XA 2Q6FA 2ANMH 3RDZA 1KXEA 2ASUB 3PYHA 4OGXA 1YLCA 1BZXE 3SHAH 3LGIA 1DUAA 4KGAA 3MH7A 3U8OH 1D3QB 3QUMP 1G3DA 1G3CA 3NZIA 4IS5A 5AFZH 3PTBA 4X1RU 1EB1H 2AGGX 4E7RG 2Z7FE 4X8SH 1P2JA 4BOHA 1ZPBA 4X2VA 1PQ8A 2GT7A 4X8TH 2HVXA 1P11E 1QHRB 1UJ1A 2PKSC 1QURH 3IG6B 2BDYA 3M7TA 1QCPA 2TGDA 1FY8E 1TBZH 5CE1A 1EXFA 1P2QA 2FI3E 4X2WA 3GYLB 3SUGA 1LPKB 2J94A 3RC6A 4D9RA 3ZZ9A 1FI8A 1A5HA 2BD2A 3QN7A 4CBOA 4ABJA 1MCTA 2HNTE 1L4DA 2UUJB 1GHAF 1G2LA 1RIWC 3RMOH 1Y59T 2ZHDA 2C8XB 3NPSA 2PGBB 3MMGA 3SO3A 1DY8A 2AMDA 2IPHA 4O3TA 1TNKA 4I8LA 3EE0B 1LVBA 4HI3A 2JKHA 3PWBA 3JZ1B 1QRWA 1MZDA 4WH6A 1FY5A 2BQ6B 1AVGH 1FDPA 1ZHRA 5C5NA 1PJPA 2Z9KA 2CF8H 1NU7B 1XXFA 4OS7A 3NWUA 2BLWA 2SGEE 3T25A 2XNIA 3M61U 1HAPH 1QNJA 3BG4C 1KLJH 4VGCC 1CA0B 3MH4A 1QIXB 1SGIB 1C5LH 4CRBA 1IQHA 4E06H 1YPGH 3ITIA 3PMJA 4Y79A 5TCCA 1XUGA 4X1SU 1GBJA 1QRXA 4ZXYH 1AKSB 7KMEH 2D1JA 3BEIB 1QFKH 2YOLA 1TE0A 2BX4A 1P12E 1C5SA 1O3DA 1PQ7A 1Z6JH 5E0GA 3SNBA 3ZZ5A 2Z3CA 3GCNA 4NA7A 3S69A 2HLCA 4KKDA 4CH2B 3RXKA 2WV5A 4ISNA 2PTCE 4SGBE 2BY8X 2ZECA 1LPZB 1HFDA 1GMCF 1ZGIA 1ELGA 3VXFH 4XFQA 3SI4H 1GBAA 4FU7A 7LPRA 2AGEX 4INHA 1Z8IB 1O3PB 2STBE 1A0HB 5FCKA 1DX5M 1ELCA 2XBVA 3P17H 3RU4T 1ZOMA 2F9OA 3LJJA 3S7HB 3SUDA 3BTTE 3M35A 1QJ6B 1JRSA 1O3OA 1C5OH 3I77A 1CGIE 1P8VC 3LONA 1A2CH 1E38B 2WUCA 4ZKNU 1CO7E 4HTCH 1EPTA 4UD9H 1TONA 1HJ8A 4IMZA 1TGSZ 5FBIA 3K6YA 2P94A 1S6HA 4NZLA 1SMFE 1K1PA 4XE4A 3VGCB 4B2AA 2G5NA 2WYGA 3F6UH 4XDEA 2GT8A 5GIBA 3RXGA 3E16B 4ABEA 3SJIA 1TX8A 2A2XH 5LPEA 1BTUA 3AW0A 3R0FA 1UVSH 3ZZ8A 4O97A 1YPJH 1D4PB 5FX6A 3RU4D 1SGPE 1B0FA 2BDHA 3ZZCA 2FX6A 3HKJB 4I33A 3FZZA 2BY5X 3BTHE 1O2PA 1TPOA 1UVTH 4Y0ZE 2BD3A 1B5GH 4GPGA 3F9EA 2FODA 4WXIA 3LC5A 4ISHH 4MNWA 1AUTC 1NO9H 5L2YH 1PYTD 1QBOA 1U6QA 1Z8JB 1YCPH 2Z3DA 1JXPA 1FLEE 1W11U 5A2MH 3GY4A 3VB5A 4JK5A 1NFYA 1BTPA 1EAIA 2H5DA 3D65E 3QWCH 4U30A 4ABBA 4NIWA 1C5WB 5EG4A 2Z9LA 1UK4A 2ZU1A 4GVUA 1P2MA 4ZROA 4ABIA 2O8MA 3RMNH 1F0RA 1YPLH 1F92A 3FP8E 3GCHB 3IWMA 3B9FH 2KAIB 3H7OA 1QA0A 1FN8A 3STJA 1LDTT 1SVPA 1UVUH 3H5CB 4ZKOU 3TK6A 1UCYK 1GJ6A 5LH8A 2NU3E 3SU4A 2FOFA 1W3CA 1C5NH 1O33A 3M3SA 3SJ9A 1C5TA 5EU8A 1F0UA 3SV7A 1O2KA 4CH8B 3P92A 5PTPA 6GCHF 2NU4E 8GCHG 1P01A 3BTME 2QV1A 2HOBA 3RC5A 2Z9GA 3U8RH 3A81A 5FPSA 3LC3A 1AQ7A 1ABIH 4AFSA 1A1RA 5GXPA 1VR1H 3K6ZA 4UFDH 7GCHG 2ALPA 3ESTA 1DUEA 1AB9B 2GCHF 2VWMA 2Y5GA 1F0SA 2R0KA 4OS6A 1FZZA 3TJNA 1GPZA 3VEQB 4B1TA 1CVWH 1UO6A 2FO9A 3CS7A 1ELTA 2TPIZ 2ZTZA 1BRAA 1D9IA 1C2EA 4TPYA 7ESTE 2A5KA 3LGVA 1MTSA 1IOEA 2FOCA 3I29A 1O2MA 1O2OA 4H6SB 1DWDH 3SUFA 3TITA 4BTTB 3UNSA 3QGJA 4RKOB 2V3HH 4MTBA 3C1KA 2BLQA 5H4IB 4AORA 3A84A 4CRDA 3RXRA 1C1SA 3ZVEA 2BOKA 1RS0A 1HPGA 1GI2A 3RXFA 1O5FH 1MKWK 3UTUH 2ZHFH 5GPIB 4A1VA 4XSKU 1O2IA 1O5CB 1QL7A 2CHAB 3F68H 8KME2 1J16A 3MNBA 3MO3A 2XTTB 3A83A 3ZZ7A 1HAVB 2OCVB 4Q2KA 4GHTA 1AZ8A 1XXDA 3PO1C 1DANH 2NU0E 1Y5AT 1E35B 4THNH 3SNCA 3EA7A 1A3EH 1TMBH 2Y7XA 1ELVA 1V2WT 1T8OA 1J8AA 1HAXB 3E91A 3M5MA 1ZPZA 2JH6D 3JZ2B 3K9XB 2P3UB 4AYYB 1DITH 1AMHA 3QDZB 2ILNA 3T29A 5AHGH 1AU8A 1MTNC 2NU2E 1CHOG 3OSYA 2FLRH 4NG9H 2YNBA 4DT7B 3KQDA 2C90B 3BG4B 1NRNH 1T31A 2BQWB 1E36B 3MU0A 4IC5A 1O3EA 2WPIS 2GCTC 4CREA 4B73A 4NZQA 4IMQA 5TJXA 2WPMS 1ETRH 5DJ7A 2PUXB 2Y81A 1FJSA 2P59A 3SZNA 1HIAB 3DUXH 4ABAA 1G9IE 2D26C 4U2WA 3D49H 1ANCA 4JZDH 2R0LA 2AS9A 2LPRA 2B9LA 4WMFA 1V2TT 1W0YH 2V0BA 2ZF0H 1GBHA 4IBLH 1GL1A 2VIVA 1O2WA 4YTAA 3P8OA 1LQDB 1P2OA 4X8VH 2SGQE 3T2NA 5K0HA 1GI8B 1YLDA 5T3HA 1D6RA 3RXJA 1NRPH 1AFQC 1VCQA 3UNQA 1UK3A 1BTZA 1A46H 1WQVH 1WSSH 4MNXA 5IDKA 4AN7A 2I6QA 3BTKE 4I8HA 4KTCA 5J4SA 2J92A 2C4FH 4I31A 4NA9H 1WU1A 3MTYA 1ETTH 3RUOA 1J17T 1E37B 4NSYA 3TK5A 1P3CA 1ARCA 2H1UA 1TOMH 1W8BH 2Z9JA 1AO5A 1C1RA 2ZU4A 2BVSH 1BDAA 1VZQH 5FHTA 1QTFA 4HFPB 4Y7AA 1ACBE 2QYIA 2J9NA 1EPTC 5L2ZH 2CXVA 4A1TA 1SLXB 4E7NA 1AWHB 4ABHA 3TGKE 2VINA 4R0IA 2H9EH 2ZTXA 3S9CA 1KIGH 2GKVE 1KLIH 2F9VA 3SV9A 3MNXA 5A0BA 3I78A 1JIRA 1YKTA 2HALA 4K1EA 3ZZAA 3TLOA 2BHGA 1GHBG 1OWKA 1TPAE 3FZDA 4OS4A 1OWDA 3Q77A 1YCPK 3SBKA 1TLDA 2QXGA 1W7XH 3ZV8A 5E2PA 3H7TA 1O2VA 1RTLA 4BAKB 4UEHH 1MTVA 1JRTA 3SQHE 3MU1A 4U01A 1E34B 5EODA 2FESH 1EASA 2Q6DA 1TRNA 3A82A 1SG8B 4LK4A 2G00A 2BLOA 2WPJS 3TNSA 1HV7A 2G8TA 1ZHMA 1HAZB 1LVOA 2A2QH 1C2GA 1YC0A 3OTJE 1CT0E 2W3IA 2QN5T 4B74A 3QGNB 2H9TH 4F4OC 4MNVA 4AYVB 3B8JA 1XKAC 3CENA 3GDSA 3RXCA 3RC4A 4K5ZA 2XBYA 1LHDH 1K1IA 3BN9A 3ELAH 1GI7B 1C1QA 1GVKB 1P57B 2UUFB 1T4UH 3P95A 5A0CA 1O31A 1O5EH 3SGQE 2WINI 3ZYDA 1DLKB 3RP2A 1Y5UT 2OQ5A 1FONA 1PPGE 2TIOA 5AF9H 3BTWE 3MO6A 1C4V2 3F1SB 2ZDMA 3SGBE 1YP9A 3GOVB 3UY9A 2QIQA 3MWIU 2FOBA 2OQUA 4YLQH 4Y76A 3M37A 4MPUA 1IQNA 4A1XA 5JDUB 1J9CH 3K65B 4F49A 1LO6A 1DY9A 1DXWA 3RXPA 9LPRA 2ODPA 2R9PA 1TNIA 4H6TA 2ZDNA 2P95A 2H5CA 1WQSA 2ZI2H 4BANB 1LQEA 5JBBS 1FV9A 1ANBA 2OBQA 1OPHB 5E2OA 1Z1JA 1PYTC 5F03A 4NIVA 3M3VA 3ZVDA 3E0NB 3RXTA 2ZZUH 1RFNA 1LHGH 2DUCA 1BMMH 5BRRE 1BITA 4HGCA 1O3CA 2OC8A 1PPZA 3PV4A 3TH3H 4X1PU 2PUQH 1YPMH 3SNAA 1PQAA 3TVJB 1YF4A 1T4VH 3SI3H 1JIMA 5DGJA 4XOJA 2H6MA 2A7HA 1HJAC 3EQ0H 4CR5A 1ZSJA 3MYWA 2FLBH 3GICB 4UFEH 3ATKA 2BLVA 2GTBA 1V2ST 2SNWA 3GCTG 2LNCA 2ZFSA 1G3BA 8GCHF 2XRCA 4CBNA 1MU8B 1TALA 1UCYH 3TPIZ 2ZGJA 3SNEA 1NM6A 1OSSA 4CR9A 1GBTA 4FUCA 5F8XA 3U98H 1KXFA 3LH1A 3EA9A 2BXTH 1BTXA 1TPPA 2QXIA 2UWPA 1XVMA 2EEKA 4DGJA 5JBCS 3URDA 7GCHF 1C5PA 1PPBH 2BZAA 2H2ZA 3KN2A 2R3UA 4RKJB 2FOEA 1XM1A 1TX7A 1YCPM 1QB1A 1BOQA 3P6ZB 2QXHA 3LOXA 4AGJA 2RG3A 3U1IB 1MAXA 1ZJDA 2P3TB 8LPRA 4Y8ZA 2ZFTA 1P9UA 1GGDC 2HNTC 1GBMA 3ZZ6A 4FUJA 4LZ1H 1PFXC 3S7KB 3ATLA 3V12A 2ZO3H 2P16A 3M7UA 1NTPA 1Z7KA 3VB7A 1OWJA 2A4QA 9ESTA 1ABJH 1C5XB 3QZQA 5EOKA 4LXBH 1MTNB 2HGTH 3KEEA 1W0ZU 1UMAH 5F6MA 1HBTH 1XUHA 4AOQA 4QT8C 1ELDE 1ELBA 2IJOB 4AFQA 5J4QA 1O3IA 4YESB 1MKWH 2GZ8A 3RXIA 4YZUA 2ZU3A 1UTKA 3HGPA 4AB8A 3U1JB 1TABE 3BIVH 2ZHQH 2CV3A 3MNCA 1GHYH 2QA9E 4MPWA 1N6YA 1OOKB 3Q3YA 1ZPCA 4CRGA 3A86A 1GCTC 1K1NA 1L4ZA 1FY3A 4ESTE 1V3XA 4B2CA 1TRYA 3KGPA 3L3TA 2BD9A 1P09A 1XUIA 3HKIB 1AZZA 1CHOF 3SU5A 3O8CA 5EGMA 1X7AC 1JMOH 2Q6GA 2XWAA 3UIRA 1V2MT 1V2JT 1SGNE 1KTSB 1GJ5H 5DP5A 3RXOA 1P9SA 2XCNA 3OX7U 3LGUA 2BM2A 1SLVB 2PSXA 2PV9B 2Y5FA 1UCYE 5SGAE 2VVUA 4BTIB 3U8TH 2GDDA 1T32A 5E8EH 5EQSA 2TRMA 1XUJA 1UTJA 1FY4A 2I6SA 4X8UH 1FN6A 1UTOA 3CS0A 3TU7H 1OWEA 2XXLA 1FNIA 2AERH 2JH5D 2G5VA 3MNSA 3FFGA 1V2PT 4AZ2B 3SHCH 1DOJA 1GHXH 4I32A 1DDJA 3A7WA 1NU9A 2GD4B 2C3SA 2A4RA 2CN0H 2AIPA 1O2YA 3FAOA 2SGAA 5JBTA 1BTYA 4GLYA 3BV9B 1H9IE 1QRZA 3DFLA 1A5IA 3AAUA 1EAUA 5CHAC 1HAGE 1ELEE 1AKSA 2VWLA 3SN8A 1C2DA 1EP6A 1IAUA 1WUNH 3C27B 5FCRA 3RXSA 4X6OA 2OP9A 2BTCE 4YM9A 3DHKH 1SOZA 2CGAA 3A7TA 2V35A 1S84A 4YOIA 1ID5H 1PPEE 1QL9A 1Y3YA 1EZXC 2ZTYA 2VGCC 1QR3E 1YPHC 1PPFE 1GHBF 1HXFH 4MG3A 4IN2A 3SJOA 1MQ6A 3DFJA 6CHAC 3ATMA 1C9PA 1NPMA 2P8OC 1UHBB 1SSXA 2G55A 1TRMA 4M7GA 3SU2A 3S9BA 1C2JA 1EP5A 3QTOH 4GHQA 1W12U 4X0WU 1GG6C 4J1YA 1KXAA 2O8WA 2BD7A 4FU9A 3T62A 3V3MA 4Q80A 3ZVGA 3ZVCA 1V2LT 1BRUP 1GJAB 2GMTC 2H9HA 1EX3A 1OX1A 4ISLA 1G32B 2W3KA 5GDSH 2G51A 1QQ4A 1VCPA 4I8JA 1BTHH 5DP8A 3VB4A 3UWIA 1UTMA 4X1NU 4ZXXH 1S5SA 1Y3WA 3FP7E 1C4Y2 1P04A 3DT0H 3ATIA 1C1NA 2ANKH 1DFPA 1GJ9B 1DM4B 2VIDA 5JBAS 1TGNA 4LOYH 1MMJN 3M5LA 1OYTH 3M3TA 1O2XA 3AASA 1W14U 4D76A 2RDLA 2BYAX 3GISB 5T6GA 2W26A 4JZ1A 3ODFA 5EXLA 2OLGA 1GBEA 5E0JA 2ZHEH 2ANWA 4MNYA 4Z0KA 1KDQB 1CBWB 2A45B 2DE8A 3LGTA 5AFYH 1CSOE 1W2KH 1MKXK 2ZU5A 5JB8S 3STIA 1TIOA 2O8LA 2QCYA 1O3JA 1O37A 3UPEA 6ESTA 1A0LA 1Z8GA 3D62A 4OGYA 3A7YA 4INKA 3BTFE 1VJAU 1MZAA 4NCYA 1SLWB 5BPEA 1DPOA 2AFQB 3MFJA 1UTPA 3OU0A 4ZHAA 2PFEA 1EOJA 3E3TA 4FUEA 4I8GA 4BXWA 3SU0A 2FI4E 3ZV9A 1Z6EA 4OS2A 1GMDF 1TMUH 1VGCC 3ZVBA 1BIOA 1GGDB 3EA8A 3SV2H 1SGRE 1KY9A 3ZZBA 1T8NA 1IQLA 1DT2A 4TYDA 4UFGH 1G30B 2FS9A 2PTNA 2FS8A 5C1XA 4WH8A 1TNJA 1W13U 1HGTH 1GBFA 2PKSB 4DW2U 1P2KA 1C2IA 3LGWA 2M5TA 3GCTF 1S82A 1AE8H 4X2YA 2CJIA 1MQ5A 4Q7XA 1GBIA 2PW8H 2Y6TA 1Q3XA 4K2YA 3RXMA 1UK2A 1GJ8B 3SGAE 1SB1H 4FVDA 3BEFB 3F9FA 3SU3A 4KTUA 2FOAA 3MH6A 3RXLA 2Y5HA 1RIWB 4MVNA 2BB4A 2GV6A 1O5GH 2VVCA 3W94A 2C8WB 3QX5H 2WUBA 1YM0A 1BUIA 3RXAA 4IGDA 2VVVA 3LPRA 4K3JA 1V2NT 1ESAA 3UOPA 2FPZA 4ZKRU 4H42U 2BY6X 4Y10E 1RXPA 1QJ7B 4NFEA 5FBEA 5FX5A 3GY6A 2FTLE 2VJ1A 1GCTB 5C20A 1WTHD 3MOCA 5G4BA 5FPYA 1PPCE 1BRCE 1EJMA 4VGCB 4A6LA 3UNRA 4Q7YA 4WMDA 2A0QB 1L0ZA 1RGQA 3LGYA 1XUFA 1S0RA 4KTSA 1HAIH 2J95A 3MU4A 3FP6E 5FXLA 1HUTH 2QF3A 1PPHE 2F9PA 1GI9B 1IHSH 3IITA 1MTUA 2V3OH 2ZFQH 2F83A 5JPMH 2Z3EA 4BXSA 3SU1A 4TWWA 2ZGBH 2XC4A 1HXEH 1N8OC 3SU6A 2ZP0H 2VIOA 1ANDA 1BCUH 4NWKA 3AAVA 2ESTE 4MLFB 1V2RT 1OYQA 1O3NA 3RXHA 4BAQB 4LZ4B 3BIUH 2A7JA 1IQJA 4KP0A 4UONA 2BDAA 1CT4E 1H9LB 1O2JA 3T26A 1ORFA 1IHTH 1WYKA 1QA7A 3E90B 1KYNA 3U69H 1TA2A 3FVFB 2OXSA 1SGFA 3KF2A 1BA8B 1ZHPA 3RLYH 2A7CA 1C1VH 5DG6A 2GV7A 1NFUA 2WPKS 4X6NA 1O3HA 4DIHH 2C93B 1TBQH 1AFEH 1SGCA 2BVRH 1ZZZA 1P2IA 4AFUA 1HIAA 1O2RA 1TGCA 3RXUA 3GYMA 2W5EA 2ZGHA 1SHYA 3SV8A 1TOCB 4UDWH 1SQOA 2VIPA 1M9UA 3W95A 3SQEE 1G36A 1ESBA 1H8DH 3AW1A 2PSYA 1C5QA 2Z9IA 5A8XA 3NK8A 1O0DH 5DKMA 1ESTA 2FOHA 1Z71A 1GI6A 2VGCB 2J34A 2PGQB 3K2UA 1EATA 4H4FA 1XKBC 2F91A 1NESE 1K1JA 3PB1E 2PKAA 1HAHH 3P8NA 1NS3A 2BX3A 2ZFFH 3R3GB 1WAYB 2QY0B 3T27A 3ODDA 3TH2H 2UUYA 2UUKB 4FUIA 2SGPE 4ABFA 1ELAA 1S83A 5ABWA 1J14A 3NKKA 1KLTA 2B0FA 1EJAA 4ZHLU 1TBRH 2TBSA 2BMGB 3MU5A 1O2SA 3ATWA 1O38A 3HATH 1Z1IA 1L1GA 1V2OT 2FIRH 1AI8H 3VGCC 1FXYA 2R2WU 2OC0A 4J2YB 1O2UA 4ASHA 4DG4A 1EKBB 1O30A 4BAMB 1TGBA 2FEQH 2A5IA 2WPLS 2BY9X 2BXUH 3VB3A 1C4U2 1QBVH 3A7VA 1FPHH 1EAXA 3RXEA 4Y6DA 1T8MA 1EB2A 2TGAA 1AE5A 1UVPA 1BRBE 1ZSLA 1GI0A 1BJVA 3E6PH 5C5OA 1XUKA 2Y82A 3A8CA 3UFAA 1MD7A 3NCLA 1XX9A 4AG2A 5A09A 4Y7BA 2VIQA 1C1PA 1C1TA 2Z6BD 1P0SH 2ZIQH 2HNTF 3TJOA 1T8LA 1K28D 3V13A 4DY7B 1ZRBA 1ZGVA 2EI8A 1AVXA 3QTVH 1TFXA 5IYTA 3OY5U 1A0JA 1EQ9A 2ZNKH 4WJG2 1TMTH 3BTQE 1GMDG 3A85A 4ABGA 2WV4A 2FM2A 2XBXA 2SGFE 5JB9S 1ZMNA 1KSNA 1C5RA 3BTGE 3LDXH 1C5MD 4DCDA 1JBUH 2AEIH 1DWBH 1LPGB 3QK1A 2AH4X 3TNTA 3T5FH 1ETSH 2D2DA 1H8IH 3PM3A 1A3BH 1BQYA 1TX6A 4TWYA 4K60A 3QZRA 2D8WA 3URCA 1BBRH 2VIWA 1D3TB 1LVYA 1O2ZA 5FAHA 3UWJH 1TAWA 2IN2A 2JETC 1NT1A 1F7ZA 1P2NA 5ESTE 2VU8E 4A7IB 3EDXB 3E1XB 3PO1B 4A92A 2RA0A 2BOHB 4NIYA 1MKXH 4WY3A 3N7OA 1DS2E 2PWXA 1J15A 2UWOA 4OS1A 1XVOA 3PTNA 1SGDE 4FUFA 2GDEH 3SUEA 1IQFA 1GJCB 4K8YA 5DP4A 5L30H 1VITG 1D3DB 5A0AE 3O8DA 4D9QA 1GJBB 5C2ZA 3BF6H 1NN6A 3EAJA 1W10U 2B7DH 4AB9A 2J2UA 2PHBA 4WWYA 3GY2A 4DOQA 3G01A 2A32A 4JMYA 3GY7A 1G3EA 4XBDA 1SFQB 3RMMH 3UQVA 1MCVA 1H9HE 1EZSC 4FVBA 1MBMA 2V6NA 1C2LA 1AGJA 1Y3UA 1DE7H 1LKAA 2F9NA 2VH6A 1A5GH 5EPYA 1SOTA 4FUDA 2GCTB 4Y8XA 1DWEH 4D7FA 4YOGA 1V2UT 2AYWA 2CHAC 2WYJA 4Y8YA 4GCHG 1SPJA 1A7SA 4CRCA 1YPEH 3A88A 1BJUA 2TGTA 2ZDLA 1Y5BT 5L6NH 1DSUA 1TB6H 3MO9A 1O3AA 1TGTA 1L1NA 2QXJA 3KQBA 3S0NA 3GY5A 3M36A 3ZZDA 1DLEA 5B6OA 3VB6A 5AVDA 3LT3A 3Q3XA 1KTTB 1AWFH 1N8OB 5EXNA 1BHXF 1AFQB 4IW4E 1OWIA 1NFXA 3MU8A 4FXGH 4ZKSU 3E8LA 1O5AB 4CRAA 4K1TA 2VWOA 1C1WH 4CHAC 1UTQA 1UVOA 2F3CE 4ABDA 4YLUA 1GL0E 1TNGA 1SQTA 2GGVB 1K21H 3WY8A 1RJXB 2ULLA 1F0TA 3VFEA 1AIXH 2B5TB 3SW2B 1O36A 1CGJE 4ZAEA 1BBRE 1Q2WA 1EPTB 3RXBA 5E0HA 2HRVA 3UREA 1DICA 1O2LA 2ZDKA 2ZDVH 2XBWA 4GSOA 2B8OH 1SR5C 4JK6A 2SNVA 3Q76A 2VB0A 3VPKA 5DO4H 5A8YA 1V2VT 1O2QA 1OP2A 1MH0A 2W7UA 2OC1A 3KQCA 1HYLA 1EOLA 1E0FD 5LPFA 2AMPA 3ZVAA 5HYOA 3UR6A 3A8AA 1GJ7B 1DSTA 1KXCA 2A4OA 1L1JA 4SGAE 2ZCHP 2J4IA 3PROA 4Y71A 1GMHG 2BQ7B 3FANA 4YT6H 1RTKA 5JYIA 4GUXA 3SJKA 1Y3XA 4ISIH 3SOSA 1BMAA 4D8NA 3HPTB 1HNEE 1AUJA 1CU1A 3RMLH 1GDQA 4ZH8A 5GCHG 2EI7A 2Y7ZA 3BG8A 4INLA 2OD3B 1CA8B 4NSVA 1GHWH 4WF8A 1S81A 4UE7H 1P03A 5C3NA 1IQGA 1CE5A 1GJ4H 5DP7A 2C8YB 5C1YA 1GI3A 3LH3A 1DVAH 3U9AH 3OY6U 3OYPA 4JZFH 3V0XA 2ZGXH 1C5ZB 2FOGA 1LMWB 1O3FA 1IQEA 3M5OA 2Y80A 3SNDA 1TQ7B 4IN1A 2THFB 3TJUA 2R3YA 2ALVA 4TY6A 1MU6B 1TNHA 3QO6A 3ZYEA 3P8GA 1Z8RA 2ZA5A 3E0PB 5T6FA 1O5DH 5GWZA 4NA8A 1QY6A 1HDTH 2JH0D 1NROH 2ZC9H 2G52A 1LCYA 3PLKA 1LKBA 1Y8TA 2ZPRA 1K9OE 2P3FH 4O03A 2PR3A 5T6DA 5C1UA 1O2HA 1L2EA 2OUAA 3AVZA 1WBGB 1BTWA 5DPAA 3ZVFA 1MD8A 4XBBA 4AG1A 4AX9H 3T28A 2F9BH 4GAWA 3HK3B 1TWXB 3A89A 5ESBA 1KXDA 5EW2H 1F5KU 1YPHE 2C8ZB 4DVAU 1RTFB 5A8ZA 1C1UH 1NZQH 3O8RA 2ZPQA 5LGOA 1C1OA 4WXVA 1SQAA 3DA9B 1GBLA 1KXBA 4D7GA 1UHBA 1B7XB 1ZR0A 1BBRK 1CQQA 1P02A 1P3EA 1NRSH 1ZMJA 3F9HA 1C5YB 4X6MA 4ISOA 1MTWA 1ELFA 4ZUHA 1HJAB 3A8BA 2FTMA 2GX4A 4NGAH 1SHHB 1TPSA 1OXGA 2BD5A 2F9UA 3BEUA 4XBCA 3HK6B 4E05H 4JYVH 3SORA 1CHGA 2FYQA 1FY1A 1SGQE 3F9GA 1V2QT 1VCWA 2FP7B 1THSH 1GI4A 5HXFA 4Y0YE 1NRRH 4JYUH 1K1LA 1O3KA 5EXMA 1EAWA 4O9VA 2BD4A 1H4WA 1TQ0B 2UWLA 1O2NA 2KAIA 4FU8A 2JETB 1INCA 1ZSKA 1O3LA 1BMLA 2YNAA 4I7YH 1EZQA 3UUZA 4JZEH 4U32A 1THPB 2OINA 1K1OA 1K22H 1O3MA 1OP8A 1F2SE 1SLUB 2ZDAH 4RSPA 1HAOH 1SGFG 4BAOB 1HLTH 2P93A 1OWHA 5HMAA 2ZCKP 1FIZA 4DURA 3ZZ4A 1SL3A 1HB0B 1BB0B 2GVFA 2G81E 2XC0A 4YT7H 3KQEA 3LIWA 1FQ3A 1KDQA 5TCAA 1AN1E 3GY8A 2G4TA 2FDAA 1IQIA 1P06A 1A61H 1GI1A 1QBNA 4YO9A 2R2MB 1EZUC 3BSQA 2BDCA 5EPNA 1GDUA 3L6PA 4B76A 4JZIA 1JOUB 3O8BA 2EC9H 1CGHA 1UTLM 3PMBB 1D6WA 2ZQ2A 2FXRA 2HWLB 3SV6A 1OS8A 3DD2H 2XW9A 1GHAG 4NIXA
chains in the Genus database with same CATH superfamily
1QGFA 1TYNA 2ZHWH 1GVLA 4TY7A 3WWFA 1RD3B 1GBBA 2ZWLH 1S85A 2CMYA 1VITF 2QC2A 3V7TA 2ANYA 1WXRA 3PMAB 4WMEA 1B0EA 2HPPH 1GHZA 3L33A 1HCGA 2BDGA 5EQQA 1O3GA 1VITH 1QL8A 1K0HA 1O34A 1W7GH 2XWBI 2VWNA 1FUJA 2RA3A 2PLXA 2CF9H 4X1QU 2KZ4A 1F5RA 3NXPA 1OKXA 2LELA 1GBCA 1HAYB 4IC6A 1G2MA 3LKWA 2JJ1D 4CHAB 5LPRA 1FAKH 4B71A 1HAVA 1THRH 3Q00A 2IOTA 5HGGA 1LHEH 4BTUB 1MBQA 2ZFPH 1O2TA 4R8TB 1HRTH 4GCHF 3P70B 3GDVA 1MUEB 5GNDA 3NUMA 5K7RA 5HM9A 1TNLA 4BAHB 2W7SA 4Q7ZA 2A1DB 4Y11E 1Q31A 1SC8U 4MPXA 2FI5E 4KELA 1WTGH 1YBWA 1BMNH 3A7XA 1V2KT 2WSSD 1FPCH 3TGIE 1C9TA 2ZEBA 1QB9A 1GMCG 2O8TA 3LJOA 2DE9A 1C2HA 4AFZA 3TIUA 3UR9A 4CRFA 8ESTE 2J5UA 5ETXA 3RXQA 3GY3A 3A8DA 2JDID 1CA0C 2WPHS 1ZTJA 2PKAB 1BHXB 3OTPA 1ZLRA 4K8BA 2XYAA 1DXPA 3FO8D 5DK1A 2AGIX 2GZ9A 4DIIH 2FZZA 1RRKA 4FUHA 5CHAB 1WOFA 1HJ9A 1NY22 1NBME 2RCEA 3B23B 1TA6A 4ZMAH 1ZMLA 3PLBA 3TJVA 1LHFH 2GP9B 1GI5A 3TK9A 4ZHMU 3RM2H 2HPQH 4JCNA 3VXEH 3LU9B 3TH4H 1ZJKA 4B2BA 4WVPE 1Y3VA 4K1SA 1MAYA 3GCOA 3ZZ3A 4YOJA 6LPRA 1EUFA 2ZU2A 1ZTLA 1C5VA 3PMHB 5DSFA 1ZTKA 2YMSC 6CHAB 1O5BB 1UTNA 2P8OB 1GCDA 3UQOA 2O9QA 3QLPH 1XMNB 5CMXH 1F5LA 4FUBA 2AIQA 2TGPZ 4B75A 1NRQH 3KYGA 5FPTA 1YYY1 1C1MA 1GG6B 2VNTA 1ZYOA 1GMHF 1C2KA 3D23A 1YPKH 2EI6A 3PLPA 4Z6AH 2ZGCA 1QB6A 2ZCLP 3WW7A 1S6LA 2SGDE 1GVZA 3DSOA 3F3BA 4FETA 2J38A 2GMTB 3W1EA 5T1VA 1SI5H 2GZ7A 4X6PA 2ZKSA 2FYRA 1LHCH 4TPIZ 2OC7A 4MPVA 1H8ED 5GCHF 3ENSB 1G37A 1SFIA 2STAE 4I86A 1AD8H 2O8UA 1NFWA 1BT7A 3MI4A 2BDBA 3RXDA 4K69A 1IQKA 2LP6A 1O3BA 1D3PB 4I8KA 3KL6A 2RDEA 4OS5A 2FX4A 4BNRA 3KCGH 4FUGA 1C2FA 1GDNA 1FIWA 1C5UA 2A31A 2NWNA 1CT2E 4NWLA 2BY7X 3BTEE 4A5TS 1WCZA 3M5NA 3N99A 2XCFA 1GJDB 1N1LA 3EYDA 3KNXA 2J97A 1A4WH 1H1BA 5F8ZA 5EW1H 3KHVA 4MDSA 5I25A 3GDUA 4NFFA 2SFAA 3EGKH 2AMQA 3A87A 2QGRA 3UAIC 2K0QA 4DJZB 6GCHG 1S0QA 2A4GA 3KIDU 2VH0A 2ZFRH 1NC6A 3RM0H 2ODYB 2EY4C 2XC5A 5I46H 1P05A 2FOMB 1QJ1B 1C2MA 5DP6A 1LTOA 2FMJA 3SJ8A 1PQ5A 1VJ9U 1O32A 2QAAA 2Z94A 1O39A 5GJ4B 2G4UA 2BZ6H 2GCHG 3GCHC 3TGJE 3P8FA 3RLWH 1AY6H 1FMGA 1GWAA 3A80A 1V6DA 4DT4A 1VGCB 2Q1JA 5C67A 1YGCH 5DP9A 3RU4E 1O35A 2EA3A 1OP0A 1ANEA 5DP3A 3MH5A 1S6FA 1ZRKA 4RN6A 1P10A 1AVWA 1SGEE 1LVMA 1SBWA 4O3UA 3HGNA 3Q3KA 4JYTA 2ZG0H 4PROA 3BTDE 1QQUA 4HZHA 1EJNA 1JWTA 2NU1E 5F8TA 1WV7H 4MQAA 1AHTH 1IQMA 4XD7D 3PRDA 3UOUA 2ODQA 1CBWC 5EJZA 3RXVA 5EJ1A 2BDIA 1SGTA 2QF0A 2ZQ1A 3A7ZA 4AGKA 2FWWA 4X2XA 1GBKA 1FAXA 1K1MA 2A5AA 2OTVA 1GBDA 1DWCH 1AB9C 1T7CA 5EQRA 1O2GH 1GHVH 1SGYE 1ARBA 1K2I1 2BVXH 2BD8A 3S9AA 2K1QA 3MHWU 5HM2A 4UFFH 3PWCA 3M7QA 3CP7A 2ZPSA 2OBOA 1N6XA 2Q6FA 2ANMH 3RDZA 1KXEA 3AK5A 2ASUB 3PYHA 4OGXA 1YLCA 1BZXE 3SHAH 3LGIA 1DUAA 4KGAA 3MH7A 3U8OH 1D3QB 3QUMP 1G3DA 1G3CA 3NZIA 4IS5A 5AFZH 3PTBA 4X1RU 1EB1H 2AGGX 4E7RG 2Z7FE 4X8SH 1P2JA 4BOHA 1ZPBA 4X2VA 1PQ8A 2GT7A 4X8TH 2HVXA 1P11E 1QHRB 1UJ1A 2PKSC 1QURH 3IG6B 2BDYA 3M7TA 3OEHD 1QCPA 2TGDA 1FY8E 1NBMD 1TBZH 5CE1A 1EXFA 1P2QA 4M9FA 2FI3E 4X2WA 3GYLB 3SUGA 1LPKB 2J94A 3RC6A 4D9RA 3ZZ9A 1FI8A 1A5HA 2BD2A 3QN7A 4CBOA 4ABJA 1MCTA 2HNTE 1L4DA 2UUJB 1GHAF 1G2LA 1RIWC 3RMOH 1Y59T 2ZHDA 2C8XB 3NPSA 2PGBB 3MMGA 3SO3A 1DY8A 2AMDA 2IPHA 3FOAA 4O3TA 1TNKA 4I8LA 3EE0B 5HKKD 1LVBA 4HI3A 2JKHA 3PWBA 3JZ1B 1QRWA 1MZDA 4WH6A 1FY5A 2BQ6B 1AVGH 1FDPA 1ZHRA 5C5NA 1PJPA 2Z9KA 2CF8H 2XNDD 1NU7B 1XXFA 4OS7A 3NWUA 2BLWA 2SGEE 3T25A 2XNIA 3M61U 1HAPH 1QNJA 3BG4C 1KLJH 4VGCC 1CA0B 3MH4A 1QIXB 1E79D 1SGIB 1C5LH 4CRBA 1IQHA 4E06H 1YPGH 3ITIA 3PMJA 4Y79A 5TCCA 1XUGA 4X1SU 1GBJA 1QRXA 4ZXYH 1AKSB 7KMEH 2D1JA 2JJ2D 3BEIB 1QFKH 2YOLA 1TE0A 2BX4A 1P12E 1C5SA 1O3DA 1PQ7A 1Z6JH 5E0GA 3SNBA 3ZZ5A 2Z3CA 3GCNA 4NA7A 3S69A 2HLCA 4KKDA 4CH2B 3RXKA 2WV5A 4ISNA 2PTCE 4SGBE 2BY8X 2ZECA 1LPZB 1HFDA 1GMCF 1ZGIA 1ELGA 3VXFH 4XFQA 3SI4H 1GBAA 2YMSB 3OAAD 4FU7A 7LPRA 2AGEX 4INHA 1Z8IB 1O3PB 2STBE 5EIYA 1A0HB 5FCKA 1DX5M 1ELCA 2XBVA 3P17H 3RU4T 1ZOMA 2F9OA 3LJJA 3S7HB 3SUDA 3BTTE 3M35A 1QJ6B 1JRSA 1O3OA 1C5OH 3I77A 1CGIE 1P8VC 3LONA 1A2CH 1E38B 2WUCA 4ZKNU 1CO7E 4HTCH 1EPTA 4UD9H 1TONA 1HJ8A 4IMZA 1TGSZ 5FBIA 3K6YA 2P94A 1S6HA 4NZLA 1SMFE 1K1PA 4XE4A 3VGCB 4B2AA 2G5NA 2WYGA 3F6UH 3KYFA 4XDEA 2GT8A 5GIBA 3RXGA 3E16B 4ABEA 3SJIA 1TX8A 2A2XH 5LPEA 1BTUA 3AW0A 3R0FA 1UVSH 3ZZ8A 4O97A 1YPJH 1D4PB 5FX6A 1OHHD 3RU4D 1SGPE 1B0FA 2BDHA 3ZZCA 2FX6A 3HKJB 4I33A 3FZZA 2BY5X 3BTHE 1O2PA 1TPOA 1UVTH 4OM9A 4Y0ZE 2BD3A 1B5GH 4GPGA 3F9EA 2FODA 4WXIA 3LC5A 4ISHH 4MNWA 1AUTC 1NO9H 1KMHB 5L2YH 1PYTD 1QBOA 2RFKC 1U6QA 1Z8JB 1YCPH 2Z3DA 1JXPA 1FLEE 2AHME 1W11U 3FN8A 5A2MH 3GY4A 3VB5A 4JK5A 1NFYA 3OFND 1BTPA 1EAIA 2H5DA 3D65E 3QWCH 4U30A 4ABBA 4NIWA 1C5WB 5EG4A 2Z9LA 1UK4A 2ZU1A 4GVUA 1P2MA 4ZROA 4ABIA 2O8MA 3RMNH 1F0RA 1YPLH 1F92A 3FP8E 3GCHB 3IWMA 3B9FH 2KAIB 2K8IA 3H7OA 2XOKD 1QA0A 1FN8A 3STJA 1LDTT 1SVPA 1UVUH 3H5CB 4ZKOU 3TK6A 1UCYK 1GJ6A 5F53A 2NU3E 5LH8A 3SU4A 1MABB 2FOFA 1W3CA 1C5NH 1O33A 3M3SA 3SJ9A 1C5TA 4TT3D 1F0UA 5EU8A 3SV7A 1O2KA 4CH8B 3P92A 5PTPA 6GCHF 1UW7A 3H09A 2NU4E 8GCHG 1P01A 3BTME 3PRBA 2QV1A 2HOBA 3RC5A 2Z9GA 3U8RH 3A81A 5FPSA 3LC3A 1AQ7A 1ABIH 4AFSA 1A1RA 5GXPA 1VR1H 3K6ZA 4UFDH 7GCHG 2ALPA 3ESTA 1DUEA 1AB9B 2GCHF 2VWMA 2Y5GA 1F0SA 2R0KA 4OS6A 1FZZA 3TJNA 1GPZA 3VEQB 4B1TA 1CVWH 1UO6A 2FO9A 3CS7A 1ELTA 2TPIZ 2ZTZA 1BRAA 1D9IA 1C2EA 4TPYA 7ESTE 2A5KA 3LGVA 1MTSA 1IOEA 2FOCA 3I29A 1O2MA 1O2OA 4H6SB 1DWDH 3SUFA 3TITA 4BTTB 3UNSA 1E1RD 3QGJA 4RKOB 2V3HH 4MTBA 3C1KA 2BLQA 5H4IB 4AORA 3A84A 4CRDA 3RXRA 1C1SA 3ZVEA 2BOKA 1RS0A 1HPGA 1GI2A 3RXFA 1O5FH 1MKWK 3UTUH 2ZHFH 5GPIB 4A1VA 4XSKU 1O2IA 1O5CB 1QL7A 2CHAB 3F68H 8KME2 1J16A 3MNBA 3MO3A 2XTTB 3A83A 3ZZ7A 1HAVB 2OCVB 4Q2KA 4GHTA 1AZ8A 1XXDA 3PO1C 1DANH 2NU0E 1Y5AT 1E35B 4THNH 1WDIA 3SNCA 3EA7A 1A3EH 1TMBH 2Y7XA 1ELVA 1V2WT 1T8OA 1J8AA 1HAXB 3E91A 3M5MA 1ZPZA 2JH6D 3JZ2B 3K9XB 2P3UB 4AYYB 1DITH 1AMHA 3QDZB 2ILNA 3T29A 5AHGH 1AU8A 1MTNC 2NU2E 2KCAA 1CHOG 3OSYA 2FLRH 4NG9H 2YNBA 4DT7B 3KQDA 2C90B 3BG4B 1NRNH 1T31A 2BQWB 1E36B 3MU0A 4IC5A 1O3EA 2WPIS 2GCTC 4CREA 4B73A 4NZQA 4IMQA 5TJXA 2WPMS 1ETRH 5DJ7A 2PUXB 2Y81A 1FJSA 2P59A 3SZNA 1HIAB 3DUXH 4ABAA 1G9IE 2D26C 4U2WA 3D49H 1ANCA 4JZDH 2R0LA 2AS9A 2LPRA 2B9LA 4WMFA 1V2TT 1W0YH 2V0BA 2ZF0H 1GBHA 4IBLH 1GL1A 2VIVA 1O2WA 3U28C 4YTAA 3P8OA 1LQDB 1P2OA 4X8VH 2M2AA 2SGQE 3T2NA 5K0HA 1GI8B 1YLDA 5T3HA 1D6RA 3RXJA 1NRPH 1AFQC 1VCQA 3UNQA 1UK3A 1BTZA 1A46H 1WQVH 1WSSH 4MNXA 5IDKA 4AN7A 2I6QA 3BTKE 4I8HA 4KTCA 5J4SA 2QF5A 2J92A 2C4FH 4I31A 4NA9H 1WU1A 3MTYA 1ETTH 3RUOA 1J17T 1E37B 4NSYA 3TK5A 1P3CA 1ARCA 2H1UA 1TOMH 1W8BH 2Z9JA 1AO5A 1C1RA 2ZU4A 2BVSH 1BDAA 1VZQH 5FHTA 4B6EA 1QTFA 4HFPB 4Y7AA 1ACBE 2QYIA 5EJLA 2J9NA 1EPTC 5L2ZH 2CXVA 4A1TA 1SLXB 4E7NA 1AWHB 4ABHA 3TGKE 2VINA 4R0IA 2H9EH 2ZTXA 3S9CA 1KIGH 2GKVE 1KLIH 2F9VA 3SV9A 2QE7D 2GJGA 3MNXA 5A0BA 2WZQA 3I78A 1JIRA 1YKTA 2HALA 4K1EA 3ZZAA 3TLOA 2BHGA 1GHBG 1OWKA 1TPAE 3FZDA 4OS4A 5IK2D 1OWDA 3Q77A 1YCPK 3SBKA 1TLDA 2QXGA 1W7XH 3ZV8A 5E2PA 3H7TA 1O2VA 1RTLA 4BAKB 4UEHH 1MTVA 1JRTA 3SQHE 5C94A 3MU1A 4U01A 1E34B 5EODA 2FESH 1EASA 2Q6DA 1TRNA 5FL7D 3A82A 1SG8B 4LK4A 2G00A 2BLOA 2WPJS 4TSFD 3TNSA 1HV7A 2G8TA 1ZHMA 1HAZB 1LVOA 2A2QH 1C2GA 1YC0A 3OTJE 1CT0E 2W3IA 2QN5T 4B74A 3QGNB 2H9TH 2QF4A 4F4OC 4MNVA 4AYVB 3B8JA 1XKAC 3CENA 3GDSA 3RXCA 3RC4A 4K5ZA 2XBYA 1LHDH 1K1IA 3BN9A 3ELAH 1GI7B 1C1QA 1GVKB 1P57B 2UUFB 1T4UH 3P95A 5A0CA 1O31A 1O5EH 3SGQE 2WINI 3ZYDA 1DLKB 3RP2A 1Y5UT 2OQ5A 5HIYA 1FONA 1PPGE 2TIOA 5AF9H 3BTWE 3MO6A 1C4V2 3F1SB 3N7EA 2ZDMA 3SGBE 1YP9A 3GOVB 3UY9A 4XRNA 2QIQA 3MWIU 2FOBA 2OQUA 4YLQH 4Y76A 3M37A 4MPUA 1IQNA 4A1XA 5JDUB 1J9CH 3K65B 4F49A 1LO6A 1DY9A 1DXWA 3RXPA 9LPRA 3NRLA 2ODPA 2R9PA 1TNIA 4H6TA 2ZDNA 2P95A 2H5CA 1WQSA 2ZI2H 4BANB 1LQEA 5JBBS 1FV9A 1ANBA 2OBQA 1OPHB 5E2OA 1Z1JA 1PYTC 1QZ8A 5F03A 4NIVA 3EE7A 3M3VA 3VG8A 3ZVDA 3E0NB 3RXTA 2ZZUH 1RFNA 4ASUD 1LHGH 2DUCA 1BMMH 5BRRE 1BITA 4HGCA 1O3CA 2OC8A 1PPZA 3GS9A 3PV4A 3TH3H 4X1PU 2PUQH 1YPMH 3SNAA 1PQAA 3TVJB 1YF4A 1T4VH 3SI3H 1JIMA 5DGJA 4XOJA 2H6MA 2A7HA 4ACAA 1HJAC 3EQ0H 4CR5A 1ZSJA 3MYWA 2FLBH 3GICB 4UFEH 3ATKA 2BLVA 2GTBA 1V2ST 2SNWA 3GCTG 2LNCA 2ZFSA 1G3BA 2KCOA 8GCHF 2XRCA 4CBNA 1MU8B 1TALA 1UCYH 3TPIZ 2ZGJA 3SNEA 1NM6A 1OSSA 4CR9A 1GBTA 4FUCA 5F8XA 3U98H 1KXFA 3LH1A 3EA9A 2BXTH 1BTXA 1TPPA 2QXIA 2UWPA 1XVMA 2EEKA 4DGJA 2PP6A 5JBCS 3URDA 7GCHF 1C5PA 1PPBH 2BZAA 2H2ZA 3KN2A 2R3UA 4RKJB 2FOEA 1XM1A 1TX7A 1YCPM 1QB1A 1BOQA 3P6ZB 2QXHA 3LOXA 4AGJA 2RG3A 3U1IB 1MAXA 1ZJDA 2P3TB 8LPRA 4Y8ZA 2ZFTA 1P9UA 1GGDC 2HNTC 1GBMA 3ZZ6A 4FUJA 4LZ1H 1PFXC 3S7KB 3ATLA 3V12A 2ZO3H 2P16A 3M7UA 1NTPA 1Z7KA 5C17A 3VB7A 1OWJA 2A4QA 9ESTA 1ABJH 1C5XB 3QZQA 5EOKA 4LXBH 1MTNB 2HGTH 3KEEA 1W0ZU 1UMAH 5F6MA 1HBTH 1XUHA 4AOQA 4QT8C 1ELDE 1ELBA 2IJOB 4AFQA 5J4QA 1O3IA 4YESB 1MKWH 2GZ8A 3RXIA 4YZUA 2ZU3A 1UTKA 3HGPA 4AB8A 3U1JB 1SKYE 1TABE 3BIVH 2ZHQH 2CV3A 3MNCA 1GHYH 2QA9E 4MPWA 1N6YA 1OOKB 3Q3YA 2HVYB 1ZPCA 4CRGA 3A86A 1GCTC 1K1NA 1L4ZA 1FY3A 4ESTE 1V3XA 4B2CA 1TRYA 3KGPA 3L3TA 2BD9A 1YLNA 1P09A 1XUIA 3HKIB 1AZZA 1CHOF 4RT0A 3SU5A 3O8CA 4F48B 5EGMA 1X7AC 1JMOH 2Q6GA 2XWAA 3UIRA 1V2MT 1V2JT 1SGNE 1KTSB 1GJ5H 5DP5A 3RXOA 1P9SA 2XCNA 3OX7U 3LGUA 5CDFE 2BM2A 1SLVB 2PSXA 2PV9B 2Y5FA 1UCYE 5SGAE 2VVUA 4BTIB 3U8TH 2GDDA 3DSGA 5KEDA 1T32A 5E8EH 5EQSA 2TRMA 1XUJA 1UTJA 2YMSD 1FY4A 2I6SA 4X8UH 1FN6A 1UTOA 2IJD1 3CS0A 3TU7H 1OWEA 2XXLA 1FNIA 2AERH 2JH5D 2G5VA 3MNSA 3FFGA 1V2PT 4AZ2B 3SHCH 1DOJA 1GHXH 4I32A 1DDJA 4B6FA 3A7WA 3DCLA 1NU9A 2GD4B 2C3SA 3F0PA 2A4RA 2CN0H 2AIPA 1O2YA 3FAOA 2SGAA 5JBTA 1VKYA 2W6JD 1BTYA 4GLYA 3BV9B 1H9IE 1QRZA 3DFLA 1A5IA 4AC9A 3AAUA 1EAUA 5CHAC 1HAGE 1ELEE 1AKSA 2VWLA 3SN8A 1C2DA 1EP6A 1IAUA 1WUNH 3C27B 5FCRA 3RXSA 4X6OA 2OP9A 2BTCE 1SQRA 4YM9A 3DHKH 1SOZA 2CGAA 3A7TA 2V35A 1S84A 4YOIA 1ID5H 3FKSD 1PPEE 1QL9A 1Y3YA 1EZXC 5CHBA 2ZTYA 2VGCC 1QR3E 1YPHC 2F4LA 1PPFE 1GHBF 1HXFH 4MG3A 4IN2A 3SJOA 1MQ6A 3DFJA 6CHAC 3ATMA 1C9PA 1NPMA 2P8OC 1UHBB 1SSXA 2G55A 1TRMA 4M7GA 3SU2A 3S9BA 1C2JA 1EP5A 3QTOH 4GHQA 1W12U 4X0WU 1GG6C 4J1YA 3DSPA 1KXAA 2O8WA 2BD7A 4FU9A 4HG6A 3T62A 3V3MA 4Q80A 3ZVGA 3ZVCA 1V2LT 1BRUP 1GJAB 3KQ5A 2GMTC 2H9HA 1EX3A 1OX1A 4ISLA 1G32B 2W3KA 5GDSH 2G51A 1QQ4A 1VCPA 4I8JA 1BTHH 5DP8A 3VB4A 3UWIA 1UTMA 4X1NU 4ZXXH 1S5SA 1Y3WA 3FP7E 1C4Y2 1P04A 3DT0H 3ATIA 1C1NA 2ANKH 1DFPA 1GJ9B 1DM4B 2VIDA 5JBAS 1TGNA 4LOYH 1MMJN 3M5LA 3F2HA 1OYTH 3M3TA 2HLDD 1O2XA 3AASA 1W14U 4D76A 2RDLA 2BYAX 3GISB 5T6GA 2L74A 2W26A 4JZ1A 3ODFA 5EXLA 4Q4LA 1EFRD 2OLGA 1GBEA 5E0JA 2ZHEH 2ANWA 4MNYA 4Z0KA 1KDQB 1CBWB 2A45B 2DE8A 2KFWA 3LGTA 5AFYH 1CSOE 1W2KH 1MKXK 2ZU5A 2KCPA 5JB8S 3STIA 1TIOA 2O8LA 2QCYA 1O3JA 2J98B 1O37A 3UPEA 6ESTA 1A0LA 1Z8GA 3D62A 4OGYA 3A7YA 4INKA 3BTFE 1VJAU 1COWD 1MZAA 4NCYA 1SLWB 5BPEA 1DPOA 2AFQB 3MFJA 1UTPA 2L6OA 3OU0A 4ZHAA 2PFEA 1EOJA 3E3TA 4FUEA 4I8GA 4BXWA 3SU0A 2FI4E 3ZV9A 1Z6EA 4OS2A 1GMDF 1TMUH 1VGCC 3ZVBA 1BIOA 3SZEA 5C0UA 1GGDB 3EA8A 3SV2H 1SGRE 1KY9A 3ZZBA 1T8NA 1IQLA 1DT2A 4TYDA 4UFGH 1G30B 2FS9A 2PTNA 3UB0A 2FS8A 5C1XA 4WH8A 1TNJA 1W13U 1HGTH 1GBFA 2PKSB 4DW2U 1P2KA 1C2IA 3LGWA 2M5TA 3GCTF 1S82A 1AE8H 2JIZD 4X2YA 2CJIA 1MQ5A 4Q7XA 1GBIA 2PW8H 2Y6TA 1Q3XA 4K2YA 3RXMA 1UK2A 1GJ8B 3SGAE 1SB1H 4FVDA 3BEFB 3F9FA 3SU3A 4KTUA 2FOAA 3MH6A 3RXLA 2Y5HA 1RIWB 4MVNA 2BB4A 2GV6A 1O5GH 2VVCA 3W94A 2C8WB 3QX5H 2WUBA 1YM0A 1BUIA 3RXAA 4IGDA 2VVVA 3LPRA 4K3JA 1V2NT 1ESAA 3UOPA 2FPZA 4ZKRU 4H42U 2BY6X 4Y10E 1RXPA 1QJ7B 4NFEA 5FBEA 5FX5A 3GY6A 2FTLE 2VJ1A 1GCTB 5C20A 1WTHD 3MOCA 5G4BA 5FPYA 1PPCE 3OEED 1BRCE 1EJMA 4VGCB 4A6LA 3UNRA 4Q7YA 4WMDA 2A0QB 1L0ZA 1RGQA 3LGYA 1XUFA 1S0RA 1YWUA 4KTSA 1HAIH 2J95A 3MU4A 3FP6E 5FXLA 1HUTH 2QF3A 1PPHE 2F9PA 1GI9B 2WPDD 1IHSH 3IITA 1MTUA 2V3OH 2ZFQH 2F83A 5JPMH 2Z3EA 1W0KD 4BXSA 3SU1A 4TWWA 2ZGBH 2XC4A 1HXEH 1N8OC 3SU6A 2ZP0H 2VIOA 5DN6D 1ANDA 1BCUH 4NWKA 3AAVA 2ESTE 4MLFB 1V2RT 1OYQA 1O3NA 3RXHA 4BAQB 4LZ4B 3BIUH 2A7JA 1IQJA 4KP0A 4UONA 2BDAA 1CT4E 1H9LB 1O2JA 3T26A 1ORFA 1IHTH 1WYKA 1QA7A 5KGOA 3E90B 1KYNA 3U69H 1TA2A 3FVFB 2OXSA 1SGFA 3KF2A 2KCYA 1BA8B 1ZHPA 3RLYH 2A7CA 1C1VH 5DG6A 2GV7A 1NFUA 2WPKS 4X6NA 1O3HA 4DIHH 2C93B 1TBQH 1AFEH 1SGCA 2BVRH 1ZZZA 1P2IA 4AFUA 1HIAA 1O2RA 1H8HD 1TGCA 3RXUA 3GYMA 2W5EA 2ZGHA 1SHYA 2F43B 3SV8A 1TOCB 4UDWH 1SQOA 2VIPA 1M9UA 3W95A 3SQEE 1G36A 1ESBA 1H8DH 3AW1A 2PSYA 1C5QA 2Z9IA 4YXWD 4ZCNA 5A8XA 3NK8A 1O0DH 5DKMA 1ESTA 2FOHA 1Z71A 1GI6A 2VGCB 2J34A 2PGQB 3K2UA 1EATA 4H4FA 1XKBC 2F91A 1NESE 1K1JA 3PB1E 2PKAA 1HAHH 3P8NA 1NS3A 2BX3A 2ZFFH 3R3GB 1WAYB 1E1QD 2QY0B 3T27A 3ODDA 3TH2H 2UUYA 2UUKB 4FUIA 4P02A 2SGPE 3PV2A 4ABFA 1ELAA 1S83A 3WWBA 5ABWA 1J14A 2V3MA 3NKKA 3MQKC 1KLTA 2B0FA 1EJAA 4ZHLU 1TBRH 2TBSA 2BMGB 3MU5A 1O2SA 3ATWA 1O38A 3HATH 1Z1IA 1L1GA 1V2OT 2FIRH 1AI8H 3VGCC 1FXYA 4RT1A 2R2WU 2OC0A 4J2YB 1O2UA 4ASHA 4DG4A 1EKBB 1O30A 4BAMB 1TGBA 2FEQH 2A5IA 2WPLS 2BY9X 2BXUH 3VB3A 1C4U2 1QBVH 3CNRA 3A7VA 1FPHH 2W6ID 1EAXA 3RXEA 4Y6DA 1BMFD 1T8MA 1EB2A 2TGAA 1AE5A 1UVPA 1BRBE 1ZSLA 1GI0A 1BJVA 3E6PH 2EQNA 5C5OA 1XUKA 2Y82A 3A8CA 2OK5A 3UFAA 1MD7A 2KX4A 3NCLA 1XX9A 4AG2A 5A09A 4Y7BA 2VIQA 1C1PA 1C1TA 2Z6BD 1P0SH 2ZIQH 2HNTF 3TJOA 1T8LA 1K28D 3V13A 4DY7B 1YY3A 3OE7D 1ZRBA 1ZGVA 2EI8A 4ACBA 1AVXA 3QTVH 1TFXA 5IYTA 3OY5U 1A0JA 1EQ9A 2ZNKH 4WJG2 1TMTH 3BTQE 1GMDG 3A85A 4ABGA 2WV4A 2FM2A 2XBXA 2SGFE 5JB9S 1ZMNA 1KSNA 1C5RA 3BTGE 3LDXH 1C5MD 4DCDA 1JBUH 2AEIH 1DWBH 1LPGB 3QK1A 2AH4X 3TNTA 3T5FH 1ETSH 2D2DA 1H8IH 3PM3A 1A3BH 1BQYA 1TX6A 4TWYA 4K60A 3QZRA 2D8WA 3URCA 3N7DA 4Q63A 1BBRH 2VIWA 1D3TB 1LVYA 2VBCA 1O2ZA 5FAHA 3UWJH 1TAWA 2IN2A 2JETC 1NT1A 1F7ZA 1P2NA 5ESTE 2VU8E 4A7IB 3EDXB 3E1XB 3PO1B 4A92A 2RA0A 2BOHB 4NIYA 1MKXH 4WY3A 3N7OA 3ZIAD 1DS2E 2PWXA 1J15A 2UWOA 4OS1A 1XVOA 3PTNA 1SGDE 4FUFA 2GDEH 3SUEA 1IQFA 1GJCB 4K8YA 5DP4A 5C0TA 5L30H 1VITG 1D3DB 5A0AE 3O8DA 4D9QA 1GJBB 5C2ZA 3BF6H 1NN6A 3EAJA 2KR7A 3F2GA 1W10U 2B7DH 4AB9A 2J2UA 2PHBA 4WWYA 3GY2A 4DOQA 3G01A 2A32A 4JMYA 3GY7A 1G3EA 4XBDA 1SFQB 3RMMH 3UQVA 1MCVA 1H9HE 1EZSC 4FVBA 1MBMA 2V6NA 1C2LA 1AGJA 1Y3UA 1DE7H 1LKAA 2F9NA 2VH6A 1A5GH 5EPYA 1SOTA 4FUDA 2GCTB 4Y8XA 1DWEH 4D7FA 4YOGA 1V2UT 2AYWA 2CHAC 2WYJA 4Y8YA 4GCHG 4Z1MD 1SPJA 1A7SA 4CRCA 1YPEH 3A88A 2V7QD 4RI0A 1BJUA 2TGTA 2ZDLA 1Y5BT 5L6NH 1DSUA 1TB6H 3MO9A 1O3AA 1TGTA 1L1NA 2QXJA 3KQBA 3S0NA 3GY5A 3M36A 3ZZDA 1DLEA 5B6OA 3VB6A 5AVDA 4F55A 3LT3A 3Q3XA 1KTTB 1AWFH 1N8OB 5EXNA 1BHXF 1AFQB 4IW4E 1OWIA 1NFXA 3MU8A 4FXGH 4ZKSU 3E8LA 1O5AB 4CRAA 4K1TA 2VWOA 1C1WH 4CHAC 1UTQA 1UVOA 2F3CE 4ABDA 4YLUA 1GL0E 1TNGA 1SQTA 2GGVB 1K21H 3WY8A 1RJXB 2ULLA 1F0TA 3VFEA 1AIXH 2B5TB 3SW2B 1O36A 1CGJE 3SYJA 4ZAEA 1BBRE 1Q2WA 1EPTB 3RXBA 2WHXA 5E0HA 2HRVA 3UREA 1DICA 1O2LA 2ZDKA 2ZDVH 2XBWA 4GSOA 2B8OH 1SR5C 4JK6A 2SNVA 3Q76A 2VB0A 3VPKA 5DO4H 5A8YA 2IPQX 1V2VT 1O2QA 1OP2A 2WV9A 1MH0A 2W7UA 2OC1A 3KQCA 1HYLA 1EOLA 1E0FD 5LPFA 2AMPA 3ZVAA 5HYOA 3UR6A 3A8AA 1GJ7B 1DSTA 1KXCA 2A4OA 1L1JA 4SGAE 2ZCHP 2J4IA 3PROA 4Y71A 1W0JD 1GMHG 2BQ7B 3FANA 4YT6H 1RTKA 5JYIA 4GUXA 5B6LA 3SJKA 1Y3XA 4ISIH 3SOSA 1BMAA 4D8NA 3HPTB 1HNEE 1AUJA 1CU1A 3RMLH 1GDQA 4ZH8A 5GCHG 2EI7A 2Y7ZA 3BG8A 4INLA 2OD3B 1CA8B 4NSVA 1GHWH 4WF8A 1S81A 4UE7H 1P03A 5C3NA 1IQGA 1CE5A 1GJ4H 5DP7A 2C8YB 5C1YA 1GI3A 3LH3A 1DVAH 3U9AH 3OY6U 3OYPA 4FOUC 4JZFH 2ZGXH 3V0XA 1C5ZB 2FOGA 1LMWB 1O3FA 1IQEA 3M5OA 2Y80A 3SNDA 1TQ7B 4IN1A 2THFB 3TJUA 2R3YA 2ALVA 4TY6A 1MU6B 1TNHA 3QO6A 3ZYEA 3P8GA 1Z8RA 2ZA5A 3E0PB 5T6FA 1FX0B 1O5DH 5GWZA 4NA8A 1QY6A 1HDTH 2JH0D 1NROH 2ZC9H 2G52A 1LCYA 3PLKA 1LKBA 1Y8TA 2ZPRA 1K9OE 2P3FH 4O03A 2PR3A 5T6DA 5C1UA 1O2HA 1L2EA 2OUAA 3AVZA 1WBGB 1BTWA 5DPAA 3ZVFA 1MD8A 4XBBA 3PV5A 4AG1A 4AX9H 3T28A 2F9BH 4GAWA 3HK3B 1TWXB 3A89A 5ESBA 1KXDA 5EW2H 1F5KU 1YPHE 2C8ZB 4DVAU 1RTFB 5A8ZA 1C1UH 1NZQH 3O8RA 2ZPQA 5LGOA 1C1OA 4WXVA 3F0OA 1SQAA 3DA9B 1GBLA 1KXBA 4D7GA 1UHBA 1B7XB 1ZR0A 1BBRK 1CQQA 1P02A 1P3EA 1NRSH 1ZMJA 3F9HA 1C5YB 4X6MA 4ISOA 1MTWA 1ELFA 4ZUHA 1HJAB 3A8BA 2FTMA 2GX4A 4NGAH 1SHHB 1TPSA 1OXGA 2BD5A 2F9UA 3BEUA 4XBCA 3HK6B 4E05H 4JYVH 3SORA 1CHGA 2FYQA 1FY1A 1SGQE 3F9GA 1V2QT 1VCWA 2FP7B 1THSH 1GI4A 5HXFA 4Y0YE 1NRRH 4JYUH 1K1LA 1O3KA 5EXMA 5KECA 5HIZA 1EAWA 4O9VA 2BD4A 1H4WA 1TQ0B 2UWLA 1O2NA 2KAIA 4FU8A 2JETB 1INCA 1ZSKA 1O3LA 1BMLA 2YNAA 4I7YH 1EZQA 3UUZA 4JZEH 4U32A 1THPB 1K1OA 1K22H 2OINA 1O3MA 1OP8A 1F2SE 1SLUB 2ZDAH 4RSPA 1HAOH 1SGFG 4BAOB 1HLTH 2P93A 1OWHA 5HMAA 2ZCKP 3F2FA 1FIZA 4DURA 3ZZ4A 1SL3A 1HB0B 1BB0B 2GVFA 2G81E 2XC0A 4YT7H 3KQEA 3LIWA 1FQ3A 1KDQA 5TCAA 1AN1E 3GY8A 2G4TA 2FDAA 1IQIA 1P06A 1A61H 1GI1A 1QBNA 4YO9A 2R2MB 1EZUC 3BSQA 2BDCA 5EPNA 1GDUA 3L6PA 2KM0A 2J98A 4B76A 4JZIA 1JOUB 3O8BA 2EC9H 1CGHA 1UTLM 3PMBB 2CK3D 1D6WA 2ZQ2A 2FXRA 2HWLB 3SV6A 1OS8A 3DD2H 2XW9A 1GHAG 4NIXA 4P00A
chains in the Genus database with same CATH topology
1QGFA 1TYNA 2ZHWH 1GVLA 4TY7A 1RD3B 1GBBA 2ZWLH 1S85A 2CMYA 1VITF 2QC2A 3V7TA 2ANYA 3PMAB 4WMEA 1B0EA 2HPPH 1GHZA 3L33A 1HCGA 2BDGA 5EQQA 1O3GA 1VITH 1QL8A 1O34A 1W7GH 2XWBI 2VWNA 1FUJA 2RA3A 2PLXA 2CF9H 4X1QU 1F5RA 3NXPA 1OKXA 1GBCA 1HAYB 4IC6A 1G2MA 3LKWA 5LPRA 4CHAB 1FAKH 4B71A 1HAVA 1THRH 3Q00A 2IOTA 5HGGA 1LHEH 4BTUB 1MBQA 2ZFPH 1O2TA 4R8TB 1HRTH 4GCHF 3P70B 3GDVA 1MUEB 3NUMA 5K7RA 5HM9A 1TNLA 4BAHB 2W7SA 4Q7ZA 2A1DB 4Y11E 1Q31A 1SC8U 4MPXA 2FI5E 4KELA 1WTGH 1YBWA 1BMNH 3A7XA 1V2KT 1FPCH 3TGIE 1C9TA 2ZEBA 1QB9A 1GMCG 2O8TA 3LJOA 2DE9A 1C2HA 4AFZA 3TIUA 3UR9A 4CRFA 8ESTE 5ETXA 3RXQA 3GY3A 3A8DA 1CA0C 2WPHS 1ZTJA 2PKAB 1BHXB 1ZLRA 4K8BA 2XYAA 1DXPA 5DK1A 4DIIH 2AGIX 2GZ9A 2FZZA 1RRKA 4FUHA 5CHAB 1WOFA 1HJ9A 1NY22 2RCEA 3B23B 1TA6A 4ZMAH 1ZMLA 3PLBA 3TJVA 1LHFH 2GP9B 1GI5A 3TK9A 4ZHMU 3RM2H 2HPQH 4JCNA 3VXEH 3LU9B 3TH4H 1ZJKA 4B2BA 4WVPE 1Y3VA 4K1SA 1MAYA 3GCOA 3ZZ3A 4YOJA 6LPRA 1EUFA 2ZU2A 1ZTLA 1C5VA 3PMHB 1ZTKA 6CHAB 1O5BB 1UTNA 2P8OB 1GCDA 3UQOA 2O9QA 3QLPH 1XMNB 5CMXH 1F5LA 4FUBA 2AIQA 2TGPZ 4B75A 1NRQH 5FPTA 1YYY1 1C1MA 1GG6B 2VNTA 1ZYOA 1GMHF 1C2KA 3D23A 1YPKH 2EI6A 3PLPA 4Z6AH 2ZGCA 1QB6A 2ZCLP 2SGDE 1GVZA 2J38A 2GMTB 1SI5H 2GZ7A 4X6PA 2ZKSA 2FYRA 1LHCH 4TPIZ 2OC7A 4MPVA 5GCHF 3ENSB 1G37A 1SFIA 2STAE 1AD8H 2O8UA 1NFWA 1BT7A 3MI4A 2BDBA 3RXDA 4K69A 1IQKA 1O3BA 1D3PB 4I8KA 3KL6A 4OS5A 2FX4A 4BNRA 3KCGH 4FUGA 1C2FA 1GDNA 1FIWA 1C5UA 2A31A 2NWNA 1CT2E 4NWLA 2BY7X 3BTEE 4A5TS 1WCZA 3M5NA 2XCFA 1GJDB 1N1LA 3EYDA 3KNXA 1A4WH 1H1BA 5F8ZA 5EW1H 3KHVA 4MDSA 5I25A 3GDUA 4NFFA 2SFAA 3EGKH 2AMQA 3A87A 2QGRA 4DJZB 6GCHG 1S0QA 2A4GA 3KIDU 2VH0A 2ZFRH 1NC6A 3RM0H 2ODYB 2XC5A 5I46H 1P05A 2FOMB 1QJ1B 1C2MA 5DP6A 1LTOA 2FMJA 3SJ8A 1PQ5A 1VJ9U 1O32A 2QAAA 2Z94A 1O39A 5GJ4B 2G4UA 2BZ6H 2GCHG 3GCHC 3TGJE 3P8FA 3RLWH 1AY6H 1FMGA 1GWAA 3A80A 1V6DA 1VGCB 2Q1JA 5C67A 1YGCH 5DP9A 3RU4E 1O35A 2EA3A 1OP0A 1ANEA 5DP3A 3MH5A 1S6FA 1ZRKA 4RN6A 1P10A 1AVWA 1SGEE 1LVMA 1SBWA 4O3UA 3HGNA 3Q3KA 4JYTA 2ZG0H 4PROA 3BTDE 1QQUA 4HZHA 1EJNA 1JWTA 2NU1E 5F8TA 1WV7H 4MQAA 1AHTH 1IQMA 3UOUA 2ODQA 1CBWC 3RXVA 2BDIA 1SGTA 2QF0A 2ZQ1A 3A7ZA 4AGKA 2FWWA 4X2XA 1GBKA 1FAXA 1K1MA 2A5AA 2OTVA 1GBDA 1DWCH 1AB9C 1T7CA 5EQRA 1O2GH 1GHVH 1SGYE 1ARBA 1K2I1 2BVXH 2BD8A 3S9AA 2K1QA 3MHWU 5HM2A 4UFFH 3PWCA 3M7QA 3CP7A 2ZPSA 2OBOA 1N6XA 2Q6FA 2ANMH 3RDZA 1KXEA 2ASUB 3PYHA 4OGXA 1YLCA 1BZXE 3SHAH 3LGIA 1DUAA 4KGAA 3MH7A 3U8OH 1D3QB 3QUMP 1G3DA 1G3CA 3NZIA 4IS5A 5AFZH 3PTBA 4X1RU 1EB1H 2AGGX 4E7RG 2Z7FE 4X8SH 1P2JA 4BOHA 1ZPBA 4X2VA 1PQ8A 2GT7A 4X8TH 2HVXA 1P11E 1QHRB 1UJ1A 2PKSC 1QURH 3IG6B 2BDYA 3M7TA 1QCPA 2TGDA 1FY8E 1TBZH 5CE1A 1EXFA 1P2QA 2FI3E 4X2WA 3GYLB 3SUGA 1LPKB 2J94A 3RC6A 4D9RA 3ZZ9A 1FI8A 1A5HA 2BD2A 3QN7A 4CBOA 4ABJA 1MCTA 2HNTE 1L4DA 2UUJB 1GHAF 1G2LA 1RIWC 3RMOH 1Y59T 2ZHDA 2C8XB 3NPSA 2PGBB 3MMGA 3SO3A 1DY8A 2AMDA 2IPHA 4O3TA 1TNKA 4I8LA 3EE0B 1LVBA 4HI3A 2JKHA 3PWBA 3JZ1B 1QRWA 1MZDA 4WH6A 1FY5A 2BQ6B 1AVGH 1FDPA 1ZHRA 5C5NA 1PJPA 2Z9KA 2CF8H 1NU7B 1XXFA 4OS7A 3NWUA 2BLWA 2SGEE 3T25A 2XNIA 3M61U 1HAPH 1QNJA 3BG4C 1KLJH 4VGCC 1CA0B 3MH4A 1QIXB 1SGIB 1C5LH 4CRBA 1IQHA 4E06H 1YPGH 3ITIA 3PMJA 4Y79A 5TCCA 1XUGA 4X1SU 1GBJA 1QRXA 4ZXYH 1AKSB 7KMEH 2D1JA 3BEIB 1QFKH 2YOLA 1TE0A 2BX4A 1P12E 1C5SA 1O3DA 1PQ7A 1Z6JH 5E0GA 3SNBA 3ZZ5A 2Z3CA 3GCNA 4NA7A 3S69A 2HLCA 4KKDA 4CH2B 3RXKA 2WV5A 4ISNA 2PTCE 4SGBE 2BY8X 2ZECA 1LPZB 1HFDA 1GMCF 1ZGIA 1ELGA 3VXFH 4XFQA 3SI4H 1GBAA 4FU7A 7LPRA 2AGEX 4INHA 1Z8IB 1O3PB 2STBE 1A0HB 5FCKA 1DX5M 1ELCA 2XBVA 3P17H 3RU4T 1ZOMA 2F9OA 3LJJA 3S7HB 3SUDA 3BTTE 3M35A 1QJ6B 1JRSA 1O3OA 1C5OH 3I77A 1CGIE 1P8VC 3LONA 1A2CH 1E38B 2WUCA 4ZKNU 1CO7E 4HTCH 1EPTA 4UD9H 1TONA 1HJ8A 4IMZA 1TGSZ 5FBIA 3K6YA 2P94A 1S6HA 4NZLA 1SMFE 1K1PA 4XE4A 3VGCB 4B2AA 2G5NA 2WYGA 3F6UH 4XDEA 2GT8A 5GIBA 3RXGA 3E16B 4ABEA 3SJIA 1TX8A 2A2XH 5LPEA 1BTUA 3AW0A 3R0FA 1UVSH 3ZZ8A 4O97A 1YPJH 1D4PB 5FX6A 3RU4D 1SGPE 1B0FA 2BDHA 3ZZCA 2FX6A 3HKJB 4I33A 3FZZA 2BY5X 3BTHE 1O2PA 1TPOA 1UVTH 4Y0ZE 2BD3A 1B5GH 4GPGA 3F9EA 2FODA 4WXIA 3LC5A 4ISHH 4MNWA 1AUTC 1NO9H 5L2YH 1PYTD 1QBOA 1U6QA 1Z8JB 1YCPH 2Z3DA 1JXPA 1FLEE 1W11U 5A2MH 3GY4A 3VB5A 4JK5A 1NFYA 1BTPA 1EAIA 2H5DA 3D65E 3QWCH 4U30A 4ABBA 4NIWA 1C5WB 5EG4A 2Z9LA 1UK4A 2ZU1A 4GVUA 1P2MA 4ZROA 4ABIA 2O8MA 3RMNH 1F0RA 1YPLH 1F92A 3FP8E 3GCHB 3IWMA 3B9FH 2KAIB 3H7OA 1QA0A 1FN8A 3STJA 1LDTT 1SVPA 1UVUH 3H5CB 4ZKOU 3TK6A 1UCYK 1GJ6A 5LH8A 2NU3E 3SU4A 2FOFA 1W3CA 1C5NH 1O33A 3M3SA 3SJ9A 1C5TA 5EU8A 1F0UA 3SV7A 1O2KA 4CH8B 3P92A 5PTPA 6GCHF 2NU4E 8GCHG 1P01A 3BTME 2QV1A 2HOBA 3RC5A 2Z9GA 3U8RH 3A81A 5FPSA 3LC3A 1AQ7A 1ABIH 4AFSA 1A1RA 5GXPA 1VR1H 3K6ZA 4UFDH 7GCHG 2ALPA 3ESTA 1DUEA 1AB9B 2GCHF 2VWMA 2Y5GA 1F0SA 2R0KA 4OS6A 1FZZA 3TJNA 1GPZA 3VEQB 4B1TA 1CVWH 1UO6A 2FO9A 3CS7A 1ELTA 2TPIZ 2ZTZA 1BRAA 1D9IA 1C2EA 4TPYA 7ESTE 2A5KA 3LGVA 1MTSA 1IOEA 2FOCA 3I29A 1O2MA 1O2OA 4H6SB 1DWDH 3SUFA 3TITA 4BTTB 3UNSA 3QGJA 4RKOB 2V3HH 4MTBA 3C1KA 2BLQA 5H4IB 4AORA 3A84A 4CRDA 3RXRA 1C1SA 3ZVEA 2BOKA 1RS0A 1HPGA 1GI2A 3RXFA 1O5FH 1MKWK 3UTUH 2ZHFH 5GPIB 4A1VA 4XSKU 1O2IA 1O5CB 1QL7A 2CHAB 3F68H 8KME2 1J16A 3MNBA 3MO3A 2XTTB 3A83A 3ZZ7A 1HAVB 2OCVB 4Q2KA 4GHTA 1AZ8A 1XXDA 3PO1C 1DANH 2NU0E 1Y5AT 1E35B 4THNH 3SNCA 3EA7A 1A3EH 1TMBH 2Y7XA 1ELVA 1V2WT 1T8OA 1J8AA 1HAXB 3E91A 3M5MA 1ZPZA 2JH6D 3JZ2B 3K9XB 2P3UB 4AYYB 1DITH 1AMHA 3QDZB 2ILNA 3T29A 5AHGH 1AU8A 1MTNC 2NU2E 1CHOG 3OSYA 2FLRH 4NG9H 2YNBA 4DT7B 3KQDA 2C90B 3BG4B 1NRNH 1T31A 2BQWB 1E36B 3MU0A 4IC5A 1O3EA 2WPIS 2GCTC 4CREA 4B73A 4NZQA 4IMQA 5TJXA 2WPMS 1ETRH 5DJ7A 2PUXB 2Y81A 1FJSA 2P59A 3SZNA 1HIAB 3DUXH 4ABAA 1G9IE 2D26C 4U2WA 3D49H 1ANCA 4JZDH 2R0LA 2AS9A 2LPRA 2B9LA 4WMFA 1V2TT 1W0YH 2V0BA 2ZF0H 1GBHA 4IBLH 1GL1A 2VIVA 1O2WA 4YTAA 3P8OA 1LQDB 1P2OA 4X8VH 2SGQE 3T2NA 5K0HA 1GI8B 1YLDA 5T3HA 1D6RA 3RXJA 1NRPH 1AFQC 1VCQA 3UNQA 1UK3A 1BTZA 1A46H 1WQVH 1WSSH 4MNXA 5IDKA 4AN7A 2I6QA 3BTKE 4I8HA 4KTCA 5J4SA 2J92A 2C4FH 4I31A 4NA9H 1WU1A 3MTYA 1ETTH 3RUOA 1J17T 1E37B 4NSYA 3TK5A 1P3CA 1ARCA 2H1UA 1TOMH 1W8BH 2Z9JA 1AO5A 1C1RA 2ZU4A 2BVSH 1BDAA 1VZQH 5FHTA 1QTFA 4HFPB 4Y7AA 1ACBE 2QYIA 2J9NA 1EPTC 5L2ZH 2CXVA 4A1TA 1SLXB 4E7NA 1AWHB 4ABHA 3TGKE 2VINA 4R0IA 2H9EH 2ZTXA 3S9CA 1KIGH 2GKVE 1KLIH 2F9VA 3SV9A 3MNXA 5A0BA 3I78A 1JIRA 1YKTA 2HALA 4K1EA 3ZZAA 3TLOA 2BHGA 1GHBG 1OWKA 1TPAE 3FZDA 4OS4A 1OWDA 3Q77A 1YCPK 3SBKA 1TLDA 2QXGA 1W7XH 3ZV8A 5E2PA 3H7TA 1O2VA 1RTLA 4BAKB 4UEHH 1MTVA 1JRTA 3SQHE 3MU1A 4U01A 1E34B 5EODA 2FESH 1EASA 2Q6DA 1TRNA 3A82A 1SG8B 4LK4A 2G00A 2BLOA 2WPJS 3TNSA 1HV7A 2G8TA 1ZHMA 1HAZB 1LVOA 2A2QH 1C2GA 1YC0A 3OTJE 1CT0E 2W3IA 2QN5T 4B74A 3QGNB 2H9TH 4F4OC 4MNVA 4AYVB 3B8JA 1XKAC 3CENA 3GDSA 3RXCA 3RC4A 4K5ZA 2XBYA 1LHDH 1K1IA 3BN9A 3ELAH 1GI7B 1C1QA 1GVKB 1P57B 2UUFB 1T4UH 3P95A 5A0CA 1O31A 1O5EH 3SGQE 2WINI 3ZYDA 1DLKB 3RP2A 1Y5UT 2OQ5A 1FONA 1PPGE 2TIOA 5AF9H 3BTWE 3MO6A 1C4V2 3F1SB 2ZDMA 3SGBE 1YP9A 3GOVB 3UY9A 2QIQA 3MWIU 2FOBA 2OQUA 4YLQH 4Y76A 3M37A 4MPUA 1IQNA 4A1XA 5JDUB 1J9CH 3K65B 4F49A 1LO6A 1DY9A 1DXWA 3RXPA 9LPRA 2ODPA 2R9PA 1TNIA 4H6TA 2ZDNA 2P95A 2H5CA 1WQSA 2ZI2H 4BANB 1LQEA 5JBBS 1FV9A 1ANBA 2OBQA 1OPHB 5E2OA 1Z1JA 1PYTC 5F03A 4NIVA 3M3VA 3ZVDA 3E0NB 3RXTA 2ZZUH 1RFNA 1LHGH 2DUCA 1BMMH 5BRRE 1BITA 4HGCA 1O3CA 2OC8A 1PPZA 3PV4A 3TH3H 4X1PU 2PUQH 1YPMH 3SNAA 1PQAA 3TVJB 1YF4A 1T4VH 3SI3H 1JIMA 5DGJA 4XOJA 2H6MA 2A7HA 1HJAC 3EQ0H 4CR5A 1ZSJA 3MYWA 2FLBH 3GICB 4UFEH 3ATKA 2BLVA 2GTBA 1V2ST 2SNWA 3GCTG 2LNCA 2ZFSA 1G3BA 8GCHF 2XRCA 4CBNA 1MU8B 1TALA 1UCYH 3TPIZ 2ZGJA 3SNEA 1NM6A 1OSSA 4CR9A 1GBTA 4FUCA 5F8XA 3U98H 1KXFA 3LH1A 3EA9A 2BXTH 1BTXA 1TPPA 2QXIA 2UWPA 1XVMA 2EEKA 4DGJA 5JBCS 3URDA 7GCHF 1C5PA 1PPBH 2BZAA 2H2ZA 3KN2A 2R3UA 4RKJB 2FOEA 1XM1A 1TX7A 1YCPM 1QB1A 1BOQA 3P6ZB 2QXHA 3LOXA 4AGJA 2RG3A 3U1IB 1MAXA 1ZJDA 2P3TB 8LPRA 4Y8ZA 2ZFTA 1P9UA 1GGDC 2HNTC 1GBMA 3ZZ6A 4FUJA 4LZ1H 1PFXC 3S7KB 3ATLA