1J14A

Benzamidine in complex with rat trypsin mutant x99rt
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRETYNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords trypsin II, anionic
publication title Reconstructing the Binding Site of Factor Xa in Trypsin Reveals Ligand-induced Structural Plasticity
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j14A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j14A02
1O2WA 1ABJH 1O2UA 3PLBA 3URDA 1SGFG 4NA9H 1TRNA 2O9QA 2VWLA 1XXFA 1GMCF 1O30A 1XX9A 4Y8ZA 4WMFA 4Y7BA 3GY4A 3LOXA 1D3TB 3VB3A 3U8RH 4ZXXH 3BTEE 1GMCG 3B23B 2ZTYA 1ELEE 1BMNH 1GJ8B 3GCNA 2VWOA 3OSYA 3RC6A 4FUHA 1O3JA 1N8OC 1SOTA 2G5NA 4VGCB 1MTUA 3QGNB 4MDSA 1ZZZA 3LGTA 3CENA 2ZDKA 1W8BH 2GV7A 4YESB 5EXNA 4K3JA 3ZVAA 1K21H 1VITH 1SB1H 4X6MA 3TH2H 3PTBA 2GT8A 4QT8C 1TBRH 1SBWA 1KXAA 3MH4A 1BMMH 3M61U 1F0SA 1Y59T 4O97A 4AFUA 2A7JA 2BLOA 3A80A 5GPIB 4AFSA 4ABDA 2FESH 3RXEA 1K1MA 1QNJA 1E34B 1ZTLA 3IITA 1G9IE 4NSVA 2BY5X 2B7DH 1T4VH 3RLWH 3FAOA 4HI3A 4YZUA 5DP3A 4AG1A 2GP9B 4B2AA 1WQVH 3P8OA 1D3PB 1W12U 1T31A 4IMQA 2FS8A 4UONA 2BMGB 4INHA 1J15A 5C5NA 4CBNA 5FXLA 4A7IB 1TWXB 2BD4A 1CU1A 4MPVA 3FZDA 1BA8B 1VZQH 1EQ9A 2NWNA 3BF6H 1NZQH 1CHOF 1C1OA 1V6DA 5C1XA 2WPHS 3S9CA 1WSSH 1D6WA 3GOVB 3SU3A 2J95A 6CHAC 5DG6A 2GZ8A 2F9NA 1GMHF 1P9SA 2IPHA 1O3EA 3IG6B 2EC9H 2JETC 3O8CA 1HFDA 3KIDU 4K5ZA 4IBLH 5L2ZH 5EQSA 3ZZ7A 1OWEA 1C2FA 1O2GH 2QA9E 3GDSA 1GCTB 1ESTA 1C1MA 1WYKA 2SGAA 2EI8A 1ZGIA 2ZPSA 1KDQA 1FIWA 1LDTT 2FXRA 3NZIA 3VPKA 1QURH 5FX6A 1A5IA 1UVPA 1TLDA 2UUKB 3ZZDA 2VIWA 4U01A 1EKBB 2OCVB 1QFKH 1YF4A 2BTCE 3SBKA 1P2JA 1O31A 1JIMA 4TPYA 1QBNA 3RXBA 2TGDA 2A1DB 1U6QA 1TGCA 3L3TA 1IQJA 3GY3A 4K60A 1W13U 1PPFE 3QUMP 3SJIA 1P3EA 4FUEA 1PPBH 1KXCA 1TNJA 3FP8E 1G30B 4AYVB 5E0HA 4A1XA 2ANYA 3R3GB 5B6OA 1SFIA 1DWBH 4ISOA 3K6YA 5FCKA 3SV8A 1QJ7B 1HAVA 2AS9A 1EB1H 2ODYB 3STIA 3PO1C 1O3GA 3HGNA 5HYOA 2BOHB 3V13A 1XUKA 2AFQB 1O0DH 1TABE 4KGAA 2EEKA 1HAXB 1ZSJA 1GJ6A 3EDXB 1DT2A 3MFJA 1SGDE 1ZHRA 2C8ZB 2EI7A 3SHCH 3V12A 3LGUA 4F4OC 1FMGA 1FUJA 1QJ6B 2HNTC 1Y5AT 3T62A 1OYQA 2R0LA 4CRAA 2JH6D 3ATMA 4Q2KA 2XBWA 1WUNH 3RXAA 2TGAA 5DP7A 5DP6A 1LHDH 1PPGE 1MKXH 1TALA 1QTFA 1WOFA 2P93A 4ABJA 1AVXA 4A6LA 5T3HA 5AFYH 1YBWA 5JB9S 3A8AA 1MU8B 1ZYOA 2BLVA 3SI4H 3I77A 1A0JA 2P3FH 2ZFQH 3QN7A 1DWEH 1D3QB 1Y3VA 1K1PA 3LIWA 1HLTH 3D23A 2CJIA 1KTSB 4KTUA 4ZHLU 3S9AA 1PPCE 1MAXA 1AZ8A 1WCZA 3KF2A 2VB0A 2ILNA 5E0JA 4XDEA 1UHBB 2SNWA 4FUJA 1C4U2 1OWKA 2OC1A 1GG6B 1ZR0A 2FX4A 1C2LA 1LQDB 2WPLS 3BTWE 1BMAA 3GICB 4B74A 4WVPE 2BD2A 2VIPA 2OP9A 3OY6U 1G37A 2BYAX 1HAZB 5DGJA 7ESTE 3ZZ8A 1AFQB 1CBWC 4DW2U 2PLXA 3E0PB 3GISB 1K1LA 2VNTA 2R9PA 5E2PA 1C5RA 2O8MA 3ZYDA 2XW9A 3U1IB 2AGIX 1A3EH 3A88A 5HGGA 4ZAEA 2H2ZA 4DVAU 2FMJA 2V0BA 2P3TB 1DXWA 1P3CA 1UTQA 2QN5T 4NWLA 2Y7ZA 3A81A 3RXVA 2FZZA 2D26C 1SQAA 2QF3A 1KXEA 1JRTA 1L4DA 1FXYA 3MMGA 3PYHA 2Z3EA 2GGVB 2OINA 3UIRA 3BTTE 1S83A 3NKKA 1Y3XA 2ZDMA 3UQVA 2GKVE 3VB4A 2GMTC 2WINI 4I8KA 3RU4D 1TNIA 3GCHC 1HJ8A 2BVRH 1YCPM 3PMHB 1QBVH 1W11U 2G8TA 1N8OB 1IQEA 2AMPA 3RXDA 4AB9A 1BUIA 1NRQH 5IDKA 1P01A 2FOEA 1ABIH 1GVKB 2RA0A 4Z0KA 1YPHE 4ZHAA 1BBRH 2ZZUH 2C8WB 1FN6A 3MO6A 2DE9A 1NRRH 4NA7A 1SPJA 3RXFA 4FVBA 4RSPA 1YC0A 1AIXH 1C5WB 1MAYA 2PTNA 3BG4C 3VEQB 3FANA 3FZZA 1BRAA 2PR3A 1Z71A 3KCGH 1IOEA 1SGRE 3MU1A 1AB9C 1EOJA 1MBQA 3BTGE 1VGCC 1D6RA 1TX7A 3A86A 3TVJB 2UWPA 1FPHH 4IMZA 1F92A 4DT7B 1THRH 3QX5H 3BTME 2H9EH 1O5EH 2QXGA 4MNXA 2EA3A 3P8GA 2QGRA 5LPEA 1SGEE 4WF8A 4TWYA 1IHTH 2Z9LA 3HK6B 4KP0A 4B73A 1AHTH 2ZU1A 3NCLA 1FPCH 1SHHB 6CHAB 3SNCA 3CP7A 2IJOB 1Z1JA 1HXEH 2C4FH 1G3DA 1BITA 3RXLA 3U98H 2TRMA 1O2YA 5K7RA 2OQ5A 1N1LA 2JETB 4IGDA 1GJCB 4ESTE 2FOGA 2Z3DA 1CT0E 1SMFE 4ABFA 1GDUA 1K1IA 3Q76A 1F5LA 2STBE 4U30A 4XBDA 4X6PA 5JYIA 4CR9A 1TPSA 1O32A 3LH1A 3VFEA 1CGHA 1L2EA 1LO6A 2ZU3A 2Y5FA 1UTMA 2FDAA 4NZLA 4JZEH 3KQBA 3BG8A 3QGJA 3TU7H 1A0LA 5LH8A 1P03A 2NU3E 3BTFE 1O38A 4K1EA 1BB0B 3U1JB 1EAXA 3GCTG 1IQLA 4Y0ZE 1GBEA 4X1NU 4UFEH 1BTXA 5DO4H 4IW4E 2UUJB 4Y0YE 4IC6A 1TNKA 9ESTA 4LOYH 2DE8A 1PQ8A 5CMXH 2TPIZ 1WTHD 3S69A 2XRCA 1QQUA 2ANMH 1LMWB 1KTTB 3BTDE 3T5FH 1C9TA 1O3HA 3MU5A 3LU9B 3MH5A 1P04A 1NO9H 3BTHE 3M37A 2ODQA 1TGBA 1FY1A 2R2MB 2ULLA 4LXBH 4HGCA 2I6QA 1C2EA 3PO1B 1TMTH 2B9LA 1NFUA 2F3CE 3VB7A 1QRXA 1YLCA 4X2VA 1UCYH 1QL8A 1Q2WA 2CMYA 1EPTA 1AUJA 1O3NA 1BHXF 4B2CA 1P2OA 1ZHPA 1IAUA 4I32A 4YOGA 1ANCA 4J2YB 3QWCH 1RIWC 3CS7A 4ISLA 1TX8A 5EXLA 4GHQA 1NTPA 1GDNA 1SGIB 1C4Y2 5JPMH 3E16B 1JMOH 3M7QA 3SUDA 1O2HA 3MTYA 5GCHG 1UK4A 4BTTB 7GCHG 1ZMLA 1GBTA 5A09A 1TX6A 3RMOH 1TMBH 5C3NA 1YLDA 4TY6A 4DJZB 1GMDF 3RMLH 1QY6A 3T27A 2BY9X 3SQEE 4KTCA 4I8JA 4U2WA 1GWAA 1TNLA 1NPMA 3GY5A 2PTCE 2FM2A 4WH6A 3RMNH 1ELDE 4NGAH 1OWDA 1FONA 3BIVH 4KKDA 1O5BB 2XWAA 3TGJE 1AD8H 4LZ4B 3AVZA 1XVOA 5FAHA 5E8EH 5L30H 1TNGA 4JCNA 1DSTA 3OTJE 4MQAA 2A5AA 6GCHF 1RS0A 1DVAH 3RXGA 3EYDA 1GHBG 2QYIA 3LC5A 3MOCA 3LC3A 2VWNA 1A2CH 2Q6DA 1NM6A 1H8IH 1O33A 1PQ5A 3TGKE 1EOLA 4X0WU 1GG6C 2VIDA 4YTAA 2BZ6H 3SNBA 2QXJA 5T6DA 1Z6EA 5AFZH 1INCA 5C20A 4IN1A 1TMUH 1C2HA 1ZTKA 2BD5A 2Z7FE 1MCTA 4X8VH 1ELTA 4JZIA 7KMEH 4DIIH 1L4ZA 1AFQC 3A83A 3AASA 1ELBA 4ASHA 1WQSA 1TA2A 3U8TH 1QIXB 1GBAA 1GL0E 3ZZ3A 4CR5A 2PW8H 3UNQA 2BY6X 1MU6B 4Y8XA 1GHAG 3U8OH 1EZXC 3EQ0H 1HPGA 1V2NT 3SORA 3RDZA 1BRBE 2DUCA 1O5GH 5FX5A 1HDTH 1MCVA 4AFQA 4JYUH 1A46H 4UDWH 2QAAA 2Y5GA 4OS7A 1SC8U 2GMTB 4IN2A 3GCHB 3RUOA 2Q6FA 2ZGCA 5EG4A 5AVDA 1O3PB 4GCHF 3TJVA 2O8TA 2ZDLA 5FCRA 3S7KB 1O2ZA 1OP8A 1TBZH 2O8WA 5EW1H 4Q7YA 4MNYA 3AW1A 1QR3E 2M5TA 3SGBE 1TGTA 3E90B 1UVUH 4BXWA 4HZHA 2A5KA 3E0NB 1AO5A 1RTFB 1A5GH 1P2MA 5ETXA 1O34A 1NRNH 2HNTE 4NIXA 2V3OH 3TNTA 5FHTA 4XFQA 1AWFH 4I31A 4AX9H 1XUGA 4TWWA 3BG4B 1YKTA 3LGYA 1TONA 1FZZA 4D9QA 3MI4A 1GBHA 2OC8A 1Y3WA 2ZPQA 3UNSA 1OSSA 1AB9B 2BD9A 5DP9A 3UWIA 1IQNA 4I8LA 5DP8A 3O8BA 1VGCB 3ELAH 2GDDA 4E05H 1DPOA 3DA9B 3RC5A 2J4IA 1GJ5H 1HNEE 4THNH 2SGEE 2ZDVH 1L1JA 1HGTH 1O2PA 5AF9H 1G3BA 2RDLA 3I29A 1SGPE 3DHKH 2BB4A 1ZHMA 2FPZA 2HALA 1MD7A 3SU0A 3S9BA 4LZ1H 3KHVA 3RXRA 2FOHA 2PKAB 2ZHFH 3ZVBA 4DG4A 1F5KU 1GL1A 2PV9B 1Z8GA 1XKBC 1O2IA 3F1SB 1FAKH 1SGQE 3RXOA 1A5HA 3FP6E 1XVMA 2ZG0H 1HUTH 1T4UH 1J16A 2ZCLP 3K6ZA 3TK6A 5JBCS 3F9HA 4OS2A 3M5LA 3CS0A 4AOQA 2G51A 2ZTZA 5E0GA 1HIAB 1NS3A 1MD8A 1PYTD 1CHOG 3VGCC 2KAIB 1VCPA 5EOKA 3BEFB 4X2WA 2NU2E 3T25A 1GBDA 4H42U 3ZZAA 1GMHG 1RXPA 3KQEA 1NU7B 2STAE 1LHCH 4AFZA 1EJNA 1V2ST 1W2KH 2C90B 4JZDH 1LPGB 3A7ZA 1EJAA 1QBOA 2GDEH 2J92A 5JBBS 1A0HB 1YGCH 2XXLA 1SI5H 1X7AC 1C1VH 1GJ9B 5DP4A 4Y11E 4YT7H 5A0AE 1P09A 4JMYA 4OS6A 3G01A 3KGPA 1AGJA 1C2JA 5FPTA 2H6MA 1UTLM 5EPYA 1FNIA 4AN7A 3TLOA 4CH2B 1C1SA 2B0FA 1P2QA 2VVUA 4GAWA 2BX3A 1C1NA 1A7SA 3RXTA 1KYNA 3SJKA 1BRCE 2F9UA 1DICA 2VIVA 3SNEA 4I33A 1V2KT 4K1TA 1PPHE 1YCPH 3A7VA 4NG9H 4K8BA 1BMLA 3DT0H 1LQEA 2BY7X 1NRSH 4D7FA 2CXVA 3LJOA 1C5QA 1S6HA 2HWLB 2TGTA 1ELVA 3Q3XA 1MZDA 1UHBA 1RIWB 1C5VA 1DUEA 1SHYA 1G3CA 3PMJA 1PFXC 3LPRA 1LVYA 1AZZA 5F6MA 2NU4E 1AKSA 2HPPH 1GVLA 3A7WA 1AQ7A 1GI6A 3PLKA 3IWMA 1AVGH 2ZEBA 2A4GA 2NU0E 1GI4A 4YLUA 1ESAA 1DLKB 1MKXK 1BZXE 1QA0A 2BDHA 2XCNA 3TJUA 1D4PB 1KSNA 1OS8A 3KN2A 1GI1A 5G4BA 1O2XA 4A92A 1BQYA 1IQIA 3F68H 1ZGVA 2XBXA 2JKHA 3VB6A 1T32A 3PM3A 1HCGA 1JIRA 1MZAA 4CHAC 1KDQB 4CRGA 3D49H 4WMEA 1MBMA 2ZFFH 2OC0A 1MTWA 2A7HA 2WPMS 2P95A 1DE7H 1BTPA 1FI8A 4ABGA 2PHBA 1J9CH 5EXMA 2H9HA 1O2QA 1OP0A 4BAKB 1QL9A 1ZMJA 1H9LB 2BDBA 1UK2A 3RXKA 1DX5M 1Q3XA 1XM1A 3O8DA 1GHZA 1NFYA 1SGNE 1SGTA 4I7YH 1TPPA 5AHGH 1K1OA 4B75A 1GBBA 1N6XA 2AGGX 1Y5BT 2K1QA 1SGCA 2BXUH 1P06A 3LJJA 4GSOA 4XBCA 3SGAE 2BD3A 3W94A 2W3KA 4YM9A 4ZKNU 1FV9A 3MYWA 4X2YA 1NC6A 1ETSH 2Z3CA 2P8OC 1HAVB 2ZFSA 4E7NA 3A7XA 3RXPA 1NT1A 1XUFA 5FBEA 2WUBA 5BPEA 2XC4A 2Q6GA 2TBSA 3SU1A 4WWYA 1EZUC 1EX3A 1P02A 1THSH 3MHWU 1FY3A 2BLWA 3A85A 1V3XA 4KTSA 1C2GA 4X1RU 3ATKA 3Q3YA 1T8MA 2OBQA 2BQWB 2I6SA 1QA7A 2ZECA 3RXSA 4AORA 3A82A 4UD9H 1EZSC 3UNRA 1TQ7B 1DY8A 1KLJH 5A8XA 3AAVA 1C1TA 1LKBA 1WAYB 1LVOA 1PYTC 4HTCH 4ZH8A 4AYYB 1PJPA 3QTOH 1MTNC 3LKWA 2Y7XA 2FP7B 3UR9A 3ZVDA 2GCHF 3UFAA 2ZFTA 1DUAA 2OXSA 4IC5A 3ZZ9A 3QDZB 4FU7A 2A7CA 2R3UA 2WYGA 1HAIH 1W0YH 1BTWA 1BBRK 2B8OH 3PB1E 1GCDA 3MU8A 2Z9JA 1HAGE 1S85A 2PUXB 2ZKSA 1QL7A 1Z6JH 2BLQA 5I46H 4ABBA 1C9PA 1ID5H 1JXPA 2XWBI 5HXFA 4U32A 3QK1A 4O3UA 4TYDA 1QB1A 3K2UA 3E6PH 1F5RA 3RU4E 2BDCA 2ZIQH 1E38B 1ACBE 1SFQB 4XOJA 4FVDA 1O2RA 1D3DB 4LK4A 3GY6A 1AVWA 1GBJA 1TOCB 2UUYA 4JYVH 4Q80A 1CVWH 4H6TA 2HRVA 1GHWH 4INLA 3MNBA 1H9IE 2OC7A 3NWUA 4UFGH 5C1YA 1G2MA 2PKSC 4RKOB 1O3AA 1HJ9A 2FI4E 4X6NA 3UUZA 4Y7AA 1EB2A 1MTVA 3ESTA 1VCQA 2HVXA 1UTJA 3LH3A 1QQ4A 4D9RA 1PPEE 2V6NA 1TPOA 1QGFA 3DUXH 3VXFH 2B5TB 1K28D 1ZRKA 1WV7H 3BN9A 2VGCC 1HAPH 2FLBH 2G4TA 2P59A 1EJMA 1RFNA 2CF8H 2GV6A 2ZC9H 1NY22 3PMAB 1XUJA 4DOQA 7LPRA 1O2TA 4DGJA 3URCA 4O3TA 1FLEE 1WBGB 4BTIB 4MTBA 2Y6TA 1UTOA 4K2YA 3RXMA 4TY7A 1HRTH 1S0QA 1P2KA 1O3DA 1HXFH 3VGCB 4UFFH 1T8LA 2H5CA 4CRFA 3SGQE 1ZJDA 2RG3A 4R0IA 1NRPH 3TH3H 2GTBA 1VJAU 1CA0C 1C1QA 1ELGA 2ZGJA 4JK5A 1C1WH 2BDYA 4NIWA 1O2LA 1MKWH 3SV6A 4NWKA 3T2NA 2VIQA 3KQCA 3LGIA 4D8NA 3I78A 1PQ7A 3K9XB 4Y10E 3MO3A 1O5DH 1MQ6A 1OWIA 4YOJA 3P8FA 2A4OA 4X8SH 4ZHMU 2Y81A 3TGIE 4UE7H 2C8YB 4FXGH 3PWBA 1EZQA 3BTQE 3K65B 2A0QB 1RRKA 1MQ5A 4GUXA 2PUQH 4A1VA 4ZKOU 4YLQH 2ZI2H 1ETTH 1AE8H 4SGBE 1Z7KA 2HNTF 1GBLA 2GZ9A 5EQQA 1GI3A 4DURA 1ETRH 1FQ3A 1HV7A 1UJ1A 3JZ2B 3EAJA 2A4QA 1DWDH 1RTLA 4ZROA 1F7ZA 1OYTH 4Y71A 1WTGH 1JRSA 1NFXA 3ZVEA 1FY4A 1GHYH 2GCTC 3RU4T 1IQKA 2CHAC 1UCYK 3MH6A 3ODDA 1P05A 2J2UA 2AEIH 3LGVA 1ZPZA 5JBAS 4INKA 5EU8A 1P57B 1YP9A 2BHGA 4ISIH 1O5AB 2WYJA 1XXDA 3E91A 4FUIA 1ZSLA 2BD7A 3P17H 5FPSA 2BX4A 3HGPA 3ATIA 4OS1A 2Y5HA 5K0HA 3T29A 1C5OH 2H1UA 1LVBA 4X1SU 2FOAA 5F8TA 1UVSH 1G32B 2THFB 1Y3UA 1DM4B 3UPEA 4BANB 2ZCHP 3M35A 3HKIB 2PGQB 3SW2B 3H7TA 4ABAA 1TIOA 1VITF 3T28A 3S0NA 5L6NH 3V7TA 2FOFA 3NPSA 3BEUA 1C5LH 2ZP0H 4CHAB 1V2LT 4NZQA 1B0FA 1C5ZB 3E1XB 1UTPA 1TAWA 1NFWA 4H6SB 1K22H 2PFEA 3QTVH 3PWCA 1VCWA 1GDQA 4J1YA 1V2JT 4A5TS 2FOMB 1GMDG 3KL6A 3MWIU 2VJ1A 3LDXH 3V3MA 1RGQA 3JZ1B 3QO6A 2QF0A 3SN8A 1GBKA 1Z8JB 1THPB 1HAHH 4YT6H 1YPLH 1KY9A 2UWOA 3L33A 1UMAH 4WXIA 4ABHA 2AERH 1CHGA 3B8JA 4Z6AH 2SGFE 4NFEA 5DPAA 1QB6A 1O3KA 3D65E 3GYMA 4X8TH 5T6FA 5TCAA 6GCHG 1NESE 3M5OA 4O9VA 2P8OB 3FFGA 3FVFB 3N7OA 5L2YH 4CRCA 1TNHA 1VR1H 3M5NA 3ZZ6A 3SV2H 1EAWA 2ODPA 5EODA 2SGDE 3RM2H 2A2QH 1EPTB 3SUEA 3TK5A 2BVSH 5C1UA 1ARBA 3A7YA 4ISHH 3ZVCA 1SGYE 2PWXA 1KXFA 4K8YA 2F9OA 1GI9B 4Q7ZA 4XSKU 2G4UA 4CH8B 1E35B 1TRMA 2WPJS 3EA9A 1QCPA 1GHXH 9LPRA 1O35A 4XE4A 3TH4H 5A8ZA 3QZRA 4OGYA 1W0ZU 1MTNB 1TYNA 1GI5A 3ZYEA 3AW0A 3FP7E 1UO6A 1SR5C 4BAHB 1AE5A 1HJAB 2OQUA 2ZO3H 1OP2A 2BQ6B 3EE0B 2ZU2A 2ZA5A 2VWMA 1AY6H 1JBUH 8GCHF 1G36A 3SJ9A 5LGOA 1O3MA 1SGFA 2PKAA 4O03A 5DKMA 4I8GA 1A1RA 1M9UA 5CHAB 3M5MA 2Y82A 5JBTA 2OTVA 3GYLB 3TIUA 4GCHG 2ZFPH 2ZPRA 3GY8A 5JDUB 4X1QU 3HKJB 1GHVH 3C27B 2A4RA 2BQ7B 3Q77A 4FU8A 3S7HB 1GI2A 2XNIA 1KXBA 5E2OA 1HIAA 4X8UH 1XKAC 2C93B 2ZCKP 5EQRA 3SOSA 1SQOA 4WXVA 2KAIA 1K9OE 2G55A 2XC0A 2J94A 1GGDC 1RJXB 2FTMA 4YO9A 3B9FH 1O2MA 2PKSB 1F2SE 4FUCA 4RKJB 1GJ4H 1K1NA 1S82A 1O3BA 2FODA 3H5CB 3TNSA 1NN6A 1YPMH 4CREA 4CRDA 4ISNA 5HMAA 2VH0A 5PTPA 1TB6H 1CGIE 4OS5A 3UOPA 3KEEA 1BJUA 2VGCB 1C5TA 1TBQH 3UQOA 2HLCA 3W95A 5C67A 3VB5A 2BZAA 1IQGA 1XUIA 3U9AH 2F83A 4ZXYH 1Y3YA 3UOUA 1BTHH 1P2IA 2G81E 5SGAE 2ZGHA 3PTNA 2D2DA 3DFJA 1ZTJA 4FU9A 3TITA 4BAMB 1GBMA 2FEQH 4F49A 1Q31A 3MU4A 1K2I1 1DWCH 1V2TT 1OXGA 4NIYA 1BT7A 5A8YA 1IHSH 4Y6DA 2A32A 2A31A 3ZV9A 5DP5A 1YPJH 1E37B 1CA0B 3ATWA 3M3TA 3RLYH 2GD4B 1P11E 3SI3H 1BTZA 4FUBA 2D8WA 3SU4A 1W7GH 1O2KA 3M3SA 2Q1JA 1QRZA 4AG2A 1W14U 2W7SA 4DY7B 2UWLA 1H4WA 2PSXA 1C2IA 1CT4E 1DS2E 2SNVA 3T26A 1P12E 5DK1A 2AMDA 6LPRA 2VIOA 3NUMA 3DFLA 4AZ2B 3LONA 3EGKH 1ZLRA 3MNCA 3F9FA 3SJOA 1ZOMA 1BTYA 1C4V2 3BSQA 1PPZA 3M3VA 2WV4A 1O5CB 2FLRH 4CBOA 4ZUHA 3Q00A 2J34A 2ZQ1A 5EGMA 2Z6BD 1C5YB 3ODFA 2GCTB 3R0FA 3SUFA 1TA6A 1SL3A 1Z8RA 2W7UA 3RMMH 2V35A 1LHFH 1YCPK 2ANWA 1ELAA 1EAIA 3UTUH 2CHAB 5HM9A 3MO9A 1O3LA 3SU2A 4R8TB 3ZV8A 5EPNA 3P92A 1NROH 2F9VA 3GY2A 2G52A 2ZDAH 1YYY1 1EXFA 3U69H 1V2PT 3SO3A 1DDJA 1BCUH 4GLYA 4MPXA 3RXJA 4BNRA 4KELA 2LNCA 1TPAE 2ZHWH 4OS4A 2H9TH 1YPGH 2HOBA 3C1KA 2VVVA 1P9UA 1SLVB 4ABEA 3P70B 4WH8A 1MTSA 2XYAA 1DITH 1LHGH 3SNDA 5LPRA 3KQDA 3WY8A 1BIOA 2FOCA 3E3TA 3SJ8A 1FJSA 5I25A 3MU0A 1TGNA 6ESTA 4SGAE 1LHEH 1W7XH 2ZU5A 2P16A 3UY9A 1CE5A 3O8RA 3SQHE 3NXPA 8ESTE 3RXCA 1VJ9U 2ZTXA 1F0TA 8KME2 2P94A 1S0RA 3SZNA 4E06H 1O3IA 1SQTA 1QRWA 4A1TA 3A87A 1FY5A 3TJOA 1S81A 1DXPA 1O36A 4B71A 1UVTH 3KNXA 3AAUA 1SG8B 1TE0A 2QXHA 3RM0H 1GJDB 2QC2A 1EP5A 1O3CA 1QB9A 1V2QT 1C5NH 2FIRH 2P3UB 1MMJN 5ESBA 1BTUA 5F8XA 2OLGA 2AYWA 1SOZA 2ZU4A 2VVCA 4FUDA 1ZJKA 1V2WT 2D1JA 4DCDA 2R3YA 1DSUA 4NA8A 4AB8A 4MNVA 1J8AA 2FO9A 1FY8E 2IOTA 4D7GA 3SV7A 3UREA 3RXUA 5FBIA 5A0CA 5J4SA 3UR6A 4BOHA 1KIGH 3TPIZ 3PLPA 1C2MA 4OGXA 3SUGA 5ESTE 1D9IA 1FIZA 1OOKB 2AIPA 1EASA 4X6OA 1BRUP 4B76A 2W26A 3RXHA 1HAYB 1F0RA 3PV4A 2HGTH 1AKSB 1GBCA 1EPTC 1FDPA 1KXDA 2ALVA 2FYRA 3LT3A 5J4QA 1AN1E 2V3HH 2A5IA 2XCFA 3NK8A 4JZ1A 4MLFB 1C5XB 8LPRA 2ZNKH 4UFDH 1SVPA 1P2NA 3ITIA 1CGJE 2J38A 1HB0B 2W3IA 2G5VA 1RTKA 3ZZ4A 1SLUB 1BDAA 1HYLA 1ZRBA 3F6UH 3MH7A 1A4WH 1LPKB 1Z1IA 1F0UA 1DOJA 1HJAC 1ANBA 1ORFA 1SLWB 2WPKS 4DIHH 4FUFA 1TGSZ 1H8DH 2JH5D 1GBFA 5CE1A 1Z8IB 5EW2H 2GCHG 1YM0A 4WY3A 1B0EA 2F91A 5CHAC 1TFXA 1CA8B 1OWJA 3RXIA 1Y8TA 3ZVGA 5F8ZA 3ZVFA 1O3OA 1GGDB 2ASUB 1O2NA 1B7XB 3A7TA 4NCYA 4ABIA 2ZDNA 1V2MT 3PROA 2A2XH 4NIVA 1G3EA 1C1PA 1SSXA 5GWZA 4X1PU 2VH6A 3OYPA 2ZGXH 1GPZA 1ZSKA 3SHAH 1T8NA 1E0FD 1RD3B 4JK6A 2AMQA 1L1GA 1XMNB 3ZZ5A 3GY7A 4TPIZ 2SGQE 1S5SA 4VGCC 1UVOA 2PGBB 1BBRE 2UUFB 3V0XA 1ZMNA 2GT7A 2QV1A 2BDAA 4GPGA 5HM2A 2FS9A 3ZZCA 1P10A 2CF9H 1JOUB 3ZZBA 1C5MD 3Q3KA 1V2OT 2BXTH 2NU1E 2G00A 3VXEH 2FOBA 2XTTB 1DFPA 2OUAA 1P8VC 1MKWK 1C5SA 2YNAA 1GBIA 1O3FA 1J14A 1ELFA 4ZKRU 1IQMA 3P95A 1LTOA 2ZHQH 4WJG2 3SNAA 4MPUA 1W3CA 3LGWA 1V2VT 1DY9A 2QXIA 1FN8A 2A45B 2BDIA 4HFPB 2ALPA 4B1TA 3QLPH 2SGPE 3ATLA 2R0KA 1L0ZA 4WMDA 1C5PA 5TJXA 1C2KA 3UWJH 2YOLA 1TRYA 3BV9B 2FTLE 1XUHA 1CQQA 2F9PA 2JH0D 3L6PA 1EAUA 1CT2E 1KLTA 1P0SH 3GDUA 2ZFRH 1UTNA 1AI8H 1N6YA 2RCEA 3F9GA 1NU9A 1OX1A 5C5OA 2FX6A 1C1RA 1K1JA 1HBTH 5A2MH 1LKAA 3M36A 2YNBA 3HPTB 2ZHDA 1O2SA 4MNWA 1UTKA 3RXQA 2IN2A 2EI6A 2FI3E 1GI8B 1GCTC 3GCTF 1HAOH 4Q7XA 2Z9KA 2F9BH 4JZFH 1OWHA 2C3SA 2WV5A 1T7CA 3EA7A 1G2LA 5T6GA 4X2XA 3PMBB 3BEIB 4BTUB 5ABWA 3M7UA 2QCYA 1TQ0B 1TOMH 4D76A 2Z9GA 4AGKA 1IQFA 2ZHEH 4MPWA 4M7GA 1E36B 1DANH 1SLXB 3MNSA 4JYTA 3TJNA 2SFAA 2GX4A 1CSOE 2QY0B 2BD8A 1AMHA 1EUFA 4MVNA 4GHTA 4BXSA 5JB8S 2AGEX 5BRRE 1LCYA 2LPRA 2O8LA 3P6ZB 4FUGA 2FWWA 3OY5U 1AWHB 2WUCA 1O5FH 1AUTC 1GJBB 2TIOA 1WU1A 1B5GH 1GI0A 3QZQA 2ZQ2A 1VITG 1A61H 1AU8A 4UEHH 4BAOB 2ANKH 2BOKA 3SV9A 4K69A 3D62A 1EATA 2VINA 2XBVA 5GIBA 1MUEB 1QJ1B 1LPZB 2TGPZ 1UK3A 1UCYE 1CO7E 2O8UA 4NFFA 2QIQA 5F03A 4ZMAH 4XBBA 1ELCA 2Z94A 3TK9A 5LPFA 1ANDA 5GCHF 4Y76A 5GXPA 1L1NA 5FPYA 7GCHF 1YPHC 2VU8E 5GJ4B 4PROA 2CV3A 5TCCA 1ANEA 2BVXH 1YPKH 2Z9IA 3DD2H 1GJ7B 1V2UT 4H4FA 4ZKSU 5A0BA 3GDVA 2ZWLH 2CN0H 3BTKE 1O2OA 1IQHA 2XC5A 4I8HA 4CRBA 4AGJA 3MNXA 2Y80A 3A8CA 1V2RT 1H9HE 3SU6A 2RA3A 3RP2A 4NSYA 5DJ7A 2PSYA 1AFEH 1C5UA 2CGAA 4GVUA 5IYTA 3GCOA 3SU5A 4Y8YA 1JWTA 1DLEA 1Y5UT 4IS5A 4K1SA 1BHXB 3HATH 2WPIS 3H7OA 5H4IB 1EP6A 2FYQA 1OPHB 1GHBF 1S84A 2GVFA 2HPQH 3A8DA 2XBYA 3A8BA 4RN6A 3P8NA 2H5DA 2AH4X 1O39A 1O37A 1BOQA 4YOIA 1H1BA 2ESTE 1J17T 1C2DA 1T8OA 1PQAA 3STJA 3M7TA 1ARCA 1O2VA 3E8LA 3OU0A 1OKXA 1CBWB 4Y79A 1LVMA 3EA8A 1YPEH 2C8XB 1C1UH 4E7RG 1A3BH 2ZGBH 5GDSH 1GJAB 3RC4A 4MG3A 3ENSB 1GVZA 3BIUH 3OX7U 2BY8X 2W5EA 1O2JA 1FAXA 2AIQA 1GI7B 2BM2A 1W10U 3HK3B 1GHAF 5C2ZA 1ZPCA 3A89A 1KLIH 8GCHG 2J9NA 2OBOA 4BAQB 1ESBA 1MH0A 4B2BA 1ZPBA 1S6FA 2GZ7A 3F9EA 1QHRB 3A84A 1BJVA 2ZF0H 2R2WU 2OD3B 2FI5E 2BDGA
chains in the Genus database with same CATH superfamily
1O2WA 1ABJH 1O2UA 3PLBA 3URDA 1SGFG 4NA9H 1TRNA 2O9QA 2VWLA 1XXFA 1GMCF 1O30A 1XX9A 4Q4LA 4WMFA 4Y7BA 3GY4A 4Y8ZA 3LOXA 1D3TB 3VB3A 3U8RH 4ZXXH 3BTEE 1GMCG 3B23B 2ZTYA 1ELEE 1BMNH 1GJ8B 3GCNA 2VWOA 3OSYA 3RC6A 4FUHA 1O3JA 1N8OC 1SOTA 2G5NA 4VGCB 1MTUA 3QGNB 4MDSA 1ZZZA 3LGTA 3CENA 2ZDKA 1W8BH 2GV7A 4YESB 5EXNA 3UAIC 4K3JA 3ZVAA 1K21H 1VITH 4YXWD 1SB1H 4X6MA 3TH2H 3PTBA 2GT8A 4QT8C 1TBRH 1SBWA 1KXAA 3MH4A 1BMMH 4RT1A 3M61U 1F0SA 1Y59T 4O97A 4AFUA 2A7JA 2BLOA 3A80A 5GPIB 4AFSA 4DT4A 4ABDA 2FESH 3RXEA 5DN6D 1K1MA 1QNJA 1E34B 1ZTLA 3IITA 1G9IE 4NSVA 2BY5X 2B7DH 1T4VH 3RLWH 3FAOA 4HI3A 4YZUA 5DP3A 4AG1A 3KQ5A 2GP9B 4B2AA 1WQVH 3P8OA 1D3PB 1W12U 1T31A 4IMQA 2FS8A 4UONA 2BMGB 4INHA 1J15A 5C5NA 4CBNA 2KCAA 5FXLA 2L74A 4A7IB 1TWXB 2BD4A 1CU1A 4MPVA 3FZDA 1BA8B 1VZQH 1EQ9A 2NWNA 3BF6H 2V7QD 1NZQH 1CHOF 1C1OA 1V6DA 5C1XA 2WPHS 3S9CA 1WSSH 1D6WA 3GOVB 3SU3A 2J95A 6CHAC 5DG6A 2GZ8A 2F9NA 1GMHF 1P9SA 2IPHA 1O3EA 3IG6B 2EC9H 2JETC 3O8CA 1HFDA 3KIDU 4K5ZA 4IBLH 5L2ZH 5EQSA 3ZZ7A 1OWEA 1C2FA 1O2GH 2QA9E 3GDSA 1GCTB 1ESTA 1C1MA 1WYKA 2SGAA 2EI8A 1ZGIA 2ZPSA 1KDQA 1FIWA 1LDTT 2FXRA 3NZIA 3VPKA 1QURH 5FX6A 1A5IA 1UVPA 1TLDA 2UUKB 3ZZDA 2VIWA 4U01A 1EKBB 2OCVB 5KEDA 1QFKH 1YF4A 2BTCE 3SBKA 1P2JA 1O31A 1JIMA 4TPYA 1QBNA 3SZEA 3RXBA 2TGDA 2EY4C 2A1DB 1U6QA 1TGCA 3L3TA 1IQJA 3GY3A 4K60A 1W13U 1PPFE 3QUMP 3SJIA 1P3EA 4FUEA 1PPBH 1KXCA 1TNJA 3FP8E 1G30B 4AYVB 5E0HA 4A1XA 2ANYA 3R3GB 5B6OA 1SFIA 1DWBH 3WW7A 4ISOA 4ACBA 3K6YA 5FCKA 3SV8A 1QJ7B 1HAVA 2AS9A 1EB1H 2ODYB 3STIA 1SKYE 3PO1C 1O3GA 3HGNA 5HYOA 2BOHB 3V13A 1XUKA 2AFQB 1O0DH 1TABE 4KGAA 2EEKA 1HAXB 1ZSJA 1GJ6A 3EDXB 4P00A 1DT2A 3MFJA 1SGDE 1ZHRA 2C8ZB 2EI7A 3SHCH 3V12A 3LGUA 4F4OC 1FMGA 1FUJA 1QJ6B 2HNTC 1Y5AT 3T62A 1OYQA 2R0LA 4CRAA 2JH6D 3ATMA 4Q2KA 2XBWA 1WUNH 3RXAA 2TGAA 5DP7A 5DP6A 1LHDH 1PPGE 1MKXH 1TALA 1QTFA 1WOFA 2P93A 4ABJA 1AVXA 4A6LA 5T3HA 5AFYH 1YBWA 5JB9S 3A8AA 1MU8B 1ZYOA 2BLVA 3SI4H 3I77A 1A0JA 2P3FH 2ZFQH 3QN7A 1DWEH 1D3QB 1Y3VA 1K1PA 3LIWA 3F3BA 1HLTH 3D23A 2CJIA 1KTSB 4KTUA 4ZHLU 3S9AA 1PPCE 1MAXA 1AZ8A 1WCZA 3KF2A 2VB0A 2ILNA 5E0JA 4XDEA 1UHBB 2OK5A 2SNWA 4FUJA 1C4U2 1OWKA 2OC1A 1GG6B 1ZR0A 2FX4A 1C2LA 1LQDB 2WPLS 3BTWE 1BMAA 3GICB 4B74A 4WVPE 2BD2A 2VIPA 2OP9A 3OY6U 1G37A 2BYAX 1HAZB 5DGJA 7ESTE 3ZZ8A 1AFQB 1CBWC 2QF4A 4DW2U 2PLXA 3E0PB 3GISB 1K1LA 2VNTA 2R9PA 5E2PA 1C5RA 2O8MA 3ZYDA 2XW9A 3U1IB 2AGIX 1A3EH 3A88A 5HGGA 4ZAEA 2H2ZA 4DVAU 2FMJA 2V0BA 2P3TB 3MQKC 1P3CA 1DXWA 1UTQA 2QN5T 4NWLA 2Y7ZA 3A81A 3RXVA 2FZZA 2D26C 1SQAA 2QF3A 1KXEA 1JRTA 1L4DA 1FXYA 3MMGA 3PYHA 2Z3EA 2GGVB 2OINA 3UIRA 3BTTE 1S83A 3NKKA 1Y3XA 2ZDMA 3UQVA 2GKVE 3VB4A 2GMTC 2WINI 4I8KA 3RU4D 1TNIA 3GCHC 1HJ8A 2BVRH 1YCPM 3PMHB 3WWFA 3OAAD 1QBVH 1W11U 2G8TA 1N8OB 1IQEA 2AMPA 3RXDA 2J98B 4AB9A 1BUIA 1NRQH 5IDKA 1P01A 2FOEA 1ABIH 1GVKB 2RA0A 4Z0KA 1YPHE 1H8HD 4ZHAA 1BBRH 2ZZUH 2C8WB 1FN6A 3MO6A 2DE9A 1NRRH 4NA7A 1SPJA 3RXFA 4FVBA 3DCLA 4RSPA 1YC0A 1AIXH 1C5WB 1MAYA 2PTNA 3BG4C 3VEQB 3FANA 3FZZA 1BRAA 2PR3A 1Z71A 3KCGH 1IOEA 1SGRE 3MU1A 1AB9C 1EOJA 4Q63A 1MBQA 3BTGE 1VGCC 3F0PA 1D6RA 1TX7A 3A86A 3TVJB 1EFRD 4B6FA 3FOAA 2UWPA 1FPHH 4RT0A 4IMZA 1F92A 4DT7B 1THRH 3QX5H 3BTME 2H9EH 1O5EH 2QXGA 3H09A 4MNXA 1W0KD 2EA3A 3P8GA 2QGRA 5LPEA 1SGEE 4WF8A 2WZQA 4TWYA 1IHTH 2Z9LA 3HK6B 2JIZD 4KP0A 4B73A 1AHTH 2ZU1A 3NCLA 1FPCH 1SHHB 6CHAB 3SNCA 3CP7A 2IJOB 1Z1JA 1HXEH 2C4FH 1G3DA 1BITA 3RXLA 3U98H 2VBCA 2TRMA 1O2YA 5K7RA 2OQ5A 1N1LA 2JETB 4IGDA 1GJCB 4ESTE 3DSGA 2FOGA 2Z3DA 1CT0E 1SMFE 4ABFA 1GDUA 1K1IA 3Q76A 1F5LA 2STBE 4U30A 4XBDA 4X6PA 5JYIA 4B6EA 4CR9A 1TPSA 1O32A 3LH1A 3VFEA 1CGHA 1L2EA 1LO6A 2ZU3A 2Y5FA 1UTMA 2FDAA 4NZLA 4JZEH 3KQBA 3BG8A 5C0UA 3QGJA 3TU7H 1A0LA 5LH8A 1P03A 2NU3E 3BTFE 1O38A 4K1EA 1BB0B 3U1JB 1EAXA 1KMHB 3GCTG 1IQLA 4Y0ZE 1GBEA 4X1NU 4UFEH 1BTXA 5DO4H 4IW4E 2UUJB 4Y0YE 4IC6A 1TNKA 9ESTA 4LOYH 3DSOA 2DE8A 5C94A 1PQ8A 5CMXH 2TPIZ 1WTHD 3S69A 2XRCA 1QQUA 2ANMH 1LMWB 1KTTB 3BTDE 3T5FH 1E1QD 1C9TA 1O3HA 3MU5A 3LU9B 3MH5A 1P04A 1NO9H 3BTHE 3M37A 2ODQA 1TGBA 1FY1A 2R2MB 2ULLA 3GS9A 4LXBH 4HGCA 2I6QA 1C2EA 3PO1B 2LELA 1TMTH 2B9LA 1NFUA 2F3CE 3VB7A 1QRXA 1YLCA 4X2VA 5EJLA 1UCYH 1QL8A 1Q2WA 2CMYA 1EPTA 1AUJA 1O3NA 2AHME 1BHXF 4B2CA 1P2OA 1ZHPA 1IAUA 4I32A 4YOGA 1ANCA 4J2YB 3QWCH 1RIWC 3CS7A 4ISLA 1TX8A 5EXLA 4GHQA 1NTPA 1GDNA 1SGIB 1C4Y2 5JPMH 3E16B 1JMOH 3M7QA 3SUDA 3PRBA 1WDIA 1O2HA 3MTYA 5GCHG 1UK4A 4BTTB 7GCHG 1ZMLA 1GBTA 5A09A 1TX6A 3RMOH 1TMBH 5C3NA 1YLDA 4TY6A 4DJZB 1GMDF 3RMLH 1QY6A 3T27A 2BY9X 3SQEE 4KTCA 4I8JA 4U2WA 3F2HA 1GWAA 1TNLA 1NPMA 3GY5A 2PTCE 2FM2A 4WH6A 3RMNH 1ELDE 4NGAH 3F0OA 1OWDA 4XD7D 1FONA 3BIVH 4KKDA 1SQRA 1O5BB 2XWAA 3TGJE 1AD8H 4LZ4B 2W6ID 3AVZA 1XVOA 5FAHA 1NBME 5E8EH 5L30H 5C17A 1TNGA 4JCNA 1DSTA 3OTJE 4MQAA 2A5AA 6GCHF 3VG8A 1RS0A 1DVAH 3RXGA 3EYDA 1GHBG 2QYIA 3LC5A 3MOCA 3LC3A 2VWNA 1A2CH 2Q6DA 1NM6A 1H8IH 1O33A 1PQ5A 3TGKE 1EOLA 4X0WU 1GG6C 2RDEA 2VIDA 2BZ6H 4YTAA 2QXJA 3SNBA 5T6DA 1Z6EA 5AFZH 1INCA 5C20A 4IN1A 1TMUH 1C2HA 1ZTKA 2BD5A 2Z7FE 1MCTA 3OEHD 4X8VH 1ELTA 4JZIA 7KMEH 4DIIH 1L4ZA 2IJD1 1AFQC 3A83A 3AASA 1ELBA 4ASHA 1WQSA 1TA2A 3U8TH 1QIXB 1GBAA 1GL0E 3ZZ3A 4CR5A 2PW8H 3UNQA 2BY6X 1MU6B 4Y8XA 1GHAG 3U8OH 1EZXC 3EQ0H 1HPGA 1V2NT 2KFWA 3SORA 2F43B 3RDZA 1BRBE 2DUCA 1O5GH 5FX5A 1HDTH 1MCVA 4AFQA 4JYUH 1A46H 4UDWH 2QAAA 2Y5GA 4OS7A 1SC8U 2GMTB 4IN2A 1BMFD 3GCHB 3RUOA 2Q6FA 2ZGCA 5EG4A 5AVDA 1O3PB 4GCHF 3DSPA 2O8TA 3TJVA 2ZDLA 5FCRA 3S7KB 5CHBA 1O2ZA 1OP8A 1TBZH 2O8WA 5EW1H 4Q7YA 4MNYA 3AW1A 4OM9A 1QR3E 2M5TA 3SGBE 1TGTA 3E90B 1UVUH 4BXWA 4HZHA 2A5KA 3E0NB 1AO5A 1RTFB 1A5GH 1P2MA 5ETXA 1O34A 1NRNH 2HNTE 4NIXA 2V3OH 3TNTA 5FHTA 4XFQA 1AWFH 4I31A 4AX9H 1XUGA 4TWWA 3BG4B 1YKTA 3LGYA 1TONA 5GNDA 1FZZA 4F48B 4D9QA 3MI4A 1GBHA 2OC8A 1Y3WA 2ZPQA 3UNSA 1OSSA 2LP6A 1AB9B 2BD9A 5DP9A 3UWIA 1IQNA 4HG6A 4I8LA 5DP8A 3O8BA 1VGCB 3ELAH 2GDDA 4E05H 1DPOA 3DA9B 3RC5A 2J4IA 1GJ5H 1HNEE 4THNH 2SGEE 2ZDVH 1L1JA 1HGTH 1O2PA 5AF9H 1G3BA 2RDLA 3I29A 1SGPE 3DHKH 2BB4A 1ZHMA 2FPZA 2HALA 1MD7A 3OEED 3SU0A 1COWD 3S9BA 4LZ1H 3KHVA 3RXRA 2FOHA 2PKAB 2ZHFH 3ZVBA 4DG4A 4ASUD 2WPDD 1F5KU 1GL1A 3W1EA 2PV9B 3WWBA 1Z8GA 1XKBC 1O2IA 3F1SB 1FAKH 1SGQE 3RXOA 1A5HA 3FP6E 1XVMA 2ZG0H 1HUTH 1T4UH 1J16A 2ZCLP 3K6ZA 3TK6A 5JBCS 3F9HA 4OS2A 3M5LA 3CS0A 4AOQA 2CK3D 2G51A 2ZTZA 5E0GA 1HIAB 2J97A 3U28C 1NS3A 1MD8A 1PYTD 1CHOG 3VGCC 2KAIB 1VCPA 3F2FA 5EOKA 3BEFB 4X2WA 2NU2E 3T25A 1GBDA 4H42U 3ZZAA 1GMHG 1RXPA 3KQEA 1NU7B 2STAE 1LHCH 4AFZA 1EJNA 1V2ST 1W2KH 2C90B 1S6LA 4JZDH 1LPGB 3A7ZA 1EJAA 1QBOA 2GDEH 2J92A 5JBBS 1A0HB 1YGCH 2XXLA 1SI5H 1X7AC 1C1VH 1GJ9B 5DP4A 4Y11E 4YT7H 5A0AE 1P09A 4JMYA 4OS6A 3G01A 3KGPA 1AGJA 1C2JA 5FPTA 2H6MA 1UTLM 3N7EA 5EPYA 1FNIA 4AN7A 3TLOA 4CH2B 1C1SA 2B0FA 1P2QA 2VVUA 4GAWA 2BX3A 1C1NA 1A7SA 3RXTA 2J5UA 1KYNA 2M2AA 3SJKA 1BRCE 2F9UA 1DICA 2VIVA 3SNEA 2WSSD 4I33A 1V2KT 4K1TA 1PPHE 1YCPH 3A7VA 4NG9H 4K8BA 1BMLA 3DT0H 1LQEA 2BY7X 1NRSH 4D7FA 2CXVA 3LJOA 5HIZA 1C5QA 1S6HA 2HWLB 2TGTA 1ELVA 3Q3XA 1MZDA 1UHBA 1RIWB 1C5VA 1DUEA 1SHYA 1G3CA 3PMJA 2WHXA 1PFXC 3LPRA 1LVYA 1AZZA 2K8IA 2YMSD 5F6MA 2NU4E 1AKSA 2HPPH 1GVLA 3A7WA 1AQ7A 1GI6A 3PLKA 3IWMA 1AVGH 5KECA 2ZEBA 2A4GA 2NU0E 1GI4A 4YLUA 1ESAA 1DLKB 1MKXK 1BZXE 1QA0A 2BDHA 2XCNA 3TJUA 1D4PB 1KSNA 4I86A 1OS8A 3KN2A 1GI1A 5G4BA 1O2XA 4A92A 1BQYA 1IQIA 3F68H 1ZGVA 2XBXA 2JKHA 3VB6A 1T32A 3PM3A 1HCGA 1JIRA 1MZAA 4CHAC 1KDQB 4CRGA 3D49H 4WMEA 1MBMA 2ZFFH 2OC0A 1MTWA 2A7HA 2WPMS 2P95A 1DE7H 1BTPA 1FI8A 4ABGA 2PHBA 1J9CH 5EXMA 2H9HA 1O2QA 1OP0A 4BAKB 1QL9A 1ZMJA 1H9LB 2BDBA 1UK2A 3RXKA 1DX5M 1Q3XA 1XM1A 3O8DA 1GHZA 1NFYA 4F55A 1SGNE 1SGTA 4I7YH 1TPPA 5AHGH 1K1OA 4B75A 1GBBA 1N6XA 2AGGX 1Y5BT 2K1QA 1SGCA 3N99A 2BXUH 1P06A 1FX0B 3LJJA 4GSOA 4XBCA 3SGAE 2BD3A 2J98A 3W94A 2W3KA 4YM9A 4ZKNU 1FV9A 3MYWA 4X2YA 1NC6A 1ETSH 2QE7D 2Z3CA 2P8OC 1HAVB 2ZFSA 4E7NA 3A7XA 3RXPA 1NT1A 1XUFA 5FBEA 2WUBA 5BPEA 2XC4A 2Q6GA 2TBSA 3SU1A 4WWYA 1EZUC 1EX3A 1P02A 1THSH 3MHWU 1FY3A 2BLWA 3A85A 1V3XA 4KTSA 2JJ1D 1C2GA 4X1RU 3ATKA 3Q3YA 1T8MA 2OBQA 2BQWB 2I6SA 1QA7A 2ZECA 3RXSA 4AORA 3A82A 4UD9H 1EZSC 3UNRA 1TQ7B 1DY8A 1KLJH 5A8XA 3AAVA 1C1TA 1LKBA 1WAYB 1LVOA 1PYTC 4HTCH 4ZH8A 4AYYB 1PJPA 2L6OA 3QTOH 1MTNC 3LKWA 2Y7XA 2FP7B 3UR9A 3ZVDA 2GCHF 3UFAA 2ZFTA 1DUAA 2OXSA 4IC5A 3ZZ9A 3QDZB 4FU7A 2A7CA 2R3UA 2WYGA 1HAIH 1W0YH 1BTWA 1BBRK 2B8OH 3PB1E 1GCDA 3MU8A 2Z9JA 1HAGE 2KCYA 1S85A 3PV2A 1OHHD 2PUXB 2ZKSA 1QL7A 1Z6JH 2BLQA 5I46H 4ABBA 1C9PA 1ID5H 1JXPA 2XWBI 5HXFA 4U32A 3QK1A 4O3UA 4TYDA 1QB1A 3K2UA 3E6PH 1F5RA 3RU4E 2BDCA 2ZIQH 1E38B 1ACBE 1SFQB 4XOJA 4FVDA 1O2RA 1D3DB 4LK4A 3GY6A 1AVWA 1GBJA 1TOCB 2UUYA 4JYVH 4Q80A 1CVWH 4H6TA 2HRVA 1E79D 1GHWH 4INLA 3MNBA 1H9IE 2OC7A 3NWUA 4UFGH 5C1YA 1G2MA 2PKSC 4RKOB 1O3AA 1HJ9A 2FI4E 4X6NA 3UUZA 3N7DA 4Y7AA 1EB2A 1MTVA 3ESTA 1VCQA 2HVXA 1UTJA 3LH3A 1QQ4A 4D9RA 1PPEE 2V6NA 1TPOA 1QGFA 3DUXH 3VXFH 2B5TB 1K28D 1ZRKA 1WV7H 3BN9A 2VGCC 1HAPH 2FLBH 2G4TA 2P59A 1EJMA 1RFNA 2CF8H 2GV6A 2ZC9H 1NY22 3PMAB 1XUJA 4TSFD 4DOQA 7LPRA 1O2TA 4DGJA 3URCA 3KYFA 4O3TA 1FLEE 1WBGB 4BTIB 2YMSC 4MTBA 2Y6TA 1UTOA 4K2YA 3RXMA 4TY7A 1HRTH 1S0QA 5EJZA 2KZ4A 1P2KA 1O3DA 1HXFH 3VGCB 4UFFH 1T8LA 2H5CA 4CRFA 3SGQE 1ZJDA 2RG3A 4R0IA 1NRPH 3TH3H 2GTBA 1VJAU 1CA0C 1C1QA 1ELGA 2ZGJA 3EE7A 4JK5A 1C1WH 2BDYA 2PP6A 4NIWA 1O2LA 1MKWH 3SV6A 4NWKA 3T2NA 2VIQA 3KQCA 3LGIA 4D8NA 3I78A 1PQ7A 3K9XB 4Y10E 3MO3A 1O5DH 1VKYA 1MQ6A 1OWIA 2QF5A 4YOJA 3P8FA 2A4OA 4X8SH 4ZHMU 2Y81A 3TGIE 4UE7H 2C8YB 4FXGH 3PWBA 5DSFA 1EZQA 3BTQE 2GJGA 3K65B 2A0QB 1RRKA 1MQ5A 4GUXA 2PUQH 4A1VA 4ZKOU 4YLQH 2ZI2H 1ETTH 2KCOA 1AE8H 4SGBE 1Z7KA 2HNTF 1GBLA 2GZ9A 5EQQA 1GI3A 4DURA 1ETRH 1FQ3A 1HV7A 1UJ1A 1UW7A 3EAJA 3JZ2B 2A4QA 1DWDH 1RTLA 4ZROA 1F7ZA 1OYTH 4Y71A 1WTGH 1JRSA 2F4LA 1NFXA 3ZVEA 1FY4A 1GHYH 2GCTC 3RU4T 2JJ2D 1IQKA 2RFKC 2CHAC 1UCYK 3MH6A 3ODDA 1P05A 2J2UA 2AEIH 3LGVA 1ZPZA 5JBAS 4INKA 5EU8A 1P57B 1YP9A 2BHGA 4ISIH 1O5AB 2WYJA 1XXDA 3E91A 4FUIA 1ZSLA 2BD7A 3P17H 5FPSA 2BX4A 3HGPA 3ATIA 4OS1A 2Y5HA 5K0HA 3T29A 1C5OH 2H1UA 1LVBA 4X1SU 2FOAA 5F8TA 1UVSH 1G32B 2THFB 1Y3UA 1DM4B 3NRLA 2WV9A 3UPEA 4BANB 2ZCHP 3M35A 3HKIB 2PGQB 3SW2B 3H7TA 4ABAA 1TIOA 2HLDD 1VITF 3T28A 1YY3A 3S0NA 5L6NH 3V7TA 2FOFA 3NPSA 3BEUA 1C5LH 5HKKD 2ZP0H 4CHAB 1V2LT 2KCPA 4NZQA 1B0FA 1C5ZB 3E1XB 1UTPA 1TAWA 1NFWA 4H6SB 1E1RD 1K22H 2PFEA 3QTVH 3PWCA 1VCWA 1GDQA 4ACAA 5KGOA 4J1YA 1V2JT 4A5TS 2FOMB 1GMDG 3KL6A 3MWIU 2VJ1A 3LDXH 3V3MA 1RGQA 3JZ1B 3QO6A 5HIYA 2QF0A 3SN8A 1GBKA 1Z8JB 1THPB 1HAHH 4YT6H 1YPLH 1KY9A 1NBMD 2UWOA 3L33A 1UMAH 4WXIA 4ABHA 2AERH 1CHGA 3B8JA 4Z6AH 2SGFE 4NFEA 5DPAA 1QB6A 2KR7A 1O3KA 3D65E 3GYMA 4X8TH 5T6FA 5TCAA 6GCHG 1NESE 3M5OA 4O9VA 2P8OB 3FFGA 3FVFB 3N7OA 5L2YH 4CRCA 1TNHA 1VR1H 3M5NA 3ZZ6A 3SV2H 1EAWA 2ODPA 5EODA 2SGDE 3RM2H 5IK2D 2A2QH 1EPTB 3SUEA 3TK5A 2BVSH 5C1UA 1ARBA 3A7YA 4ISHH 3ZVCA 1SGYE 2PWXA 1KXFA 4K8YA 2F9OA 1GI9B 4Q7ZA 4XSKU 2G4UA 3OFND 4CH8B 1E35B 1TRMA 2WPJS 3EA9A 1QCPA 1GHXH 9LPRA 1O35A 5B6LA 4XE4A 3TH4H 5A8ZA 3QZRA 4OGYA 1W0ZU 1MTNB 1TYNA 1GI5A 3ZYEA 3AW0A 3FP7E 1UO6A 1SR5C 4BAHB 1AE5A 1HJAB 2OQUA 2ZO3H 1OP2A 2BQ6B 5CDFE 3EE0B 2ZU2A 2ZA5A 2VWMA 1AY6H 1JBUH 8GCHF 1G36A 3SJ9A 5LGOA 1O3MA 1SGFA 2PKAA 4O03A 5DKMA 4I8GA 1A1RA 1M9UA 5CHAB 3M5MA 2Y82A 1W0JD 5JBTA 2OTVA 3GYLB 3TIUA 4GCHG 2ZFPH 2ZPRA 3GY8A 3OTPA 5JDUB 4X1QU 3HKJB 1GHVH 3C27B 2A4RA 2BQ7B 3Q77A 4FU8A 3S7HB 1GI2A 2XNIA 1KXBA 5E2OA 1HIAA 4X8UH 1XKAC 2C93B 2ZCKP 5EQRA 3SOSA 1SQOA 4WXVA 4RI0A 2KAIA 1K9OE 2G55A 2XC0A 2J94A 1GGDC 1RJXB 2FTMA 4YO9A 3B9FH 1O2MA 2PKSB 1F2SE 4FUCA 4RKJB 1GJ4H 1K1NA 1S82A 2V3MA 4Z1MD 1O3BA 1MABB 2FODA 3H5CB 3TNSA 1NN6A 1YPMH 4CREA 4CRDA 4ISNA 5HMAA 2VH0A 4XRNA 5PTPA 1TB6H 1CGIE 4OS5A 3UOPA 3KEEA 1BJUA 2VGCB 1C5TA 1TBQH 3UQOA 2HLCA 3W95A 5C67A 3VB5A 2BZAA 1IQGA 1XUIA 3U9AH 2F83A 4ZXYH 5F53A 1Y3YA 3UOUA 1BTHH 1P2IA 2YMSB 2G81E 5SGAE 2ZGHA 3PTNA 2D2DA 3DFJA 1ZTJA 4FU9A 3TITA 4BAMB 1GBMA 2FEQH 4F49A 1Q31A 3MU4A 1K2I1 1DWCH 1V2TT 1OXGA 4NIYA 1BT7A 5A8YA 1IHSH 4Y6DA 2A32A 2A31A 3ZV9A 5DP5A 1YPJH 1E37B 1CA0B 3ATWA 3M3TA 3F2GA 3RLYH 2GD4B 1P11E 3SI3H 1BTZA 4FUBA 2D8WA 3SU4A 1W7GH 1O2KA 3M3SA 2Q1JA 1QRZA 4AG2A 1W14U 2W7SA 4DY7B 2UWLA 1H4WA 2PSXA 1C2IA 1CT4E 1DS2E 2SNVA 3T26A 3FKSD 1P12E 5DK1A 2AMDA 6LPRA 2VIOA 3NUMA 3DFLA 4AZ2B 2XOKD 3LONA 3EGKH 1ZLRA 3MNCA 3F9FA 3SJOA 1ZOMA 3OE7D 1BTYA 1C4V2 3BSQA 1PPZA 3M3VA 2WV4A 1O5CB 2FLRH 4CBOA 4ZUHA 3Q00A 2J34A 2ZQ1A 5EGMA 2Z6BD 1C5YB 3KYGA 3ODFA 2GCTB 3R0FA 3SUFA 1TA6A 1SL3A 1Z8RA 2W7UA 3RMMH 2V35A 1LHFH 1YCPK 4FETA 2ANWA 1ELAA 1EAIA 3UTUH 2CHAB 5HM9A 3MO9A 1O3LA 3SU2A 4R8TB 4P02A 3ZV8A 5EPNA 3P92A 1NROH 2F9VA 3GY2A 2G52A 2ZDAH 1YYY1 1EXFA 3U69H 1V2PT 3SO3A 1DDJA 1BCUH 4AC9A 4GLYA 4MPXA 3RXJA 4BNRA 4KELA 2LNCA 1TPAE 2ZHWH 4OS4A 2H9TH 1YPGH 2HOBA 2EQNA 2VVVA 3C1KA 1P9UA 2HVYB 1SLVB 4ABEA 3P70B 4WH8A 1MTSA 2XYAA 1DITH 1LHGH 3SNDA 5LPRA 3KQDA 3WY8A 1BIOA 2FOCA 3E3TA 3SJ8A 1FJSA 5I25A 3MU0A 1TGNA 3FN8A 6ESTA 4SGAE 1LHEH 1W7XH 2ZU5A 2P16A 3UY9A 1CE5A 3O8RA 3SQHE 3NXPA 8ESTE 3RXCA 1VJ9U 2ZTXA 1F0TA 8KME2 2P94A 1S0RA 3SZNA 2KX4A 4E06H 1O3IA 1SQTA 1QRWA 4A1TA 3A87A 1FY5A 3TJOA 1S81A 1DXPA 1O36A 4B71A 1UVTH 3KNXA 3AAUA 1SG8B 1TE0A 2QXHA 3RM0H 1GJDB 2QC2A 1EP5A 1O3CA 1QB9A 1V2QT 1C5NH 2FIRH 2P3UB 1MMJN 5ESBA 1BTUA 5F8XA 2OLGA 2AYWA 3UB0A 1QZ8A 1SOZA 3PRDA 2ZU4A 2VVCA 4FUDA 1ZJKA 1V2WT 2D1JA 4DCDA 2R3YA 1DSUA 4NA8A 4AB8A 4MNVA 1J8AA 2FO9A 1FY8E 2IOTA 4D7GA 3SV7A 3UREA 3RXUA 5FBIA 5A0CA 5J4SA 3UR6A 4BOHA 1KIGH 3TPIZ 3PLPA 1C2MA 4OGXA 3SUGA 5ESTE 1D9IA 1FIZA 1OOKB 2AIPA 1EASA 4X6OA 1BRUP 4B76A 2W26A 3RXHA 1HAYB 1F0RA 3PV4A 2HGTH 1AKSB 1GBCA 1EPTC 1FDPA 1KXDA 2ALVA 2FYRA 3LT3A 5J4QA 1AN1E 2V3HH 2A5IA 2XCFA 3NK8A 4JZ1A 4MLFB 1C5XB 8LPRA 2ZNKH 4UFDH 1SVPA 1P2NA 3ITIA 3PV5A 1CGJE 2J38A 1HB0B 2W3IA 2G5VA 3FO8D 1RTKA 3ZZ4A 1SLUB 1BDAA 1HYLA 1ZRBA 3F6UH 3MH7A 1A4WH 1LPKB 1Z1IA 1F0UA 1DOJA 1HJAC 4ZCNA 1ANBA 1ORFA 1SLWB 2WPKS 3ZIAD 4FUFA 4DIHH 1TGSZ 1H8DH 2JH5D 1GBFA 5CE1A 1Z8IB 5EW2H 2GCHG 1YM0A 4WY3A 1B0EA 2F91A 5CHAC 1TFXA 1YLNA 1CA8B 1OWJA 3RXIA 4TT3D 1Y8TA 3ZVGA 5F8ZA 3ZVFA 1O3OA 1GGDB 2ASUB 1O2NA 1B7XB 3A7TA 4NCYA 4ABIA 2ZDNA 1V2MT 3PROA 2A2XH 4NIVA 1G3EA 1C1PA 1SSXA 2XNDD 5GWZA 4X1PU 4FOUC 2VH6A 3OYPA 2ZGXH 1GPZA 1ZSKA 3SHAH 1T8NA 1E0FD 1RD3B 4JK6A 2AMQA 1L1GA 1XMNB 3ZZ5A 5EIYA 3GY7A 4TPIZ 2SGQE 3SYJA 1K0HA 1S5SA 4VGCC 1UVOA 2PGBB 1BBRE 2UUFB 3V0XA 1ZMNA 2GT7A 2QV1A 2BDAA 4GPGA 5HM2A 2FS9A 3ZZCA 1P10A 2CF9H 1JOUB 3ZZBA 1C5MD 3Q3KA 1V2OT 2BXTH 2NU1E 2G00A 3VXEH 2FOBA 2XTTB 1DFPA 2OUAA 1P8VC 1MKWK 1C5SA 2YNAA 1GBIA 1O3FA 1J14A 1ELFA 4ZKRU 1IQMA 3P95A 1LTOA 2ZHQH 4WJG2 3SNAA 4MPUA 1W3CA 3LGWA 1V2VT 1DY9A 2QXIA 1FN8A 2A45B 2BDIA 4HFPB 2ALPA 4B1TA 3QLPH 2SGPE 3ATLA 2R0KA 1L0ZA 4WMDA 1C5PA 5TJXA 1C2KA 3UWJH 2YOLA 1TRYA 3BV9B 2FTLE 1XUHA 1CQQA 2F9PA 2JH0D 3L6PA 1EAUA 1CT2E 1KLTA 1P0SH 3GDUA 2ZFRH 1UTNA 1AI8H 1N6YA 2RCEA 3F9GA 1NU9A 4M9FA 1OX1A 5C5OA 2FX6A 1C1RA 1K1JA 1HBTH 5A2MH 1LKAA 3M36A 2YNBA 3HPTB 2ZHDA 1O2SA 4MNWA 1UTKA 3RXQA 2IN2A 2EI6A 2FI3E 2IPQX 1GI8B 1GCTC 3GCTF 1HAOH 4Q7XA 2Z9KA 2F9BH 4JZFH 1OWHA 2C3SA 2WV5A 1T7CA 3EA7A 1G2LA 5T6GA 4X2XA 3PMBB 3BEIB 4BTUB 5ABWA 3M7UA 2QCYA 1TQ0B 1TOMH 4D76A 2Z9GA 4AGKA 1IQFA 2ZHEH 4MPWA 4M7GA 1E36B 1DANH 1SLXB 3MNSA 4JYTA 3TJNA 2SFAA 3AK5A 2GX4A 1CSOE 2QY0B 2BD8A 1AMHA 1EUFA 4MVNA 4GHTA 4BXSA 5JB8S 2AGEX 3CNRA 5BRRE 1LCYA 1H8ED 2LPRA 2O8LA 3P6ZB 4FUGA 2FWWA 3OY5U 1AWHB 2WUCA 2JDID 1O5FH 1AUTC 1GJBB 2TIOA 1WU1A 1B5GH 1GI0A 3QZQA 5FL7D 2ZQ2A 1VITG 1A61H 1AU8A 4UEHH 4BAOB 2ANKH 2BOKA 3SV9A 4K69A 3D62A 1EATA 2VINA 2XBVA 5GIBA 1MUEB 1QJ1B 1LPZB 1WXRA 2TGPZ 1UK3A 1UCYE 1CO7E 2O8UA 4NFFA 2QIQA 5F03A 4ZMAH 4XBBA 1ELCA 2Z94A 3TK9A 5LPFA 1ANDA 5GCHF 4Y76A 5GXPA 1L1NA 5FPYA 7GCHF 1YPHC 2VU8E 5GJ4B 4PROA 2CV3A 5TCCA 1ANEA 2BVXH 1YPKH 2Z9IA 3DD2H 1GJ7B 1V2UT 1YWUA 4H4FA 4ZKSU 5A0BA 3GDVA 2ZWLH 2CN0H 3BTKE 1O2OA 1IQHA 2XC5A 4I8HA 4CRBA 4AGJA 3MNXA 2Y80A 3A8CA 1V2RT 1H9HE 3SU6A 2RA3A 3RP2A 4NSYA 5DJ7A 2PSYA 1AFEH 1C5UA 2CGAA 4GVUA 5IYTA 3GCOA 3SU5A 4Y8YA 1JWTA 1DLEA 1Y5UT 4IS5A 4K1SA 1BHXB 3HATH 2WPIS 3H7OA 5H4IB 1EP6A 2FYQA 1OPHB 1GHBF 1S84A 2GVFA 2HPQH 2W6JD 2XBYA 3A8DA 3A8BA 4RN6A 3P8NA 2H5DA 2AH4X 5T1VA 1O39A 1O37A 1BOQA 4YOIA 1H1BA 2ESTE 1J17T 1C2DA 1T8OA 1PQAA 3STJA 3M7TA 1ARCA 1O2VA 3E8LA 5C0TA 3OU0A 1OKXA 1CBWB 4Y79A 1LVMA 3EA8A 1YPEH 2C8XB 1C1UH 4E7RG 1A3BH 5EJ1A 2ZGBH 5GDSH 1GJAB 3RC4A 2KM0A 4MG3A 3ENSB 1GVZA 3BIUH 3OX7U 2BY8X 2W5EA 1O2JA 1FAXA 2AIQA 1GI7B 2BM2A 1W10U 3HK3B 1GHAF 5C2ZA 1ZPCA 3A89A 1KLIH 8GCHG 2J9NA 2OBOA 4BAQB 1ESBA 1MH0A 4B2BA 1ZPBA 2K0QA 1S6FA 2GZ7A 3F9EA 1QHRB 3A84A 1BJVA 2ZF0H 2R2WU 2OD3B 2FI5E 2BDGA
chains in the Genus database with same CATH topology
1O2WA 1ABJH 1O2UA 3PLBA 3URDA 1SGFG 4NA9H 1TRNA 2O9QA 2VWLA 1XXFA 1GMCF 1O30A 1XX9A 4Y8ZA 4WMFA 4Y7BA 3GY4A 3LOXA 1D3TB 3VB3A 3U8RH 4ZXXH 3BTEE 1GMCG 3B23B 2ZTYA 1ELEE 1BMNH 1GJ8B 3GCNA 2VWOA 3OSYA 3RC6A 4FUHA 1O3JA 1N8OC 1SOTA 2G5NA 4VGCB 1MTUA 3QGNB 4MDSA 1ZZZA 3LGTA 3CENA 2ZDKA 1W8BH 2GV7A 4YESB 5EXNA 4K3JA 3ZVAA 1K21H 1VITH 1SB1H 4X6MA 3TH2H 3PTBA 2GT8A 4QT8C 1TBRH 1SBWA 1KXAA 3MH4A 1BMMH 3M61U 1F0SA 1Y59T 4O97A 4AFUA 2A7JA 2BLOA 3A80A 5GPIB 4AFSA 4ABDA 2FESH 3RXEA 1K1MA 1QNJA 1E34B 1ZTLA 3IITA 1G9IE 4NSVA 2BY5X 2B7DH 1T4VH 3RLWH 3FAOA 4HI3A 4YZUA 5DP3A 4AG1A 2GP9B 4B2AA 1WQVH 3P8OA 1D3PB 1W12U 1T31A 4IMQA 2FS8A 4UONA 2BMGB 4INHA 1J15A 5C5NA 4CBNA 5FXLA 4A7IB 1TWXB 2BD4A 1CU1A 4MPVA 3FZDA 1BA8B 1VZQH 1EQ9A 2NWNA 3BF6H 1NZQH 1CHOF 1C1OA 1V6DA 5C1XA 2WPHS 3S9CA 1WSSH 1D6WA 3GOVB 3SU3A 2J95A 6CHAC 5DG6A 2GZ8A 2F9NA 1GMHF 1P9SA 2IPHA 1O3EA 3IG6B 2EC9H 2JETC 3O8CA 1HFDA 3KIDU 4K5ZA 4IBLH 5L2ZH 5EQSA 3ZZ7A 1OWEA 1C2FA 1O2GH 2QA9E 3GDSA 1GCTB 1ESTA 1C1MA 1WYKA 2SGAA 2EI8A 1ZGIA 2ZPSA 1KDQA 1FIWA 1LDTT 2FXRA 3NZIA 3VPKA 1QURH 5FX6A 1A5IA 1UVPA 1TLDA 2UUKB 3ZZDA 2VIWA 4U01A 1EKBB 2OCVB 1QFKH 1YF4A 2BTCE 3SBKA 1P2JA 1O31A 1JIMA 4TPYA 1QBNA 3RXBA 2TGDA 2A1DB 1U6QA 1TGCA 3L3TA 1IQJA 3GY3A 4K60A 1W13U 1PPFE 3QUMP 3SJIA 1P3EA 4FUEA 1PPBH 1KXCA 1TNJA 3FP8E 1G30B 4AYVB 5E0HA 4A1XA 2ANYA 3R3GB 5B6OA 1SFIA 1DWBH 4ISOA 3K6YA 5FCKA 3SV8A 1QJ7B 1HAVA 2AS9A 1EB1H 2ODYB 3STIA 3PO1C 1O3GA 3HGNA 5HYOA 2BOHB 3V13A 1XUKA 2AFQB 1O0DH 1TABE 4KGAA 2EEKA 1HAXB 1ZSJA 1GJ6A 3EDXB 1DT2A 3MFJA 1SGDE 1ZHRA 2C8ZB 2EI7A 3SHCH 3V12A 3LGUA 4F4OC 1FMGA 1FUJA 1QJ6B 2HNTC 1Y5AT 3T62A 1OYQA 2R0LA 4CRAA 2JH6D 3ATMA 4Q2KA 2XBWA 1WUNH 3RXAA 2TGAA 5DP7A 5DP6A 1LHDH 1PPGE 1MKXH 1TALA 1QTFA 1WOFA 2P93A 4ABJA 1AVXA 4A6LA 5T3HA 5AFYH 1YBWA 5JB9S 3A8AA 1MU8B 1ZYOA 2BLVA 3SI4H 3I77A 1A0JA 2P3FH 2ZFQH 3QN7A 1DWEH 1D3QB 1Y3VA 1K1PA 3LIWA 1HLTH 3D23A 2CJIA 1KTSB 4KTUA 4ZHLU 3S9AA 1PPCE 1MAXA 1AZ8A 1WCZA 3KF2A 2VB0A 2ILNA 5E0JA 4XDEA 1UHBB 2SNWA 4FUJA 1C4U2 1OWKA 2OC1A 1GG6B 1ZR0A 2FX4A 1C2LA 1LQDB 2WPLS 3BTWE 1BMAA 3GICB 4B74A 4WVPE 2BD2A 2VIPA 2OP9A 3OY6U 1G37A 2BYAX 1HAZB 5DGJA 7ESTE 3ZZ8A 1AFQB 1CBWC 4DW2U 2PLXA 3E0PB 3GISB 1K1LA 2VNTA 2R9PA 5E2PA 1C5RA 2O8MA 3ZYDA 2XW9A 3U1IB 2AGIX 1A3EH 3A88A 5HGGA 4ZAEA 2H2ZA 4DVAU 2FMJA 2V0BA 2P3TB 1DXWA 1P3CA 1UTQA 2QN5T 4NWLA 2Y7ZA 3A81A 3RXVA 2FZZA 2D26C 1SQAA 2QF3A 1KXEA 1JRTA 1L4DA 1FXYA 3MMGA 3PYHA 2Z3EA 2GGVB 2OINA 3UIRA 3BTTE 1S83A 3NKKA 1Y3XA 2ZDMA 3UQVA 2GKVE 3VB4A 2GMTC 2WINI 4I8KA 3RU4D 1TNIA 3GCHC 1HJ8A 2BVRH 1YCPM 3PMHB 1QBVH 1W11U 2G8TA 1N8OB 1IQEA 2AMPA 3RXDA 4AB9A 1BUIA 1NRQH 5IDKA 1P01A 2FOEA 1ABIH 1GVKB 2RA0A 4Z0KA 1YPHE 4ZHAA 1BBRH 2ZZUH 2C8WB 1FN6A 3MO6A 2DE9A 1NRRH 4NA7A 1SPJA 3RXFA 4FVBA 4RSPA 1YC0A 1AIXH 1C5WB 1MAYA 2PTNA 3BG4C 3VEQB 3FANA 3FZZA 1BRAA 2PR3A 1Z71A 3KCGH 1IOEA 1SGRE 3MU1A 1AB9C 1EOJA 1MBQA 3BTGE 1VGCC 1D6RA 1TX7A 3A86A 3TVJB 2UWPA 1FPHH 4IMZA 1F92A 4DT7B 1THRH 3QX5H 3BTME 2H9EH 1O5EH 2QXGA 4MNXA 2EA3A 3P8GA 2QGRA 5LPEA 1SGEE 4WF8A 4TWYA 1IHTH 2Z9LA 3HK6B 4KP0A 4B73A 1AHTH 2ZU1A 3NCLA 1FPCH 1SHHB 6CHAB 3SNCA 3CP7A 2IJOB 1Z1JA 1HXEH 2C4FH 1G3DA 1BITA 3RXLA 3U98H 2TRMA 1O2YA 5K7RA 2OQ5A 1N1LA 2JETB 4IGDA 1GJCB 4ESTE 2FOGA 2Z3DA 1CT0E 1SMFE 4ABFA 1GDUA 1K1IA 3Q76A 1F5LA 2STBE 4U30A 4XBDA 4X6PA 5JYIA 4CR9A 1TPSA 1O32A 3LH1A 3VFEA 1CGHA 1L2EA 1LO6A 2ZU3A 2Y5FA 1UTMA 2FDAA 4NZLA 4JZEH 3KQBA 3BG8A 3QGJA 3TU7H 1A0LA 5LH8A 1P03A 2NU3E 3BTFE 1O38A 4K1EA 1BB0B 3U1JB 1EAXA 3GCTG 1IQLA 4Y0ZE 1GBEA 4X1NU 4UFEH 1BTXA 5DO4H 4IW4E 2UUJB 4Y0YE 4IC6A 1TNKA 9ESTA 4LOYH 2DE8A 1PQ8A 5CMXH 2TPIZ 1WTHD 3S69A 2XRCA 1QQUA 2ANMH 1LMWB 1KTTB 3BTDE 3T5FH 1C9TA 1O3HA 3MU5A 3LU9B 3MH5A 1P04A 1NO9H 3BTHE 3M37A 2ODQA 1TGBA 1FY1A 2R2MB 2ULLA 4LXBH 4HGCA 2I6QA 1C2EA 3PO1B 1TMTH 2B9LA 1NFUA 2F3CE 3VB7A 1QRXA 1YLCA 4X2VA 1UCYH 1QL8A 1Q2WA 2CMYA 1EPTA 1AUJA 1O3NA 1BHXF 4B2CA 1P2OA 1ZHPA 1IAUA 4I32A 4YOGA 1ANCA 4J2YB 3QWCH 1RIWC 3CS7A 4ISLA 1TX8A 5EXLA 4GHQA 1NTPA 1GDNA 1SGIB 1C4Y2 5JPMH 3E16B 1JMOH 3M7QA 3SUDA 1O2HA 3MTYA 5GCHG 1UK4A 4BTTB 7GCHG 1ZMLA 1GBTA 5A09A 1TX6A 3RMOH 1TMBH 5C3NA 1YLDA 4TY6A 4DJZB 1GMDF 3RMLH 1QY6A 3T27A 2BY9X 3SQEE 4KTCA 4I8JA 4U2WA 1GWAA 1TNLA 1NPMA 3GY5A 2PTCE 2FM2A 4WH6A 3RMNH 1ELDE 4NGAH 1OWDA 1FONA 3BIVH 4KKDA 1O5BB 2XWAA 3TGJE 1AD8H 4LZ4B 3AVZA 1XVOA 5FAHA 5E8EH 5L30H 1TNGA 4JCNA 1DSTA 3OTJE 4MQAA 2A5AA 6GCHF 1RS0A 1DVAH 3RXGA 3EYDA 1GHBG 2QYIA 3LC5A 3MOCA 3LC3A 2VWNA 1A2CH 2Q6DA 1NM6A 1H8IH 1O33A 1PQ5A 3TGKE 1EOLA 4X0WU 1GG6C 2VIDA 4YTAA 2BZ6H 3SNBA 2QXJA 5T6DA 1Z6EA 5AFZH 1INCA 5C20A 4IN1A 1TMUH 1C2HA 1ZTKA 2BD5A 2Z7FE 1MCTA 4X8VH 1ELTA 4JZIA 7KMEH 4DIIH 1L4ZA 1AFQC 3A83A 3AASA 1ELBA 4ASHA 1WQSA 1TA2A 3U8TH 1QIXB 1GBAA 1GL0E 3ZZ3A 4CR5A 2PW8H 3UNQA 2BY6X 1MU6B 4Y8XA 1GHAG 3U8OH 1EZXC 3EQ0H 1HPGA 1V2NT 3SORA 3RDZA 1BRBE 2DUCA 1O5GH 5FX5A 1HDTH 1MCVA 4AFQA 4JYUH 1A46H 4UDWH 2QAAA 2Y5GA 4OS7A 1SC8U 2GMTB 4IN2A 3GCHB 3RUOA 2Q6FA 2ZGCA 5EG4A 5AVDA 1O3PB 4GCHF 3TJVA 2O8TA 2ZDLA 5FCRA 3S7KB 1O2ZA 1OP8A 1TBZH 2O8WA 5EW1H 4Q7YA 4MNYA 3AW1A 1QR3E 2M5TA 3SGBE 1TGTA 3E90B 1UVUH 4BXWA 4HZHA 2A5KA 3E0NB 1AO5A 1RTFB 1A5GH 1P2MA 5ETXA 1O34A 1NRNH 2HNTE 4NIXA 2V3OH 3TNTA 5FHTA 4XFQA 1AWFH 4I31A 4AX9H 1XUGA 4TWWA 3BG4B 1YKTA 3LGYA 1TONA 1FZZA 4D9QA 3MI4A 1GBHA 2OC8A 1Y3WA 2ZPQA 3UNSA 1OSSA 1AB9B 2BD9A 5DP9A 3UWIA 1IQNA 4I8LA 5DP8A 3O8BA 1VGCB 3ELAH 2GDDA 4E05H 1DPOA 3DA9B 3RC5A 2J4IA 1GJ5H 1HNEE 4THNH 2SGEE 2ZDVH 1L1JA 1HGTH 1O2PA 5AF9H 1G3BA 2RDLA 3I29A 1SGPE 3DHKH 2BB4A 1ZHMA 2FPZA 2HALA 1MD7A 3SU0A 3S9BA 4LZ1H 3KHVA 3RXRA 2FOHA 2PKAB 2ZHFH 3ZVBA 4DG4A 1F5KU 1GL1A 2PV9B 1Z8GA 1XKBC 1O2IA 3F1SB 1FAKH 1SGQE 3RXOA 1A5HA 3FP6E 1XVMA 2ZG0H 1HUTH 1T4UH 1J16A 2ZCLP 3K6ZA 3TK6A 5JBCS 3F9HA 4OS2A 3M5LA 3CS0A 4AOQA 2G51A 2ZTZA 5E0GA 1HIAB 1NS3A 1MD8A 1PYTD 1CHOG 3VGCC 2KAIB 1VCPA 5EOKA 3BEFB 4X2WA 2NU2E 3T25A 1GBDA 4H42U 3ZZAA 1GMHG 1RXPA 3KQEA 1NU7B 2STAE 1LHCH 4AFZA 1EJNA 1V2ST 1W2KH 2C90B 4JZDH 1LPGB 3A7ZA 1EJAA 1QBOA 2GDEH 2J92A 5JBBS 1A0HB 1YGCH 2XXLA 1SI5H 1X7AC 1C1VH 1GJ9B 5DP4A 4Y11E 4YT7H 5A0AE 1P09A 4JMYA 4OS6A 3G01A 3KGPA 1AGJA 1C2JA 5FPTA 2H6MA 1UTLM 5EPYA 1FNIA 4AN7A 3TLOA 4CH2B 1C1SA 2B0FA 1P2QA 2VVUA 4GAWA 2BX3A 1C1NA 1A7SA 3RXTA 1KYNA 3SJKA 1BRCE 2F9UA 1DICA 2VIVA 3SNEA 4I33A 1V2KT 4K1TA 1PPHE 1YCPH 3A7VA 4NG9H 4K8BA 1BMLA 3DT0H 1LQEA 2BY7X 1NRSH 4D7FA 2CXVA 3LJOA 1C5QA 1S6HA 2HWLB 2TGTA 1ELVA 3Q3XA 1MZDA 1UHBA 1RIWB 1C5VA 1DUEA 1SHYA 1G3CA 3PMJA 1PFXC 3LPRA 1LVYA 1AZZA 5F6MA 2NU4E 1AKSA 2HPPH 1GVLA 3A7WA 1AQ7A 1GI6A 3PLKA 3IWMA 1AVGH 2ZEBA 2A4GA 2NU0E 1GI4A 4YLUA 1ESAA 1DLKB 1MKXK 1BZXE 1QA0A 2BDHA 2XCNA 3TJUA 1D4PB 1KSNA 1OS8A 3KN2A 1GI1A 5G4BA 1O2XA 4A92A 1BQYA 1IQIA 3F68H 1ZGVA 2XBXA 2JKHA 3VB6A 1T32A 3PM3A 1HCGA 1JIRA 1MZAA 4CHAC 1KDQB 4CRGA 3D49H 4WMEA 1MBMA 2ZFFH 2OC0A 1MTWA 2A7HA 2WPMS 2P95A 1DE7H 1BTPA 1FI8A 4ABGA 2PHBA 1J9CH 5EXMA 2H9HA 1O2QA 1OP0A 4BAKB 1QL9A 1ZMJA 1H9LB 2BDBA 1UK2A 3RXKA 1DX5M 1Q3XA 1XM1A 3O8DA 1GHZA 1NFYA 1SGNE 1SGTA 4I7YH 1TPPA 5AHGH 1K1OA 4B75A 1GBBA 1N6XA 2AGGX 1Y5BT 2K1QA 1SGCA 2BXUH 1P06A 3LJJA 4GSOA 4XBCA 3SGAE 2BD3A 3W94A 2W3KA 4YM9A 4ZKNU 1FV9A 3MYWA 4X2YA 1NC6A 1ETSH 2Z3CA 2P8OC 1HAVB 2ZFSA 4E7NA 3A7XA 3RXPA 1NT1A 1XUFA 5FBEA 2WUBA 5BPEA 2XC4A 2Q6GA 2TBSA 3SU1A 4WWYA 1EZUC 1EX3A 1P02A 1THSH 3MHWU 1FY3A 2BLWA 3A85A 1V3XA 4KTSA 1C2GA 4X1RU 3ATKA 3Q3YA 1T8MA 2OBQA 2BQWB 2I6SA 1QA7A 2ZECA 3RXSA 4AORA 3A82A 4UD9H 1EZSC 3UNRA 1TQ7B 1DY8A 1KLJH 5A8XA 3AAVA 1C1TA 1LKBA 1WAYB 1LVOA 1PYTC 4HTCH 4ZH8A 4AYYB 1PJPA 3QTOH 1MTNC 3LKWA 2Y7XA 2FP7B 3UR9A 3ZVDA 2GCHF 3UFAA 2ZFTA 1DUAA 2OXSA 4IC5A 3ZZ9A 3QDZB 4FU7A 2A7CA 2R3UA 2WYGA 1HAIH 1W0YH 1BTWA 1BBRK 2B8OH 3PB1E 1GCDA 3MU8A 2Z9JA 1HAGE 1S85A 2PUXB 2ZKSA 1QL7A 1Z6JH 2BLQA 5I46H 4ABBA 1C9PA 1ID5H 1JXPA 2XWBI 5HXFA 4U32A 3QK1A 4O3UA 4TYDA 1QB1A 3K2UA 3E6PH 1F5RA 3RU4<