2P59A

Crystal structure of hepatitis c virus ns3.4a protease
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
151
Chain Sequence
VEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS3
publication title Inhibitors of hepatitis C virus NS3.4A protease. Effect of P4 capping groups on inhibitory potency and pharmacokinetics.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein
total genus 35
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2p59A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2p59A01
3DFLA 1MD8A 1P02A 4K5ZA 1K28D 1SPJA 3ZV8A 1UTMA 1ZOMA 1IQLA 2XWBI 1A5IA 3LGWA 1ZYOA 2PTNA 2F9OA 3RXKA 3RXLA 3EYDA 1UK3A 4ZH8A 4HI3A 4ZKOU 4CHAC 2W3KA 1A61H 4X8VH 2GT8A 5JYIA 4IN2A 1BUIA 3V13A 1CT0E 3K9XB 3DD2H 2G55A 1YC0A 4XBDA 1Z6JH 1GBCA 1RD3B 2WUBA 3GY2A 4XFQA 1J15A 2THFB 1C5NH 3F9EA 2G4TA 4H42U 1UCYH 4B6FA 3GCOA 1P3CA 1TX6A 5AFYH 3STIA 4WWYA 2GCTB 4ISIH 2AGIX 4NIWA 4FVBA 1PYTD 2JH5D 5DP4A 1O3HA 3MU0A 4OS5A 1V2JT 4AFSA 1YYY1 3MO3A 1F0SA 1HV7A 1Y3VA 2FLBH 1T32A 1NN6A 1DLKB 5A0BA 1FZZA 1GCTC 1GJBB 1UCYE 1IHSH 1T4UH 1TALA 4I8KA 1DANH 4GAWA 2XBWA 1ZMJA 2GDEH 1O2KA 4HZHA 3M5LA 1G3EA 2BQ6B 3ZZ3A 2ESTE 2EEKA 3A84A 1WQSA 1HAVB 2Q1JA 1P0SH 1QQUA 3ELAH 2RA0A 2XBVA 3L3TA 2C8XB 3LGIA 3DT0H 4X2XA 1E0FD 4Q7XA 3O8BA 3PLKA 3ATLA 4NA9H 4JZ1A 1P2JA 1AI8H 3FANA 1NS3A 4GUXA 4BAMB 1BA8B 5DG6A 2WV9A 4O97A 5TCCA 1GMCG 4K3JA 4UFGH 3LC3A 1P12E 5G4BA 1SMFE 3GCHC 1BRUP 2CXVA 1O3NA 3LGVA 4X8SH 1L1GA 1GHBF 1O2NA 1THRH 3MO9A 3AAUA 4NSVA 2PHBA 2C90B 1BRAA 1EZSC 1MQ5A 3BEIB 4NWLA 4WXVA 1B5GH 2HNTF 1GVLA 1S0RA 1ESBA 1BZXE 4INHA 3A7VA 3ZZ8A 4ZAEA 1YLDA 3A8AA 1C1UH 1MZDA 1P2IA 1HGTH 2F9PA 1AB9B 1CU1A 1TX7A 2Z3CA 3BTGE 4GHQA 1RRKA 4QT8C 3ZZ9A 5C1YA 4K1SA 2BY7X 3PM3A 1Z1IA 2WPJS 3BEFB 3ENSB 1MU8B 4NZQA 4DGJA 5T1VA 3Q77A 2JETC 3SORA 1ZSKA 1HFDA 4BOHA 1HJ8A 5GJ4B 4YOJA 1L4ZA 3SJ9A 4A6LA 4CRBA 3OY6U 4Y0YE 1NM6A 2BD7A 5BPEA 1PPCE 3U8OH 1P2OA 2SGFE 1OP8A 2I6QA 2ZHEH 5LPEA 3ZYDA 1P2MA 8ESTE 2VWLA 1O2SA 1L1JA 2ZCHP 5GCHF 1NRNH 1DSUA 1GBFA 4YT6H 1S85A 1V2RT 2H1UA 2AGEX 5EQQA 1S82A 3S0NA 1MTNC 4Y79A 4AYYB 2UWOA 1SB1H 4Y8ZA 4BAHB 4ABDA 2ZC9H 3P95A 3MH7A 4U32A 3NUMA 2RA3A 4X1PU 1VCPA 5A8XA 4VGCB 3UOPA 1NRQH 2ODYB 3M5OA 4CRFA 4A7IB 2Q6FA 3TJUA 4Q7YA 1FPCH 3UNQA 3MOCA 1GHXH 1A3EH 2ZEBA 5J4QA 1PPZA 2Y80A 1TNHA 1K2I1 2O8LA 4GHTA 1CBWB 1W0ZU 3ZZAA 4XSKU 2BY5X 1ZRKA 2A45B 4D9QA 1F5LA 3TLOA 4DJZB 4B6EA 3AW0A 1GI3A 3PYHA 1VITH 3M7TA 1S6FA 1GI0A 2Y82A 4M9FA 1FY5A 1OP0A 2D8WA 2Z94A 3A81A 1EAIA 3TJNA 2FMJA 3SYJA 8GCHF 3RC5A 3C1KA 1V2PT 1BHXF 1PPGE 5DK1A 3QO6A 1QJ1B 1GL0E 3FZZA 5JBAS 4Y76A 3QK1A 3E1XB 1DFPA 4X6PA 1HIAB 2ZGJA 2BQWB 1K22H 1HNEE 3Q00A 3ZVGA 2SGDE 2VIQA 1DWDH 2GZ8A 2BD8A 3BEUA 4MNVA 3RC6A 2QXIA 2UUFB 1O39A 3BTHE 1GHYH 2TGPZ 1TMUH 1T8NA 4ISOA 3UQOA 3ATIA 4ZHAA 2CF9H 4D7GA 3QGNB 3ODFA 9LPRA 1AD8H 5AF9H 2BX4A 1EZUC 1FIWA 1AIXH 2SNWA 3A7YA 1O2QA 1KY9A 2VIPA 1ZPBA 5F8TA 2J94A 1HAZB 2HPQH 1GI5A 2P94A 1QURH 1GMHF 3RMLH 1S81A 2B9LA 4K8YA 5CHAC 2P59A 4ASHA 2WV4A 1EP5A 1O3GA 1V2QT 3P8FA 3PV2A 1LPKB 2ANKH 3GCTF 4E7NA 2AH4X 2FX6A 4YT7H 1KXDA 5FPYA 4O3TA 1BRCE 1HXEH 2Z7FE 1GBBA 4B71A 2CF8H 1MTWA 3URDA 2W7SA 1ELAA 3SU6A 1BBRK 3QZRA 1TX8A 2ZP0H 1W8BH 2ZHQH 1SGYE 1GCDA 1IQEA 2GMTC 4RI0A 3LT3A 2OTVA 1OYTH 1SGFA 4NSYA 4RN6A 1ELCA 1QY6A 1ANCA 3A87A 1GBJA 4LOYH 3SV2H 4MNXA 3UFAA 1ZZZA 4JZIA 1EKBB 2FOGA 1RTFB 2PKAA 3GICB 2Y5HA 2A4GA 2GKVE 3ZZ4A 4IGDA 1GBHA 3T26A 4D8NA 1TPPA 3UNSA 2WZQA 2ZDVH 1P11E 2GP9B 4GSOA 1CVWH 1RS0A 4LK4A 1PQ5A 1SG8B 1TE0A 5EW1H 2ZIQH 3QLPH 1AE8H 4X1NU 3S7HB 1XXFA 4Y10E 1MQ6A 4I7YH 4Z0KA 2V6NA 2IPHA 3SZEA 3C27B 1C2LA 1W3CA 2WPHS 1LVOA 2Q6DA 1C5ZB 3UR6A 2A1DB 1YPMH 1FAXA 1N8OC 2CJIA 1TGTA 1AQ7A 1Q31A 3KQBA 5FHTA 4KELA 3VXFH 3STJA 1NPMA 3PMAB 5JBCS 1P06A 1W12U 1O2PA 1D4PB 3A86A 2A4OA 1V2KT 1LPZB 1C2GA 1HIAA 3GY4A 8LPRA 1AY6H 1O31A 2O8WA 3A89A 1OWJA 2AERH 1A0HB 1TBQH 3BTFE 3S9AA 1C1SA 1SL3A 3IG6B 3ZYEA 1ETSH 3Q3XA 1Y3WA 2VGCC 1UJ1A 2PW8H 3ODDA 5HXFA 1GI2A 1KXEA 4I8JA 2EC9H 2H5DA 2P16A 3W94A 3UOUA 2AMPA 1UTJA 5DKMA 1A2CH 1C1VH 3EAJA 4CBNA 4AZ2B 5B6LA 4IMQA 4UE7H 1Z6EA 4B74A 3QTOH 4DY7B 1CGHA 2B5TB 3D49H 4IMZA 4NIXA 1ZTJA 1FAKH 1GWAA 1ID5H 3RM2H 3ZVFA 1VGCB 1JWTA 1MAYA 4FU7A 2SNVA 2R9PA 4ZXYH 1FY4A 2V3OH 5E0GA 3ZZBA 4O3UA 1LHGH 5ABWA 1NU9A 3HK6B 1SHYA 2FOEA 1LQEA 1GI9B 1O3AA 2FOCA 3GOVB 4YLUA 1UVPA 5GIBA 2ZECA 1UTPA 3EQ0H 1O2VA 4Y6DA 4H6TA 4IC6A 4FUEA 1HJAB 3TVJB 4MVNA 2BDAA 1DITH 2GCHG 4RKOB 2A0QB 4BTUB 3TGIE 4LZ4B 3ZVDA 4CRDA 5SGAE 2H2ZA 1DWBH 1YKTA 3K6YA 3M3SA 3A7ZA 4X1QU 3SV6A 1F5KU 3MNSA 1UTQA 3F9GA 3K2UA 1LQDB 2JKHA 2EI6A 1GHAG 2BLOA 2W26A 1NY22 5HM9A 1S6HA 1O5CB 1SFIA 1ELVA 1C2KA 1Y3XA 1G9IE 1F2SE 1J8AA 1SGEE 3O8DA 2IN2A 3LJJA 2QF3A 3KL6A 2BDIA 2VJ1A 3RC4A 1ZHRA 3TNTA 2BOHB 4Y0ZE 4RKJB 3A7XA 2J92A 1SI5H 4JK6A 1QL7A 1V2NT 1O3FA 2QIQA 3LH3A 3AAVA 4H4FA 3SNBA 3RXOA 5FAHA 2G00A 1WBGB 4FUHA 2ODPA 5ETXA 4FUIA 4J1YA 3KCGH 2HNTE 2XCFA 2ZKSA 1P01A 3BIUH 3KN2A 4GLYA 4OS7A 1TGBA 1YPGH 5HM2A 4CREA 1CA0C 1SLUB 4BXWA 2VH0A 3H09A 3BTTE 1TNIA 1BDAA 4UFDH 4JYVH 3P8GA 1MH0A 2ILNA 5EGMA 1ARBA 1X7AC 1HAYB 3MNXA 2ZHDA 4JMYA 1U6QA 4I31A 3LDXH 4F49A 1O5GH 1YPHC 3ZVAA 4INKA 2A5AA 1HAHH 1KLJH 1J9CH 3P92A 4OGXA 2BZAA 3H5CB 2ANMH 2A32A 1O3DA 1GVKB 5EXNA 1ESTA 1EOJA 2R2MB 1HB0B 2C8YB 1TPOA 2DE9A 1PPBH 1GI7B 1HLTH 4SGAE 1KYNA 4CRGA 1UVUH 1ZMNA 1L0ZA 1C5WB 1O2WA 2C8WB 1W7GH 1DE7H 1D3PB 5CE1A 3F68H 7GCHG 1TMTH 1P05A 1LKAA 3BG8A 5K0HA 1C5RA 2FM2A 4MG3A 1E35B 1AFQC 3RXQA 1AN1E 2BVRH 4DW2U 3ZZ7A 4MPXA 3SNEA 4X2WA 1UVSH 5DP5A 1T7CA 2AIPA 3PO1B 4MPVA 4A92A 5E0JA 2C8ZB 2ZU2A 4K8BA 4ZUHA 1GJ4H 6CHAB 1GJCB 3BTWE 5FPSA 1OWDA 1Y3UA 1EZXC 2H9TH 1NZQH 1LVBA 4OS2A 2BD5A 5A2MH 2GV7A 1O3CA 2NU0E 1D6WA 2ZTYA 5L30H 1QB1A 2BD3A 1ZRBA 1BTXA 2ZFSA 4XBBA 2XTTB 4K1TA 1EPTC 1NROH 2A7JA 2V35A 1QCPA 1S83A 2FEQH 3RXUA 3SI4H 2XXLA 5FXLA 4A1XA 3BV9B 1XUIA 1CQQA 2AGGX 1TIOA 2ZFFH 2Y6TA 1GMDF 1BTYA 1BB0B 1XM1A 1HDTH 1C4U2 2F9NA 1JXPA 1EQ9A 4NCYA 3BTDE 1YF4A 1ELTA 3AW1A 2OINA 1V2LT 4INLA 1AE5A 1A0JA 1C2DA 1O2RA 5DP3A 2ZWLH 5HGGA 1AZZA 1DSTA 3W95A 1CE5A 1PPHE 1C2EA 3T25A 5GXPA 1Z71A 2FWWA 1C5QA 3M36A 3KHVA 4Y8YA 3D65E 2RDLA 3SNDA 2PSXA 4BNRA 1UVOA 2OC1A 5C5OA 2O8UA 1A4WH 3KIDU 1NFYA 2ANWA 2XBYA 4B76A 4NIYA 2CGAA 1SGRE 2NU4E 1YLCA 5AHGH 1C4Y2 1C1QA 1T8MA 4CHAB 3PTNA 1GJ8B 1ORFA 5B6OA 1XKBC 2XRCA 3DFJA 4AFZA 3NK8A 4WMEA 4ABGA 3MH4A 3Q3YA 1TWXB 4MPWA 1QFKH 4WH8A 2OC7A 3QX5H 2HALA 5A8YA 1V2VT 2H9EH 3TH2H 2OQUA 2WINI 5C67A 1DWCH 4MQAA 3QDZB 3RDZA 4ZKSU 1SLWB 1BQYA 1FN6A 1AVGH 2ZTXA 2VB0A 4O9VA 1G3DA 3SNAA 3SJIA 2FOAA 1C1MA 3MTYA 1QBOA 3SQEE 1DS2E 1MKWK 3CS7A 3SV9A 3MWIU 1GCTB 1FNIA 2ZGHA 3ZZDA 1GMCF 1BHXB 4BTIB 1SSXA 3T62A 5LPRA 1TRNA 3VB7A 4Q2KA 1GJ9B 4HFPB 4DURA 1Z8GA 3RU4D 1C5MD 3P6ZB 1OWHA 3VGCC 2VBCA 2FTLE 3SU0A 1P2NA 2BY9X 3PWCA 1H4WA 1NFWA 1O2ZA 2QC2A 4A1VA 2TGTA 1SVPA 1O2OA 2VIDA 1XUGA 1Y8TA 1AUTC 1J16A 3LGTA 1DVAH 4X6OA 1AWFH 3GCHB 1BMLA 1QBNA 3A88A 1O3KA 2TGAA 3Q3KA 5F03A 1O2UA 1TONA 4TY7A 2SGAA 3TH4H 1FQ3A 2G4UA 2AFQB 1RIWC 1O36A 3BTME 2TGDA 1UHBB 4ISNA 3SV7A 1AUJA 2BLVA 3MH5A 1AMHA 2P8OC 2ZPQA 3UTUH 4JCNA 1M9UA 4Y7AA 1CGJE 2ZPSA 2QV1A 2ZDKA 3E3TA 1GG6C 1GBLA 2ZFTA 2VNTA 3LPRA 1ELGA 2ZDLA 1XVOA 3RU4E 2UWLA 4NWKA 4NFFA 3A8BA 1EASA 4O03A 5LH8A 1FLEE 2BY8X 2PLXA 2GDDA 1TNKA 3U1IB 1CHOG 3ZZ5A 4YOIA 2JETB 1SGFG 1Z8JB 3F9FA 1ARCA 1HAVA 3AK5A 3QN7A 2OP9A 1GL1A 5A0AE 5E2OA 2Y7ZA 4ZKNU 1WTHD 2XNIA 3A85A 2QGRA 4KGAA 4MTBA 1SHHB 1SGIB 4KTSA 1P09A 1O2HA 1S5SA 1A46H 1GMHG 3CP7A 3EA8A 1AVXA 2ZTZA 3KF2A 2DE8A 2FYRA 1CGIE 3OU0A 4GCHG 1MTNB 2Y7XA 1O33A 1QHRB 1W0YH 1HCGA 3RMMH 1C5OH 1J14A 1K1OA 1OKXA 2PTCE 5DP8A 1CT4E 3QTVH 2SGQE 1J17T 3L33A 1C1NA 1OSSA 1C9PA 3RXBA 1O3BA 5F8XA 2ZQ2A 4NA8A 1DY9A 2H5CA 4IBLH 1FI8A 4WH6A 2R3UA 3T29A 1D6RA 3UPEA 3F6UH 2K1QA 3RXVA 4LZ1H 2VIOA 2ASUB 1W2KH 5E2PA 3SO3A 1V2UT 1SBWA 5DP6A 4TWWA 2P3TB 1O35A 4MLFB 2VH6A 1W11U 2WPMS 1LO6A 2R0KA 2FIRH 2YNAA 1RJXB 3UQVA 4E05H 1HAIH 1LVMA 1G2LA 1HYLA 1O3JA 1L4DA 2G5VA 2G81E 4ISHH 2UUKB 1ABIH 1K1LA 6ESTA 1XXDA 5FBIA 1BCUH 4YM9A 3M37A 3RM0H 1UK2A 4JZEH 2J4IA 2LNCA 3SU2A 5JB8S 1H9LB 2SGEE 1XVMA 3FP6E 1WTGH 3SUFA 4CR9A 2O9QA 1NT1A 3ITIA 3VB6A 1ZSLA 1NTPA 2FDAA 1P04A 1K1JA 3SJKA 1UTKA 2G52A 2YOLA 3EA7A 2XC5A 1C1RA 2GGVB 2XW9A 4X6MA 1YGCH 4CH2B 1O0DH 5IYTA 2ZG0H 1LCYA 3S7KB 1TABE 3QUMP 1DOJA 1C5VA 4JK5A 1LTOA 4MPUA 3LGYA 4ABJA 2ZHFH 1EAXA 2BMGB 1UHBA 2BD2A 2QAAA 2XYAA 1O5FH 2BDBA 1TAWA 4DIIH 1CSOE 1JIMA 1KXCA 1KTTB 3EDXB 1CHGA 4DG4A 2FOMB 5A09A 2STBE 5C1UA 5CHAB 2ALPA 1VJAU 3P17H 4WXIA 2OC0A 3BSQA 1AU8A 1WOFA 1ANBA 1QJ6B 1MD7A 4XE4A 1MUEB 1BTHH 1P9UA 3B9FH 1WYKA 2Y5GA 4KP0A 2ZDAH 3LKWA 1BMMH 2ZFPH 1NU7B 2GTBA 1OX1A 4I8LA 2GV6A 3RUOA 1NFUA 6GCHG 3SOSA 7LPRA 1LKBA 1BBRE 3VB5A 2NU3E 2D1JA 3M35A 3A7WA 3SQHE 1HAPH 1A3BH 4B75A 2CHAC 1DX5M 2C4FH 2WPKS 1S0QA 3S69A 4TWYA 3VPKA 1FV9A 1GJ7B 2GMTB 1HAXB 2P93A 3MYWA 4JYTA 4BXSA 3A82A 1IQIA 1Y59T 3U69H 2XBXA 3RMOH 2HOBA 1Z8IB 3SN8A 5LGOA 1XUKA 4AOQA 4F4OC 1DXWA 3HKJB 1TYNA 1IQMA 2C93B 1LPGB 2CV3A 1YCPM 1G36A 5A0CA 1K1PA 3P8NA 4ZROA 2BQ7B 2PKSC 1O3LA 3E91A 4B2CA 5L6NH 1BMNH 3MU8A 5E0HA 2ZO3H 3GISB 2JH6D 4YOGA 2IJOB 1O3PB 4BAOB 4U2WA 4CR5A 1VITF 2QN5T 4ZHMU 1BIOA 1YCPK 2ALVA 1C5LH 5EXLA 4DCDA 1BTWA 1DXPA 1GBEA 3ATWA 1UMAH 1YPLH 3RXCA 4ISLA 1AHTH 1UO6A 3U8TH 3EGKH 4XOJA 2F3CE 3B23B 2ZFRH 4K69A 1F5RA 1Y3YA 1ZHMA 4Y8XA 4AB9A 1N8OB 4JZFH 1ELEE 3R3GB 2G5NA 3HK3B 2A4QA 1P2KA 2KAIB 1QRXA 2BXUH 3RXDA 1PPFE 1F92A 1VCWA 2BDYA 2BZ6H 5HYOA 1ELFA 3A80A 2GD4B 1A0LA 4D9RA 1ZPCA 1LHCH 1C4V2 2FI3E 4X8TH 5DO4H 1TOMH 3O8CA 4I8GA 1AZ8A 1UK4A 3PV5A 1MTSA 1KXBA 2OQ5A 1GI1A 4JYUH 1QIXB 3SNCA 4ABAA 5FCKA 4XBCA 2VGCB 1WXRA 5L2ZH 1UTLM 1DPOA 3MI4A 1SQTA 3RXPA 3TGKE 1EUFA 1NESE 1V3XA 1Y5BT 2AMQA 2UUYA 3T2NA 3TU7H 5TCAA 1O5EH 1GGDC 5T6DA 2Y81A 2Z9LA 4AYVB 3MMGA 4R8TB 4CRCA 5JBTA 3GCNA 3TNSA 2EA3A 4TPYA 2OUAA 4FUJA 3V7TA 1UTOA 1O37A 1TQ0B 2GCHF 4AG2A 4X0WU 1FDPA 1SGCA 2Z9GA 1GVZA 3DHKH 1NC6A 2V3HH 1IAUA 4WVPE 4B2AA 1SQAA 1KDQB 3K6ZA 1EXFA 2ZA5A 3MU4A 1N1LA 5EG4A 1G3CA 3UIRA 1TMBH 1SC8U 2VVUA 4ABEA 2Z9IA 1PJPA 1YPHE 3CS0A 3DUXH 3NPSA 3RXFA 3RXRA 1GHAF 1JRTA 8KME2 2A2XH 1E38B 4OS6A 1QA7A 1SGDE 2C3SA 5T6FA 3E6PH 3LGUA 3GDUA 4FVDA 3UR9A 2PGBB 3R0FA 5C1XA 2D2DA 3P70B 4D7FA 4I8HA 1IOEA 2A5IA 3BN9A 1OYQA 2VWOA 2WPLS 1SQOA 2F4LA 4ABBA 1QGFA 3MH6A 4KTUA 4WJG2 2GZ9A 2NWNA 3SUEA 1ACBE 2IOTA 3SU5A 5EQSA 2VIWA 1C5YB 3MNBA 4JZDH 1F0RA 1FN8A 3ZV9A 2J95A 2A31A 2TBSA 4Y7BA 4XDEA 1MKXH 1DUAA 4CRAA 5GWZA 3ATMA 2B7DH 2QF0A 1AWHB 2ZCLP 2GCTC 2FP7B 1JMOH 2VIVA 1HXFH 2CMYA 1F0TA 1W13U 7KMEH 2ZGXH 1O2JA 1RGQA 1Y5AT 1WSSH 3T28A 2PFEA 1O2TA 1EZQA 1AO5A 1C5TA 4H6SB 2OLGA 3KQDA 2RG3A 1S84A 2UUJB 4ABHA 1TLDA 1ZHPA 3GY3A 4ESTE 3O8RA 1W10U 1UCYK 3TJOA 1DY8A 5DJ7A 1A5HA 1H8DH 4FXGH 2G51A 2OBOA 2DUCA 1CA0B 1GI6A 1SGPE 1TGNA 5DP7A 1SLXB 3SJ8A 1KXFA 5EPYA 4M7GA 5K7RA 2R0LA 2F83A 4UD9H 2EI7A 2FS9A 1T31A 5F6MA 3U98H 3M3VA 1DLEA 1FIZA 3BTKE 3UY9A 7GCHF 1WQVH 1K1IA 1V2MT 5AVDA 1SR5C 4UFEH 3TJVA 3RU4T 4OM9A 3T5FH 2J9NA 3QWCH 4FUBA 2JH0D 2ZNKH 2QXJA 3P8OA 2SGPE 3BIVH 2QXGA 3NXPA 1B0EA 1DWEH 5I25A 2ZDMA 1KLIH 1XUHA 4WMDA 2I6SA 4FUDA 3ZVBA 1ZR0A 3SUDA 1BITA 2ZI2H 1Z8RA 2BVSH 3BTEE 4NIVA 2HPPH 3RXGA 1TPAE 1TGSZ 3IWMA 4SGBE 1C1WH 5C3NA 1C9TA 3SW2B 1AFQB 1C1PA 3HKIB 1GHBG 3A83A 2FYQA 3B8JA 1ABJH 1GDQA 3GY6A 4DT7B 4Z6AH 1AB9C 5FPTA 1WU1A 2STAE 4PROA 1FPHH 2H6MA 4TY6A 1W14U 3NKKA 1BJVA 1TQ7B 1GBIA 2FXRA 2PUQH 3OTPA 3RXIA 2WUCA 4YTAA 3VB3A 3SI3H 2VWNA 5EQRA 1KDQA 2BVXH 2Z9KA 1P3EA 2R3YA 2OBQA 2AIQA 1OWKA 1W7XH 2ULLA 5ESBA 1TPSA 1ZJKA 3ESTA 1IQJA 3AASA 1MAXA 2YNBA 4NGAH 3RP2A 1RFNA 3CENA 5GPIB 1EPTB 2VVVA 1G3BA 2Y5FA 1OWIA 1QRZA 3PV4A 1JBUH 1NFXA 3SU4A 1ZGVA 1C2JA 6LPRA 1ZTKA 2GX4A 2BHGA 4ABFA 1GJ5H 1KXAA 3GYMA 3K65B 3GYLB 3LOXA 4GVUA 3PMJA 1KSNA 1K1NA 3SUGA 4VGCC 2ZGBH 1N6XA 3NWUA 2ZPRA 3EA9A 1PYTC 2OC8A 3GDSA 5GCHG 2BLQA 1H9IE 1KTSB 5DP9A 1LHFH 1A7SA 1V2OT 1XKAC 1T4VH 1KLTA 1AGJA 2O8MA 1CBWC 4ZXXH 1XX9A 2HVXA 4IW4E 4A5TS 4ABIA 2BM2A 1N6YA 5FX5A 4NFEA 5HMAA 1V2WT 1QNJA 3FFGA 2QY0B 4IC5A 1O5BB 1ANEA 1AKSB 4BAQB 4YZUA 4AGKA 3PTBA 1ZJDA 2BXTH 1PFXC 2FO9A 5DGJA 1ZTLA 4TPIZ 1MKWH 3G01A 2AS9A 1GBMA 4B2BA 3I78A 1EATA 3RXTA 1GHZA 1TNGA 3F9HA 4A1TA 1NO9H 4YESB 1OWEA 4E7RG 1CO7E 4HTCH 1RXPA 5GDSH 3H7OA 1QL8A 4RSPA 2FI4E 4TYDA 1RTKA 2TIOA 2F9UA 2ZU3A 1O30A 1TOCB 4DVAU 4ZMAH 5EODA 4X6NA 8GCHG 2PGQB 1EB2A 1ZLRA 1O3EA 1BOQA 1O2XA 2XC4A 4GPGA 3SGBE 1K9OE 1FUJA 2PKAB 3SGQE 4MDSA 2ZZUH 1F0UA 4B1TA 3U9AH 3M5MA 1EB1H 4J2YB 4Y11E 3T27A 2A7HA 1PPEE 2R2WU 3MHWU 4ZHLU 1V6DA 1MU6B 2ZCKP 1BTZA 1IQHA 1MTUA 1YPKH 4FU8A 1A5GH 1EP6A 2EI8A 2J2UA 3KQEA 3HGNA 5AFZH 1PQ7A 2CN0H 1H8IH 3VGCB 1OPHB 3Q76A 1SLVB 1O3IA 1E34B 3LIWA 5A8ZA 3SJOA 3FP7E 1IQFA 2B0FA 1O2MA 2W5EA 1DICA 1SGTA 3VEQB 1C2IA 2Q6GA 4I32A 2P95A 3F1SB 5JPMH 2WYJA 5GNDA 2D26C 2GZ7A 1FY3A 3AVZA 1JIRA 1SOZA 4HGCA 2SFAA 3ZVEA 1GI8B 2ZDNA 1G30B 1IQKA 1RIWB 2BX3A 3GCTG 2A4RA 2ZU1A 3RLYH 3IITA 2FX4A 1C5XB 2FPZA 2NU2E 2O8TA 5J4SA 1O2LA 1TGCA 3OY5U 4FUCA 2HLCA 1O2GH 2P8OB 2BY6X 3GY7A 4IN1A 1CT2E 1MCTA 2BB4A 1CHOF 5JDUB 1EPTA 2B8OH 1O32A 3MU1A 4AX9H 1GG6B 2AMDA 1P2QA 3QGJA 3M7QA 4NZLA 3V12A 2H9HA 1SGQE 2AEIH 1SGNE 3SU3A 1ZPZA 5FBEA 1TA6A 3FZDA 1TNLA 1Q2WA 4X2VA 1C1OA 1INCA 3OX7U 1MZAA 2XWAA 3TGJE 2FI5E 1QRWA 4GCHF 1V2ST 3M5NA 2BD4A 3D62A 1D3DB 1GJ6A 2ZU4A 4I33A 3LJOA 1L1NA 3VFEA 4DIHH 4UDWH 2NU1E 2BLWA 1YM0A 4Q80A 1ZGIA 1F7ZA 3E8LA 3LU9B 4FUGA 3UWJH 1DUEA 3NCLA 1SFQB 3ZZCA 3MNCA 4BAKB 1P10A 3LC5A 1MCVA 3RXEA 1O2IA 2TRMA 3QZQA 2FODA 3SGAE 1AKSA 2BOKA 3SHAH 3HGPA 3RXHA 1GDNA 3UUZA 1MTVA 1O3OA 1HJ9A 1BMAA 2FOHA 4OS4A 3E0PB 1BTUA 1T8OA 2VVCA 2WV5A 2F91A 3D23A 4WF8A 1VJ9U 3PB1E 1D3TB 1BBRH 4K60A 1WAYB 2IJD1 5ESTE 3GDVA 2BDGA 4X1RU 3M61U 3U8RH 1Y5UT 4AFQA 3URCA 2OD3B 1JOUB 3RLWH 5FCRA 3S9CA 2HWLB 2HRVA 5PTPA 3KNXA 3PLPA 3TK6A 2VWMA 1MMJN 2J34A 1FY8E 1EJAA 1C2MA 1NRRH 1Q3XA 3TK9A 3GY5A 1ELDE 2WPIS 3VXEH 5E8EH 1LHEH 1VGCC 3U1JB 4E06H 2ZU5A 3E16B 4UFFH 1IQGA 1GHVH 5C20A 5C2ZA 1XUJA 2WYGA 2LPRA 4FU9A 3FVFB 3LONA 2ZHWH 1ANDA 1UTNA 3FP8E 2XCNA 4LXBH 2BTCE 3PWBA 2F9BH 1LVYA 1A1RA 1E36B 2GVFA 3I29A 1PQ8A 1TBZH 3KGPA 1ZMLA 1HBTH 1HJAC 4B73A 2M5TA 1BJUA 1ZSJA 2TPIZ 4UONA 1VITG 1H9HE 1EOLA 3A8DA 3OTJE 1BTPA 2A5KA 1IQNA 1OP2A 4CBOA 2FESH 1FY1A 2VU8E 6GCHF 1VZQH 1P57B 4X8UH 4U01A 2VINA 2UWPA 2WHXA 2BDHA 1HAOH 1B0FA 2PWXA 3MU5A 1QB6A 1XUFA 3MO6A 5JB9S 5DPAA 1GHWH 5F8ZA 5H4IB 3SU1A 1O2YA 1MBMA 3RMNH 4KKDA 1E37B 1JRSA 3M3TA 4UEHH 1LMWB 1NRPH 4MNWA 3N7OA 2GT7A 1GBAA 1SOTA 3SV8A 1K21H 4K1EA 1Z1JA 2BDCA 2QA9E 1TBRH 3EE0B 4DOQA 1YPJH 2CHAB 1HUTH 1QJ7B 1XMNB 4BTTB 3DA9B 4YLQH 5BRRE 3V0XA 3NZIA 1DM4B 3PLBA 1G2MA 3MFJA 3JZ1B 5LPFA 3M7UA 5EOKA 2XC0A 1RTLA 2PR3A 2Z6BD 4X2YA 4U30A 4OS1A 1C5SA 1P03A 1TFXA 2FZZA 5T3HA 1C2HA 2ANYA 1EX3A 1GJDB 1OS8A 3UREA 4YO9A 1QBVH 2PV9B 3FAOA 1YCPH 1C1TA 1C5UA 2ZF0H 1OXGA 1P9SA 1L2EA 3ZZ6A 4BANB 2ZQ1A 2A2QH 2Z3DA 2A7CA 1TRMA 2PKSB 2OK5A 1YBWA 1C2FA 1HAGE 1K1MA 4OGYA 1TB6H 1GBTA 1QR3E 1GBDA 4AORA 1D3QB 1UVTH 1YP9A 1AFEH 2P3UB 3BTQE 7ESTE 4CH8B 3A7TA 1EAUA 1BRBE 3S9BA 1QL9A 1HRTH 1VR1H 4KTCA 4AGJA 2OXSA 3OSYA 4MNYA 3SHCH 4WY3A 2OCVB 2W3IA 3BG4C 1C5PA 5TJXA 1THPB 3TK5A 2BD9A 1EJNA 2BYAX 1ETRH 1T8LA 4WMFA 3UNRA 4NG9H 5IDKA 3LH1A 1GI4A 1QB9A 1WUNH 2FLRH 4IS5A 2Z9JA 1FJSA 3OYPA 3E0NB 1FMGA 3WY8A 3A8CA 2F9VA 1B7XB 3RXSA 5T6GA 3H7TA 3L6PA 2ODQA 2V0BA 3RXAA 3BF6H 1NRSH 2ZFQH 1MKXK 2QYIA 3PO1C 1EAWA 4R0IA 2HGTH 2ZGCA 3E90B 3I77A 3PMBB 5FX6A 3SZNA 6CHAC 1G32B 3V3MA 1BT7A 2PUXB 3KEEA 4AN7A 1GJAB 4Q7ZA 3TH3H 1O3MA 5JBBS 2FTMA 1HPGA 1LHDH 4THNH 3HPTB 3TITA 2FS8A 1G37A 1GBKA 1MBQA 3TIUA 1ESAA 1YPEH 2G8TA 1Z7KA 2HNTC 5L2YH 2QCYA 1P8VC 2PSYA 3SBKA 3VB4A 2AYWA 4X1SU 4AFUA 4Y71A 2RCEA 1FONA 1O5DH 3RXJA 1GGDB 5C5NA 1TNJA 1WCZA 2QXHA 4AG1A 1O34A 1QTFA 1GPZA 1QA0A 1DDJA 4K2YA 1O38A 1LDTT 1KIGH 5EU8A 3GY8A 1V2TT 5EXMA 4AB8A 5EPNA 1TRYA 4FUFA 2FOBA 1FXYA 9ESTA 3JZ2B 1AVWA 2P3FH 3PROA 3HATH 3RXMA 3KQCA 1O5AB 3BG4B 2FOFA 4D76A 1D9IA 5I46H 4NA7A 3UWIA 2J38A 2Z3EA 1EJMA 5EW2H 1IHTH 3PMHB 1GDUA 1WV7H 1ETTH 1DT2A 1GMDG 3ZVCA 1CA8B 1QQ4A 3TPIZ 1OOKB 4ZKRU 1H1BA 1ELBA 1VCQA 1PQAA 5CMXH 1TA2A 1THSH 2W7UA 2KAIA 3ATKA
chains in the Genus database with same CATH superfamily
3DFLA 1MD8A 1P02A 4K5ZA 1K28D 1SPJA 3ZV8A 1UTMA 1ZOMA 1IQLA 3F3BA 2XWBI 1A5IA 3LGWA 1ZYOA 2PTNA 2F9OA 3RXKA 3RXLA 3EYDA 1UK3A 4ZH8A 4HI3A 4ZKOU 4CHAC 2W3KA 1A61H 4X8VH 2GT8A 5JYIA 4IN2A 1BUIA 3V13A 1CT0E 3K9XB 3DD2H 2G55A 1YC0A 4XBDA 1Z6JH 1GBCA 1RD3B 2WUBA 3GY2A 5IK2D 4XFQA 1J15A 2THFB 1C5NH 3F9EA 2G4TA 4H42U 1UCYH 4B6FA 3GCOA 1P3CA 1TX6A 5AFYH 3STIA 4WWYA 2GCTB 4ISIH 2AGIX 4NIWA 4FVBA 1PYTD 2JH5D 5DP4A 1O3HA 3MU0A 4OS5A 1V2JT 4AFSA 1YYY1 3MO3A 1F0SA 1HV7A 1Y3VA 2FLBH 1T32A 1NN6A 1DLKB 5A0BA 1FZZA 1GCTC 1GJBB 1UCYE 1IHSH 1T4UH 1TALA 4I8KA 1DANH 4GAWA 2XBWA 1ZMJA 2GDEH 1O2KA 4HZHA 3M5LA 1G3EA 2BQ6B 3ZZ3A 2ESTE 2EEKA 3A84A 1WQSA 1HAVB 2Q1JA 1P0SH 1QQUA 3ELAH 2RA0A 2XBVA 3L3TA 2C8XB 2KFWA 1YWUA 3LGIA 3DT0H 4X2XA 1E0FD 4Q7XA 3O8BA 3PLKA 3ATLA 4NA9H 4JZ1A 1P2JA 1AI8H 3FANA 1NS3A 4GUXA 4BAMB 1BA8B 2WV9A 5DG6A 4O97A 5TCCA 1GMCG 4K3JA 4UFGH 3U28C 3LC3A 1P12E 5G4BA 1SMFE 3GCHC 1BRUP 2CXVA 1O3NA 3LGVA 4X8SH 1L1GA 1GHBF 1O2NA 1THRH 3MO9A 3AAUA 1E1QD 4NSVA 2PHBA 2C90B 1BRAA 1EZSC 1MQ5A 3BEIB 4NWLA 2WSSD 2YMSD 4WXVA 1B5GH 5C94A 2HNTF 1GVLA 1S0RA 1ESBA 1BZXE 4INHA 3A7VA 3ZZ8A 4ZAEA 1YLDA 3A8AA 1C1UH 1MZDA 1P2IA 4Q4LA 1HGTH 2F9PA 1AB9B 1CU1A 1TX7A 2Z3CA 3BTGE 4GHQA 1RRKA 4QT8C 3ZZ9A 5C1YA 4K1SA 2BY7X 3PM3A 1Z1IA 2WPJS 3BEFB 3ENSB 1MU8B 4NZQA 4DGJA 5T1VA 3Q77A 2JETC 3SORA 1ZSKA 1HFDA 4BOHA 1HJ8A 5GJ4B 4YOJA 1L4ZA 3SJ9A 4A6LA 4CRBA 3OY6U 4Y0YE 1NM6A 2BD7A 5BPEA 1PPCE 3U8OH 1P2OA 2SGFE 1OP8A 2I6QA 2ZHEH 5LPEA 3ZYDA 4XRNA 3FOAA 1P2MA 8ESTE 2VWLA 1O2SA 1L1JA 2ZCHP 5GCHF 1NRNH 1DSUA 1GBFA 4I86A 5CDFE 4YT6H 1S85A 1V2RT 2H1UA 2AGEX 5EQQA 1S82A 3S0NA 1MTNC 4Y79A 4AYYB 2UWOA 1SB1H 4Y8ZA 4BAHB 4ABDA 2ZC9H 3P95A 3MH7A 4U32A 3NUMA 2RA3A 4X1PU 1VCPA 5A8XA 4VGCB 3UOPA 1NRQH 2ODYB 3M5OA 4CRFA 4A7IB 2Q6FA 3TJUA 4Q7YA 1FPCH 3UNQA 3MOCA 1GHXH 1A3EH 2ZEBA 5J4QA 1PPZA 2Y80A 1TNHA 1K2I1 2O8LA 4GHTA 1CBWB 1W0ZU 3ZZAA 2KZ4A 4XSKU 2BY5X 1ZRKA 2A45B 4D9QA 1F5LA 3TLOA 4DJZB 4B6EA 3AW0A 1GI3A 3PYHA 1VITH 3M7TA 1S6FA 1GI0A 2Y82A 4M9FA 1FY5A 1OP0A 2D8WA 2Z94A 3A81A 1EAIA 3TJNA 2FMJA 3SYJA 8GCHF 3RC5A 3C1KA 1V2PT 1BHXF 1PPGE 5DK1A 3QO6A 3F0PA 1QJ1B 1GL0E 3FZZA 5JBAS 4ACBA 4Y76A 3QK1A 3E1XB 1DFPA 4X6PA 1HIAB 2ZGJA 2BQWB 1K22H 1HNEE 3Q00A 3ZVGA 2SGDE 2VIQA 1DWDH 2GZ8A 2BD8A 3BEUA 4MNVA 3RC6A 2QXIA 2KX4A 1O39A 2UUFB 3BTHE 1GHYH 2TGPZ 1TMUH 1T8NA 4ISOA 3UQOA 3ATIA 4ZHAA 2CF9H 4D7GA 3QGNB 3ODFA 9LPRA 1AD8H 5AF9H 2BX4A 1EZUC 1FIWA 1AIXH 2SNWA 3A7YA 1O2QA 1KY9A 2VIPA 1ZPBA 4Z1MD 5F8TA 2J94A 4F55A 1HAZB 2HPQH 1GI5A 2P94A 2YMSB 1QURH 3MQKC 1GMHF 3RMLH 1S81A 5KECA 2B9LA 4K8YA 5CHAC 2P59A 4ASHA 2WV4A 1EP5A 1O3GA 2GJGA 1V2QT 3P8FA 3PV2A 1LPKB 2ANKH 3GCTF 4E7NA 2AH4X 2FX6A 4YT7H 1KXDA 3PRBA 5FPYA 4O3TA 1BRCE 1HXEH 2Z7FE 5HKKD 1GBBA 4B71A 2CF8H 1MTWA 3URDA 2W7SA 1ELAA 2AHME 3SU6A 1BBRK 3QZRA 1TX8A 2ZP0H 1W8BH 5EJ1A 2ZHQH 5HIYA 1SGYE 1GCDA 1IQEA 2GMTC 4RI0A 3LT3A 2OTVA 1OYTH 1SGFA 4NSYA 4RN6A 1ELCA 1QY6A 2JJ2D 1ANCA 2V7QD 3A87A 1GBJA 4LOYH 3SV2H 1VKYA 4MNXA 3UFAA 1ZZZA 2QF5A 4JZIA 1EKBB 2FOGA 1RTFB 2PKAA 3GICB 2Y5HA 2A4GA 2GKVE 3ZZ4A 3N7EA 1GBHA 4IGDA 3T26A 4D8NA 1TPPA 3UNSA 2WZQA 2ZDVH 1P11E 2GP9B 4GSOA 1CVWH 1RS0A 4LK4A 1H8ED 1PQ5A 1SG8B 1TE0A 2ZIQH 5EW1H 3QLPH 1AE8H 4X1NU 5DN6D 3S7HB 1XXFA 4Y10E 1YLNA 1MQ6A 4I7YH 4Z0KA 2V6NA 2IPHA 3SZEA 3C27B 1C2LA 1W3CA 2WPHS 1LVOA 2Q6DA 1C5ZB 3UR6A 2A1DB 1YPMH 1FAXA 1N8OC 2CJIA 1TGTA 1AQ7A 1Q31A 3KQBA 5FHTA 4KELA 3VXFH 3STJA 1NPMA 3PMAB 5JBCS 1P06A 1W12U 1O2PA 1D4PB 3A86A 2A4OA 1V2KT 1LPZB 1C2GA 1HIAA 3GY4A 8LPRA 1AY6H 1O31A 2O8WA 3A89A 2F43B 1OWJA 2AERH 1A0HB 1TBQH 3BTFE 3S9AA 1C1SA 1SL3A 3IG6B 3ZYEA 1ETSH 3Q3XA 1Y3WA 2VGCC 1UJ1A 2PW8H 2IPQX 3ODDA 5HXFA 1GI2A 1KXEA 4I8JA 2EC9H 2H5DA 2P16A 3W94A 3UOUA 2AMPA 1UTJA 5DKMA 1A2CH 1C1VH 3EAJA 4CBNA 4AZ2B 5B6LA 4IMQA 4UE7H 1Z6EA 4B74A 3QTOH 4DY7B 1CGHA 2B5TB 3D49H 4IMZA 4NIXA 1ZTJA 1FAKH 1GWAA 1ID5H 3RM2H 3EE7A 3ZVFA 1VGCB 2LP6A 1JWTA 1MAYA 4FU7A 2SNVA 2R9PA 4ZXYH 1FY4A 2V3OH 5E0GA 3ZZBA 4O3UA 1LHGH 5ABWA 1NU9A 3HK6B 1SHYA 2J5UA 2FOEA 1LQEA 1GI9B 1O3AA 2L6OA 2FOCA 5EJLA 3GOVB 4YLUA 1UVPA 5GIBA 2ZECA 1UTPA 3EQ0H 1O2VA 3OEED 4Y6DA 4H6TA 4IC6A 2M2AA 4FUEA 1HJAB 3TVJB 4MVNA 2BDAA 1DITH 2GCHG 4RKOB 2A0QB 4BTUB 3TGIE 4LZ4B 3ZVDA 4CRDA 5SGAE 2H2ZA 1DWBH 1YKTA 3K6YA 3M3SA 3A7ZA 4X1QU 3SV6A 1F5KU 3MNSA 1UTQA 3F9GA 3K2UA 1LQDB 2JKHA 2EI6A 2J98B 1GHAG 2BLOA 2W26A 1NY22 5HM9A 1S6HA 1O5CB 1SFIA 1ELVA 1C2KA 1Y3XA 1G9IE 1F2SE 1J8AA 1SGEE 3O8DA 2IN2A 3LJJA 2QF3A 3KL6A 2BDIA 2VJ1A 3RC4A 1ZHRA 3TNTA 2BOHB 4P02A 4Y0ZE 4RKJB 3A7XA 2J92A 1SI5H 4JK6A 1QL7A 2QF4A 3W1EA 1V2NT 1O3FA 2QIQA 3LH3A 3AAVA 4H4FA 3SNBA 3RXOA 5FAHA 2G00A 1WBGB 4FUHA 2ODPA 5ETXA 4FUIA 4J1YA 3KCGH 2HNTE 2XCFA 2ZKSA 1P01A 3BIUH 3KN2A 4GLYA 4OS7A 1TGBA 1YPGH 5HM2A 4CREA 1CA0C 1SLUB 3H09A 2VH0A 4BXWA 3BTTE 1TNIA 1BDAA 4UFDH 4JYVH 3P8GA 1MH0A 2ILNA 5EGMA 1ARBA 1X7AC 1HAYB 3MNXA 2ZHDA 4JMYA 1U6QA 4I31A 3LDXH 4F49A 1O5GH 1YPHC 3ZVAA 4INKA 2A5AA 1HAHH 1KLJH 1J9CH 3P92A 4OGXA 2BZAA 3H5CB 2ANMH 2A32A 1O3DA 1GVKB 5EXNA 1ESTA 2JIZD 1EOJA 2R2MB 1HB0B 2C8YB 1TPOA 2DE9A 1PPBH 1GI7B 1HLTH 4SGAE 1KYNA 4CRGA 1UVUH 1ZMNA 1L0ZA 1C5WB 1O2WA 2C8WB 1W7GH 1DE7H 1D3PB 5CE1A 3F68H 7GCHG 1TMTH 1P05A 1LKAA 3BG8A 5K0HA 1C5RA 2FM2A 4MG3A 1E35B 1AFQC 3RXQA 5KEDA 1AN1E 2BVRH 4DW2U 3ZZ7A 4MPXA 3SNEA 4X2WA 1UVSH 5DP5A 1T7CA 2AIPA 3PO1B 4MPVA 4A92A 5E0JA 2C8ZB 2ZU2A 4K8BA 4ZUHA 1GJ4H 6CHAB 3DSOA 1GJCB 3BTWE 5FPSA 1OWDA 1Y3UA 3ZIAD 1EZXC 2H9TH 1NZQH 1LVBA 4OS2A 2BD5A 5A2MH 2GV7A 1O3CA 2NU0E 1D6WA 2ZTYA 5L30H 1QB1A 2BD3A 1ZRBA 1BTXA 2ZFSA 4XBBA 2XTTB 4K1TA 1EPTC 1NROH 2A7JA 2V35A 1QCPA 1S83A 2FEQH 3RXUA 3SI4H 2XXLA 5FXLA 4A1XA 3BV9B 1XUIA 1CQQA 2AGGX 1TIOA 2ZFFH 2Y6TA 1GMDF 1BTYA 1BB0B 1XM1A 2RFKC 1HDTH 1C4U2 2F9NA 2J98A 1JXPA 1EQ9A 4NCYA 3BTDE 1YF4A 1ELTA 3AW1A 2OINA 1V2LT 4INLA 2JDID 1AE5A 1A0JA 1C2DA 1O2RA 5DP3A 2ZWLH 5HGGA 1AZZA 1DSTA 3W95A 1CE5A 1PPHE 1C2EA 3T25A 5GXPA 1WDIA 1Z71A 2FWWA 1C5QA 3M36A 3KHVA 4Y8YA 3D65E 2RDLA 3SNDA 2PSXA 4BNRA 2W6JD 1UVOA 2OC1A 5C5OA 2O8UA 1A4WH 3KIDU 1NFYA 2ANWA 2K8IA 2XBYA 4B76A 4NIYA 2CGAA 1SGRE 2NU4E 1YLCA 5AHGH 1C4Y2 1C1QA 1T8MA 4CHAB 3PTNA 1GJ8B 1ORFA 5B6OA 1XKBC 2XRCA 3DFJA 4AFZA 3NK8A 4WMEA 4ABGA 3MH4A 3Q3YA 1TWXB 4MPWA 1QFKH 4WH8A 2OC7A 3QX5H 2HALA 5A8YA 1V2VT 2H9EH 3TH2H 2OQUA 2WINI 4RT1A 5C67A 1DWCH 4MQAA 3QDZB 3RDZA 4ZKSU 1SLWB 1BQYA 1FN6A 1AVGH 2ZTXA 2VB0A 4O9VA 1G3DA 3SNAA 3SJIA 3OFND 2FOAA 1C1MA 3MTYA 1QBOA 3SQEE 1DS2E 1MKWK 3CS7A 3SV9A 3MWIU 1GCTB 1FNIA 2ZGHA 4XD7D 3ZZDA 1GMCF 1BHXB 4BTIB 1SSXA 3T62A 5LPRA 1TRNA 3VB7A 4Q2KA 1GJ9B 4HFPB 4DURA 1Z8GA 3RU4D 1C5MD 3P6ZB 1OWHA 2VBCA 3VGCC 3WW7A 2CK3D 2FTLE 3SU0A 1P2NA 2BY9X 2HLDD 3PWCA 1H4WA 1NFWA 1O2ZA 2QC2A 4A1VA 2TGTA 1SVPA 1O2OA 2VIDA 1XUGA 1Y8TA 1AUTC 1J16A 3LGTA 1DVAH 4X6OA 1AWFH 3GCHB 1BMLA 1QBNA 3A88A 1O3KA 2TGAA 3Q3KA 5F03A 1O2UA 1TONA 4TY7A 2SGAA 3TH4H 1FQ3A 2G4UA 2AFQB 1RIWC 1O36A 3BTME 2TGDA 1UHBB 3DSGA 4ISNA 3SV7A 1AUJA 2BLVA 3MH5A 1AMHA 2P8OC 2ZPQA 3UTUH 4JCNA 1M9UA 4Y7AA 1CGJE 2ZPSA 2QV1A 1SQRA 2ZDKA 3E3TA 1GG6C 1GBLA 2ZFTA 2VNTA 3LPRA 1ELGA 2ZDLA 1XVOA 3RU4E 2UWLA 4NWKA 4NFFA 3A8BA 1EASA 4O03A 5LH8A 1FLEE 2BY8X 2PLXA 2GDDA 1TNKA 3U1IB 1CHOG 3ZZ5A 4Q63A 4YOIA 2JETB 1SGFG 1Z8JB 3F9FA 1ARCA 1HAVA 3AK5A 3QN7A 2OP9A 1GL1A 5A0AE 5E2OA 4F48B 2Y7ZA 4ZKNU 1WTHD 2XNIA 3A85A 2QGRA 4KGAA 4TSFD 4MTBA 1SHHB 1SGIB 4KTSA 1P09A 1O2HA 1S5SA 1A46H 1GMHG 3CP7A 3EA8A 1AVXA 2ZTZA 3KF2A 2DE8A 2FYRA 1CGIE 3OU0A 4GCHG 1MTNB 2Y7XA 1O33A 1QHRB 1W0YH 1HCGA 3RMMH 1C5OH 1J14A 1K1OA 1OKXA 2PTCE 5DP8A 1CT4E 3QTVH 2SGQE 1J17T 3L33A 1E79D 4ACAA 1C1NA 1OSSA 1C9PA 3RXBA 1O3BA 5F8XA 2ZQ2A 4NA8A 1DY9A 2H5CA 4IBLH 1FI8A 4WH6A 2R3UA 3T29A 1D6RA 3UPEA 3F6UH 2K1QA 3RXVA 4LZ1H 2VIOA 5DSFA 2ASUB 1W2KH 5E2PA 3SO3A 1V2UT 1SBWA 5DP6A 4TWWA 2P3TB 1O35A 4MLFB 2VH6A 1W11U 2WPMS 1LO6A 2R0KA 2FIRH 2YNAA 1RJXB 3UQVA 4E05H 1HAIH 1LVMA 1G2LA 1HYLA 1O3JA 1L4DA 2G5VA 2G81E 4ISHH 2UUKB 1ABIH 1K1LA 6ESTA 1XXDA 5FBIA 1BCUH 4YM9A 3M37A 3RM0H 1UK2A 4JZEH 2J4IA 2LNCA 3SU2A 5JB8S 1H9LB 2SGEE 1XVMA 3FP6E 1WTGH 3OEHD 3SUFA 4CR9A 2O9QA 1NT1A 3ITIA 3VB6A 1ZSLA 3F2GA 1NTPA 2FDAA 1P04A 1K1JA 3SJKA 1UTKA 2G52A 2YOLA 3EA7A 2XC5A 1C1RA 2GGVB 2XW9A 4X6MA 1YGCH 4CH2B 1O0DH 2V3MA 2ZG0H 5IYTA 1LCYA 4P00A 3S7KB 1TABE 3QUMP 1DOJA 1C5VA 4JK5A 1LTOA 4MPUA 3LGYA 4ABJA 2ZHFH 1EAXA 2BMGB 1UHBA 2BD2A 2QAAA 2XYAA 1O5FH 2BDBA 3KYFA 1TAWA 4DIIH 1CSOE 1JIMA 1KXCA 1KTTB 1SKYE 1CHGA 3EDXB 4FETA 4DG4A 2FOMB 5A09A 2STBE 5C1UA 5CHAB 2ALPA 1VJAU 3P17H 4WXIA 2OC0A 3BSQA 1AU8A 1WOFA 1ANBA 1QJ6B 1MD7A 4XE4A 1MUEB 1BTHH 1P9UA 3B9FH 1WYKA 2Y5GA 4KP0A 2ZDAH 3LKWA 1BMMH 2ZFPH 1NU7B 2GTBA 1OX1A 4I8LA 2GV6A 3RUOA 1NFUA 6GCHG 3SOSA 7LPRA 1LKBA 1BBRE 3VB5A 2NU3E 2D1JA 2KM0A 3M35A 3PRDA 2JJ1D 3A7WA 3SQHE 1HAPH 1A3BH 4B75A 2CHAC 1DX5M 2C4FH 2WPKS 1S0QA 3S69A 4TWYA 4AC9A 3VPKA 1FV9A 1GJ7B 2GMTB 1HAXB 2K0QA 5CHBA 2P93A 3MYWA 4JYTA 4BXSA 3A82A 1IQIA 1Y59T 3U69H 2XBXA 3RMOH 2HOBA 1Z8IB 3SN8A 5LGOA 1XUKA 4AOQA 1NBMD 4F4OC 1DXWA 3HKJB 1TYNA 1IQMA 2C93B 1LPGB 2CV3A 1YCPM 1G36A 5A0CA 1K1PA 3P8NA 4ZROA 2BQ7B 2PKSC 1O3LA 3E91A 4B2CA 5L6NH 1BMNH 3MU8A 3GS9A 5E0HA 2ZO3H 3GISB 2JH6D 4YOGA 2IJOB 1O3PB 4BAOB 4U2WA 4CR5A 1VITF 2QN5T 4ZHMU 1BIOA 1YCPK 2ALVA 1C5LH 5EXLA 4DCDA 1BTWA 1DXPA 1GBEA 3ATWA 1UMAH 1YPLH 3RXCA 4ISLA 1AHTH 1UO6A 2XNDD 3U8TH 3F2FA 3EGKH 4XOJA 2F3CE 3B23B 2ZFRH 4K69A 3N99A 1F5RA 1Y3YA 1ZHMA 4Y8XA 4AB9A 1N8OB 4JZFH 1ELEE 3R3GB 2G5NA 3HK3B 2A4QA 1P2KA 2KAIB 1QRXA 2BXUH 3RXDA 1PPFE 1F92A 1VCWA 2BDYA 2BZ6H 5HYOA 1ELFA 3A80A 2GD4B 1A0LA 4D9RA 1ZPCA 1LHCH 1NBME 1C4V2 2FI3E 4X8TH 5DO4H 1TOMH 3PV5A 4I8GA 1AZ8A 1UK4A 3O8CA 1MTSA 1KXBA 2OQ5A 1GI1A 4JYUH 1QIXB 3SNCA 4ABAA 5FCKA 4XBCA 2VGCB 1WXRA 5L2ZH 2EY4C 1UTLM 1DPOA 3MI4A 1SQTA 3RXPA 3TGKE 1EUFA 1NESE 1V3XA 1Y5BT 2AMQA 2UUYA 3T2NA 3TU7H 5TCAA 1O5EH 1GGDC 5T6DA 2Y81A 2Z9LA 4AYVB 3MMGA 4R8TB 4CRCA 5JBTA 3GCNA 3TNSA 2EA3A 4TPYA 2OUAA 4FUJA 3V7TA 1UTOA 1O37A 1TQ0B 2GCHF 4AG2A 4X0WU 1FDPA 1SGCA 2Z9GA 4YXWD 1GVZA 3DHKH 4ZCNA 1NC6A 2V3HH 1IAUA 4WVPE 4B2AA 1SQAA 1KDQB 3K6ZA 1EXFA 2ZA5A 3MU4A 1N1LA 5EG4A 1G3CA 3UIRA 1TMBH 1SC8U 2VVUA 4ABEA 2Z9IA 1PJPA 1YPHE 3CS0A 3DUXH 3NPSA 3RXFA 3RXRA 1GHAF 1JRTA 8KME2 2A2XH 1E38B 4OS6A 1QA7A 1SGDE 2C3SA 5T6FA 3E6PH 3LGUA 3GDUA 4FVDA 3UR9A 2PGBB 3R0FA 5C1XA 2D2DA 3P70B 4D7FA 4I8HA 1IOEA 2A5IA 3BN9A 1OYQA 2VWOA 2WPLS 1SQOA 2F4LA 4ABBA 1QGFA 2KCYA 3MH6A 4KTUA 4WJG2 2GZ9A 2NWNA 3SUEA 1ACBE 2IOTA 3SU5A 1EFRD 5EQSA 2VIWA 1C5YB 3MNBA 4JZDH 1F0RA 1FN8A 3ZV9A 2J95A 2A31A 2TBSA 4Y7BA 4XDEA 1MKXH 5HIZA 1DUAA 1YY3A 4CRAA 5GWZA 3ATMA 2B7DH 2QF0A 1AWHB 2LELA 2ZCLP 2GCTC 2FP7B 1JMOH 2VIVA 1HXFH 2CMYA 1F0TA 1W13U 7KMEH 2ZGXH 1O2JA 1E1RD 1RGQA 1Y5AT 1BMFD 1WSSH 3T28A 2PFEA 1O2TA 1EZQA 1AO5A 2EQNA 1C5TA 3F0OA 4H6SB 2OLGA 3KQDA 2RG3A 1S84A 2UUJB 4ABHA 1TLDA 1ZHPA 3GY3A 4ESTE 3O8RA 1W10U 1UCYK 1UW7A 5EJZA 3TJOA 1DY8A 2WPDD 5DJ7A 1A5HA 1H8DH 4FXGH 2G51A 2OBOA 2DUCA 1CA0B 1GI6A 1SGPE 1TGNA 5DP7A 1SLXB 3SJ8A 1KXFA 5EPYA 4M7GA 5K7RA 2R0LA 2F83A 4UD9H 2EI7A 2FS9A 1T31A 5F6MA 3U98H 3M3VA 1DLEA 1FIZA 3BTKE 3UY9A 7GCHF 1WQVH 1K1IA 1V2MT 5AVDA 1SR5C 4UFEH 3TJVA 3RU4T 4OM9A 3T5FH 2J9NA 3QWCH 4FUBA 2JH0D 2ZNKH 2QXJA 3P8OA 2SGPE 2KCOA 3BIVH 2QXGA 3NXPA 1B0EA 1DWEH 5I25A 2ZDMA 1KLIH 1XUHA 4WMDA 2I6SA 4FUDA 3ZVBA 1ZR0A 3SUDA 1BITA 2ZI2H 3OAAD 1Z8RA 2BVSH 3BTEE 4NIVA 2HPPH 3RXGA 1TPAE 1TGSZ 3IWMA 2QE7D 4SGBE 1C1WH 5C3NA 1C9TA 3N7DA 3SW2B 1AFQB 1C1PA 3HKIB 1GHBG 3A83A 2FYQA 3B8JA 1ABJH 1GDQA 3GY6A 4DT7B 4Z6AH 1AB9C 5FPTA 1WU1A 2STAE 4PROA 1FPHH 2H6MA 4TY6A 1W14U 3NKKA 1BJVA 1QZ8A 1TQ7B 1GBIA 2FXRA 2PUQH 3OTPA 3RXIA 2WUCA 4YTAA 3VB3A 3SI3H 2VWNA 3UB0A 5EQRA 1KDQA 2BVXH 2Z9KA 1P3EA 2R3YA 2OBQA 2AIQA 1OWKA 1W7XH 2ULLA 5ESBA 1TPSA 1ZJKA 3ESTA 1IQJA 3AASA 5KGOA 1MAXA 2YNBA 4NGAH 3RP2A 1RFNA 3CENA 5GPIB 1EPTB 1W0KD 2VVVA 1G3BA 2Y5FA 1OWIA 1QRZA 3PV4A 1JBUH 1NFXA 3SU4A 1ZGVA 1C2JA 6LPRA 1ZTKA 2GX4A 2BHGA 4ABFA 1GJ5H 1KXAA 3GYMA 3K65B 3GYLB 3LOXA 4GVUA 3PMJA 1KSNA 1K1NA 3SUGA 4VGCC 2ZGBH 1N6XA 3NWUA 2ZPRA 3EA9A 1PYTC 2OC8A 3GDSA 5GCHG 2BLQA 1H9IE 1KTSB 5DP9A 1LHFH 1A7SA 1V2OT 1XKAC 1T4VH 1KLTA 1AGJA 2O8MA 1CBWC 4ZXXH 5FL7D 4DT4A 1XX9A 2HVXA 4IW4E 4A5TS 4ABIA 2BM2A 1N6YA 5FX5A 4NFEA 5HMAA 1V2WT 1QNJA 3FFGA 2QY0B 4IC5A 5C0UA 1O5BB 1ANEA 1AKSB 4BAQB 4YZUA 4AGKA 3PTBA 1ZJDA 2BXTH 1PFXC 2FO9A 5DGJA 1ZTLA 4TPIZ 1MKWH 3G01A 2AS9A 1GBMA 4B2BA 3I78A 1EATA 3RXTA 1GHZA 1TNGA 3F9HA 4A1TA 1NO9H 4YESB 1OWEA 4E7RG 1CO7E 3WWBA 4HTCH 1RXPA 5GDSH 3H7OA 1QL8A 2J97A 2FI4E 4RSPA 1RTKA 2TIOA 2F9UA 4TYDA 2ZU3A 1O30A 1TOCB 4DVAU 4ZMAH 5EODA 4X6NA 8GCHG 1FX0B 2PGQB 1EB2A 1ZLRA 1O3EA 1BOQA 1O2XA 2XC4A 4GPGA 3SGBE 1K9OE 1FUJA 2PKAB 3SGQE 4MDSA 2ZZUH 1F0UA 4B1TA 3U9AH 3M5MA 1EB1H 4J2YB 4Y11E 3T27A 2A7HA 1PPEE 2R2WU 3MHWU 4ZHLU 1V6DA 1MU6B 2ZCKP 1BTZA 1IQHA 1MTUA 1YPKH 2YMSC 4FU8A 1A5GH 1EP6A 2EI8A 2J2UA 3KQEA 3HGNA 5AFZH 1PQ7A 2CN0H 1H8IH 3VGCB 1OPHB 3Q76A 3FO8D 1SLVB 1O3IA 1E34B 3LIWA 5A8ZA 3SJOA 4ASUD 3FP7E 1IQFA 2B0FA 1O2MA 2W5EA 1DICA 1SGTA 3VEQB 1C2IA 2Q6GA 4I32A 2P95A 3F1SB 5JPMH 2WYJA 5GNDA 2D26C 2GZ7A 1FY3A 3AVZA 1JIRA 1SOZA 4FOUC 1S6LA 4HGCA 2SFAA 3ZVEA 1GI8B 2ZDNA 1G30B 1IQKA 1RIWB 2BX3A 3GCTG 2A4RA 2ZU1A 3RLYH 3IITA 2FX4A 1C5XB 2FPZA 2NU2E 2O8TA 5J4SA 1O2LA 1TGCA 3OY5U 4FUCA 2HLCA 2XOKD 1O2GH 2P8OB 4TT3D 2BY6X 3GY7A 4IN1A 1CT2E 1MCTA 2BB4A 1CHOF 5JDUB 1EPTA 2B8OH 1O32A 3MU1A 4AX9H 1GG6B 2AMDA 1P2QA 3QGJA 3M7QA 4NZLA 3V12A 1MABB 2H9HA 1SGQE 2AEIH 1SGNE 3SU3A 1ZPZA 3FN8A 5FBEA 1TA6A 3FZDA 1TNLA 1Q2WA 4X2VA 1C1OA 1INCA 3OX7U 1MZAA 2XWAA 2W6ID 3TGJE 2FI5E 1QRWA 4GCHF 1V2ST 3M5NA 2BD4A 3D62A 1D3DB 1GJ6A 1OHHD 2ZU4A 4I33A 3LJOA 1L1NA 3VFEA 5F53A 4DIHH 4UDWH 2NU1E 2BLWA 1YM0A 4Q80A 1ZGIA 1F7ZA 3E8LA 3LU9B 4FUGA 3UWJH 1DUEA 3NCLA 1SFQB 3ZZCA 3MNCA 4BAKB 1P10A 3LC5A 1MCVA 3RXEA 1O2IA 2TRMA 3QZQA 2FODA 3SGAE 1AKSA 2BOKA 3SHAH 3HGPA 3RXHA 1GDNA 3UUZA 1MTVA 1O3OA 1HJ9A 1BMAA 2FOHA 4OS4A 3E0PB 1BTUA 1K0HA 1T8OA 2VVCA 2WV5A 2F91A 3D23A 4WF8A 1VJ9U 3PB1E 1D3TB 1BBRH 4K60A 1WAYB 2IJD1 5ESTE 3GDVA 2BDGA 4X1RU 3UAIC 3M61U 3U8RH 1Y5UT 4AFQA 3URCA 2OD3B 1JOUB 3RLWH 5FCRA 3S9CA 2HWLB 2HRVA 5PTPA 3KNXA 3PLPA 3TK6A 2VWMA 1MMJN 2J34A 1FY8E 1EJAA 1C2MA 1NRRH 1Q3XA 3TK9A 3GY5A 5C17A 1ELDE 2WPIS 3VXEH 3DCLA 3FKSD 5E8EH 1LHEH 1VGCC 3U1JB 4E06H 2ZU5A 3E16B 4UFFH 1IQGA 1GHVH 5C20A 5C2ZA 1XUJA 2WYGA 2LPRA 4FU9A 3FVFB 2L74A 3LONA 1W0JD 2ZHWH 1ANDA 1UTNA 3FP8E 2XCNA 4LXBH 2BTCE 3PWBA 2F9BH 1LVYA 1A1RA 1E36B 2GVFA 3I29A 1PQ8A 1TBZH 3KGPA 1ZMLA 1HBTH 1HJAC 4B73A 2M5TA 1BJUA 1ZSJA 2TPIZ 4UONA 1VITG 1H9HE 1EOLA 3A8DA 3OTJE 2HVYB 1BTPA 3DSPA 2A5KA 2KCAA 1IQNA 1OP2A 2RDEA 4CBOA 2FESH 1FY1A 2VU8E 6GCHF 1VZQH 1P57B 3WWFA 4X8UH 4U01A 2VINA 2UWPA 2WHXA 2BDHA 1HAOH 1B0FA 2PWXA 3MU5A 1QB6A 1XUFA 3MO6A 5JB9S 5DPAA 2PP6A 1GHWH 5F8ZA 5H4IB 3SU1A 1O2YA 1MBMA 3RMNH 4KKDA 1E37B 1JRSA 3M3TA 4UEHH 3CNRA 1LMWB 4HG6A 1NRPH 4MNWA 3N7OA 3F2HA 2GT7A 1GBAA 1SOTA 3SV8A 1K21H 4K1EA 1Z1JA 1KMHB 2BDCA 2QA9E 1TBRH 3EE0B 4DOQA 1YPJH 2CHAB 4RT0A 1HUTH 1QJ7B 1XMNB 4BTTB 3DA9B 4YLQH 5BRRE 3V0XA 3NZIA 1DM4B 3PLBA 1G2MA 3MFJA 3JZ1B 5LPFA 3M7UA 5EOKA 2XC0A 1RTLA 2PR3A 2Z6BD 4X2YA 4U30A 4OS1A 1C5SA 1P03A 1TFXA 2FZZA 5T3HA 1C2HA 2KCPA 2ANYA 1EX3A 1GJDB 1OS8A 3UREA 4YO9A 1QBVH 2PV9B 3FAOA 1YCPH 1C1TA 1C5UA 2ZF0H 1OXGA 1P9SA 1L2EA 3ZZ6A 4BANB 2ZQ1A 2A2QH 2Z3DA 2A7CA 1TRMA 2PKSB 1COWD 2OK5A 1YBWA 1C2FA 1HAGE 1K1MA 4OGYA 1TB6H 1GBTA 1QR3E 1GBDA 4AORA 1D3QB 1UVTH 1YP9A 1AFEH 2P3UB 3BTQE 7ESTE 4CH8B 3A7TA 1EAUA 1BRBE 3S9BA 1QL9A 1HRTH 1VR1H 4KTCA 4AGJA 5EIYA 2OXSA 3OSYA 4MNYA 3SHCH 4WY3A 2OCVB 2W3IA 3BG4C 1C5PA 5TJXA 1THPB 3TK5A 2BD9A 1EJNA 2BYAX 1ETRH 1T8LA 4WMFA 3UNRA 4NG9H 5IDKA 3LH1A 1GI4A 1QB9A 1WUNH 2FLRH 4IS5A 2Z9JA 1FJSA 5C0TA 3OYPA 3E0NB 1FMGA 3WY8A 3A8CA 2F9VA 1B7XB 3RXSA 5T6GA 3H7TA 3L6PA 2ODQA 2V0BA 3RXAA 3BF6H 1NRSH 2ZFQH 1MKXK 2QYIA 3OE7D 3PO1C 1EAWA 4R0IA 2HGTH 2ZGCA 3E90B 3I77A 3PMBB 5FX6A 3SZNA 6CHAC 1G32B 3V3MA 1BT7A 2PUXB 3KEEA 4AN7A 1GJAB 4Q7ZA 3TH3H 1O3MA 5JBBS 2FTMA 1HPGA 1LHDH 4THNH 3HPTB 3KQ5A 3TITA 2FS8A 1G37A 1GBKA 1MBQA 3TIUA 1ESAA 1YPEH 2G8TA 1Z7KA 2HNTC 5L2YH 2QCYA 1P8VC 2PSYA 3SBKA 3VB4A 2AYWA 4X1SU 4AFUA 4Y71A 2RCEA 1FONA 1O5DH 3RXJA 1GGDB 5C5NA 1TNJA 1WCZA 2QXHA 4AG1A 1O34A 1QTFA 1GPZA 3KYGA 1QA0A 1DDJA 4K2YA 1O38A 1LDTT 2KR7A 1KIGH 5EU8A 3GY8A 1V2TT 5EXMA 4AB8A 3VG8A 5EPNA 1TRYA 4FUFA 2FOBA 1FXYA 9ESTA 3JZ2B 1AVWA 2P3FH 3PROA 3HATH 3RXMA 3KQCA 1O5AB 3BG4B 3NRLA 2FOFA 4D76A 1D9IA 5I46H 4NA7A 3UWIA 2J38A 1H8HD 2Z3EA 1EJMA 5EW2H 1IHTH 3PMHB 1GDUA 1WV7H 1ETTH 1DT2A 1GMDG 3ZVCA 1CA8B 1QQ4A 3TPIZ 1OOKB 4ZKRU 1H1BA 1ELBA 1VCQA 1PQAA 5CMXH 1TA2A 1THSH 2W7UA 2KAIA 3ATKA
chains in the Genus database with same CATH topology
3DFLA 1MD8A 1P02A 4K5ZA 1K28D 1SPJA 3ZV8A 1UTMA 1ZOMA 1IQLA 3F3BA 2XWBI 1A5IA 3LGWA 1ZYOA 2PTNA 2F9OA 3RXKA 3RXLA 3EYDA 1UK3A 4ZH8A 4HI3A 4ZKOU 4CHAC 2W3KA 1A61H 4X8VH 2GT8A 5JYIA 4IN2A 1BUIA 3V13A 1CT0E 3K9XB 3DD2H 2G55A 1YC0A 4XBDA 1Z6JH 1GBCA 1RD3B 2WUBA 3GY2A 5IK2D 4XFQA 1J15A 2THFB 1C5NH 3F9EA 2G4TA 4H42U 1UCYH 4B6FA 3GCOA 1P3CA 1TX6A 5AFYH 3STIA 4WWYA 2GCTB 4ISIH 2AGIX 4NIWA 4FVBA 1PYTD 2JH5D 5DP4A 1O3HA 3MU0A 4OS5A 1V2JT 4AFSA 1YYY1 3MO3A 1F0SA 1HV7A 1Y3VA 2FLBH 1T32A 1NN6A 1DLKB 5A0BA 1FZZA 1GCTC 1GJBB 1UCYE 1IHSH 1T4UH 1TALA 4I8KA 1DANH 4GAWA 2XBWA 1ZMJA 2GDEH 1O2KA 4HZHA 3M5LA 1G3EA 2BQ6B 3ZZ3A 2ESTE 2EEKA 3A84A 1WQSA 1HAVB 2Q1JA 1P0SH 1QQUA 3ELAH 2RA0A 2XBVA 3L3TA 2C8XB 2KFWA 3LGIA 3DT0H 4X2XA 1E0FD 4Q7XA 3O8BA 3PLKA 3ATLA 4NA9H 4JZ1A 1P2JA 1AI8H 3FANA 1NS3A 4GUXA 4BAMB 1BA8B 5DG6A 2WV9A 4O97A 5TCCA 1GMCG 4K3JA 4UFGH 3LC3A 1P12E 5G4BA 1SMFE 3GCHC 1BRUP 2CXVA 1O3NA 3LGVA 4X8SH 1L1GA 1GHBF 1O2NA 1THRH 3MO9A 3AAUA 1E1QD 4NSVA 2PHBA 2C90B 1BRAA 1EZSC 1MQ5A 3BEIB 4NWLA 2WSSD 2YMSD 4WXVA 1B5GH 2HNTF 1GVLA 1S0RA 1ESBA 1BZXE 4INHA 3A7VA 3ZZ8A 4ZAEA 1YLDA 3A8AA 1C1UH 1MZDA 1P2IA 4Q4LA 1HGTH 2F9PA 1AB9B 1CU1A 1TX7A 2Z3CA 3BTGE 4GHQA 1RRKA 4QT8C 3ZZ9A 5C1YA 4K1SA 2BY7X 3PM3A 1Z1IA 2WPJS 3BEFB 3ENSB 1MU8B 4NZQA 4DGJA 5T1VA 3Q77A 2JETC 3SORA 1ZSKA 1HFDA 4BOHA 1HJ8A 5GJ4B 4YOJA 1L4ZA 3SJ9A 4A6LA 4CRBA 3OY6U 4Y0YE 1NM6A 2BD7A 5BPEA 1PPCE 3U8OH 1P2OA 2SGFE 1OP8A 2I6QA 2ZHEH 5LPEA 3ZYDA 3FOAA 1P2MA 8ESTE 2VWLA 1O2SA 1L1JA 2ZCHP 5GCHF 1NRNH 1DSUA 1GBFA 5CDFE 4YT6H 1S85A 1V2RT 2H1UA 2AGEX 5EQQA 1S82A 3S0NA 1MTNC 4Y79A 4AYYB 2UWOA 1SB1H 4Y8ZA 4BAHB 4ABDA 2ZC9H 3P95A 3MH7A 4U32A 3NUMA 2RA3A 4X1PU 1VCPA 5A8XA 4VGCB 3UOPA 1NRQH 2ODYB 3M5OA 4CRFA 4A7IB 2Q6FA 3TJUA 4Q7YA 1FPCH 3UNQA 3MOCA 1GHXH 1A3EH 2ZEBA 5J4QA 1PPZA 2Y80A 1TNHA 1K2I1 2O8LA 4GHTA 1CBWB 1W0ZU 3ZZAA 2KZ4A 4XSKU 2BY5X 1ZRKA 2A45B 4D9QA 1F5LA 3TLOA 4DJZB 4B6EA 3AW0A 1GI3A 3PYHA 1VITH 3M7TA 1S6FA 1GI0A 2Y82A 4M9FA 1FY5A 1OP0A 2D8WA 2Z94A 3A81A 1EAIA 3TJNA 2FMJA 3SYJA 8GCHF 3RC5A 3C1KA 1V2PT 1BHXF 1PPGE 5DK1A 3QO6A 3F0PA 1QJ1B 1GL0E 3FZZA 5JBAS 4Y76A 3QK1A 3E1XB 1DFPA 4X6PA 1HIAB 2ZGJA 2BQWB 1K22H 1HNEE 3Q00A 3ZVGA 2SGDE 2VIQA 1DWDH 2GZ8A 2BD8A 3BEUA 4MNVA 3RC6A 2QXIA 2UUFB 1O39A 3BTHE 1GHYH 2TGPZ 1TMUH 1T8NA 4ISOA 3UQOA 3ATIA 4ZHAA 2CF9H 4D7GA 3QGNB 3ODFA 9LPRA 1AD8H 5AF9H 2BX4A 1EZUC 1FIWA 1AIXH 2SNWA 3A7YA 1O2QA 1KY9A 2VIPA 1ZPBA 4Z1MD 5F8TA 2J94A 4F55A 1HAZB 2HPQH 1GI5A 2P94A 2YMSB 1QURH 1GMHF 3RMLH 1S81A 2B9LA 4K8YA 5CHAC 2P59A 4ASHA 2WV4A 1EP5A 1O3GA 1V2QT 3P8FA 3PV2A 1LPKB 2ANKH 3GCTF 4E7NA 2AH4X 2FX6A 4YT7H 1KXDA 3PRBA 5FPYA 4O3TA 1BRCE 1HXEH 2Z7FE 5HKKD 1GBBA 4B71A 2CF8H 1MTWA 3URDA 2W7SA 1ELAA 2AHME 3SU6A 1BBRK 3QZRA 1TX8A 2ZP0H 1W8BH 2ZHQH 1SGYE 1GCDA 1IQEA 2GMTC 4RI0A 3LT3A 2OTVA 1OYTH 1SGFA 4NSYA 4RN6A 1ELCA 1QY6A 2JJ2D 1ANCA 2V7QD 3A87A 1GBJA 4LOYH 3SV2H 4MNXA 3UFAA 1ZZZA 4JZIA 2QF5A 1EKBB 2FOGA 1RTFB 2PKAA 3GICB 2Y5HA 2A4GA 2GKVE 3ZZ4A 4IGDA 1GBHA 3N7EA 3T26A 4D8NA 1TPPA 3UNSA 2WZQA 2ZDVH 1P11E 2GP9B 4GSOA 1CVWH 1RS0A 4LK4A 1PQ5A 1SG8B 1TE0A 5EW1H 2ZIQH 3QLPH 1H8ED 1AE8H 4X1NU 5DN6D 3S7HB 1XXFA 4Y10E 1MQ6A 4I7YH 4Z0KA 2V6NA 2IPHA 3SZEA 3C27B 1C2LA 1W3CA 2WPHS 1LVOA 2Q6DA 1C5ZB 3UR6A 2A1DB 1YPMH 1FAXA 1N8OC 2CJIA 1TGTA 1AQ7A 1Q31A 3KQBA 5FHTA 4KELA 3VXFH 3STJA 1NPMA 3PMAB 5JBCS 1P06A 1W12U 1O2PA 1D4PB 3A86A 2A4OA 1V2KT 1LPZB 1C2GA 1HIAA 3GY4A 8LPRA 1AY6H 1O31A 2O8WA 3A89A 2F43B 1OWJA 2AERH 1A0HB 1TBQH 3BTFE 3S9AA 1C1SA 1SL3A 3IG6B 3ZYEA 1ETSH 3Q3XA 1Y3WA 2VGCC 1UJ1A 2PW8H 3ODDA 5HXFA 1GI2A 1KXEA 4I8JA 2EC9H 2H5DA 2P16A 3W94A 3UOUA 2AMPA 1UTJA 5DKMA 1A2CH 1C1VH 3EAJA 4CBNA 4AZ2B 5B6LA 4IMQA 4UE7H 1Z6EA 4B74A 3QTOH 4DY7B 1CGHA 2B5TB 3D49H 4IMZA 4NIXA 1ZTJA 1FAKH 1GWAA 1ID5H 3RM2H 3ZVFA 1VGCB 1JWTA 1MAYA 4FU7A 2SNVA 2R9PA 4ZXYH 1FY4A 2V3OH 5E0GA 3ZZBA 4O3UA 1LHGH 5ABWA 1NU9A 3HK6B 1SHYA 2J5UA 2FOEA 1LQEA 1GI9B 1O3AA 2L6OA 2FOCA 3GOVB 4YLUA 1UVPA 5GIBA 2ZECA 1UTPA 3EQ0H 1O2VA 3OEED 4Y6DA 4H6TA 4IC6A 2M2AA 4FUEA 1HJAB 3TVJB 4MVNA 2BDAA 1DITH 2GCHG 4RKOB 2A0QB 4BTUB 3TGIE 4LZ4B 3ZVDA 4CRDA 5SGAE 2H2ZA 1DWBH 1YKTA 3K6YA 3M3SA 3A7ZA 4X1QU 3SV6A 1F5KU 3MNSA 1UTQA 3F9GA 3K2UA 1LQDB 2JKHA 2EI6A 1GHAG 2BLOA 2W26A 1NY22 5HM9A 1S6HA 1O5CB 1SFIA 1ELVA 1C2KA 1Y3XA 1G9IE 1F2SE 1J8AA 1SGEE 3O8DA 2IN2A 3LJJA 2QF3A 3KL6A 2BDIA 2VJ1A 3RC4A 1ZHRA 3TNTA 2BOHB 4Y0ZE 4RKJB 3A7XA 2J92A 1SI5H 4JK6A 1QL7A 2QF4A 3W1EA 1V2NT 1O3FA 2QIQA 3LH3A 3AAVA 4H4FA 3SNBA 3RXOA 5FAHA 2G00A 1WBGB 4FUHA 2ODPA 5ETXA 4FUIA 4J1YA 3KCGH 2HNTE 2XCFA 2ZKSA 1P01A 3BIUH 3KN2A 4GLYA 4OS7A 1TGBA 1YPGH 5HM2A 4CREA 1CA0C 1SLUB 4BXWA 2VH0A 3H09A 3BTTE 1TNIA 1BDAA 4UFDH 4JYVH 3P8GA 1MH0A 2ILNA 5EGMA 1ARBA 1X7AC 1HAYB 3MNXA 2ZHDA 4JMYA 1U6QA 4I31A 3LDXH 4F49A 1O5GH 1YPHC 3ZVAA 4INKA 2A5AA 1HAHH 1KLJH 1J9CH 3P92A 4OGXA 2BZAA 3H5CB 2ANMH 2A32A 1O3DA 1GVKB 5EXNA 1ESTA 2JIZD 1EOJA 2R2MB 1HB0B 2C8YB 1TPOA 2DE9A 1PPBH 1GI7B 1HLTH 4SGAE 1KYNA 4CRGA 1UVUH 1ZMNA 1L0ZA 1C5WB 1O2WA 2C8WB 1W7GH 1DE7H 1D3PB 5CE1A 3F68H 7GCHG 1TMTH 1P05A 1LKAA 3BG8A 5K0HA 1C5RA 2FM2A 4MG3A 1E35B 1AFQC 3RXQA 1AN1E 2BVRH 4DW2U 3ZZ7A 4MPXA 3SNEA 4X2WA 1UVSH 5DP5A 1T7CA 2AIPA 3PO1B 4MPVA 4A92A 5E0JA 2C8ZB 2ZU2A 4K8BA 4ZUHA 1GJ4H 6CHAB 3DSOA 1GJCB 3BTWE 5FPSA 1OWDA 1Y3UA 3ZIAD 1EZXC 2H9TH 1NZQH 1LVBA 4OS2A 2BD5A 5A2MH 2GV7A 1O3CA 2NU0E 1D6WA 2ZTYA 5L30H 1QB1A 2BD3A 1ZRBA 1BTXA 2ZFSA 4XBBA 2XTTB 4K1TA 1EPTC 1NROH 2A7JA 2V35A 1QCPA 1S83A 2FEQH 3RXUA 3SI4H 2XXLA 5FXLA 4A1XA 3BV9B 1XUIA 1CQQA 2AGGX 1TIOA 2ZFFH 2Y6TA 1GMDF 1BTYA 1BB0B 1XM1A 1HDTH 1C4U2 2F9NA 1JXPA 1EQ9A 4NCYA 3BTDE 1YF4A 1ELTA 3AW1A 2OINA 1V2LT 4INLA 2JDID 1AE5A 1A0JA 1C2DA 1O2RA 5DP3A 2ZWLH 5HGGA 1AZZA 1DSTA 3W95A 1CE5A 1PPHE 1C2EA 3T25A 5GXPA 1Z71A 2FWWA 1C5QA 3M36A 3KHVA 4Y8YA 3D65E 2RDLA 3SNDA 2PSXA 4BNRA 2W6JD 1UVOA 2OC1A 5C5OA 2O8UA 1A4WH 3KIDU 1NFYA 2ANWA 2XBYA 4B76A 2K8IA 4NIYA 2CGAA 1SGRE 2NU4E 1YLCA 5AHGH 1C4Y2 1C1QA 1T8MA 4CHAB 3PTNA 1GJ8B 1ORFA 5B6OA 1XKBC 2XRCA 3DFJA 4AFZA 3NK8A 4WMEA 4ABGA 3MH4A 3Q3YA 1TWXB 4MPWA 1QFKH 4WH8A 2OC7A 3QX5H 2HALA 5A8YA 1V2VT 2H9EH 3TH2H 2OQUA 2WINI 5C67A 1DWCH 4MQAA 3QDZB 3RDZA 4ZKSU 1SLWB 1BQYA 1FN6A 1AVGH 2ZTXA 2VB0A 4O9VA 1G3DA 3SNAA 3SJIA 3OFND 2FOAA 1C1MA 3MTYA 1QBOA 3SQEE 1DS2E 1MKWK 3CS7A 3SV9A 3MWIU 1GCTB 1FNIA 2ZGHA 4XD7D 3ZZDA 1GMCF 1BHXB 4BTIB 1SSXA 3T62A 5LPRA 1TRNA 3VB7A 4Q2KA 1GJ9B 4HFPB 4DURA 1Z8GA 3RU4D 1C5MD 3P6ZB 1OWHA 3VGCC 2VBCA 3WW7A 2CK3D 2FTLE 3SU0A 1P2NA 2BY9X 2HLDD 3PWCA 1H4WA 1NFWA 1O2ZA 2QC2A 4A1VA 2TGTA 1SVPA 1O2OA 2VIDA 1XUGA 1Y8TA 1AUTC 1J16A 3LGTA 1DVAH 4X6OA 1AWFH 3GCHB 1BMLA 1QBNA 3A88A 1O3KA 2TGAA 3Q3KA 5F03A 1O2UA 1TONA 4TY7A 2SGAA 3TH4H 1FQ3A 2G4UA 2AFQB 1RIWC 1O36A 3BTME 2TGDA 1UHBB 4ISNA 3SV7A 1AUJA 2BLVA 3MH5A 1AMHA 2P8OC 2ZPQA 3UTUH 4JCNA 1M9UA 4Y7AA 1CGJE 2ZPSA 2QV1A 2ZDKA 3E3TA 1GG6C 1GBLA 2ZFTA 2VNTA 3LPRA 1ELGA 2ZDLA 1XVOA 3RU4E 2UWLA 4NWKA 4NFFA 3A8BA 1EASA 4O03A 5LH8A 1FLEE 2BY8X 2PLXA 2GDDA 1TNKA 3U1IB 1CHOG 3ZZ5A 4YOIA 4Q63A 2JETB 1SGFG 1Z8JB 3F9FA 1ARCA 1HAVA 3AK5A 3QN7A 2OP9A 1GL1A 5A0AE 5E2OA 2Y7ZA 4ZKNU 1WTHD 2XNIA 3A85A 2QGRA 4KGAA 4TSFD 4MTBA 1SHHB 1SGIB 4KTSA 1P09A 1O2HA 1S5SA 1A46H 1GMHG 3CP7A 3EA8A 1AVXA 2ZTZA 3KF2A 2DE8A 2FYRA 1CGIE 3OU0A 4GCHG 1MTNB 2Y7XA 1O33A 1QHRB 1W0YH 1HCGA 3RMMH 1C5OH 1J14A 1K1OA 1OKXA 2PTCE 5DP8A 1CT4E 3QTVH 2SGQE 1J17T 3L33A 1E79D 1C1NA 1OSSA 1C9PA 3RXBA 1O3BA 5F8XA 2ZQ2A 4NA8A 1DY9A 2H5CA 4IBLH 1FI8A 4WH6A 2R3UA 3T29A 1D6RA 3UPEA 3F6UH 2K1QA 3RXVA 4LZ1H 2VIOA 5DSFA 2ASUB 1W2KH 5E2PA 3SO3A 1V2UT 1SBWA 5DP6A 4TWWA 2P3TB 1O35A 4MLFB 2VH6A 1W11U 2WPMS 1LO6A 2R0KA 2FIRH 2YNAA 1RJXB 3UQVA 4E05H 1HAIH 1LVMA 1G2LA 1HYLA 1O3JA 1L4DA 2G5VA 2G81E 4ISHH 2UUKB 1ABIH