2TGTA

On the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title On the Disordered Activation Domain in Trypsinogen. Chemical Labelling and Low-Temperature Crystallography
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase zymogen (serine proteinase)
total genus 48
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1981-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tgtA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tgtA02
5LPEA 3ZYEA 4B2CA 3A7YA 4I8HA 5DPAA 1Y3YA 3ZZ4A 2C8ZB 1OOKB 3U8RH 3FP8E 2TBSA 2ALPA 2GP9B 3QGJA 3LGUA 1W14U 2NU0E 2ANKH 1BTXA 3LKWA 3ODFA 1UTLM 1ZTKA 2F9VA 1TQ0B 2AIPA 3NPSA 1CBWB 1W7XH 4JMYA 3UR6A 1FIWA 2CHAC 1HAVA 2ZFQH 1ZPBA 1GI6A 1GI8B 1OWKA 4A1XA 4K8BA 1O38A 2GDEH 4JCNA 3QZRA 5FCKA 1Y3WA 3GCOA 1FLEE 3SJKA 2VWMA 3UQVA 1O2QA 3TGIE 5JB8S 3ZVFA 3S9BA 4F49A 2ZI2H 2BDYA 1LPZB 1NT1A 1JRTA 1VGCC 3RXBA 1Z1IA 1QB9A 5JB9S 1DUEA 1HAYB 1P2MA 1VJ9U 8KME2 4A7IB 2GTBA 1OYTH 1HXFH 1UCYE 5EPNA 1GJCB 1LPGB 1T8OA 2R0LA 5EXMA 1ZMNA 3UNRA 1VITF 4AORA 1RGQA 1RTLA 4BAMB 3NKKA 4NSYA 1Q31A 1L4DA 1QRZA 2GT7A 2JH5D 2Z9LA 1F5RA 3EE0B 2BHGA 2H6MA 4LXBH 5EW1H 1SBWA 3A85A 2A2XH 4E05H 1IOEA 1GDNA 3EAJA 1CE5A 3PMJA 2GKVE 1PPCE 4ZXYH 1GMCG 2A4GA 3GYMA 5CHAB 4ABDA 2WPIS 3K6ZA 3ZVGA 3NWUA 3RXVA 1BQYA 2THFB 1TPAE 1NS3A 3E3TA 5T6FA 3A83A 1F0TA 4J1YA 1JIRA 4NWLA 5LPRA 1O2NA 1LVBA 4WMEA 1S82A 1Z71A 1FONA 1BMAA 2ZU3A 3TJOA 2J4IA 1ZHMA 4CRBA 5IYTA 1GI4A 1W8BH 1TMTH 2ZDKA 3SV7A 2ZPQA 3S7HB 3O8BA 2QYIA 1O3BA 4ZKSU 1DUAA 1TNLA 2PSXA 3KHVA 1DWDH 1YPLH 1AFQB 2G4TA 2J38A 3RXGA 1WYKA 1SGDE 1V2KT 1PQ5A 2OXSA 1AU8A 3F1SB 3RXJA 2FOHA 4ZHLU 4WH6A 1YP9A 2BDBA 1DDJA 4XFQA 2ANWA 4R8TB 2GDDA 3LGIA 5G4BA 3S9AA 1TPOA 3SZNA 1TOMH 4LK4A 4BXWA 1FPHH 1TOCB 4FUGA 3SGAE 4CRGA 3MH6A 4FU8A 1BMMH 1YM0A 2FYQA 1F5KU 3UOUA 3SUDA 1MTNB 4TPIZ 2UUFB 1EJMA 2ZHEH 4YOJA 2I6SA 4K1SA 3ZVEA 1YGCH 3H5CB 1NFXA 1G3BA 1N8OC 4MPUA 1DOJA 2G5VA 1LHDH 1IQNA 2P8OB 3UTUH 2VIPA 3MNXA 3RXRA 1TONA 1GBCA 2R2WU 1V2WT 2ZO3H 3GISB 4AB8A 1KYNA 1C5OH 2AGIX 4E06H 1O5CB 2BQ7B 4WH8A 1PJPA 1PYTC 2D26C 3T27A 3VFEA 1RRKA 1TX7A 3E16B 1DXWA 1TA2A 1TIOA 5A0BA 1QJ1B 2AFQB 4NA8A 1CBWC 1FN8A 3M5LA 3K9XB 2BTCE 3BTHE 4MNXA 2W3IA 4D7FA 2B9LA 9ESTA 5FHTA 1MMJN 1O5BB 2OC8A 1P2QA 2ZDVH 3A88A 1BRAA 2Y7ZA 4CBNA 1MCVA 2XWBI 3QN7A 1B0FA 2BXUH 1CGIE 4WMFA 1BRCE 1Y5UT 2WV4A 1AIXH 1KDQB 1SLXB 1HBTH 1F0SA 1NRRH 1O39A 3G01A 2XW9A 3PWBA 1GBDA 3ZZ5A 1JRSA 4DY7B 1PQ8A 7GCHF 1AO5A 1T8MA 2XNIA 2P3TB 1S0RA 2GV6A 2K1QA 2BLQA 3RXAA 3S0NA 3MWIU 1S85A 2Y5FA 4Y71A 4NGAH 2NU4E 4CRFA 4X2VA 2W5EA 4FU7A 4ZH8A 3RXIA 1BTWA 1S81A 1SGRE 5EG4A 1XUKA 4GHQA 1G3DA 4D76A 5C3NA 1A5IA 3SO3A 1VITG 1O33A 3A81A 4I32A 2AGGX 2YOLA 1DVAH 1O3HA 2SGQE 4A1TA 1E34B 5ESTE 1ZOMA 3ZZCA 1D9IA 2Z3DA 3KL6A 2BDIA 2IN2A 1GMDF 3ZZ9A 1XVOA 3A8DA 3GCHC 1FQ3A 1IQLA 1NY22 1AKSB 1EZXC 4H4FA 3ZVCA 4KTSA 1GI7B 4YO9A 1HJ8A 1L1GA 2C93B 2TPIZ 4HZHA 3LGWA 2A5AA 1MKWK 1QTFA 2STBE 1NESE 1V6DA 2FO9A 1TGCA 3SHAH 1P3CA 3KQDA 2ZF0H 3TGJE 4Y76A 4JYVH 3S7KB 1NFUA 4JZDH 1W13U 5T6GA 1UHBB 3GY5A 1AFQC 3GY4A 2ZTZA 4AFQA 4O97A 4MDSA 4ZHAA 1DY8A 3LH1A 5GWZA 3M37A 1FUJA 1C5TA 2PLXA 4WY3A 4SGAE 4TPYA 4XOJA 3M7UA 1YPJH 1TX8A 3MMGA 3OX7U 1BBRK 1T31A 1WBGB 4BNRA 2GZ9A 1EB1H 5EODA 3Q3XA 1FY8E 2FOEA 4FUBA 1BMNH 2FLBH 2ZDAH 1MTNC 5F6MA 4ZKRU 2F9PA 1N6YA 2AH4X 5A8YA 2Q6DA 4ABHA 4BTUB 5K0HA 2AEIH 1MTUA 1O34A 1NU7B 4O03A 3D65E 4KKDA 1RTFB 3C27B 7ESTE 1O3DA 2PTCE 1AE5A 3GY6A 1K1LA 3QO6A 2O8WA 1C5RA 2QIQA 2P8OC 3GY2A 1EKBB 3SW2B 4A1VA 3RU4D 1QY6A 1AFEH 1T32A 1HAZB 4BTIB 3P95A 1OWHA 1YC0A 2FOGA 1KLIH 1TNKA 2SGEE 3SNCA 1C2FA 1GHVH 1K1OA 1UTKA 2BXTH 5DO4H 5EGMA 2OCVB 1ELAA 5BRRE 8LPRA 1L4ZA 3A8BA 1UVPA 4ZHMU 4YTAA 2FDAA 3A7ZA 1TYNA 2AMDA 3A7WA 1DT2A 2C4FH 1O3CA 3ZVBA 1O2MA 4Y8XA 1FXYA 1FPCH 2NU2E 1NFWA 1QFKH 1WOFA 3MO9A 1DWEH 2FLRH 1BHXB 1QL7A 2BDCA 3RXHA 1GJBB 3A7XA 1GI9B 4AYYB 1Z6JH 3QZQA 2VINA 3PWCA 4CRAA 3NK8A 1HAXB 1NZQH 4B74A 2ZGCA 1HAVB 1P05A 4Y0YE 1TABE 3LGVA 4K5ZA 3FZZA 5L2ZH 4I33A 2Q6FA 2FWWA 4IW4E 1GHBF 1UO6A 1KDQA 3M5NA 1NN6A 3SOSA 1MBMA 4HGCA 3R3GB 2SGPE 3B23B 3U1IB 1P06A 1RS0A 4XSKU 2A7HA 2CHAB 3GCNA 4MPXA 3MH5A 3M7TA 1A2CH 1EASA 1ZZZA 1GDQA 1GVKB 4X1NU 5HXFA 2ZZUH 2ZCLP 2JETB 1GHZA 1T7CA 1QL8A 5T3HA 3D49H 4FUDA 1O2IA 3GICB 4KTUA 3UQOA 6LPRA 1E35B 5ETXA 3MH4A 2FPZA 2QF3A 2UUYA 4Q80A 1SMFE 4IBLH 1VGCB 2HNTE 4Y7AA 4YOIA 2FI4E 1O3EA 2V3HH 3BEIB 3F9FA 4K1TA 4FUJA 2SFAA 2ZDMA 3QLPH 1PFXC 3TK9A 1C1NA 2BB4A 4H42U 4TWYA 4GPGA 2F9UA 1THPB 2ASUB 2ZHDA 2ZQ1A 2Z9GA 3RXPA 1O2OA 2FS8A 1WUNH 2ZFPH 1GMDG 4YESB 3BV9B 5DJ7A 4DGJA 3SI3H 1LQEA 1HB0B 2STAE 1G37A 4O9VA 5C1YA 3GCTF 1K9OE 3SU0A 5JDUB 2BD2A 5T6DA 1P9UA 1KTSB 1P2JA 2ESTE 3OY5U 5FXLA 2YNAA 4B73A 1Z7KA 1DXPA 4INHA 4U2WA 2BD9A 1HLTH 1SR5C 5GIBA 5HMAA 3E91A 1Q3XA 1QB1A 2ZCKP 6GCHF 4UFFH 1G3EA 5FBEA 1TRNA 1CO7E 1PPHE 3JZ2B 1UHBA 2D2DA 4MVNA 3HPTB 1FMGA 1TGNA 4B1TA 2ODPA 4LZ1H 1OS8A 1OPHB 3FP7E 1QA0A 3PLKA 4OS1A 3MNCA 4NA9H 1LVYA 5DG6A 1P2KA 1T8LA 3QDZB 2VIWA 3STJA 3O8RA 2PUQH 1EAIA 2A2QH 1EUFA 1AN1E 1S6FA 3S69A 2WUCA 2QV1A 1HAPH 3A87A 1TALA 1VCWA 3BTGE 4AG1A 1C2EA 1UTMA 1V2NT 1NROH 3VXEH 1D3PB 1O3LA 2GD4B 2ZGBH 2RA0A 3MOCA 3GYLB 1O2GH 5TCCA 3RXEA 1BITA 2R2MB 1TGSZ 2OP9A 1PPZA 1SQAA 1MCTA 4ABFA 2QAAA 1SLVB 1LHCH 5DP9A 2BLVA 2QXIA 1C2KA 3AASA 3MHWU 4GAWA 2XC4A 3SN8A 2G8TA 1O2XA 2FTMA 1SOTA 3HGPA 4MPVA 1BT7A 4K60A 1BZXE 2VJ1A 1S83A 1SGFA 4YLUA 6ESTA 1Y8TA 1AQ7A 1DY9A 1ZRKA 2V6NA 1BA8B 3HK3B 2P59A 1C2LA 5HM2A 3FFGA 4YLQH 2OBOA 2BY8X 3UY9A 1VCQA 3KIDU 1AB9B 1MU8B 2G51A 1PPFE 1AZ8A 4MNYA 4B71A 4IN2A 4ZMAH 3BTME 2NU1E 4UFDH 4I8JA 3TJUA 1Z8GA 2QXJA 3L3TA 4UONA 4RKJB 1C4V2 1TMUH 2XBYA 3I77A 3LDXH 5E2OA 2VIDA 1GJAB 4X1RU 5GDSH 1V2OT 1INCA 1ZPZA 1SVPA 3SUGA 5H4IB 2A5KA 4JYTA 1CVWH 2JETC 2LPRA 1GJ6A 3M3SA 1W3CA 5DP5A 1KXFA 1GHBG 3ZV8A 2Z3EA 1A5HA 1PPEE 2ZFSA 3GY7A 3BN9A 1GCDA 3L33A 4GSOA 2PW8H 1IQEA 1AWHB 1MZAA 1K1NA 1TFXA 4X2YA 2QA9E 5E0JA 3LT3A 1GBBA 2Z9KA 2CGAA 3PLPA 1IQGA 3KGPA 1C2GA 2AERH 2EI7A 2XBWA 2C8XB 3TH3H 1JBUH 2ZKSA 1SOZA 1O36A 2CXVA 4K69A 1QBNA 1QR3E 5C67A 1EZSC 3F9HA 3RU4E 4WXIA 1KTTB 3QGNB 1J16A 4AFSA 4KGAA 1Q2WA 1AUTC 1BHXF 2ZG0H 3H7OA 1C5SA 2Y7XA 3A8CA 1F2SE 2DE9A 4B2AA 1OXGA 2ZFTA 3CP7A 4ISIH 3ZVAA 2Y82A 1SGPE 1TRMA 3F9GA 3PMAB 3RMLH 5C5OA 1PQ7A 3GCTG 3GCHB 2R3YA 4B75A 3RXMA 3R0FA 3VB3A 6GCHG 2OQ5A 1QJ6B 1MKXK 5GPIB 4AN7A 4K3JA 1BTHH 4FXGH 4X8SH 1E37B 1ANEA 2ZGHA 1JOUB 2A45B 3K6YA 4DVAU 1N6XA 4X6MA 2OC0A 3QX5H 2J9NA 2EI8A 1SQTA 1CA0B 2CV3A 3M36A 5GJ4B 3PMBB 3UOPA 1ELFA 2AYWA 4ABGA 5TCAA 1GMHF 2BY6X 1GBKA 4IC5A 3VB5A 4CRCA 2G5NA 1CT0E 2XCNA 1AVWA 3VGCB 3AAVA 5EPYA 3ATMA 2BLWA 3SBKA 2ZHWH 1GDUA 2GVFA 3RXQA 1GJ9B 3SORA 5LPFA 3KN2A 1K1PA 4MPWA 1TLDA 2WINI 4IGDA 3RMOH 2HLCA 1O2WA 2Y5GA 2F91A 4ABBA 1SGNE 8ESTE 1FY4A 1MAXA 4WJG2 1O3GA 3SJIA 1CGJE 2SNWA 1C1TA 1GBHA 1C1OA 1TRYA 5CMXH 1TMBH 1O2SA 3Q3KA 4FUCA 1LDTT 1O31A 1GBIA 1O2ZA 1G2MA 1V2QT 3A84A 1ELGA 2B5TB 5ABWA 3Q77A 1E38B 1GJ4H 1GVLA 2O8UA 2F9OA 1RTKA 2EEKA 3E6PH 2ODYB 1AB9C 3LU9B 3LC5A 2FOAA 3U8OH 1KXEA 4X6NA 4DIHH 3F9EA 2VVCA 3BTKE 2AGEX 1HJAC 3GY3A 2IJOB 1C5YB 3IITA 1YPHC 5FX5A 2FOFA 1BBRE 1LVOA 3T62A 1G32B 1ZMLA 4NIYA 1WV7H 1C5ZB 1EAUA 2ZFRH 2ZEBA 1HAHH 4ABIA 2BVXH 2FX4A 2H9HA 3TH4H 3OU0A 4Q2KA 1C2DA 1HAGE 1IQMA 4BTTB 1L1JA 2V0BA 1F7ZA 3TK6A 1A3EH 1ZGVA 2GCTC 2PUXB 2ZPSA 4X6PA 2O8LA 1V2JT 2ALVA 2GZ7A 1EAXA 5EU8A 1SGTA 1YCPK 1C1QA 4XBCA 1ELBA 5HGGA 3P92A 4X1QU 4OS4A 3RM2H 7KMEH 4J2YB 5A0AE 1ARCA 2A7CA 1BTPA 2FEQH 3T25A 1W10U 5GXPA 3BTWE 1B0EA 1C5PA 4YZUA 3SU2A 3MTYA 2PSYA 1MKWH 1EPTB 2G81E 1DE7H 3V13A 1C4Y2 4KTCA 1BRBE 1FDPA 4MNVA 3ATIA 1O2PA 2Z9IA 2RA3A 1AHTH 1LHEH 2SGAA 1UTPA 1SGFG 1RD3B 1XUHA 3BG8A 1SGYE 2ZTYA 4I8LA 4ISHH 4FUFA 5E2PA 1C1PA 1B7XB 2TGDA 3BTFE 1AGJA 1FI8A 1TNIA 1YPKH 3RC5A 3KQCA 2BD8A 1P9SA 1O30A 1GGDB 1VR1H 1EZQA 2Z3CA 3DFJA 2VH6A 3SNDA 1YKTA 1BBRH 1LPKB 1SGEE 2R3UA 4TY7A 3UIRA 1MZDA 4LZ4B 3V12A 4MNWA 1O37A 3SJOA 2JH6D 2R9PA 3AVZA 3KF2A 4NIWA 2QXHA 4NIVA 5TJXA 1QL9A 1GJ7B 2DE8A 3M35A 2Q6GA 3TNSA 2SNVA 2WYGA 1Y3XA 1MUEB 4CHAC 3MO3A 1TB6H 4DJZB 1YYY1 3S9CA 1SHHB 1W0ZU 2OC1A 1DANH 3DFLA 3RLWH 1CA0C 1EXFA 2VIQA 4IS5A 1C1VH 1C5LH 4ASHA 2HOBA 3EA9A 1GI0A 2O8TA 2Z94A 3BIVH 1ZRBA 1LHFH 4ABAA 3OYPA 1FV9A 3RDZA 2ZQ2A 1HXEH 2BZ6H 2FZZA 3JZ1B 2CF8H 1O2YA 4XBDA 2GMTB 3VGCC 3M5OA 3MU1A 1AVGH 1NM6A 1T4UH 3MI4A 2BZAA 1C5WB 5A8XA 4CREA 1H9HE 1SB1H 1M9UA 4UD9H 2OC7A 1W7GH 1THRH 3IG6B 5I25A 4VGCB 1DICA 1O35A 1MD8A 3PMHB 1GMHG 1UMAH 2G52A 1ZSLA 3LC3A 1GCTB 1EP5A 5DP3A 4Y79A 3VB7A 2RCEA 2A32A 3AW0A 3RMMH 1ESBA 1SFQB 4UDWH 5SGAE 2AIQA 5B6OA 1WAYB 3MU5A 1H1BA 2Z7FE 1C2HA 1NPMA 1OYQA 1W2KH 3P8OA 4E7NA 5A8ZA 4PROA 3P8FA 1BIOA 1HRTH 1W0YH 2WYJA 2PKAB 1QBOA 1SPJA 4ZUHA 1A3BH 4BXSA 4Y8ZA 4F4OC 1IQJA 1MU6B 1RIWB 1TBZH 2ZGXH 2OINA 3TLOA 1DM4B 1WSSH 4X8VH 3E90B 3LOXA 4ESTE 3ZVDA 2FI5E 2ZC9H 3QTVH 1GBEA 1NRPH 1TBQH 2P16A 1ANCA 1UTNA 2BVSH 3FP6E 2CJIA 1A4WH 3V0XA 2VB0A 3ZZDA 1V2MT 1ZPCA 2VIVA 1JXPA 2VVVA 2FOBA 3PV4A 1E0FD 1TGBA 1ZMJA 1DWCH 2H1UA 4CBOA 1DLEA 2WV5A 1KXAA 4X2XA 2ZECA 3RC6A 1QRWA 1BOQA 3LGTA 3SHCH 2BLOA 4H6TA 4Y7BA 4NA7A 1ORFA 3B9FH 1EPTC 3SNBA 3WY8A 5J4QA 1NFYA 4BAHB 3PYHA 1DPOA 1NRQH 4JZEH 4E7RG 4UFEH 4CH2B 3C1KA 2GT8A 5E0GA 4AOQA 5FPYA 1W11U 1LO6A 1K28D 4DOQA 1EPTA 1GBJA 1TE0A 2ZP0H 3A7TA 1SGCA 2PHBA 4TY6A 1VITH 3BG4B 2PGBB 5AHGH 3F68H 2ANYA 3LJJA 1GGDC 2FODA 1BUIA 1TWXB 3FAOA 1E36B 4HFPB 3O8CA 4NSVA 1VJAU 1TNGA 3RMNH 2FI3E 4U32A 2DUCA 5DK1A 3ATLA 1P0SH 1SL3A 1HYLA 2RG3A 1LHGH 1P10A 4X8UH 1BJUA 1O3OA 1ESAA 4Y11E 2B0FA 4CH8B 3NXPA 8GCHF 1TA6A 2TGTA 1O0DH 1O5GH 3MYWA 2BD4A 1GWAA 1A5GH 3AW1A 1F92A 1HCGA 4M7GA 2BY9X 2Y81A 2EA3A 3LPRA 2FESH 1EP6A 1QGFA 1L1NA 4XDEA 3SV8A 1LCYA 1D3TB 1D3QB 1SHYA 3GDUA 5EXLA 1A46H 1O3PB 2H9TH 4U01A 2Q1JA 3B8JA 1O2TA 1YF4A 2XC5A 1C1SA 2GMTC 2WPHS 2P3UB 1TAWA 1AUJA 3P6ZB 2ULLA 1L0ZA 2J2UA 4UEHH 1GBTA 4TYDA 1OWEA 1OKXA 1P57B 1O5EH 4OGXA 3P8NA 4NZLA 2TGPZ 4VGCC 1XX9A 9LPRA 5L2YH 4JZIA 3SNEA 1GCTC 3M3TA 2ZU1A 2FIRH 5EQSA 3SUEA 2LNCA 1FIZA 2OQUA 3SI4H 1CHOF 3GDSA 3U8TH 3SNAA 1UTJA 3QK1A 4NG9H 3NZIA 2QC2A 1DSTA 1ETTH 2AMPA 2M5TA 3NCLA 1O3MA 1H9LB 1O2HA 2ANMH 3HKJB 2VIOA 1NRSH 5EQRA 1X7AC 2ZHQH 1T4VH 2WPJS 4OS2A 4Q7XA 5EOKA 2VNTA 1GJ8B 1ZR0A 2ZDLA 3PTBA 5K7RA 2XXLA 1U6QA 1QJ7B 2ZU5A 3D62A 4RN6A 2A4OA 1AVXA 2W26A 4THNH 1RIWC 2XRCA 3MFJA 2P3FH 1FNIA 1XUIA 3E1XB 2PKAA 3BTQE 3W95A 4ZAEA 1C5QA 1C1UH 3GOVB 2G55A 2NU3E 5EW2H 2J92A 1SG8B 5A2MH 2FOCA 4GVUA 2ZU2A 3Q00A 1CSOE 3QTOH 2A7JA 1GBLA 3DUXH 1C2MA 1GBMA 1W12U 3OY6U 3ZYDA 3BTTE 1LMWB 2Y5HA 3A89A 3E8LA 1XUFA 4D8NA 2F3CE 3ZZBA 1NO9H 4JK6A 1Z6EA 4FUIA 4HI3A 2KAIA 2W7UA 3TU7H 1IQFA 1ELTA 5FAHA 1MTWA 1QRXA 1WQSA 4I31A 3FANA 3STIA 3DHKH 1HJAB 2BX3A 3OTJE 1IQKA 3FVFB 4ISNA 1NC6A 4AX9H 2ZPRA 4QT8C 5BPEA 1WU1A 2BVRH 2QCYA 1MTSA 3ATKA 2WPLS 1ETRH 2XTTB 4FU9A 3SQHE 5C1XA 3N7OA 2HPPH 4JZFH 5JBCS 4JK5A 3RU4T 1A1RA 1YCPM 4WVPE 2YNBA 3EA8A 3BG4C 2GCTB 2VVUA 1LQDB 1SFIA 2SGDE 3CENA 2PWXA 2PV9B 3U1JB 1RXPA 3ZV9A 1P01A 2GZ8A 1K2I1 2ZWLH 1G36A 2VWOA 3PO1B 1KXCA 1TNHA 1DITH 3BF6H 1AY6H 1EZUC 5E8EH 3CS0A 2ZDNA 1J17T 2A4RA 3TIUA 1UTQA 4AFUA 5DKMA 3SV9A 3SGBE 4FUHA 1KIGH 4GHTA 5LGOA 1BJVA 3BEUA 1XXFA 1MKXH 1XUGA 2F83A 1OP8A 5ESBA 1QHRB 1IHSH 1G3CA 3P70B 3SU4A 3U98H 3MO6A 4AZ2B 4B2BA 4CRDA 2J94A 1HGTH 3SU3A 1FAKH 2FP7B 1KXBA 1Z8RA 1AE8H 4H6SB 3F6UH 1KXDA 3RXTA 1BTUA 4WXVA 4AYVB 1P3EA 1ELEE 1QURH 4DCDA 5HM9A 8GCHG 1QBVH 2BQ6B 1DX5M 1WQVH 2Y80A 1KY9A 2BD7A 3SJ9A 1GHYH 5L30H 1CQQA 1P02A 3UUZA 4WF8A 4OS7A 1BB0B 5PTPA 3T2NA 3V7TA 1HIAB 1ID5H 1N1LA 5JBAS 3SU1A 1CT4E 1C1MA 2IPHA 2AMQA 1LKAA 2BOHB 1IQHA 2HNTC 1C2IA 2OLGA 1V2ST 1AI8H 2A4QA 2BQWB 2O9QA 4Y0ZE 1OWJA 1VCPA 2XBXA 3ZZAA 4CHAB 1HAIH 5F8XA 1ZHRA 1P8VC 1SC8U 3SU6A 1K21H 1AZZA 2J34A 2QN5T 3TK5A 3UWJH 1S5SA 1OP2A 2WPMS 1A0LA 1CHOG 3HGNA 3LIWA 1AWFH 4DW2U 3VXFH 1ZJKA 2UUKB 3M7QA 1EOLA 5A0CA 4DIIH 5DP6A 2BDGA 3H7TA 1EB2A 2BMGB 2ZA5A 3I78A 1B5GH 5AF9H 1CHGA 2ZHFH 2BY7X 2P95A 1MD7A 1QA7A 3M61U 1CT2E 1FN6A 2ZIQH 1LTOA 2ZCHP 2GCHF 5AFZH 3ESTA 3SV2H 5I46H 1UCYH 3SGQE 2H5CA 1XM1A 1YCPH 1MQ5A 2BM2A 5AFYH 3PROA 1UK4A 3ELAH 3CS7A 3EQ0H 1KLTA 2BY5X 4X1SU 4BANB 5AVDA 4Z6AH 3MU4A 1TX6A 3TPIZ 5C1UA 1TBRH 1D4PB 4K8YA 2HNTF 1J15A 2Z9JA 4YOGA 1H8DH 1GHXH 1O3KA 4A92A 1QNJA 3EYDA 4X8TH 4IC6A 2FYRA 1EOJA 1BDAA 1P03A 1GBFA 4BAQB 4OS5A 3KEEA 2QF0A 1ZSKA 1PQAA 5C20A 1JWTA 2OTVA 4ZKNU 1GI5A 1PPBH 1QIXB 3BTEE 1ACBE 2UWPA 3NUMA 1GHWH 2PFEA 2HRVA 1MTVA 2EI6A 4Y8YA 3RXUA 1O32A 1GHAF 1UCYK 2GGVB 3UNSA 2FMJA 1BTYA 3SQEE 1HUTH 3E0PB 1HAOH 4LOYH 1Z1JA 3RM0H 2VGCB 3PO1C 4ISOA 4MG3A 2BDHA 1HV7A 2WPKS 3GDVA 3K2UA 1C4U2 1V2UT 4FVBA 2A31A 3MNBA 3KCGH 5FPTA 3RXCA 3MNSA 5L6NH 3D23A 2FOMB 1OX1A 5DGJA 1ESTA 4ABJA 1H8IH 3RXOA 3LONA 4K1EA 1XUJA 1O2RA 4ZKOU 2ZTXA 3P17H 3BEFB 1OSSA 1ETSH 3ITIA 2XBVA 1Y5AT 1O3IA 1EX3A 4DURA 4XE4A 1HFDA 4AGJA 2C8WB 3HK6B 4MQAA 1GI3A 5FX6A 1H4WA 1FY3A 3FZDA 3VB6A 3VPKA 3PM3A 1D3DB 5F03A 1PYTD 2TRMA 1IAUA 5DP8A 5DP7A 5LH8A 1YLCA 3A80A 1O3AA 1O2VA 4DT7B 1J14A 3E0NB 1QQ4A 2I6QA 1UJ1A 3RXLA 4OGYA 4ABEA 1TQ7B 5JBTA 5JPMH 5J4SA 1GJDB 4R0IA 1ABIH 3MU8A 5CHAC 1HIAA 2G00A 4GUXA 4GLYA 1HNEE 1HJ9A 4K2YA 1ZTJA 5JYIA 1WCZA 1KLJH 2HWLB 4INLA 5JBBS 1V2VT 1K1MA 2F9BH 4AGKA 2C90B 4CR9A 1ANBA 3ZZ8A 1J8AA 5C2ZA 1NRNH 4D9RA 1SI5H 2P93A 4JYUH 1O3FA 1FJSA 1MH0A 1FAXA 1P09A 1XVMA 3A8AA 3MH7A 2G4UA 3RC4A 4ZROA 2JKHA 1O2UA 4MLFB 2RDLA 1QCPA 4AB9A 4YT6H 3MU0A 5EQQA 3ZZ7A 1EQ9A 1C5VA 3URDA 4A6LA 2TIOA 3A82A 2JH0D 1AMHA 3QWCH 4NFEA 4X0WU 1UK2A 4INKA 1P2NA 1JIMA 3HKIB 3TVJB 1O5DH 1G2LA 3PB1E 1C5NH 3BIUH 1UTOA 4RSPA 3UREA 4UE7H 1V2TT 2GCHG 2ZNKH 3TH2H 2XYAA 4D9QA 3KNXA 1DWBH 1GG6B 2H9EH 1LKBA 1P2IA 4XBBA 1C9TA 3RXFA 5EXNA 1ZSJA 3GY8A 4WMDA 1GL1A 3TNTA 1S84A 3U69H 2H5DA 3KQEA 2UWLA 3URCA 1IHTH 1ZGIA 2EC9H 2V3OH 4ISLA 5F8TA 2F9NA 2VWNA 1V2PT 4GCHF 4BOHA 1QQUA 1XKBC 6CHAB 3OSYA 1BRUP 1P04A 4I8KA 3ATWA 4Q7YA 4Q7ZA 2BDAA 2KAIB 2PKSB 2OD3B 3KQBA 1H9IE 4NZQA 2BX4A 1ABJH 1Y3UA 2C3SA 1K1JA 2PTNA 2ODQA 1ZLRA 3RXKA 2VGCC 1GJ5H 4FVDA 2FX6A 1ZJDA 1DLKB 1Y5BT 3EDXB 4JZ1A 5GCHF 4WWYA 1F0UA 1GI2A 1AD8H 3BTDE 1GHAG 1FZZA 2BYAX 3LH3A 4Z0KA 4NFFA 1C1RA 1J9CH 1O5FH 1D6WA 2GX4A 1C9PA 5CE1A 2VU8E 2QY0B 1O2JA 1VZQH 1YPGH 2B7DH 2O8MA 1DSUA 1ARBA 3PTNA 1BCUH 1UVOA 5F8ZA 1C2JA 3DA9B 1V2LT 1THSH 1HPGA 3ZZ3A 1JMOH 1SGQE 1UVUH 2NWNA 1CA8B 2BOKA 2QXGA 3TITA 3L6PA 1FY5A 4IMQA 4NIXA 1ZYOA 1O2KA 3TJVA 3EA7A 3I29A 4NCYA 7LPRA 3DT0H 2C8YB 2CMYA 1RFNA 2HALA 5C5NA 1Z8JB 1Y59T 1EATA 2FM2A 3SUFA 4YT7H 2FTLE 2XC0A 1UVTH 3A86A 2HGTH 7GCHG 2ZFFH 3UPEA 2PGQB 4TWWA 3SU5A 1ELVA 4BAKB 3TGKE 1YBWA 1K22H 2R0KA 5FCRA 1A0JA 1YPMH 1TPPA 1SQOA 2D1JA 1Y3VA 1TNJA 2A5IA 3RLYH 1P11E 4U30A 2ZGJA 2FS9A 5E0HA 4HTCH 1XKAC 2BD5A 3TJNA 4MTBA 2IOTA 2FXRA 1O5AB 3Q3YA 4ZXXH 4AG2A 2AS9A 4Y6DA 4NWKA 1C5XB 3P8GA 3T5FH 1OWIA 2UWOA 4IMZA 1F0RA 1SLWB 4I8GA 1GL0E 3UNQA 1O3JA 3O8DA 1D6RA 5FPSA 3LGYA 2OUAA 1T8NA 3U9AH 1A61H 1IQIA 1AKSA 1GMCF 1CU1A 1UVSH 4IN1A 1NU9A 3A7VA 4X1PU 1SLUB 1P12E 3PLBA 1GVZA 1YPEH 2D8WA 1UK3A 3BSQA 3RXDA 3DD2H 1DS2E 1ZHPA 3Q76A 1A0HB 2V35A 4OS6A 3LJOA 2VH0A 1A7SA 4B76A 3M5MA 3UR9A 3T26A 2UUJB 3EGKH 2TGAA 3RP2A 1C1WH 1CGHA 1NTPA 1C5UA 2Z6BD 4A5TS 4DG4A 1ELDE 2B8OH 5A09A 1K1IA 1P2OA 1G30B 1V3XA 2P94A 3V3MA 2ILNA 1O2LA 3T28A 2Y6TA 1ZTLA 1WTGH 3RUOA 1Z8IB 1GPZA 5DP4A 1TGTA 1SSXA 1L2EA 2HVXA 1SGIB 1PPGE 1GG6C 1XXDA 2QGRA 4I7YH 2XCFA 4CR5A 1MAYA 4BAOB 1TPSA 1EJNA 2VWLA 1GBAA 4X6OA 3SV6A 5IDKA 2A1DB 1S0QA 3RXSA 3UFAA 3W94A 1LVMA 3AAUA 2W7SA 1OP0A 4YM9A 6CHAC 2OBQA 2CN0H 4KELA 4X2WA 1YPHE 1EJAA 4SGBE 3ZZ6A 4RKOB 3SJ8A 4O3UA 1F5LA 1DFPA 2PKSC 3VEQB 1WTHD 4KP0A 2ZU4A 2CF9H 1EAWA 1ANDA 4O3TA 3IWMA 1BTZA 1MBQA 2WUBA 2W3KA 3ENSB 3T29A 4GCHG 2GV7A 2SGFE 1BMLA 2XWAA 1KSNA 1RJXB 5FBIA 1HDTH 2HPQH 1FY1A 1C5MD 3QUMP 3M3VA 1YLDA 3K65B 1QB6A 3ODDA 4Y10E 2BD3A 1G9IE 1ELCA 4UFGH 1V2RT 1XMNB 5HYOA 3VB4A 1MQ6A 2H2ZA 2J95A 4AFZA 2PR3A 3HATH 4D7GA 2A0QB 5GCHG 1O3NA 1GI1A 1S6HA 3UWIA 4FUEA 1N8OB 1OWDA
chains in the Genus database with same CATH superfamily
5LPEA 3ZYEA 4B2CA 3A7YA 4I8HA 5DPAA 1Y3YA 3ZZ4A 2C8ZB 1OOKB 3U8RH 3FP8E 4ZCNA 2TBSA 2ALPA 5T1VA 2GP9B 3QGJA 3LGUA 1W14U 2NU0E 2ANKH 1BTXA 3LKWA 3ODFA 1UTLM 1ZTKA 2F9VA 1TQ0B 2AIPA 3NPSA 1CBWB 1W7XH 4JMYA 3UR6A 1FIWA 2CHAC 1HAVA 2ZFQH 1ZPBA 4F48B 1GI6A 1GI8B 1OWKA 4A1XA 4K8BA 1FX0B 1O38A 2GDEH 4JCNA 3QZRA 5FCKA 1Y3WA 3GCOA 1FLEE 3SJKA 2VWMA 3UQVA 1O2QA 3TGIE 5JB8S 3ZVFA 3S9BA 4F49A 2ZI2H 2BDYA 1LPZB 1NT1A 1JRTA 1VGCC 3RXBA 1Z1IA 1QB9A 5JB9S 1DUEA 1HAYB 1P2MA 1VJ9U 8KME2 4A7IB 2GTBA 1OYTH 1HXFH 1UCYE 5EPNA 1GJCB 1LPGB 1T8OA 2R0LA 5EXMA 1ZMNA 3UNRA 1VITF 2QF5A 3OE7D 4AORA 1RGQA 1RTLA 4BAMB 3NKKA 4NSYA 1Q31A 2YMSD 1L4DA 1QRZA 2GT7A 2JH5D 2Z9LA 1F5RA 3EE0B 2BHGA 2H6MA 4LXBH 5EW1H 1SBWA 3A85A 2A2XH 4E05H 1IOEA 1GDNA 3EAJA 1CE5A 3PMJA 2GKVE 3F2GA 1PPCE 4ZXYH 1GMCG 2A4GA 3GYMA 5CHAB 4ABDA 2JDID 2WPIS 3K6ZA 3ZVGA 3NWUA 3RXVA 1BQYA 2THFB 1TPAE 1NS3A 3E3TA 5T6FA 3A83A 1F0TA 4J1YA 1JIRA 4NWLA 5LPRA 1O2NA 1LVBA 4WMEA 1S82A 1Z71A 1FONA 1BMAA 2ZU3A 3TJOA 2J4IA 1ZHMA 4CRBA 5IYTA 1GI4A 1W8BH 1TMTH 2ZDKA 3SV7A 2ZPQA 3S7HB 3O8BA 2QYIA 1O3BA 4ZKSU 1DUAA 1K0HA 1TNLA 2PSXA 3KHVA 1DWDH 1YPLH 1AFQB 2G4TA 2J38A 3RXGA 1WYKA 1SGDE 1V2KT 1PQ5A 2OXSA 1AU8A 3F1SB 3RXJA 2FOHA 4ZHLU 4WH6A 1YP9A 2BDBA 1DDJA 4XFQA 2ANWA 4R8TB 2GDDA 3LGIA 5G4BA 3S9AA 1TPOA 3SZNA 1TOMH 4LK4A 4BXWA 1FPHH 1TOCB 4FUGA 3PV5A 3SGAE 4CRGA 3MH6A 4FU8A 1BMMH 1YM0A 2FYQA 1F5KU 3UOUA 3WWFA 3SUDA 1MTNB 4TPIZ 2UUFB 1EJMA 2ZHEH 4YOJA 2I6SA 4K1SA 3ZVEA 1YGCH 4X1PU 3H5CB 1NFXA 1G3BA 1N8OC 4MPUA 1DOJA 2G5VA 1LHDH 1IQNA 2P8OB 3UTUH 2VIPA 3MNXA 3RXRA 1TONA 1GBCA 2R2WU 1V2WT 2ZO3H 3GISB 1E79D 4AB8A 1KYNA 1C5OH 2AGIX 4E06H 1O5CB 2BQ7B 4WH8A 1PJPA 1PYTC 2D26C 3T27A 3VFEA 1RRKA 1TX7A 3E16B 1DXWA 1TA2A 1TIOA 5A0BA 1QJ1B 2AFQB 4NA8A 1CBWC 1FN8A 3M5LA 3K9XB 2BTCE 3BTHE 4MNXA 2W3IA 4D7FA 2B9LA 9ESTA 5FHTA 1MMJN 1O5BB 2OC8A 1P2QA 2ZDVH 3A88A 1BRAA 2LP6A 2Y7ZA 4CBNA 1MCVA 2XWBI 3QN7A 1B0FA 2BXUH 1CGIE 4WMFA 1BRCE 1Y5UT 2WV4A 1AIXH 1KDQB 1SLXB 1HBTH 1F0SA 1NRRH 1O39A 3G01A 2XW9A 3PWBA 1GBDA 3ZZ5A 1JRSA 4DY7B 1PQ8A 7GCHF 1AO5A 1T8MA 2XNIA 2P3TB 1S0RA 2GV6A 2K1QA 2BLQA 5EJLA 3RXAA 3S0NA 3MWIU 2M2AA 1S85A 2Y5FA 4Y71A 4NGAH 2NU4E 4CRFA 4X2VA 2W5EA 4FU7A 4ZH8A 3RXIA 1BTWA 1S81A 1SGRE 5EG4A 1XUKA 4GHQA 1G3DA 4D76A 5C3NA 1A5IA 3SO3A 1VITG 1O33A 3A81A 4I32A 2AGGX 2YOLA 1DVAH 1O3HA 2SGQE 4RT1A 4A1TA 3KYGA 1E34B 5ESTE 1ZOMA 3ZZCA 1D9IA 2Z3DA 3KL6A 2BDIA 2IN2A 1GMDF 3ZZ9A 1XVOA 3A8DA 3GCHC 1FQ3A 1IQLA 1NY22 1AKSB 1EZXC 4H4FA 3ZVCA 4KTSA 1GI7B 4YO9A 1HJ8A 1L1GA 2C93B 2TPIZ 4HZHA 3LGWA 2A5AA 1MKWK 1QTFA 2STBE 1NESE 1V6DA 2FO9A 5C94A 1TGCA 3SHAH 1P3CA 2LELA 3KQDA 1YWUA 2ZF0H 3TGJE 4Y76A 4JYVH 3S7KB 1NFUA 4JZDH 3OTPA 1W13U 5T6GA 1UHBB 3GY5A 1AFQC 3GY4A 1SKYE 2ZTZA 4AFQA 1YY3A 4O97A 4MDSA 4ZHAA 1DY8A 3LH1A 5GWZA 3M37A 1FUJA 1C5TA 2PLXA 4WY3A 4SGAE 3W1EA 4TPYA 4XOJA 3M7UA 1YPJH 1TX8A 3MMGA 3OX7U 1BBRK 1T31A 1WBGB 4BNRA 2GZ9A 1EB1H 2JJ1D 5EODA 3Q3XA 1FY8E 2FOEA 4FUBA 1BMNH 2FLBH 2ZDAH 3N7DA 1MTNC 5F6MA 4ZKRU 2F9PA 1N6YA 2AH4X 5A8YA 2Q6DA 4ABHA 4BTUB 5K0HA 2AEIH 1MTUA 1O34A 1NU7B 4O03A 3D65E 4KKDA 1RTFB 3C27B 7ESTE 1O3DA 2PTCE 1AE5A 3DCLA 3GY6A 1K1LA 3QO6A 2O8WA 1C5RA 2QIQA 1EFRD 2P8OC 3GY2A 1EKBB 3SW2B 4A1VA 3RU4D 3MQKC 1QY6A 1AFEH 1T32A 1HAZB 4BTIB 3P95A 1OWHA 1UW7A 1YC0A 2FOGA 1KLIH 2KCOA 1TNKA 2SGEE 3SNCA 1C2FA 1GHVH 1K1OA 1UTKA 2BXTH 5DO4H 5EGMA 2OCVB 1ELAA 5BRRE 8LPRA 1L4ZA 2XNDD 3A8BA 1UVPA 4ZHMU 4YTAA 4YXWD 1BMFD 2FDAA 3A7ZA 1TYNA 2AMDA 3A7WA 1DT2A 1COWD 2C4FH 1O3CA 3ZVBA 1O2MA 4Y8XA 1FXYA 1FPCH 2NU2E 1NFWA 1QFKH 1WOFA 3MO9A 1DWEH 2FLRH 1BHXB 1QL7A 2BDCA 3RXHA 1GJBB 3A7XA 1GI9B 4AYYB 1Z6JH 3QZQA 2VINA 3PWCA 4CRAA 3NK8A 1HAXB 1NZQH 4B74A 3GS9A 2ZGCA 1HAVB 1P05A 4Y0YE 1TABE 3LGVA 4K5ZA 3FZZA 5L2ZH 3FO8D 4I33A 2Q6FA 2KX4A 2FWWA 4IW4E 1GHBF 1UO6A 1KDQA 3M5NA 1NN6A 3SOSA 1MBMA 3UAIC 4HGCA 3R3GB 4HG6A 2SGPE 3B23B 3U1IB 1P06A 1RS0A 4XSKU 2A7HA 2CHAB 3GCNA 4MPXA 3MH5A 3M7TA 1A2CH 1EASA 1ZZZA 1GDQA 1GVKB 4X1NU 5HXFA 2ZZUH 2ZCLP 2JETB 1GHZA 1T7CA 1QL8A 5T3HA 3D49H 4FUDA 1O2IA 3GICB 4KTUA 3UQOA 6LPRA 1E35B 5ETXA 3MH4A 2FPZA 2IPQX 2QF3A 2UUYA 4Q80A 1SMFE 4IBLH 2F4LA 1VGCB 2HNTE 4Y7AA 2WSSD 4YOIA 2FI4E 4TT3D 1O3EA 2V3HH 3BEIB 3F9FA 4K1TA 4FUJA 2SFAA 2ZDMA 3QLPH 2V7QD 1PFXC 3TK9A 1C1NA 2BB4A 4H42U 4TWYA 4GPGA 2F9UA 1THPB 2ASUB 2ZHDA 2ZQ1A 2Z9GA 3RXPA 1O2OA 2FS8A 1WUNH 2ZFPH 1GMDG 4YESB 3BV9B 5DJ7A 4DGJA 3SI3H 1LQEA 1HB0B 2STAE 1G37A 4O9VA 4ACBA 3F0OA 5C1YA 3GCTF 1K9OE 3SU0A 2HVYB 5JDUB 2BD2A 3F2FA 5T6DA 1P9UA 1KTSB 1P2JA 2ESTE 3OY5U 5FXLA 2YNAA 4B73A 1Z7KA 1DXPA 4INHA 4U2WA 2BD9A 1HLTH 1SR5C 5GIBA 5HMAA 3E91A 1Q3XA 1QB1A 2ZCKP 6GCHF 4UFFH 1G3EA 5FBEA 1TRNA 1CO7E 1PPHE 3JZ2B 1UHBA 2D2DA 4MVNA 3HPTB 1FMGA 1TGNA 4B1TA 2ODPA 4LZ1H 1OS8A 1OPHB 3FP7E 3F2HA 1QA0A 3PLKA 4OS1A 3MNCA 4NA9H 1LVYA 5DG6A 1P2KA 1T8LA 3QDZB 2VIWA 3STJA 3O8RA 2PUQH 1EAIA 2A2QH 1EUFA 1AN1E 1S6FA 3S69A 2WUCA 2QV1A 1HAPH 3A87A 1TALA 1VCWA 3BTGE 4AG1A 1C2EA 1UTMA 1V2NT 1NROH 3VXEH 1D3PB 1O3LA 2GD4B 2ZGBH 2RA0A 3MOCA 3GYLB 1O2GH 5TCCA 3RXEA 1BITA 2R2MB 1TGSZ 2OP9A 1PPZA 1SQAA 1MCTA 4ABFA 2QAAA 1SLVB 1LHCH 5DP9A 2BLVA 2QXIA 1C2KA 3AASA 3F3BA 3MHWU 4GAWA 2XC4A 3SN8A 2G8TA 1O2XA 2FTMA 1SOTA 1NBMD 3HGPA 4MPVA 1BT7A 4K60A 1BZXE 2VJ1A 1S83A 1SGFA 4YLUA 6ESTA 1Y8TA 1AQ7A 1DY9A 1ZRKA 2V6NA 1BA8B 3HK3B 2P59A 1C2LA 5HM2A 3FFGA 4YLQH 2OBOA 2BY8X 3UY9A 1VCQA 3KIDU 1AB9B 1MU8B 2G51A 1PPFE 1AZ8A 4MNYA 4B71A 4IN2A 4ZMAH 2J98B 3BTME 2NU1E 4UFDH 2YMSC 4I8JA 3TJUA 2F43B 2QE7D 1Z8GA 2QXJA 3L3TA 4UONA 5C17A 4RKJB 1C4V2 5HIYA 1TMUH 3DSGA 2XBYA 3I77A 1H8ED 3LDXH 5E2OA 2VIDA 1GJAB 1MABB 4X1RU 5GDSH 1V2OT 1INCA 1ZPZA 1SVPA 3SUGA 5H4IB 2A5KA 4JYTA 1CVWH 2JETC 2LPRA 1GJ6A 3M3SA 1W3CA 5DP5A 1KXFA 1GHBG 3ZV8A 2Z3EA 1A5HA 1PPEE 2ZFSA 3GY7A 3BN9A 1GCDA 3L33A 4GSOA 2PW8H 1IQEA 1AWHB 1MZAA 1K1NA 1TFXA 3FOAA 2QA9E 4X2YA 5E0JA 4B6FA 3LT3A 1GBBA 2Z9KA 2CGAA 3PLPA 1IQGA 3KGPA 1C2GA 2AERH 2EI7A 2XBWA 2C8XB 3TH3H 1JBUH 2ZKSA 1SOZA 1O36A 2CXVA 4K69A 1QBNA 1QR3E 5C67A 1EZSC 3F9HA 3RU4E 4WXIA 1KTTB 3QGNB 1J16A 4AFSA 4KGAA 1Q2WA 1AUTC 1BHXF 3PRDA 2ZG0H 3H7OA 1C5SA 2Y7XA 3A8CA 1F2SE 3OAAD 2DE9A 4B2AA 4ASUD 1OXGA 2ZFTA 3CP7A 4ISIH 3ZVAA 2Y82A 1SGPE 1TRMA 3F9GA 3PMAB 4ACAA 3RMLH 4FETA 5C5OA 1PQ7A 3GCTG 3GCHB 2R3YA 4B75A 3RXMA 5KECA 3R0FA 3VB3A 6GCHG 2OQ5A 1QJ6B 1MKXK 5GPIB 4AN7A 4K3JA 1WXRA 1BTHH 4FXGH 4X8SH 1E37B 1ANEA 2ZGHA 1JOUB 2A45B 3K6YA 4DT4A 4DVAU 1N6XA 4X6MA 2OC0A 3QX5H 2J9NA 2EI8A 1SQTA 1CA0B 2CV3A 3M36A 2RDEA 5GJ4B 3PMBB 3UOPA 1ELFA 2AYWA 4ABGA 5TCAA 1GMHF 2BY6X 1GBKA 4IC5A 3VB5A 4CRCA 2G5NA 1CT0E 2XCNA 1AVWA 3VGCB 3AAVA 5EPYA 3ATMA 2BLWA 3SBKA 2ZHWH 5EIYA 1GDUA 2GVFA 3RXQA 1GJ9B 3SORA 5LPFA 3KN2A 1K1PA 4MPWA 1TLDA 2WINI 4IGDA 3RMOH 2HLCA 1O2WA 2Y5GA 2F91A 4ABBA 1SGNE 8ESTE 1FY4A 1MAXA 4WJG2 1O3GA 3SJIA 1CGJE 2SNWA 1C1TA 1GBHA 1C1OA 1TRYA 5CMXH 1TMBH 1O2SA 3Q3KA 4FUCA 1LDTT 1O31A 5KEDA 1GBIA 1O2ZA 1W0KD 1G2MA 1V2QT 3A84A 1ELGA 2B5TB 5ABWA 3Q77A 1E38B 1GJ4H 1GVLA 2O8UA 2F9OA 3FKSD 1RTKA 2EEKA 3E6PH 3UB0A 2ODYB 1AB9C 3LU9B 3LC5A 2FOAA 3U8OH 1KXEA 4X6NA 4DIHH 3F9EA 1E1QD 2VVCA 3BTKE 2AGEX 1HJAC 3GY3A 2IJOB 1C5YB 3IITA 1YPHC 5FX5A 2FOFA 2KCAA 1BBRE 1LVOA 3T62A 1G32B 1ZMLA 4NIYA 3AK5A 1WV7H 1C5ZB 1EAUA 2ZFRH 2ZEBA 1HAHH 4ABIA 2BVXH 2FX4A 2H9HA 3TH4H 2J98A 3OU0A 4Q2KA 1C2DA 1HAGE 1IQMA 4BTTB 1L1JA 2V0BA 1F7ZA 3TK6A 1A3EH 1ZGVA 2GCTC 2PUXB 2ZPSA 4X6PA 2O8LA 1V2JT 2ALVA 2GZ7A 1EAXA 5EU8A 1SGTA 1YCPK 1C1QA 4XBCA 1ELBA 5HGGA 3P92A 4X1QU 4OS4A 3RM2H 7KMEH 4J2YB 5A0AE 1ARCA 2A7CA 1BTPA 2FEQH 3T25A 1W10U 5GXPA 3BTWE 1B0EA 1S6LA 1C5PA 4YZUA 3SU2A 3MTYA 2PSYA 1MKWH 1EPTB 2G81E 1DE7H 3V13A 1C4Y2 4KTCA 1BRBE 1FDPA 4MNVA 3ATIA 1O2PA 2Z9IA 2RA3A 1AHTH 1LHEH 2SGAA 1UTPA 1SGFG 1RD3B 1XUHA 3BG8A 1SGYE 2ZTYA 4I8LA 2PP6A 4ISHH 4FUFA 5E2PA 1C1PA 1B7XB 2TGDA 3BTFE 1AGJA 1FI8A 1TNIA 1YPKH 3RC5A 3KQCA 2BD8A 1P9SA 1O30A 1GGDB 1VR1H 1EZQA 2Z3CA 3DFJA 2VH6A 3SNDA 1YKTA 1BBRH 1LPKB 1NBME 1SGEE 2R3UA 4TY7A 3UIRA 1MZDA 4LZ4B 3V12A 4MNWA 1O37A 3SJOA 2JH6D 5EJZA 5EJ1A 2R9PA 3AVZA 3KF2A 4NIWA 2QXHA 4NIVA 5TJXA 1QL9A 1GJ7B 2DE8A 3M35A 2Q6GA 3TNSA 2SNVA 2WYGA 1Y3XA 1MUEB 4CHAC 3MO3A 1TB6H 4DJZB 1YYY1 3S9CA 1SHHB 1W0ZU 2OC1A 1DANH 3DFLA 3RLWH 1CA0C 1EXFA 2L6OA 2VIQA 4IS5A 1C1VH 1C5LH 4ASHA 2HOBA 3EA9A 1GI0A 2O8TA 2Z94A 3BIVH 1ZRBA 1LHFH 4ABAA 3OYPA 1FV9A 3RDZA 2ZQ2A 1HXEH 2BZ6H 2FZZA 3JZ1B 2CF8H 1O2YA 4XBDA 5KGOA 2GMTB 3VGCC 3M5OA 3MU1A 3VG8A 1AVGH 1NM6A 1T4UH 3MI4A 2BZAA 1C5WB 5A8XA 4CREA 1H9HE 1SB1H 1M9UA 4UD9H 2OC7A 1W7GH 1THRH 4Q63A 3IG6B 5I25A 4VGCB 1DICA 1O35A 1MD8A 3PMHB 1GMHG 1UMAH 2G52A 1ZSLA 3LC3A 1GCTB 1EP5A 5DP3A 4Y79A 2WV9A 3VB7A 2RCEA 2A32A 3AW0A 3RMMH 5DN6D 1ESBA 1SFQB 4UDWH 5SGAE 2AIQA 5B6OA 1WAYB 3MU5A 1H1BA 2Z7FE 1C2HA 1NPMA 1OYQA 1W2KH 3P8OA 4E7NA 5A8ZA 4PROA 3P8FA 1BIOA 1HRTH 1W0YH 2WYJA 2PKAB 1QBOA 1SPJA 2AHME 4ZUHA 1A3BH 4RI0A 4RT0A 4BXSA 2KCYA 4Y8ZA 4F4OC 1IQJA 1MU6B 1RIWB 1TBZH 2ZGXH 2OINA 3FN8A 3TLOA 1DM4B 1WSSH 4X8VH 3E90B 3LOXA 4ESTE 3ZVDA 2FI5E 2ZC9H 3QTVH 3OEHD 1GBEA 4Q4LA 1NRPH 1TBQH 5GNDA 2P16A 1ANCA 1UTNA 2BVSH 3FP6E 2CJIA 1A4WH 3V0XA 1YLNA 2VB0A 3ZZDA 1V2MT 1ZPCA 2VIVA 1JXPA 2VVVA 2FOBA 3PV4A 4P02A 1E0FD 1TGBA 5C0TA 1ZMJA 1DWCH 2H1UA 4CBOA 1DLEA 2WV5A 1KXAA 4X2XA 2ZECA 3RC6A 1QRWA 1BOQA 3LGTA 3SHCH 3WW7A 2BLOA 4H6TA 4Y7BA 4NA7A 1ORFA 3B9FH 1EPTC 3SNBA 3WY8A 2YMSB 5J4QA 3F0PA 1NFYA 4BAHB 3PYHA 1DPOA 1NRQH 4JZEH 4E7RG 2W6ID 4UFEH 4CH2B 3C1KA 2GT8A 5E0GA 4AOQA 5FPYA 1W11U 1LO6A 1K28D 4DOQA 1EPTA 1GBJA 1TE0A 2ZP0H 3A7TA 1SGCA 2PHBA 4TY6A 1VITH 3BG4B 2PGBB 5AHGH 3F68H 2L74A 2ANYA 3LJJA 1GGDC 2FODA 1BUIA 1TWXB 3FAOA 1E36B 4HFPB 3O8CA 4NSVA 1VJAU 1TNGA 3RMNH 2FI3E 2EQNA 4U32A 2DUCA 5DK1A 3ATLA 1P0SH 1SL3A 1HYLA 2RG3A 1LHGH 1P10A 4X8UH 1BJUA 1O3OA 1ESAA 4Y11E 2B0FA 4CH8B 3NXPA 8GCHF 1TA6A 2TGTA 1O0DH 1O5GH 3MYWA 2BD4A 1GWAA 1A5GH 3AW1A 1F92A 1HCGA 4M7GA 2BY9X 2Y81A 2EA3A 3LPRA 2FESH 1EP6A 1QGFA 1L1NA 4XDEA 3SV8A 1LCYA 1D3TB 1D3QB 1SHYA 3GDUA 5EXLA 1A46H 1O3PB 2H9TH 4U01A 2Q1JA 3B8JA 5HIZA 1O2TA 1YF4A 2XC5A 5C0UA 1C1SA 2GMTC 2WPHS 2P3UB 1TAWA 1AUJA 3P6ZB 2ULLA 1L0ZA 2J2UA 4UEHH 1GBTA 4TYDA 1OWEA 1OKXA 1P57B 1O5EH 4OGXA 3P8NA 4NZLA 2TGPZ 4VGCC 1XX9A 9LPRA 5L2YH 4JZIA 3SNEA 1GCTC 3M3TA 2ZU1A 2FIRH 5EQSA 2J97A 3SUEA 2LNCA 1FIZA 2OQUA 3SI4H 1CHOF 3GDSA 1W0JD 3U8TH 3SNAA 1UTJA 3QK1A 4NG9H 3NZIA 2QF4A 3CNRA 2QC2A 1DSTA 1ETTH 2AMPA 2M5TA 3NCLA 1O3MA 1H9LB 1O2HA 2ANMH 3HKJB 2VIOA 1NRSH 4M9FA 1X7AC 2ZHQH 1T4VH 5EQRA 2WPJS 4OS2A 4Q7XA 5EOKA 2VNTA 1GJ8B 1ZR0A 2ZDLA 3PTBA 5K7RA 2XXLA 1U6QA 1QJ7B 2ZU5A 2JIZD 3D62A 4RN6A 2A4OA 1AVXA 2W26A 4THNH 1RIWC 2XRCA 3MFJA 2P3FH 3NRLA 1FNIA 1XUIA 3E1XB 4B6EA 2PKAA 3BTQE 3W95A 4ZAEA 1C5QA 1C1UH 3GOVB 2G55A 2NU3E 5EW2H 2XOKD 2J92A 1SG8B 5A2MH 2FOCA 4GVUA 2ZU2A 3Q00A 2VBCA 2WPDD 1CSOE 3QTOH 2A7JA 1GBLA 3DUXH 1C2MA 1GBMA 1W12U 3OY6U 3ZYDA 3BTTE 1LMWB 2Y5HA 3A89A 3E8LA 1XUFA 4D8NA 2F3CE 3ZZBA 1NO9H 4JK6A 1Z6EA 4FUIA 4HI3A 5F53A 2KAIA 2W7UA 3TU7H 1IQFA 1ELTA 3H09A 2K0QA 5FAHA 1MTWA 1QRXA 1WQSA 4I31A 3FANA 3STIA 3DHKH 1HJAB 2KCPA 2BX3A 3OTJE 1IQKA 3FVFB 4ISNA 4TSFD 4I86A 1NC6A 4AX9H 2ZPRA 4QT8C 5BPEA 1WU1A 2BVRH 2QCYA 1MTSA 3ATKA 2WPLS 1ETRH 2XTTB 4FU9A 3SQHE 5C1XA 3N7OA 2HPPH 4JZFH 5JBCS 4JK5A 3RU4T 1A1RA 1YCPM 4WVPE 2YNBA 3EA8A 3BG4C 2GCTB 2VVUA 1LQDB 1SFIA 5DSFA 2SGDE 3CENA 2PWXA 2PV9B 3U1JB 1RXPA 3ZV9A 1P01A 4Z1MD 2GZ8A 1K2I1 2ZWLH 1G36A 2VWOA 3PO1B 1KXCA 1TNHA 1DITH 3BF6H 1AY6H 1EZUC 5E8EH 3CS0A 2ZDNA 1J17T 2A4RA 3TIUA 1UTQA 4AFUA 5DKMA 3SV9A 3SGBE 4FUHA 1KIGH 2EY4C 4GHTA 5LGOA 1BJVA 3N99A 3BEUA 1XXFA 1MKXH 1XUGA 2F83A 1OP8A 5ESBA 1QHRB 1IHSH 1G3CA 3P70B 3SU4A 3U98H 3MO6A 4AZ2B 4B2BA 4CRDA 2J94A 1HGTH 3SU3A 1FAKH 2FP7B 1KXBA 1Z8RA 1AE8H 4H6SB 3F6UH 1KXDA 5FL7D 3RXTA 1BTUA 4WXVA 4AYVB 1P3EA 1ELEE 1QURH 4P00A 4DCDA 5HM9A 8GCHG 1QBVH 2BQ6B 1DX5M 1WQVH 2Y80A 1KY9A 2BD7A 3SJ9A 1GHYH 5L30H 1CQQA 1P02A 3UUZA 4WF8A 4OS7A 1BB0B 5PTPA 3T2NA 3V7TA 1HIAB 1ID5H 1N1LA 5JBAS 3SU1A 1CT4E 1C1MA 2IPHA 2AMQA 1LKAA 2BOHB 1IQHA 2HNTC 1C2IA 2OLGA 1V2ST 1AI8H 2A4QA 2BQWB 2O9QA 4Y0ZE 1OWJA 1VCPA 2CK3D 2XBXA 1QZ8A 3ZZAA 4CHAB 1HAIH 5F8XA 1ZHRA 1P8VC 1SC8U 3SU6A 1K21H 1AZZA 2J34A 2QN5T 3TK5A 3UWJH 1S5SA 1OP2A 2WPMS 1A0LA 1CHOG 3HGNA 3LIWA 1AWFH 4DW2U 3VXFH 1ZJKA 2UUKB 3M7QA 1EOLA 5A0CA 2K8IA 5DP6A 4DIIH 2KZ4A 2BDGA 3PRBA 3H7TA 1EB2A 2BMGB 2ZA5A 4XRNA 3I78A 1B5GH 5AF9H 1CHGA 2ZHFH 2BY7X 2P95A 1MD7A 1QA7A 3M61U 1CT2E 1FN6A 1VKYA 2ZIQH 1LTOA 2ZCHP 2GCHF 5AFZH 3ESTA 3SV2H 5I46H 1UCYH 3SGQE 2H5CA 1XM1A 1YCPH 1MQ5A 2BM2A 5AFYH 3PROA 1UK4A 3ELAH 3CS7A 3EQ0H 1KLTA 2BY5X 4X1SU 4BANB 5AVDA 4Z6AH 3MU4A 1TX6A 3TPIZ 2KR7A 1TBRH 5C1UA 1D4PB 4K8YA 2HNTF 1J15A 2Z9JA 4YOGA 1H8DH 1GHXH 1O3KA 4A92A 1QNJA 3EYDA 4X8TH 4IC6A 2FYRA 2WZQA 1EOJA 1BDAA 1P03A 1GBFA 4BAQB 4OS5A 3KEEA 2QF0A 1ZSKA 1PQAA 5C20A 1JWTA 2OTVA 4ZKNU 1GI5A 1PPBH 1QIXB 3BTEE 1ACBE 2UWPA 3NUMA 1GHWH 2PFEA 2HRVA 1MTVA 2EI6A 4Y8YA 3RXUA 1O32A 1GHAF 1UCYK 2GGVB 3UNSA 2FMJA 1BTYA 3SQEE 1HUTH 3E0PB 1HAOH 4LOYH 1Z1JA 3RM0H 2VGCB 3PO1C 4ISOA 4MG3A 2BDHA 1HV7A 2WPKS 3GDVA 3K2UA 1C4U2 1V2UT 4FVBA 2A31A 3MNBA 5CDFE 3KCGH 5FPTA 5B6LA 3RXCA 2GJGA 3MNSA 2OK5A 5L6NH 3D23A 2FOMB 1OX1A 5DGJA 1ESTA 4ABJA 4AC9A 1H8IH 3RXOA 3LONA 4K1EA 1XUJA 1O2RA 4ZKOU 2ZTXA 3P17H 3BEFB 1OSSA 2JJ2D 1ETSH 3ITIA 2XBVA 1Y5AT 3KYFA 1O3IA 1EX3A 1KMHB 2RFKC 4DURA 4XE4A 1HFDA 3U28C 4AGJA 2C8WB 3HK6B 4MQAA 1GI3A 5FX6A 1H4WA 1FY3A 3FZDA 3VB6A 3VPKA 3PM3A 1D3DB 5F03A 1PYTD 2TRMA 1IAUA 5DP8A 5DP7A 5LH8A 1E1RD 1YLCA 3A80A 1H8HD 1O3AA 1O2VA 4DT7B 1J14A 3E0NB 1QQ4A 2I6QA 1UJ1A 3RXLA 3OEED 4OGYA 1TQ7B 4ABEA 5JBTA 5JPMH 5J4SA 1GJDB 4R0IA 1ABIH 3MU8A 5CHAC 1HIAA 2G00A 2WHXA 4GUXA 4GLYA 1HNEE 1HJ9A 2KFWA 4K2YA 1ZTJA 5JYIA 1WCZA 1KLJH 2HWLB 4INLA 5JBBS 1V2VT 1K1MA 2F9BH 4AGKA 2C90B 4CR9A 1ANBA 3ZZ8A 1J8AA 5C2ZA 1NRNH 4D9RA 1SI5H 2P93A 4JYUH 1O3FA 2IJD1 1FJSA 1MH0A 1FAXA 1P09A 1XVMA 3A8AA 3MH7A 2G4UA 3RC4A 4ZROA 2JKHA 1O2UA 4MLFB 2RDLA 1QCPA 4AB9A 4YT6H 3MU0A 5EQQA 3ZZ7A 1EQ9A 1C5VA 3URDA 4A6LA 2TIOA 3A82A 2JH0D 1AMHA 3QWCH 4NFEA 4X0WU 1UK2A 4INKA 3WWBA 1P2NA 1WDIA 1JIMA 3HKIB 3TVJB 1O5DH 1G2LA 3PB1E 1C5NH 3BIUH 1UTOA 4RSPA 3UREA 4UE7H 1V2TT 2GCHG 2ZNKH 3TH2H 2XYAA 4D9QA 3KNXA 1DWBH 1GG6B 2H9EH 1LKBA 1P2IA 4XBBA 1C9TA 3RXFA 3SZEA 5EXNA 1ZSJA 3GY8A 4WMDA 1GL1A 3TNTA 1S84A 3U69H 2H5DA 3KQEA 2UWLA 3KQ5A 3URCA 1IHTH 1ZGIA 2EC9H 2V3OH 4ISLA 5F8TA 2F9NA 5HKKD 2VWNA 1V2PT 4GCHF 4BOHA 1QQUA 1XKBC 6CHAB 1SQRA 3OSYA 1BRUP 1P04A 4I8KA 3ATWA 4Q7YA 4Q7ZA 2BDAA 2KAIB 2PKSB 2OD3B 3KQBA 1H9IE 4NZQA 2BX4A 1ABJH 1Y3UA 2C3SA 1K1JA 2PTNA 4F55A 2ODQA 1ZLRA 3RXKA 2VGCC 1GJ5H 4FVDA 2FX6A 1ZJDA 1DLKB 1Y5BT 3EDXB 4JZ1A 5GCHF 4WWYA 1F0UA 1GI2A 1AD8H 3BTDE 1GHAG 1FZZA 2BYAX 3LH3A 4Z0KA 4NFFA 1C1RA 1J9CH 1O5FH 1D6WA 2GX4A 1C9PA 5CE1A 5IK2D 2VU8E 4FOUC 2QY0B 1O2JA 1VZQH 1YPGH 2B7DH 2O8MA 1DSUA 3OFND 1ARBA 3PTNA 1BCUH 1UVOA 5F8ZA 1C2JA 3DA9B 1V2LT 1THSH 1HPGA 3ZZ3A 1JMOH 1SGQE 1UVUH 2NWNA 1CA8B 2BOKA 2QXGA 3TITA 3L6PA 1FY5A 4IMQA 4NIXA 1ZYOA 1O2KA 3TJVA 3EA7A 3I29A 4NCYA 7LPRA 3DT0H 2C8YB 2CMYA 1RFNA 2HALA 5C5NA 1Z8JB 1Y59T 1EATA 2FM2A 3SUFA 4YT7H 2FTLE 2XC0A 1UVTH 3A86A 2HGTH 7GCHG 3EE7A 2ZFFH 3UPEA 2PGQB 4TWWA 3SU5A 1ELVA 4BAKB 3TGKE 1YBWA 1K22H 2R0KA 5FCRA 1A0JA 1YPMH 3SYJA 1TPPA 1SQOA 2D1JA 1Y3VA 1TNJA 2A5IA 3RLYH 1P11E 4U30A 2ZGJA 2FS9A 5E0HA 4HTCH 1XKAC 2BD5A 3TJNA 4MTBA 2IOTA 2FXRA 1O5AB 5CHBA 3Q3YA 4ZXXH 4AG2A 2AS9A 2KM0A 4NWKA 1C5XB 3P8GA 4Y6DA 3T5FH 1OWIA 2UWOA 4IMZA 1F0RA 1SLWB 4I8GA 1GL0E 3UNQA 4OM9A 1O3JA 3O8DA 1D6RA 5FPSA 3LGYA 2OUAA 2HLDD 1T8NA 3U9AH 1A61H 1IQIA 1AKSA 1GMCF 1CU1A 1UVSH 3PV2A 1NU9A 3A7VA 4IN1A 1SLUB 1P12E 3PLBA 1GVZA 1YPEH 2D8WA 1UK3A 3BSQA 3RXDA 2W6JD 3DD2H 1DS2E 1ZHPA 3Q76A 1A0HB 2V35A 4OS6A 3LJOA 2VH0A 1A7SA 4B76A 3M5MA 3UR9A 3T26A 2UUJB 3EGKH 2TGAA 3RP2A 1C1WH 1CGHA 1NTPA 1C5UA 3DSPA 2Z6BD 4A5TS 4DG4A 3N7EA 1ELDE 2B8OH 5A09A 1K1IA 1P2OA 1G30B 1V3XA 2P94A 3V3MA 2ILNA 1O2LA 3T28A 2Y6TA 1ZTLA 1WTGH 3RUOA 1Z8IB 3ZIAD 1GPZA 5DP4A 1TGTA 1SSXA 1L2EA 2HVXA 1SGIB 1PPGE 1GG6C 2J5UA 1XXDA 2QGRA 4I7YH 2XCFA 4CR5A 1MAYA 4BAOB 1TPSA 1EJNA 2VWLA 1GBAA 4X6OA 3SV6A 5IDKA 2A1DB 1S0QA 3RXSA 3UFAA 3W94A 1LVMA 3AAUA 2W7SA 1OP0A 4YM9A 6CHAC 2OBQA 2CN0H 4KELA 4X2WA 1YPHE 1EJAA 4SGBE 4XD7D 3ZZ6A 4RKOB 3SJ8A 4O3UA 1F5LA 1DFPA 2PKSC 3VEQB 1WTHD 4KP0A 2ZU4A 2CF9H 1EAWA 1ANDA 4O3TA 3IWMA 1BTZA 1MBQA 2WUBA 2W3KA 3ENSB 3T29A 4GCHG 2GV7A 2SGFE 1BMLA 2XWAA 1KSNA 1RJXB 5FBIA 1OHHD 1HDTH 2HPQH 1FY1A 1C5MD 3DSOA 3QUMP 3M3VA 1YLDA 3K65B 1QB6A 3ODDA 4Y10E 2BD3A 1G9IE 1ELCA 4UFGH 1V2RT 1XMNB 5HYOA 3VB4A 1MQ6A 2H2ZA 2J95A 4AFZA 2PR3A 3HATH 4D7GA 2V3MA 2A0QB 5GCHG 1O3NA 1GI1A 1S6HA 3UWIA 4FUEA 1N8OB 1OWDA
chains in the Genus database with same CATH topology
5LPEA 3ZYEA 4B2CA 3A7YA 4I8HA 5DPAA 1Y3YA 3ZZ4A 2C8ZB 1OOKB 3U8RH 3FP8E 2TBSA 2ALPA 2GP9B 3QGJA 3LGUA 1W14U 2NU0E 2ANKH 1BTXA 3LKWA 3ODFA 1UTLM 1ZTKA 2F9VA 1TQ0B 2AIPA 3NPSA 1CBWB 1W7XH 4JMYA 3UR6A 1FIWA 2CHAC 1HAVA 2ZFQH 1ZPBA 1GI6A 1GI8B 1OWKA 4A1XA 4K8BA 1O38A 2GDEH 4JCNA 3QZRA 5FCKA 1Y3WA 3GCOA 1FLEE 3SJKA 2VWMA 3UQVA 1O2QA 3TGIE 5JB8S 3ZVFA 3S9BA 4F49A 2ZI2H 2BDYA 1LPZB 1NT1A 1JRTA 1VGCC 3RXBA 1Z1IA 1QB9A 5JB9S 1DUEA 1HAYB 1P2MA 1VJ9U 8KME2 4A7IB 2GTBA 1OYTH 1HXFH 1UCYE 5EPNA 1GJCB 1LPGB 1T8OA 2R0LA 5EXMA 1ZMNA 3UNRA 1VITF 4AORA 1RGQA 1RTLA 4BAMB 3NKKA 4NSYA 1Q31A 1L4DA 1QRZA 2GT7A 2JH5D 2Z9LA 1F5RA 3EE0B 2BHGA 2H6MA 4LXBH 5EW1H 1SBWA 3A85A 2A2XH 4E05H 1IOEA 1GDNA 3EAJA 1CE5A 3PMJA 2GKVE 1PPCE 4ZXYH 1GMCG 2A4GA 3GYMA 5CHAB 4ABDA 2WPIS 3K6ZA 3ZVGA 3NWUA 3RXVA 1BQYA 2THFB 1TPAE 1NS3A 3E3TA 5T6FA 3A83A 1F0TA 4J1YA 1JIRA 4NWLA 5LPRA 1O2NA 1LVBA 4WMEA 1S82A 1Z71A 1FONA 1BMAA 2ZU3A 3TJOA 2J4IA 1ZHMA 4CRBA 5IYTA 1GI4A 1W8BH 1TMTH 2ZDKA 3SV7A 2ZPQA 3S7HB 3O8BA 2QYIA 1O3BA 4ZKSU 1DUAA 1TNLA 2PSXA 3KHVA 1DWDH 1YPLH 1AFQB 2G4TA 2J38A 3RXGA 1WYKA 1SGDE 1V2KT 1PQ5A 2OXSA 1AU8A 3F1SB 3RXJA 2FOHA 4ZHLU 4WH6A 1YP9A 2BDBA 1DDJA 4XFQA 2ANWA 4R8TB 2GDDA 3LGIA 5G4BA 3S9AA 1TPOA 3SZNA 1TOMH 4LK4A 4BXWA 1FPHH 1TOCB 4FUGA 3SGAE 4CRGA 3MH6A 4FU8A 1BMMH 1YM0A 2FYQA 1F5KU 3UOUA 3SUDA 1MTNB 4TPIZ 2UUFB 1EJMA 2ZHEH 4YOJA 2I6SA 4K1SA 3ZVEA 1YGCH 3H5CB 1NFXA 1G3BA 1N8OC 4MPUA 1DOJA 2G5VA 1LHDH 1IQNA 2P8OB 3UTUH 2VIPA 3MNXA 3RXRA 1TONA 1GBCA 2R2WU 1V2WT 2ZO3H 3GISB 4AB8A 1KYNA 1C5OH 2AGIX 4E06H 1O5CB 2BQ7B 4WH8A 1PJPA 1PYTC 2D26C 3T27A 3VFEA 1RRKA 1TX7A 3E16B 1DXWA 1TA2A 1TIOA 5A0BA 1QJ1B 2AFQB 4NA8A 1CBWC 1FN8A 3M5LA 3K9XB 2BTCE 3BTHE 4MNXA 2W3IA 4D7FA 2B9LA 9ESTA 5FHTA 1MMJN 1O5BB 2OC8A 1P2QA 2ZDVH 3A88A 1BRAA 2Y7ZA 4CBNA 1MCVA 2XWBI 3QN7A 1B0FA 2BXUH 1CGIE 4WMFA 1BRCE 1Y5UT 2WV4A 1AIXH 1KDQB 1SLXB 1HBTH 1F0SA 1NRRH 1O39A 3G01A 2XW9A 3PWBA 1GBDA 3ZZ5A 1JRSA 4DY7B 1PQ8A 7GCHF 1AO5A 1T8MA 2XNIA 2P3TB 1S0RA 2GV6A 2K1QA 2BLQA 3RXAA 3S0NA 3MWIU 1S85A 2Y5FA 4Y71A 4NGAH 2NU4E 4CRFA 4X2VA 2W5EA 4FU7A 4ZH8A 3RXIA 1BTWA 1S81A 1SGRE 5EG4A 1XUKA 4GHQA 1G3DA 4D76A 5C3NA 1A5IA 3SO3A 1VITG 1O33A 3A81A 4I32A 2AGGX 2YOLA 1DVAH 1O3HA 2SGQE 4A1TA 1E34B 5ESTE 1ZOMA 3ZZCA 1D9IA 2Z3DA 3KL6A 2BDIA 2IN2A 1GMDF 3ZZ9A 1XVOA 3A8DA 3GCHC 1FQ3A 1IQLA 1NY22 1AKSB 1EZXC 4H4FA 3ZVCA 4KTSA 1GI7B 4YO9A 1HJ8A 1L1GA 2C93B 2TPIZ 4HZHA 3LGWA 2A5AA 1MKWK 1QTFA 2STBE 1NESE 1V6DA 2FO9A 1TGCA 3SHAH 1P3CA 3KQDA 2ZF0H 3TGJE 4Y76A 4JYVH 3S7KB 1NFUA 4JZDH 1W13U 5T6GA 1UHBB 3GY5A 1AFQC 3GY4A 2ZTZA 4AFQA 4O97A 4MDSA 4ZHAA 1DY8A 3LH1A 5GWZA 3M37A 1FUJA 1C5TA 2PLXA 4WY3A 4SGAE 4TPYA 4XOJA 3M7UA 1YPJH 1TX8A 3MMGA 3OX7U 1BBRK 1T31A 1WBGB 4BNRA 2GZ9A 1EB1H 5EODA 3Q3XA 1FY8E 2FOEA 4FUBA 1BMNH 2FLBH 2ZDAH 1MTNC 5F6MA 4ZKRU 2F9PA 1N6YA 2AH4X 5A8YA 2Q6DA 4ABHA 4BTUB 5K0HA 2AEIH 1MTUA 1O34A 1NU7B 4O03A 3D65E 4KKDA 1RTFB 3C27B 7ESTE 1O3DA 2PTCE 1AE5A 3GY6A 1K1LA 3QO6A 2O8WA 1C5RA 2QIQA 2P8OC 3GY2A 1EKBB 3SW2B 4A1VA 3RU4D 1QY6A 1AFEH 1T32A 1HAZB 4BTIB 3P95A 1OWHA 1YC0A 2FOGA 1KLIH 1TNKA 2SGEE 3SNCA 1C2FA 1GHVH 1K1OA 1UTKA 2BXTH 5DO4H 5EGMA 2OCVB 1ELAA 5BRRE 8LPRA 1L4ZA 3A8BA 1UVPA 4ZHMU 4YTAA 2FDAA 3A7ZA 1TYNA 2AMDA 3A7WA 1DT2A 2C4FH 1O3CA 3ZVBA 1O2MA 4Y8XA 1FXYA 1FPCH 2NU2E 1NFWA 1QFKH 1WOFA 3MO9A 1DWEH 2FLRH 1BHXB 1QL7A 2BDCA 3RXHA 1GJBB 3A7XA 1GI9B 4AYYB 1Z6JH 3QZQA 2VINA 3PWCA 4CRAA 3NK8A 1HAXB 1NZQH 4B74A 2ZGCA 1HAVB 1P05A 4Y0YE 1TABE 3LGVA 4K5ZA 3FZZA 5L2ZH 4I33A 2Q6FA 2FWWA 4IW4E 1GHBF 1UO6A 1KDQA 3M5NA 1NN6A 3SOSA 1MBMA 4HGCA 3R3GB 2SGPE 3B23B 3U1IB 1P06A 1RS0A 4XSKU 2A7HA 2CHAB 3GCNA 4MPXA 3MH5A 3M7TA 1A2CH 1EASA 1ZZZA 1GDQA 1GVKB 4X1NU 5HXFA 2ZZUH 2ZCLP 2JETB 1GHZA 1T7CA 1QL8A 5T3HA 3D49H 4FUDA 1O2IA 3GICB 4KTUA 3UQOA 6LPRA 1E35B 5ETXA 3MH4A 2FPZA 2QF3A 2UUYA 4Q80A 1SMFE 4IBLH 1VGCB 2HNTE 4Y7AA 4YOIA 2FI4E 1O3EA 2V3HH 3BEIB 3F9FA 4K1TA 4FUJA 2SFAA 2ZDMA 3QLPH 1PFXC 3TK9A 1C1NA 2BB4A 4H42U 4TWYA 4GPGA 2F9UA 1THPB 2ASUB 2ZHDA 2ZQ1A 2Z9GA 3RXPA 1O2OA 2FS8A 1WUNH 2ZFPH 1GMDG 4YESB 3BV9B 5DJ7A 4DGJA 3SI3H 1LQEA 1HB0B 2STAE 1G37A 4O9VA 5C1YA 3GCTF 1K9OE 3SU0A 5JDUB 2BD2A 5T6DA 1P9UA 1KTSB 1P2JA 2ESTE 3OY5U 5FXLA 2YNAA 4B73A 1Z7KA 1DXPA 4INHA 4U2WA 2BD9A 1HLTH 1SR5C 5GIBA 5HMAA 3E91A 1Q3XA 1QB1A 2ZCKP 6GCHF 4UFFH 1G3EA 5FBEA 1TRNA 1CO7E 1PPHE 3JZ2B 1UHBA 2D2DA 4MVNA 3HPTB 1FMGA 1TGNA 4B1TA 2ODPA 4LZ1H 1OS8A 1OPHB 3FP7E 1QA0A 3PLKA 4OS1A 3MNCA 4NA9H 1LVYA 5DG6A 1P2KA 1T8LA 3QDZB 2VIWA 3STJA 3O8RA 2PUQH 1EAIA 2A2QH 1EUFA 1AN1E 1S6FA 3S69A 2WUCA 2QV1A 1HAPH 3A87A 1TALA 1VCWA 3BTGE 4AG1A 1C2EA 1UTMA 1V2NT 1NROH 3VXEH 1D3PB 1O3LA 2GD4B 2ZGBH 2RA0A 3MOCA 3GYLB 1O2GH 5TCCA 3RXEA 1BITA 2R2MB 1TGSZ 2OP9A 1PPZA 1SQAA 1MCTA 4ABFA 2QAAA 1SLVB 1LHCH 5DP9A 2BLVA 2QXIA 1C2KA 3AASA 3MHWU 4GAWA 2XC4A 3SN8A 2G8TA 1O2XA 2FTMA 1SOTA 3HGPA 4MPVA 1BT7A 4K60A 1BZXE 2VJ1A 1S83A 1SGFA 4YLUA 6ESTA 1Y8TA 1AQ7A 1DY9A 1ZRKA 2V6NA 1BA8B 3HK3B 2P59A 1C2LA 5HM2A 3FFGA 4YLQH 2OBOA 2BY8X 3UY9A 1VCQA 3KIDU 1AB9B 1MU8B 2G51A 1PPFE 1AZ8A 4MNYA 4B71A 4IN2A 4ZMAH 3BTME 2NU1E 4UFDH 4I8JA 3TJUA 1Z8GA 2QXJA 3L3TA 4UONA 4RKJB 1C4V2 1TMUH 2XBYA 3I77A 3LDXH 5E2OA 2VIDA 1GJAB 4X1RU 5GDSH 1V2OT 1INCA 1ZPZA 1SVPA 3SUGA 5H4IB 2A5KA 4JYTA 1CVWH 2JETC 2LPRA 1GJ6A 3M3SA 1W3CA 5DP5A 1KXFA 1GHBG 3ZV8A 2Z3EA 1A5HA 1PPEE 2ZFSA 3GY7A 3BN9A 1GCDA 3L33A 4GSOA 2PW8H 1IQEA 1AWHB 1MZAA 1K1NA 1TFXA 4X2YA 2QA9E 5E0JA 3LT3A 1GBBA 2Z9KA 2CGAA 3PLPA 1IQGA 3KGPA 1C2GA 2AERH 2EI7A 2XBWA 2C8XB 3TH3H 1JBUH 2ZKSA 1SOZA 1O36A 2CXVA 4K69A 1QBNA 1QR3E 5C67A 1EZSC 3F9HA 3RU4E 4WXIA 1KTTB 3QGNB 1J16A 4AFSA 4KGAA 1Q2WA 1AUTC 1BHXF 2ZG0H 3H7OA 1C5SA 2Y7XA 3A8CA 1F2SE 2DE9A 4B2AA 1OXGA 2ZFTA 3CP7A 4ISIH 3ZVAA 2Y82A 1SGPE 1TRMA 3F9GA 3PMAB 3RMLH 5C5OA 1PQ7A 3GCTG 3GCHB 2R3YA 4B75A 3RXMA 3R0FA 3VB3A 6GCHG 2OQ5A 1QJ6B 1MKXK 5GPIB 4AN7A 4K3JA 1BTHH 4FXGH 4X8SH 1E37B 1ANEA 2ZGHA 1JOUB 2A45B 3K6YA 4DVAU 1N6XA 4X6MA 2OC0A 3QX5H 2J9NA 2EI8A 1SQTA 1CA0B 2CV3A 3M36A 5GJ4B 3PMBB 3UOPA 1ELFA 2AYWA 4ABGA 5TCAA 1GMHF 2BY6X 1GBKA 4IC5A 3VB5A 4CRCA 2G5NA 1CT0E 2XCNA 1AVWA 3VGCB 3AAVA 5EPYA 3ATMA 2BLWA 3SBKA 2ZHWH 1GDUA 2GVFA 3RXQA 1GJ9B 3SORA 5LPFA 3KN2A 1K1PA 4MPWA 1TLDA 2WINI 4IGDA 3RMOH 2HLCA 1O2WA 2Y5GA 2F91A 4ABBA 1SGNE 8ESTE 1FY4A 1MAXA 4WJG2 1O3GA 3SJIA 1CGJE 2SNWA 1C1TA 1GBHA 1C1OA 1TRYA 5CMXH 1TMBH 1O2SA 3Q3KA 4FUCA 1LDTT 1O31A 1GBIA 1O2ZA 1G2MA 1V2QT 3A84A 1ELGA 2B5TB 5ABWA 3Q77A 1E38B 1GJ4H 1GVLA 2O8UA 2F9OA 1RTKA 2EEKA 3E6PH 2ODYB 1AB9C 3LU9B 3LC5A 2FOAA 3U8OH 1KXEA 4X6NA 4DIHH 3F9EA 2VVCA 3BTKE 2AGEX 1HJAC 3GY3A 2IJOB 1C5YB 3IITA 1YPHC 5FX5A 2FOFA 1BBRE 1LVOA 3T62A 1G32B 1ZMLA 4NIYA 1WV7H 1C5ZB 1EAUA 2ZFRH 2ZEBA 1HAHH 4ABIA 2BVXH 2FX4A 2H9HA 3TH4H 3OU0A 4Q2KA 1C2DA 1HAGE 1IQMA 4BTTB 1L1JA 2V0BA 1F7ZA 3TK6A 1A3EH 1ZGVA 2GCTC 2PUXB 2ZPSA 4X6PA 2O8LA 1V2JT 2ALVA 2GZ7A 1EAXA 5EU8A 1SGTA 1YCPK 1C1QA 4XBCA 1ELBA 5HGGA 3P92A 4X1QU 4OS4A 3RM2H 7KMEH 4J2YB 5A0AE 1ARCA 2A7CA 1BTPA 2FEQH 3T25A 1W10U 5GXPA 3BTWE 1B0EA 1C5PA 4YZUA 3SU2A 3MTYA 2PSYA 1MKWH 1EPTB 2G81E 1DE7H 3V13A 1C4Y2 4KTCA 1BRBE 1FDPA 4MNVA 3ATIA 1O2PA 2Z9IA 2RA3A 1AHTH 1LHEH 2SGAA 1UTPA 1SGFG 1RD3B 1XUHA 3BG8A 1SGYE 2ZTYA 4I8LA 4ISHH 4FUFA 5E2PA 1C1PA 1B7XB 2TGDA 3BTFE 1AGJA 1FI8A 1TNIA 1YPKH 3RC5A 3KQCA 2BD8A 1P9SA 1O30A 1GGDB 1VR1H 1EZQA 2Z3CA 3DFJA 2VH6A 3SNDA 1YKTA 1BBRH 1LPKB 1SGEE 2R3UA 4TY7A 3UIRA 1MZDA 4LZ4B 3V12A 4MNWA 1O37A 3SJOA 2JH6D 2R9PA 3AVZA 3KF2A 4NIWA 2QXHA 4NIVA 5TJXA 1QL9A 1GJ7B 2DE8A 3M35A 2Q6GA 3TNSA 2SNVA 2WYGA 1Y3XA 1MUEB 4CHAC 3MO3A 1TB6H 4DJZB 1YYY1 3S9CA 1SHHB 1W0ZU 2OC1A 1DANH 3DFLA 3RLWH 1CA0C 1EXFA 2VIQA 4IS5A 1C1VH 1C5LH 4ASHA 2HOBA 3EA9A 1GI0A 2O8TA 2Z94A 3BIVH 1ZRBA 1LHFH 4ABAA 3OYPA 1FV9A 3RDZA 2ZQ2A 1HXEH 2BZ6H 2FZZA 3JZ1B 2CF8H 1O2YA 4XBDA 2GMTB 3VGCC 3M5OA 3MU1A 1AVGH 1NM6A 1T4UH 3MI4A 2BZAA 1C5WB 5A8XA 4CREA 1H9HE 1SB1H 1M9U<