2P59A

Crystal structure of hepatitis c virus ns3.4a protease
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
151
Chain Sequence
VEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS3
publication title Inhibitors of hepatitis C virus NS3.4A protease. Effect of P4 capping groups on inhibitory potency and pharmacokinetics.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein
total genus 35
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2p59A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2p59A01
2ZECA 4MTBA 5T1VA 2O8TA 3SUEA 3A81A 1ZRKA 2BXTH 3AVZA 5DP6A 3OTJE 1L4DA 7ESTE 4IN1A 1AKSB 4ZAEA 3DHKH 3STJA 1N6YA 5FXLA 3P8OA 2LNCA 3RXCA 5EW1H 2J9NA 4AOQA 2HOBA 1FV9A 1YPHC 3MH4A 1C1NA 3RXFA 1WUNH 1CO7E 1FPCH 3SGQE 1W3CA 1J9CH 3GCNA 2QXGA 1A5HA 1C2GA 2DE8A 4AFZA 5FX5A 1HUTH 1TAWA 4IN2A 1UTPA 4ISLA 1UVTH 4ABHA 4X1NU 2ZI2H 4M7GA 3SO3A 1O5BB 1C1OA 1HXEH 4WY3A 4OS6A 4B73A 1JBUH 2XBWA 6LPRA 2ZHEH 3GCTF 1BT7A 1AIXH 2VNTA 4XBDA 5IDKA 4YTAA 1NRPH 2J94A 1LQEA 2ZFRH 5BRRE 1GMHG 1OKXA 4A5TS 3RMMH 2C3SA 3O8CA 1GGDC 1L4ZA 1TLDA 1XUFA 1ANEA 1GI7B 5HM2A 3BF6H 2ZU5A 5E0GA 1OP2A 3RC5A 1O2IA 2P8OC 3MNXA 3UQVA 1O3PB 3B9FH 1F0SA 3LKWA 4K3JA 1V2WT 1ELFA 3UR9A 2QF3A 3SW2B 2BDBA 1AE5A 2ZHDA 5ETXA 4BAMB 4AN7A 2FOEA 2VWNA 5A0CA 2ZP0H 1UTQA 2XW9A 1YM0A 2FOBA 1BDAA 1PPBH 1AB9C 1SGEE 4IBLH 3N7OA 1H4WA 1MTWA 1DWCH 1N6XA 4U01A 1W12U 1KXDA 3V0XA 4ISHH 3LOXA 1ZGIA 3PLBA 1GJBB 2OINA 1BRBE 1S85A 2FI5E 2ZDMA 4F4OC 4BXSA 1VITF 1Z1IA 4I8KA 4ESTE 2XC4A 3ATMA 2XNIA 2IOTA 1EXFA 1QGFA 1Z8IB 3SU4A 3PB1E 4GHQA 4D8NA 2KAIB 2HNTE 3SJOA 5JBAS 2RCEA 1NT1A 2GCHG 2Z94A 3HK3B 1CHOG 1WQSA 2XBYA 1GI1A 1LHFH 1RXPA 4GCHF 3D65E 1BUIA 2W3IA 6CHAB 3LGUA 3SU6A 3M36A 5A8YA 1EQ9A 4U2WA 1W7XH 3PTBA 1GG6C 2A7HA 1IHSH 1VJAU 1LO6A 2Y80A 2ZPSA 1EP5A 3P17H 5G4BA 4ABDA 3RMLH 2HPQH 4GSOA 4I8HA 2HGTH 4ASHA 5JB8S 1SGIB 2OC0A 2R2WU 1G36A 3A80A 1K28D 2QGRA 1CGJE 2C93B 1Y3UA 3RXGA 2A4RA 5DP9A 3A8DA 1HLTH 4ABEA 3PMAB 3RXEA 5GWZA 2ZDAH 3MU5A 1QB9A 2UUKB 1EZUC 1L2EA 1BBRK 3ZZBA 2QF0A 3KNXA 2Z3DA 1T8LA 2Y5FA 2A2XH 3ZVDA 2BY6X 1KXCA 2BD9A 2FESH 3URCA 1W8BH 1FMGA 1TBRH 4NSYA 2V6NA 3CENA 2ZU1A 2VIOA 3GY7A 4ZHAA 2ALVA 4TYDA 3RXDA 1SQAA 2PGQB 3U69H 1GHVH 1SLXB 1MD8A 1C5UA 1YPJH 3I77A 1C9PA 4D9RA 1Q3XA 4WF8A 1C5ZB 2Y5HA 1MKWK 1JRTA 2CF9H 2NU2E 2ZGHA 1SLVB 1DFPA 2BD2A 1BTYA 4Y0ZE 1Z6JH 2PUXB 2CMYA 4BNRA 1C5PA 2AMQA 4O3TA 3VB5A 4IW4E 9LPRA 4HZHA 1RRKA 2I6QA 1DOJA 1DSUA 3MMGA 4X6PA 4WXVA 2J95A 1D6RA 5GPIB 4X6OA 2H9TH 2Q6FA 2GZ8A 4YLUA 1TNJA 1O3KA 1QL9A 2J92A 1MU6B 4AZ2B 1H9HE 4NFFA 3ZVBA 2BD3A 1FIWA 4D9QA 2VH6A 3NKKA 1SGQE 2DE9A 1TX7A 1BTPA 1C9TA 2F83A 1OSSA 3PYHA 1YPGH 1P2MA 1FZZA 1QFKH 3Q3XA 2SGEE 3RM0H 1UO6A 1G32B 1O3NA 4X2VA 3RXSA 4Y10E 1C2EA 1RGQA 4NSVA 3TLOA 1AQ7A 4X2XA 4I32A 2UWLA 1B0FA 1DXPA 1PQAA 3RU4E 1SGTA 1IQGA 4INHA 4MPWA 3UPEA 3ZVCA 2VGCB 1AE8H 1YPHE 1VGCB 4B76A 2Y7XA 3ZZ6A 5DP8A 1O5AB 2WPLS 4LZ1H 1G2LA 4XSKU 1V2KT 1IQFA 5JBTA 3RMNH 4DJZB 1UCYE 3RP2A 1PQ8A 1C1UH 1S0QA 2W7SA 2UUYA 3M5MA 4HGCA 1ELTA 4Q80A 2PGBB 1IQHA 3SNDA 2C90B 4NA8A 2OQUA 1V2PT 2QIQA 4ZKNU 3PTNA 5CHAB 2ASUB 3V7TA 3H09A 4IGDA 1ID5H 1QY6A 4FU9A 4KKDA 2G4TA 1SOZA 1UTJA 2F4LA 1Z8GA 5A8XA 1V2NT 5FPTA 1BBRE 4LZ4B 1A5IA 2FDAA 3RLWH 2G81E 2A2QH 1QRWA 3E3TA 1TGSZ 3RM2H 2SGQE 1T8NA 1O2XA 1HAYB 1O30A 2AIQA 4MPXA 4WH6A 1C2IA 1JIRA 4MLFB 1BHXB 3P8NA 4MNVA 5A2MH 2ZEBA 1DPOA 1Y3XA 1YC0A 2GX4A 4E7NA 5LPEA 3SYJA 3M37A 5C1YA 1MKXH 1GBFA 3LGYA 3HATH 1LMWB 2VINA 1L1JA 5DKMA 1BRUP 2ULLA 1XUHA 2BVSH 4X8UH 4AORA 3TGKE 2A5KA 2FEQH 1OX1A 1VJ9U 3UOUA 3MO9A 4AYYB 4YM9A 2SGAA 3OX7U 4NZQA 5B6OA 1FN6A 1YCPM 3OY6U 1WOFA 2WHXA 3A7VA 1UTNA 4CREA 3SV2H 4JYUH 1AGJA 4X2YA 5L2ZH 3BTHE 2W5EA 1BZXE 1GHBG 2ANYA 2VWOA 2ZWLH 5E0HA 3RDZA 2FM2A 3IG6B 3P92A 2ANKH 5CMXH 2P94A 2FX6A 3SUDA 1ELGA 3F6UH 1AFQB 2GKVE 1FQ3A 2D8WA 5GIBA 5JBCS 2A4GA 2NU0E 3V13A 4KTUA 2P3FH 5LPFA 1FIZA 1V2TT 4KGAA 2OCVB 1MTVA 3ATIA 1O0DH 1N8OB 3RXMA 4CH2B 5FBIA 3KCGH 4IMZA 1MD7A 3AASA 3UUZA 4ZXXH 4GHTA 5EXLA 1C5QA 1DUAA 1ETTH 1HAXB 2BDAA 7GCHG 3HGPA 1FDPA 5K7RA 1UTOA 1HCGA 1ZSLA 4AB9A 3TJOA 1T8OA 1OPHB 1P2NA 1P0SH 3PWCA 2WINI 1SGCA 2WYJA 3K6ZA 2TGDA 5AF9H 1KXBA 4ABGA 5J4QA 2HALA 3U1IB 1GCTC 2ZKSA 4OS1A 1VITH 2XWBI 5H4IB 1NPMA 1E35B 4WH8A 1SC8U 2FX4A 4YT7H 4AGJA 1EJMA 1CT2E 2Y6TA 3S0NA 3KQEA 4DURA 1O2VA 3NUMA 5EGMA 1YP9A 1L1NA 1UHBA 1TA2A 2ZFPH 1C1WH 2YOLA 4AG1A 4BAOB 3GY3A 1AU8A 1SQTA 3EA9A 1W13U 1HAVA 1IAUA 1O2MA 1HJAC 1NFXA 2NWNA 2J2UA 4F49A 1C5LH 1TPPA 1TRMA 2C4FH 1DT2A 4CHAC 1DXWA 1CA0B 1T32A 1UVOA 3M3SA 4X8SH 3BG4C 1A3EH 2V35A 1P2QA 2VIQA 1GHXH 1DICA 2Z9LA 3D62A 4RKOB 4XDEA 3QTVH 1BRAA 1CVWH 4B71A 1P2JA 4LK4A 1CGIE 1O3JA 1ZTKA 2EEKA 3OYPA 1HAZB 4Y7AA 1KDQA 1AZ8A 1QIXB 5T6GA 3K2UA 1ZOMA 1AN1E 4ZXYH 3GCOA 3P6ZB 1T4UH 1QB6A 2M5TA 1TIOA 4KTCA 5DG6A 3LONA 1YCPK 2C8WB 4X8VH 1P57B 1WV7H 2ZG0H 1MTNC 1DY9A 5CHAC 1UVPA 2VIVA 1V2UT 2FZZA 2OC7A 3E1XB 1P01A 1A0LA 1O3IA 2OUAA 3VGCC 2NU4E 1O33A 1C2LA 4H6TA 3UNSA 1IQLA 3TH4H 3RXHA 1TWXB 3TH3H 4BAKB 1N1LA 5DGJA 1F0UA 2ZDLA 4JZIA 1BA8B 4ZHMU 4BAHB 1O3FA 1EPTA 1C5XB 2ZDKA 1ZJDA 5EODA 1DANH 4X1PU 4NG9H 3UREA 1F5KU 2QCYA 2HLCA 2PTNA 2QA9E 1OXGA 1ZHPA 4I31A 5A0AE 1EAXA 3RU4D 1UK2A 1TX8A 4DT7B 2GV7A 4K2YA 2F9VA 5EPYA 1O2TA 4OGXA 2PSYA 5FX6A 1O2GH 1JMOH 2FLBH 4A6LA 1XM1A 3BIUH 2FXRA 1FY3A 2G8TA 2ZC9H 4FUIA 5JPMH 2GMTB 1FONA 2SGPE 1HAHH 3F1SB 4FUEA 1AKSA 3SJIA 1SLUB 3PM3A 1LHCH 3OY5U 1XUJA 3T2NA 1O2UA 4I8JA 3SHAH 4A1XA 1P06A 3UIRA 2LPRA 2FOMB 3A88A 1ZTLA 3EA7A 1FUJA 1UVUH 4M9FA 1FY1A 3BTQE 3BEUA 2ZFQH 1LKAA 3VB6A 1A2CH 1C5SA 1N8OC 3Q77A 4UFGH 3ZVAA 3KGPA 3GDSA 3GDUA 1HIAB 1F5RA 2A32A 2P16A 1GPZA 4I33A 1Z71A 3VXFH 1EZSC 2A0QB 4INLA 3GYLB 1RTLA 2F91A 3ZVGA 1O5EH 4H4FA 4D7FA 3U9AH 4Y6DA 1GVLA 2OXSA 3T5FH 3SZEA 2I6SA 4K8YA 1YPMH 4FU8A 2Z7FE 2Y81A 4XOJA 1TYNA 2JETC 3QTOH 2D1JA 2FO9A 5L30H 2ZU2A 1P3CA 3R3GB 5EQQA 1J17T 1MBMA 7LPRA 1IQNA 1O2RA 1QRXA 1C2JA 1LHGH 1E34B 4K1SA 4XE4A 5HXFA 3SJ9A 2BVRH 3I78A 3R0FA 6ESTA 1BMMH 1HNEE 4RKJB 3RXKA 3JZ2B 5EG4A 5EPNA 3TNSA 1O2WA 1AVWA 1DDJA 1A3BH 3JZ1B 4Z0KA 4AX9H 5A8ZA 1O36A 4NIYA 3A83A 1K1NA 1OYQA 2BD5A 4OS2A 2ZZUH 1QA7A 1BMNH 1SGYE 2PKSC 1C2DA 1ELEE 1YPKH 5DP3A 3BTFE 3MWIU 1ORFA 3QGNB 3SNAA 5HYOA 5GJ4B 1QJ7B 4KTSA 1CA0C 2STBE 2XWAA 1BTZA 1P2IA 1YPLH 1TGNA 3LGIA 1SGFA 5IYTA 3FP8E 3EDXB 1SSXA 3MNSA 1EOJA 1SG8B 1O2NA 1H8IH 1XUGA 3QDZB 2ZGCA 1QCPA 1DLEA 3VB4A 1K1LA 3FP7E 3AAUA 1IQIA 1TMBH 2XCNA 3LJJA 5F8ZA 2P3TB 3BTTE 2HVXA 5LH8A 2ANMH 1KLJH 4FUCA 3SNEA 2ZTXA 2RA3A 1NFWA 1J14A 2KAIA 1ESAA 1GBTA 3SUFA 1ELDE 3RXVA 1DLKB 8GCHG 1B7XB 4U32A 5FAHA 1ZPCA 3Q76A 4IC5A 3M3TA 1K1MA 1E0FD 2BQ6B 5LGOA 5BPEA 3M7TA 1LKBA 3SV7A 1MMJN 2FYQA 7KMEH 1MCVA 1C5WB 1TMUH 2ZTZA 1NU7B 4JZ1A 1CA8B 2O8WA 5ESTE 1EKBB 1HXFH 3RXAA 3T62A 1F2SE 1GJ6A 4O03A 1QHRB 3MNCA 5EOKA 2P95A 4FU7A 4WXIA 2SNVA 2XCFA 3OTPA 1SFIA 3SORA 1ZPBA 1QJ6B 1O3OA 3LDXH 3TJVA 4J2YB 3MU8A 5ABWA 2IJOB 4MVNA 1GL0E 3KIDU 4E05H 1O5DH 2H2ZA 4DOQA 3GY5A 3SUGA 1AUJA 1FAKH 1F5LA 1P2KA 3L3TA 3KQDA 1GJDB 3LH3A 1O3MA 3ZZCA 1MQ6A 1V2MT 2AFQB 1O3HA 4YZUA 2VBCA 1T8MA 4Z6AH 3STIA 3T28A 4CRAA 1AVGH 1LPGB 1E37B 1Z8JB 3BSQA 2VVCA 4CRDA 2GZ9A 2FOAA 3UOPA 1LQDB 4IMQA 1FY4A 4Y7BA 1ETSH 1G37A 2FOFA 3ZV8A 1DSTA 1F0TA 3RXQA 1EPTC 1GBJA 4OS4A 1G3CA 3MO6A 3E16B 1BTXA 1OYTH 2Y5GA 3BTDE 2ZGBH 1NZQH 2Z9JA 1VR1H 3P70B 4BTUB 2QXHA 1SHHB 4NIWA 4WWYA 1PFXC 4K1TA 2R3UA 2BHGA 2QN5T 2ZTYA 1S6HA 3ZV9A 2ZQ1A 1G3BA 4DIHH 2JH5D 1P3EA 2B5TB 1KIGH 2XC5A 1O5CB 2BB4A 4BOHA 1GBBA 3LGVA 1WYKA 2BY5X 2F3CE 3SU2A 1K1IA 1BMLA 4KELA 1GHYH 3K9XB 4DIIH 3HGNA 3PO1B 5EQSA 2G5VA 1BTUA 5EXNA 3TGJE 2BQWB 2FOCA 4Y79A 5JB9S 1QRZA 2GDDA 4I8LA 4JMYA 2ZU3A 3S7KB 2WZQA 3PLKA 2FTMA 3TJUA 1BIOA 5FPSA 1TPSA 1QJ1B 1LDTT 1GI9B 1NROH 2AS9A 3L33A 2ZFTA 2BZ6H 2XBVA 3SU5A 4K69A 1UCYH 2JH0D 2PR3A 1QTFA 4K1EA 2ZQ2A 1ESTA 1GJAB 3GCTG 4IC6A 3Q3KA 2A31A 2PKAB 1GBDA 3VXEH 1HGTH 3QK1A 1NRNH 1RFNA 1C5TA 3LC3A 2D2DA 1A7SA 4AGKA 1BBRH 3ZZDA 1TB6H 1DWEH 4LOYH 2VVUA 2BX4A 4B1TA 4FUJA 2WPKS 4RN6A 1EX3A 2TRMA 3SI3H 3TVJB 1RIWB 1UMAH 3KQBA 2IJD1 4ZUHA 4ZHLU 1PPEE 1UJ1A 3NPSA 1HAGE 1S0RA 3A8CA 1MKWH 4SGBE 1W11U 3NXPA 1O2JA 1O3CA 1W0YH 2GD4B 1DVAH 3BEIB 1TRNA 3GY2A 4JCNA 3A7XA 3BN9A 1AI8H 1VCQA 2OLGA 1O3GA 1Y8TA 3T29A 3A7ZA 4MPUA 1XXDA 2QXIA 4TWWA 2GV6A 2GGVB 5C3NA 3EQ0H 1PPGE 1VITG 1PYTD 2JH6D 2V3HH 1GHAF 3GCHB 2FS8A 1GI6A 2SGDE 3QN7A 1TE0A 3QZRA 4X6MA 4BAQB 4JZDH 5E2OA 1D6WA 1LHEH 4NCYA 3HKIB 1C1MA 1P09A 1ZR0A 1C5MD 4UFDH 1OWKA 1EB2A 2OP9A 2VJ1A 1B0EA 3VEQB 8KME2 3S7HB 5DP4A 2ZDNA 4VGCB 3ATLA 1J8AA 3TITA 2OK5A 1FI8A 4GCHG 4JZEH 1FLEE 3LIWA 4XBBA 3ESTA 2Y82A 1FY8E 2R0LA 2G4UA 6CHAC 1TMTH 2BY7X 3QZQA 1O2QA 2O8UA 1EP6A 3LGTA 1AO5A 2AH4X 1VZQH 2B7DH 1CGHA 1K21H 1K9OE 1SBWA 1NESE 6GCHF 3UTUH 2JKHA 1V2QT 1L1GA 1NS3A 3F68H 3H7OA 2A7CA 1BQYA 2W3KA 1GBMA 1XX9A 2CXVA 1C5VA 3TNTA 4DVAU 1ZYOA 2BQ7B 1S5SA 1G3DA 4CBOA 3SV8A 1HDTH 2ZGXH 3A85A 1NY22 1O2KA 2EA3A 1UTMA 3LJOA 1D3DB 4UEHH 4X6NA 1SGFG 1P05A 2WPIS 3PV4A 2VB0A 4WMDA 4Q7YA 4CR9A 1SI5H 1C5OH 1C5YB 1PYTC 4HFPB 3NCLA 3A7WA 4ISNA 3TK5A 1C4U2 2IN2A 5L2YH 2ANWA 2CF8H 3FAOA 1Z6EA 3A89A 5DP5A 2HRVA 1O5GH 2Z3CA 3ZVFA 4JK6A 2ZHWH 3EAJA 1BTWA 4B6FA 1KTTB 1O2HA 2TBSA 5C1UA 1C1TA 1LVMA 3SGAE 2EI8A 5E8EH 1O31A 3KEEA 4O97A 5EXMA 1Q31A 1GI3A 3ZZ5A 2FIRH 4THNH 1GBAA 5FBEA 1F7ZA 3FZDA 1CU1A 5F6MA 2J4IA 4DG4A 1GVZA 1SL3A 1WAYB 1BHXF 3M61U 1ZMNA 1XVOA 4UDWH 2H5CA 1O2PA 3RXPA 4DGJA 2ZPRA 1GBIA 2ZCLP 1CBWB 4YOJA 5B6LA 5FCRA 3PLPA 1TONA 3ZYEA 3QGJA 4FUBA 4CRCA 1Y3YA 4BTIB 1THRH 3AK5A 4R0IA 1Y59T 3FFGA 2B9LA 3IITA 1NO9H 3T27A 1ZPZA 1XMNB 2PUQH 3URDA 1AWHB 1D3TB 3SQEE 5EU8A 1XVMA 1ELCA 1SVPA 4ABIA 3LGWA 2VIWA 1UK4A 3AW0A 1OWEA 1AD8H 4TWYA 3U8RH 3MU4A 1RIWC 2BM2A 2UWPA 1NFUA 1LVYA 1GJ9B 1TGTA 2AGEX 4H6SB 1O37A 1YF4A 3TIUA 4HTCH 2F9BH 1Y3WA 1Z1JA 1TPAE 2QXJA 3NK8A 3RXJA 4UONA 2J34A 3GY6A 4UE7H 1C4V2 1KLIH 1Y5BT 1GBKA 2TGAA 1SGRE 3MHWU 3LC5A 2VGCC 4SGAE 1WSSH 1VGCC 2BDCA 1TOMH 3EA8A 1J16A 4WVPE 4DW2U 2F9NA 2GDEH 2C8ZB 3GY8A 1EZXC 1NRSH 3M5LA 1JXPA 2G52A 4O3UA 2EC9H 3GCHC 1YBWA 4CRGA 5SGAE 1D4PB 1FJSA 2BY9X 2R0KA 3IWMA 1HBTH 4QT8C 1OWIA 3ZZ7A 3KQCA 2FPZA 2PLXA 1TQ0B 3SJKA 3KF2A 3O8DA 2WYGA 1SMFE 3ITIA 3VFEA 2IPHA 2QC2A 1LCYA 2FOGA 4VGCC 3F9FA 4FVDA 3UQOA 4AFUA 8LPRA 1H9IE 1TFXA 1TABE 3NWUA 2AEIH 1W14U 3LT3A 2VH0A 1C2KA 1F0RA 5TCAA 1W0ZU 2XBXA 1DY8A 1EAUA 3EYDA 2R2MB 1QA0A 1VCWA 3BTEE 1O3BA 3O8RA 1YLCA 1HIAA 4WMEA 3TPIZ 3A82A 1YPEH 1QNJA 1AB9B 1FXYA 3RXRA 1Y5UT 4TPYA 1C1VH 2WPHS 1ZSJA 4OS5A 5I25A 3C1KA 1DM4B 2RA0A 3EGKH 1NFYA 1ANDA 1YCPH 3ZVEA 3MH6A 4B2CA 1C5NH 1KDQB 3SN8A 2OD3B 3M35A 4DY7B 5JDUB 1EZQA 1D3QB 2BDYA 1BOQA 4BTTB 1O3LA 1HB0B 1ZLRA 1ABIH 2W7UA 4FUHA 3QLPH 1UVSH 4BANB 3LH1A 4BXWA 1AFQC 3SZNA 2ODPA 1NU9A 2FP7B 4CR5A 1WBGB 3ODFA 1C1QA 4NA9H 1LVBA 5AVDA 3W94A 4AFQA 1PPZA 1THSH 2GCHF 2Z9IA 1TNIA 3MYWA 1GBHA 1K22H 3E8LA 2AGIX 3LU9B 1V2RT 2FI4E 2THFB 1RS0A 1OOKB 1GG6B 4OGYA 1EOLA 1AFEH 2XYAA 3RXBA 5HGGA 1CHGA 4A92A 4CH8B 1O2OA 2H9HA 2UWOA 2OC1A 4NIVA 2XTTB 1V2VT 2H6MA 1V2LT 4X2WA 2W26A 4MPVA 3W95A 1ZRBA 1O39A 1PPCE 2BDIA 4GAWA 2OC8A 4FXGH 3VB7A 4ABAA 2TIOA 1XKAC 4NIXA 1TNLA 3M5NA 1O3EA 2B8OH 1S6FA 1H8DH 1GMDF 3QO6A 1MZDA 2QY0B 1TALA 1KXAA 2AGGX 1W7GH 1INCA 1IOEA 2ZGJA 1GJ7B 1TNHA 4I7YH 1ZTJA 1A5GH 4GVUA 2P93A 2TGTA 1IQJA 4FVBA 3DFJA 3HPTB 3MU1A 2PFEA 3RC4A 1C4Y2 1BJUA 2FTLE 3PWBA 1A0JA 1MQ5A 2GT8A 2O8MA 3VPKA 3MU0A 1CE5A 1PQ7A 1A0HB 5DO4H 1GBCA 1ELBA 4Y71A 3B23B 1ZMJA 4YOIA 3AAVA 1KLTA 5LPRA 1Z8RA 3E0PB 1MZAA 5I46H 5GXPA 3F9GA 3SOSA 4D7GA 3PV2A 1AY6H 2BX3A 1KY9A 4JYVH 1QQ4A 4GLYA 2WV4A 3TJNA 3S69A 3E90B 5GCHF 3P8GA 5PTPA 4RSPA 1UTKA 3UNQA 1A4WH 1ZJKA 1AMHA 1RD3B 2XXLA 2SFAA 1OWHA 2Q6DA 1EASA 1GCDA 2A7JA 4X0WU 1TBZH 4ISIH 1WTHD 3U8OH 1W10U 5TJXA 3SU0A 4CRFA 3SNCA 5DK1A 3H7TA 2PTCE 2GCTB 1GJ4H 2ZDVH 1G3EA 2CGAA 2HPPH 2FODA 3SBKA 2Z3EA 1V2JT 4ZH8A 1ZZZA 3L6PA 4KP0A 1KSNA 3SJ8A 3RXLA 1GDUA 1TA6A 3PV5A 4TY6A 2D26C 5J4SA 2XC0A 4D76A 2WPJS 2ZU4A 2VU8E 1D9IA 4FUFA 1FN8A 3UFAA 2DUCA 2G00A 1IHTH 1MTUA 4A1TA 4NWLA 2BLVA 2GP9B 1MTSA 3MI4A 1P8VC 1ELAA 3BIVH 3SNBA 5E0JA 1GHWH 3E91A 1DE7H 1ACBE 1QL8A 1E38B 3E0NB 2BY8X 1P04A 2AERH 1KXFA 2ZHFH 1DWDH 1Q2WA 1QBVH 2GMTC 5C2ZA 1MAYA 4LXBH 3UY9A 1M9UA 3Q3YA 4YO9A 2BD8A 1DITH 2O9QA 3TGIE 1WXRA 3S9AA 1DWBH 1O35A 5DJ7A 2WV5A 3S9BA 4ZKSU 5FPYA 1VCPA 4K8BA 2BD4A 1HFDA 1PQ5A 4X8TH 3U8TH 1SQOA 1V2OT 3ELAH 4MNXA 2RG3A 4Y8ZA 4ZROA 3PROA 3ODDA 2BDGA 1JOUB 3U1JB 2F9UA 2ZF0H 2TGPZ 2WPMS 1OP8A 1EJNA 3MFJA 3TU7H 1MH0A 1YKTA 1MAXA 1TOCB 4OM9A 3ENSB 3CS0A 1MUEB 4HI3A 4Y76A 2STAE 1O32A 2OBOA 1GL1A 2PKAA 3A84A 3RU4T 1P9UA 3FP6E 2CV3A 3TK6A 4MQAA 3P8FA 1U6QA 3BTME 1SFQB 3ZYDA 1C2HA 1AUTC 1TRYA 1UCYK 4Q7XA 4AYVB 2Z9GA 4CRBA 3ATKA 2NU3E 2BMGB 2BTCE 3QUMP 4TPIZ 1C5RA 1GMDG 1HPGA 1GMCF 1WCZA 1GHBF 1ZSKA 4O9VA 1WQVH 2FI3E 1Y3VA 2WUBA 3AW1A 2BOHB 4B2AA 1GI8B 1V6DA 1HJ9A 1ETRH 1GI2A 3CP7A 3ZZ3A 2K1QA 3S9CA 1ANBA 1TPOA 1UK3A 3A86A 1A61H 4MNWA 2VWMA 1NN6A 3D49H 5JYIA 1ANCA 4A7IB 2AMPA 1ABJH 3C27B 1ELVA 5C20A 5C5OA 3RMOH 1LHDH 1JRSA 4K60A 4NGAH 1T7CA 7GCHF 4YT6H 3SV9A 1BB0B 4U30A 1AZZA 2FOHA 2B0FA 3UR6A 1GJCB 4I8GA 4DCDA 1GCTB 1IQMA 5TCCA 2ZIQH 2ZNKH 1EUFA 1RTKA 1XXFA 2AMDA 2BYAX 1OWJA 2ZFFH 1G9IE 1OP0A 1GI0A 1CT4E 5GCHG 1E36B 5GDSH 4ZMAH 3BV9B 1C1PA 2AYWA 3DA9B 1T31A 2OTVA 4E7RG 2PHBA 1DS2E 4CBNA 1J15A 1HJAB 1ZHRA 1DUEA 3K65B 4GUXA 1C2MA 2F9OA 2GCTC 4FUDA 1PJPA 1GDNA 1BJVA 4CHAB 1S84A 1D3PB 3SI4H 1O3DA 3BG4B 2GZ7A 2A4QA 1ESBA 2AIPA 1MKXK 3M7QA 1EB1H 1O2YA 2NU1E 2A5IA 1QURH 4Q7ZA 1ZMLA 4Y8YA 1LVOA 2QV1A 5HMAA 1GDQA 2PWXA 2ZPQA 1O5FH 1XKBC 3T26A 1GI5A 4B74A 2XRCA 1FPHH 4JK5A 3PMBB 1QB1A 4OS7A 1H1BA 1RTFB 1BMAA 1S81A 1PPFE 1P9SA 3FVFB 1O3AA 2FMJA 1A46H 1O2LA 1OWDA 1MTNB 3ZZAA 4AB8A 1IQEA 2ZA5A 2BOKA 1P03A 2BZAA 1SHYA 3SV6A 3HKJB 2C8XB 5FHTA 3A7YA 2QAAA 1B5GH 3A87A 4IS5A 3RXTA 3RLYH 2H1UA 2A5AA 2EI7A 3UNRA 3DD2H 2CHAB 4B75A 3VGCB 1YYY1 1QBOA 1BRCE 3UWIA 3BEFB 1FNIA 2PV9B 2VIPA 1TX6A 5C67A 1OS8A 2C8YB 1BCUH 1S83A 3M3VA 2VVVA 1F92A 1ZHMA 3MH7A 1IQKA 2Z6BD 1MU8B 4ZKOU 3PMJA 1A1RA 1C1SA 1S82A 3E6PH 3QWCH 4NZLA 2BLWA 4AFSA 4X1SU 2OBQA 5AFZH 2J38A 3Q00A 1UTLM 4NA7A 1WU1A 2ALPA 1TQ7B 1HRTH 1GMCG 2HWLB 2HNTF 2GT7A 2VWLA 5C1XA 2R9PA 1P11E 3MTYA 5ESBA 2UUFB 1X7AC 2FWWA 2OQ5A 2GVFA 4R8TB 1HV7A 2PW8H 1K1OA 1GWAA 3TH2H 1G2MA 2BDHA 2P59A 4WMFA 2P3UB 2CJIA 2EI6A 3PO1C 1HAOH 5L6NH 1P2OA 4GPGA 1SGNE 3KN2A 1O2SA 1GBLA 1YGCH 4PROA 1SOTA 5T6FA 1KXEA 4NWKA 1GHZA 4RI0A 1GI4A 2BVXH 3CS7A 1CQQA 4MNYA 1CT0E 1TNGA 1O34A 1P12E 3A8AA 3ZZ8A 3NZIA 2H5DA 4Y8XA 5EQRA 2SGFE 1LPZB 4AG2A 3BG8A 2ZHQH 3OSYA 5T3HA 3SQHE 5A09A 3RXUA 8ESTE 3ZZ9A 3SU3A 4WJG2 1P02A 3DT0H 3G01A 1HAPH 2JETB 1FY5A 4NFEA 1SPJA 1TBQH 2Q6GA 3ZZ4A 1TNKA 2ESTE 3QX5H 5F03A 3MOCA 3VB3A 1QL7A 4UFEH 3B8JA 4Q2KA 1C2FA 1TGCA 2A4OA 4ISOA 5DP7A 4H42U 3GDVA 3M7UA 1MBQA 4XFQA 1QBNA 5A0BA 1ZGVA 2G51A 3F9EA 1W2KH 3FANA 1SGPE 4UD9H 1NC6A 1P10A 2V0BA 3T25A 1JIMA 5F8XA 2GTBA 1ARBA 4ABBA 2PKSB 3KHVA 5E2PA 2TPIZ 3HK6B 2SNWA 2CN0H 1GJ5H 3A8BA 1AHTH 3GYMA 2ZO3H 3RUOA 1GJ8B 4TY7A 2HNTC 3F9HA 4ZKRU 1AVXA 1GHAG 1PPHE 5AFYH 5CE1A 1HAIH 1Z7KA 2V3OH 1V3XA 1L0ZA 2G5NA 3DFLA 2QYIA 1SB1H 3GICB 3LPRA 3TK9A 4MG3A 1O38A 5GNDA 1GMHF 3A7TA 5DPAA 5HM9A 4J1YA 3P95A 5FCKA 1GGDB 3RC6A 4B6EA 2BXUH 1MCTA 1BTHH 3UWJH 2Q1JA 3GOVB 3WY8A 2A45B 1YLDA 1NM6A 2P8OB 1NTPA 3GY4A 3EE0B 3BTWE 1UHBB 4ABFA 1GBEA 1HYLA 1SLWB 2F9PA 1LPKB 3GISB 1C1RA 2RDLA 8GCHF 3PMHB 1HAVB 4X1QU 4K5ZA 5K0HA 1H9LB 1Y5AT 4MDSA 4X1RU 2H9EH 3MNBA 1KTSB 3RXOA 3I29A 1BITA 4YESB 3DUXH 2CHAC 3FZZA 6GCHG 3RXIA 5F8TA 2O8LA 3U98H 3O8BA 3MO3A 3V12A 4YLQH 1LTOA 4JYTA 3D23A 1DX5M 1THPB 4INKA 1QQUA 3K6YA 2FS9A 4Y11E 4E06H 1TGBA 2WV9A 3M5OA 1KYNA 1NRRH 5T6DA 1EATA 4FUGA 1EJAA 3V3MA 2FYRA 3H5CB 2ZCKP 1XUIA 2ODYB 3BTGE 1EAWA 1WTGH 2ILNA 1K1JA 1ARCA 2R3YA 2FLRH 1K2I1 2G55A 2YNBA 1GVKB 3KL6A 4YOGA 3SHCH 2VIDA 1NRQH 3MH5A 2Z9KA 5C5NA 1K1PA 5AHGH 4Y0YE 1RJXB 1T4VH 3SGBE 2BLOA 2YNAA 1CHOF 3BTKE 2ZFSA 1AWFH 5EW2H 2WUCA 3ATWA 3OU0A 4ABJA 1CSOE 4JZFH 1EAIA 2PSXA 1XUKA 9ESTA 1JWTA 2BLQA 5JBBS 1EPTB 1V2ST 2Y7ZA 4A1VA 3SU1A 1HJ8A 2ODQA 1QR3E 2A1DB 1FAXA 1O2ZA 1G30B 1SR5C 1CBWC 4XBCA 2UUJB 2ZCHP 1SGDE 4B2BA 4UFFH 2BD7A
chains in the Genus database with same CATH superfamily
2ZECA 4MTBA 5T1VA 2O8TA 3SUEA 3N7EA 3A81A 1ZRKA 2BXTH 3AVZA 5DP6A 3OTJE 1L4DA 7ESTE 4IN1A 1AKSB 4ZAEA 3DHKH 3STJA 1N6YA 5FXLA 3P8OA 2LNCA 3RXCA 5EW1H 2J9NA 4AOQA 2HOBA 1FV9A 1YPHC 2KX4A 3MH4A 1C1NA 3RXFA 1WUNH 1CO7E 1FPCH 3SGQE 1W3CA 1J9CH 3GCNA 2QXGA 1A5HA 1C2GA 2DE8A 4AFZA 5FX5A 1HUTH 1TAWA 4IN2A 1UTPA 4ISLA 1UVTH 4ABHA 4X1NU 2ZI2H 4M7GA 3SO3A 1O5BB 1C1OA 1HXEH 4WY3A 3VG8A 4OS6A 4B73A 1JBUH 2XBWA 6LPRA 2ZHEH 3GCTF 1BT7A 1AIXH 2VNTA 4XBDA 5C17A 5IDKA 4YTAA 1NRPH 2J94A 1LQEA 3WWBA 2ZFRH 5BRRE 1GMHG 4F55A 1OKXA 4A5TS 3RMMH 2C3SA 3O8CA 1GGDC 1L4ZA 1TLDA 1XUFA 1ANEA 1GI7B 5HM2A 3BF6H 2ZU5A 5E0GA 2YMSC 5F53A 1OP2A 3RC5A 1O2IA 2P8OC 3MNXA 3UQVA 1O3PB 3B9FH 1F0SA 3LKWA 4K3JA 1V2WT 1ELFA 3UR9A 2QF3A 3SW2B 2BDBA 1AE5A 2ZHDA 5ETXA 4BAMB 4AN7A 2FOEA 2VWNA 5A0CA 2ZP0H 1UTQA 2XW9A 1YM0A 2FOBA 1BDAA 1PPBH 1AB9C 1SGEE 4I86A 4IBLH 5DN6D 3N7OA 1H4WA 1MTWA 1DWCH 1N6XA 4U01A 1W12U 1KXDA 3V0XA 4ISHH 3LOXA 1ZGIA 3PLBA 1GJBB 2OINA 1BRBE 1S85A 2FI5E 2ZDMA 4F4OC 4BXSA 1VITF 1Z1IA 2QE7D 4I8KA 4ESTE 2XC4A 3ATMA 1EFRD 2XNIA 2IOTA 1EXFA 1QGFA 1Z8IB 3SU4A 3PB1E 4GHQA 4D8NA 5C0UA 2KAIB 2HNTE 3SJOA 5JBAS 2RCEA 1NT1A 2GCHG 2Z94A 3HK3B 1CHOG 1WQSA 3OAAD 2XBYA 1GI1A 1LHFH 1RXPA 4GCHF 2KCOA 3D65E 1BUIA 2W3IA 6CHAB 3LGUA 3SU6A 3M36A 5A8YA 1EQ9A 4U2WA 1W7XH 3PTBA 1GG6C 2A7HA 1IHSH 1VJAU 1LO6A 2Y80A 2ZPSA 1EP5A 3P17H 5G4BA 4ABDA 3RMLH 2HPQH 2QF5A 4GSOA 4I8HA 2HGTH 4ASHA 5JB8S 1SGIB 2OC0A 2R2WU 1G36A 3A80A 1VKYA 5FL7D 1K28D 2QGRA 1CGJE 3OFND 2C93B 1SQRA 1Y3UA 2A4RA 3RXGA 5DP9A 3A8DA 1HLTH 4ABEA 3PMAB 3RXEA 5GWZA 2ZDAH 3F2FA 3MU5A 1QB9A 2UUKB 1EZUC 1L2EA 1BBRK 3ZZBA 2KCPA 2QF0A 3KNXA 2Z3DA 1T8LA 2Y5FA 2A2XH 3ZVDA 2BY6X 1KXCA 2BD9A 2FESH 3URCA 1W8BH 1FMGA 1TBRH 4NSYA 2V6NA 3CENA 2ZU1A 2VIOA 3GY7A 4HG6A 4ZHAA 2ALVA 4TYDA 3RXDA 1SQAA 2PGQB 3U69H 1GHVH 1SLXB 1MD8A 1C5UA 1YPJH 3I77A 1C9PA 4D9RA 1Q3XA 4WF8A 1C5ZB 2J98B 2Y5HA 1MKWK 1JRTA 2CF9H 2NU2E 2ZGHA 1SLVB 2WSSD 1DFPA 2BD2A 1BTYA 1FX0B 4Y0ZE 1Z6JH 2PUXB 2CMYA 4BNRA 1C5PA 2AMQA 4O3TA 3VB5A 4IW4E 9LPRA 4HZHA 1RRKA 2I6QA 1DOJA 1DSUA 3MMGA 4X6PA 4WXVA 2J95A 1D6RA 5GPIB 4X6OA 2H9TH 2Q6FA 2GZ8A 4YLUA 1TNJA 1O3KA 1QL9A 2J92A 1MU6B 2KZ4A 1H9HE 4NFFA 4AZ2B 3ZVBA 2BD3A 1FIWA 4D9QA 2VH6A 3NKKA 1SGQE 2DE9A 1TX7A 1BTPA 1C9TA 2F83A 1OSSA 3PYHA 1YPGH 1P2MA 4ACBA 1FZZA 1QFKH 3Q3XA 2SGEE 3RM0H 1UO6A 1G32B 1O3NA 4X2VA 3RXSA 4Y10E 5HIYA 1C2EA 1RGQA 4NSVA 3TLOA 1AQ7A 4X2XA 4I32A 2UWLA 1B0FA 1DXPA 1PQAA 3RU4E 1SGTA 2KR7A 1IQGA 4INHA 4MPWA 3UPEA 3ZVCA 2VGCB 1AE8H 1YPHE 1VGCB 4B76A 2Y7XA 3ZZ6A 5DP8A 1O5AB 2WPLS 4LZ1H 1G2LA 4XSKU 1V2KT 1IQFA 5JBTA 3RMNH 4DJZB 1UCYE 3RP2A 1PQ8A 1C1UH 1S0QA 2W7SA 2UUYA 3M5MA 4HGCA 2J5UA 1ELTA 2PGBB 1IQHA 4Q80A 3SNDA 2C90B 4NA8A 2OQUA 1V2PT 2QIQA 4ZKNU 2HVYB 3PTNA 5CHAB 2ASUB 3V7TA 3H09A 4IGDA 1ID5H 1QY6A 3U28C 4FU9A 4KKDA 2G4TA 1SOZA 1UTJA 2F4LA 1Z8GA 5A8XA 1QZ8A 1V2NT 5FPTA 1BBRE 4LZ4B 1A5IA 2FDAA 3RLWH 2G81E 2A2QH 1QRWA 3E3TA 1TGSZ 3RM2H 2SGQE 1T8NA 1O2XA 1HAYB 1O30A 2AIQA 4MPXA 4WH6A 1C2IA 1JIRA 4MLFB 1BHXB 3P8NA 4MNVA 5A2MH 2ZEBA 1DPOA 1Y3XA 1YC0A 2GX4A 4E7NA 5LPEA 3SYJA 3M37A 5C1YA 1MKXH 1GBFA 3LGYA 3HATH 1LMWB 2VINA 1L1JA 5DKMA 1BRUP 2ULLA 1XUHA 2BVSH 4X8UH 4AORA 3TGKE 2A5KA 2FEQH 1OX1A 1VJ9U 3UOUA 3MO9A 4AYYB 4YM9A 2F43B 2SGAA 3OX7U 4NZQA 5B6OA 3FOAA 1FN6A 1YCPM 3OY6U 1WOFA 2WHXA 3A7VA 1UTNA 4CREA 3SV2H 4JYUH 1AGJA 4X2YA 5L2ZH 3BTHE 2W5EA 1BZXE 1GHBG 2ANYA 2VWOA 2ZWLH 4FETA 5E0HA 3RDZA 2FM2A 3IG6B 3P92A 2ANKH 5CMXH 2P94A 2FX6A 3SUDA 1ELGA 3F6UH 1AFQB 2GKVE 1FQ3A 2D8WA 5GIBA 5JBCS 2A4GA 2NU0E 3V13A 4KTUA 2P3FH 5LPFA 1FIZA 1V2TT 4KGAA 2OCVB 1MTVA 3ATIA 1O0DH 1N8OB 3RXMA 4CH2B 5FBIA 4XRNA 3KCGH 4IMZA 1MD7A 3AASA 3UUZA 3F0PA 4ZXXH 4GHTA 5EXLA 1C5QA 1DUAA 1ETTH 1HAXB 2BDAA 7GCHG 3HGPA 1FDPA 5K7RA 1UTOA 1HCGA 1ZSLA 4AB9A 2XNDD 3DCLA 3TJOA 1T8OA 1OPHB 1P2NA 1P0SH 3PWCA 2WINI 1SGCA 2WYJA 3K6ZA 2TGDA 5AF9H 1KXBA 4ABGA 5J4QA 2HALA 3U1IB 1GCTC 2ZKSA 4OS1A 1VITH 2XWBI 5H4IB 1NPMA 5KECA 1E35B 4WH8A 1SC8U 2FX4A 4YT7H 4AGJA 1EJMA 1CT2E 2Y6TA 3S0NA 3KQEA 4DURA 1O2VA 3NUMA 5EGMA 1YP9A 1L1NA 1UHBA 1TA2A 2ZFPH 1C1WH 1H8ED 2YOLA 4AG1A 4BAOB 3GY3A 1AU8A 1SQTA 3EA9A 1W13U 1HAVA 1IAUA 1O2MA 1HJAC 1NFXA 2NWNA 2J2UA 4F49A 4TT3D 1C5LH 1TPPA 1TRMA 2C4FH 1DT2A 4CHAC 1DXWA 1CA0B 1T32A 1UVOA 3M3SA 4X8SH 3BG4C 1MABB 1A3EH 2V35A 1P2QA 2VIQA 1GHXH 1DICA 2Z9LA 3D62A 4RKOB 4XDEA 3QTVH 1BRAA 1CVWH 4B71A 1P2JA 4LK4A 1CGIE 1O3JA 1ZTKA 2EEKA 3OYPA 1HAZB 4Y7AA 1KDQA 1AZ8A 1QIXB 5T6GA 3K2UA 1ZOMA 1AN1E 4ZXYH 3GCOA 3P6ZB 1T4UH 1QB6A 2M5TA 1TIOA 3OEED 4KTCA 5DG6A 3LONA 1YCPK 1YY3A 2C8WB 4X8VH 1P57B 1WV7H 2K0QA 2ZG0H 1MTNC 1DY9A 5CHAC 1BMFD 1UVPA 2VIVA 1V2UT 2FZZA 2OC7A 3WW7A 3E1XB 1H8HD 1P01A 1A0LA 1O3IA 2OUAA 3VGCC 2NU4E 1O33A 1C2LA 4H6TA 3UNSA 1IQLA 3TH4H 3RXHA 1TWXB 3TH3H 2GJGA 4BAKB 1N1LA 5DGJA 1F0UA 2ZDLA 4JZIA 1BA8B 4ZHMU 4BAHB 1O3FA 1EPTA 1C5XB 2ZDKA 1ZJDA 5EODA 1DANH 4X1PU 4NG9H 3UREA 1F5KU 2QCYA 2HLCA 2PTNA 2QA9E 1OXGA 1ZHPA 4I31A 5A0AE 1EAXA 3RU4D 1UK2A 1TX8A 4DT7B 2GV7A 4K2YA 2F9VA 5EPYA 1O2TA 4OGXA 2PSYA 5FX6A 1O2GH 1JMOH 2FLBH 4A6LA 1XM1A 3BIUH 2FXRA 1FY3A 2G8TA 2ZC9H 4FUIA 5JPMH 2GMTB 1FONA 2SGPE 1HAHH 3F1SB 4FUEA 1AKSA 3SJIA 1SLUB 3PM3A 1LHCH 3OY5U 1XUJA 3T2NA 1O2UA 4I8JA 3SHAH 4A1XA 1P06A 3UIRA 2LPRA 2FOMB 3A88A 1ZTLA 3EA7A 3OE7D 1FUJA 1UVUH 4M9FA 1FY1A 4TSFD 3BTQE 3BEUA 2ZFQH 1LKAA 3VB6A 1A2CH 1C5SA 2JJ2D 1N8OC 3Q77A 4UFGH 3ZVAA 3KGPA 3GDSA 2LP6A 3GDUA 1HIAB 3DSOA 1F5RA 2A32A 2P16A 1GPZA 4I33A 1Z71A 3VXFH 1EZSC 2A0QB 4INLA 3GYLB 2YMSD 1RTLA 2F91A 4FOUC 1O5EH 4H4FA 3ZVGA 4D7FA 3U9AH 4Y6DA 1GVLA 2OXSA 2RDEA 3T5FH 3SZEA 3ZZCA 2I6SA 4K8YA 1YPMH 4FU8A 2Z7FE 2Y81A 4XOJA 1TYNA 2JETC 3QTOH 2D1JA 2FO9A 5L30H 2ZU2A 1P3CA 3R3GB 5EQQA 1J17T 1MBMA 7LPRA 1IQNA 1O2RA 1YWUA 1QRXA 1C2JA 1LHGH 2KCAA 1E34B 1E1RD 4K1SA 4XE4A 5HXFA 3SJ9A 2BVRH 3I78A 3R0FA 6ESTA 1BMMH 1HNEE 4RKJB 3RXKA 3JZ2B 5EG4A 5EPNA 3TNSA 1O2WA 1AVWA 1DDJA 1A3BH 3JZ1B 4Z0KA 4AX9H 5A8ZA 1O36A 4NIYA 3A83A 1K1NA 1OYQA 2BD5A 2HLDD 4OS2A 2ZZUH 1QA7A 1BMNH 1SGYE 2PKSC 1C2DA 1ELEE 1YPKH 5DP3A 5IK2D 3BTFE 3MWIU 1ORFA 3QGNB 3SNAA 5HYOA 5GJ4B 1QJ7B 4KTSA 1CA0C 2STBE 2XWAA 1BTZA 1P2IA 1YPLH 1TGNA 3LGIA 1SGFA 5IYTA 3FP8E 3EDXB 1SSXA 3MNSA 1EOJA 1SG8B 1O2NA 1H8IH 1XUGA 3QDZB 2ZGCA 1QCPA 5KGOA 1DLEA 3VB4A 1K1LA 3FP7E 3AAUA 1IQIA 1E1QD 1TMBH 2XCNA 3LJJA 5F8ZA 2P3TB 3BTTE 2HVXA 5LH8A 2ANMH 1KLJH 4FUCA 3SNEA 2ZTXA 2RA3A 1NFWA 1J14A 2KAIA 1ESAA 1GBTA 3SUFA 1ELDE 3RXVA 1DLKB 8GCHG 1B7XB 4U32A 5FAHA 1ZPCA 3Q76A 4IC5A 3M3TA 1K1MA 1E0FD 2BQ6B 5LGOA 5BPEA 3M7TA 1LKBA 3SV7A 1MMJN 2FYQA 7KMEH 5KEDA 1MCVA 1C5WB 1TMUH 2ZTZA 1NU7B 4JZ1A 1CA8B 2O8WA 5ESTE 1EKBB 1HXFH 3RXAA 3T62A 1F2SE 1GJ6A 4O03A 1QHRB 3MNCA 5EOKA 2P95A 4FU7A 3PRDA 4WXIA 3GS9A 2SNVA 2XCFA 3OTPA 1SFIA 3N7DA 3SORA 1ZPBA 1QJ6B 1O3OA 3LDXH 3TJVA 4J2YB 3MU8A 5ABWA 2IJOB 2V7QD 1GL0E 4MVNA 5CHBA 3KIDU 4E05H 1O5DH 2H2ZA 4DOQA 3GY5A 2JJ1D 3SUGA 2JDID 1AUJA 1FAKH 1F5LA 1P2KA 3L3TA 3KQDA 1GJDB 3LH3A 2L74A 1O3MA 3KYGA 1MQ6A 1UW7A 1V2MT 1O3HA 2AFQB 2VBCA 1T8MA 4YZUA 4Z6AH 3STIA 3T28A 4CRAA 2QF4A 1AVGH 1LPGB 1E37B 1Z8JB 3BSQA 2VVCA 4CRDA 2GZ9A 2FOAA 3UOPA 1LQDB 4IMQA 1FY4A 4Y7BA 1ETSH 2J98A 1G37A 2FOFA 3ZV8A 1DSTA 1F0TA 3RXQA 1EPTC 1GBJA 4OS4A 1G3CA 3MO6A 3E16B 1BTXA 1OYTH 2Y5GA 3BTDE 2ZGBH 1NZQH 2Z9JA 1VR1H 3KQ5A 3P70B 4BTUB 2QXHA 1SHHB 4NIWA 4WWYA 1PFXC 4K1TA 2R3UA 2BHGA 3UAIC 2QN5T 2ZTYA 1S6HA 3ZV9A 2ZQ1A 1G3BA 4DIHH 2JH5D 1P3EA 2KM0A 2B5TB 1KIGH 2XC5A 1O5CB 2BB4A 4BOHA 1GBBA 3LGVA 1WYKA 2BY5X 2F3CE 3SU2A 1K1IA 1BMLA 4KELA 1GHYH 3K9XB 2AHME 4DIIH 3HGNA 3PO1B 5EQSA 2G5VA 1BTUA 5EXNA 3TGJE 2BQWB 2FOCA 4Y79A 5JB9S 1QRZA 2GDDA 2WZQA 4I8LA 2ZU3A 4JMYA 3S7KB 3PLKA 2FTMA 3TJUA 1BIOA 5FPSA 1TPSA 1QJ1B 1LDTT 1GI9B 1NROH 2AS9A 3L33A 2ZFTA 2BZ6H 2XBVA 3SU5A 4K69A 1UCYH 2JH0D 2PR3A 1QTFA 4K1EA 2ZQ2A 1ESTA 1GJAB 3GCTG 4IC6A 3Q3KA 2A31A 2PKAB 1GBDA 3VXEH 1HGTH 3QK1A 1NRNH 1RFNA 1C5TA 3LC3A 2D2DA 1A7SA 4AC9A 4AGKA 1BBRH 3ZZDA 1TB6H 1DWEH 4LOYH 2VVUA 2BX4A 4B1TA 4FUJA 2WPKS 4RN6A 1EX3A 2TRMA 3SI3H 4YXWD 3TVJB 1RIWB 1UMAH 3KQBA 2IJD1 4ZUHA 4ZHLU 1PPEE 1UJ1A 3NPSA 1HAGE 4ACAA 1S0RA 3A8CA 1MKWH 4SGBE 1W11U 3NXPA 1O2JA 1O3CA 1W0YH 2GD4B 1DVAH 3BEIB 1TRNA 3GY2A 4JCNA 3A7XA 3BN9A 5C94A 1AI8H 1VCQA 2OLGA 1O3GA 1Y8TA 3T29A 4RT0A 3A7ZA 4MPUA 1XXDA 2QXIA 4TWWA 2GV6A 2GGVB 5C3NA 3EQ0H 1PPGE 1VITG 1PYTD 2JH6D 2V3HH 1GHAF 3GCHB 2FS8A 1GI6A 2SGDE 3QN7A 1TE0A 3QZRA 4X6MA 4BAQB 4JZDH 5E2OA 1D6WA 1LHEH 4NCYA 3HKIB 1C1MA 1P09A 1ZR0A 1C5MD 4UFDH 1OWKA 1EB2A 2OP9A 2VJ1A 1B0EA 3VEQB 8KME2 3S7HB 5DP4A 2ZDNA 4VGCB 3ATLA 1J8AA 3TITA 2WPDD 2OK5A 1FI8A 2L6OA 4GCHG 4JZEH 1FLEE 3LIWA 4XBBA 3ESTA 2Y82A 1FY8E 2R0LA 2G4UA 6CHAC 1TMTH 2BY7X 3QZQA 1O2QA 2W6ID 2O8UA 1EP6A 3LGTA 1AO5A 2AH4X 3F0OA 1VZQH 3N99A 2B7DH 1CGHA 1K21H 1K9OE 1SBWA 1NESE 6GCHF 3UTUH 2JKHA 1V2QT 1L1GA 1NS3A 3F68H 3H7OA 2A7CA 1BQYA 2W3KA 1GBMA 1XX9A 2CXVA 1C5VA 3TNTA 4DVAU 1ZYOA 2BQ7B 1S5SA 1G3DA 4CBOA 3SV8A 1HDTH 2ZGXH 3A85A 1NY22 1O2KA 2KFWA 2EA3A 1UTMA 3LJOA 1D3DB 4UEHH 4X6NA 1SGFG 1P05A 2WPIS 3PV4A 2VB0A 4WMDA 4Q7YA 4CR9A 1SI5H 1C5OH 1C5YB 1PYTC 4HFPB 3NCLA 3A7WA 4ISNA 3TK5A 1C4U2 3WWFA 2IN2A 5L2YH 2ANWA 2CF8H 3FAOA 1Z6EA 3A89A 5DP5A 2HRVA 1O5GH 2Z3CA 3ZVFA 4JK6A 2ZHWH 3EAJA 1BTWA 4B6FA 1KTTB 1O2HA 2TBSA 5C1UA 1C1TA 1LVMA 3SGAE 2EI8A 5E8EH 1O31A 3KEEA 4O97A 5EXMA 1Q31A 1GI3A 3ZZ5A 4F48B 2FIRH 4THNH 1GBAA 5FBEA 1F7ZA 3FZDA 1CU1A 3F2HA 5F6MA 5CDFE 2J4IA 4DG4A 1GVZA 1SL3A 1WAYB 1BHXF 3M61U 1ZMNA 1XVOA 4UDWH 2H5CA 1O2PA 3RXPA 4DGJA 2ZPRA 1GBIA 2ZCLP 1CBWB 4YOJA 5B6LA 3F3BA 5FCRA 3PLPA 1TONA 3ZYEA 3QGJA 4FUBA 4CRCA 1Y3YA 4BTIB 1THRH 3AK5A 4R0IA 1Y59T 5EJLA 3FFGA 2B9LA 3IITA 1NO9H 3T27A 1ZPZA 1XMNB 4Q4LA 2PUQH 5DSFA 1AWHB 1D3TB 3SQEE 5EU8A 3URDA 1XVMA 3W1EA 1ELCA 1SVPA 4ABIA 3LGWA 2VIWA 1UK4A 3AW0A 1OWEA 1AD8H 4TWYA 3U8RH 3MU4A 1RIWC 2BM2A 2UWPA 1NFUA 1LVYA 1GJ9B 1TGTA 2AGEX 5EIYA 4H6SB 1O37A 1YF4A 4Z1MD 3TIUA 4HTCH 2F9BH 1Y3WA 1Z1JA 1TPAE 2QXJA 3NK8A 3RXJA 4UONA 2J34A 3GY6A 4UE7H 1C4V2 1KLIH 1Y5BT 1GBKA 2TGAA 1SGRE 3MHWU 3LC5A 2VGCC 4SGAE 1WSSH 1VGCC 2BDCA 1TOMH 3EA8A 1J16A 4WVPE 4DW2U 2F9NA 2GDEH 2C8ZB 3GY8A 1EZXC 1NRSH 3M5LA 1JXPA 2PP6A 2G52A 4O3UA 2EC9H 3GCHC 1YBWA 5HIZA 4CRGA 5SGAE 1D4PB 1FJSA 2BY9X 2R0KA 3IWMA 1HBTH 4QT8C 2LELA 1OWIA 3ZZ7A 3KQCA 4P02A 2FPZA 2PLXA 1TQ0B 3DSGA 3SJKA 3KF2A 3O8DA 2WYGA 1SMFE 3ITIA 3VFEA 2IPHA 2QC2A 1LCYA 2FOGA 4VGCC 3F9FA 4FVDA 3UQOA 4AFUA 8LPRA 1S6LA 1H9IE 1TFXA 1TABE 3NWUA 2AEIH 1W14U 3LT3A 2VH0A 1C2KA 2K8IA 1F0RA 5TCAA 1W0ZU 2XBXA 1DY8A 1EAUA 3EYDA 2R2MB 1QA0A 1VCWA 2V3MA 1O3BA 3BTEE 3O8RA 1YLCA 1HIAA 4WMEA 3TPIZ 3A82A 1YPEH 1QNJA 1AB9B 1FXYA 3RXRA 1Y5UT 4TPYA 1C1VH 2WPHS 1ZSJA 4OS5A 5I25A 3C1KA 1DM4B 2RA0A 3EGKH 1NFYA 1ANDA 1YCPH 3ZVEA 3MH6A 4B2CA 1E79D 1C5NH 1KDQB 3SN8A 2OD3B 3M35A 4DY7B 5JDUB 1EZQA 1D3QB 2BDYA 1BOQA 4BTTB 1O3LA 1HB0B 1ZLRA 1ABIH 2W7UA 4FUHA 3QLPH 1UVSH 4BANB 3LH1A 4BXWA 1AFQC 3SZNA 2ODPA 2XOKD 1NU9A 2FP7B 4CR5A 1WBGB 3ODFA 1C1QA 4NA9H 1LVBA 5AVDA 3W94A 4AFQA 1PPZA 1THSH 2GCHF 2Z9IA 1TNIA 3MYWA 1GBHA 1K22H 3E8LA 2AGIX 3LU9B 3F2GA 1V2RT 2FI4E 2THFB 1RS0A 1OOKB 1GG6B 4OGYA 1EOLA 1AFEH 2XYAA 3RXBA 5HGGA 1CHGA 4A92A 4CH8B 1O2OA 2H9HA 2UWOA 2OC1A 4NIVA 2XTTB 1V2VT 2H6MA 2KCYA 1V2LT 1W0KD 4X2WA 2W26A 4MPVA 3W95A 1ZRBA 1O39A 1PPCE 2BDIA 4GAWA 2OC8A 4FXGH 3VB7A 4ABAA 2TIOA 1XKAC 4NIXA 1TNLA 3M5NA 1O3EA 2B8OH 1S6FA 1H8DH 1GMDF 3NRLA 3QO6A 1MZDA 2QY0B 1TALA 1KXAA 2AGGX 1W7GH 1INCA 1IOEA 2ZGJA 1GJ7B 1TNHA 4I7YH 1ZTJA 2EQNA 1A5GH 4GVUA 2P93A 2TGTA 1IQJA 4FVBA 3DFJA 3HPTB 3MU1A 2PFEA 3RC4A 1C4Y2 1BJUA 2FTLE 3PWBA 1A0JA 1MQ5A 2GT8A 2O8MA 3VPKA 2J97A 3MU0A 1CE5A 1PQ7A 1A0HB 4DT4A 5DO4H 1GBCA 1ELBA 4Y71A 3DSPA 3B23B 1ZMJA 4YOIA 5HKKD 3AAVA 1KLTA 5LPRA 1Z8RA 3E0PB 1MZAA 5I46H 5GXPA 3F9GA 3SOSA 4D7GA 3PV2A 1AY6H 2BX3A 1KY9A 4RT1A 4JYVH 1QQ4A 4GLYA 2WV4A 3TJNA 3S69A 3E90B 5GCHF 3P8GA 5PTPA 4RSPA 1UTKA 3UNQA 1A4WH 1ZJKA 1AMHA 4ASUD 1RD3B 2XXLA 2SFAA 1OWHA 2Q6DA 1EASA 1GCDA 2A7JA 4X0WU 1TBZH 4ISIH 1WTHD 3U8OH 1W10U 5TJXA 3SU0A 4CRFA 3SNCA 5DK1A 3H7TA 2PTCE 2GCTB 1GJ4H 2ZDVH 1G3EA 2CGAA 2HPPH 2FODA 3SBKA 2Z3EA 1V2JT 4ZH8A 1ZZZA 3L6PA 4KP0A 1KSNA 3SJ8A 3RXLA 1GDUA 1TA6A 3PV5A 4TY6A 2D26C 5J4SA 2XC0A 4D76A 1SKYE 2WPJS 2ZU4A 2VU8E 1D9IA 4FUFA 1FN8A 3UFAA 2DUCA 2G00A 1IHTH 1MTUA 4A1TA 4NWLA 2BLVA 2GP9B 1MTSA 3MI4A 1P8VC 1ELAA 3BIVH 3SNBA 3ZIAD 1KMHB 5E0JA 1GHWH 3E91A 1DE7H 1ACBE 1QL8A 1E38B 2JIZD 3E0NB 2BY8X 1P04A 2AERH 1KXFA 2ZHFH 1DWDH 1Q2WA 1QBVH 1OHHD 2GMTC 5C2ZA 1MAYA 4LXBH 3UY9A 1M9UA 3Q3YA 4YO9A 2BD8A 3UB0A 1DITH 2O9QA 2M2AA 3TGIE 1WXRA 3S9AA 1DWBH 1O35A 5DJ7A 2WV5A 3S9BA 4ZKSU 5FPYA 1VCPA 4K8BA 2BD4A 1HFDA 1PQ5A 4X8TH 3U8TH 1SQOA 1V2OT 3ELAH 4MNXA 2RG3A 4Y8ZA 4ZROA 3PROA 1YLNA 3ODDA 2BDGA 1JOUB 3FKSD 3U1JB 2F9UA 4XD7D 2ZF0H 2TGPZ 2WPMS 1OP8A 1EJNA 3MFJA 3TU7H 2RFKC 1MH0A 1YKTA 1MAXA 1TOCB 4OM9A 3ENSB 3CS0A 1MUEB 4HI3A 4Y76A 5EJ1A 2STAE 1O32A 2OBOA 1GL1A 2PKAA 3A84A 3RU4T 1P9UA 3FP6E 2CV3A 3TK6A 4MQAA 3P8FA 1U6QA 1NBME 3BTME 1SFQB 3ZYDA 1C2HA 1AUTC 1TRYA 1UCYK 4Q7XA 4AYVB 2Z9GA 4CRBA 3ATKA 2NU3E 2BMGB 2BTCE 3QUMP 4TPIZ 1C5RA 1GMDG 1HPGA 1GMCF 1WCZA 1GHBF 1ZSKA 4O9VA 1WQVH 2FI3E 1Y3VA 2WUBA 3AW1A 2BOHB 4B2AA 1GI8B 1V6DA 1HJ9A 1ETRH 1GI2A 3CP7A 3CNRA 3KYFA 3ZZ3A 2K1QA 3S9CA 1ANBA 1TPOA 1UK3A 3A86A 1A61H 4MNWA 3PRBA 2VWMA 1NN6A 3D49H 5JYIA 1ANCA 4A7IB 2AMPA 1ABJH 3C27B 1ELVA 5C20A 5C5OA 3RMOH 1LHDH 1JRSA 4K60A 4NGAH 1T7CA 5C0TA 7GCHF 4YT6H 3SV9A 1BB0B 4U30A 1AZZA 2FOHA 2B0FA 3UR6A 1GJCB 4I8GA 4DCDA 1GCTB 1IQMA 5TCCA 2ZIQH 2ZNKH 1EUFA 1RTKA 1XXFA 2AMDA 2BYAX 1OWJA 2ZFFH 1G9IE 1OP0A 1GI0A 1CT4E 5GCHG 1E36B 5GDSH 4ZMAH 3BV9B 1C1PA 2AYWA 3DA9B 1T31A 2OTVA 4E7RG 2PHBA 1DS2E 4CBNA 1J15A 1HJAB 1ZHRA 1DUEA 3K65B 4GUXA 1C2MA 2F9OA 2GCTC 4FUDA 1PJPA 1GDNA 1BJVA 4CHAB 1S84A 1D3PB 3SI4H 1O3DA 3BG4B 2GZ7A 2A4QA 1ESBA 2AIPA 1MKXK 3M7QA 1EB1H 1O2YA 2NU1E 2A5IA 1QURH 4Q7ZA 1ZMLA 4Y8YA 1LVOA 2QV1A 5HMAA 1GDQA 2PWXA 2ZPQA 1O5FH 1XKBC 3T26A 1GI5A 4B74A 2XRCA 1FPHH 4JK5A 3PMBB 1QB1A 4OS7A 1H1BA 1RTFB 1BMAA 1S81A 1PPFE 1P9SA 3FVFB 1O3AA 2FMJA 1A46H 1O2LA 1OWDA 1MTNB 3ZZAA 4AB8A 1IQEA 2ZA5A 2BOKA 1P03A 3EE7A 2BZAA 1SHYA 3SV6A 3HKJB 2C8XB 5FHTA 3A7YA 2QAAA 1B5GH 3A87A 4IS5A 3RXTA 3RLYH 2H1UA 2A5AA 2EI7A 3UNRA 3DD2H 2CHAB 4B75A 3VGCB 1YYY1 1QBOA 1BRCE 3UWIA 2W6JD 3BEFB 1FNIA 2PV9B 2VIPA 1TX6A 5C67A 1OS8A 2C8YB 1BCUH 1S83A 3M3VA 2VVVA 1COWD 1F92A 1ZHMA 3MH7A 1IQKA 2Z6BD 1MU8B 4ZKOU 3PMJA 1A1RA 1C1SA 1S82A 3E6PH 3QWCH 4NZLA 2BLWA 4AFSA 4X1SU 2OBQA 5AFZH 2J38A 3Q00A 1UTLM 4NA7A 1WU1A 2ALPA 1TQ7B 1HRTH 1GMCG 2HWLB 2HNTF 2GT7A 2VWLA 5C1XA 3OEHD 2R9PA 1P11E 3MTYA 5ESBA 2UUFB 1X7AC 2FWWA 2OQ5A 2GVFA 4R8TB 1HV7A 2PW8H 1K1OA 1GWAA 3TH2H 1G2MA 2BDHA 2P59A 4WMFA 2P3UB 2CJIA 2EI6A 3PO1C 1HAOH 5L6NH 1P2OA 4GPGA 1SGNE 3KN2A 1O2SA 1GBLA 1YGCH 4PROA 1SOTA 5T6FA 1KXEA 4NWKA 1GHZA 4RI0A 1GI4A 2BVXH 3CS7A 4P00A 1CQQA 4MNYA 2EY4C 1CT0E 1O34A 1TNGA 1P12E 3A8AA 3ZZ8A 3NZIA 2H5DA 4Y8XA 5EQRA 2SGFE 1LPZB 4AG2A 3BG8A 2ZHQH 3OSYA 5T3HA 1K0HA 3SQHE 5A09A 3RXUA 8ESTE 3ZZ9A 3SU3A 4WJG2 1P02A 3FO8D 3DT0H 1NBMD 3G01A 1HAPH 2JETB 1FY5A 4NFEA 1SPJA 1TBQH 2Q6GA 3ZZ4A 1TNKA 2ESTE 3QX5H 5F03A 3MOCA 3VB3A 1QL7A 3FN8A 4UFEH 3B8JA 4Q2KA 1C2FA 1TGCA 2A4OA 4ISOA 5DP7A 1WDIA 4H42U 3GDVA 3M7UA 1MBQA 4XFQA 1QBNA 5A0BA 1W0JD 1ZGVA 2G51A 3F9EA 1W2KH 3FANA 1SGPE 4UD9H 1NC6A 1P10A 2V0BA 3T25A 1JIMA 5F8XA 2GTBA 1ARBA 4ABBA 2PKSB 3KHVA 5E2PA 2TPIZ 3HK6B 2SNWA 2CN0H 1GJ5H 3A8BA 1AHTH 3GYMA 2ZO3H 3RUOA 1GJ8B 4TY7A 2HNTC 3F9HA 4ZKRU 1AVXA 1GHAG 1PPHE 5AFYH 5CE1A 1HAIH 1Z7KA 2V3OH 1V3XA 1L0ZA 2G5NA 3DFLA 2QYIA 1SB1H 3GICB 3LPRA 3TK9A 4MG3A 1O38A 5GNDA 1GMHF 3A7TA 5DPAA 5HM9A 4J1YA 3P95A 5FCKA 1GGDB 2CK3D 3RC6A 4B6EA 2BXUH 1MCTA 1BTHH 3UWJH 2IPQX 2Q1JA 2YMSB 3GOVB 3MQKC 3WY8A 2A45B 1YLDA 1NM6A 2P8OB 1NTPA 3GY4A 3EE0B 3BTWE 1UHBB 4ABFA 1GBEA 1HYLA 1SLWB 2F9PA 1LPKB 3GISB 1C1RA 2RDLA 8GCHF 3PMHB 1HAVB 4X1QU 4K5ZA 5K0HA 1H9LB 1Y5AT 4MDSA 4X1RU 2H9EH 3MNBA 1KTSB 3RXOA 3I29A 1BITA 4YESB 4ZCNA 3DUXH 2CHAC 3FZZA 6GCHG 3RXIA 5F8TA 2O8LA 3U98H 3O8BA 3MO3A 3V12A 4YLQH 1LTOA 4JYTA 3D23A 1DX5M 1THPB 4INKA 1QQUA 3K6YA 2FS9A 4Y11E 4E06H 1TGBA 2WV9A 3M5OA 1KYNA 1NRRH 5T6DA 1EATA 4FUGA 1EJAA 3V3MA 2FYRA 3H5CB 2ZCKP 1XUIA 2ODYB 3BTGE 1EAWA 1WTGH 2ILNA 1K1JA 1ARCA 2R3YA 2FLRH 1K2I1 2G55A 2YNBA 1GVKB 3KL6A 4YOGA 3SHCH 2VIDA 1NRQH 3MH5A 2Z9KA 5C5NA 1K1PA 5AHGH 4Y0YE 1RJXB 1T4VH 3SGBE 2BLOA 2YNAA 1CHOF 3BTKE 2ZFSA 1AWFH 5EW2H 2WUCA 3ATWA 3OU0A 4ABJA 1CSOE 4JZFH 1EAIA 2PSXA 1XUKA 9ESTA 1JWTA 2BLQA 5JBBS 1EPTB 4Q63A 1V2ST 2Y7ZA 4A1VA 3SU1A 1HJ8A 2ODQA 1QR3E 2A1DB 1FAXA 1O2ZA 1G30B 1SR5C 1CBWC 4XBCA 2UUJB 2ZCHP 5EJZA 1SGDE 4B2BA 4UFFH 2BD7A
chains in the Genus database with same CATH topology
2ZECA 4MTBA 5T1VA 2O8TA 3SUEA 3N7EA 3A81A 1ZRKA 2BXTH 3AVZA 5DP6A 3OTJE 1L4DA 7ESTE 4IN1A 1AKSB 4ZAEA 3DHKH 3STJA 1N6YA 5FXLA 3P8OA 2LNCA 3RXCA 5EW1H 2J9NA 4AOQA 2HOBA 1FV9A 1YPHC 3MH4A 1C1NA 3RXFA 1WUNH 1CO7E 1FPCH 3SGQE 1W3CA 1J9CH 3GCNA 2QXGA 1A5HA 1C2GA 2DE8A 4AFZA 5FX5A 1HUTH 1TAWA 4IN2A 1UTPA 4ISLA 1UVTH 4ABHA 4X1NU 2ZI2H 4M7GA 3SO3A 1O5BB 1C1OA 1HXEH 4WY3A 3VG8A 4OS6A 4B73A 1JBUH 2XBWA 6LPRA 2ZHEH 3GCTF 1BT7A 1AIXH 2VNTA 4XBDA 5C17A 5IDKA 4YTAA 1NRPH 2J94A 1LQEA 3WWBA 2ZFRH 5BRRE 1GMHG 4F55A 1OKXA 4A5TS 3RMMH 2C3SA 3O8CA 1GGDC 1L4ZA 1TLDA 1XUFA 1ANEA 1GI7B 5HM2A 3BF6H 2ZU5A 5E0GA 2YMSC 5F53A 1OP2A 3RC5A 1O2IA 2P8OC 3MNXA 3UQVA 1O3PB 3B9FH 1F0SA 3LKWA 4K3JA 1V2WT 1ELFA 3UR9A 2QF3A 3SW2B 2BDBA 1AE5A 2ZHDA 5ETXA 4BAMB 4AN7A 2FOEA 2VWNA 5A0CA 2ZP0H 1UTQA 2XW9A 1YM0A 2FOBA 1BDAA 1PPBH 1AB9C 1SGEE 4IBLH 5DN6D 3N7OA 1H4WA 1MTWA 1DWCH 1N6XA 4U01A 1W12U 1KXDA 3V0XA 4ISHH 3LOXA 1ZGIA 3PLBA 1GJBB 2OINA 1BRBE 1S85A 2FI5E 2ZDMA 4F4OC 4BXSA 1VITF 1Z1IA 2QE7D 4I8KA 4ESTE 2XC4A 3ATMA 2XNIA 1EFRD 2IOTA 1EXFA 1QGFA 1Z8IB 3SU4A 3PB1E 4GHQA 4D8NA 5C0UA 2KAIB 2HNTE 3SJOA 5JBAS 2RCEA 1NT1A 2GCHG 2Z94A 3HK3B 1CHOG 1WQSA 3OAAD 2XBYA 1GI1A 1LHFH 1RXPA 4GCHF 2KCOA 3D65E 1BUIA 2W3IA 6CHAB 3LGUA 3SU6A 3M36A 5A8YA 1EQ9A 4U2WA 1W7XH 3PTBA 1GG6C 2A7HA 1IHSH 1VJAU 1LO6A 2Y80A 2ZPSA 1EP5A 3P17H 5G4BA 4ABDA 3RMLH 2HPQH 4GSOA 2QF5A 4I8HA 2HGTH 4ASHA 5JB8S 1SGIB 2OC0A 2R2WU 1G36A 3A80A 5FL7D 1K28D 2QGRA 1CGJE 3OFND 2C93B 1Y3UA 3RXGA 2A4RA 5DP9A 3A8DA 1HLTH 4ABEA 3PMAB 3RXEA 5GWZA 2ZDAH 3MU5A 3F2FA 1QB9A 2UUKB 1EZUC 1L2EA 1BBRK 3ZZBA 2KCPA 2QF0A 3KNXA 2Z3DA 1T8LA 2Y5FA 2A2XH 3ZVDA 2BY6X 1KXCA 2BD9A 2FESH 3URCA 1W8BH 1FMGA 1TBRH 4NSYA 2V6NA 3CENA 2ZU1A 2VIOA 3GY7A 4ZHAA 2ALVA 4TYDA 3RXDA 1SQAA 2PGQB 3U69H 1GHVH 1SLXB 1MD8A 1C5UA 1YPJH 3I77A 1C9PA 4D9RA 1Q3XA 4WF8A 1C5ZB 2Y5HA 1MKWK 1JRTA 2CF9H 2NU2E 2ZGHA 1SLVB 2WSSD 1DFPA 2BD2A 1BTYA 1FX0B 4Y0ZE 1Z6JH 2PUXB 2CMYA 4BNRA 1C5PA 2AMQA 4O3TA 3VB5A 4IW4E 9LPRA 4HZHA 1RRKA 2I6QA 1DOJA 1DSUA 3MMGA 4X6PA 4WXVA 2J95A 1D6RA 5GPIB 4X6OA 2H9TH 2Q6FA 2GZ8A 4YLUA 1TNJA 1O3KA 1QL9A 2J92A 1MU6B 4AZ2B 1H9HE 4NFFA 2KZ4A 3ZVBA 2BD3A 1FIWA 4D9QA 2VH6A 3NKKA 1SGQE 2DE9A 1TX7A 1BTPA 1C9TA 2F83A 1OSSA 3PYHA 1YPGH 1P2MA 1FZZA 1QFKH 3Q3XA 2SGEE 3RM0H 1UO6A 1G32B 1O3NA 4X2VA 3RXSA 4Y10E 1C2EA 1RGQA 4NSVA 3TLOA 1AQ7A 4X2XA 4I32A 2UWLA 1B0FA 1DXPA 1PQAA 3RU4E 1SGTA 2KR7A 1IQGA 4INHA 4MPWA 3UPEA 3ZVCA 2VGCB 1AE8H 1YPHE 1VGCB 4B76A 2Y7XA 3ZZ6A 5DP8A 1O5AB 2WPLS 4LZ1H 1G2LA 4XSKU 1V2KT 1IQFA 5JBTA 3RMNH 4DJZB 1UCYE 3RP2A 1PQ8A 1C1UH 1S0QA 2W7SA 2UUYA 3M5MA 4HGCA 1ELTA 4Q80A 2PGBB 1IQHA 3SNDA 2J5UA 2C90B 4NA8A 2OQUA 1V2PT 2QIQA 4ZKNU 3PTNA 5CHAB 2ASUB 3V7TA 3H09A 4IGDA 1ID5H 1QY6A 4FU9A 4KKDA 2G4TA 1SOZA 1UTJA 2F4LA 1Z8GA 5A8XA 1V2NT 5FPTA 1BBRE 4LZ4B 1A5IA 2FDAA 3RLWH 2G81E 2A2QH 1QRWA 3E3TA 1TGSZ 3RM2H 2SGQE 1T8NA 1O2XA 1HAYB 1O30A 2AIQA 4MPXA 4WH6A 1C2IA 1JIRA 4MLFB 1BHXB 3P8NA 4MNVA 5A2MH 2ZEBA 1DPOA 1Y3XA 1YC0A 2GX4A 4E7NA 5LPEA 3SYJA 3M37A 5C1YA 1MKXH 1GBFA 3LGYA 3HATH 1LMWB 2VINA 1L1JA 5DKMA 1BRUP 2ULLA 1XUHA 2BVSH 4X8UH 4AORA 3TGKE 2A5KA 2FEQH 1OX1A 1VJ9U 3UOUA 3MO9A 4AYYB 4YM9A 2F43B 2SGAA 3OX7U 4NZQA 5B6OA 3FOAA 1FN6A 1YCPM 3OY6U 1WOFA 2WHXA 3A7VA 1UTNA 4CREA 3SV2H 4JYUH 1AGJA 4X2YA 5L2ZH 3BTHE 2W5EA 1BZXE 1GHBG 2ANYA 2VWOA 2ZWLH 5E0HA 3RDZA 4FETA 2FM2A 3IG6B 3P92A 2ANKH 5CMXH 2P94A 2FX6A 3SUDA 1ELGA 3F6UH 1AFQB 2GKVE 1FQ3A 2D8WA 5GIBA 5JBCS 2A4GA 2NU0E 3V13A 4KTUA 2P3FH 5LPFA 1FIZA 1V2TT 4KGAA 2OCVB 1MTVA 3ATIA 1O0DH 1N8OB 3RXMA 4CH2B 5FBIA 3KCGH 4IMZA 1MD7A 3AASA 3UUZA 3F0PA 4ZXXH 4GHTA 5EXLA 1C5QA 1DUAA 1ETTH 1HAXB 2BDAA 7GCHG 3HGPA 1FDPA 5K7RA 1UTOA 1HCGA 1ZSLA 4AB9A 2XNDD 3DCLA 3TJOA 1T8OA 1OPHB 1P2NA 1P0SH 3PWCA 2WINI 1SGCA 2WYJA 3K6ZA 2TGDA 5AF9H 1KXBA 4ABGA 5J4QA 2HALA 3U1IB 1GCTC 2ZKSA 4OS1A 1VITH 2XWBI 5H4IB 1NPMA 1E35B 4WH8A 1SC8U 2FX4A 4YT7H 4AGJA 1EJMA 1CT2E 2Y6TA 3S0NA 3KQEA 4DURA 1O2VA 3NUMA 5EGMA 1YP9A 1L1NA 1UHBA 1TA2A 2ZFPH 1C1WH 1H8ED 2YOLA 4AG1A 4BAOB 3GY3A 1AU8A 1SQTA 3EA9A 1W13U 1HAVA 1IAUA 1O2MA 1HJAC 1NFXA 2NWNA 2J2UA 4F49A 4TT3D 1C5LH 1TPPA 1TRMA 2C4FH 1DT2A 4CHAC 1DXWA 1CA0B 1T32A 1UVOA 3M3SA 4X8SH 3BG4C 1MABB 1A3EH 2V35A 1P2QA 2VIQA 1GHXH 1DICA 2Z9LA 3D62A 4RKOB 4XDEA 3QTVH 1BRAA 1CVWH 4B71A 1P2JA 4LK4A 1CGIE 1O3JA 1ZTKA 2EEKA 3OYPA 1HAZB 4Y7AA 1KDQA 1AZ8A 1QIXB 5T6GA 3K2UA 1ZOMA 1AN1E 4ZXYH 3GCOA 3P6ZB 1T4UH 1QB6A 2M5TA 1TIOA 3OEED 4KTCA 5DG6A 3LONA 1YCPK 2C8WB 4X8VH 1P57B 1WV7H 2ZG0H 2K0QA 1MTNC 1DY9A 5CHAC 1UVPA 1BMFD 2VIVA 1V2UT 2FZZA 2OC7A 3WW7A 3E1XB 1H8HD 1P01A 1A0LA 1O3IA 2OUAA 3VGCC 2NU4E 1O33A 1C2LA 4H6TA 3UNSA 1IQLA 3TH4H 3RXHA 1TWXB 3TH3H 4BAKB 1N1LA 5DGJA 1F0UA 2ZDLA 4JZIA 1BA8B 4ZHMU 4BAHB 1O3FA 1EPTA 1C5XB 2ZDKA 1ZJDA 5EODA 1DANH 4X1PU 4NG9H 3UREA 1F5KU 2QCYA 2HLCA 2PTNA 2QA9E 1OXGA 1ZHPA 4I31A 5A0AE 1EAXA 3RU4D 1UK2A 1TX8A 4DT7B 2GV7A 4K2YA 2F9VA 5EPYA 1O2TA 4OGXA 2PSYA 5FX6A 1O2GH 1JMOH 2FLBH 4A6LA 1XM1A 3BIUH 2FXRA 1FY3A 2G8TA 2ZC9H 4FUIA 5JPMH 2GMTB 1FONA 2SGPE 1HAHH 3F1SB 4FUEA 1AKSA 3SJIA 1SLUB 3PM3A 1LHCH 3OY5U 1XUJA 3T2NA 1O2UA 4I8JA 3SHAH 4A1XA 1P06A 3UIRA 2LPRA 2FOMB 3A88A 1ZTLA 3EA7A 3OE7D 1FUJA 1UVUH 4M9FA 1FY1A 4TSFD 3BTQE 3BEUA 2ZFQH 1LKAA 3VB6A 1A2CH 1C5SA 2JJ2D 1N8OC 3Q77A 4UFGH 3ZVAA 3KGPA 3GDSA 3GDUA 1HIAB 3DSOA 1F5RA 2A32A 2P16A 1GPZA 4I33A 1Z71A 3VXFH 1EZSC 2A0QB 4INLA 3GYLB 2YMSD 1RTLA 2F91A 3ZVGA 1O5EH 4H4FA 4D7FA 3U9AH 4Y6DA 1GVLA 2OXSA 3T5FH 3SZEA 2I6SA 4K8YA 1YPMH 4FU8A 2Z7FE 2Y81A 4XOJA 1TYNA 2JETC 3QTOH 2D1JA 2FO9A 5L30H 2ZU2A 1P3CA 3R3GB 5EQQA 1J17T 1MBMA 7LPRA 1IQNA 1O2RA 1QRXA 1C2JA 1LHGH 2KCAA 1E34B 1E1RD 4K1SA 4XE4A 5HXFA 3SJ9A 2BVRH 3I78A 3R0FA 6ESTA 1BMMH 1HNEE 4RKJB 3RXKA 3JZ2B 5EG4A 5EPNA 3TNSA 1O2WA 1AVWA 1DDJA 1A3BH 3JZ1B 4Z0KA 4AX9H 5A8ZA 1O36A 4NIYA 3A83A 1K1NA 1OYQA 2BD5A 2HLDD 4OS2A 2ZZUH 1QA7A 1BMNH 1SGYE 2PKSC 1C2DA 1ELEE 1YPKH 5DP3A 5IK2D 3BTFE 3MWIU 1ORFA 3QGNB 3SNAA 5HYOA 5GJ4B 1QJ7B 4KTSA 1CA0C 2STBE 2XWAA 1BTZA 1P2IA 1YPLH 1TGNA 3LGIA 1SGFA 5IYTA 3FP8E 3EDXB 1SSXA 3MNSA 1EOJA 1SG8B 1O2NA 1H8IH 1XUGA 3QDZB 2ZGCA 1QCPA 1DLEA 3VB4A 1K1LA 3FP7E 3AAUA 1IQIA 1TMBH 1E1QD 2XCNA 3LJJA 5F8ZA 2P3TB 3BTTE 2HVXA 5LH8A 2ANMH 1KLJH 4FUCA 3SNEA 2ZTXA 2RA3A 1NFWA 1J14A 2KAIA 1ESAA 1GBTA 3SUFA 1ELDE 3RXVA 1DLKB 8GCHG 1B7XB 4U32A 5FAHA 1ZPCA 3Q76A 4IC5A 3M3TA 1K1MA 1E0FD 2BQ6B 5LGOA 5BPEA 3M7TA 1LKBA 3SV7A 1MMJN 2FYQA 7KMEH 1MCVA 1C5WB 1TMUH 2ZTZA 1NU7B 4JZ1A 1CA8B 2O8WA 5ESTE 1EKBB 1HXFH 3RXAA 3T62A 1F2SE 1GJ6A 4O03A 1QHRB 3MNCA 5EOKA 2P95A 4FU7A 3PRDA 4WXIA 3GS9A 2SNVA 2XCFA 3OTPA 1SFIA 3N7DA 3SORA 1ZPBA 1QJ6B 1O3OA 3LDXH 3TJVA 4J2YB 3MU8A 5ABWA 2IJOB 4MVNA 1GL0E 2V7QD 5CHBA 3KIDU 4E05H 1O5DH 2H2ZA 4DOQA 3GY5A 3SUGA 2JJ1D 2JDID 1AUJA 1FAKH 1F5LA 1P2KA 3L3TA 3KQDA 1GJDB 3LH3A 1O3MA 3ZZCA 1MQ6A 1V2MT 2AFQB 1O3HA 4YZUA 2VBCA 1T8MA 4Z6AH 3STIA 3T28A 4CRAA 2QF4A 1AVGH 1LPGB 1E37B 1Z8JB 3BSQA 2VVCA 4CRDA 2GZ9A 2FOAA 3UOPA 1LQDB 4IMQA 1FY4A 4Y7BA 1ETSH 1G37A 2FOFA 3ZV8A 1DSTA 1F0TA 3RXQA 1EPTC 1GBJA 4OS4A 1G3CA 3MO6A 3E16B 1BTXA 1OYTH 2Y5GA 3BTDE 2ZGBH 1NZQH 2Z9JA 1VR1H 3P70B 4BTUB 2QXHA 1SHHB 4NIWA 4WWYA 1PFXC 4K1TA 2R3UA 2BHGA 2QN5T 2ZTYA 1S6HA 3ZV9A 2ZQ1A 1G3BA 4DIHH 2JH5D 1P3EA 2KM0A 2B5TB 1KIGH 2XC5A 1O5CB 2BB4A 4BOHA 1GBBA 3LGVA 1WYKA 2BY5X 2F3CE 3SU2A 1K1IA 1BMLA 4KELA 1GHYH 3K9XB 2AHME 4DIIH 3HGNA 3PO1B 5EQSA 2G5VA 1BTUA 5EXNA 3TGJE 2BQWB 2FOCA 4Y79A 5JB9S 1QRZA 2GDDA 4I8LA 4JMYA 2ZU3A 3S7KB 2WZQA 3PLKA 2FTMA 3TJUA 1BIOA 5FPSA 1TPSA 1QJ1B 1LDTT 1GI9B 1NROH 2AS9A 3L33A 2ZFTA 2BZ6H 2XBVA 3SU5A 4K69A 1UCYH 2JH0D 2PR3A 1QTFA 4K1EA 2ZQ2A 1ESTA 1GJAB 3GCTG 4IC6A 3Q3KA 2A31A 2PKAB 1GBDA 3VXEH 1HGTH 3QK1A 1NRNH 1RFNA 1C5TA 3LC3A 2D2DA 1A7SA 4AGKA