2P59A

Crystal structure of hepatitis c virus ns3.4a protease
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
151
Chain Sequence
VEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords NS3
publication title Inhibitors of hepatitis C virus NS3.4A protease. Effect of P4 capping groups on inhibitory potency and pharmacokinetics.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 35
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2p59A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2p59A01
3VPKA 2Y81A 1Z1IA 3M7UA 3BEUA 4B2CA 1AMHA 1O33A 1EKBB 3OU0A 2H2ZA 3P8NA 3E16B 1RD3B 4ZXYH 3E91A 4Q2KA 2RA0A 2UUFB 3P8GA 2BLWA 4ISIH 4A1XA 1PPHE 1SLUB 3F9HA 4PROA 3MNCA 4U01A 1GGDC 1T8NA 3ATIA 3LGTA 1ELCA 1SLVB 3PV2A 2F4LA 1DUAA 1AI8H 4E7RG 2TGTA 2WPHS 2UUYA 1ANBA 3UQVA 1GI3A 1FI8A 1C4U2 1FMGA 3ODFA 3U69H 4D76A 2QV1A 1TRNA 1O3HA 2BVSH 4BTIB 3A86A 4F4OC 4ISHH 2A4GA 1C2LA 3F1SB 4ABGA 2XC4A 3Q3KA 4UFGH 1V2WT 3A85A 3K9XB 5EODA 1BTPA 3SUDA 1PYTC 1A3BH 1ZZZA 1AO5A 1THSH 3M5OA 4BTTB 3VB5A 3VB6A 1BA8B 2FO9A 3NK8A 2KAIA 1O2YA 3MH6A 4LZ4B 1YLCA 1SVPA 2BLOA 1QTFA 1YPEH 1VCWA 1QJ7B 3GCTG 1UHBA 3TJOA 2FYQA 2A4RA 4TY7A 5C3NA 4A6LA 5EXMA 3KGPA 5ABWA 1YF4A 2FI4E 2WZQA 5GCHG 1W7XH 1UTKA 3M3VA 1HIAB 4MQAA 5C20A 2ZGJA 3ATMA 1S0RA 2ZGBH 2G55A 6CHAB 9ESTA 1GI0A 1FV9A 1CA0B 1V2MT 1XXDA 1KXFA 1C5ZB 1K1MA 3LGIA 4IS5A 1ANEA 1L1GA 1BMAA 4ABIA 5ESTE 1ZMLA 3TVJB 3TH3H 1D3QB 1QL7A 1YPGH 4B74A 4K3JA 3EE0B 1AFEH 2O8MA 1V2OT 3FP6E 2Y5FA 3FP7E 1GVKB 1GDUA 1V2NT 3QGNB 1UVUH 1LVYA 1A61H 4FUBA 2RA3A 3TJVA 2ZHQH 9LPRA 1F0SA 3S9AA 1H9IE 2BQWB 3KQBA 2XWAA 2BQ7B 2JETC 1LPZB 1SBWA 1A46H 2XBWA 4B2AA 4Z6AH 1AU8A 3URCA 1ZJKA 1SGTA 2FOHA 5AFYH 1A0HB 2F9PA 1GCTB 3SNCA 4HI3A 1O3DA 3F6UH 2QYIA 1O0DH 3A8DA 4JZIA 4MPVA 1Z71A 4MNYA 1BMMH 1DX5M 3P92A 1BTZA 3A7TA 1MZAA 1P2QA 3LH1A 4O03A 3F68H 1JIRA 3BTHE 4DCDA 1GBCA 1Z8RA 3U1JB 1YLDA 4H4FA 6CHAC 3HK3B 5F8TA 1D3TB 1CA0C 1FONA 4X2WA 4GSOA 1NRNH 4TY6A 3S9CA 1TBRH 3OY5U 1NPMA 1E38B 3JZ1B 4WVPE 4XFQA 3QZRA 1WTHD 1OWIA 4O9VA 1J16A 1H9LB 1XVOA 2R9PA 1TE0A 5T1VA 1V2RT 1XUHA 1CSOE 1DICA 1QURH 1O35A 2H5CA 1AUJA 1C5XB 4NG9H 1Z6JH 1O2XA 1HBTH 1SMFE 2ZDNA 3TH2H 5TJXA 1QA0A 2ZDMA 5IDKA 4XBBA 2P59A 2V3HH 1PPCE 3GICB 1ZSKA 4X6PA 2FOAA 3SV6A 2NU4E 1XKAC 3BTKE 2K1QA 1V3XA 5TCCA 2J2UA 1DT2A 3ZZ8A 5C5OA 3RXUA 5ETXA 1G36A 1EAXA 1VITH 2WV5A 2BZ6H 3BEFB 1O3FA 1TB6H 2XTTB 3L6PA 5DP8A 2A5IA 2GDEH 1FJSA 7ESTE 1Q2WA 5FAHA 4ISOA 2FZZA 3DD2H 1AZ8A 4VGCB 1ZRKA 2STAE 1GHZA 3RU4E 1SLXB 1O2PA 2EI8A 1WV7H 1P2MA 4ABHA 1QHRB 1BITA 4MNVA 4X1PU 1WTGH 2H9EH 4BAHB 4OS4A 4AGKA 2FODA 4NFEA 3BTWE 4WF8A 4X2VA 1TRYA 1HNEE 3MYWA 1OP2A 3PV4A 4I7YH 4K8YA 1O32A 1OWHA 3ZZ4A 1HAVA 1NZQH 5I46H 1V2TT 5J4QA 3M37A 3SJ9A 2H6MA 4DG4A 1Q3XA 1TAWA 1CE5A 3MU5A 1O2KA 1O2QA 4BTUB 1GMHF 5EPYA 1C1PA 4NSVA 3PMJA 3S7KB 1G30B 4IC5A 2OK5A 2Z94A 4E05H 2FXRA 2OQ5A 4BXWA 4FUGA 3RLYH 1KXCA 1A0LA 3U9AH 7GCHF 3ZZ7A 1FLEE 4ZH8A 3PMAB 1W12U 4INLA 1CA8B 2ZGCA 3MNSA 4CBOA 5B6LA 1LPKB 1Y3WA 4YM9A 1MU6B 1O3IA 1W3CA 4DW2U 3RXEA 3SOSA 1TALA 1G3DA 6ESTA 3RU4D 1ETRH 3QK1A 4FUHA 1ESTA 4NWKA 2BX4A 4NA8A 3FZDA 1ESAA 3SNBA 1BBRE 5GIBA 4ZKSU 4K69A 3LGUA 4WWYA 1JMOH 3ZVGA 1ELVA 3L3TA 1EZUC 3QN7A 5HMAA 2Z9IA 3T27A 1RRKA 5LPRA 3UIRA 2ZDKA 5FPTA 1MMJN 1CBWB 5EQSA 1J17T 1HAOH 1K1LA 2JH5D 3UWJH 1TGSZ 3MO6A 4FUJA 1UO6A 2C90B 3BSQA 3M5LA 1SLWB 3ZZ3A 1UHBB 1IQFA 2TBSA 2O8LA 3AW1A 4CHAC 3MH4A 4TWWA 2ZTYA 1P0SH 2FWWA 4IC6A 2WV4A 1PPZA 1XX9A 3EYDA 2XC5A 4MPWA 4BAKB 1O2NA 3T29A 2EI6A 3RMLH 4GVUA 3Q3XA 2UUKB 3D49H 3ZZDA 1S81A 4HTCH 4KP0A 5I25A 3M7QA 3SU5A 4K60A 5JDUB 4Y71A 4Y76A 4THNH 3TGKE 1TIOA 3RXLA 2GD4B 2XCNA 3A7ZA 1GJ8B 1TX7A 5DP6A 1PPBH 4I8GA 1AHTH 3SV7A 4U30A 1AVGH 3U8TH 4ESTE 2H9HA 1BB0B 1D9IA 4ISNA 5LGOA 1L0ZA 1SI5H 4X8UH 3STIA 2XW9A 4NIYA 4FUDA 1L4ZA 1C2GA 5K0HA 2P3TB 3SU4A 3PMHB 1CHOG 2B5TB 1NT1A 1QIXB 1TOCB 4X1QU 1O3NA 2ODQA 3ATWA 1Z8JB 3K65B 1UTMA 1GHWH 1TA2A 4IMZA 1VCQA 1UMAH 1Y3UA 2BOHB 4Y8XA 4RKOB 1EX3A 2A7JA 4BNRA 1V2ST 3RXCA 3SHAH 4WMDA 2ZNKH 2FOGA 3RXVA 2O8UA 1GCDA 1MTNB 2BB4A 2OBQA 1ELEE 2BY8X 1XUGA 4AOQA 2VVVA 1GHAG 2GTBA 4OS6A 1V2JT 4D9RA 1TBQH 1E36B 4ZKOU 1TNLA 2HVXA 2SNWA 4UD9H 1NFWA 1XMNB 3BEIB 1MTSA 1LMWB 3GCTF 4MNXA 1KLIH 4MDSA 2ZU3A 1EQ9A 1UK2A 3SZNA 3AAUA 1YPMH 2PKSB 2AIPA 1IOEA 1ZRBA 4WY3A 2CF9H 3E6PH 1Q31A 1ZSJA 1YPHE 3SJOA 5GCHF 2PLXA 2A1DB 5A09A 3RUOA 3MNXA 4DURA 3SJIA 2G52A 1OX1A 4JZFH 4IMQA 3RXDA 3BTFE 2AMQA 1K1NA 1UVSH 2BDAA 3UUZA 3S7HB 1GJ6A 1ELDE 5DGJA 1WSSH 4HFPB 3L33A 1VJAU 4INKA 3A8BA 2YOLA 2VH6A 2VIOA 2PV9B 1C2KA 3BTEE 2VWOA 1G2LA 3M5NA 1BCUH 2A0QB 1QJ6B 3RC5A 3A89A 1O3BA 1SOZA 2AGEX 1C2MA 1L4DA 3A7WA 4BOHA 1V2QT 3E0NB 3SV9A 2ZIQH 1SQTA 1GMDG 1ELBA 3TNTA 3BTDE 1DXPA 1EJMA 4I8HA 2TRMA 4CRGA 3BG4B 1MTNC 1F92A 4ABEA 1DLKB 4AGJA 1TRMA 2ZQ1A 3GY3A 3VFEA 3AVZA 4DY7B 1EJAA 4DVAU 2SGAA 1H1BA 1UVPA 1GPZA 1O2IA 1EAIA 4Y0ZE 1TONA 1JXPA 1BTXA 1MH0A 2FS9A 4UFFH 1PQ5A 3N7OA 1DS2E 1CO7E 1KLTA 3RMOH 4ZKRU 2BOKA 5FHTA 5EPNA 2HNTE 1G37A 3M3SA 2PKSC 1P3CA 3KNXA 3IWMA 1TGTA 1MZDA 3ODDA 5L6NH 1SC8U 2FTMA 2W7SA 3DHKH 4E7NA 2Z3DA 2XWBI 1GJ5H 4A1VA 2A2QH 3T25A 1Z8GA 4A92A 3PO1C 4NIWA 2XNIA 5EW2H 1P05A 2FLBH 2P95A 1QQUA 3Q76A 4NIVA 1WAYB 2BD7A 2R3UA 3QWCH 5CHAB 1TGNA 2FDAA 2ALVA 1AE5A 5C67A 1AFQC 2Z3EA 2HOBA 1QQ4A 1FDPA 3SU6A 1DUEA 3RM0H 2PKAB 2AMPA 2PUQH 4DIIH 1O3LA 4FVDA 4YOJA 2UWLA 3A82A 1NO9H 2ZDAH 1MAYA 1HAVB 1BMLA 1V2UT 2NU0E 4GAWA 4YOIA 3CS7A 1HLTH 4UE7H 2QXHA 3P6ZB 1XUKA 3EGKH 2FPZA 5FBEA 1ZMJA 4I31A 1GJ7B 5CMXH 1HAXB 3UR9A 5DP7A 3ZV8A 2Z7FE 4BAMB 1O37A 1NFXA 8GCHG 1LHCH 4K1TA 4JYTA 3RMNH 3UOPA 3GY4A 1JBUH 1ZLRA 2G4TA 2PFEA 2ZGHA 2GCTC 2OC8A 4HZHA 2FIRH 3GCOA 5JB9S 1S85A 3QO6A 2PWXA 1OWJA 4OGXA 3A80A 2ZHDA 2BVRH 3HGPA 1GJCB 3SORA 1TGBA 1TNGA 2BDYA 3T2NA 4R0IA 1AKSA 3FAOA 3TGIE 2IJOB 1XUFA 1E37B 2WPKS 1FQ3A 3A8CA 1AD8H 2FX6A 1S83A 3AW0A 1FY1A 4YLQH 3LIWA 4ABFA 3RXOA 4LXBH 2ZP0H 1OYQA 3MH5A 5CHAC 4ZKNU 3ZZCA 4AFUA 3ZZAA 1BRAA 2OP9A 1LTOA 5EXLA 5F03A 1HJ9A 1NC6A 1G9IE 4Y6DA 2C8YB 1T32A 3PMBB 4X8VH 1ETTH 2B0FA 1Y5AT 3QDZB 5EXNA 3T5FH 1NFUA 2DE8A 1PQ7A 1GI7B 2BDBA 4NGAH 3IITA 4JZEH 2XBYA 2JETB 4BXSA 2THFB 1QBVH 4ZMAH 1OS8A 1O3PB 4CR5A 2FP7B 2B7DH 4AZ2B 2Q6GA 1RIWC 1TX6A 3FVFB 1FXYA 1TNJA 4X2XA 1O2OA 1PPFE 1DM4B 1SGPE 4CRAA 2EC9H 3LONA 3LKWA 1FN8A 1QJ1B 1SL3A 1TA6A 3DFLA 1QB9A 3GDVA 3ZZ9A 1BHXB 4JK6A 5CE1A 5JYIA 2W7UA 3LGVA 1GBEA 2G5VA 2FS8A 1PPGE 1O5FH 1EP5A 1GI2A 4IN1A 1AB9C 2IN2A 1BTWA 2Z9LA 1FY5A 4OS2A 2HPQH 2C3SA 4O97A 1UTOA 3ESTA 4XOJA 2Y80A 1CT4E 2AYWA 1QL9A 2HPPH 5H4IB 4AFZA 3HK6B 2ZCLP 1GBBA 3TJUA 1CGHA 2BD8A 1C5YB 4AN7A 3PB1E 4XBDA 5LPFA 1P2JA 3CENA 1C5UA 4TPYA 3RXKA 2F9OA 1OSSA 4YTAA 1HPGA 3SQEE 3E8LA 1P2IA 5EG4A 4OM9A 3O8CA 3T62A 1MQ5A 2BLQA 2V35A 4Q80A 2V3OH 2H9TH 1AWFH 4Y11E 2J38A 2GDDA 3DA9B 3V3MA 1ABIH 1UTJA 1W13U 1C5LH 3EA7A 1AVXA 4B1TA 1IQLA 1P9SA 5EGMA 1HJ8A 8LPRA 2ANYA 1KXEA 3LGWA 1SGYE 8ESTE 4X1NU 1ZPCA 2BZAA 1THRH 1PFXC 4D7FA 1VITG 3ZVCA 2HWLB 2Q1JA 2BVXH 3A84A 5EOKA 1U6QA 2BD4A 4KTUA 3C27B 2GZ7A 3SI4H 1UTPA 7KMEH 1DSTA 2VJ1A 4A7IB 3ITIA 4I8KA 2GVFA 2A4QA 2VIDA 1P03A 1MD7A 4YLUA 1CHOF 5DP3A 2CGAA 3STJA 5FPYA 1RTKA 1P04A 1O3JA 1CGJE 1GI9B 1P3EA 1MTVA 2OQUA 4JCNA 5JPMH 3AASA 2V6NA 2YNAA 3HKIB 1E34B 1QL8A 1JRTA 5EQRA 4NA7A 4WH8A 2ASUB 2FOMB 2VIVA 1AZZA 4XBCA 3B9FH 1AWHB 2VIPA 1C5SA 1C1OA 2P94A 1KTTB 4LK4A 1Y8TA 1G32B 2R2MB 3H5CB 1VGCB 3PLKA 4QT8C 3GCHC 3ZVFA 1GHAF 2GMTB 2BQ6B 1O38A 4JZDH 4DGJA 3E0PB 2SGFE 1N8OC 4CRCA 1F5LA 1N6YA 2Z3CA 3LOXA 3SZEA 1UTLM 4SGBE 4KKDA 5G4BA 1ZGIA 1C2HA 3RXHA 1GMCG 3F9EA 2M5TA 1IQJA 1O39A 3KEEA 1TPSA 1M9UA 1F0UA 1HDTH 3FFGA 1GDQA 1C1NA 2UWPA 2SGQE 1O2ZA 1C5RA 1H8IH 2A4OA 1N6XA 1EZSC 1ZR0A 2FMJA 3RC4A 5HM2A 1DITH 1SG8B 3LJOA 1K2I1 3VGCB 4UEHH 3P8FA 1LVMA 3M3TA 1ELFA 1ID5H 1QFKH 1JOUB 5A8YA 1EZQA 1EZXC 1LVOA 1T8OA 1A5GH 3GY5A 1CHGA 3O8DA 1DY8A 3SNEA 1A7SA 1GMDF 2BD3A 2ZDVH 3BIUH 1LDTT 4WXVA 4CH8B 5DJ7A 2PKAA 3TK5A 4CHAB 1P11E 1A1RA 1VGCC 1KTSB 2FOEA 3W95A 1O31A 2GMTC 2ZFPH 3SV8A 2XCFA 2QXJA 4CBNA 1C2JA 1GI6A 5AHGH 1P09A 4ZUHA 1SGFG 4Z0KA 5K7RA 1RTLA 3GDUA 3GY6A 2Y7XA 1LCYA 1WQSA 1O3AA 2BYAX 3W94A 1AKSB 2OINA 3SU2A 2BDCA 1O5AB 1O3OA 2V0BA 4RSPA 3BTGE 2FOFA 3ATKA 1V2LT 1V2VT 1O5EH 1A0JA 1W10U 4X6NA 3JZ2B 1ZPBA 2OUAA 3K2UA 2GGVB 2VIWA 1D3PB 3PV5A 4X1SU 3A87A 2WV9A 1JWTA 3BG8A 3M61U 4O3TA 3PROA 1CVWH 2ZPSA 1J15A 4FUEA 3MTYA 1C9TA 1RFNA 2BD2A 1LO6A 4X1RU 3KIDU 3VGCC 2A7HA 4YOGA 3UREA 1HRTH 1O3EA 2FI5E 4DT7B 5JB8S 1HCGA 2CXVA 2ZFQH 1KLJH 1K28D 1A5IA 2EA3A 2FLRH 3TK9A 5E0HA 2P3FH 1A4WH 4NA9H 2F83A 1HAHH 5E0JA 4ZHAA 2W3IA 1ZSLA 1DXWA 1OKXA 3TPIZ 3SQHE 1MTWA 4CREA 8GCHF 1GBLA 5DP4A 1MCVA 1QR3E 3H7OA 5AVDA 2SFAA 1FZZA 5E2OA 2PGQB 3E3TA 1GJ4H 3HATH 3ZYDA 4ZAEA 1SGEE 2SNVA 5LPEA 3TK6A 2AS9A 2QAAA 5A0AE 3ZYEA 1O2GH 1ELAA 3HPTB 2WPJS 5T6FA 1NROH 1GHXH 2J4IA 1OPHB 1IQNA 1PYTD 4ZXXH 1GI8B 1C5MD 4DJZB 1C1QA 1ARBA 3C1KA 1UCYK 2C8WB 5FXLA 2UWOA 1QBOA 1YPLH 3KQDA 3RDZA 4YESB 1SPJA 5JBAS 3F9FA 1EJNA 1FY4A 2C8ZB 1ELGA 1O5CB 4NZQA 3R3GB 1NTPA 1V2PT 2PR3A 3O8RA 3S0NA 2FESH 1NESE 1D3DB 1NM6A 1SB1H 3SGQE 3GY2A 2R3YA 2ZDLA 3K6YA 5FX6A 1D6RA 3MU0A 2ZC9H 1OP0A 4YO9A 4IN2A 2Q6FA 1DANH 1YC0A 1GHBG 2AH4X 1DDJA 3RXAA 1ZHPA 3SW2B 1UCYH 1QRZA 2F9NA 2W3KA 4D7GA 2ZU5A 5DKMA 1G2MA 3SUEA 5T3HA 3PM3A 2VBCA 1KDQA 2HNTF 1BRBE 1QBNA 1UVTH 3PTNA 4BAQB 4Y0YE 2J9NA 2XBXA 1TFXA 1J8AA 3I77A 2ILNA 2VINA 3RXGA 1P2OA 3KF2A 2AGIX 2PSXA 1SR5C 4X8SH 3A83A 3GDSA 1GJ9B 2AEIH 2VIQA 1MQ6A 1XM1A 1TOMH 1HXEH 2FTLE 1MUEB 1THPB 1UJ1A 2ANKH 2YNBA 1SGQE 3PO1B 3RXFA 1P12E 5L2YH 3LGYA 3T28A 4AORA 1N1LA 4FU8A 1AFQB 2F9VA 2CHAC 4FVBA 2VNTA 3S9BA 1K1PA 2VB0A 4J1YA 1F0RA 2ZFFH 5JBCS 3M36A 3EQ0H 4K1EA 2BDHA 1C2DA 4BAOB 1T8LA 2TGAA 1EPTC 4LOYH 3VB3A 2ZHWH 2QY0B 1EB2A 2G00A 2BY5X 1SFIA 5DPAA 4NIXA 2DE9A 5JBTA 1DFPA 2XC0A 4OGYA 4GCHG 2ZQ2A 3KN2A 2ZCHP 1LKBA 2ZPRA 1VZQH 1HB0B 5A0BA 1O2LA 2GCTB 1C1UH 1GBHA 2VWMA 2Y5GA 4RKJB 3MNBA 1C5VA 1F5KU 4X8TH 4AB9A 2A32A 1AGJA 3SO3A 1K9OE 3U8RH 1L1NA 4KELA 3BV9B 1YKTA 4FU9A 2Z9GA 2XBVA 2FEQH 4K5ZA 1BTYA 3BN9A 2BTCE 2BY9X 4MPXA 2W5EA 4OS7A 2GZ8A 1VITF 2OC0A 2F9BH 1IHSH 1MU8B 2BXUH 1TMUH 1GBIA 1PPEE 4AFQA 1Z6EA 3GY8A 4D8NA 1UK4A 2I6SA 4D9QA 2NU1E 4KTSA 1XUJA 1FIZA 1DWEH 3SYJA 2QN5T 1W0YH 3AK5A 2LNCA 1AVWA 7LPRA 4I8LA 3E90B 1OWDA 4J2YB 3ZZ5A 1GHVH 2BY6X 5BPEA 3NPSA 2XXLA 5EQQA 1RTFB 2XYAA 2F91A 1ANDA 3GISB 3A7VA 3UOUA 1AN1E 2G51A 3RLWH 1WXRA 2BLVA 3BTQE 5HYOA 3UR6A 3SNDA 3EA8A 5DP9A 2WUCA 2G4UA 5F8ZA 4ZHLU 2FYRA 1WYKA 3KL6A 3VB7A 3P70B 3U1IB 2RCEA 2ZG0H 4E06H 1PJPA 4CRBA 2BX3A 3MHWU 5IYTA 1GBMA 2J34A 1RIWB 4ZROA 1C5PA 3MU8A 1C5QA 1C5OH 4FU7A 1HXFH 2ODYB 4WMFA 5E8EH 1O36A 2GT7A 3NCLA 2BDIA 4Y8ZA 3PLBA 1CT0E 1O2SA 1Y3VA 1GMCF 1S0QA 2SGPE 4OS1A 3RXQA 1FPHH 3RXPA 3Q77A 1KSNA 1FN6A 4YT7H 1SGIB 2O8WA 1A5HA 3Q00A 1J14A 1B5GH 2F9UA 5TCAA 2QC2A 1A2CH 3SUFA 1OWEA 2QA9E 1AB9B 1MCTA 5FCRA 3ZVEA 1O30A 2NU3E 1K21H 1VCPA 1DOJA 1KXAA 2Z9KA 1BJVA 4CR9A 4CH2B 2I6QA 1EASA 3LC3A 3QZQA 3NUMA 2SGDE 3MO9A 1C1RA 2BY7X 5HM9A 3GOVB 1L2EA 2ZU1A 1C9PA 1TWXB 1E0FD 4Y7BA 2QCYA 1G3EA 1DWCH 2B9LA 2G81E 2ZFTA 2D2DA 2VU8E 3SI3H 4AB8A 1HAGE 4A1TA 4B6EA 1SGRE 2C93B 2GCHG 1HAIH 1FNIA 3GYLB 1A3EH 2ZZUH 2ZCKP 1EATA 2FX4A 1TLDA 3TNSA 4RI0A 2ZEBA 3QUMP 3RU4T 2ESTE 1MKXK 2P8OC 3H7TA 4GUXA 2ZTXA 1MBQA 2OD3B 3RM2H 1BT7A 1K1IA 2A7CA 1LHEH 3A7YA 1HUTH 5GNDA 1T8MA 4WJG2 4X6OA 4Y8YA 1GI4A 1GBKA 1O3GA 1BOQA 1C4V2 3P95A 1XVMA 3KQCA 2AFQB 3OTPA 1WQVH 4B71A 1IQMA 1ARCA 1UTQA 1DVAH 2WINI 1TX8A 2LPRA 2W26A 1TBZH 1K1JA 1VJ9U 4TWYA 1EOJA 3U98H 4XE4A 1WUNH 3TH4H 1GI1A 1BMNH 1MKXH 1SSXA 2EEKA 3SU3A 2RDLA 5T6DA 3UNRA 2ZFRH 2IJD1 1FPCH 1F5RA 2NU2E 1W2KH 1FIWA 8KME2 4WH6A 1Z8IB 2ZWLH 1BDAA 3VXFH 1Y59T 2OLGA 1OP8A 3MFJA 2ZU4A 1F7ZA 1ZJDA 2UUJB 5C5NA 2O9QA 2D8WA 5A2MH 3QTOH 3D23A 4GHTA 3NXPA 1BJUA 1HAYB 2G8TA 1B7XB 3RXMA 1H8DH 1KDQB 3SGBE 2BDGA 3GCHB 1ELTA 1P2KA 1EPTA 5AFZH 2ZTZA 2ULLA 1YPKH 1N8OB 2D26C 2CJIA 2GT8A 3QTVH 3PLPA 1GVLA 3BF6H 1Y5BT 4U2WA 2VWLA 1TMBH 2Y7ZA 2ZF0H 4ABBA 2OC7A 1QNJA 1SGFA 1ZTLA 2ANMH 2QF0A 1O2RA 4CRFA 3B8JA 5L2ZH 1MKWK 2VH0A 1S5SA 2ZHEH 5AF9H 2GV7A 4X0WU 1X7AC 2A5AA 2J94A 1P9UA 1K1OA 1EAWA 3M5MA 1IQHA 1YM0A 2BD9A 3B23B 1IQGA 1P57B 1Z1JA 2AERH 1HGTH 3KHVA 1QB1A 4I8JA 4HGCA 1TPAE 5GPIB 3VB4A 3VEQB 3SBKA 2A2XH 2ZO3H 5SGAE 1RGQA 4WMEA 2WPLS 1XXFA 2VWNA 1LHFH 4GHQA 4IGDA 5JBBS 1LHDH 3MMGA 4AYVB 1Y3YA 1W14U 3NKKA 3G01A 1B0EA 1TNKA 4Q7ZA 3T26A 3URDA 2H1UA 1EXFA 1HJAB 2WPMS 1LKAA 1MKWH 2F3CE 1EP6A 2STBE 4AX9H 1BUIA 1TABE 1NRRH 4NFFA 1QRXA 1LQEA 1SGNE 1YCPK 1JIMA 4Q7YA 2ZGXH 1FY8E 2PGBB 6GCHG 5PTPA 1Y5UT 1GHBF 3A81A 1NRSH 3OX7U 2OBOA 5C1YA 3V12A 1YPHC 1C2IA 3NWUA 3P17H 3ENSB 1DWBH 4MG3A 3O8BA 2NWNA 5E2PA 1ZMNA 1O3MA 1UCYE 1ZPZA 3ATLA 5J4SA 3LJJA 1BZXE 2P3UB 4ABDA 4M7GA 2OTVA 4XSKU 4ABAA 5GDSH 1TNIA 4DIHH 2FI3E 3PWBA 1ZHMA 1BRUP 4Y79A 1P06A 4JMYA 3MWIU 3ZZ6A 3ZVBA 1YP9A 2Z9JA 3LH3A 4UONA 6LPRA 1YCPH 1W0ZU 4DOQA 5GJ4B 1NN6A 1O2VA 3UNQA 3V0XA 1TPPA 1GCTC 3M7TA 1O2UA 2HGTH 2WYJA 5FX5A 4NSYA 3HKJB 1PQAA 2PHBA 2ZECA 1GBAA 3NZIA 4KTCA 3SU1A 1KY9A 2JH0D 5A8XA 4YZUA 1GJBB 2QXGA 2Y6TA 2WHXA 2BD5A 5A8ZA 4RN6A 1SOTA 2QXIA 1GBJA 1HJAC 1UK3A 1DWDH 1O3CA 1C1MA 4MVNA 1TGCA 2JH6D 1RS0A 1V6DA 1S6FA 4UDWH 3DT0H 1ZYOA 1QB6A 1P2NA 4MTBA 2ZKSA 1BRCE 3P8OA 1LVBA 2CF8H 2CN0H 1YCPM 2HNTC 4GCHF 4KGAA 2BMGB 2G5NA 3OSYA 1SHHB 3SU0A 3PTBA 5HXFA 4IW4E 4B76A 3RXTA 3RC6A 3LDXH 1SQAA 4JK5A 1GG6B 2TGPZ 5C1UA 1GWAA 2O8TA 1TQ7B 1P02A 4X2YA 1HV7A 4U32A 1F2SE 3TLOA 3SGAE 1ZHRA 1NY22 3MO3A 3TITA 1H4WA 1DSUA 1AIXH 1LPGB 3UWIA 2TPIZ 1AY6H 2PTNA 1GBDA 2HRVA 3SJ8A 3MH7A 2P93A 1C2FA 5BRRE 1ZOMA 1HAPH 1XKBC 3FANA 2PSYA 4Q7XA 1IQEA 1C1TA 2VVCA 2BXTH 1EOLA 1ZTKA 1WU1A 1GJAB 3RXRA 1O3KA 3RMMH 4NCYA 1W8BH 1WOFA 1IQKA 1BHXF 1KXBA 3PYHA 4K2YA 1YYY1 4ZHMU 1AUTC 1C5NH 4VGCC 1UTNA 1IQIA 1EUFA 3A8AA 4AG1A 4AYYB 3RXBA 2ZA5A 2PUXB 4JZ1A 1LHGH 1C5TA 1O2MA 1TQ0B 3ELAH 4FUFA 1BQYA 4TPIZ 3DUXH 4XDEA 2KAIB 1OXGA 1BTUA 2B8OH 3AAVA 2A31A 4GLYA 1EB1H 1AE8H 2H5DA 3LT3A 3IG6B 2HLCA 5L30H 2WYGA 5ESBA 1O5GH 1MBMA 5GWZA 1GG6C 3MU1A 3VXEH 3BTTE 4A5TS 4X6MA 3SN8A 4SGAE 1GL1A 1SGCA 2CV3A 1NU7B 1TPOA 3Q3YA 2A45B 1YGCH 2IOTA 3CP7A 3TGJE 1G3BA 1PQ8A 3SUGA 3GYMA 2CHAB 4I32A 4JYVH 5F6MA 2SGEE 2A5KA 2OXSA 3GCNA 1C2EA 3UY9A 3BIVH 2QGRA 1H9HE 2TIOA 4GPGA 1NU9A 1SHYA 1C4Y2 2FOCA 1EPTB 5DO4H 2DUCA 2GCHF 1O5DH 5DP5A 1BIOA 1INCA 1HIAA 1W11U 1YPJH 4JYUH 1HAZB 3V13A 1GBFA 1CT2E 1KXDA 1L1JA 1FAKH 2FOBA 4R8TB 4K8BA 3QGJA 2PW8H 1ACBE 2CMYA 2VGCB 3QX5H 5A0CA 1C1VH 3PWCA 3M35A 1WBGB 1QGFA 3TJNA 4IBLH 4Y10E 1F0TA 4H6SB 1CBWC 5HGGA 1TNHA 1NS3A 5EU8A 1NRPH 2ZFSA 2VVUA 2ZHFH 4H42U 3SHCH 4UFDH 1TYNA 3FP8E 4ASHA 2C4FH 2ANWA 5F8XA 1IAUA 1O2TA 3H09A 2HALA 4CRDA 1BTHH 2QF3A 4WXIA 4B2BA 1GJDB 3OYPA 3LC5A 1XUIA 3RXIA 1P8VC 2D1JA 2QIQA 1P01A 1ANCA 1JRSA 3KQEA 2JKHA 3FZZA 1OWKA 1W7GH 2R2WU 1GVZA 2WPIS 1T31A 5DG6A 1GL0E 1B0FA 1C1SA 1ORFA 3EDXB 3RXSA 3UFAA 4MLFB 3BTME 4O3UA 3OTJE 1D6WA 4F49A 1CQQA 5DK1A 1CU1A 1WCZA 5LH8A 2Y82A 1P10A 1SFQB 1ETSH 3GY7A 4K1SA 4MPUA 3HGNA 3UPEA 4FUCA 1QCPA 1LQDB 5C1XA 2ODPA 4M9FA 2AIQA 2FM2A 3WY8A 1GHYH 1CGIE 2Y5HA 3K6ZA 3RXJA 4LZ1H 1HFDA 3TIUA 1G3CA 3V7TA 1DY9A 1FAXA 3UNSA 1DE7H 1HYLA 3D65E 2GX4A 4INHA 1SQOA 3MOCA 2GP9B 2GKVE 2ZU2A 3EAJA 2OCVB 2VGCC 1QA7A 4H6TA 5FBIA 1NFYA 3LPRA 1TMTH 3R0FA 3RP2A 5B6OA 3MU4A 3A88A 2OC1A 3I29A 1YBWA 1MTUA 3F9GA 3ZVDA 4NZLA 2AMDA 2RG3A 4FXGH 1BBRK 2ZI2H 3QLPH 4ABJA 1MAXA 1IHTH 4OS5A 2XRCA 5EW1H 4B75A 2C8XB 4MNWA 3ZV9A 1FY3A 1GMHG 1Y3XA 2AGGX 4AG2A 1O2HA 1O2WA 1O5BB 2PTCE 4ISLA 1ABJH 1UVOA 1E35B 3UQOA 1ESBA 1GDNA 5GXPA 1KYNA 3D62A 1QY6A 1S84A 3DFJA 7GCHG 3OY6U 3U8OH 2ZPQA 1GI5A 3CS0A 1Z7KA 2BM2A 1C5WB 4B73A 2R0LA 3TU7H 3SJKA 5C2ZA 1GGDB 2BHGA 1T4UH 3I78A 1DPOA 1BBRH 1NRQH 2J92A 3SV2H 3A7XA 2P8OB 3SNAA 4Y7AA 3ZZBA 1SGDE 1S82A 1AQ7A 2EI7A 4B6FA 1S6HA 1MD8A 1RXPA 1J9CH 6GCHF 3ZVAA 4YT6H 5FCKA 2IPHA 1VR1H 4I33A 2TGDA 2P16A 4NWLA 1ZGVA 3E1XB 1ZTJA 1KIGH 5FPSA 1EAUA 1D4PB 1OYTH 4AFSA 1T7CA 3MI4A 1K22H 2Q6DA 3KCGH 4TYDA 3UTUH 3EA9A 1OOKB 2R0KA 2Z6BD 2GV6A 4UFEH 3BG4C 5E0GA 2GZ9A 1T4VH 3LU9B 1FUJA 4BANB 1O2JA 1RJXB 1O34A 2WUBA 1V2KT 1GBTA 2ALPA 3S69A 5T6GA 1C1WH 4FUIA 2J95A 1QRWA 1DLEA
chains in the Genus database with same CATH superfamily
3VPKA 2Y81A 4I86A 1Z1IA 3M7UA 3BEUA 4B2CA 1AMHA 1O33A 1EKBB 3OU0A 2H2ZA 3P8NA 3E16B 1RD3B 4ZXYH 3E91A 4Q2KA 2RA0A 2UUFB 3P8GA 2BLWA 4ISIH 4A1XA 1PPHE 1SLUB 3F9HA 4PROA 3MNCA 4U01A 1GGDC 1T8NA 3ATIA 3LGTA 1ELCA 1SLVB 3PV2A 2F4LA 1DUAA 1AI8H 4E7RG 2TGTA 1NBME 2WPHS 2UUYA 1ANBA 3UQVA 1GI3A 1FI8A 1C4U2 1FMGA 3ODFA 4XRNA 3U69H 4D76A 2QV1A 1TRNA 1O3HA 2BVSH 2KZ4A 4BTIB 3A86A 4F4OC 4ISHH 2A4GA 1C2LA 3F1SB 4ABGA 2XC4A 3Q3KA 4UFGH 1V2WT 3A85A 3K9XB 5EODA 1BTPA 3U28C 3SUDA 1PYTC 1A3BH 1ZZZA 1AO5A 1THSH 3M5OA 4RT1A 4BTTB 3VB5A 3VB6A 1BA8B 2FO9A 3NK8A 2KAIA 1O2YA 3MH6A 4LZ4B 1YLCA 1SVPA 2BLOA 2J97A 1QTFA 1YPEH 1VCWA 1QJ7B 3GCTG 1UHBA 3TJOA 2FYQA 2A4RA 4TY7A 5C3NA 4A6LA 5EXMA 3KGPA 5ABWA 1YF4A 2FI4E 2WZQA 5GCHG 1W7XH 1UTKA 3M3VA 1HIAB 4MQAA 5C20A 2QE7D 2ZGJA 3ATMA 1S0RA 2ZGBH 2G55A 6CHAB 9ESTA 1GI0A 1FV9A 1CA0B 1V2MT 1XXDA 1KXFA 1NBMD 1C5ZB 1K1MA 3LGIA 4IS5A 1ANEA 1L1GA 1BMAA 4ABIA 5ESTE 1ZMLA 3TVJB 2V7QD 1D3QB 3TH3H 1QL7A 1YPGH 4B74A 4K3JA 3EE0B 1AFEH 2O8MA 1V2OT 3FP6E 2Y5FA 3FP7E 1GVKB 4TSFD 1GDUA 1V2NT 3QGNB 1UVUH 1LVYA 1A61H 4FUBA 2RA3A 3TJVA 2ZHQH 9LPRA 1F0SA 3S9AA 1H9IE 2BQWB 3KQBA 3F0PA 2XWAA 4FETA 2BQ7B 2JETC 1LPZB 1SBWA 1A46H 2XBWA 4B2AA 2K8IA 4Z6AH 1AU8A 3URCA 1ZJKA 1SGTA 2FOHA 5AFYH 1A0HB 2F9PA 1E1QD 1GCTB 3SNCA 4HI3A 1O3DA 3F6UH 2QYIA 4FOUC 1O0DH 3A8DA 4JZIA 4MPVA 1Z71A 4MNYA 1BMMH 1DX5M 3P92A 1BTZA 3A7TA 1MZAA 1P2QA 4YXWD 3LH1A 4O03A 3F68H 1SKYE 1JIRA 3BTHE 4DCDA 1GBCA 1Z8RA 3U1JB 1YLDA 4H4FA 6CHAC 3HK3B 2PP6A 5F8TA 5DN6D 1D3TB 1CA0C 1FONA 4X2WA 4GSOA 1NRNH 4TY6A 3S9CA 1TBRH 3OY5U 1NPMA 1E38B 3JZ1B 4WVPE 4XFQA 3QZRA 1WTHD 1OWIA 4O9VA 1J16A 1H9LB 1XVOA 2R9PA 3OEED 1TE0A 5T1VA 1V2RT 1XUHA 1CSOE 1DICA 1QURH 1O35A 2H5CA 5HIZA 1AUJA 1C5XB 4NG9H 1Z6JH 1O2XA 1HBTH 1SMFE 2ZDNA 3TH2H 5TJXA 1QA0A 2ZDMA 5IDKA 4XBBA 2XOKD 2P59A 2V3HH 1PPCE 3GICB 1ZSKA 4X6PA 2FOAA 3SV6A 2NU4E 1XKAC 3BTKE 2K1QA 1V3XA 5TCCA 2J2UA 1DT2A 2WSSD 3ZZ8A 5C5OA 3RXUA 5ETXA 1G36A 1EAXA 2J98B 1VITH 2WV5A 2BZ6H 3BEFB 1O3FA 1TB6H 2XTTB 3L6PA 5DP8A 2A5IA 2YMSB 2GDEH 3F2HA 1FJSA 7ESTE 1Q2WA 5FAHA 4ISOA 2FZZA 3DD2H 1AZ8A 4VGCB 1ZRKA 2STAE 1GHZA 3RU4E 1SLXB 1O2PA 2EI8A 1WV7H 1P2MA 4ABHA 1QHRB 4Z1MD 1BITA 5F53A 4MNVA 5EJZA 4X1PU 1WTGH 2H9EH 4BAHB 1K0HA 4OS4A 4AGKA 2FODA 4NFEA 3BTWE 4WF8A 4X2VA 1TRYA 1HNEE 3MYWA 1OP2A 3PV4A 4I7YH 4K8YA 1O32A 1OWHA 3ZZ4A 1HAVA 1NZQH 5I46H 1V2TT 5J4QA 3M37A 3SJ9A 2H6MA 4DG4A 1Q3XA 1TAWA 1CE5A 3MU5A 1O2KA 1O2QA 4BTUB 1GMHF 5EPYA 1C1PA 4NSVA 3PMJA 3S7KB 1G30B 4IC5A 2OK5A 2Z94A 4E05H 2FXRA 2OQ5A 4BXWA 4FUGA 3RLYH 1KXCA 3KHVA 1A0LA 3U9AH 7GCHF 3ZZ7A 1FLEE 4ZH8A 3PMAB 1W12U 4INLA 1CA8B 2ZGCA 3MNSA 4CBOA 5B6LA 1LPKB 1Y3WA 4YM9A 1MU6B 1O3IA 1W3CA 4DW2U 3RXEA 3SOSA 1TALA 1G3DA 6ESTA 3RU4D 1ETRH 3QK1A 4FUHA 1ESTA 4NWKA 2BX4A 4NA8A 3FZDA 1ESAA 3SNBA 1BBRE 5GIBA 4ZKSU 4K69A 3LGUA 4WWYA 1JMOH 3ZVGA 1ELVA 3L3TA 1EZUC 3QN7A 5HMAA 2Z9IA 3T27A 1RRKA 5LPRA 3UIRA 2ZDKA 5FPTA 1MMJN 1CBWB 5EQSA 1J17T 1HAOH 1K1LA 2JH5D 3UWJH 1TGSZ 3MO6A 4FUJA 1UO6A 2C90B 3BSQA 3M5LA 1SLWB 3ZZ3A 1UHBB 1IQFA 2TBSA 4P00A 2O8LA 3AW1A 4CHAC 3MH4A 4TWWA 2ZTYA 1P0SH 2FWWA 4IC6A 2WV4A 1PPZA 1XX9A 3EYDA 2XC5A 4MPWA 4BAKB 3F2FA 1O2NA 3T29A 2EI6A 3RMLH 4GVUA 3Q3XA 2UUKB 3D49H 3ZZDA 1S81A 4HTCH 4KP0A 5I25A 3M7QA 3SU5A 4K60A 5HIYA 5JDUB 4Y71A 4Y76A 4THNH 3TGKE 1TIOA 3RXLA 2GD4B 2XCNA 3A7ZA 1GJ8B 1TX7A 5DP6A 2IPQX 1PPBH 4I8GA 1AHTH 3SV7A 4U30A 1AVGH 3U8TH 4ESTE 2H9HA 1BB0B 1D9IA 4ISNA 5LGOA 1L0ZA 1SI5H 4X8UH 3STIA 2XW9A 4NIYA 4FUDA 1L4ZA 1C2GA 5K0HA 2P3TB 3SU4A 3PMHB 1CHOG 2B5TB 1NT1A 1QIXB 1TOCB 4X1QU 1O3NA 2ODQA 3ATWA 1Z8JB 3K65B 1UTMA 1GHWH 1TA2A 4IMZA 1VCQA 1UMAH 1Y3UA 2BOHB 4Y8XA 4RKOB 1EX3A 2A7JA 4BNRA 1V2ST 3RXCA 3SHAH 4WMDA 2ZNKH 2FOGA 3RXVA 1MABB 2O8UA 3N99A 1GCDA 1MTNB 2BB4A 2OBQA 1ELEE 1E1RD 2BY8X 1XUGA 4AOQA 2VVVA 1GHAG 2GTBA 4OS6A 1V2JT 4D9RA 1TBQH 1E36B 4ZKOU 1TNLA 2HVXA 2SNWA 4UD9H 1NFWA 1XMNB 3BEIB 1MTSA 1LMWB 3GCTF 4MNXA 1KLIH 4MDSA 2ZU3A 1EQ9A 1UK2A 3SZNA 3AAUA 1YPMH 2PKSB 2AIPA 1IOEA 1ZRBA 4WY3A 2CF9H 3E6PH 1Q31A 1ZSJA 1YPHE 3SJOA 5GCHF 2PLXA 5HKKD 2A1DB 5A09A 3RUOA 3MNXA 4DURA 3SJIA 2G52A 1OX1A 4JZFH 4IMQA 3RXDA 3BTFE 2AMQA 1K1NA 1UVSH 2BDAA 3UUZA 3S7HB 1GJ6A 1ELDE 5DGJA 1WSSH 4HFPB 3L33A 2WPDD 1VJAU 4INKA 3A8BA 2YOLA 5KECA 2VH6A 2VIOA 2PV9B 1C2KA 3BTEE 2VWOA 1G2LA 3M5NA 1BCUH 2A0QB 1QJ6B 3RC5A 3A89A 1O3BA 1SOZA 2AGEX 1C2MA 1L4DA 3A7WA 4BOHA 1V2QT 3E0NB 3SV9A 2ZIQH 1SQTA 1GMDG 1ELBA 3TNTA 3BTDE 1DXPA 1EJMA 4I8HA 2TRMA 4CRGA 3BG4B 1MTNC 1F92A 4ABEA 1DLKB 3VG8A 4AGJA 1TRMA 2ZQ1A 3GY3A 3VFEA 3AVZA 4DY7B 1EJAA 4DVAU 2SGAA 1H1BA 1UVPA 1GPZA 1O2IA 1EAIA 4Y0ZE 1TONA 1JXPA 1BTXA 1MH0A 2FS9A 4UFFH 1PQ5A 3N7OA 1DS2E 1CO7E 1KLTA 3RMOH 4ZKRU 2BOKA 5FHTA 5EPNA 2HNTE 1G37A 3M3SA 2PKSC 1P3CA 3KNXA 3IWMA 1TGTA 1MZDA 3ODDA 5L6NH 1SC8U 2FTMA 2W7SA 3DHKH 4E7NA 2Z3DA 2XWBI 1GJ5H 4A1VA 2A2QH 3T25A 1Z8GA 4A92A 3PO1C 4NIWA 2XNIA 5EW2H 1P05A 2FLBH 2P95A 1QQUA 3Q76A 4NIVA 1WAYB 2BD7A 2J98A 4ASUD 2R3UA 3QWCH 2L6OA 5CHAB 1TGNA 2FDAA 2ALVA 1AE5A 5C67A 1AFQC 2Z3EA 2HOBA 1QQ4A 2KCOA 1FDPA 3SU6A 1DUEA 3RM0H 2PKAB 2AMPA 2PUQH 4DIIH 1O3LA 4FVDA 4YOJA 2UWLA 3A82A 1NO9H 2ZDAH 1MAYA 1HAVB 1BMLA 3PRDA 1V2UT 2NU0E 4GAWA 4YOIA 3CS7A 1HLTH 4UE7H 2QXHA 3P6ZB 1XUKA 3EGKH 2FPZA 5FBEA 1ZMJA 4I31A 1GJ7B 5CMXH 1HAXB 3UR9A 5DP7A 3ZV8A 2Z7FE 4BAMB 1O37A 1NFXA 8GCHG 1LHCH 4K1TA 4JYTA 3RMNH 3UOPA 3GY4A 1JBUH 1ZLRA 2G4TA 2PFEA 4ZCNA 2ZGHA 2GCTC 2QF4A 2OC8A 2W6ID 4HZHA 2FIRH 3GCOA 5JB9S 1S85A 3QO6A 2PWXA 4AC9A 1OWJA 4OGXA 3A80A 2ZHDA 2BVRH 3HGPA 1GJCB 3SORA 1TGBA 3N7EA 1TNGA 2BDYA 3T2NA 4R0IA 1AKSA 3FAOA 3TGIE 2IJOB 1XUFA 1E37B 2WPKS 3F0OA 1FQ3A 3A8CA 1AD8H 2FX6A 1S83A 3AW0A 1FY1A 4YLQH 3LIWA 2KCYA 4ABFA 3RXOA 4LXBH 2ZP0H 1OYQA 3MH5A 5CHAC 4ZKNU 3ZZCA 4AFUA 2J5UA 3ZZAA 1BRAA 2OP9A 1LTOA 5EXLA 5F03A 1HJ9A 1NC6A 1G9IE 4Y6DA 2C8YB 3NRLA 1T32A 3PMBB 4X8VH 3OAAD 1ETTH 2B0FA 1Y5AT 3QDZB 5EXNA 3T5FH 1NFUA 2DE8A 1PQ7A 1GI7B 2BDBA 4NGAH 3IITA 4JZEH 2XBYA 2JETB 2YMSD 4BXSA 2THFB 1QBVH 4ZMAH 1OS8A 1O3PB 4CR5A 2FP7B 2B7DH 4AZ2B 2Q6GA 1RIWC 1TX6A 3FVFB 1FXYA 1TNJA 4X2XA 1O2OA 1PPFE 1DM4B 1UW7A 1SGPE 4CRAA 2EC9H 3LONA 5EIYA 3LKWA 1FN8A 1QJ1B 1SL3A 1TA6A 3DFLA 1QB9A 3GDVA 3ZZ9A 1BHXB 4JK6A 5CE1A 5JYIA 2W7UA 3LGVA 1GBEA 2G5VA 2FS8A 1PPGE 1O5FH 1EP5A 1GI2A 4IN1A 1AB9C 2IN2A 1BTWA 2Z9LA 1FY5A 4OS2A 2HPQH 2C3SA 4O97A 1UTOA 3ESTA 4XOJA 2Y80A 1CT4E 2AYWA 1QL9A 2HPPH 5H4IB 4AFZA 1WDIA 3HK6B 2ZCLP 1GBBA 3TJUA 1CGHA 2BD8A 1C5YB 4AN7A 3PB1E 4XBDA 5LPFA 1P2JA 3CENA 1C5UA 3F2GA 4TPYA 3RXKA 2F9OA 1OSSA 4YTAA 1HPGA 3SQEE 3E8LA 1P2IA 4OM9A 5EG4A 3O8CA 3T62A 2HVYB 5C0TA 1MQ5A 2BLQA 2V35A 4Q80A 2V3OH 2H9TH 1AWFH 4Y11E 2J38A 2GDDA 3DA9B 3V3MA 1ABIH 1UTJA 3DCLA 1W13U 1C5LH 3EA7A 1AVXA 4B1TA 1IQLA 2EQNA 1P9SA 5EGMA 1HJ8A 8LPRA 1W0KD 2ANYA 1KXEA 2HLDD 3LGWA 1SGYE 8ESTE 4X1NU 4RT0A 1ZPCA 2BZAA 1THRH 1PFXC 4D7FA 1VITG 3ZVCA 2HWLB 2Q1JA 2BVXH 3A84A 5EOKA 1U6QA 2BD4A 4KTUA 3C27B 3WWBA 2GZ7A 3SI4H 1UTPA 7KMEH 1DSTA 2VJ1A 4A7IB 3ITIA 4I8KA 2GVFA 2A4QA 2VIDA 1P03A 2JJ1D 1MD7A 3FO8D 4YLUA 1CHOF 5DP3A 2CGAA 3STJA 5FPYA 1RTKA 1P04A 1O3JA 1CGJE 1GI9B 1P3EA 1MTVA 2OQUA 3EE7A 4JCNA 5JPMH 3AASA 2V6NA 2YNAA 3HKIB 1E34B 2KCPA 1QL8A 1JRTA 5EQRA 4NA7A 4WH8A 2ASUB 2FOMB 2VIVA 1AZZA 4XBCA 3B9FH 1AWHB 2VIPA 1C5SA 1C1OA 2P94A 1KTTB 4LK4A 1Y8TA 1G32B 2R2MB 3H5CB 1VGCB 3PLKA 4QT8C 3GCHC 3ZVFA 5KEDA 1GHAF 2GMTB 2BQ6B 1O38A 4JZDH 4DGJA 3E0PB 2SGFE 1N8OC 4CRCA 1F5LA 1N6YA 2Z3CA 4ACBA 3LOXA 4P02A 3SZEA 1UTLM 4SGBE 4KKDA 5G4BA 1ZGIA 1C2HA 3RXHA 1GMCG 3F9EA 2M5TA 1IQJA 1O39A 3KEEA 1TPSA 1M9UA 1F0UA 1HDTH 3FFGA 1GDQA 1C1NA 2UWPA 2SGQE 1O2ZA 1C5RA 1SQRA 1H8IH 2A4OA 1N6XA 1EZSC 1ZR0A 2FMJA 3RC4A 4TT3D 5HM2A 1DITH 1SG8B 3LJOA 1K2I1 2KR7A 3VGCB 4UEHH 3P8FA 3DSOA 1LVMA 3M3TA 1ELFA 1ID5H 1QFKH 1JOUB 5A8YA 5DSFA 1EZQA 1EZXC 1LVOA 5EJLA 1T8OA 1A5GH 3GY5A 1CHGA 3O8DA 1DY8A 3SNEA 1A7SA 1GMDF 3KYGA 2BD3A 2ZDVH 3BIUH 1LDTT 4WXVA 4CH8B 5DJ7A 5KGOA 2PKAA 3TK5A 4CHAB 1P11E 1A1RA 3FN8A 1VGCC 1KTSB 2FOEA 3W95A 1O31A 2GMTC 2ZFPH 1KMHB 3SV8A 2XCFA 2QXJA 2AHME 1C2JA 1GI6A 5AHGH 1P09A 4ZUHA 1SGFG 4Z0KA 4CBNA 1RTLA 3GDUA 5K7RA 3GY6A 2Y7XA 1LCYA 1WQSA 1O3AA 2BYAX 2GJGA 3W94A 1AKSB 2OINA 3SU2A 2BDCA 1O5AB 1O3OA 2V0BA 4RSPA 3BTGE 2FOFA 3ATKA 1V2LT 1V2VT 1O5EH 1A0JA 1W10U 4X6NA 3JZ2B 1ZPBA 2OUAA 3K2UA 2GGVB 2VIWA 1D3PB 3PV5A 4X1SU 2WV9A 3A87A 1JWTA 3BG8A 3M61U 4O3TA 3PROA 3WW7A 1CVWH 2ZPSA 1J15A 4FUEA 3MTYA 1C9TA 1RFNA 2BD2A 1LO6A 4X1RU 3KIDU 3VGCC 2A7HA 4YOGA 3UREA 1HRTH 1O3EA 2FI5E 4DT7B 5JB8S 1HCGA 2CXVA 2ZFQH 1KLJH 1K28D 1A5IA 2EA3A 2FLRH 3TK9A 5E0HA 2P3FH 5C17A 1A4WH 4NA9H 2F83A 1HAHH 5E0JA 4ZHAA 2W3IA 1QZ8A 1ZSLA 1DXWA 1OKXA 3TPIZ 3SQHE 1MTWA 4CREA 8GCHF 1GBLA 5DP4A 1MCVA 1QR3E 3H7OA 5AVDA 2SFAA 1FZZA 5E2OA 2PGQB 3E3TA 1GJ4H 3HATH 3ZYDA 4ZAEA 1SGEE 2SNVA 5LPEA 3TK6A 2AS9A 2QAAA 5A0AE 3ZYEA 1O2GH 1ELAA 3HPTB 2WPJS 5T6FA 1NROH 1GHXH 2J4IA 1OPHB 1IQNA 1PYTD 4ZXXH 1GI8B 1C5MD 4DJZB 1C1QA 1ARBA 3C1KA 1UCYK 2C8WB 3ZIAD 5FXLA 2UWOA 1QBOA 1YPLH 3KQDA 3RDZA 4YESB 1SPJA 5JBAS 3F9FA 1EJNA 1FY4A 2C8ZB 1ELGA 1O5CB 4NZQA 3R3GB 4Q63A 1NTPA 1V2PT 2PR3A 3O8RA 3MQKC 3S0NA 2FESH 1NESE 1D3DB 1NM6A 1SB1H 3SGQE 3GY2A 2R3YA 2ZDLA 3K6YA 5FX6A 1D6RA 3MU0A 2ZC9H 1OP0A 4YO9A 4IN2A 2Q6FA 1DANH 1YC0A 1GHBG 2AH4X 1DDJA 3RXAA 1ZHPA 3SW2B 1UCYH 1QRZA 2F9NA 2W3KA 4D7GA 2ZU5A 5DKMA 1G2MA 3SUEA 5T3HA 3PM3A 2VBCA 1KDQA 2HNTF 1BRBE 1QBNA 1UVTH 3PTNA 4BAQB 4Y0YE 2J9NA 2XBXA 1TFXA 1J8AA 3I77A 2ILNA 2VINA 3RXGA 1P2OA 3KF2A 2AGIX 2PSXA 1SR5C 4X8SH 3A83A 3GDSA 1GJ9B 2AEIH 2VIQA 1MQ6A 1XM1A 1TOMH 3KYFA 1HXEH 2FTLE 1MUEB 1THPB 1UJ1A 2ANKH 2YNBA 1SGQE 3PO1B 3RXFA 1P12E 5L2YH 3LGYA 3T28A 4AORA 1N1LA 4FU8A 1AFQB 2F9VA 2CHAC 4FVBA 2VNTA 3S9BA 1K1PA 2VB0A 4J1YA 1F0RA 2ZFFH 5JBCS 3M36A 1S6LA 3EQ0H 4K1EA 2BDHA 1C2DA 4BAOB 1T8LA 5CDFE 2TGAA 4F55A 1EPTC 4LOYH 3VB3A 2ZHWH 2QY0B 1EB2A 1W0JD 2G00A 2BY5X 1SFIA 5DPAA 4NIXA 2DE9A 5JBTA 1DFPA 2XC0A 4OGYA 4GCHG 2ZQ2A 3KN2A 2ZCHP 1LKBA 2ZPRA 1VZQH 1HB0B 5A0BA 1O2LA 2GCTB 1C1UH 1GBHA 2VWMA 2Y5GA 4RKJB 3MNBA 1C5VA 1F5KU 4X8TH 4AB9A 2A32A 1AGJA 3SO3A 1K9OE 3U8RH 1L1NA 4KELA 3BV9B 3OE7D 1YKTA 4FU9A 2Z9GA 2XBVA 2FEQH 4K5ZA 1BTYA 3BN9A 2BTCE 2BY9X 4MPXA 2W5EA 4OS7A 2GZ8A 1VITF 2OC0A 2F9BH 1IHSH 1MU8B 2BXUH 1TMUH 1GBIA 1PPEE 4AFQA 1Z6EA 3GY8A 4D8NA 1UK4A 2I6SA 4D9QA 2NU1E 4KTSA 1XUJA 1FIZA 1DWEH 2F43B 3SYJA 2QN5T 1W0YH 3AK5A 1YY3A 2LNCA 1AVWA 7LPRA 4I8LA 3E90B 1OWDA 4J2YB 3ZZ5A 1GHVH 2BY6X 5BPEA 3NPSA 2XXLA 5EQQA 1RTFB 2XYAA 2F91A 1ANDA 3GISB 3A7VA 3UOUA 1AN1E 2G51A 3RLWH 1WXRA 2BLVA 3BTQE 5HYOA 3UR6A 3SNDA 3EA8A 5DP9A 2WUCA 2G4UA 5F8ZA 4ZHLU 2FYRA 1WYKA 3KL6A 3VB7A 3P70B 3U1IB 2RDEA 2RCEA 2ZG0H 4E06H 1PJPA 4CRBA 2BX3A 3MHWU 5IYTA 1GBMA 2J34A 1RIWB 4ZROA 1C5PA 3MU8A 1C5QA 1C5OH 4FU7A 2L74A 1HXFH 2ODYB 4WMFA 5E8EH 1O36A 2GT7A 2V3MA 3NCLA 2BDIA 4Y8ZA 3PLBA 1CT0E 1O2SA 1Y3VA 1GMCF 1S0QA 2SGPE 4OS1A 3RXQA 1FPHH 3RXPA 3Q77A 1KSNA 1FN6A 4YT7H 1SGIB 2O8WA 1A5HA 3Q00A 1J14A 1B5GH 2F9UA 5TCAA 2QC2A 1A2CH 3SUFA 1OWEA 2QA9E 1AB9B 1MCTA 5FCRA 3ZVEA 1O30A 2NU3E 1K21H 1VCPA 1DOJA 1KXAA 2Z9KA 1BJVA 4CR9A 4CH2B 2I6QA 1EASA 3LC3A 3QZQA 3NUMA 2SGDE 3MO9A 1C1RA 2BY7X 5HM9A 3GOVB 1L2EA 2ZU1A 1C9PA 1TWXB 1E0FD 4Y7BA 2QCYA 1G3EA 1DWCH 2B9LA 2G81E 2ZFTA 2D2DA 2VU8E 3SI3H 4AB8A 1HAGE 4A1TA 4B6EA 1SGRE 2C93B 2GCHG 1HAIH 1FNIA 3GYLB 1COWD 1A3EH 2ZZUH 2ZCKP 1EATA 2FX4A 1TLDA 3TNSA 4RI0A 2ZEBA 3QUMP 3RU4T 2ESTE 1MKXK 2P8OC 3H7TA 4GUXA 2ZTXA 1MBQA 2OD3B 3RM2H 1BT7A 1K1IA 2A7CA 1LHEH 2JJ2D 3A7YA 1HUTH 5GNDA 1T8MA 4WJG2 4X6OA 4Y8YA 1GI4A 1GBKA 1O3GA 1BOQA 1C4V2 3P95A 1XVMA 3KQCA 2AFQB 3OTPA 1WQVH 4B71A 5EJ1A 1IQMA 1ARCA 1UTQA 1DVAH 1OHHD 2WINI 1TX8A 2LPRA 2W26A 1TBZH 1K1JA 1VJ9U 4TWYA 1EOJA 3U98H 4XE4A 1WUNH 3TH4H 1GI1A 1BMNH 1MKXH 1SSXA 2EEKA 3SU3A 2RDLA 5T6DA 3UNRA 2ZFRH 2IJD1 1FPCH 1F5RA 2NU2E 1W2KH 1FIWA 8KME2 4WH6A 1Z8IB 2ZWLH 1BDAA 3VXFH 1Y59T 2OLGA 1OP8A 3MFJA 3N7DA 2ZU4A 1F7ZA 1ZJDA 2UUJB 5C5NA 2O9QA 2D8WA 5A2MH 3QTOH 3D23A 4GHTA 5CHBA 3NXPA 1BJUA 1HAYB 2G8TA 1B7XB 3RXMA 1H8DH 1KDQB 3SGBE 2BDGA 3GCHB 1ELTA 1P2KA 1EPTA 5AFZH 2ZTZA 2ULLA 1YPKH 1N8OB 2D26C 2CJIA 2GT8A 3QTVH 3PLPA 1GVLA 3BF6H 1Y5BT 5FL7D 4U2WA 2VWLA 1TMBH 2Y7ZA 2ZF0H 4ABBA 3DSPA 2OC7A 1QNJA 4XD7D 1SGFA 1ZTLA 2ANMH 2QF0A 1O2RA 4CRFA 3B8JA 5L2ZH 1MKWK 2VH0A 1S5SA 2ZHEH 5AF9H 2GV7A 4X0WU 1X7AC 2A5AA 2J94A 1P9UA 1K1OA 1EAWA 3M5MA 2LP6A 1IQHA 1YM0A 2BD9A 3B23B 1IQGA 1P57B 1Z1JA 2AERH 1HGTH 2K0QA 1QB1A 2LELA 4I8JA 4HGCA 1TPAE 5GPIB 3VB4A 3VEQB 3SBKA 2A2XH 2ZO3H 5SGAE 1RGQA 4WMEA 2WPLS 1XXFA 2VWNA 1LHFH 4GHQA 4IGDA 5JBBS 2JDID 1LHDH 3MMGA 4AYVB 1Y3YA 1W14U 3NKKA 3G01A 1B0EA 1TNKA 4Q7ZA 3T26A 3URDA 2H1UA 1EXFA 1HJAB 2WPMS 1LKAA 1MKWH 2F3CE 1EP6A 2STBE 4AX9H 1BUIA 1TABE 3WWFA 1NRRH 4NFFA 1QRXA 1LQEA 1SGNE 1YCPK 5C0UA 1JIMA 4Q7YA 2ZGXH 2RFKC 1FY8E 2PGBB 6GCHG 5PTPA 1Y5UT 1GHBF 3A81A 4DT4A 1NRSH 2EY4C 3OX7U 2OBOA 5C1YA 3V12A 1YPHC 1C2IA 3NWUA 3P17H 3ENSB 1DWBH 4MG3A 3O8BA 2NWNA 5E2PA 1ZMNA 1O3MA 1UCYE 1ZPZA 3ATLA 5J4SA 3LJJA 1BZXE 2P3UB 4ABDA 4M7GA 2OTVA 4XSKU 4ABAA 5GDSH 1TNIA 4DIHH 2FI3E 3PWBA 1ZHMA 1FX0B 1BRUP 4Y79A 1P06A 4JMYA 3MWIU 3ZZ6A 3ZVBA 1YP9A 2Z9JA 3LH3A 4UONA 6LPRA 1YCPH 1W0ZU 4DOQA 5GJ4B 1NN6A 1O2VA 3UNQA 3V0XA 1TPPA 2KM0A 1GCTC 3M7TA 1O2UA 2HGTH 2WYJA 5FX5A 4NSYA 3HKJB 1PQAA 2PHBA 2ZECA 1GBAA 3NZIA 4KTCA 3SU1A 1KY9A 2JH0D 5A8XA 4YZUA 1GJBB 2QXGA 2Y6TA 2WHXA 2BD5A 2KX4A 5A8ZA 4RN6A 1SOTA 2QXIA 1GBJA 1HJAC 1UK3A 1DWDH 1O3CA 1C1MA 4MVNA 1TGCA 2JH6D 1RS0A 1V6DA 1S6FA 4UDWH 3DT0H 1ZYOA 5C94A 1QB6A 1P2NA 4MTBA 2ZKSA 1BRCE 3P8OA 1LVBA 2CF8H 2CN0H 1YCPM 2HNTC 4GCHF 4KGAA 2BMGB 2G5NA 3OSYA 1SHHB 3SU0A 3PTBA 5HXFA 4IW4E 3DSGA 4B76A 3RXTA 3RC6A 3LDXH 1SQAA 4JK5A 1GG6B 2TGPZ 5C1UA 1GWAA 2O8TA 1TQ7B 1P02A 4X2YA 1HV7A 4U32A 1BMFD 1F2SE 3TLOA 3SGAE 1ZHRA 1NY22 3MO3A 3TITA 1H4WA 1DSUA 1AIXH 1LPGB 3UWIA 2TPIZ 1AY6H 2PTNA 1GBDA 2HRVA 3SJ8A 3MH7A 2P93A 1C2FA 5BRRE 1ZOMA 1HAPH 1XKBC 3FANA 2PSYA 4Q7XA 2XNDD 3FOAA 1IQEA 1C1TA 2VVCA 2BXTH 1EOLA 1ZTKA 1WU1A 2CK3D 2M2AA 2YMSC 1GJAB 3RXRA 1O3KA 3RMMH 4NCYA 1W8BH 1WOFA 1IQKA 1BHXF 1KXBA 3PYHA 4K2YA 1YYY1 4ZHMU 3OEHD 1AUTC 1C5NH 4VGCC 1UTNA 1IQIA 1EUFA 3A8AA 4AG1A 4AYYB 3RXBA 2ZA5A 2PUXB 4JZ1A 1LHGH 1C5TA 1O2MA 1TQ0B 3ELAH 4FUFA 1BQYA 4TPIZ 3DUXH 4XDEA 2KAIB 1OXGA 1BTUA 2B8OH 3AAVA 2A31A 4GLYA 1EB1H 1AE8H 2H5DA 3LT3A 3IG6B 2HLCA 5L30H 2WYGA 5ESBA 1O5GH 1MBMA 5GWZA 1GG6C 3OFND 4Q4LA 3MU1A 3VXEH 3BTTE 4A5TS 4X6MA 3SN8A 4SGAE 1GL1A 1SGCA 3F3BA 2CV3A 1NU7B 1TPOA 3Q3YA 2A45B 4HG6A 1YGCH 2IOTA 3CP7A 3TGJE 1G3BA 1PQ8A 3SUGA 3GYMA 2CHAB 4I32A 4JYVH 5F6MA 2SGEE 2A5KA 2OXSA 3GCNA 1C2EA 3UY9A 2JIZD 3BIVH 2QGRA 3UB0A 1H9HE 2TIOA 4GPGA 1NU9A 1SHYA 1C4Y2 2FOCA 1EPTB 5DO4H 2DUCA 2GCHF 1O5DH 5DP5A 1BIOA 1INCA 1HIAA 1W11U 1YPJH 4JYUH 1HAZB 3V13A 1GBFA 1CT2E 1KXDA 1L1JA 1FAKH 2FOBA 4R8TB 4K8BA 3QGJA 2PW8H 1ACBE 2CMYA 2VGCB 3QX5H 5A0CA 1C1VH 3PWCA 3M35A 1WBGB 1QGFA 3TJNA 4IBLH 4Y10E 1F0TA 3CNRA 4H6SB 1CBWC 5HGGA 1TNHA 1NS3A 5EU8A 1NRPH 2ZFSA 2VVUA 2ZHFH 4H42U 3SHCH 4UFDH 1TYNA 1H8HD 3FP8E 4ASHA 2C4FH 2ANWA 5F8XA 1IAUA 1O2TA 3H09A 2HALA 4CRDA 1BTHH 2QF3A 4WXIA 4B2BA 1GJDB 3OYPA 3LC5A 1XUIA 3RXIA 1P8VC 2D1JA 2KFWA 2QIQA 1P01A 1ANCA 1JRSA 3KQEA 2JKHA 3FZZA 1OWKA 1W7GH 2R2WU 1GVZA 2WPIS 1T31A 5DG6A 1GL0E 1B0FA 1C1SA 1ORFA 2QF5A 3EDXB 3RXSA 3UFAA 4MLFB 3BTME 4O3UA 3OTJE 1D6WA 4F49A 1CQQA 5DK1A 1CU1A 1WCZA 5LH8A 2Y82A 1P10A 1SFQB 1ETSH 3GY7A 4K1SA 1YLNA 4MPUA 3HGNA 3UPEA 4FUCA 2KCAA 1QCPA 1LQDB 5C1XA 2ODPA 4M9FA 2AIQA 2FM2A 3WY8A 1GHYH 1CGIE 2Y5HA 3K6ZA 3RXJA 4LZ1H 1HFDA 3TIUA 1G3CA 3V7TA 1DY9A 1FAXA 3UNSA 1DE7H 1HYLA 3D65E 2GX4A 4INHA 1SQOA 3MOCA 2GP9B 2GKVE 2ZU2A 3EAJA 2OCVB 2VGCC 1QA7A 4H6TA 5FBIA 1NFYA 3LPRA 1TMTH 3R0FA 3RP2A 5B6OA 3MU4A 1VKYA 3FKSD 3A88A 2OC1A 3I29A 1YBWA 1MTUA 3F9GA 3ZVDA 4F48B 4NZLA 2AMDA 2RG3A 4FXGH 1BBRK 2ZI2H 3QLPH 4ABJA 1MAXA 1IHTH 3UAIC 5IK2D 4OS5A 2XRCA 5EW1H 4B75A 2C8XB 4MNWA 3ZV9A 1FY3A 1GMHG 1Y3XA 2AGGX 4AG2A 1O2HA 1O2WA 1O5BB 2PTCE 4ISLA 1ABJH 1UVOA 1E35B 3UQOA 1ESBA 1GDNA 5GXPA 1KYNA 3D62A 1QY6A 1S84A 3DFJA 2W6JD 7GCHG 3OY6U 3U8OH 2ZPQA 3GS9A 1GI5A 1H8ED 3KQ5A 3CS0A 1Z7KA 2BM2A 1C5WB 4B73A 2R0LA 3TU7H 3SJKA 5C2ZA 1GGDB 2BHGA 1T4UH 3I78A 1DPOA 4ACAA 1BBRH 3PRBA 1NRQH 2J92A 3SV2H 3A7XA 2P8OB 3SNAA 4Y7AA 1EFRD 3ZZBA 1SGDE 1S82A 1AQ7A 2EI7A 4B6FA 1S6HA 1MD8A 1RXPA 1J9CH 6GCHF 3ZVAA 4YT6H 5FCKA 2IPHA 1VR1H 4I33A 2TGDA 2P16A 3W1EA 4NWLA 1ZGVA 3E1XB 1ZTJA 1KIGH 5FPSA 1EAUA 1D4PB 1OYTH 4AFSA 1T7CA 1YWUA 1K22H 2Q6DA 3KCGH 3MI4A 4TYDA 3UTUH 3EA9A 1OOKB 2R0KA 2Z6BD 2GV6A 4UFEH 3BG4C 5E0GA 2GZ9A 1T4VH 3LU9B 1FUJA 1E79D 4BANB 1O2JA 1RJXB 1O34A 2WUBA 1V2KT 1GBTA 2ALPA 3S69A 5T6GA 1C1WH 4FUIA 2J95A 1QRWA 1DLEA
chains in the Genus database with same CATH topology
3VPKA 2Y81A 1Z1IA 3M7UA 3BEUA 4B2CA 1AMHA 1O33A 1EKBB 3OU0A 2H2ZA 3P8NA 3E16B 1RD3B 4ZXYH 3E91A 4Q2KA 2RA0A 2UUFB 3P8GA 2BLWA 4ISIH 4A1XA 1PPHE 1SLUB 3F9HA 4PROA 3MNCA 4U01A 1GGDC 1T8NA 3ATIA 3LGTA 1ELCA 1SLVB 3PV2A 2F4LA 1DUAA 1AI8H 4E7RG 2TGTA 2WPHS 1NBME 2UUYA 1ANBA 3UQVA 1GI3A 1FI8A 1C4U2 1FMGA 3ODFA 3U69H 4D76A 2QV1A 1TRNA 1O3HA 2BVSH 2KZ4A 4BTIB 3A86A 4F4OC 4ISHH 2A4GA 1C2LA 3F1SB 4ABGA 2XC4A 3Q3KA 4UFGH 1V2WT 3A85A 3K9XB 5EODA 1BTPA 3SUDA 1PYTC 1A3BH 1ZZZA 1AO5A 1THSH 3M5OA 4BTTB 3VB5A 3VB6A 1BA8B 2FO9A 3NK8A 2KAIA 1O2YA 3MH6A 4LZ4B 1YLCA 1SVPA 2BLOA 1QTFA 1YPEH 1VCWA 1QJ7B 3GCTG 1UHBA 3TJOA 2FYQA 2A4RA 4TY7A 5C3NA 4A6LA 5EXMA 3KGPA 5ABWA 1YF4A 2FI4E 2WZQA 5GCHG 1W7XH 1UTKA 3M3VA 1HIAB 4MQAA 5C20A 2QE7D 2ZGJA 3ATMA 1S0RA 2ZGBH 2G55A 6CHAB 9ESTA 1GI0A 1FV9A 1CA0B 1V2MT 1XXDA 1KXFA 1NBMD 1C5ZB 1K1MA 3LGIA 4IS5A 1ANEA 1L1GA 1BMAA 4ABIA 5ESTE 1ZMLA 3TVJB 3TH3H 1D3QB 2V7QD 1QL7A 1YPGH 4B74A 4K3JA 3EE0B 1AFEH 2O8MA 1V2OT 3FP6E 2Y5FA 3FP7E 1GVKB 4TSFD 1GDUA 1V2NT 3QGNB 1UVUH 1LVYA 1A61H 4FUBA 2RA3A 3TJVA 2ZHQH 9LPRA 1F0SA 3S9AA 1H9IE 2BQWB 3KQBA 3F0PA 2XWAA 4FETA 2BQ7B 2JETC 1LPZB 1SBWA 1A46H 2XBWA 4B2AA 2K8IA 4Z6AH 1AU8A 3URCA 1ZJKA 1SGTA 2FOHA 5AFYH 1A0HB 2F9PA 1E1QD 1GCTB 3SNCA 4HI3A 1O3DA 3F6UH 2QYIA 1O0DH 3A8DA 4JZIA 4MPVA 1Z71A 4MNYA 1BMMH 1DX5M 3P92A 1BTZA 3A7TA 1MZAA 1P2QA 4YXWD 3LH1A 4O03A 3F68H 1SKYE 1JIRA 3BTHE 4DCDA 1GBCA 1Z8RA 3U1JB 1YLDA 4H4FA 6CHAC 3HK3B 5F8TA 5DN6D 1D3TB 1CA0C 1FONA 4X2WA 4GSOA 1NRNH 4TY6A 3S9CA 1TBRH 3OY5U 1NPMA 1E38B 3JZ1B 4WVPE 4XFQA 3QZRA 1WTHD 1OWIA 4O9VA 1J16A 1H9LB 1XVOA 2R9PA 3OEED 1TE0A 5T1VA 1V2RT 1XUHA 1CSOE 1DICA 1QURH 1O35A 2H5CA 1AUJA 1C5XB 4NG9H 1Z6JH 1O2XA 1HBTH 1SMFE 2ZDNA 3TH2H 5TJXA 1QA0A 2ZDMA 5IDKA 4XBBA 2XOKD 2P59A 2V3HH 1PPCE 3GICB 1ZSKA 4X6PA 2FOAA 3SV6A 2NU4E 1XKAC 3BTKE 2K1QA 1V3XA 5TCCA 2J2UA 1DT2A 2WSSD 3ZZ8A 5C5OA 3RXUA 5ETXA 1G36A 1EAXA 1VITH 2WV5A 2BZ6H 3BEFB 1O3FA 1TB6H 2XTTB 3L6PA 5DP8A 2A5IA 2YMSB 2GDEH 3F2HA 1FJSA 7ESTE 1Q2WA 5FAHA 4ISOA 2FZZA 3DD2H 1AZ8A 4VGCB 1ZRKA 2STAE 1GHZA 3RU4E 1SLXB 1O2PA 2EI8A 1WV7H 1P2MA 4ABHA 1QHRB 4Z1MD 1BITA 5F53A 4MNVA 4X1PU 1WTGH 2H9EH 4BAHB 4OS4A 4AGKA 2FODA 4NFEA 3BTWE 4WF8A 4X2VA 1TRYA 1HNEE 3MYWA 1OP2A 3PV4A 4I7YH 4K8YA 1O32A 1OWHA 3ZZ4A 1HAVA 1NZQH 5I46H 1V2TT 5J4QA 3M37A 3SJ9A 2H6MA 4DG4A 1Q3XA 1TAWA 1CE5A 3MU5A 1O2KA 1O2QA 4BTUB 1GMHF 5EPYA 1C1PA 4NSVA 3PMJA 3S7KB 1G30B 4IC5A 2OK5A 2Z94A 4E05H 2FXRA 2OQ5A 4BXWA 4FUGA 3RLYH 1KXCA 1A0LA 3U9AH 7GCHF 3ZZ7A 1FLEE 4ZH8A 3PMAB 1W12U 4INLA 1CA8B 2ZGCA 3MNSA 4CBOA 5B6LA 1LPKB 1Y3WA 4YM9A 1MU6B 1O3IA 1W3CA 4DW2U 3RXEA 3SOSA 1TALA 1G3DA 6ESTA 3RU4D 1ETRH 3QK1A 4FUHA 1ESTA 4NWKA 2BX4A 4NA8A 3FZDA 1ESAA 3SNBA 1BBRE 5GIBA 4ZKSU 4K69A 3LGUA 4WWYA 1JMOH 3ZVGA 1ELVA 3L3TA 1EZUC 3QN7A 5HMAA 2Z9IA 3T27A 1RRKA 5LPRA 3UIRA 2ZDKA 5FPTA 1MMJN 1CBWB 5EQSA 1J17T 1HAOH 1K1LA 2JH5D 3UWJH 1TGSZ 3MO6A 4FUJA 1UO6A 2C90B 3BSQA 3M5LA 1SLWB 3ZZ3A 1UHBB 1IQFA 2TBSA 2O8LA 3AW1A 4CHAC 3MH4A 4TWWA 2ZTYA 1P0SH 2FWWA 4IC6A 2WV4A 1PPZA 1XX9A 3EYDA 2XC5A 4MPWA 4BAKB 3F2FA 1O2NA 3T29A 2EI6A 3RMLH 4GVUA 3Q3XA 2UUKB 3D49H 3ZZDA 1S81A 4HTCH 4KP0A 5I25A 3M7QA 3SU5A 4K60A 5JDUB 4Y71A 4Y76A 4THNH 3TGKE 1TIOA 3RXLA 2GD4B 2XCNA 3A7ZA 1GJ8B 1TX7A 5DP6A 1PPBH 4I8GA 1AHTH 3SV7A 4U30A 1AVGH 3U8TH 4ESTE 2H9HA 1BB0B 1D9IA 4ISNA 5LGOA 1L0ZA 1SI5H 4X8UH 3STIA 2XW9A 4NIYA 4FUDA 1L4ZA 1C2GA 5K0HA 2P3TB 3SU4A 3PMHB 1CHOG 2B5TB 1NT1A 1QIXB 1TOCB 4X1QU 1O3NA 2ODQA 3ATWA 1Z8JB 3K65B 1UTMA 1GHWH 1TA2A 4IMZA 1VCQA 1UMAH 1Y3UA 2BOHB 4Y8XA 4RKOB 1EX3A 2A7JA 4BNRA 1V2ST 3RXCA 3SHAH 4WMDA 2ZNKH 2FOGA 3RXVA 1MABB 2O8UA 3N99A 1GCDA 1MTNB 2BB4A 2OBQA 1ELEE 1E1RD 2BY8X 1XUGA 4AOQA 2VVVA 1GHAG 2GTBA 4OS6A 1V2JT 4D9RA 1TBQH 1E36B 4ZKOU 1TNLA 2HVXA 2SNWA 4UD9H 1NFWA 1XMNB 3BEIB 1MTSA 1LMWB 3GCTF 4MNXA 1KLIH 4MDSA 2ZU3A 1EQ9A 1UK2A 3SZNA 3AAUA 1YPMH 2PKSB 2AIPA 1IOEA 1ZRBA 4WY3A 2CF9H 3E6PH 1Q31A 1ZSJA 1YPHE 3SJOA 5GCHF 2PLXA 5HKKD 2A1DB 5A09A 3RUOA 3MNXA 4DURA 3SJIA 2G52A 1OX1A 4JZFH 4IMQA 3RXDA 3BTFE 2AMQA 1K1NA 1UVSH 2BDAA 3UUZA 3S7HB 1GJ6A 1ELDE 5DGJA 1WSSH 4HFPB 3L33A 2WPDD 1VJAU 4INKA 3A8BA 2YOLA 2VH6A 2VIOA 2PV9B 1C2KA 3BTEE 2VWOA 1G2LA 3M5NA 1BCUH 2A0QB 1QJ6B 3RC5A 3A89A 1O3BA 1SOZA 2AGEX 1C2MA 1L4DA 3A7WA 4BOHA 1V2QT 3E0NB 3SV9A 2ZIQH 1SQTA 1GMDG 1ELBA 3TNTA 3BTDE 1DXPA 1EJMA 4I8HA 2TRMA 4CRGA 3BG4B 1MTNC 1F92A 4ABEA 1DLKB 3VG8A 4AGJA 1TRMA 2ZQ1A 3GY3A 3VFEA 3AVZA 4DY7B 1EJAA 4DVAU 2SGAA 1H1BA 1UVPA 1GPZA 1O2IA 1EAIA 4Y0ZE 1TONA 1JXPA 1BTXA 1MH0A 2FS9A 4UFFH 1PQ5A 3N7OA 1DS2E 1CO7E 1KLTA 3RMOH 4ZKRU 2BOKA 5FHTA 5EPNA 2HNTE 1G37A 3M3SA 2PKSC 1P3CA 3KNXA 3IWMA 1TGTA 1MZDA 3ODDA 5L6NH 1SC8U 2FTMA 2W7SA 3DHKH 4E7NA 2Z3DA 2XWBI 1GJ5H 4A1VA 2A2QH 3T25A 1Z8GA 4A92A 3PO1C 4NIWA 2XNIA 5EW2H 1P05A 2FLBH 2P95A 1QQUA 3Q76A 4NIVA 1WAYB 2BD7A 4ASUD 2R3UA 3QWCH 2L6OA 5CHAB 1TGNA 2FDAA 2ALVA 1AE5A 5C67A 1AFQC 2Z3EA 2HOBA 1QQ4A 2KCOA 1FDPA 3SU6A 1DUEA 3RM0H 2PKAB 2AMPA 2PUQH 4DIIH 1O3LA 4FVDA 4YOJA 2UWLA 3A82A 1NO9H 2ZDAH 1MAYA 1HAVB 1BMLA 3PRDA 1V2UT 2NU0E 4GAWA 4YOIA 3CS7A 1HLTH 4UE7H 2QXHA 3P6ZB 1XUKA 3EGKH 2FPZA 5FBEA 1ZMJA 4I31A 1GJ7B 5CMXH 1HAXB 3UR9A 5DP7A 3ZV8A 2Z7FE 4BAMB 1O37A 1NFXA 8GCHG 1LHCH 4K1TA 4JYTA 3RMNH 3UOPA 3GY4A 1JBUH 1ZLRA 2G4TA 2PFEA 4ZCNA 2ZGHA 2GCTC 2QF4A 2OC8A 2W6ID 4HZHA 2FIRH 3GCOA 5JB9S 1S85A 3QO6A 2PWXA 1OWJA 4OGXA 3A80A 2ZHDA 2BVRH 3HGPA 1GJCB 3SORA 1TGBA 3N7EA 1TNGA 2BDYA 3T2NA 4R0IA 1AKSA 3FAOA 3TGIE 2IJOB 1XUFA 1E37B 2WPKS 3F0OA 1FQ3A 3A8CA 1AD8H 2FX6A 1S83A 3AW0A 1FY1A 4YLQH 3LIWA 2KCYA 4ABFA 3RXOA 4LXBH 2ZP0H 1OYQA 3MH5A 5CHAC 4ZKNU 3ZZCA 4AFUA 2J5UA 3ZZAA 1BRAA 2OP9A 1LTOA 5EXLA 5F03A 1HJ9A 1NC6A 1G9IE 4Y6DA 2C8YB 3NRLA 1T32A 3PMBB 4X8VH 3OAAD 1ETTH 2B0FA 1Y5AT 3QDZB 5EXNA 3T5FH 1NFUA 2DE8A 1PQ7A 1GI7B 2BDBA 4NGAH 3IITA 4JZEH 2XBYA 2JETB 4BXSA 2YMSD 2THFB 1QBVH 4ZMAH 1OS8A 1O3PB 4CR5A 2FP7B 2B7DH 4AZ2B 2Q6GA 1RIWC 1TX6A 3FVFB 1FXYA 1TNJA 4X2XA 1O2OA 1PPFE 1DM4B 1SGPE 4CRAA 2EC9H 3LONA 3LKWA 1FN8A 1QJ1B 1SL3A 1TA6A 3DFLA 1QB9A 3GDVA 3ZZ9A 1BHXB 4JK6A 5CE1A 5JYIA 2W7UA 3LGVA 1GBEA 2G5VA 2FS8A 1PPGE 1O5FH 1EP5A 1GI2A 4IN1A 1AB9C 2IN2A 1BTWA 2Z9LA 1FY5A 4OS2A 2HPQH 2C3SA 4O97A 1UTOA 3ESTA 4XOJA 2Y80A 1CT4E 2AYWA 1QL9A 2HPPH 5H4IB 4AFZA 3HK6B 2ZCLP 1GBBA 3TJUA 1CGHA 2BD8A 1C5YB 4AN7A 3PB1E 4XBDA 5LPFA 1P2JA 3CENA 1C5UA 3F2GA 4TPYA 3RXKA 2F9OA 1OSSA 4YTAA 1HPGA 3SQEE 3E8LA 1P2IA 5EG4A 4OM9A 3O8CA 3T62A 5C0TA 1MQ5A 2BLQA 2V35A 4Q80A 2V3OH 2H9TH 1AWFH 4Y11E 2J38A 2GDDA 3DA9B 3V3MA 1ABIH 1UTJA 3DCLA 1W13U 1C5LH 3EA7A 1AVXA 4B1TA 1IQLA 1P9SA 5EGMA 1HJ8A 8LPRA 2ANYA 1W0KD 1KXEA 2HLDD 3LGWA 1SGYE 8ESTE 4X1NU 1ZPCA 2BZAA 1THRH 1PFXC 4D7FA 1VITG 3ZVCA 2HWLB 2Q1JA 2BVXH 3A84A 5EOKA 1U6QA 2BD4A 4KTUA 3C27B 3WWBA 2GZ7A 3SI4H 1UTPA 7KMEH 1DSTA 2VJ1A 4A7IB 3ITIA 4I8KA 2GVFA 2A4QA 2VIDA 1P03A 2JJ1D 1MD7A 3FO8D 4YLUA 1CHOF 5DP3A 2CGAA 3STJA 5FPYA 1RTKA 1P04A 1O3JA 1CGJE 1GI9B 1P3EA 1MTVA 2OQUA 4JCNA 5JPMH 3AASA 2V6NA 2YNAA 3HKIB 1E34B 2KCPA 1QL8A 1JRTA 5EQRA 4NA7A 4WH8A 2ASUB 2FOMB 2VIVA 1AZZA 4XBCA 3B9FH 1AWHB 2VIPA 1C5SA 1C1OA 2P94A 1KTTB 4LK4A 1Y8TA 1G32B 2R2MB 3H5CB 1VGCB 3PLKA 4QT8C 3GCHC 3ZVFA 1GHAF 2GMTB 2BQ6B 1O38A 4JZDH 4DGJA 3E0PB 2SGFE 1N8OC 4CRCA 1F5LA 1N6YA 2Z3CA 3LOXA 3SZEA 1UTLM 4SGBE 4KKDA 5G4BA 1ZGIA 1C2HA 3RXHA 1GMCG 3F9EA 2M5TA 1IQJA 1O39A 3KEEA 1TPSA 1M9UA 1F0UA 1HDTH 3FFGA 1GDQA 1C1NA 2UWPA 2SGQE 1O2ZA 1C5RA 1H8IH 2A4OA 1N6XA 1EZSC 1ZR0A 2FMJA 3RC4A 4TT3D 5HM2A 1DITH 1SG8B 3LJOA 1K2I1 2KR7A 3VGCB 4UEHH 3P8FA 3DSOA 1LVMA 3M3TA 1ELFA 1ID5H 1QFKH 1JOUB 5A8YA 5DSFA 1EZQA 1EZXC 1LVOA 1T8OA 1A5GH 3GY5A 1CHGA 3O8DA 1DY8A 3SNEA 1A7SA 1GMDF 2BD3A 2ZDVH 3BIUH 1LDTT 4WXVA 4CH8B 5DJ7A 2PKAA 3TK5A 4CHAB 1P11E 1A1RA