1J14A

Benzamidine in complex with rat trypsin mutant x99rt
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRETYNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords trypsin II, anionic
publication title Reconstructing the Binding Site of Factor Xa in Trypsin Reveals Ligand-induced Structural Plasticity
pubmed doi rcsb
source organism Rattus norvegicus
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j14A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j14A02
5JBBS 2ZF0H 2YNBA 3DUXH 4AG2A 3BN9A 1AY6H 2AGGX 4FUBA 1HJAB 1C5UA 4B1TA 1SGNE 1TX8A 2VJ1A 1O3CA 3FAOA 4UD9H 2A5KA 5A8ZA 1EXFA 5I25A 1F0RA 1KSNA 2ZECA 3U1JB 2Z9JA 1ZSLA 1BBRK 1BZXE 1ZRKA 2FI4E 1VR1H 1E36B 2HOBA 2P59A 1YLDA 3VB5A 1QQ4A 3AVZA 2PR3A 2NU4E 3QZRA 1SLVB 2EI7A 4Y6DA 2Z3CA 1EATA 3VEQB 2F9PA 4BXSA 4F4OC 5K0HA 3MU1A 1MBMA 1O2HA 2ZU3A 1TNKA 5FPYA 4XFQA 1OP0A 3QGJA 2V3OH 4CBNA 5JPMH 3OY6U 2BXTH 2DUCA 3GCHB 3BEFB 4BOHA 1O2RA 1C1SA 2ZG0H 2GX4A 4B74A 1BMMH 2FDAA 4AX9H 1ESBA 4BANB 1QL7A 1QFKH 4XBCA 4A7IB 3TJVA 4WMEA 1DOJA 2OP9A 2ALVA 4M7GA 1B5GH 1GI9B 1MZDA 5AFYH 4A6LA 4IN2A 1O2VA 1K1NA 3GCTF 1GVLA 4FXGH 6CHAB 4X8VH 1BHXB 1L2EA 2O9QA 1RS0A 2OXSA 4D8NA 1GBKA 3ITIA 3P6ZB 1V2QT 1ID5H 3TH2H 4YESB 2AIQA 4CRGA 9LPRA 1GBIA 3QTVH 1TOMH 5EQRA 1A5HA 4X1PU 3M7TA 1AB9B 3BSQA 4ZKNU 2DE9A 4Y11E 4CRCA 2O8LA 1HPGA 3E1XB 1NRNH 1MAYA 1SLUB 1A3BH 2NWNA 4AZ2B 1SFIA 1YCPM 2Y81A 1NY22 1ZMJA 1DWDH 3AAVA 1RRKA 2OINA 4SGBE 4K1TA 1D3DB 5JBAS 5EOKA 2Y6TA 2XYAA 5A0BA 1O5FH 1EUFA 1H1BA 2BX4A 2BYAX 3CS7A 4O97A 1T31A 1NU7B 2D26C 4K8BA 1J17T 3TGJE 3A81A 3QUMP 4AORA 1C5MD 1QIXB 1O2PA 4KELA 3L3TA 5HM9A 1MD7A 2A32A 4BAMB 1MTWA 3TJNA 2A1DB 2A7CA 3PLBA 3BIUH 5C2ZA 1PPBH 3KGPA 3UNSA 5DPAA 1L4DA 4A1TA 2BY8X 4NFFA 2FYRA 1DXWA 1O38A 1G32B 1CVWH 1AVWA 3GY4A 5JYIA 3LIWA 4FUJA 3ZVFA 3RC5A 5JBTA 3JZ1B 1FIWA 3MU4A 5EXLA 5F8ZA 4Q7YA 1OYQA 2BLOA 4CRDA 1O2KA 5FXLA 1RIWB 2FYQA 1FONA 2WV4A 2BY5X 1E38B 1WOFA 2QIQA 2ZNKH 3MO6A 5LGOA 1SG8B 2BTCE 4WMFA 3I29A 3F1SB 1BRAA 5GCHF 3SBKA 1HB0B 2GT8A 3RXFA 2P95A 1P2NA 1Y3VA 1E0FD 3QGNB 2BD4A 1B7XB 1O2UA 1IQLA 1MU6B 2FOEA 2WPJS 2Z94A 1BUIA 3E0PB 1QJ6B 2XBYA 1C2GA 3Q3KA 3ZVGA 1P8VC 4X1QU 5C1UA 1BCUH 2SGFE 4MNYA 3MTYA 2BZ6H 4X8SH 2JH5D 1QY6A 1VCQA 5LPFA 1CBWC 2BD5A 4NZQA 3ZV9A 9ESTA 1SB1H 3U98H 1AN1E 3M36A 1DE7H 1SGTA 2ZU4A 3FP6E 3C27B 1LVYA 3G01A 3GCOA 1NTPA 1WSSH 4GPGA 2BQWB 4BAKB 3MI4A 5FAHA 3MWIU 2YNAA 3BTEE 1KDQA 4BNRA 3ODFA 5FPSA 4GCHG 3O8CA 3SU3A 3TH3H 1MU8B 4ABFA 1TNJA 1MKWK 4ZMAH 5EQQA 3F9HA 4GHTA 2OC1A 1BTWA 2P3UB 1ZTLA 1HCGA 4K5ZA 4ABDA 2A2QH 3PM3A 2GTBA 6GCHF 1W7GH 2Z9IA 1Q3XA 1NZQH 3TITA 3LGTA 7ESTE 4FVBA 4UFEH 3RXTA 3T27A 4JYVH 1S82A 3PO1C 4K69A 3LGWA 3TK6A 1S5SA 2Q6DA 1D6WA 3D62A 4XBDA 4ABJA 1OWIA 2R3YA 1GJBB 3ZVDA 2BVRH 2LPRA 1KXBA 3RXEA 1MQ5A 1TMUH 3S9AA 1ORFA 4U32A 1OKXA 4H42U 1TIOA 1DS2E 3RUOA 3SNBA 1ELEE 1KY9A 2H9HA 4FU8A 2B9LA 3KQDA 1LMWB 2XBWA 3TVJB 1OWDA 1QQUA 2R0KA 1HAHH 1DY9A 3ZZ9A 1Y5BT 3A8CA 4NSYA 1ZHMA 5DKMA 4E06H 2ZGJA 1BBRH 1QA0A 2ZFQH 1TNIA 1NPMA 5E0JA 1XM1A 3PROA 1GBMA 1EOJA 1CT2E 2TGTA 1SQOA 1YM0A 1ARCA 3ZZ8A 3NZIA 4QT8C 3UTUH 1ACBE 2P16A 4TY7A 2A45B 3PB1E 1UTPA 1TNLA 2ZHWH 2Y82A 2ZHQH 1O2SA 1GBDA 1OOKB 1OS8A 1NESE 1MD8A 3SOSA 3S69A 2ZHFH 3ZZBA 1C5QA 2PGQB 4X1SU 4D9QA 1GI8B 2FOHA 2G52A 3RXAA 2A4GA 2J2UA 1GVKB 5FCRA 1LKAA 1F5LA 1GBLA 1O5GH 5E0HA 3UNQA 3LGVA 1HYLA 1AFQB 1QRXA 3UR9A 1CA8B 3S7HB 1TFXA 1OWHA 1TA2A 2HVXA 4B2BA 3Q00A 1BB0B 3ATLA 3RU4T 1GGDC 3RXIA 1Y8TA 4GHQA 2R3UA 4OS1A 3SN8A 1D3PB 1GMHF 2XBXA 4TWYA 1OP8A 1O2GH 1K28D 2VB0A 4X1NU 1UK3A 3ELAH 2BOHB 1W0ZU 1C4Y2 2OC7A 1S0RA 3LGUA 2O8WA 2ZFRH 1TA6A 4Z0KA 5C20A 2BY7X 4NGAH 2ZFSA 4YT7H 3OTJE 1HJ9A 1TQ0B 3VB6A 1ABJH 1TX6A 2PWXA 2AFQB 2FTMA 1F7ZA 4INHA 4UDWH 4ISIH 2C3SA 2O8MA 4I8JA 3T29A 1MCVA 2FODA 3M3TA 2CF9H 1CU1A 1VJAU 5AFZH 1LCYA 2FMJA 1AQ7A 1E35B 1EZSC 1Y3WA 2F9VA 1AZ8A 1OP2A 1XUJA 2TRMA 1SGRE 1DLKB 2F3CE 2OBQA 2CF8H 5TJXA 2M5TA 1TGTA 1F5KU 2A4RA 1C2JA 2PGBB 1HJ8A 2J34A 1O5BB 1P57B 2BLVA 5JB9S 3NXPA 1C5WB 5F03A 5DP7A 3T26A 4OGXA 1O2LA 1ZJKA 3AAUA 1SR5C 3SO3A 4OS7A 1YKTA 2GMTC 2JETC 1MH0A 2PKAB 1WQSA 3RXVA 1V2VT 4X1RU 1J8AA 1T8OA 2CV3A 2H5CA 1G30B 3A7ZA 1O5AB 3S9BA 3GICB 2ZC9H 3CENA 3E90B 3SUGA 4PROA 1TWXB 5JB8S 4BXWA 1O5CB 3F9EA 1EAIA 3RXMA 1G9IE 3PYHA 3ZVAA 4MPUA 1Z71A 3LJJA 4AFSA 2GCHG 2FOAA 4AYYB 2OD3B 1GI7B 1K22H 5A8YA 2CHAC 3SHAH 4MNVA 4UE7H 2PKSC 1RXPA 4U30A 1O3BA 3KQCA 4YTAA 2FLBH 4ABIA 1SGIB 2O8TA 2VGCB 1Z8RA 3GY3A 1EJNA 2IN2A 2WPKS 4K2YA 1BTXA 4A1XA 5A09A 1YLCA 2W3KA 1UHBB 3ODDA 4HZHA 5DP8A 1A3EH 1EKBB 1DT2A 1GJDB 5SGAE 1H9LB 2A4QA 3A85A 1Y59T 3E0NB 2ULLA 4MPWA 5A0CA 2UUFB 3RXBA 2ZTXA 5FCKA 4MPVA 3SJIA 3MOCA 1C5PA 2EI8A 1J15A 1ZJDA 3EDXB 5CHAB 3UQOA 4DURA 3PMJA 5BRRE 1LHGH 3A7VA 1HXEH 1AHTH 2ZFTA 2VH0A 2R0LA 4ZKSU 3LH3A 3ZZ6A 4UFGH 5DJ7A 3UWIA 1H4WA 3PTBA 5AVDA 3RXUA 4A1VA 4Z6AH 4KGAA 1H9IE 1UTNA 1GCTB 1ZLRA 2BDGA 2C8WB 1GHXH 1HAVA 2WUBA 3E8LA 3LC3A 3P8FA 1G2MA 2AYWA 3RXRA 1BQYA 1EJAA 3A8DA 3FP8E 2FOGA 1S0QA 1C5LH 1A5IA 2WPLS 1MMJN 1T8NA 2GDDA 4I8KA 1LPGB 1AUTC 4NA7A 3QDZB 5ETXA 3HKIB 2AGIX 1V2OT 6ESTA 1HJAC 4I7YH 1MTUA 1MTSA 3FZZA 1UMAH 1ELBA 3LGYA 2FEQH 3U8TH 2WUCA 3RU4D 1L4ZA 2OQUA 1LHDH 1O3PB 2XCFA 1YBWA 4IMQA 1FN6A 1S83A 3N7OA 2AIPA 4HTCH 5DP4A 1NROH 3ZZ5A 3HK6B 3RXCA 2P3TB 3MMGA 1C5RA 1JIRA 1XX9A 5EXNA 1EPTB 5JBCS 1ZSJA 1C5ZB 3MU5A 4D76A 1BTHH 4INKA 1Y5AT 3BTGE 1S6HA 4JK6A 1BITA 4X6PA 3E3TA 1O3GA 3GDUA 2R9PA 4ZKOU 1Z8GA 5T6DA 4CH2B 1L1NA 1ZGIA 1A5GH 2A5AA 3V13A 1HRTH 4HGCA 1GBAA 1BDAA 4CREA 1TGBA 4E7NA 3LDXH 1O3NA 3SNCA 2O8UA 2UWLA 3MHWU 4Y76A 1QB1A 1LKBA 2PSXA 1O5DH 4Y8YA 3ATKA 3T62A 1D3TB 1PQ7A 3GCTG 1RJXB 1IQEA 4JYUH 2F9UA 2HNTF 1ELGA 3SNDA 4K8YA 1UTOA 2WYJA 1K1JA 2R2WU 3GY7A 1TGSZ 1FAKH 1O3AA 2SGAA 1UTMA 1HGTH 1GJAB 3PMHB 3MNXA 3FFGA 4H6SB 2ZCLP 6CHAC 1EASA 1YCPH 3VGCB 3S7KB 4XOJA 2BXUH 5CMXH 1ZPCA 1GJ7B 4HFPB 3RP2A 3WY8A 2SGQE 1QA7A 3T28A 2P8OB 1AB9C 3DFJA 1QBOA 1LQEA 4WMDA 1VITH 4LZ1H 1AWFH 1ELTA 3Q77A 1P05A 4TY6A 8LPRA 4MLFB 3QWCH 4R8TB 1CA0B 4IGDA 1LVBA 3SU5A 1HAYB 5TCCA 2G4UA 5AF9H 1BMLA 4I32A 3RXGA 1XKBC 3OYPA 1BBRE 1V2ST 1GJCB 1F0SA 4NWKA 2ZWLH 1WQVH 1X7AC 4MVNA 4AN7A 1BTPA 2W26A 2A31A 2FX6A 3F9FA 1NRRH 1DSUA 3GISB 4XDEA 2AH4X 3ZZAA 1MQ6A 1ELDE 4U2WA 2OC0A 4THNH 1V2UT 1KXCA 4WF8A 3SJ8A 4MG3A 3SV9A 3W95A 2SGEE 2QXHA 1K21H 1P10A 1B0EA 3BTHE 1V2TT 1O3OA 1D6RA 4CHAB 4FUGA 1IHTH 1TB6H 2XWBI 2G51A 2XNIA 4IS5A 1Z6JH 4X6NA 1O3DA 2ZGBH 1C5YB 1ETSH 3LJOA 2VIPA 5EU8A 5G4BA 1P2OA 5GCHG 1RIWC 3ZZ7A 1NT1A 1GVZA 1P3EA 3EGKH 3HKJB 1ABIH 3VXFH 5DK1A 1T7CA 2NU0E 2H9TH 3A86A 3BIVH 2FO9A 1CHOF 4IW4E 1Q31A 2ODPA 4TPIZ 1CE5A 3GY5A 3RXOA 1V2WT 2ZPQA 1DITH 1OSSA 2ZDMA 1WYKA 4XE4A 4I33A 2HWLB 1DX5M 4RKOB 2VWMA 3V3MA 1JIMA 3PWBA 2BDBA 2NU2E 1C1TA 2Z9KA 1Z1IA 3H7OA 1YPKH 7LPRA 1GBEA 4GLYA 5L6NH 1SGCA 2CMYA 1KIGH 4Q7ZA 3OU0A 2G00A 3AW0A 1AU8A 3FVFB 4NIWA 4TWWA 1C2KA 2ZZUH 3IWMA 5EODA 1ZOMA 2IJOB 1VJ9U 1FY4A 2QAAA 1SVPA 1UVSH 4B76A 2Y5GA 6GCHG 1S6FA 2Y5FA 1BIOA 1P11E 4Q2KA 4YO9A 1TPOA 4AG1A 1P9UA 1IQJA 2H5DA 1JWTA 2G55A 3IG6B 2VU8E 5GPIB 1UTQA 1XUHA 1C2DA 1HFDA 1H8DH 2C8YB 1V2JT 2EC9H 3SI4H 1EZXC 2OBOA 5ESBA 2ZU5A 4I8HA 1L1GA 5ABWA 3QZQA 1VITF 3SJOA 3SU0A 1EAXA 5PTPA 3OSYA 2Z7FE 3TK5A 1TLDA 5CE1A 2AERH 1EAUA 2GKVE 3RXQA 2BLWA 1JMOH 2QXJA 4INLA 4FUIA 5DP5A 5T6GA 5L30H 4DCDA 1BTYA 1WTGH 4NSVA 1VGCB 3TK9A 2VIDA 1ESAA 2GCTB 2ZGXH 2WPIS 3M5NA 4DG4A 3M5OA 3HGPA 2EI6A 4HI3A 4TYDA 5I46H 3DA9B 3RDZA 1NU9A 4WXVA 1SGEE 1LHFH 4YZUA 3M61U 3PLKA 2QA9E 2IOTA 3SV8A 3M35A 2D8WA 4KKDA 4Y10E 2G4TA 4IC5A 3O8DA 2NU3E 4D7FA 2I6QA 4UONA 4VGCB 1O2WA 3EQ0H 1PQAA 2F9OA 3SUFA 1C1UH 3U1IB 1GPZA 2BD8A 3SU2A 4JZ1A 1S81A 4Y79A 4WH8A 3DHKH 1E34B 2XWAA 2J4IA 1W13U 3D23A 4ZKRU 2HPPH 2JH6D 2XC0A 1IQIA 3VXEH 2BY9X 1XUFA 2UWOA 2THFB 3RXSA 1HAIH 1XUKA 1MTVA 2VIVA 3HGNA 1AKSB 4BTUB 1UTKA 1A2CH 3P8NA 1BTZA 1G37A 3FZDA 1NFYA 1SI5H 1FV9A 3RLYH 3BTQE 1SSXA 5FX6A 1YPHE 1GMHG 3MH7A 1B0FA 2I6SA 1O3FA 2ZHDA 1DVAH 3EA8A 2HLCA 1AFQC 1TYNA 1V6DA 1KTSB 4ZHLU 4TPYA 2BM2A 3ZVCA 4OGYA 1CBWB 4DGJA 1BJUA 1K1LA 1V2RT 5T6FA 4LOYH 1ZPBA 1YF4A 4NIXA 1N6XA 1UCYK 1W2KH 1CGHA 2BDIA 1JBUH 2B5TB 1UVPA 3PWCA 1C5VA 2J95A 3JZ2B 4IN1A 3TGKE 1O3EA 5E2PA 2TBSA 1F0TA 2FLRH 4KTCA 2GZ7A 2P93A 1XUGA 1INCA 1W12U 1EP6A 1GHYH 1V2MT 1DM4B 4AYVB 1NM6A 1VCPA 2QC2A 2SFAA 4FUDA 1XXDA 3SV7A 3ZVBA 2GV7A 1YPGH 1AVXA 1SOZA 5C5OA 2ZDNA 5HYOA 2GZ8A 3E6PH 5T3HA 1FXYA 3U8RH 1YCPK 2QCYA 3RXHA 2Z3DA 1GI5A 1AI8H 3A7XA 3CS0A 1DSTA 2QYIA 2RG3A 1HAGE 8ESTE 2SGPE 1C2FA 1SQTA 3ESTA 3SGBE 1NFWA 2BB4A 3KNXA 1SL3A 1THSH 2XC5A 1O31A 3LGIA 3SV6A 1H8IH 3P17H 1GMCF 3LPRA 4ISHH 3L6PA 4FU7A 2STBE 4JZDH 3PMBB 3UPEA 4AFUA 2VH6A 1O37A 4NG9H 4WXIA 1GDQA 3F6UH 4H6TA 1FY1A 1YPJH 1BMAA 3MNSA 3ATWA 1P04A 1ZPZA 1AD8H 2KAIB 4CRFA 3S9CA 2ILNA 1TAWA 1LVOA 1MTNB 1UK4A 2ZGHA 1MUEB 4NA8A 2ZPRA 3TNTA 4E7RG 1TMBH 3CP7A 2AMQA 1P01A 1GI4A 2ZQ1A 5LPRA 3SORA 1C1VH 1W10U 1NRQH 7KMEH 1KLTA 1P2KA 3QTOH 3S0NA 1A4WH 1C5XB 1W11U 2UWPA 1D4PB 4ABEA 1JRSA 4FUHA 4GUXA 1BT7A 2XRCA 1EP5A 1F5RA 7GCHF 4YOJA 4CH8B 3UY9A 1LVMA 2ZFFH 2Y7XA 4NA9H 1IQHA 1O3LA 1Q2WA 2ZDKA 3TLOA 1QB9A 4WJG2 2ASUB 4NCYA 3RXPA 2QXIA 2HGTH 3BV9B 1P2QA 3STJA 5FPTA 5CHAC 1IQGA 1O2IA 4MNXA 4NWLA 4Q80A 4DIHH 1FLEE 3H7TA 1ZMNA 3HATH 3MFJA 2A0QB 3EAJA 1BMNH 4IC6A 2W7SA 3BG4B 3RXDA 5DP9A 2UUYA 1YPHC 2ZKSA 2OTVA 3ZYEA 5F8XA 4JCNA 1SGDE 3R0FA 1PYTD 3UIRA 1GCTC 4AB9A 1C5OH 1C9PA 1N8OB 1LHCH 5E0GA 1ANEA 1O2QA 1MZAA 2XC4A 3ATIA 3HPTB 4ASHA 1YPMH 2PHBA 2YOLA 2OCVB 1EJMA 1P0SH 3TPIZ 3FP7E 2GP9B 2B0FA 3K65B 3VB3A 2P3FH 5C1XA 2ZPSA 4X8TH 2ZCHP 3A83A 1L0ZA 4YOGA 1QBNA 4AOQA 2IPHA 4I8LA 1GCDA 2ZO3H 1FDPA 2FIRH 5EG4A 1OX1A 1MBQA 1WUNH 2BZAA 1GI1A 1GL0E 1O3MA 1PPZA 1HIAB 3QLPH 4DW2U 1PFXC 3SU6A 3DD2H 1DY8A 4WH6A 3MNBA 3VFEA 1K9OE 1CO7E 3GCNA 1GBHA 1WCZA 2RA3A 2F9BH 4NIYA 1A7SA 1T4UH 1S84A 1BA8B 3KIDU 1MCTA 2FTLE 1P2IA 1RTFB 1C2EA 1KLJH 8KME2 1Z8IB 3EA7A 1AVGH 1K1OA 2TGPZ 3ZZ4A 1O2MA 2ALPA 1QNJA 2VVVA 1C5TA 3M3VA 4K3JA 2ANMH 4B2CA 3RC6A 2OUAA 4LZ4B 1A0LA 1P09A 3V12A 5F8TA 2BD2A 2BY6X 3RXLA 2BOKA 1MKXH 3L33A 1BRBE 3MH4A 2PKAA 1TE0A 4KP0A 4CBOA 3NCLA 4RN6A 2HRVA 1RTLA 1TRYA 1TBRH 1C1QA 2CXVA 1THRH 1O36A 1ZR0A 3KN2A 1HBTH 1SGFG 5EW2H 5GDSH 1EB2A 3P8OA 4Y8ZA 3KQBA 1QR3E 1F0UA 1C4U2 1GMDF 4NFEA 1PPFE 2TPIZ 2B7DH 4K60A 2ZDVH 4RSPA 3V7TA 1TOCB 2GDEH 2TIOA 1DPOA 3KCGH 1C1WH 1TQ7B 2ODYB 2C4FH 4OS6A 3VGCC 5LPEA 8GCHF 1AFEH 2FX4A 1FMGA 2H9EH 1SGFA 1WTHD 2BD7A 2RA0A 2BQ6B 4CRBA 2CGAA 3UOPA 2G8TA 2PW8H 2BVSH 2RCEA 3RM0H 1TPPA 4CR9A 1GHAF 2BQ7B 2P8OC 1KYNA 1SGYE 4O9VA 1FAXA 4ZXXH 1E37B 1WV7H 1UHBA 3HK3B 3ZZCA 1UK2A 1HNEE 2VWNA 3A80A 3GCHC 3LU9B 1BOQA 3SNAA 1YGCH 5DP6A 4GSOA 4JMYA 3SU1A 1UCYH 1CA0C 3BTME 1ZHRA 3FANA 1QL9A 2LNCA 3LKWA 3RXJA 5IDKA 4MTBA 1ZTJA 4UFFH 1NFUA 3T2NA 2ZQ2A 4B75A 5TCAA 4CR5A 4O3UA 3UUZA 1GG6B 1GJ8B 2WPMS 5DGJA 1YYY1 2QF0A 1T4VH 2F91A 1TGCA 3KHVA 2FP7B 2ANYA 2XCNA 3GY2A 1THPB 3SUDA 1AIXH 1TRMA 1V3XA 2Q6FA 1FIZA 1GBFA 1NO9H 2JKHA 1P2MA 5FBEA 2VVUA 1GHBF 2SNVA 2H2ZA 4ZROA 5IYTA 1EOLA 1T32A 2G5VA 1O2JA 4A92A 5L2YH 3RMNH 4CHAC 1BRCE 3MU8A 5ESTE 4BAQB 2BDHA 1W0YH 4O03A 1P9SA 3NK8A 5L2ZH 4O3TA 1EB1H 1NN6A 1FQ3A 1SGPE 3QN7A 3UWJH 2TGDA 1AWHB 4GVUA 1OWKA 2BDAA 1O3HA 2A4OA 3A88A 4J1YA 1CHOG 1GHWH 1NC6A 1O3JA 1GBBA 1RFNA 2BHGA 2FI3E 5EPYA 3V0XA 1PPGE 2UUKB 5GJ4B 5FBIA 2ODQA 3O8RA 2Z9LA 4DT7B 2BD9A 4ISNA 4CRAA 3BEIB 3QO6A 1DWCH 1LQDB 1N6YA 2PFEA 1HLTH 1Y5UT 1O2NA 2D1JA 2FESH 3R3GB 1EPTA 1DANH 1GBTA 1AE5A 2SNWA 1DWEH 2FWWA 1SHHB 2J38A 3UNRA 3EE0B 5EQSA 3OX7U 1FN8A 1TNHA 1VCWA 4H4FA 1ELAA 3K6YA 3VB7A 2BVXH 1WU1A 3U9AH 5E8EH 4JZFH 1AMHA 3A87A 4X6MA 3O8BA 1HV7A 2A5IA 1PQ5A 1Z7KA 2WYGA 1GI6A 1SOTA 1IQMA 2BDYA 2C90B 3RMLH 3SHCH 1C5NH 5GWZA 3MU0A 3F68H 2ZCKP 1P03A 1XXFA 2QXGA 2ZU2A 4ABHA 1NRSH 3KQEA 1VITG 2FI5E 4DY7B 2GVFA 3SI3H 1CGJE 1LTOA 2R2MB 3STIA 3UR6A 3ZZ3A 4U01A 4JZEH 3M3SA 1ZTKA 2FOCA 3VPKA 1CHGA 1AO5A 2FM2A 1EX3A 1JRTA 3MH6A 1QJ7B 4IMZA 1SFQB 4MNWA 2B8OH 4WWYA 1KDQB 2PLXA 4UFDH 4JYTA 2JH0D 4DVAU 2F83A 5DO4H 5EGMA 1RGQA 2VIOA 1VGCC 5EW1H 3UFAA 1BRUP 4WY3A 2GCTC 5C3NA 2AMDA 1SGQE 2BMGB 1GDNA 3I77A 3Q3YA 4ZUHA 4X2YA 4BAOB 1C2IA 4NIVA 1O32A 2FS9A 4KTUA 3URDA 5JDUB 2FPZA 1KXEA 3B9FH 2WV5A 2VNTA 1TGNA 4X0WU 1V2PT 4AFQA 3Q76A 2K1QA 4VGCC 1S85A 1TABE 2C8ZB 3MYWA 1D3QB 2ZIQH 3NPSA 1V2KT 1ETTH 3BTWE 1C1NA 1Z6EA 3A7YA 1OPHB 1QRZA 4LXBH 3W94A 3M5LA 1C1OA 5F6MA 1FNIA 1Z1JA 3SQHE 4D7GA 3F9GA 4UEHH 5GIBA 1DLEA 2ZU1A 1YC0A 2F9NA 3AASA 3PV4A 4ZAEA 1W7XH 5BPEA 3A7WA 1VZQH 4B71A 2ZI2H 1GBJA 1ANDA 4X2WA 3P8GA 1ZHPA 1OWJA 1C5SA 3MO3A 2HNTE 4ESTE 1SBWA 4RKJB 1K2I1 1W14U 1O2YA 1PPEE 2WINI 1TONA 1ZZZA 1XKAC 2V3HH 1QCPA 2P94A 1SLXB 2A7HA 4I31A 4ABGA 1UVUH 2PSYA 1EZUC 1Y3YA 3KEEA 4YLUA 1OXGA 1SHYA 1WBGB 2SGDE 1QJ1B 1SMFE 5EXMA 4AGJA 1QB6A 1L1JA 1RD3B 3BTKE 1MKXK 2OC8A 1O30A 3M5MA 2QF3A 4OS2A 3SJKA 2ZTYA 2ZEBA 3ZV8A 2EEKA 1CT4E 4Y71A 3MNCA 1LPKB 2Z6BD 4FUCA 4Y7AA 1J14A 2HALA 1FPCH 1SPJA 2FXRA 2EA3A 2VWLA 1JOUB 2PUXB 4NZLA 1O2OA 1W8BH 2ZTZA 1IAUA 2ZDAH 3SW2B 1BHXF 1GHZA 4LK4A 1DFPA 1PJPA 3D49H 3SQEE 1P3CA 3BTTE 2FS8A 1F92A 2Z9GA 3Q3XA 4FU9A 3ZZDA 3BG8A 3PTNA 1GJ9B 3MH5A 1GMCG 2H6MA 1LO6A 2AEIH 1P02A 3P92A 1QURH 5FX5A 3UREA 2V35A 1O34A 3TH4H 5DG6A 1TPAE 1FPHH 4YT6H 3RU4E 1AUJA 1CQQA 2Q6GA 2V6NA 2PV9B 1BJVA 1QRWA 3EA9A 3B23B 1ZYOA 5HM2A 3NKKA 3BEUA 1CSOE 3A7TA 3TJOA 4B2AA 4B73A 5C1YA 4ZHMU 4X6OA 3BTFE 1TX7A 1CT0E 1OYTH 2XTTB 1FUJA 2VIWA 1O33A 1K1IA 1FY3A 2STAE 1TNGA 1IOEA 1O35A 1EAWA 1IQFA 1MTNC 3UQVA 1GI3A 2ZDLA 1GJ6A 1ARBA 1ELVA 1ESTA 2ZGCA 3LC5A 4GCHF 2ZA5A 3GY8A 3URCA 2ESTE 2XXLA 2BD3A 1EZQA 2PTCE 1HAPH 1HAXB 3PO1B 3SGQE 3MO9A 1IQNA 1J16A 7GCHG 1SC8U 1TBQH 4AFZA 3DFLA 1ELCA 1IQKA 3K2UA 4R0IA 1G2LA 3GY6A 1UCYE 1AGJA 1JXPA 1SLWB 3NUMA 1F2SE 1XVOA 3LOXA 1C1MA 1TBZH 4X2VA 1PYTC 2QV1A 1KXFA 3SUEA 1QGFA 1RTKA 1WAYB 3RLWH 3RM2H 1IHSH 1O2ZA 1K1PA 1ELFA 1G3CA 2GGVB 1FY8E 4MPXA 4Q7XA 1DWBH 2DE8A 4KTSA 4K1EA 2AGEX 2UUJB 4MQAA 3IITA 4FUEA 1A0HB 1A61H 3M7UA 4A5TS 2HNTC 1C2HA 1KTTB 1XVMA 3E91A 2G81E 1C9TA 4X8UH 5J4QA 3TU7H 1AKSA 3BG4C 1C1PA 1GHVH 2WPHS 1QTFA 1HAOH 5AHGH 4BTTB 3M7QA 3RXKA 2AMPA 4D9RA 1UTLM 1V2LT 1T8MA 1G3DA 2GD4B 1N8OC 4BTIB 3H5CB 2VGCC 1PPHE 3DT0H 1UJ1A 4ZH8A 5LH8A 1AZZA 2VIQA 3SJ9A 2A2XH 1BTUA 2J92A 4FUFA 1YPLH 1A1RA 4K1SA 2BDCA 1HAVB 4Y8XA 5A2MH 3BTDE 1FI8A 2QY0B 4Y0ZE 3SV2H 2XBVA 5C5NA 2J94A 1GI2A 1ETRH 5B6OA 1C2MA 2GV6A 1GDUA 2W3IA 4AGKA 1H9HE 5EPNA 1GGDB 1O5EH 3K9XB 1W3CA 4YOIA 1FJSA 1DICA 3QK1A 1K1MA 2FZZA 3C1KA 1N1LA 2QGRA 5J4SA 4X2XA 1OWEA 1D9IA 2GT7A 4OS4A 2ZHEH 4Y7BA 3QX5H 1GI0A 1ZRBA 4ISLA 5K7RA 3A84A 3SZNA 1UVOA 4OS5A 1KXDA 1TMTH 1FZZA 5A0AE 3SU4A 4ABAA 1YP9A 3GOVB 1ANBA 1KXAA 1QL8A 1C1RA 1PQ8A 4ABBA 1P12E 3GYMA 3TGIE 2BLQA 2NU1E 4DIIH 1LDTT 4XBBA 5HXFA 1C2LA 1Z8JB 1GL1A 5C67A 2HPQH 1HXFH 1GMDG 3TJUA 2W7UA 1NFXA 3OY5U 1DDJA 2ANKH 2GZ9A 4E05H 1Y3XA 2C93B 1ZSKA 3GDVA 1A0JA 3GDSA 1TALA 2KAIA 3TNSA 3RMOH 2OLGA 1HDTH 1M9UA 2V0BA 4ZXYH 8GCHG 2FOMB 1HUTH 3M37A 3A82A 1DUAA 3VB4A 1YPEH 2ANWA 2VWOA 1O3IA 4ZHAA 3LT3A 1A46H 1DXPA 1XUIA 2GMTB 2JETB 3AW1A 1GHAG 1O2XA 1PPCE 1LHEH 5GXPA 1O2TA 1G3EA 2Z3EA 3B8JA 3ZVEA 3NWUA 4I8GA 3SNEA 1EPTC 3PMAB 3P95A 1G36A 1LPZB 1QHRB 3P70B 2QN5T 4MDSA 1P06A 1GJ4H 5E2OA 4BAHB 1P2JA 3RC4A 3PLPA 2Y7ZA 3U69H 3KF2A 3A8AA 4GAWA 2FOBA 1XMNB 2CHAB 1O3KA 1V2NT 1ZGVA 4YLQH 5H4IB 2PKSB 2Y5HA 1J9CH 1CGIE 2CJIA 2FOFA 3A89A 2GCHF 1O39A 1GG6C 1G3BA 3GYLB 1FY5A 1TPSA 3A8BA 3BF6H 1ANCA 1QBVH 3UOUA 1GWAA 1GHBG 1O0DH 2TGAA 2H1UA 1MKWH 2VVCA 4IBLH 4J2YB 2D2DA 1NS3A 2VINA 5HGGA 3ENSB 1UTJA 4JZIA 1DUEA 1U6QA 2Q1JA 2W5EA 1GBCA 4Y0YE 1AE8H 2J9NA 4JK5A 5HMAA 3SGAE 3U8OH 4YM9A 6LPRA 2CN0H 3TIUA 4DOQA 5DP3A 4FVDA 3T25A 4AB8A 3LH1A 1Y3UA 2PTNA 2A7JA 2OQ5A 1HAZB 2G5NA 1KLIH 2RDLA 1T8LA 1C4V2 2ZP0H 3T5FH 3D65E 3RMMH 2C8XB 1GJ5H 3ATMA 4F49A 5A8XA 1ZMLA 4DJZB 4XSKU 1SQAA 3K6ZA 5FHTA 3KL6A 1TRNA 1EQ9A 1UVTH 1NRPH 2ZFPH 3EYDA 3I78A 2Y80A 2PUQH 2AS9A 2XW9A 1MAXA 2BX3A 3ZYDA 1HIAA 3E16B 4SGAE 1UO6A 4WVPE 4ISOA 3LONA
chains in the Genus database with same CATH superfamily
5JBBS 2ZF0H 2YNBA 3DUXH 4AG2A 3BN9A 1AY6H 2AGGX 4FUBA 1HJAB 1C5UA 4B1TA 1SGNE 1TX8A 2VJ1A 1O3CA 3FAOA 4UD9H 2A5KA 3OTPA 5A8ZA 1EXFA 5I25A 1F0RA 1H8HD 1KSNA 2ZECA 3U1JB 2Z9JA 1ZSLA 1BBRK 1BZXE 3F3BA 1ZRKA 2FI4E 1VR1H 1E36B 2HOBA 2P59A 1YLDA 3VB5A 1QQ4A 3AVZA 2QF4A 2PR3A 2NU4E 3QZRA 4AC9A 1SLVB 2EI7A 4F48B 4Y6DA 2Z3CA 1EATA 3VEQB 2F9PA 4BXSA 4F4OC 5K0HA 3MU1A 1MBMA 1O2HA 2ZU3A 1TNKA 5FPYA 4XFQA 5EJZA 1OP0A 3QGJA 2V3OH 4CBNA 5JPMH 5HKKD 3OY6U 2BXTH 2DUCA 3GCHB 3BEFB 5T1VA 4BOHA 1O2RA 1S6LA 1C1SA 2ZG0H 2GX4A 4B74A 1BMMH 2FDAA 4AX9H 1ESBA 4BANB 1QL7A 1QFKH 4XBCA 4A7IB 3TJVA 4WMEA 1DOJA 2OP9A 2ALVA 4M7GA 1B5GH 1GI9B 1MZDA 3F2FA 5AFYH 4A6LA 4IN2A 1O2VA 1K1NA 3GCTF 1GVLA 4FXGH 6CHAB 4X8VH 1BHXB 1L2EA 2O9QA 1RS0A 2OXSA 4D8NA 1GBKA 3ITIA 3P6ZB 1V2QT 1ID5H 3TH2H 4YESB 2AIQA 4CRGA 9LPRA 1GBIA 3QTVH 1TOMH 5EQRA 1A5HA 4X1PU 3M7TA 1AB9B 3BSQA 1NBME 4ZKNU 2DE9A 4Y11E 4CRCA 2O8LA 1HPGA 3E1XB 1NRNH 1MAYA 1SLUB 1A3BH 2NWNA 4ASUD 1SFIA 1YCPM 2Y81A 1NY22 4AZ2B 1ZMJA 1DWDH 3AAVA 1RRKA 2OINA 4SGBE 4K1TA 1D3DB 5JBAS 5EOKA 2Y6TA 2XYAA 5A0BA 1O5FH 1EUFA 1H1BA 2BX4A 2BYAX 3CS7A 4O97A 1T31A 1NU7B 2D26C 4K8BA 1J17T 3TGJE 3WWBA 3A81A 3QUMP 4AORA 1C5MD 1QIXB 1O2PA 4KELA 3L3TA 5HM9A 4YXWD 1MD7A 2A32A 4BAMB 1MTWA 3F0OA 3TJNA 2A1DB 2A7CA 3PLBA 3BIUH 2QF5A 5C2ZA 1PPBH 3KGPA 3UNSA 5DPAA 1L4DA 4A1TA 2BY8X 1UW7A 4NFFA 2FYRA 2J5UA 1DXWA 1O38A 1G32B 1CVWH 1AVWA 3GY4A 5JYIA 3LIWA 4FUJA 3ZVFA 3RC5A 5JBTA 3JZ1B 1FIWA 3MU4A 5EXLA 5F8ZA 4Q7YA 1OYQA 2BLOA 4CRDA 1O2KA 2KCOA 5FXLA 1RIWB 2FYQA 1FONA 2WV4A 2BY5X 1E38B 1WOFA 2QIQA 2ZNKH 3MO6A 5LGOA 1SG8B 2BTCE 3PRDA 3I29A 3F1SB 1BRAA 4WMFA 5GCHF 3SBKA 1HB0B 2GT8A 3RXFA 2P95A 1P2NA 1Y3VA 1E0FD 3QGNB 3N7EA 2BD4A 1B7XB 1O2UA 1IQLA 1MU6B 2FOEA 2WPJS 2Z94A 4RT0A 1BUIA 3E0PB 1QJ6B 2XBYA 1C2GA 3Q3KA 3ZVGA 4FETA 1P8VC 4X1QU 5C1UA 1BCUH 2SGFE 4MNYA 3MTYA 2BZ6H 4X8SH 2JH5D 1QY6A 1VCQA 5LPFA 1CBWC 2BD5A 4NZQA 4Q63A 3ZV9A 9ESTA 1SB1H 3U98H 1AN1E 1K0HA 3M36A 1YWUA 1DE7H 1SGTA 2ZU4A 3FP6E 3C27B 1LVYA 3G01A 3GCOA 1NTPA 2LP6A 1WSSH 4GPGA 2BQWB 4BAKB 3MI4A 5FAHA 3MWIU 2YNAA 3BTEE 1KDQA 4BNRA 3ODFA 5FPSA 4GCHG 3O8CA 3SU3A 3TH3H 1MU8B 4ABFA 1TNJA 2L74A 1MKWK 4ZMAH 5EQQA 3F9HA 4GHTA 2OC1A 1BTWA 2P3UB 1ZTLA 1HCGA 4K5ZA 4ABDA 2A2QH 3PM3A 2GTBA 6GCHF 1W7GH 2Z9IA 1Q3XA 5IK2D 1NZQH 3TITA 3LGTA 7ESTE 4FVBA 4UFEH 3RXTA 3T27A 4JYVH 1S82A 3PO1C 4K69A 3LGWA 3TK6A 1S5SA 2Q6DA 1D6WA 3D62A 4XBDA 4ABJA 1OWIA 2R3YA 1GJBB 3ZVDA 2BVRH 2LPRA 1KXBA 3RXEA 1MQ5A 1TMUH 3S9AA 1ORFA 4U32A 1OKXA 4H42U 1TIOA 1DS2E 3RUOA 3SNBA 1ELEE 1KY9A 2H9HA 4FU8A 2B9LA 3N7DA 3N99A 3KQDA 1LMWB 2XBWA 3TVJB 4OM9A 1OWDA 1QQUA 2R0KA 2F43B 1HAHH 1DY9A 3ZZ9A 1Y5BT 3A8CA 4NSYA 1ZHMA 5DKMA 4E06H 2ZGJA 1BBRH 5KEDA 1QA0A 2ZFQH 1TNIA 3GS9A 1NPMA 5E0JA 1XM1A 3PROA 1GBMA 1EOJA 1CT2E 2TGTA 1SQOA 1YM0A 1ARCA 3ZZ8A 3NZIA 4QT8C 2F4LA 3UTUH 1ACBE 2P16A 4TY7A 2HVYB 2A45B 3PB1E 4XD7D 1UTPA 1TNLA 2ZHWH 2Y82A 2ZHQH 1O2SA 1GBDA 1OOKB 1OS8A 1NESE 1MD8A 3SOSA 3S69A 2ZHFH 3ZZBA 1C5QA 2PGQB 1KMHB 4X1SU 4D9QA 1GI8B 2FOHA 2G52A 3RXAA 2A4GA 2J2UA 1GVKB 5FCRA 1LKAA 1F5LA 1GBLA 1O5GH 5E0HA 3UNQA 4HG6A 4P00A 3LGVA 1HYLA 1AFQB 1QRXA 3UR9A 1CA8B 3S7HB 1TFXA 1OWHA 1TA2A 2HVXA 4B2BA 3Q00A 1BB0B 3ATLA 3RU4T 1GGDC 3RXIA 1Y8TA 4GHQA 2R3UA 4OS1A 3SN8A 1D3PB 1GMHF 2XBXA 5C94A 4TWYA 1OP8A 1O2GH 1K28D 2VB0A 4X1NU 1UK3A 3ELAH 2BOHB 1W0ZU 1C4Y2 2OC7A 1S0RA 3LGUA 1W0JD 2O8WA 2ZFRH 1TA6A 4Z0KA 5C20A 2BY7X 4NGAH 2ZFSA 4YT7H 3OTJE 1HJ9A 1TQ0B 3VB6A 1ABJH 1TX6A 2PWXA 2AFQB 2FTMA 1F7ZA 4INHA 4UDWH 4ISIH 2C3SA 2O8MA 4I8JA 3T29A 1MCVA 2FODA 3M3TA 2CF9H 1CU1A 1VJAU 5AFZH 1LCYA 2FMJA 1AQ7A 1E35B 1EZSC 1Y3WA 2F9VA 1AZ8A 1OP2A 5EJLA 1XUJA 2TRMA 1SGRE 1DLKB 2F3CE 2OBQA 2CF8H 5TJXA 2M5TA 1TGTA 1F5KU 2A4RA 1C2JA 2PGBB 1HJ8A 2J34A 1O5BB 1P57B 2BLVA 5JB9S 3NXPA 1C5WB 5F03A 5DP7A 3T26A 4OGXA 1O2LA 1ZJKA 3AAUA 1SR5C 3SO3A 4OS7A 1YKTA 2GMTC 3ZIAD 2JETC 1MH0A 2PKAB 1WQSA 3RXVA 1V2VT 4X1RU 1J8AA 1T8OA 2CV3A 2H5CA 1G30B 3A7ZA 1O5AB 3S9BA 3GICB 2ZC9H 3CENA 3E90B 3SUGA 4PROA 1TWXB 5JB8S 4BXWA 1O5CB 3F9EA 1EAIA 3RXMA 1G9IE 3PYHA 3ZVAA 4MPUA 2EY4C 1Z71A 3LJJA 4AFSA 2GCHG 2FOAA 4AYYB 2OD3B 1GI7B 1K22H 2IJD1 5A8YA 2CHAC 3SHAH 4MNVA 4UE7H 2PKSC 1RXPA 4U30A 3FOAA 1O3BA 3KQCA 4YTAA 2FLBH 4ABIA 1SGIB 1MABB 2O8TA 2VGCB 1Z8RA 3GY3A 1EJNA 2IN2A 2KX4A 2WPKS 4K2YA 1BTXA 4A1XA 5A09A 1YLCA 2W3KA 1UHBB 3ODDA 4HZHA 5DP8A 2RFKC 1A3EH 1EKBB 1DT2A 1GJDB 5SGAE 2V7QD 1H9LB 2A4QA 3A85A 1Y59T 3E0NB 2ULLA 4MPWA 3DSOA 5A0CA 2UUFB 3RXBA 2ZTXA 5FCKA 4MPVA 3SJIA 3UAIC 3MOCA 1C5PA 2EI8A 1J15A 1ZJDA 3EDXB 5CHAB 3UQOA 4DURA 3PMJA 5BRRE 5KECA 1LHGH 3A7VA 1HXEH 1AHTH 2ZFTA 1E1QD 2VH0A 2R0LA 4ZKSU 3LH3A 3ZZ6A 4UFGH 5DJ7A 3UWIA 1H4WA 3PTBA 5AVDA 3RXUA 4A1VA 4Z6AH 4KGAA 1H9IE 1UTNA 1GCTB 1ZLRA 2BDGA 2C8WB 1GHXH 1HAVA 2WUBA 3E8LA 3LC3A 3P8FA 1G2MA 2AYWA 3RXRA 1BQYA 1EJAA 3A8DA 3FP8E 2FOGA 1S0QA 1C5LH 1A5IA 2WPLS 1MMJN 1T8NA 2GDDA 1EFRD 4I8KA 1LPGB 1AUTC 4NA7A 3QDZB 5ETXA 3HKIB 2AGIX 1V2OT 6ESTA 1HJAC 4I7YH 1MTUA 1MTSA 3FZZA 1UMAH 1COWD 1ELBA 3LGYA 2FEQH 3U8TH 2WUCA 3RU4D 1L4ZA 2OQUA 1LHDH 1O3PB 2XCFA 1YBWA 4IMQA 1FN6A 1S83A 3N7OA 2AIPA 2KCAA 4HTCH 5DP4A 1NROH 3ZZ5A 3HK6B 3RXCA 2P3TB 3MMGA 1C5RA 1JIRA 1XX9A 5EXNA 1EPTB 5JBCS 1ZSJA 1C5ZB 3MU5A 4D76A 1BTHH 4INKA 1Y5AT 3BTGE 5FL7D 1S6HA 4JK6A 3H09A 1BITA 4X6PA 3E3TA 1O3GA 3GDUA 2R9PA 4ZKOU 1Z8GA 5T6DA 4CH2B 1L1NA 1ZGIA 1A5GH 2A5AA 3V13A 1HRTH 4HGCA 1GBAA 1BDAA 4CREA 1TGBA 4E7NA 3LDXH 1O3NA 3SNCA 2O8UA 2UWLA 3MHWU 4Y76A 1QB1A 1LKBA 2PSXA 1O5DH 4Y8YA 3ATKA 3T62A 1D3TB 1PQ7A 3GCTG 1RJXB 1IQEA 4JYUH 2F9UA 2HNTF 1ELGA 3SNDA 3UB0A 4K8YA 1UTOA 2WYJA 1K1JA 2R2WU 3GY7A 1TGSZ 1FAKH 1O3AA 2SGAA 1UTMA 1HGTH 1GJAB 2JIZD 3PMHB 3MNXA 3FFGA 4H6SB 2ZCLP 6CHAC 1EASA 1YCPH 3VGCB 3OFND 3S7KB 4XOJA 2BXUH 5CMXH 1ZPCA 3OEED 1GJ7B 4HFPB 3RP2A 3WY8A 2SGQE 1QA7A 3T28A 2P8OB 1AB9C 3DFJA 1QBOA 1LQEA 4WMDA 1VITH 4LZ1H 1AWFH 1ELTA 3Q77A 1P05A 4TY6A 8LPRA 4MLFB 3QWCH 4R8TB 1CA0B 4IGDA 1LVBA 3SU5A 1HAYB 5TCCA 2G4UA 5AF9H 1BMLA 4I32A 3RXGA 1XKBC 3OYPA 1BBRE 2K0QA 1V2ST 1GJCB 1F0SA 4NWKA 2JDID 2WHXA 2ZWLH 1WQVH 1X7AC 4MVNA 4AN7A 2WV9A 1BTPA 2W26A 2A31A 2FX6A 3F9FA 1NRRH 1DSUA 3GISB 4XDEA 2AH4X 3ZZAA 1MQ6A 1ELDE 4U2WA 2OC0A 4THNH 1V2UT 1KXCA 4WF8A 2W6ID 4MG3A 4XRNA 3SJ8A 3SV9A 3W95A 2SGEE 2QXHA 1K21H 1P10A 3SYJA 1B0EA 3BTHE 1V2TT 1WXRA 1O3OA 1D6RA 2J97A 1YY3A 4CHAB 4FUGA 1IHTH 1TB6H 2XWBI 2G51A 2XNIA 4IS5A 1QZ8A 1Z6JH 4X6NA 1O3DA 2ZGBH 1C5YB 1ETSH 3LJOA 2VIPA 5EU8A 5G4BA 2KCYA 1P2OA 5GCHG 1RIWC 3ZZ7A 1NT1A 1GVZA 1P3EA 3EGKH 3HKJB 1ABIH 3VXFH 5DK1A 1T7CA 2NU0E 2H9TH 3A86A 3BIVH 2FO9A 1CHOF 4IW4E 1Q31A 2ODPA 4TPIZ 1CE5A 3GY5A 3RXOA 1V2WT 2ZPQA 1DITH 1OSSA 2ZDMA 1WYKA 4XE4A 4I33A 2HWLB 1DX5M 4RKOB 2VWMA 3V3MA 1JIMA 3PWBA 2BDBA 2NU2E 1C1TA 2Z9KA 5F53A 1Z1IA 3H7OA 1YPKH 4ACBA 7LPRA 1GBEA 4GLYA 5L6NH 1SGCA 2CMYA 1KIGH 4Q7ZA 3OU0A 2G00A 3AW0A 1AU8A 3FVFB 4NIWA 4TWWA 1C2KA 2VBCA 2ZZUH 3IWMA 2KFWA 5EODA 1ZOMA 2IJOB 1VJ9U 1FY4A 2QAAA 1SVPA 1UVSH 4B76A 3OE7D 2Y5GA 6GCHG 1S6FA 2Y5FA 1BIOA 3F2GA 1P11E 4Q2KA 4YO9A 1TPOA 4AG1A 1P9UA 1IQJA 2H5DA 1JWTA 2G55A 3IG6B 2VU8E 5GPIB 1UTQA 1XUHA 1C2DA 1HFDA 1H8DH 2WSSD 2C8YB 1V2JT 2EC9H 3SI4H 1EZXC 2OBOA 5ESBA 2ZU5A 4I8HA 1L1GA 5ABWA 3QZQA 1VITF 3SJOA 3SU0A 1EAXA 5PTPA 3OSYA 2Z7FE 3TK5A 1TLDA 5CE1A 2AERH 1EAUA 2GKVE 3RXQA 4DT4A 2BLWA 1JMOH 2QXJA 4INLA 4FUIA 5DP5A 5T6GA 5L30H 1SKYE 4DCDA 1BTYA 1WTGH 4NSVA 3FKSD 1VGCB 3TK9A 2VIDA 1ESAA 2GCTB 2ZGXH 2WPIS 3M5NA 4DG4A 3M5OA 3HGPA 2EI6A 4HI3A 4TYDA 5I46H 3DA9B 3RDZA 1NU9A 4WXVA 1SGEE 1LHFH 4YZUA 3M61U 5HIYA 3PLKA 2QA9E 2IOTA 3SV8A 3M35A 2D8WA 4KKDA 4Y10E 2G4TA 4IC5A 3O8DA 2NU3E 4D7FA 2I6QA 4UONA 4VGCB 1O2WA 3EQ0H 1PQAA 2F9OA 3SUFA 1C1UH 3U1IB 1GPZA 2BD8A 3SU2A 4JZ1A 1S81A 1W0KD 4Y79A 4WH8A 3DHKH 1E34B 2XWAA 2J4IA 1W13U 2OK5A 3D23A 4F55A 4ZKRU 2HPPH 2JH6D 3F0PA 2XC0A 1IQIA 3VXEH 2BY9X 1XUFA 2JJ1D 2UWOA 2THFB 3WW7A 3RXSA 1HAIH 1XUKA 1MTVA 2VIVA 3HGNA 1AKSB 4BTUB 1UTKA 1A2CH 2WZQA 3KQ5A 3P8NA 5GNDA 1BTZA 1G37A 3FZDA 1NFYA 1SI5H 1FV9A 3RLYH 3BTQE 1SSXA 5FX6A 1YPHE 1GMHG 3MH7A 1B0FA 2I6SA 1O3FA 2ZHDA 1DVAH 3EA8A 2HLCA 1AFQC 1TYNA 1V6DA 1KTSB 4ZHLU 4TPYA 2BM2A 3ZVCA 4OGYA 1CBWB 4DGJA 1BJUA 1K1LA 1V2RT 5T6FA 4LOYH 1ZPBA 1YF4A 4NIXA 1N6XA 5EJ1A 1UCYK 1W2KH 1CGHA 2BDIA 5KGOA 1JBUH 2B5TB 1UVPA 3PWCA 1C5VA 2J95A 3JZ2B 4IN1A 3TGKE 1O3EA 5E2PA 2TBSA 1F0TA 2FLRH 4KTCA 2GZ7A 2P93A 1XUGA 1INCA 2J98B 4B6FA 1W12U 1EP6A 1GHYH 1V2MT 1DM4B 4AYVB 1NM6A 1VCPA 2QC2A 2SFAA 4FUDA 1XXDA 3SV7A 3ZVBA 2GV7A 2RDEA 1YPGH 1AVXA 1SOZA 5C5OA 2ZDNA 5HYOA 2GZ8A 3E6PH 5T3HA 1FXYA 3U8RH 1YCPK 2QCYA 3RXHA 2Z3DA 1GI5A 1AI8H 3A7XA 3CS0A 1DSTA 2QYIA 2RG3A 1HAGE 8ESTE 4Z1MD 2SGPE 1C2FA 1SQTA 3ESTA 3SGBE 1NFWA 2BB4A 3KNXA 1SL3A 1THSH 2XC5A 1O31A 3LGIA 3SV6A 1H8IH 3P17H 1GMCF 3LPRA 4ISHH 3L6PA 4FU7A 2STBE 4JZDH 3PMBB 3UPEA 4AFUA 2VH6A 1O37A 4NG9H 4WXIA 1GDQA 3F6UH 4H6TA 1FY1A 1YPJH 1BMAA 3MNSA 3ATWA 1P04A 1ZPZA 1AD8H 2KAIB 4CRFA 3S9CA 2ILNA 1TAWA 1LVOA 1MTNB 1UK4A 2ZGHA 1MUEB 4NA8A 2ZPRA 3TNTA 5CDFE 4E7RG 1TMBH 3CP7A 2AMQA 1P01A 1GI4A 2ZQ1A 5LPRA 3SORA 1C1VH 1W10U 1NRQH 7KMEH 1KLTA 3W1EA 1P2KA 2HLDD 3QTOH 3S0NA 1A4WH 1C5XB 1W11U 2UWPA 1D4PB 4ABEA 1JRSA 4FUHA 4GUXA 1BT7A 2XRCA 1EP5A 1F5RA 7GCHF 4YOJA 4CH8B 3UY9A 1LVMA 2ZFFH 3FN8A 2Y7XA 4NA9H 1IQHA 1O3LA 1Q2WA 2ZDKA 3TLOA 1QB9A 4WJG2 2ASUB 4NCYA 3RXPA 2QXIA 2HGTH 3BV9B 1P2QA 3STJA 5FPTA 2KCPA 5CHAC 1IQGA 1O2IA 2IPQX 4MNXA 4NWLA 2LELA 4Q80A 4DIHH 1FLEE 3H7TA 1ZMNA 3HATH 3MFJA 2A0QB 3EAJA 1BMNH 4IC6A 2W7SA 3BG4B 3RXDA 5DP9A 2UUYA 2CK3D 1YPHC 2ZKSA 2OTVA 3ZYEA 5F8XA 4JCNA 1SGDE 3R0FA 1PYTD 3UIRA 1GCTC 4AB9A 4TSFD 1C5OH 1C9PA 2JJ2D 1N8OB 1LHCH 5E0GA 1ANEA 1O2QA 1MZAA 2XC4A 3ATIA 3HPTB 1H8ED 4ASHA 1YPMH 2PHBA 2YOLA 2OCVB 1EJMA 1P0SH 3TPIZ 3FP7E 2GP9B 2B0FA 3K65B 3VB3A 2P3FH 5C1XA 2ZPSA 4TT3D 4X8TH 2ZCHP 3A83A 1L0ZA 4YOGA 2XNDD 1QBNA 4AOQA 3SZEA 2IPHA 4I8LA 1GCDA 2ZO3H 1FDPA 2FIRH 5EG4A 1OX1A 1MBQA 1WUNH 2BZAA 1GI1A 1GL0E 1O3MA 1PPZA 1HIAB 3QLPH 4DW2U 1PFXC 3SU6A 3KYGA 3DD2H 1DY8A 4WH6A 3MNBA 3VFEA 1K9OE 1CO7E 3GCNA 3OAAD 1GBHA 1WCZA 2RA3A 2F9BH 4NIYA 1A7SA 1T4UH 1S84A 1BA8B 3F2HA 3KIDU 1MCTA 2FTLE 1P2IA 1RTFB 1C2EA 1KLJH 8KME2 1Z8IB 3EA7A 1AVGH 1K1OA 2TGPZ 3EE7A 3ZZ4A 1O2MA 2ALPA 1QNJA 2VVVA 1C5TA 3M3VA 4K3JA 2ANMH 4B2CA 3RC6A 2OUAA 4LZ4B 1A0LA 1P09A 3V12A 5F8TA 2BD2A 2BY6X 3RXLA 2BOKA 1MKXH 3L33A 1BRBE 3MH4A 2PKAA 1TE0A 4KP0A 4CBOA 3NCLA 4RN6A 2HRVA 1RTLA 1TRYA 1TBRH 1C1QA 2CXVA 3KYFA 1THRH 1O36A 1ZR0A 3KN2A 1HBTH 1SGFG 5EW2H 5GDSH 1EB2A 3P8OA 4Y8ZA 3KQBA 1QR3E 1F0UA 1C4U2 1GMDF 4NFEA 1PPFE 2TPIZ 2B7DH 4K60A 2ZDVH 4RSPA 3V7TA 1TOCB 2GDEH 2TIOA 1DPOA 3KCGH 1C1WH 1TQ7B 2ODYB 2C4FH 4OS6A 3VGCC 5B6LA 5LPEA 8GCHF 1AFEH 2FX4A 1FMGA 2H9EH 1SGFA 1WTHD 2BD7A 2RA0A 2BQ6B 4CRBA 2CGAA 3UOPA 2G8TA 2PW8H 2BVSH 2RCEA 3RM0H 1TPPA 4CR9A 1GHAF 2BQ7B 2P8OC 4Q4LA 1KYNA 1SGYE 4O9VA 1FAXA 4ZXXH 1E37B 1WV7H 1UHBA 3HK3B 3ZZCA 1UK2A 1HNEE 2VWNA 3A80A 3GCHC 3LU9B 1BOQA 3SNAA 1YGCH 5DP6A 4GSOA 4JMYA 3SU1A 1UCYH 1CA0C 3BTME 1ZHRA 3FANA 1QL9A 2LNCA 3LKWA 3RXJA 5IDKA 4MTBA 1ZTJA 4UFFH 1NFUA 3T2NA 2ZQ2A 4B75A 5TCAA 4CR5A 4O3UA 3UUZA 1GG6B 1GJ8B 2WPMS 5DGJA 3WWFA 1YYY1 2QF0A 1T4VH 2F91A 1TGCA 3KHVA 2FP7B 2ANYA 2XCNA 3GY2A 3DCLA 1THPB 3SUDA 5EIYA 1AIXH 1TRMA 1V3XA 2Q6FA 1FIZA 1GBFA 1NO9H 2JKHA 1P2MA 5FBEA 2VVUA 1GHBF 2SNVA 2H2ZA 4ZROA 5C17A 5IYTA 1EOLA 1T32A 2G5VA 1O2JA 5CHBA 4A92A 5L2YH 3RMNH 4CHAC 1BRCE 3MU8A 5ESTE 4BAQB 2BDHA 1W0YH 2YMSB 4O03A 1P9SA 3NK8A 5L2ZH 4O3TA 1EB1H 1NN6A 1FQ3A 1SGPE 3QN7A 3UWJH 2TGDA 1AWHB 4GVUA 1OWKA 2BDAA 1O3HA 2A4OA 2GJGA 3A88A 4J1YA 1CHOG 1GHWH 1NC6A 1O3JA 1GBBA 1RFNA 2BHGA 2FI3E 5EPYA 3V0XA 1PPGE 2UUKB 5GJ4B 5FBIA 2ODQA 3O8RA 2Z9LA 4DT7B 2YMSD 2BD9A 4ISNA 4CRAA 3BEIB 3QO6A 1DWCH 1LQDB 1N6YA 2PFEA 1HLTH 1Y5UT 1O2NA 2D1JA 2FESH 2AHME 3R3GB 1EPTA 5C0UA 1DANH 1GBTA 1AE5A 2SNWA 1VKYA 1DWEH 2FWWA 1SHHB 2J38A 3UNRA 3EE0B 5EQSA 3OX7U 1FN8A 1TNHA 1VCWA 4H4FA 1ELAA 3K6YA 3VB7A 2BVXH 1WU1A 3PRBA 3U9AH 5E8EH 4JZFH 1AMHA 3A87A 2EQNA 4X6MA 3O8BA 1HV7A 2A5IA 1PQ5A 4I86A 1Z7KA 2WYGA 1GI6A 1SOTA 1IQMA 2BDYA 2C90B 3RMLH 3SHCH 1C5NH 5GWZA 3MU0A 3F68H 2ZCKP 1P03A 1XXFA 2QXGA 2ZU2A 4ABHA 1YLNA 1NRSH 3KQEA 1VITG 2FI5E 4DY7B 2GVFA 3SI3H 4P02A 1CGJE 1LTOA 2R2MB 3STIA 3UR6A 3ZZ3A 4U01A 4JZEH 3M3SA 1ZTKA 2FOCA 3VPKA 1CHGA 1AO5A 2FM2A 1EX3A 1JRTA 3MH6A 1QJ7B 4IMZA 1SQRA 1SFQB 4MNWA 2B8OH 4WWYA 1KDQB 2PLXA 2QE7D 4UFDH 4JYTA 4ZCNA 2JH0D 4DVAU 2F83A 5DO4H 5EGMA 1RGQA 2VIOA 1VGCC 5EW1H 2M2AA 3UFAA 1BRUP 4WY3A 2GCTC 5C3NA 2AMDA 1SGQE 2BMGB 1GDNA 3DSPA 3I77A 3NRLA 3Q3YA 4ZUHA 4X2YA 4BAOB 1C2IA 4NIVA 1O32A 2FS9A 4KTUA 3URDA 5JDUB 2FPZA 2KZ4A 1KXEA 3B9FH 2WV5A 2VNTA 1TGNA 4X0WU 1V2PT 4AFQA 3Q76A 2K1QA 4VGCC 1S85A 1TABE 2C8ZB 3MYWA 1D3QB 2ZIQH 3NPSA 1V2KT 1ETTH 3BTWE 1C1NA 1Z6EA 3A7YA 1OPHB 1QRZA 4LXBH 4ACAA 3W94A 3M5LA 1C1OA 5F6MA 1FNIA 1Z1JA 3SQHE 4D7GA 3F9GA 4UEHH 5GIBA 1DLEA 2ZU1A 1YC0A 2F9NA 3AASA 3PV4A 4ZAEA 1W7XH 3PV5A 5BPEA 3A7WA 1VZQH 4B71A 2ZI2H 1GBJA 1ANDA 4X2WA 3P8GA 1ZHPA 1OWJA 1C5SA 3MO3A 2HNTE 4ESTE 1SBWA 4RKJB 1K2I1 1W14U 1O2YA 1PPEE 2KM0A 2WINI 1TONA 1ZZZA 1XKAC 2V3HH 1QCPA 2P94A 1SLXB 2A7HA 4I31A 4ABGA 1UVUH 2PSYA 3AK5A 1EZUC 1Y3YA 3KEEA 4YLUA 1OXGA 1SHYA 1WBGB 2SGDE 1QJ1B 1SMFE 5EXMA 4AGJA 1QB6A 1L1JA 1RD3B 3BTKE 1MKXK 2OC8A 1O30A 3M5MA 2QF3A 4OS2A 3SJKA 2ZTYA 2ZEBA 3ZV8A 2EEKA 1CT4E 4Y71A 3MNCA 1LPKB 2PP6A 2Z6BD 4FUCA 4Y7AA 1J14A 2HALA 1FPCH 1SPJA 2FXRA 2EA3A 2VWLA 1JOUB 2PUXB 4NZLA 1O2OA 1W8BH 2ZTZA 1IAUA 2V3MA 2ZDAH 3SW2B 1BHXF 1GHZA 4LK4A 1DFPA 1PJPA 3D49H 3SQEE 1P3CA 3BTTE 2FS8A 1F92A 2Z9GA 3Q3XA 4FU9A 3ZZDA 3BG8A 5DSFA 3PTNA 1GJ9B 3MH5A 1GMCG 2H6MA 1LO6A 2AEIH 1P02A 3P92A 1QURH 5FX5A 3UREA 2V35A 1O34A 3TH4H 5DG6A 1TPAE 1FPHH 4YT6H 3RU4E 1AUJA 1CQQA 2Q6GA 2V6NA 2PV9B 1BJVA 1QRWA 3EA9A 3B23B 1ZYOA 5HM2A 3NKKA 3BEUA 1CSOE 3A7TA 3PV2A 3TJOA 4B2AA 4B73A 5C1YA 4ZHMU 4X6OA 3BTFE 4FOUC 1TX7A 1CT0E 1OYTH 2XTTB 1FUJA 2VIWA 1O33A 1K1IA 1FY3A 2STAE 1TNGA 1IOEA 1O35A 1EAWA 1IQFA 1MTNC 3UQVA 1GI3A 2ZDLA 1GJ6A 4RI0A 1ARBA 1ELVA 1ESTA 2ZGCA 3LC5A 4GCHF 2ZA5A 3GY8A 3URCA 2ESTE 2XXLA 2BD3A 1EZQA 2PTCE 1HAPH 1HAXB 3PO1B 3SGQE 3MO9A 1IQNA 1J16A 4RT1A 7GCHG 1SC8U 1TBQH 4AFZA 3DFLA 1ELCA 1IQKA 3DSGA 3K2UA 4R0IA 1G2LA 3GY6A 1UCYE 1AGJA 1JXPA 1SLWB 3NUMA 1F2SE 1XVOA 3LOXA 1C1MA 1TBZH 4X2VA 1PYTC 2QV1A 1KXFA 3SUEA 1QGFA 1RTKA 1WAYB 3RLWH 3RM2H 1IHSH 1O2ZA 1K1PA 1ELFA 1G3CA 2GGVB 1FY8E 4MPXA 4B6EA 2KR7A 4Q7XA 1DWBH 2DE8A 4KTSA 4K1EA 3U28C 2AGEX 2UUJB 4MQAA 1NBMD 3IITA 4FUEA 1E1RD 1A0HB 1A61H 2L6OA 3M7UA 4A5TS 2HNTC 1C2HA 1KTTB 1XVMA 3E91A 2G81E 1C9TA 4X8UH 5J4QA 3TU7H 1AKSA 3BG4C 1C1PA 1GHVH 2WPHS 1QTFA 1HAOH 5AHGH 4BTTB 3M7QA 3RXKA 1OHHD 2AMPA 4D9RA 1UTLM 1V2LT 1T8MA 1G3DA 2GD4B 1N8OC 4BTIB 3H5CB 2VGCC 1BMFD 1PPHE 3MQKC 3DT0H 1UJ1A 4ZH8A 5LH8A 1AZZA 2VIQA 3SJ9A 2A2XH 1BTUA 2J92A 4FUFA 1YPLH 1A1RA 4K1SA 2BDCA 3FO8D 1HAVB 4Y8XA 5A2MH 3BTDE 1FI8A 2QY0B 4Y0ZE 3SV2H 2XBVA 5C5NA 2J94A 1GI2A 1ETRH 2J98A 2WPDD 1C2MA 2GV6A 1GDUA 2W3IA 5B6OA 4AGKA 1H9HE 5EPNA 1GGDB 1O5EH 3K9XB 1W3CA 4YOIA 1FJSA 1DICA 3QK1A 1K1MA 2FZZA 3C1KA 1N1LA 2QGRA 5J4SA 4X2XA 1OWEA 1D9IA 2GT7A 4OS4A 4M9FA 2ZHEH 4Y7BA 3QX5H 1GI0A 1ZRBA 4ISLA 5K7RA 3A84A 3SZNA 1UVOA 4OS5A 1KXDA 1TMTH 1FZZA 5A0AE 5DN6D 3SU4A 4ABAA 1YP9A 3GOVB 1ANBA 1KXAA 1QL8A 1C1RA 1PQ8A 4ABBA 1P12E 3GYMA 3TGIE 2BLQA 2NU1E 4DIIH 1LDTT 4XBBA 5HXFA 3VG8A 1C2LA 1Z8JB 1GL1A 5C67A 2HPQH 1HXFH 1GMDG 3TJUA 2W7UA 1NFXA 3OY5U 1DDJA 2ANKH 2GZ9A 4E05H 1Y3XA 2C93B 1E79D 1ZSKA 3GDVA 1A0JA 3GDSA 1TALA 2KAIA 3TNSA 3RMOH 2OLGA 1HDTH 1M9UA 2V0BA 4ZXYH 8GCHG 2FOMB 1HUTH 3M37A 3A82A 1DUAA 3VB4A 1YPEH 2ANWA 2VWOA 1O3IA 4ZHAA 3LT3A 1A46H 1DXPA 1XUIA 2GMTB 2JETB 3AW1A 1GHAG 1O2XA 3CNRA 1PPCE 1LHEH 5GXPA 2W6JD 1O2TA 1G3EA 2Z3EA 3B8JA 3ZVEA 3NWUA 4I8GA 3SNEA 1EPTC 3PMAB 3P95A 1G36A 1LPZB 1QHRB 3P70B 2QN5T 4MDSA 1P06A 1GJ4H 5E2OA 4BAHB 1P2JA 3RC4A 3PLPA 2XOKD 2Y7ZA 3U69H 3KF2A 3A8AA 4GAWA 2FOBA 1XMNB 2CHAB 1WDIA 1O3KA 1V2NT 1ZGVA 4YLQH 5H4IB 2PKSB 2Y5HA 1J9CH 1CGIE 2CJIA 2FOFA 3A89A 2GCHF 1O39A 1GG6C 1G3BA 3GYLB 1FY5A 1TPSA 3A8BA 3BF6H 1ANCA 1QBVH 3UOUA 1GWAA 1GHBG 1O0DH 2TGAA 2H1UA 1MKWH 2VVCA 4IBLH 4J2YB 2D2DA 1NS3A 2VINA 1FX0B 5HGGA 3ENSB 1UTJA 4JZIA 1DUEA 1U6QA 2Q1JA 2W5EA 1GBCA 4Y0YE 1AE8H 2J9NA 2K8IA 4JK5A 5HMAA 3SGAE 5C0TA 3U8OH 4YM9A 6LPRA 2CN0H 3TIUA 4DOQA 5DP3A 4FVDA 3T25A 4AB8A 3LH1A 1Y3UA 2PTNA 2A7JA 2OQ5A 2YMSC 1HAZB 2G5NA 1KLIH 2RDLA 1T8LA 1C4V2 2ZP0H 3T5FH 3D65E 3RMMH 2C8XB 1GJ5H 3ATMA 4F49A 5A8XA 1ZMLA 4DJZB 4XSKU 1SQAA 3K6ZA 5FHTA 3KL6A 1TRNA 1EQ9A 1UVTH 1NRPH 2ZFPH 3EYDA 3I78A 2Y80A 2PUQH 2AS9A 2XW9A 1MAXA 2BX3A 3ZYDA 5HIZA 3OEHD 1HIAA 3E16B 4SGAE 1UO6A 4WVPE 4ISOA 3LONA
chains in the Genus database with same CATH topology
5JBBS 2ZF0H 2YNBA 3DUXH 4AG2A 3BN9A 1AY6H 2AGGX 4FUBA 1HJAB 1C5UA 4B1TA 1SGNE 1TX8A 2VJ1A 1O3CA 3FAOA 4UD9H 2A5KA 5A8ZA 1EXFA 5I25A 1F0RA 1KSNA 2ZECA 3U1JB 2Z9JA 1ZSLA 1BBRK 1BZXE 1ZRKA 2FI4E 1VR1H 1E36B 2HOBA 2P59A 1YLDA 3VB5A 1QQ4A 3AVZA 2PR3A 2NU4E 3QZRA 1SLVB 2EI7A 4Y6DA 2Z3CA 1EATA 3VEQB 2F9PA 4BXSA 4F4OC 5K0HA 3MU1A 1MBMA 1O2HA 2ZU3A 1TNKA 5FPYA 4XFQA 1OP0A 3QGJA 2V3OH 4CBNA 5JPMH 3OY6U 2BXTH 2DUCA 3GCHB 3BEFB 4BOHA 1O2RA 1C1SA 2ZG0H 2GX4A 4B74A 1BMMH 2FDAA 4AX9H 1ESBA 4BANB 1QL7A 1QFKH 4XBCA 4A7IB 3TJVA 4WMEA 1DOJA 2OP9A 2ALVA 4M7GA 1B5GH 1GI9B 1MZDA 5AFYH 4A6LA 4IN2A 1O2VA 1K1NA 3GCTF 1GVLA 4FXGH 6CHAB 4X8VH 1BHXB 1L2EA 2O9QA 1RS0A 2OXSA 4D8NA 1GBKA 3ITIA 3P6ZB 1V2QT 1ID5H 3TH2H 4YESB 2AIQA 4CRGA 9LPRA 1GBIA 3QTVH 1TOMH 5EQRA 1A5HA 4X1PU 3M7TA 1AB9B 3BSQA 4ZKNU 2DE9A 4Y11E 4CRCA 2O8LA 1HPGA 3E1XB 1NRNH 1MAYA 1SLUB 1A3BH 2NWNA 4AZ2B 1SFIA 1YCPM 2Y81A 1NY22 1ZMJA 1DWDH 3AAVA 1RRKA 2OINA 4SGBE 4K1TA 1D3DB 5JBAS 5EOKA 2Y6TA 2XYAA 5A0BA 1O5FH 1EUFA 1H1BA 2BX4A 2BYAX 3CS7A 4O97A 1T31A 1NU7B 2D26C 4K8BA 1J17T 3TGJE 3A81A 3QUMP 4AORA 1C5MD 1QIXB 1O2PA 4KELA 3L3TA 5HM9A 1MD7A 2A32A 4BAMB 1MTWA 3TJNA 2A1DB 2A7CA 3PLBA 3BIUH 5C2ZA 1PPBH 3KGPA 3UNSA 5DPAA 1L4DA 4A1TA 2BY8X 4NFFA 2FYRA 1DXWA 1O38A 1G32B 1CVWH 1AVWA 3GY4A 5JYIA 3LIWA 4FUJA 3ZVFA 3RC5A 5JBTA 3JZ1B 1FIWA 3MU4A 5EXLA 5F8ZA 4Q7YA 1OYQA 2BLOA 4CRDA 1O2KA 5FXLA 1RIWB 2FYQA 1FONA 2WV4A 2BY5X 1E38B 1WOFA 2QIQA 2ZNKH 3MO6A 5LGOA 1SG8B 2BTCE 4WMFA 3I29A 3F1SB 1BRAA 5GCHF 3SBKA 1HB0B 2GT8A 3RXFA 2P95A 1P2NA 1Y3VA 1E0FD 3QGNB 2BD4A 1B7XB 1O2UA 1IQLA 1MU6B 2FOEA 2WPJS 2Z94A 1BUIA 3E0PB 1QJ6B 2XBYA 1C2GA 3Q3KA 3ZVGA 1P8VC 4X1QU 5C1UA 1BCUH 2SGFE 4MNYA 3MTYA 2BZ6H 4X8SH 2JH5D 1QY6A 1VCQA 5LPFA 1CBWC 2BD5A 4NZQA 3ZV9A 9ESTA 1SB1H 3U98H 1AN1E 3M36A 1DE7H 1SGTA 2ZU4A 3FP6E 3C27B 1LVYA 3G01A 3GCOA 1NTPA 1WSSH 4GPGA 2BQWB 4BAKB 3MI4A 5FAHA 3MWIU 2YNAA 3BTEE 1KDQA 4BNRA 3ODFA 5FPSA 4GCHG 3O8CA 3SU3A 3TH3H 1MU8B 4ABFA 1TNJA 1MKWK 4ZMAH 5EQQA 3F9HA 4GHTA 2OC1A 1BTWA 2P3UB 1ZTLA 1HCGA 4K5ZA 4ABDA 2A2QH 3PM3A 2GTBA 6GCHF 1W7GH 2Z9IA 1Q3XA 1NZQH 3TITA 3LGTA 7ESTE 4FVBA 4UFEH 3RXTA 3T27A 4JYVH 1S82A 3PO1C 4K69A 3LGWA 3TK6A 1S5SA 2Q6DA 1D6WA 3D62A 4XBDA 4ABJA 1OWIA 2R3YA 1GJBB 3ZVDA 2BVRH 2LPRA 1KXBA 3RXEA 1MQ5A 1TMUH 3S9AA 1ORFA 4U32A 1OKXA 4H42U 1TIOA 1DS2E 3RUOA 3SNBA 1ELEE 1KY9A 2H9HA 4FU8A 2B9LA 3KQDA 1LMWB 2XBWA 3TVJB 1OWDA 1QQUA 2R0KA 1HAHH 1DY9A 3ZZ9A 1Y5BT 3A8CA 4NSYA 1ZHMA 5DKMA 4E06H 2ZGJA 1BBRH 1QA0A 2ZFQH 1TNIA 1NPMA 5E0JA 1XM1A 3PROA 1GBMA 1EOJA 1CT2E 2TGTA 1SQOA 1YM0A 1ARCA 3ZZ8A 3NZIA 4QT8C 3UTUH 1ACBE 2P16A 4TY7A 2A45B 3PB1E 1UTPA 1TNLA 2ZHWH 2Y82A 2ZHQH 1O2SA 1GBDA 1OOKB 1OS8A 1NESE 1MD8A 3SOSA 3S69A 2ZHFH 3ZZBA 1C5QA 2PGQB 4X1SU 4D9QA 1GI8B 2FOHA 2G52A 3RXAA 2A4GA 2J2UA 1GVKB 5FCRA 1LKAA 1F5LA 1GBLA 1O5GH 5E0HA 3UNQA 3LGVA 1HYLA 1AFQB 1QRXA 3UR9A 1CA8B 3S7HB 1TFXA 1OWHA 1TA2A 2HVXA 4B2BA 3Q00A 1BB0B 3ATLA 3RU4T 1GGDC 3RXIA 1Y8TA 4GHQA 2R3UA 4OS1A 3SN8A 1D3PB 1GMHF 2XBXA 4TWYA 1OP8A 1O2GH 1K28D 2VB0A 4X1NU 1UK3A 3ELAH 2BOHB 1W0ZU 1C4Y2 2OC7A 1S0RA 3LGUA 2O8WA 2ZFRH 1TA6A 4Z0KA 5C20A 2BY7X 4NGAH 2ZFSA 4YT7H 3OTJE 1HJ9A 1TQ0B 3VB6A 1ABJH 1TX6A 2PWXA 2AFQB 2FTMA 1F7ZA 4INHA 4UDWH 4ISIH 2C3SA 2O8MA 4I8JA 3T29A 1MCVA 2FODA 3M3TA 2CF9H 1CU1A 1VJAU 5AFZH 1LCYA 2FMJA 1AQ7A 1E35B 1EZSC 1Y3WA 2F9VA 1AZ8A 1OP2A 1XUJA 2TRMA 1SGRE 1DLKB 2F3CE 2OBQA 2CF8H 5TJXA 2M5TA 1TGTA 1F5KU 2A4RA 1C2JA 2PGBB 1HJ8A 2J34A 1O5BB 1P57B 2BLVA 5JB9S 3NXPA 1C5WB 5F03A 5DP7A 3T26A 4OGXA 1O2LA 1ZJKA 3AAUA 1SR5C 3SO3A 4OS7A 1YKTA 2GMTC 2JETC 1MH0A 2PKAB 1WQSA 3RXVA 1V2VT 4X1RU 1J8AA 1T8OA 2CV3A 2H5CA 1G30B 3A7ZA 1O5AB 3S9BA 3GICB 2ZC9H 3CENA 3E90B 3SUGA 4PROA 1TWXB 5JB8S 4BXWA 1O5CB 3F9EA 1EAIA 3RXMA 1G9IE 3PYHA 3ZVAA 4MPUA 1Z71A 3LJJA 4AFSA 2GCHG 2FOAA 4AYYB 2OD3B 1GI7B 1K22H 5A8YA 2CHAC 3SHAH 4MNVA 4UE7H 2PKSC 1RXPA 4U30A 1O3BA 3KQCA 4YTAA 2FLBH 4ABIA 1SGIB 2O8TA 2VGCB 1Z8RA 3GY3A 1EJNA 2IN2A 2WPKS 4K2YA 1BTXA 4A1XA 5A09A 1YLCA 2W3KA 1UHBB 3ODDA 4HZHA 5DP8A 1A3EH 1EKBB 1DT2A 1GJDB 5SGAE 1H9LB 2A4QA 3A85A 1Y59T 3E0NB 2ULLA 4MPWA 5A0CA 2UUFB 3RXBA 2ZTXA 5FCKA 4MPVA 3SJIA 3MOCA 1C5PA 2EI8A 1J15A 1ZJDA 3EDXB 5CHAB 3UQOA 4DURA 3PMJA 5BRRE 1LHGH 3A7VA 1HXEH 1AHTH 2ZFTA 2VH0A 2R0LA 4ZKSU 3LH3A 3ZZ6A 4UFGH 5DJ7A 3UWIA 1H4WA 3PTBA 5AVDA 3RXUA 4A1VA 4Z6AH 4KGAA 1H9IE 1UTNA 1GCTB 1ZLRA 2BDGA 2C8WB 1GHXH 1HAVA 2WUBA 3E8LA 3LC3A 3P8FA 1G2MA 2AYWA 3RXRA 1BQYA 1EJAA 3A8DA 3FP8E 2FOGA 1S0QA 1C5LH 1A5IA 2WPLS 1MMJN 1T8NA 2GDDA 4I8KA 1LPGB 1AUTC 4NA7A 3QDZB 5ETXA 3HKIB 2AGIX 1V2OT 6ESTA 1HJAC 4I7YH 1MTUA 1MTSA 3FZZA 1UMAH 1ELBA 3LGYA 2FEQH 3U8TH 2WUCA 3RU4D 1L4ZA 2OQUA 1LHDH 1O3PB 2XCFA 1YBWA 4IMQA 1FN6A 1S83A 3N7OA 2AIPA 4HTCH 5DP4A 1NROH 3ZZ5A 3HK6B 3RXCA 2P3TB 3MMGA 1C5RA 1JIRA 1XX9A 5EXNA 1EPTB 5JBCS 1ZSJA 1C5ZB 3MU5A 4D76A 1BTHH 4INKA 1Y5AT 3BTGE 1S6HA 4JK6A 1BITA 4X6PA 3E3TA 1O3GA 3GDUA 2R9PA 4ZKOU 1Z8GA 5T6DA 4CH2B 1L1NA 1ZGIA 1A5GH 2A5AA 3V13A 1HRTH 4HGCA 1GBAA 1BDAA 4CREA 1TGBA 4E7NA 3LDXH 1O3NA 3SNCA 2O8UA 2UWLA 3MHWU 4Y76A 1QB1A 1LKBA 2PSXA 1O5DH 4Y8YA 3ATKA 3T62A 1D3TB 1PQ7A 3GCTG 1RJXB 1IQEA 4JYUH 2F9UA 2HNTF 1ELGA 3SNDA 4K8YA 1UTOA 2WYJA 1K1JA 2R2WU 3GY7A 1TGSZ 1FAKH 1O3AA 2SGAA 1UTMA 1HGTH 1GJAB 3PMHB 3MNXA 3FFGA 4H6SB 2ZCLP 6CHAC 1EASA 1YCPH 3VGCB 3S7KB 4XOJA 2BXUH 5CMXH 1ZPCA 1GJ7B 4HFPB 3RP2A 3WY8A 2SGQE 1QA7A 3T28A 2P8OB 1AB9C 3DFJA 1QBOA 1LQEA 4WMDA 1VITH 4LZ1H 1AWFH 1ELTA 3Q77A 1P05A 4TY6A 8LPRA 4MLFB 3QWCH 4R8TB 1CA0B 4IGDA 1LVBA 3SU5A 1HAYB 5TCCA 2G4UA 5AF9H 1BMLA 4I32A 3RXGA 1XKBC 3OYPA 1BBRE 1V2ST 1GJCB 1F0SA 4NWKA 2ZWLH 1WQVH 1X7AC 4MVNA 4AN7A 1BTPA 2W26A 2A31A 2FX6A 3F9FA 1NRRH 1DSUA 3GISB 4XDEA 2AH4X 3ZZAA 1MQ6A 1ELDE 4U2WA 2OC0A 4THNH 1V2UT 1KXCA 4WF8A 3SJ8A 4MG3A 3SV9A 3W95A 2SGEE 2QXHA 1K21H 1P10A 1B0EA 3BTHE 1V2TT 1O3OA 1D6RA 4CHAB 4FUGA 1IHTH 1TB6H 2XWBI 2G51A 2XNIA 4IS5A 1Z6JH 4X6NA 1O3DA 2ZGBH 1C5YB 1ETSH 3LJOA 2VIPA 5EU8A 5G4BA 1P2OA 5GCHG 1RIWC 3ZZ7A 1NT1A 1GVZA 1P3EA 3EGKH 3HKJB 1ABIH 3VXFH 5DK1A 1T7CA 2NU0E 2H9TH 3A86A 3BIVH 2FO9A 1CHOF 4IW4E 1Q31A 2ODPA 4TPIZ 1CE5A 3GY5A 3RXOA 1V2WT 2ZPQA 1DITH 1OSSA 2ZDMA 1WYKA 4XE4A 4I33A 2HWLB 1DX5M 4RKOB 2VWMA 3V3MA 1JIMA 3PWBA 2BDBA 2NU2E 1C1TA 2Z9KA 1Z1IA 3H7OA 1YPKH 7LPRA 1GBEA 4GLYA 5L6NH 1SGCA 2CMYA 1KIGH 4Q7ZA 3OU0A 2G00A 3AW0A 1AU8A 3FVFB 4NIWA 4TWWA 1C2KA 2ZZUH 3IWMA 5EODA 1ZOMA 2IJOB 1VJ9U 1FY4A 2QAAA 1SVPA 1UVSH 4B76A 2Y5GA 6GCHG 1S6FA 2Y5FA 1BIOA 1P11E 4Q2KA 4YO9A 1TPOA 4AG1A 1P9UA 1IQJA 2H5DA 1JWTA 2G55A 3IG6B 2VU8E 5GPIB 1UTQA 1XUHA 1C2DA 1HFDA 1H8DH 2C8YB 1V2JT 2EC9H 3SI4H 1EZXC 2OBOA 5ESBA 2ZU5A 4I8HA 1L1GA 5ABWA 3QZQA 1VITF 3SJOA 3SU0A 1EAXA 5PTPA 3OSYA 2Z7FE 3TK5A 1TLDA 5CE1A 2AERH 1EAUA 2GKVE 3RXQA 2BLWA 1JMOH 2QXJA 4INLA 4FUIA 5DP5A 5T6GA 5L30H 4DCDA 1BTYA 1WTGH 4NSVA 1VGCB 3TK9A 2VIDA 1ESAA 2GCTB 2ZGXH 2WPIS 3M5NA 4DG4A 3M5OA 3HGPA 2EI6A 4HI3A 4TYDA 5I46H 3DA9B 3RDZA 1NU9A 4WXVA 1SGEE 1LHFH 4YZUA 3M61U 3PLKA 2QA9E 2IOTA 3SV8A 3M35A 2D8WA 4KKDA 4Y10E 2G4TA 4IC5A 3O8DA 2NU3E 4D7FA 2I6QA 4UONA 4VGCB 1O2WA 3EQ0H 1PQAA 2F9OA 3SUFA 1C1UH 3U1IB 1GPZA 2BD8A 3SU2A 4JZ1A 1S81A 4Y79A 4WH8A 3DHKH 1E34B 2XWAA 2J4IA 1W13U 3D23A 4ZKRU 2HPPH 2JH6D 2XC0A 1IQIA 3VXEH 2BY9X 1XUFA 2UWOA 2THFB 3RXSA 1HAIH 1XUKA 1MTVA 2VIVA 3HGNA 1AKSB 4BTUB 1UTKA 1A2CH 3P8NA 1BTZA 1G37A 3FZDA 1NFYA 1SI5H 1FV9A 3RLYH 3BTQE 1SSXA 5FX6A 1YPHE 1GMHG 3MH7A 1B0FA 2I6SA 1O3FA 2ZHDA 1DVAH 3EA8A 2HLCA 1AFQC 1TYNA 1V6DA 1KTSB 4ZHLU 4TPYA 2BM2A 3ZVCA 4OGYA 1CBWB 4DGJA 1BJUA 1K1LA 1V2RT 5T6FA 4LOYH 1ZPBA 1YF4A 4NIXA 1N6XA 1UCYK 1W2KH 1CGHA 2BDIA 1JBUH 2B5TB 1UVPA 3PWCA 1C5VA 2J95A 3JZ2B 4IN1A 3TGKE 1O3EA 5E2PA 2TBSA 1F0TA 2FLRH 4KTCA 2GZ7A 2P93A 1XUGA 1INCA 1W12U 1EP6A 1GHYH 1V2MT 1DM4B 4AYVB 1NM6A 1VCPA 2QC2A 2SFAA 4FUDA 1XXDA 3SV7A 3ZVBA 2GV7A 1YPGH 1AVXA 1SOZA 5C5OA 2ZDNA 5HYOA 2GZ8A 3E6PH 5T3HA