2TGTA

On the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase zymogen (serine proteinase)
molecule keywords TRYPSINOGEN
publication title On the Disordered Activation Domain in Trypsinogen. Chemical Labelling and Low-Temperature Crystallography
pubmed rcsb
source organism Bos taurus
total genus 48
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1981-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tgtA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tgtA02
5EGMA 3NK8A 1OWKA 2VVCA 2YOLA 1VITG 1O2ZA 3M5LA 1UVUH 1K1NA 1L4DA 1AI8H 1YF4A 1FPHH 2FOEA 2SGEE 3UWIA 4JZEH 3A8DA 1F92A 1WCZA 1DS2E 1AHTH 1C2DA 1EB2A 2QN5T 3AVZA 1GCTB 5CMXH 3M7TA 1YPHC 1LQDB 3PWBA 2OP9A 1GI1A 3A83A 1UO6A 1C1TA 2A1DB 3NUMA 3P8NA 3PTNA 1DWEH 3BTEE 2J38A 1GCTC 3GCNA 1F0TA 3MH5A 2A32A 2A2XH 2XBWA 4Y7BA 2JH5D 6GCHG 4YM9A 2ULLA 2Q6DA 2ZDLA 1E38B 3LOXA 2A4GA 2R9PA 3DT0H 1EZQA 1N6XA 2Y80A 2ZQ1A 5GJ4B 1S5SA 3TU7H 1PQ7A 4ISHH 2BX3A 2Y5HA 1V2RT 2BDCA 1HFDA 4BAOB 1YPJH 1GBJA 2PR3A 1GMDG 3OX7U 1C5RA 2AERH 2SNWA 5I25A 1NRSH 4U01A 3ZVEA 1KY9A 6ESTA 2AIQA 1AZZA 1Y3WA 3BIUH 1P12E 4HTCH 1SOZA 1DANH 1TQ7B 2TPIZ 4ASHA 3ZV9A 2VIVA 1NESE 3RXTA 3B8JA 1EX3A 2G4TA 5L6NH 3T62A 3MU5A 3M5MA 3UFAA 5BRRE 1A1RA 4TYDA 2VWNA 3D49H 4YOJA 2H2ZA 1C5LH 2Z9IA 3AASA 1P2MA 1Y5UT 1Z8IB 2Q6GA 1QBNA 1EOJA 2SGFE 2WPHS 2HNTC 1BOQA 3S69A 5C5OA 3TLOA 1X7AC 3PO1B 4GHQA 2HNTF 2GCHG 2GP9B 1TYNA 4NWLA 2STBE 5JBAS 2A7CA 4IW4E 1TOCB 1Z1JA 5FHTA 3ATLA 4X2XA 1AUJA 3PO1C 1C5XB 3TH3H 2GGVB 3SJKA 2VGCB 1GJCB 5IYTA 2GCTB 3K2UA 1EB1H 4ZAEA 3TH4H 2BDYA 3Q3KA 1ZTJA 4E06H 2Y6TA 1EXFA 1ZTKA 2O9QA 1K9OE 3ZVFA 2VGCC 1AVXA 2P93A 2FOCA 2GCTC 5T6FA 2F3CE 5ETXA 1FMGA 1QB1A 4IC6A 1BCUH 1ANCA 1NRRH 3O8CA 2W7SA 3SV8A 1ELGA 4O03A 3KQEA 5GPIB 4J1YA 5GXPA 5ESTE 1J14A 3A7XA 1ZJKA 5HGGA 4FUHA 3E1XB 1RJXB 2SNVA 5DO4H 2BDBA 3RU4E 4YOGA 1H8IH 3SU5A 3QTOH 2CV3A 4NZQA 5LPFA 3BTTE 1C1MA 3DUXH 2FS9A 1O5EH 2FOGA 4GCHF 1TE0A 1GI4A 4ISLA 1NRPH 4A1TA 2Y81A 3EE0B 1BTWA 3RUOA 4F49A 1ETTH 1EAIA 1A5GH 1SBWA 1WUNH 3GY2A 2V3OH 5PTPA 1SI5H 1HYLA 3GY8A 1UVTH 4Q80A 5ABWA 2FI3E 1BTHH 3URCA 3ZZAA 2EC9H 1TGNA 3LKWA 1O2SA 1YYY1 1WYKA 1J17T 3T2NA 4FUEA 1CT0E 1PFXC 1EJMA 3T29A 1GI7B 2AMQA 1QGFA 1PPBH 2P16A 4ISOA 1O2PA 1P2QA 1UK4A 3O8DA 1CA8B 1RTLA 4H6TA 3VB3A 1KXAA 1MTNC 1MKWH 3UNQA 1XUFA 1ELTA 5L2ZH 3TJUA 1C2JA 5J4QA 5AFYH 2P59A 4Y8ZA 1FJSA 3T27A 3MFJA 1FPCH 3P70B 2R2MB 2ZQ2A 1P09A 2C93B 1SHHB 1G9IE 2GZ9A 3LH3A 1CT4E 1O35A 4ISNA 5DKMA 1IQJA 1MQ5A 1C1NA 1KLTA 2CHAB 3LGUA 4XOJA 2DE8A 2AGGX 1EAXA 1JRSA 2GDEH 3MO3A 4CRCA 2PWXA 1EJNA 1CT2E 3A7YA 1K1IA 3M5NA 4I8GA 2AH4X 1F2SE 4D76A 2H9EH 2CHAC 1IQEA 1GDNA 4FUBA 1NFXA 1TNJA 2H5CA 2BMGB 1SGEE 1V2PT 3SJ8A 1HXEH 5J4SA 2GDDA 1P9SA 3KF2A 4FUJA 1FONA 1BZXE 1HAXB 1JRTA 3SORA 3M7QA 3SI3H 4ABAA 3BTWE 1BQYA 3Q3YA 2CMYA 4KTSA 1RXPA 4Y6DA 4UEHH 2PGQB 1KSNA 3DA9B 1E35B 3P8GA 3RLWH 4ZUHA 1VCQA 3A7TA 4XDEA 2P95A 3W94A 2BD3A 3ZZ8A 3PLBA 4AG2A 1IHTH 1IQKA 1OP8A 5EQSA 1QJ6B 1O2VA 3IITA 1ESTA 1OYQA 2W7UA 1K1PA 3GISB 3OY5U 3BTKE 5FXLA 1O34A 3HATH 2OC7A 4K1TA 5EPYA 1ZGVA 4GSOA 2TGDA 2ZFFH 1LCYA 3T25A 1W8BH 2BD2A 3ITIA 3I29A 3TNSA 4B73A 1HIAA 1N6YA 1SC8U 2F9UA 2GV7A 5GIBA 1ZSJA 3SJOA 1TALA 5EODA 1DWBH 1YPGH 3RXCA 4X1PU 2XXLA 4K8YA 5TJXA 4UFFH 1OWDA 3SN8A 5C5NA 5T6DA 3QGNB 2QXGA 1RIWB 2G5VA 3RP2A 3MYWA 5AFZH 1YPHE 3N7OA 4YO9A 2W26A 4TPYA 4NA9H 1HAVA 1BBRK 2Z9KA 3VFEA 2BX4A 1C4U2 5LPEA 3SHAH 1C4V2 4XBBA 1RIWC 2R3UA 1HAZB 2WPKS 1AFQB 2Q1JA 2O8LA 1HIAB 1OYTH 1QQ4A 1J15A 4X8SH 3ATIA 2GT7A 2FOHA 2TRMA 3FVFB 1XM1A 1NRQH 1P2KA 2FXRA 1AFQC 4ESTE 5FPYA 3E0PB 1G3CA 3ZZ5A 1ESBA 1FIWA 3RU4T 1XXFA 4MNVA 4XBCA 1WQVH 1OWJA 4B76A 1W12U 2A31A 1S85A 1DY9A 5C1YA 1S82A 1O3MA 1ELAA 2BDHA 2GX4A 1SQAA 2Y7ZA 3AAUA 1BJVA 3JZ2B 1ZMLA 1P03A 3ESTA 1MBQA 6LPRA 4MPVA 3BTHE 5F03A 2ZI2H 1IQGA 3BEUA 3RC4A 4FU7A 1RD3B 3I77A 3LGIA 4A1XA 2ZHFH 3A7WA 1JMOH 3LJOA 2HGTH 2BLVA 1DVAH 1GCDA 3DFLA 2ANYA 2XTTB 1ELFA 3QGJA 1PYTC 2K1QA 4RSPA 4GPGA 2HNTE 2XW9A 1UCYH 4UFGH 1SVPA 3UOPA 3ZVBA 1W13U 1GI2A 3SQHE 4K8BA 2QXIA 1ZSLA 2ZWLH 1QJ1B 4YESB 3MNXA 1T4UH 1HJAB 1GBIA 1GHAF 1P06A 4M7GA 3B23B 4B1TA 1K2I1 2A5AA 4BXWA 1TIOA 1RTKA 2R0LA 2A4OA 1HJAC 3KL6A 2G00A 1UHBA 3RMOH 4DOQA 1TABE 1WAYB 5LGOA 2SGAA 4NZLA 3EA9A 4GAWA 3S7HB 5G4BA 3RXRA 1S6FA 3RC5A 1KXCA 1O2IA 4IMZA 1O33A 4NG9H 5C67A 1GBBA 1LKBA 1XXDA 1TBZH 1T4VH 4KTUA 1PYTD 1DE7H 2PUQH 1QNJA 2ODQA 4CBNA 2ZCKP 2FLBH 3GY3A 4FU9A 3SBKA 2V3HH 4YLQH 4DJZB 5A8XA 5HM9A 3QZQA 2KAIA 1D4PB 4DURA 1UHBB 1O3PB 1GL0E 2O8UA 1SR5C 3RXBA 1JBUH 1AB9B 1LHFH 2XRCA 1TA2A 4KTCA 1QB9A 2D8WA 3Q76A 1K21H 4B2CA 4GHTA 1NFWA 4E05H 3Q00A 5FPSA 1UTPA 3A86A 1FAKH 4OGXA 3ZZ3A 3V12A 5IDKA 2EA3A 3CP7A 1NZQH 1AB9C 4AG1A 3TVJB 1QHRB 3NCLA 1L0ZA 3BG8A 1TMTH 2ANWA 7KMEH 4MQAA 9ESTA 2JETC 3EDXB 1EPTA 3SU0A 3RMMH 3NZIA 1O5BB 4OS2A 1K28D 3HGNA 2BDAA 3PB1E 2WYGA 2Z3CA 2NU0E 1SLWB 7ESTE 4UE7H 3FFGA 5E8EH 1O2LA 3H7TA 3P8OA 1ELBA 4R0IA 4TPIZ 1UTQA 2BQ7B 4JYVH 1OWHA 1GJ7B 4WMEA 2W3KA 1MTUA 4X1NU 1C1RA 3T28A 4MLFB 1SGFA 4XE4A 5I46H 1HAPH 1C9TA 1EPTB 2Y7XA 3QX5H 1MKXH 2C90B 1O3CA 5E2PA 1K1JA 1Q2WA 3CENA 3EA7A 2PHBA 2HLCA 2VH6A 1GI3A 5SGAE 1GHWH 4ZXYH 2D26C 1EPTC 2D1JA 1NM6A 1FY1A 1NS3A 5AVDA 3VXEH 1O5GH 3GY5A 5TCCA 1TAWA 1C2EA 1UJ1A 1GHBF 1QB6A 1S0QA 4DVAU 1Z8GA 2ZCLP 2IN2A 2ILNA 4BAQB 2HOBA 5EXNA 3UPEA 3R3GB 2JH6D 3L33A 1UTKA 1Y8TA 2ZU4A 3JZ1B 4I8KA 2STAE 4ABGA 4WMFA 1HB0B 4NCYA 4FXGH 2ZZUH 2V6NA 2VIQA 4Y0ZE 1LPKB 4NA7A 4YOIA 5JYIA 1PQ5A 1TWXB 1CHOF 2BD5A 1MTVA 1AKSA 2PKAA 4X1RU 1O3EA 1PPGE 1A4WH 2FODA 1XVOA 3AW0A 1AU8A 1EZSC 2FWWA 2GV6A 1OXGA 3TGKE 2VU8E 4OS7A 3LPRA 1SG8B 1Z71A 5E0GA 1C1PA 2F83A 4H42U 1YC0A 2BZAA 1K1MA 1WU1A 1ABIH 2Y5FA 1KTTB 1CA0B 2ZPSA 1HCGA 1O3DA 1D6WA 4HI3A 4ZXXH 1TPAE 1T31A 2F9VA 2B9LA 1XKBC 2W5EA 3BG4C 1VR1H 1C5QA 5T3HA 1IQLA 4FUIA 4JYTA 1CA0C 3EA8A 1AKSB 2GD4B 2OINA 4UFDH 3ODDA 4KP0A 1DX5M 1IQIA 4JZ1A 4B74A 1F0SA 1GDUA 1GMHF 1S6HA 1XX9A 4AGJA 4AFSA 5DPAA 3ZZ9A 2XYAA 1SOTA 1G3DA 1NFYA 1BMLA 1D9IA 1GI8B 2EEKA 2ZNKH 1YP9A 1XMNB 1P2IA 1EJAA 1T7CA 2J92A 3IWMA 1OP0A 4WXVA 1O3KA 2FI5E 2VINA 2ZPQA 1C5OH 5T6GA 1P2JA 4AFZA 1EZUC 3ENSB 8LPRA 3M7UA 4K1SA 2Z9JA 1WTGH 1DLEA 4GVUA 1GJ8B 3RXJA 2VIDA 2AGEX 4YLUA 3EQ0H 3ZYDA 1MU8B 3FP8E 2XBYA 2QXHA 1QR3E 5H4IB 1GHXH 3SUGA 3BTDE 1MH0A 1OWIA 3GICB 1SL3A 1AMHA 2AIPA 3RXHA 2B7DH 1VCPA 3IG6B 1MMJN 2HWLB 4Y71A 2V0BA 2J4IA 4A5TS 3LDXH 4F4OC 4X6PA 3QZRA 4TY6A 2ZU3A 1W3CA 4AX9H 5AF9H 3MNBA 1OPHB 1MCVA 3L3TA 1QBVH 4CHAB 4D9QA 2WV4A 2AFQB 2GTBA 1JOUB 4AFQA 3S9CA 1KDQA 1AQ7A 4AOQA 2ZA5A 1YBWA 2ZHDA 3PLPA 4X2VA 3FP6E 2Z9LA 4CHAC 4UD9H 3M3TA 3BN9A 4PROA 4QT8C 2A7JA 3D23A 4ABDA 3MOCA 2AYWA 1UTLM 1C1WH 1V2ST 2FM2A 4FUDA 1ZRBA 5DP6A 3BTGE 5EW1H 1SQOA 1TRMA 2WPIS 4X1QU 1H9IE 3M61U 2Z6BD 3GCTG 2FOMB 2BLQA 2SGQE 3SOSA 1ID5H 4JCNA 1J16A 2ANMH 3ZV8A 3D65E 1BMMH 3OY6U 1V2OT 1TGBA 2LNCA 1BMNH 1DWCH 1O2WA 1QY6A 1V2TT 2FMJA 1XUJA 3ZVCA 1SGQE 2BB4A 3R0FA 2JH0D 5FCKA 1PQ8A 4Q7YA 2UUYA 1KDQB 2BXTH 2TIOA 5DJ7A 3PTBA 5EPNA 4UONA 4DY7B 1P2OA 2BD8A 3S9BA 1FQ3A 4U2WA 2BTCE 1JIMA 1CE5A 4DW2U 4CR9A 5A09A 1O5CB 4ZMAH 2QY0B 2FI4E 1G32B 1C2IA 4CR5A 1C2FA 1ZLRA 2OC0A 3P8FA 2FLRH 2UUFB 1GVLA 2A2QH 1SGCA 5E0JA 4D7FA 1NN6A 2ZFRH 2ZU1A 1W0YH 4MG3A 4RN6A 1DUEA 4I32A 1IQMA 4CRDA 1LMWB 1VGCB 1Z7KA 2A45B 4MPXA 5EXMA 3TK6A 1MKWK 3M37A 4U32A 3O8RA 4NSVA 3DFJA 4VGCB 1GBTA 1LHCH 1QRXA 1JXPA 1DICA 1VGCC 2RCEA 3QO6A 1SLXB 2ZGJA 3QK1A 4VGCC 1MTNB 3MU4A 3SNCA 1VITF 1FV9A 4NIVA 3UQVA 2ZF0H 3EGKH 1W7XH 1FZZA 4HGCA 1J9CH 3U8OH 1GHVH 1OOKB 1BT7A 2UWLA 4LXBH 3RXMA 3RXIA 2ZP0H 2BOKA 5A0CA 2OBQA 3KQDA 3VGCB 1M9UA 3UNRA 2Z3EA 2XWAA 1LVMA 1YM0A 3ATWA 1UVPA 5E2OA 1G2LA 2CF8H 2TBSA 1ZPCA 1JWTA 1GJAB 1TX6A 7LPRA 1H9HE 1UTMA 4WF8A 2NWNA 3VGCC 1AD8H 1ZPBA 4H6SB 6GCHF 2G51A 1SFQB 3K65B 4TWYA 3K6YA 4IS5A 1A46H 1FN6A 2CGAA 3UWJH 1EUFA 1ZR0A 2ZIQH 3TGIE 1F0UA 1L1GA 4Y76A 1ARBA 2ZHEH 3KQBA 4X0WU 1O3GA 1N1LA 1QURH 4ABJA 1GMDF 4BTIB 3E16B 1O3BA 1W14U 2G8TA 3V7TA 3A8AA 1UVOA 1QL9A 2C8ZB 5HYOA 4MNWA 4ZKRU 2BDIA 1HAYB 1BHXF 3UREA 5GWZA 3STIA 1C5ZB 3SJIA 4U30A 1LTOA 2P3UB 3A89A 1UCYE 3P95A 1HDTH 3LONA 2UWOA 1GJ5H 3Q3XA 2NU4E 1HJ8A 1QCPA 3BIVH 2GCHF 4WY3A 1O3HA 1FLEE 3S7KB 1V2NT 1RFNA 2EI6A 1NFUA 1CO7E 2DE9A 2BY6X 2XC5A 2AEIH 5JBTA 1PPFE 1MD7A 2QYIA 1MAYA 2FYRA 3PV4A 5DP7A 3M35A 1C2GA 5C1UA 5JPMH 4I8LA 2GVFA 1BTZA 4Q7ZA 1O30A 5JDUB 2WV5A 4IC5A 2ESTE 1THRH 4RKJB 3SJ9A 2FESH 2BXUH 1O3OA 1F5LA 2FX6A 4SGAE 3RXLA 1P05A 2ZPRA 1EP6A 1C5YB 4O3UA 3C1KA 3ZZDA 1UTOA 1WOFA 3PMJA 3SO3A 1CGIE 2I6QA 2SFAA 2M5TA 4ABIA 2BDGA 2V35A 1E34B 4FU8A 5A0BA 2ZCHP 3SW2B 2F9PA 2RG3A 2ZGCA 2Z9GA 1TMBH 2PFEA 2J34A 4GUXA 2FTLE 1ZJDA 3GY7A 5FBEA 4DG4A 1WBGB 1IQHA 1GMCG 1P3EA 1HPGA 5C20A 2ODPA 8ESTE 1Q31A 1UCYK 4JK6A 5GDSH 1P8VC 1SGDE 1ZPZA 1ZTLA 2JKHA 3RXFA 1HAVB 3SUFA 1TB6H 2AGIX 4CREA 3RC6A 4H4FA 3TGJE 1TNGA 1QFKH 1FUJA 1FY4A 1RTFB 5JB8S 2J9NA 2VWOA 3A8CA 2FZZA 1LVOA 4ZHLU 1GJDB 4AGKA 3URDA 2QF0A 4NFFA 3LGTA 2D2DA 4O9VA 2FTMA 3ZZ7A 3HGPA 3MNSA 1Y3YA 1AY6H 4J2YB 4E7RG 2BY7X 3NXPA 1YCPM 2PKSC 1PQAA 2G52A 1P0SH 1O2KA 1TGSZ 3LIWA 1VJ9U 4BANB 4MPUA 3HKIB 4WMDA 1SGFG 1BRBE 2ZTYA 3HK6B 1KLIH 1UTNA 1TX8A 2W3IA 4DCDA 2VB0A 3F1SB 5HM2A 1H1BA 5A8YA 1O2NA 1K1LA 2PGBB 2ZDNA 4AB8A 2H9HA 1O39A 1TPSA 1TFXA 3VPKA 1BRAA 1ZOMA 3RXEA 1O0DH 1FY8E 1GGDB 3TJVA 1UTJA 1NU7B 2PV9B 1KXFA 3SNBA 1CGJE 4Z6AH 3WY8A 1EAUA 2VNTA 3ZVGA 5F6MA 1BTYA 3BSQA 3M36A 3B9FH 4A1VA 3F9EA 1FDPA 1GGDC 3ATKA 5ESBA 1EOLA 2VWMA 4CRFA 4KGAA 1TRNA 1OKXA 2A5IA 2R0KA 1P9UA 4IGDA 1DWDH 3VB7A 2RA0A 1A5HA 4OS4A 1S81A 1PPHE 1ZGIA 4BXSA 5FX6A 5CHAB 4MTBA 3UOUA 1MQ6A 1BIOA 3BF6H 3SU1A 2JETB 5C2ZA 1P02A 1UMAH 1TGTA 4BTTB 3FZZA 1C2KA 1ELDE 4B2AA 1G3BA 1TBQH 3QUMP 2FOFA 5CHAC 4WXIA 2BD4A 1F0RA 1LQEA 1G30B 1OS8A 1C5VA 3SU4A 5JB9S 3MH7A 4MNYA 1C1VH 2G81E 4NA8A 3PMBB 1WV7H 3QLPH 5FAHA 3UIRA 5E0HA 1SLUB 2ZC9H 1MKXK 2KAIB 3TITA 2NU3E 2ZGBH 5JBBS 2THFB 1GBLA 1MAXA 1QJ7B 3GCOA 4X8VH 1FAXA 1P10A 1KXDA 1QA7A 1ESAA 3TK9A 3SGQE 1V2KT 1FXYA 1XUGA 2OC1A 1ETSH 1ANEA 3HPTB 1TBRH 2GT8A 3U1JB 1GJBB 1KLJH 2ALVA 4AZ2B 2B5TB 4INHA 5EQRA 2O8WA 2FEQH 2BZ6H 2XBVA 2ZKSA 1KTSB 1K22H 2XC4A 1AN1E 1F5RA 2IJOB 2H6MA 3EYDA 4YT6H 2ODYB 1GJ6A 2P8OB 1GI6A 1GL1A 4SGBE 2Z7FE 2OC8A 4A7IB 3RXGA 5L2YH 4Y8YA 4X6NA 2BY5X 4E7NA 4WWYA 2TGAA 3RDZA 4WVPE 3ZZ4A 1FY5A 4Z0KA 2P8OC 1LKAA 1A3EH 4TWWA 1BRCE 2F9BH 2ZHWH 3V0XA 1MZAA 4XSKU 4FUGA 1JIRA 4MVNA 1E37B 2WYJA 4WH6A 4BNRA 1O2MA 2YNBA 2FP7B 4ZKNU 4CBOA 1QIXB 3PMHB 1QL8A 1IHSH 3RXDA 2BY8X 4OS5A 3E91A 3ZVDA 2F91A 4B2BA 3E8LA 3L6PA 2ALPA 4YT7H 1DSTA 1MD8A 1NU9A 1B7XB 1A7SA 1AE8H 2G4UA 4FVDA 4NIYA 4LZ1H 3TNTA 3F6UH 4CRBA 1YPLH 1EATA 1AZ8A 1P2NA 1G36A 3BEIB 4ZKSU 1YLCA 3ODFA 4GCHG 3BG4B 1HAIH 1UK3A 3MWIU 1NRNH 2FX4A 3K9XB 3QDZB 4HZHA 2Y82A 4X2YA 1KXEA 4NWKA 4A6LA 3LH1A 4X8UH 1ZYOA 2FOBA 2ZG0H 5HXFA 1O3FA 1WQSA 1V3XA 3GDSA 1YCPH 3A7VA 1XUHA 5DGJA 8GCHG 4A92A 3MO6A 1ZHRA 3S0NA 1YGCH 2ZFQH 2RA3A 2PKAB 1VITH 3C27B 1CVWH 1OWEA 3S9AA 3OU0A 1MZDA 3MTYA 4ZH8A 1H9LB 4JYUH 4MDSA 4ZROA 2UWPA 3SNAA 4AYYB 5JBCS 1INCA 1DSUA 1C5SA 1VZQH 1EZXC 1DFPA 1C4Y2 1EASA 5EOKA 4R8TB 2WINI 3TK5A 1Y3XA 3CS0A 2IPHA 1B0FA 1BDAA 1H4WA 1EKBB 1TRYA 5TCAA 4MPWA 3UR9A 2BHGA 3TH2H 2VVUA 4IN1A 2ANKH 1XVMA 2EI7A 1GI9B 5LH8A 2C3SA 5EW2H 2FPZA 1HLTH 2HPPH 3TJNA 2UUKB 1V2WT 3KQCA 2NU1E 1O3JA 2J94A 1O2XA 2XBXA 3I78A 4X1SU 1DY8A 1THPB 2QGRA 1LPGB 1U6QA 4ABEA 1ZRKA 2WPMS 4D8NA 1DLKB 1GBMA 4TY7A 3KHVA 1D3DB 5FBIA 3ZZBA 1SPJA 1Y3UA 3BEFB 4NIWA 4UFEH 2AS9A 3TPIZ 2BD9A 4INLA 3E90B 1YKTA 3BTQE 3MHWU 1B0EA 1FNIA 1TLDA 1GBAA 1Y3VA 3SI4H 1GBEA 2SGDE 3SUEA 4ABHA 2R3YA 1SHYA 4I33A 3UTUH 1DM4B 1BUIA 2ZDKA 1GJ9B 1E0FD 3U69H 4ZHMU 3H7OA 1ZZZA 3A80A 3H5CB 5C3NA 1A0LA 1D3QB 1LPZB 3UY9A 2XC0A 1A3BH 1UK2A 1GBDA 3A85A 1LVBA 3CS7A 1AE5A 3QN7A 2FDAA 1V2UT 5EQQA 3PWCA 1TNKA 1QBOA 3UR6A 5EG4A 1C1QA 2PTNA 4X2WA 2VVVA 1ABJH 3EAJA 1Y5AT 2FO9A 2C4FH 5DK1A 3A87A 5GCHG 3RXQA 4INKA 3KIDU 3RXSA 1SGPE 3GYMA 3GYLB 3HK3B 1GBCA 1C5NH 5FCRA 2BM2A 1Z1IA 5A0AE 3FP7E 3ATMA 2ZDVH 1K1OA 4FUCA 4NFEA 1TNIA 1DUAA 3VB5A 4NSYA 5DP3A 3UUZA 1A0JA 2HVXA 1SGRE 5EU8A 2TGPZ 1FN8A 3P92A 1G2MA 1T8OA 3TIUA 4IN2A 1THSH 4RKOB 1NO9H 1ZSKA 2BVXH 4K2YA 1HBTH 2OLGA 1GHYH 3MU8A 1A5IA 1PJPA 4Y11E 2A5KA 1FY3A 4D9RA 2LPRA 3P6ZB 3RM2H 2VH0A 1H8DH 3STJA 9LPRA 1EAWA 3F9FA 1DXWA 4O97A 1GHZA 2F9OA 1GWAA 2FS8A 1QL7A 2QAAA 3D62A 3VB4A 1AIXH 2AMPA 2QCYA 4Y7AA 1V2VT 3GOVB 2VIPA 4BAMB 2HPQH 1AVGH 1W0ZU 1CHGA 1KXBA 3MH4A 3ZVAA 3UQOA 5F8TA 1ZHPA 8GCHF 3LGYA 1TPOA 3E3TA 4BAKB 1BTXA 3RXAA 1ARCA 1FI8A 1AWHB 1GBFA 5FPTA 2O8MA 4ABFA 1XUIA 4K69A 3A88A 1HJ9A 2PW8H 3M3VA 5C1XA 1SSXA 2QF3A 2BLOA 3MO9A 1DITH 1TPPA 4WJG2 1O37A 2CXVA 3MNCA 1IAUA 2VIOA 2OQ5A 5AHGH 3SV6A 2OUAA 1O5FH 1HAHH 1SB1H 2WUCA 1QA0A 1C5PA 1C5UA 2ZFSA 1T8NA 4I31A 2HRVA 3KNXA 1GHAG 1VCWA 3OTJE 1TQ0B 2ZDMA 3ELAH 2ZU2A 4ABBA 1O2HA 2XWBI 4LZ4B 4LK4A 4CRGA 3ZZ6A 1BHXB 2OTVA 1LO6A 5CE1A 2Y5GA 2QA9E 1V2LT 3AAVA 1NTPA 1D3PB 2TGTA 1SQTA 5A8ZA 4I8HA 4JK5A 2XCNA 4OS1A 3SQEE 1WTHD 1PPCE 1ZHMA 2C8XB 2QXJA 1O2YA 1BBRE 1QRWA 1F7ZA 3E0NB 4D7GA 5B6OA 1CSOE 1DDJA 1Y5BT 2ZO3H 2XNIA 3NWUA 1D6RA 3LC3A 4K3JA 3RLYH 3SGBE 1O5AB 3ZYEA 3V13A 2YNAA 1BA8B 1O2OA 1Z8JB 5K0HA 1C5TA 2A4QA 1S83A 5F8XA 1GDQA 1G3EA 1LDTT 2FIRH 1Z8RA 4JZIA 1BMAA 1O31A 3SUDA 1LHGH 2I6SA 3RXUA 2H1UA 1B5GH 3LC5A 3PM3A 3RXVA 1C1UH 3SNEA 3VXFH 1T8LA 3RXKA 3NPSA 3U8RH 3LJJA 4B75A 1YPMH 3GCTF 2PSYA 1W11U 1NPMA 2WPLS 3A84A 3QWCH 1TMUH 2J95A 1C1SA 3RXOA 2J2UA 5GCHF 4BAHB 1QRZA 2ZDAH 4YTAA 1ELVA 3A7ZA 1ZMJA 2FYQA 3SV7A 1O2RA 1UVSH 4X6MA 2BY9X 1C2HA 1P01A 3QTVH 3A82A 2ZU5A 2ZGXH 2OCVB 2O8TA 1GI0A 4XBDA 1A0HB 1XKAC 1P57B 3GY4A 2PUXB 3LU9B 3VB6A 1O2QA 4Y10E 1OP2A 1ANBA 1BJUA 1CGHA 2GZ7A 1DOJA 1W7GH 3T26A 3PMAB 3SU6A 2QV1A 2CF9H 4YZUA 3W95A 2FOAA 2RDLA 1P3CA 3SV2H 1SMFE 2PLXA 1HRTH 2ZFTA 3LGVA 2IOTA 1RS0A 1BTUA 3BTME 1EQ9A 1DXPA 1QTFA 1VJAU 3RXPA 3M3SA 1V2MT 5A2MH 1NY22 1GHBG 1ELCA 1C2LA 2P3FH 1YPEH 2P94A 2GMTB 1TOMH 2PTCE 4LOYH 1OSSA 2QIQA 1O36A 3MH6A 3E6PH 4CRAA 2PKSB 1TNLA 1BBRH 1ELEE 5DP5A 4BTUB 2GMTC 1G37A 1O38A 1SGYE 2OD3B 3U9AH 1AO5A 1HV7A 3T5FH 4O3TA 3LT3A 1GBKA 2R2WU 5DG6A 3ZZCA 6CHAB 1HAGE 2C8YB 1TONA 1CHOG 3UNSA 1DPOA 4K60A 7GCHG 1KYNA 2OQUA 4JMYA 1Q3XA 3KN2A 2ZTXA 1S84A 1MTSA 4DT7B 3FZDA 1TX7A 4DGJA 6CHAC 2Z3DA 3SU3A 5F8ZA 3FAOA 4MNXA 3AW1A 1O5DH 1AWFH 1C9PA 1BTPA 1SFIA 4FVBA 1RRKA 4KELA 3O8BA 2BVSH 1J8AA 4I7YH 1GVZA 1GBHA 2P3TB 1PPEE 2OBOA 2QC2A 2CN0H 2ZGHA 1SGIB 3SGAE 2ASUB 3A81A 3G01A 1FIZA 2GKVE 2ZFPH 3GDVA 4K5ZA 4AB9A 4IMQA 3TJOA 1P11E 1L4ZA 1TA6A 2BOHB 1P04A 4UDWH 4CH2B 1GMHG 1O3LA 1IQNA 2XCFA 1DT2A 3SZNA 3U8TH 3DHKH 1O2JA 1L2EA 1XUKA 1O3NA 1MCTA 1L1NA 3LGWA 3GDUA 1GG6B 4JZDH 2VWLA 1O2GH 3P17H 1A61H 3PLKA 1HGTH 1O3AA 4XFQA 4DIHH 1W2KH 2H9TH 1E36B 2BLWA 5DP9A 3OSYA 1YLDA 4ZKOU 1GG6C 1SLVB 5BPEA 1ACBE 2G55A 4AYVB 1LHDH 2CJIA 1V6DA 1LHEH 1MBMA 1V2JT 1WSSH 3MU1A 1HNEE 4OS6A 3F9HA 3NKKA 3A8BA 1F5KU 1O32A 1ORFA 1CBWB 1NROH 3BTFE 4Y8XA 2B8OH 1ETRH 1PPZA 2B0FA 1V2QT 3MI4A 2AMDA 3SU2A 1Z6JH 1GVKB 1GI5A 1W10U 4ISIH 1EP5A 2BYAX 2Q6FA 2G5NA 4Q7XA 1CBWC 4JZFH 2NU2E 1IQFA 3Q77A 2A7HA 5DP8A 4BOHA 1MUEB 8KME2 1GPZA 3F9GA 5L30H 3MU0A 1MTWA 3RU4D 5LPRA 1S0RA 2A0QB 1RGQA 2VJ1A 3FANA 1OX1A 4I8JA 2WUBA 4DIIH 4ZHAA 1AUTC 4X6OA 1T32A 3RMLH 1HAOH 3GCHB 3KEEA 1D3TB 4Y0YE 2BD7A 3U98H 2GZ8A 1O3IA 3F68H 1BITA 1SGNE 3PROA 1Y59T 4IBLH 4B71A 1KIGH 2C8WB 3GCHC 3GY6A 2BQ6B 4CH8B 1QQUA 1IOEA 1C2MA 1CU1A 1NC6A 3MMGA 1GMCF 1YPKH 1NT1A 2ZECA 4WH8A 1C5MD 1GJ4H 2VIWA 1SGTA 2WPJS 2EI8A 4Q2KA 1ANDA 2UUJB 3K6ZA 3V3MA 1O2UA 5FX5A 1AFEH 4GLYA 4X8TH 4HFPB 1C5WB 1YCPK 1O2TA 1C1OA 3HKJB 2BVRH 4K1EA 4NIXA 2SGPE 1MU6B 2DUCA 3SNDA 3SHCH 1BB0B 1A2CH 2HALA 4OGYA 5K7RA 4FUFA 1BRUP 2F9NA 5DP4A 3M5OA 4AFUA 1ZMNA 4NGAH 5HMAA 3KCGH 1LVYA 1L1JA 2H5DA 3VEQB 5EXLA 1T8MA 2ZEBA 7GCHF 3KGPA 2A4RA 3SV9A 2ZHQH 3RMNH 1CQQA 1AVWA 2OXSA 4AORA 2PSXA 3RM0H 1HXFH 1N8OB 4Y79A 2ZTZA 1Z6EA 3OYPA 1AGJA 3U1IB 3BV9B 1HUTH 2Z94A 4THNH 4KKDA 4AN7A 3PYHA 2BQWB 1TGCA 3DD2H 1N8OC 1TNHA
chains in the Genus database with same CATH superfamily
5EGMA 3NK8A 1OWKA 2VVCA 2YOLA 1VITG 2M2AA 1O2ZA 3M5LA 1UVUH 1K1NA 1L4DA 1AI8H 1YF4A 1FPHH 2FOEA 2SGEE 3UWIA 4JZEH 3A8DA 2K0QA 1F92A 1WCZA 1DS2E 1AHTH 1C2DA 1EB2A 2QN5T 3AVZA 1GCTB 5CMXH 3M7TA 1YPHC 1LQDB 3PWBA 2OP9A 1GI1A 3A83A 2XNDD 1UO6A 1C1TA 2A1DB 3NUMA 3P8NA 3PTNA 1DWEH 3BTEE 2J38A 1GCTC 2KR7A 3GCNA 1F0TA 3MH5A 2A32A 2A2XH 2XBWA 4Y7BA 2JH5D 6GCHG 4YM9A 2ULLA 2Q6DA 2ZDLA 1E38B 3LOXA 2A4GA 2R9PA 3DT0H 1EZQA 1N6XA 2Y80A 2ZQ1A 5GJ4B 1S5SA 3TU7H 1PQ7A 4ISHH 2BX3A 2Y5HA 1V2RT 2BDCA 1HFDA 4BAOB 1YPJH 1GBJA 2PR3A 1GMDG 2V7QD 3OX7U 1C5RA 2AERH 2SNWA 4F48B 5I25A 1NRSH 3FO8D 4U01A 3ZVEA 1KY9A 6ESTA 2AIQA 1AZZA 1Y3WA 3BIUH 1P12E 4HTCH 1SOZA 1DANH 1TQ7B 2TPIZ 4ASHA 3ZV9A 2VIVA 1NESE 3RXTA 3B8JA 1EX3A 2G4TA 5L6NH 3T62A 3MU5A 3M5MA 3UFAA 5BRRE 1A1RA 4TYDA 2VWNA 3D49H 4YOJA 2H2ZA 1C5LH 2Z9IA 3AASA 1P2MA 1Y5UT 1Z8IB 2Q6GA 1QBNA 1EOJA 2SGFE 2WPHS 2HNTC 1BOQA 3S69A 5C5OA 3TLOA 1X7AC 3PO1B 4GHQA 2HNTF 2GCHG 2GP9B 1TYNA 4NWLA 2STBE 5JBAS 2A7CA 4IW4E 1TOCB 1Z1JA 5FHTA 3ATLA 2GJGA 4X2XA 1AUJA 3PO1C 1C5XB 3TH3H 2GGVB 3SJKA 2VGCB 1GJCB 5IYTA 2GCTB 3K2UA 1EB1H 3SYJA 4ZAEA 3TH4H 2BDYA 3Q3KA 2QF4A 1ZTJA 4E06H 2Y6TA 1EXFA 1ZTKA 2O9QA 1K9OE 3ZVFA 2VGCC 1AVXA 2P93A 1K0HA 2FOCA 2GCTC 5T6FA 2F3CE 5ETXA 1FMGA 2F4LA 1QB1A 4IC6A 1BCUH 1ANCA 1NRRH 3O8CA 2W7SA 3SV8A 1ELGA 4O03A 3KQEA 5GPIB 4J1YA 5GXPA 5ESTE 1J14A 3A7XA 1ZJKA 5HGGA 4FUHA 3E1XB 1RJXB 3WWBA 2SNVA 5DO4H 2BDBA 3RU4E 4YOGA 1H8IH 3SU5A 3QTOH 2CV3A 4NZQA 5LPFA 3BTTE 1C1MA 3DUXH 2FS9A 1O5EH 2FOGA 4GCHF 1TE0A 1GI4A 4ISLA 1NRPH 4A1TA 2Y81A 3EE0B 1BTWA 3RUOA 4F49A 1ETTH 1EAIA 1A5GH 1SBWA 1WUNH 3GY2A 2V3OH 5PTPA 1SI5H 1HYLA 3GY8A 1UVTH 4Q80A 5ABWA 2FI3E 1BTHH 3DSGA 2K8IA 3URCA 3ZZAA 2EC9H 1TGNA 3LKWA 1O2SA 2AHME 1YYY1 1WYKA 1J17T 1SKYE 3T2NA 4FUEA 1CT0E 1PFXC 1EJMA 3T29A 1GI7B 2AMQA 1QGFA 1PPBH 2P16A 4ISOA 1O2PA 1P2QA 1UK4A 3O8DA 1CA8B 1RTLA 4H6TA 3VB3A 2KCOA 1KXAA 1MTNC 1MKWH 3UNQA 1XUFA 1ELTA 5L2ZH 4RI0A 3TJUA 1C2JA 5J4QA 5AFYH 2P59A 4Y8ZA 1FJSA 2LELA 3T27A 3MFJA 1FPCH 3P70B 2R2MB 2ZQ2A 1P09A 2C93B 1SHHB 1G9IE 2GZ9A 3LH3A 1CT4E 1O35A 4ISNA 5DKMA 1IQJA 1MQ5A 1C1NA 1KLTA 2CHAB 3LGUA 4XOJA 2DE8A 2AGGX 1EAXA 1JRSA 2GDEH 3MO3A 4CRCA 2PWXA 1EJNA 1CT2E 3A7YA 1K1IA 3M5NA 4I8GA 2AH4X 1F2SE 4D76A 2H9EH 2EQNA 2OK5A 2CHAC 1IQEA 1GDNA 4FUBA 1NFXA 1TNJA 2H5CA 2BMGB 1SGEE 1V2PT 3SJ8A 1HXEH 5J4SA 2GDDA 1P9SA 3KF2A 4FUJA 1FONA 3ZIAD 1BZXE 1HAXB 1JRTA 3SORA 3M7QA 3SI3H 4ABAA 3BTWE 3KYGA 1BQYA 3NRLA 3Q3YA 2CMYA 4KTSA 2WV9A 1RXPA 4Y6DA 4UEHH 2PGQB 1KSNA 3DA9B 1E35B 3P8GA 3RLWH 4ZUHA 1VCQA 3A7TA 4XDEA 4AC9A 2P95A 3W94A 4OM9A 2BD3A 3ZZ8A 3PLBA 4AG2A 1IHTH 1IQKA 1OP8A 5EQSA 1QJ6B 5C0UA 1O2VA 3IITA 1ESTA 1OYQA 2W7UA 1K1PA 3GISB 2QE7D 3OY5U 3BTKE 5FXLA 1O34A 3HATH 3KQ5A 2OC7A 4K1TA 5EPYA 1ZGVA 4GSOA 2TGDA 2ZFFH 1LCYA 3T25A 1W8BH 2BD2A 2F43B 3ITIA 3I29A 3TNSA 4B73A 1HIAA 1N6YA 1SC8U 2F9UA 2GV7A 1OHHD 5GIBA 1ZSJA 3SJOA 1TALA 5EODA 1DWBH 1YPGH 3RXCA 4X1PU 2XXLA 4K8YA 5TJXA 4UFFH 1OWDA 3SN8A 5C5NA 5T6DA 3QGNB 2QXGA 1RIWB 2G5VA 3RP2A 3MYWA 5AFZH 1YPHE 3N7OA 4YO9A 2W26A 4TPYA 5EIYA 4NA9H 1HAVA 1BBRK 2Z9KA 3VFEA 2BX4A 1C4U2 5LPEA 3SHAH 1C4V2 4XBBA 1RIWC 2R3UA 1HAZB 2WPKS 1AFQB 2Q1JA 2O8LA 1HIAB 1OYTH 1QQ4A 1J15A 4X8SH 3ATIA 2GT7A 2FOHA 2TRMA 3FVFB 1XM1A 1NRQH 4Q63A 1P2KA 2FXRA 2WHXA 1AFQC 4ESTE 5FPYA 3E0PB 1G3CA 3ZZ5A 1ESBA 1FIWA 3RU4T 1XXFA 4MNVA 4XBCA 1WQVH 1OWJA 4B76A 1W12U 2A31A 1S85A 1DY9A 5C1YA 1S82A 1O3MA 1ELAA 2BDHA 2GX4A 1SQAA 2Y7ZA 3AAUA 1BJVA 3JZ2B 1ZMLA 1P03A 3ESTA 1MBQA 6LPRA 4MPVA 3BTHE 5F03A 2ZI2H 3WW7A 1IQGA 3BEUA 3RC4A 4FU7A 1RD3B 3I77A 3LGIA 4A1XA 2ZHFH 3A7WA 1JMOH 3LJOA 2HGTH 2BLVA 1DVAH 1GCDA 3DFLA 2ANYA 2XTTB 1ELFA 3QGJA 1PYTC 2K1QA 4RSPA 4GPGA 2HNTE 2XW9A 1UCYH 4UFGH 1SVPA 3UOPA 3ZVBA 1W13U 1GI2A 3SQHE 4K8BA 2QXIA 2HLDD 1ZSLA 2ZWLH 1QJ1B 3OE7D 4YESB 3MNXA 1T4UH 1HJAB 1GBIA 1GHAF 1P06A 4M7GA 3B23B 4B1TA 3N7EA 1K2I1 3OEHD 2A5AA 4BXWA 1TIOA 3FKSD 1RTKA 2R0LA 2A4OA 1HJAC 3KL6A 2G00A 1UHBA 3RMOH 4DOQA 1TABE 1WAYB 5LGOA 2SGAA 4NZLA 3EA9A 4GAWA 3S7HB 5G4BA 3RXRA 1S6FA 3RC5A 1KXCA 1O2IA 4IMZA 3CNRA 1O33A 4NG9H 5C67A 1GBBA 1LKBA 1XXDA 1TBZH 1T4VH 4KTUA 1PYTD 1DE7H 2PUQH 1QNJA 2ODQA 4CBNA 2ZCKP 2FLBH 3GY3A 4FU9A 3SBKA 2V3HH 4YLQH 4DJZB 5A8XA 5CHBA 5HM9A 3QZQA 2KAIA 1D4PB 4DURA 1UHBB 1O3PB 1GL0E 2O8UA 1SR5C 2RDEA 3RXBA 1JBUH 1AB9B 1LHFH 2XRCA 1TA2A 4KTCA 1QB9A 2D8WA 2KCPA 3Q76A 1K21H 4B2CA 4GHTA 1VKYA 1NFWA 4E05H 3Q00A 5FPSA 1UTPA 3A86A 1FAKH 4OGXA 3F2HA 3ZZ3A 3V12A 5IDKA 2EA3A 3CP7A 1NZQH 1AB9C 4AG1A 3TVJB 1QHRB 3NCLA 1L0ZA 4ACAA 3BG8A 1E79D 1TMTH 2ANWA 7KMEH 4MQAA 9ESTA 2JETC 3EDXB 1EPTA 3SZEA 3SU0A 3RMMH 3NZIA 1O5BB 3UAIC 4OS2A 1K28D 3HGNA 2BDAA 3PB1E 2WYGA 2Z3CA 2NU0E 1SLWB 7ESTE 2IJD1 4UE7H 3FFGA 5E8EH 1O2LA 3H7TA 3P8OA 1ELBA 4R0IA 4TPIZ 1UTQA 2BQ7B 4JYVH 1OWHA 2KCYA 1GJ7B 4WMEA 2W3KA 1MTUA 4X1NU 1C1RA 3T28A 4MLFB 1SGFA 4XE4A 5I46H 1HAPH 1C9TA 1EPTB 2Y7XA 3QX5H 1MKXH 2C90B 1O3CA 5E2PA 1K1JA 1Q2WA 3CENA 3EA7A 2PHBA 2HLCA 2VH6A 1GI3A 5SGAE 1GHWH 4ZXYH 2D26C 1EPTC 2D1JA 1NM6A 1FY1A 1NS3A 5AVDA 3VXEH 1O5GH 3GY5A 5TCCA 1TAWA 1C2EA 1UJ1A 1GHBF 1QB6A 1S0QA 4DVAU 1Z8GA 2WZQA 2ZCLP 2IN2A 2ILNA 4BAQB 2HOBA 5EXNA 3UPEA 3R3GB 2JH6D 3L33A 1UTKA 1Y8TA 2ZU4A 3JZ1B 4I8KA 2STAE 4ABGA 4WMFA 1HB0B 4NCYA 4FXGH 2ZZUH 2V6NA 2VIQA 4Y0ZE 1LPKB 1W0JD 4NA7A 4YOIA 4F55A 5JYIA 1PQ5A 1TWXB 1CHOF 2BD5A 1MTVA 1AKSA 2PKAA 4X1RU 1O3EA 1PPGE 1A4WH 2FODA 1XVOA 3AW0A 1AU8A 1EZSC 2FWWA 2GV6A 1OXGA 3TGKE 2VU8E 5EJ1A 4OS7A 3LPRA 1SG8B 1Z71A 5E0GA 1C1PA 2F83A 4H42U 1YC0A 2BZAA 1K1MA 1WU1A 1ABIH 2Y5FA 3H09A 1KTTB 1CA0B 2ZPSA 3FN8A 1HCGA 1O3DA 1D6WA 4HI3A 4ZXXH 5HIZA 1TPAE 1T31A 2F9VA 2B9LA 5KGOA 1XKBC 2W5EA 3BG4C 1VR1H 1C5QA 5T3HA 1IQLA 4FUIA 4JYTA 1CA0C 3EA8A 1AKSB 2GD4B 2OINA 4ACBA 4UFDH 3ODDA 4KP0A 1DX5M 1IQIA 4JZ1A 4B74A 3PV2A 1F0SA 1GDUA 1GMHF 1S6HA 1XX9A 4AGJA 4AFSA 5DPAA 3ZZ9A 2XYAA 1SOTA 1G3DA 1NFYA 1BMLA 1D9IA 1GI8B 2EEKA 2ZNKH 1YP9A 1XMNB 1P2IA 1EJAA 1T7CA 2J92A 3IWMA 1OP0A 4WXVA 1O3KA 2FI5E 2VINA 2ZPQA 1C5OH 5T6GA 1P2JA 4AFZA 1EZUC 3ENSB 8LPRA 3M7UA 4I86A 4K1SA 2Z9JA 1WTGH 1DLEA 4GVUA 1GJ8B 3RXJA 2VIDA 2AGEX 4YLUA 3EQ0H 3ZYDA 1MU8B 3FP8E 2XBYA 2QXHA 1QR3E 5H4IB 1GHXH 3SUGA 3BTDE 1MH0A 1OWIA 3GICB 1SL3A 1AMHA 4YXWD 2AIPA 3RXHA 2B7DH 1VCPA 3IG6B 1MMJN 2HWLB 4Y71A 2V0BA 2J4IA 4A5TS 3LDXH 4F4OC 4X6PA 3QZRA 4TY6A 2ZU3A 1FX0B 1W3CA 4AX9H 5AF9H 3MNBA 1OPHB 1MCVA 3L3TA 1QBVH 4CHAB 4D9QA 2WV4A 2AFQB 2GTBA 1JOUB 3PRDA 4AFQA 3S9CA 1KDQA 1AQ7A 4AOQA 2ZA5A 1YBWA 1W0KD 2ZHDA 3PLPA 4X2VA 3FP6E 1KMHB 2Z9LA 4CHAC 4UD9H 3M3TA 3BN9A 4PROA 4QT8C 2A7JA 3D23A 4ABDA 3MOCA 2AYWA 1UTLM 2L74A 1C1WH 1V2ST 2FM2A 4FUDA 1ZRBA 5DP6A 3BTGE 5EW1H 1SQOA 1TRMA 2WPIS 4X1QU 1H9IE 3M61U 2Z6BD 5EJLA 3GCTG 2FOMB 2BLQA 2SGQE 3SOSA 1ID5H 4JCNA 1J16A 2ANMH 3ZV8A 3D65E 3W1EA 1BMMH 3OY6U 1V2OT 1TGBA 2LNCA 1BMNH 1DWCH 1O2WA 1QY6A 1V2TT 2FMJA 1XUJA 3ZVCA 1SGQE 2BB4A 3R0FA 2JH0D 5FCKA 1PQ8A 4Q7YA 2UUYA 1KDQB 2BXTH 2WPDD 2TIOA 5DJ7A 3PTBA 5EPNA 4UONA 4DY7B 1P2OA 2BD8A 3S9BA 1FQ3A 4U2WA 2BTCE 1JIMA 1CE5A 4DW2U 4CR9A 5A09A 1O5CB 4ZMAH 2QY0B 2FI4E 1G32B 1C2IA 4CR5A 1C2FA 1ZLRA 2OC0A 3P8FA 2FLRH 2UUFB 1GVLA 2A2QH 1SGCA 5E0JA 4D7FA 1NN6A 2ZFRH 2ZU1A 1W0YH 4MG3A 4RN6A 1DUEA 4I32A 1IQMA 2KZ4A 4CRDA 1LMWB 1VGCB 1Z7KA 2A45B 4MPXA 5EXMA 3TK6A 1MKWK 3M37A 4U32A 3O8RA 4NSVA 3DFJA 4VGCB 1GBTA 1LHCH 1QRXA 1JXPA 1DICA 1VGCC 2RCEA 3QO6A 1SLXB 2ZGJA 3QK1A 4VGCC 1MTNB 3MU4A 3SNCA 1VITF 1FV9A 4NIVA 3UQVA 2ZF0H 3EGKH 1W7XH 1FZZA 4HGCA 1J9CH 3U8OH 1GHVH 1OOKB 1BT7A 2UWLA 4LXBH 3RXMA 3RXIA 2ZP0H 2BOKA 5A0CA 2JIZD 2OBQA 3KQDA 3VGCB 1M9UA 3UNRA 2Z3EA 2XWAA 1LVMA 1YM0A 3ATWA 1UVPA 5E2OA 1G2LA 2CF8H 2TBSA 1ZPCA 1JWTA 1GJAB 1TX6A 7LPRA 1H9HE 1UTMA 4WF8A 2NWNA 3VGCC 1AD8H 1ZPBA 4H6SB 6GCHF 2G51A 1SFQB 3OFND 3K65B 4TWYA 3K6YA 4IS5A 1A46H 1FN6A 2CGAA 3UWJH 1EUFA 1ZR0A 2ZIQH 3TGIE 1F0UA 1L1GA 4Y76A 1ARBA 2ZHEH 3KQBA 4X0WU 1O3GA 1SQRA 1N1LA 1QURH 4ABJA 1GMDF 1YY3A 4FOUC 4BTIB 3E16B 1O3BA 1W14U 2G8TA 3V7TA 3A8AA 1UVOA 1QL9A 2C8ZB 5HYOA 4MNWA 4ZKRU 2BDIA 1HAYB 5HIYA 1BHXF 3UREA 5GWZA 3STIA 1C5ZB 3SJIA 4U30A 1LTOA 2P3UB 3A89A 1UCYE 3P95A 1HDTH 3LONA 2UWOA 3GS9A 1GJ5H 3Q3XA 2NU4E 1HJ8A 1QCPA 3BIVH 2GCHF 4WY3A 1O3HA 1FLEE 3S7KB 1V2NT 5C94A 1RFNA 2EI6A 1NFUA 1CO7E 2DE9A 2LP6A 2BY6X 2XC5A 2AEIH 5JBTA 1PPFE 1MD7A 2QYIA 1MAYA 2FYRA 3PV4A 5DP7A 3M35A 1C2GA 5C1UA 5JPMH 4I8LA 2GVFA 1BTZA 4Q7ZA 1O30A 5JDUB 2WV5A 4IC5A 2ESTE 2YMSB 1THRH 5IK2D 4RKJB 3SJ9A 2FESH 2BXUH 1O3OA 1F5LA 2FX6A 4SGAE 3RXLA 1P05A 2ZPRA 1EP6A 1C5YB 4O3UA 3C1KA 2YMSC 3ZZDA 1UTOA 1WOFA 3PMJA 3SO3A 1CGIE 2I6QA 2SFAA 2M5TA 4ABIA 2BDGA 2V35A 1E34B 4FU8A 5A0BA 2ZCHP 3SW2B 2F9PA 2RG3A 2ZGCA 2Z9GA 1TMBH 2PFEA 2J34A 4GUXA 2FTLE 1ZJDA 3GY7A 5FBEA 2IPQX 4DG4A 1WBGB 1IQHA 1GMCG 1P3EA 1HPGA 5C20A 2ODPA 8ESTE 1Q31A 1UCYK 4JK6A 3DSPA 5GDSH 1P8VC 1SGDE 1ZPZA 1ZTLA 2JKHA 3RXFA 1HAVB 3SUFA 1TB6H 2AGIX 4CREA 3RC6A 4H4FA 3TGJE 1TNGA 1QFKH 4B6EA 1FUJA 1FY4A 1RTFB 5JB8S 4FETA 2J9NA 2VWOA 3A8CA 2FZZA 1LVOA 4ZHLU 1GJDB 4AGKA 3URDA 2QF0A 4NFFA 3LGTA 2D2DA 4O9VA 2FTMA 3DCLA 3ZZ7A 3HGPA 3MNSA 1Y3YA 1AY6H 4J2YB 4E7RG 4DT4A 2BY7X 3NXPA 1YCPM 2PKSC 1PQAA 2G52A 1P0SH 1O2KA 1TGSZ 3LIWA 1VJ9U 4BANB 4MPUA 3HKIB 4WMDA 3OEED 1SGFG 1BRBE 2ZTYA 3HK6B 1KLIH 1UTNA 1TX8A 2W3IA 4DCDA 2VB0A 3F1SB 5HM2A 1H1BA 3EE7A 5A8YA 1O2NA 2VBCA 1K1LA 2PGBB 2ZDNA 4AB8A 2H9HA 1O39A 1TPSA 1TFXA 3VPKA 1BRAA 1ZOMA 3RXEA 1O0DH 1FY8E 1GGDB 3TJVA 1UTJA 1NU7B 2PV9B 1KXFA 3SNBA 1CGJE 4Z6AH 3WY8A 1EAUA 4Q4LA 2VNTA 3ZVGA 5F6MA 1BTYA 3BSQA 3M36A 3B9FH 4A1VA 3F9EA 1FDPA 1GGDC 3ATKA 5ESBA 1EOLA 2VWMA 4ASUD 4CRFA 4KGAA 1TRNA 1OKXA 1YWUA 3VG8A 2A5IA 2R0KA 1P9UA 4IGDA 1DWDH 3VB7A 2RA0A 3N7DA 1A5HA 4OS4A 1S81A 1PPHE 1ZGIA 4BXSA 5FX6A 5CHAB 4MTBA 3UOUA 1MQ6A 1BIOA 3BF6H 3SU1A 2JETB 5C2ZA 1P02A 1UMAH 1TGTA 4BTTB 3FZZA 1C2KA 1ELDE 4XD7D 4B2AA 1G3BA 1TBQH 3QUMP 2FOFA 5CHAC 4WXIA 2BD4A 1F0RA 1WDIA 1LQEA 1G30B 1OS8A 1C5VA 3SU4A 4TSFD 5JB9S 3MH7A 4MNYA 1C1VH 2G81E 4NA8A 3PMBB 1WV7H 3QLPH 5FAHA 3UIRA 5E0HA 1SLUB 2ZC9H 1MKXK 2KAIB 3TITA 2NU3E 2ZGBH 5JBBS 2THFB 1GBLA 1MAXA 1QJ7B 3GCOA 4X8VH 1FAXA 2KX4A 1P10A 1KXDA 1QA7A 1ESAA 4RT0A 3TK9A 3SGQE 1S6LA 1V2KT 1FXYA 1XUGA 2OC1A 1ETSH 1ANEA 3HPTB 1TBRH 2GT8A 4XRNA 3U1JB 1GJBB 1KLJH 2ALVA 4AZ2B 2B5TB 4INHA 5EQRA 2O8WA 2FEQH 2BZ6H 2XBVA 4HG6A 2ZKSA 1KTSB 1K22H 2XC4A 1AN1E 1F5RA 2IJOB 2H6MA 3EYDA 4YT6H 2ODYB 1GJ6A 2P8OB 1GI6A 1GL1A 4SGBE 2Z7FE 2OC8A 4A7IB 3RXGA 5L2YH 4Y8YA 4X6NA 2BY5X 4E7NA 4WWYA 2TGAA 3RDZA 4WVPE 3ZZ4A 1FY5A 4Z0KA 2P8OC 2QF5A 4RT1A 1LKAA 1A3EH 4TWWA 1BRCE 2F9BH 2ZHWH 3V0XA 1MZAA 4XSKU 2PP6A 4FUGA 1JIRA 4MVNA 1E37B 2WYJA 4WH6A 4BNRA 1O2MA 2YNBA 2FP7B 4ZKNU 4CBOA 1QIXB 3PMHB 1QL8A 1IHSH 3RXDA 2W6ID 2BY8X 4OS5A 3E91A 3ZVDA 2F91A 4B2BA 3E8LA 3L6PA 2ALPA 4YT7H 1DSTA 1MD8A 1NU9A 1B7XB 1A7SA 1AE8H 2G4UA 4FVDA 5T1VA 4NIYA 4LZ1H 3TNTA 3F6UH 4CRBA 1YPLH 1EATA 1AZ8A 1P2NA 3PV5A 1G36A 3BEIB 4ZKSU 1YLCA 3ODFA 4GCHG 3BG4B 1HAIH 1UK3A 3MWIU 1NRNH 2FX4A 3K9XB 3QDZB 4HZHA 2JJ2D 2Y82A 4X2YA 1KXEA 4NWKA 4A6LA 3LH1A 4X8UH 1ZYOA 2FOBA 2ZG0H 5HXFA 1O3FA 1WQSA 1V3XA 3GDSA 1YCPH 3A7VA 1XUHA 5DGJA 8GCHG 4A92A 3MO6A 1ZHRA 3S0NA 1YGCH 2ZFQH 2RA3A 2PKAB 1VITH 3C27B 1CVWH 1OWEA 3S9AA 3OU0A 1MZDA 3MTYA 4ZH8A 1H9LB 4JYUH 4MDSA 2WSSD 4ZROA 2UWPA 3SNAA 4AYYB 5JBCS 1INCA 3WWFA 1DSUA 1C5SA 1VZQH 1EZXC 1DFPA 1C4Y2 1EASA 5EOKA 4R8TB 2WINI 3TK5A 1H8ED 1Y3XA 3CS0A 2IPHA 1B0FA 1BDAA 1H4WA 1EKBB 1NBME 1TRYA 5TCAA 4MPWA 3UR9A 2BHGA 3TH2H 2VVUA 4IN1A 2ANKH 3U28C 1XVMA 2EI7A 1GI9B 2V3MA 5LH8A 2C3SA 5EW2H 2XOKD 2FPZA 1HLTH 2HPPH 3TJNA 2UUKB 1V2WT 3KQCA 2NU1E 1O3JA 2J94A 1O2XA 2XBXA 3I78A 4X1SU 1DY8A 1THPB 5HKKD 2QGRA 1LPGB 1U6QA 4ABEA 1ZRKA 2WPMS 4D8NA 1DLKB 1GBMA 2KFWA 4TY7A 3KHVA 1D3DB 5FBIA 3PRBA 3ZZBA 1UW7A 1SPJA 1Y3UA 3BEFB 4NIWA 4UFEH 2AS9A 3TPIZ 2BD9A 4INLA 3E90B 1YKTA 3BTQE 3MHWU 1B0EA 1FNIA 1TLDA 1GBAA 1Y3VA 3SI4H 2J5UA 1GBEA 2SGDE 3SUEA 4ABHA 2R3YA 1SHYA 4I33A 3UTUH 1DM4B 1BUIA 2ZDKA 1GJ9B 1E0FD 3U69H 1EFRD 4ZHMU 3H7OA 1ZZZA 3A80A 3H5CB 5C3NA 1A0LA 1D3QB 1LPZB 3UY9A 3AK5A 2XC0A 1A3BH 1UK2A 1GBDA 3A85A 1LVBA 3CS7A 1AE5A 3QN7A 2FDAA 1V2UT 5EQQA 3PWCA 1TNKA 1QBOA 3UR6A 5EG4A 1C1QA 2PTNA 4X2WA 2VVVA 1ABJH 3EAJA 1Y5AT 2FO9A 2C4FH 5DK1A 3A87A 5GCHG 3RXQA 4INKA 3KIDU 3RXSA 1SGPE 3GYMA 3GYLB 3HK3B 1GBCA 1C5NH 5FCRA 2BM2A 1Z1IA 5A0AE 3FP7E 3ATMA 2ZDVH 1K1OA 4FUCA 4NFEA 1TNIA 1DUAA 3VB5A 4NSYA 5DP3A 3UUZA 1A0JA 2HVXA 1SGRE 5EU8A 2TGPZ 1FN8A 3P92A 1G2MA 3FOAA 1T8OA 3TIUA 4IN2A 1THSH 4RKOB 2CK3D 1NO9H 1ZSKA 2BVXH 4K2YA 1HBTH 2OLGA 1GHYH 3MU8A 2J97A 3F3BA 1A5IA 1YLNA 1PJPA 4Y11E 2A5KA 1FY3A 4D9RA 2LPRA 3P6ZB 3RM2H 2VH0A 1H8DH 3STJA 9LPRA 1EAWA 3F9FA 1DXWA 4O97A 1GHZA 2EY4C 2F9OA 3N99A 1GWAA 2FS8A 1QL7A 2QAAA 3D62A 3VB4A 1AIXH 2AMPA 2QCYA 4Y7AA 1V2VT 3GOVB 2VIPA 4BAMB 2HPQH 1AVGH 1W0ZU 1CHGA 1KXBA 1COWD 3MH4A 3UQOA 5F8TA 3ZVAA 1ZHPA 8GCHF 3LGYA 1TPOA 3E3TA 4BAKB 1BTXA 3RXAA 1ARCA 1FI8A 1AWHB 1GBFA 5FPTA 2O8MA 4ABFA 1XUIA 4K69A 3A88A 4M9FA 1HJ9A 2PW8H 3M3VA 5C1XA 1SSXA 2QF3A 2BLOA 3MO9A 1DITH 1TPPA 4WJG2 1O37A 2CXVA 3MNCA 1IAUA 2VIOA 2OQ5A 5AHGH 3SV6A 2OUAA 4P00A 1O5FH 1HAHH 2HVYB 1SB1H 2WUCA 3F0PA 5GNDA 1QA0A 1C5PA 5FL7D 1C5UA 2ZFSA 1T8NA 5KECA 4I31A 2HRVA 3KNXA 1GHAG 1VCWA 3OTJE 1TQ0B 2ZDMA 3ELAH 2ZU2A 4ABBA 1O2HA 2XWBI 4LZ4B 4LK4A 4CRGA 2J98A 3ZZ6A 1BHXB 2OTVA 1LO6A 5CE1A 2Y5GA 2QA9E 1V2LT 3AAVA 1NTPA 1D3PB 2TGTA 1SQTA 5A8ZA 4I8HA 4JK5A 2XCNA 4OS1A 3SQEE 1WTHD 1PPCE 5DN6D 1ZHMA 2C8XB 2QXJA 1O2YA 1BBRE 1QRWA 1F7ZA 3E0NB 4D7GA 5B6OA 1H8HD 3UB0A 1CSOE 1DDJA 1Y5BT 2ZO3H 2XNIA 3NWUA 2KCAA 1D6RA 3LC3A 4K3JA 3RLYH 3SGBE 1O5AB 3ZYEA 3V13A 2YNAA 1BA8B 1O2OA 1Z8JB 5K0HA 1C5TA 2A4QA 1S83A 5F8XA 2J98B 1GDQA 1G3EA 1LDTT 2FIRH 1Z8RA 4JZIA 1BMAA 1O31A 3SUDA 2RFKC 1LHGH 2I6SA 3RXUA 2H1UA 3F2FA 1B5GH 3LC5A 3PM3A 1WXRA 3RXVA 1C1UH 3SNEA 3VXFH 1T8LA 3RXKA 3NPSA 3U8RH 3LJJA 1E1QD 4B75A 1YPMH 4Z1MD 3GCTF 2PSYA 1W11U 1NPMA 2WPLS 3A84A 3QWCH 1TMUH 2J95A 1C1SA 3RXOA 2J2UA 5GCHF 4BAHB 1QRZA 2ZDAH 4YTAA 1ELVA 3A7ZA 1ZMJA 2FYQA 3SV7A 1O2RA 1UVSH 4X6MA 2BY9X 1C2HA 1P01A 3QTVH 5C0TA 3A82A 2ZU5A 2ZGXH 2OCVB 2O8TA 1GI0A 4XBDA 1A0HB 1XKAC 1P57B 1BMFD 3GY4A 2PUXB 3LU9B 3VB6A 1O2QA 4Y10E 1OP2A 1ANBA 1BJUA 1CGHA 2GZ7A 1DOJA 1W7GH 3T26A 1E1RD 3PMAB 3SU6A 2QV1A 2CF9H 4YZUA 3W95A 2FOAA 2RDLA 1P3CA 3SV2H 1SMFE 4B6FA 2PLXA 1HRTH 2ZFTA 3LGVA 2IOTA 1RS0A 1BTUA 3BTME 1EQ9A 1DXPA 1QTFA 1VJAU 3RXPA 3M3SA 1V2MT 5A2MH 1NY22 1GHBG 1ELCA 1C2LA 1YPEH 2GMTB 2P3FH 2P94A 1TOMH 5F53A 2PTCE 4LOYH 1OSSA 2QIQA 1O36A 3MH6A 2YMSD 5CDFE 3E6PH 1NBMD 4CRAA 2PKSB 1TNLA 1BBRH 1ELEE 5DP5A 4BTUB 2GMTC 1G37A 1O38A 1SGYE 2OD3B 3U9AH 1AO5A 1HV7A 3T5FH 4O3TA 3LT3A 1GBKA 2R2WU 5DG6A 3ZZCA 6CHAB 1HAGE 2C8YB 1TONA 1CHOG 3UNSA 1DPOA 4K60A 7GCHG 1KYNA 2OQUA 4JMYA 1Q3XA 3KN2A 2ZTXA 1S84A 1MTSA 4DT7B 3FZDA 3DSOA 1TX7A 4DGJA 6CHAC 2Z3DA 3F2GA 3SU3A 5F8ZA 3FAOA 4MNXA 3AW1A 1O5DH 1AWFH 1C9PA 1BTPA 1SFIA 4FVBA 1RRKA 4KELA 3O8BA 2BVSH 1J8AA 4I7YH 1GVZA 1GBHA 2P3TB 1PPEE 2OBOA 2QC2A 2CN0H 1MABB 2ZGHA 5C17A 1SGIB 3SGAE 2ASUB 3A81A 3G01A 1FIZA 2GKVE 2ZFPH 3GDVA 4K5ZA 4AB9A 4IMQA 3TJOA 1P11E 1L4ZA 1TA6A 2BOHB 1P04A 4UDWH 4CH2B 1GMHG 1O3LA 1IQNA 2XCFA 1DT2A 3SZNA 3U8TH 4P02A 3DHKH 1O2JA 1L2EA 1XUKA 1O3NA 1MCTA 1L1NA 3LGWA 3GDUA 1GG6B 4JZDH 2VWLA 1O2GH 3P17H 1A61H 3PLKA 2KM0A 1HGTH 1O3AA 4XFQA 4DIHH 1W2KH 2H9TH 1E36B 2BLWA 5DP9A 3OSYA 1YLDA 4ZKOU 1GG6C 1SLVB 5BPEA 1ACBE 2G55A 3KYFA 4AYVB 1LHDH 2CJIA 1V6DA 1LHEH 1MBMA 1V2JT 1WSSH 3MU1A 1HNEE 4OS6A 3F9HA 3NKKA 3A8BA 1F5KU 1O32A 1ORFA 1CBWB 1NROH 5DSFA 3BTFE 4Y8XA 2B8OH 1ETRH 1PPZA 2B0FA 1V2QT 3MI4A 2AMDA 3SU2A 1Z6JH 1GVKB 1GI5A 1W10U 4ISIH 1EP5A 2BYAX 2Q6FA 2G5NA 4Q7XA 1CBWC 4JZFH 2NU2E 1IQFA 3Q77A 2A7HA 5DP8A 4BOHA 1MUEB 8KME2 1GPZA 3F9GA 5L30H 3MU0A 1QZ8A 1MTWA 3RU4D 5LPRA 1S0RA 2A0QB 1RGQA 2VJ1A 3FANA 1OX1A 4I8JA 2WUBA 4DIIH 4ZHAA 1AUTC 4X6OA 4ZCNA 1T32A 3RMLH 1HAOH 3GCHB 3KEEA 1D3TB 4Y0YE 2BD7A 3U98H 2GZ8A 1O3IA 3F68H 1BITA 1SGNE 3PROA 1Y59T 4IBLH 4B71A 1KIGH 2C8WB 3OTPA 4TT3D 3GCHC 3GY6A 2BQ6B 4CH8B 1QQUA 1IOEA 1C2MA 1CU1A 1NC6A 3MMGA 1GMCF 1YPKH 2L6OA 5KEDA 1NT1A 2ZECA 4WH8A 1C5MD 1GJ4H 2VIWA 1SGTA 3F0OA 2WPJS 2EI8A 5EJZA 4Q2KA 1ANDA 2UUJB 3K6ZA 3V3MA 1O2UA 5FX5A 1AFEH 4GLYA 4X8TH 4HFPB 1C5WB 1YCPK 1O2TA 3MQKC 1C1OA 3HKJB 2BVRH 4K1EA 4NIXA 2SGPE 1MU6B 2DUCA 3SNDA 3SHCH 1BB0B 1A2CH 2HALA 4OGYA 5B6LA 5K7RA 4FUFA 1BRUP 2F9NA 5DP4A 3M5OA 3OAAD 1ZMNA 4AFUA 4NGAH 5HMAA 2JJ1D 3KCGH 1LVYA 1L1JA 2H5DA 3VEQB 5EXLA 1T8MA 2ZEBA 7GCHF 3KGPA 2A4RA 3SV9A 2ZHQH 2W6JD 3RMNH 1CQQA 1AVWA 2OXSA 4AORA 2PSXA 3RM0H 1HXFH 1N8OB 4Y79A 2ZTZA 1Z6EA 3OYPA 1AGJA 3U1IB 3BV9B 1HUTH 2Z94A 4THNH 4KKDA 4AN7A 2JDID 3PYHA 2BQWB 1TGCA 3DD2H 1N8OC 1TNHA
chains in the Genus database with same CATH topology
5EGMA 3NK8A 1OWKA 2VVCA 2YOLA 1VITG 1O2ZA 3M5LA 1UVUH 1K1NA 1L4DA 1AI8H 1YF4A 1FPHH 2FOEA 2SGEE 3UWIA 4JZEH 3A8DA 1F92A 1WCZA 1DS2E 1AHTH 1C2DA 1EB2A 2QN5T 3AVZA 1GCTB 5CMXH 3M7TA 1YPHC 1LQDB 3PWBA 2OP9A 1GI1A 3A83A 1UO6A 1C1TA 2A1DB 3NUMA 3P8NA 3PTNA 1DWEH 3BTEE 2J38A 1GCTC 3GCNA 1F0TA 3MH5A 2A32A 2A2XH 2XBWA 4Y7BA 2JH5D 6GCHG 4YM9A 2ULLA 2Q6DA 2ZDLA 1E38B 3LOXA 2A4GA 2R9PA 3DT0H 1EZQA 1N6XA 2Y80A 2ZQ1A 5GJ4B 1S5SA 3TU7H 1PQ7A 4ISHH 2BX3A 2Y5HA 1V2RT 2BDCA 1HFDA 4BAOB 1YPJH 1GBJA 2PR3A 1GMDG 3OX7U 1C5RA 2AERH 2SNWA 5I25A 1NRSH 4U01A 3ZVEA 1KY9A 6ESTA 2AIQA 1AZZA 1Y3WA 3BIUH 1P12E 4HTCH 1SOZA 1DANH 1TQ7B 2TPIZ 4ASHA 3ZV9A 2VIVA 1NESE 3RXTA 3B8JA 1EX3A 2G4TA 5L6NH 3T62A 3MU5A 3M5MA 3UFAA 5BRRE 1A1RA 4TYDA 2VWNA 3D49H 4YOJA 2H2ZA 1C5LH 2Z9IA 3AASA 1P2MA 1Y5UT 1Z8IB 2Q6GA 1QBNA 1EOJA 2SGFE 2WPHS 2HNTC 1BOQA 3S69A 5C5OA 3TLOA 1X7AC 3PO1B 4GHQA 2HNTF 2GCHG 2GP9B 1TYNA 4NWLA 2STBE 5JBAS 2A7CA 4IW4E 1TOCB 1Z1JA 5FHTA 3ATLA 4X2XA 1AUJA 3PO1C 1C5XB 3TH3H 2GGVB 3SJKA 2VGCB 1GJCB 5IYTA 2GCTB 3K2UA 1EB1H 4ZAEA 3TH4H 2BDYA 3Q3KA 1ZTJA 4E06H 2Y6TA 1EXFA 1ZTKA 2O9QA 1K9OE 3ZVFA 2VGCC 1AVXA 2P93A 2FOCA 2GCTC 5T6FA 2F3CE 5ETXA 1FMGA 1QB1A 4IC6A 1BCUH 1ANCA 1NRRH 3O8CA 2W7SA 3SV8A 1ELGA 4O03A 3KQEA 5GPIB 4J1YA 5GXPA 5ESTE 1J14A 3A7XA 1ZJKA 5HGGA 4FUHA 3E1XB 1RJXB 2SNVA 5DO4H 2BDBA 3RU4E 4YOGA 1H8IH 3SU5A 3QTOH 2CV3A 4NZQA 5LPFA 3BTTE 1C1MA 3DUXH 2FS9A 1O5EH 2FOGA 4GCHF 1TE0A 1GI4A 4ISLA 1NRPH 4A1TA 2Y81A 3EE0B 1BTWA 3RUOA 4F49A 1ETTH 1EAIA 1A5GH 1SBWA 1WUNH 3GY2A 2V3OH 5PTPA 1SI5H 1HYLA 3GY8A 1UVTH 4Q80A 5ABWA 2FI3E 1BTHH 3URCA 3ZZAA 2EC9H 1TGNA 3LKWA 1O2SA 1YYY1 1WYKA 1J17T 3T2NA 4FUEA 1CT0E 1PFXC 1EJMA 3T29A 1GI7B 2AMQA 1QGFA 1PPBH 2P16A 4ISOA 1O2PA 1P2QA 1UK4A 3O8DA 1CA8B 1RTLA 4H6TA 3VB3A 1KXAA 1MTNC 1MKWH 3UNQA 1XUFA 1ELTA 5L2ZH 3TJUA 1C2JA 5J4QA 5AFYH 2P59A 4Y8ZA 1FJSA 3T27A 3MFJA 1FPCH 3P70B 2R2MB 2ZQ2A 1P09A 2C93B 1SHHB 1G9IE 2GZ9A 3LH3A 1CT4E 1O35A 4ISNA 5DKMA 1IQJA 1MQ5A 1C1NA 1KLTA 2CHAB 3LGUA 4XOJA 2DE8A 2AGGX 1EAXA 1JRSA 2GDEH 3MO3A 4CRCA 2PWXA 1EJNA 1CT2E 3A7YA 1K1IA 3M5NA 4I8GA 2AH4X 1F2SE 4D76A 2H9EH 2CHAC 1IQEA 1GDNA 4FUBA 1NFXA 1TNJA 2H5CA 2BMGB 1SGEE 1V2PT 3SJ8A 1HXEH 5J4SA 2GDDA 1P9SA 3KF2A 4FUJA 1FONA 1BZXE 1HAXB 1JRTA 3SORA 3M7QA 3SI3H 4ABAA 3BTWE 1BQYA 3Q3YA 2CMYA 4KTSA 1RXPA 4Y6DA 4UEHH 2PGQB 1KSNA 3DA9B 1E35B 3P8GA 3RLWH 4ZUHA 1VCQA 3A7TA 4XDEA 2P95A 3W94A 2BD3A 3ZZ8A 3PLBA 4AG2A 1IHTH 1IQKA 1OP8A 5EQSA 1QJ6B 1O2VA 3IITA 1ESTA 1OYQA 2W7UA 1K1PA 3GISB 3OY5U 3BTKE 5FXLA 1O34A 3HATH 2OC7A 4K1TA 5EPYA 1ZGVA 4GSOA 2TGDA 2ZFFH 1LCYA 3T25A 1W8BH 2BD2A 3ITIA 3I29A 3TNSA 4B73A 1HIAA 1N6YA 1SC8U 2F9UA 2GV7A 5GIBA 1ZSJA 3SJOA 1TALA 5EODA 1DWBH 1YPGH 3RXCA 4X1PU 2XXLA 4K8YA 5TJXA 4UFFH 1OWDA 3SN8A 5C5NA 5T6DA 3QGNB 2QXGA 1RIWB 2G5VA 3RP2A 3MYWA 5AFZH 1YPHE 3N7OA 4YO9A 2W26A 4TPYA 4NA9H 1HAVA 1BBRK 2Z9KA 3VFEA 2BX4A 1C4U2 5LPEA 3SHAH 1C4V2 4XBBA 1RIWC 2R3UA 1HAZB 2WPKS 1AFQB 2Q1JA 2O8LA 1HIAB 1OYTH 1QQ4A 1J15A 4X8SH 3ATIA 2GT7A 2FOHA 2TRMA 3FVFB 1XM1A 1NRQH 1P2KA 2FXRA 1AFQC 4ESTE 5FPYA 3E0PB 1G3CA 3ZZ5A 1ESBA 1FIWA 3RU4T 1XXFA 4MNVA 4XBCA 1WQVH 1OWJA 4B76A 1W12U 2A31A 1S85A 1DY9A 5C1YA 1S82A 1O3MA 1ELAA 2BDHA 2GX4A 1SQAA 2Y7ZA 3AAUA 1BJVA 3JZ2B 1ZMLA 1P03A 3ESTA 1MBQA 6LPRA 4MPVA 3BTHE 5F03A 2ZI2H 1IQGA 3BEUA 3RC4A 4FU7A 1RD3B 3I77A 3LGIA 4A1XA 2ZHFH 3A7WA 1JMOH 3LJOA 2HGTH 2BLVA 1DVAH 1GCDA 3DFLA 2ANYA 2XTTB 1ELFA 3QGJA 1PYTC 2K1QA 4RSPA 4GPGA 2HNTE 2XW9A 1UCYH 4UFGH 1SVPA 3UOPA 3ZVBA 1W13U 1GI2A 3SQHE 4K8BA 2QXIA 1ZSLA 2ZWLH 1QJ1B 4YESB 3MNXA 1T4UH 1HJAB 1GBIA 1GHAF 1P06A 4M7GA 3B23B 4B1TA 1K2I1 2A5AA 4BXWA 1TIOA 1RTKA 2R0LA 2A4OA 1HJAC 3KL6A 2G00A 1UHBA 3RMOH 4DOQA 1TABE 1WAYB 5LGOA 2SGAA 4NZLA 3EA9A 4GAWA 3S7HB 5G4BA 3RXRA 1S6FA 3RC5A 1KXCA 1O2IA 4IMZA 1O33A 4NG9H 5C67A 1GBBA 1LKBA 1XXDA 1TBZH 1T4VH 4KTUA 1PYTD 1DE7H 2PUQH 1QNJA 2ODQA 4CBNA 2ZCKP 2FLBH 3GY3A 4FU9A 3SBKA 2V3HH 4YLQH 4DJZB 5A8XA 5HM9A 3QZQA 2KAIA 1D4PB 4DURA 1UHBB 1O3PB 1GL0E 2O8UA 1SR5C 3RXBA 1JBUH 1AB9B 1LHFH 2XRCA 1TA2A 4KTCA 1QB9A 2D8WA 3Q76A 1K21H 4B2CA 4GHTA 1NFWA 4E05H 3Q00A 5FPSA 1UTPA 3A86A 1FAKH 4OGXA 3ZZ3A 3V12A 5IDKA 2EA3A 3CP7A 1NZQH 1AB9C 4AG1A 3TVJB 1QHRB 3NCLA 1L0ZA 3BG8A 1TMTH 2ANWA 7KMEH 4MQAA 9ESTA 2JETC 3EDXB 1EPTA 3SU0A 3RMMH 3NZIA 1O5BB 4OS2A 1K28D 3HGNA 2BDAA 3PB1E 2WYGA 2Z3CA 2NU0E 1SLWB 7ESTE 4UE7H 3FFGA 5E8EH 1O2LA 3H7TA 3P8OA 1ELBA 4R0IA 4TPIZ 1UTQA 2BQ7B 4JYVH 1OWHA 1GJ7B 4WMEA 2W3KA 1MTUA 4X1NU 1C1RA 3T28A 4MLFB 1SGFA 4XE4A 5I46H 1HAPH 1C9TA 1EPTB 2Y7XA 3QX5H 1MKXH 2C90B 1O3CA 5E2PA 1K1JA 1Q2WA 3CENA 3EA7A 2PHBA 2HLCA 2VH6A 1GI3A 5SGAE 1GHWH 4ZXYH 2D26C 1EPTC 2D1JA 1NM6A 1FY1A 1NS3A 5AVDA 3VXEH 1O5GH 3GY5A 5TCCA 1TAWA 1C2EA 1UJ1A 1GHBF 1QB6A 1S0QA 4DVAU 1Z8GA 2ZCLP 2IN2A 2ILNA 4BAQB 2HOBA 5EXNA 3UPEA 3R3GB 2JH6D 3L33A 1UTKA 1Y8TA 2ZU4A 3JZ1B 4I8KA 2STAE 4ABGA 4WMFA 1HB0B 4NCYA 4FXGH 2ZZUH 2V6NA 2VIQA 4Y0ZE 1LPKB 4NA7A 4YOIA 5JYIA 1PQ5A 1TWXB 1CHOF 2BD5A 1MTVA 1AKSA 2PKAA 4X1RU 1O3EA 1PPGE 1A4WH 2FODA 1XVOA 3AW0A 1AU8A 1EZSC 2FWWA 2GV6A 1OXGA 3TGKE 2VU8E 4OS7A 3LPRA 1SG8B 1Z71A 5E0GA 1C1PA 2F83A 4H42U 1YC0A 2BZAA 1K1MA 1WU1A 1ABIH 2Y5FA 1KTTB 1CA0B 2ZPSA 1HCGA 1O3DA 1D6WA 4HI3A 4ZXXH 1TPAE 1T31A 2F9VA 2B9LA 1XKBC 2W5EA 3BG4C 1VR1H 1C5QA 5T3HA 1IQLA 4FUIA 4JYTA 1CA0C 3EA8A 1AKSB 2GD4B 2OINA 4UFDH 3ODDA 4KP0A 1DX5M 1IQIA 4JZ1A 4B74A 1F0SA 1GDUA 1GMHF 1S6HA 1XX9A 4AGJA 4AFSA 5DPAA 3ZZ9A 2XYAA 1SOTA 1G3DA 1NFYA 1BMLA 1D9IA 1GI8B 2EEKA 2ZNKH 1YP9A 1XMNB 1P2IA 1EJAA 1T7CA 2J92A 3IWMA 1OP0A 4WXVA 1O3KA 2FI5E 2VINA 2ZPQA 1C5OH 5T6GA 1P2JA 4AFZA 1EZUC 3ENSB 8LPRA 3M7UA 4K1SA 2Z9JA 1WTGH 1DLEA 4GVUA 1GJ8B 3RXJA 2VIDA 2AGEX 4YLUA 3EQ0H 3ZYDA 1MU8B 3FP8E 2XBYA 2QXHA 1QR3E 5H4IB 1GHXH 3SUGA 3BTDE 1MH0A 1OWIA 3GICB 1SL3A 1AMHA 2AIPA 3RXHA 2B7DH 1VCPA 3IG6B 1MMJN 2HWLB 4Y71A 2V0BA 2J4IA 4A5TS 3LDXH 4F4OC 4X6PA 3QZRA 4TY6A 2ZU3A 1W3CA 4AX9H 5AF9H 3MNBA 1OPHB 1MCVA 3L3TA 1QBVH 4CHAB 4D9QA 2WV4A 2AFQB 2GTBA 1JOUB 4AFQA 3S9CA 1KDQA 1AQ7A 4AOQA 2ZA5A 1YBWA 2ZHDA 3PLPA 4X2VA 3FP6E 2Z9LA 4CHAC 4UD9H 3M3TA 3BN9A 4PROA 4QT8C 2A7JA 3D23A 4ABDA 3MOCA 2AYWA 1UTLM 1C1WH 1V2ST 2FM2A 4FUDA 1ZRBA 5DP6A 3BTGE 5EW1H 1SQOA 1TRMA 2WPIS 4X1QU 1H9IE 3M61U 2Z6BD 3GCTG 2FOMB 2BLQA 2SGQE 3SOSA 1ID5H 4JCNA 1J16A 2ANMH 3ZV8A 3D65E 1BMMH 3OY6U 1V2OT 1TGBA 2LNCA 1BMNH 1DWCH 1O2WA 1QY6A 1V2TT 2FMJA 1XUJA 3ZVCA 1SGQE 2BB4A 3R0FA 2JH0D 5FCKA 1PQ8A 4Q7YA 2UUYA 1KDQB 2BXTH 2TIOA 5DJ7A 3PTBA 5EPNA 4UONA 4DY7B 1P2OA 2BD8A 3S9BA 1FQ3A 4U2WA 2BTCE 1JIMA 1CE5A 4DW2U 4CR9A 5A09A 1O5CB 4ZMAH 2QY0B 2FI4E 1G32B 1C2IA 4CR5A 1C2FA 1ZLRA 2OC0A 3P8FA 2FLRH 2UUFB 1GVLA 2A2QH 1SGCA 5E0JA 4D7FA 1NN6A 2ZFRH 2ZU1A 1W0YH 4MG3A 4RN6A 1DUEA 4I32A 1IQMA 4CRDA 1LMWB 1VGCB 1Z7KA 2A45B 4MPXA 5EXMA 3TK6A 1MKWK 3M37A 4U32A 3O8RA 4NSVA 3DFJA 4VGCB 1GBTA 1LHCH 1QRXA 1JXPA 1DICA 1VGCC 2RCEA 3QO6A 1SLXB 2ZGJA 3QK1A 4VGCC 1MTNB 3MU4A 3SNCA 1VITF 1FV9A 4NIVA 3UQVA 2ZF0H 3EGKH 1W7XH 1FZZA 4HGCA 1J9CH 3U8OH 1GHVH 1OOKB 1BT7A 2UWLA 4LXBH 3RXMA 3RXIA 2ZP0H 2BOKA 5A0CA 2OBQA 3KQDA 3VGCB 1M9UA 3UNRA 2Z3EA 2XWAA 1LVMA 1YM0A 3ATWA 1UVPA 5E2OA 1G2LA 2CF8H 2TBSA 1ZPCA 1JWTA 1GJAB 1TX6A 7LPRA 1H9HE 1UTMA 4WF8A 2NWNA 3VGCC 1AD8H 1ZPBA 4H6SB 6GCHF 2G51A 1SFQB 3K65B 4TWYA 3K6YA 4IS5A 1A46H 1FN6A 2CGAA 3UWJH 1EUFA 1ZR0A 2ZIQH 3TGIE 1F0UA 1L1GA 4Y76A 1ARBA 2ZHEH 3KQBA 4X0WU 1O3GA 1N1LA 1QURH 4ABJA 1GMDF 4BTIB 3E16B 1O3BA 1W14U 2G8TA 3V7TA 3A8AA 1UVOA 1QL9A 2C8ZB 5HYOA 4MNWA 4ZKRU 2BDIA 1HAYB 1BHXF 3UREA 5GWZA 3STIA 1C5ZB 3SJIA 4U30A 1LTOA 2P3UB 3A89A 1UCYE 3P95A 1HDTH 3LONA 2UWOA 1GJ5H 3Q3XA 2NU4E 1HJ8A 1QCPA 3BIVH 2GCHF 4WY3A 1O3HA 1FLEE 3S7KB 1V2NT 1RFNA 2EI6A 1NFUA 1CO7E 2DE9A 2BY6X 2XC5A 2AEIH 5JBTA 1PPFE 1MD7A 2QYIA 1MAYA 2FYRA 3PV4A 5DP7A 3M35A 1C2GA 5C1UA 5JPMH 4I8LA 2GVFA 1BTZA 4Q7ZA 1O30A 5JDUB 2WV5A 4IC5A 2ESTE 1THRH 4RKJB 3SJ9A 2FESH 2BXUH 1O3OA