5CHBA

Crystal structure of nvpizza2-s16h58 coordinating a cdcl2 nanocrystal
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
84
Chain Sequence
MFTGLNTPSGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVLPFTGLNTPHGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords nvPizza2-S16H58
publication title Biomineralization of a Cadmium Chloride Nanocrystal by a Designed Symmetrical Protein
pubmed doi rcsb
total genus 13
structure length 84
sequence length 84
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.500 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5chbA00
3WW7A 5CHBA 3WWFA 3WWBA 5F53A 4ZCNA
chains in the Genus database with same CATH superfamily
3CP7A 4K5ZA 1GHBG 5F8TA 2BXUH 2QF4A 4GCHG 1FY5A 2XBWA 3BIVH 4XD7D 2QE7D 3RM0H 1UTKA 2D1JA 4FUIA 4ABDA 3QZRA 2C8XB 4WVPE 2LPRA 3D23A 2SGPE 2ZU4A 2FX6A 1PQ7A 1H8IH 1QB1A 2GT8A 3ZZ3A 3M35A 3UNSA 3AVZA 4Z6AH 4NWKA 1NRSH 5IDKA 4RI0A 4O9VA 1P8VC 3I29A 1K2I1 1EOJA 1VZQH 2JJ1D 1D3TB 4JCNA 1QRZA 1UJ1A 2Y5FA 1Z8RA 4I33A 1AKSA 1MTWA 1CGJE 4DURA 5C94A 1BHXF 1O3NA 4FUCA 1LDTT 1TBZH 1V2QT 3SNCA 1F7ZA 2KCPA 4WMDA 4K1EA 1SL3A 1C1UH 1C5UA 1D3QB 4DIHH 2RDEA 3IITA 3RLYH 4IBLH 3TH2H 5DP7A 4AG2A 2BY8X 3SQEE 5HIYA 1KY9A 2G00A 4K3JA 4CHAB 2R2WU 4BTTB 1GI6A 4UFEH 1J17T 1IAUA 2ZHFH 4UFFH 2F9BH 1P2IA 1SC8U 1WOFA 3DT0H 1GG6C 1TRYA 1C2EA 3QUMP 3UREA 3TITA 4XOJA 1CBWC 3ZVEA 1SGYE 1O2LA 1Y59T 2ZO3H 5GCHF 4JK5A 1YLNA 6ESTA 2VVCA 2FEQH 5EOKA 1HJ8A 1H9IE 1Z6JH 1NRNH 3E91A 1HAXB 3P8GA 3UOPA 3VGCC 3MU5A 2PSYA 2Y7XA 4KTUA 2C8ZB 2CJIA 1RIWB 3QZQA 1W14U 2B8OH 2VBCA 3EE7A 4ZMAH 1GDQA 2OBOA 2WV5A 2BDAA 2F91A 1HJAB 3LOXA 1C5TA 3LGWA 5C3NA 1P11E 2P8OB 4B71A 3E6PH 2FOCA 1QBNA 4YZUA 3KL6A 3SV2H 4A6LA 1AFQC 5J4QA 2G52A 2ILNA 4FVDA 2NU4E 2IOTA 1ELVA 2BB4A 2FS9A 2ZGJA 3RC5A 3UB0A 1W0KD 4HFPB 4INLA 2TGAA 2B9LA 1FAXA 1QJ1B 2ZI2H 4YOIA 1W2KH 1C2HA 3MYWA 3AAVA 1TNJA 1YPKH 2EY4C 1F0UA 1TNLA 5DK1A 2ZHWH 1Y3WA 1V2VT 3U9AH 5DN6D 1AB9C 1G36A 1K1IA 2YMSD 1T8LA 1SQRA 1DUAA 4IS5A 1LQEA 3SHCH 4CR9A 2C8YB 3LJOA 3A86A 2A4GA 1AUTC 2ANMH 1YPGH 4R0IA 1BMLA 2PLXA 2PSXA 1XUHA 2OQUA 2W7UA 3Q3KA 2EI8A 1PQ8A 2A45B 4IN1A 1GVKB 1ORFA 2OC1A 3LGTA 1E79D 3F9FA 1LHCH 4NIYA 1GBCA 4KELA 2BD8A 1F0TA 5E0GA 1ZJKA 2VGCC 5EXMA 1NROH 2J38A 3GY7A 2PUXB 1O5DH 2PTCE 3CENA 2HNTE 3VB5A 3AASA 2RCEA 5FX5A 2A5AA 2CK3D 1GL1A 2QN5T 3VXFH 2FIRH 2R9PA 2BDHA 4Y0YE 4ACAA 5C0TA 3M37A 3SI4H 5ESBA 1RJXB 1P05A 2PKSC 5HM9A 2P3UB 1O39A 3I78A 3WWBA 2RA0A 4AB8A 2CHAC 2FESH 4X6NA 8KME2 1SB1H 2OLGA 5GDSH 3PLPA 1SKYE 2FOBA 2QXHA 3URCA 2Y82A 1KXBA 1GHVH 1NO9H 1THPB 2WPMS 3A84A 4AZ2B 4RKOB 4OS5A 1V6DA 7GCHF 1VCPA 2A5KA 4I86A 2R3UA 3PB1E 1E0FD 2BLOA 2J34A 3SV7A 1O2QA 1V2WT 3UWJH 3ATKA 3GDVA 4WJG2 1MCVA 5DG6A 3Q3YA 1HGTH 2O9QA 3ZV8A 1G3EA 1OP2A 2A4QA 1KXFA 1TGTA 2GKVE 3MO6A 4NIVA 2SFAA 1NU9A 1BMMH 1UCYK 4X8UH 1AD8H 1V2LT 2NU3E 3A7XA 1YPLH 1S6HA 2Z9LA 2VIVA 1AWFH 1IHSH 1X7AC 5TCAA 1KSNA 4YT6H 2UWOA 4TY7A 4I8GA 2UWPA 2ZFQH 1OP0A 2WPKS 1QNJA 3PWBA 4D9QA 1O30A 2HVXA 3HK6B 3M36A 5T1VA 5CDFE 2A7CA 1P2MA 3QX5H 4CRCA 2FMJA 3RXTA 3EA7A 5E2OA 3M3TA 5C17A 3O8DA 1DOJA 1GBKA 2H2ZA 4Y7AA 2XC5A 3A8AA 1XUIA 4YT7H 1JWTA 2AERH 4F49A 2H1UA 3NWUA 4FETA 3LC3A 1EFRD 1E35B 3ZYEA 2H6MA 1C9PA 2G51A 3MNBA 1TOMH 3KIDU 1SGIB 4Y79A 1GHYH 1GJBB 1ZMNA 3HGPA 1T7CA 1QJ6B 5FXLA 1WQVH 1MU8B 1SHYA 3LH3A 4Q7XA 1EB1H 3A80A 1P0SH 4DGJA 1C5LH 1IQFA 3M7QA 1NS3A 2G5VA 1BJVA 3FVFB 1GDNA 1V2OT 4CRBA 3M7TA 3FN8A 4A5TS 1W10U 2GZ7A 3A83A 1ELBA 4DVAU 1TX6A 4FUJA 4Z0KA 4B74A 3TH3H 5BRRE 4D9RA 1NC6A 3CS7A 2SGDE 1YPJH 1Z71A 5A0CA 5IK2D 3AAUA 6GCHF 3RC4A 1QHRB 2R2MB 3K65B 4KTSA 4F55A 1OS8A 4DCDA 2J92A 4JYVH 4B2CA 1O2OA 1JIRA 5JBBS 5T6GA 2G8TA 3F1SB 3UQOA 1XUFA 3MNCA 1BUIA 1N8OB 3N7OA 2BDGA 3H7TA 1WTGH 3E16B 4KP0A 3W95A 4XBCA 2HPPH 2TGDA 2CF9H 4NFFA 1EXFA 1OWHA 4H6SB 5C1YA 1SVPA 1EZUC 1MUEB 2Z9IA 1AZ8A 2F9NA 3A7TA 3LPRA 3LONA 1GJ5H 1TYNA 1YGCH 2AIQA 1CU1A 2ZECA 1A5IA 1IOEA 2W5EA 3C1KA 1WU1A 4I7YH 4DT4A 1KYNA 2NWNA 4NA7A 4FU7A 1V2ST 4Y10E 1SR5C 1ARCA 1HAZB 1V2RT 1E36B 4ZROA 4M7GA 1NRPH 1OWDA 1AI8H 1QB6A 2OXSA 3EGKH 3SJ8A 1ELDE 1UTNA 3NZIA 1W8BH 3RMNH 1O5CB 2ALPA 2XBYA 2ZQ1A 4JZIA 1GJ7B 4JZFH 5KGOA 2PKAB 5HGGA 1W3CA 1MQ6A 2ESTE 2ZGBH 4BAKB 1MTUA 5CHAB 3I77A 3OTPA 5F8XA 1O5EH 3GOVB 1BJUA 2BQ6B 4LOYH 5DP4A 4A1VA 1J8AA 1S81A 1E1RD 3RC6A 3EQ0H 1O2KA 1GCDA 2BQWB 4IC6A 1FDPA 1TNIA 3LIWA 3BTHE 1LCYA 6CHAB 1FY3A 1A3EH 1NFWA 1OWIA 2RDLA 1LVYA 3Q00A 4WF8A 1W0YH 2ZFPH 4ZXXH 1UTMA 4ABEA 1F5RA 8ESTE 3O8RA 1ELEE 1Q2WA 2AMDA 1DXPA 2SNWA 3FFGA 3SNAA 1QGFA 3K2UA 3B8JA 1BRCE 5C1XA 1MTSA 5EW1H 2F83A 3OU0A 3MFJA 3PV5A 1GHXH 2H9HA 5AF9H 4Y71A 1OKXA 1EASA 3BSQA 2GTBA 1Q31A 2CXVA 4X2VA 1BB0B 2QXJA 2V3HH 3T26A 3PM3A 1RXPA 2FXRA 2WZQA 5HYOA 3SGQE 3UY9A 2AH4X 5AHGH 2W26A 1LVMA 1G9IE 1KIGH 1HYLA 2NU0E 2WPDD 3W94A 1YPMH 1Z7KA 1L2EA 2ZTYA 2PWXA 2FX4A 3RMMH 4AFUA 2BD4A 1C1VH 1SGFA 2AYWA 1O2GH 4ISNA 1AKSB 1DX5M 2QA9E 4X8SH 3QDZB 2K0QA 4VGCC 4ABGA 4AFSA 4CBOA 3MU0A 3SNBA 3H09A 1PPEE 3NXPA 1AHTH 4K1TA 2JETB 1OYTH 3LDXH 2O8MA 5K0HA 2V6NA 1EZXC 5EODA 4FU8A 3BEFB 4TSFD 4UONA 2ZTZA 1O31A 3GY2A 5A0BA 3ATWA 4Y8XA 1TONA 1RTKA 1V2NT 5LGOA 1EPTC 4Y6DA 1C5XB 5EQRA 3VG8A 3MI4A 4A1XA 4Y7BA 2ZU1A 1GJCB 2ZDKA 3F6UH 4XE4A 2EQNA 1S0RA 1LTOA 1SBWA 4HZHA 2ZHDA 3N99A 2FOHA 1O2XA 4DW2U 5EPNA 2GT7A 1YCPH 4MNWA 5H4IB 1C4U2 3KGPA 2QV1A 3SZNA 4MPUA 1C5OH 2GV6A 3MMGA 4BXWA 7ESTE 2BHGA 1GMDG 1IHTH 2J5UA 3MO9A 4XBDA 1OPHB 4X6PA 2QF3A 5FCKA 1L4DA 1B0EA 1L4ZA 4FUEA 3K6ZA 1FN8A 3UNRA 1O2NA 3PROA 5GXPA 2UUFB 1YF4A 1FONA 5EQQA 4AORA 4YESB 2VINA 1ELFA 5DP3A 3NK8A 1UVSH 1HJ9A 1AE5A 1A0JA 1O3EA 4LZ1H 1YBWA 2BZ6H 2J2UA 2VVVA 3HGNA 4WH8A 4NA8A 1VR1H 1A0HB 1XVOA 2ZCLP 1BTPA 1AVWA 2ODPA 2OQ5A 5FPYA 3RP2A 1ZOMA 4HI3A 3QLPH 4DJZB 3RMLH 3BV9B 4OS6A 3P8OA 8GCHF 1TWXB 1DT2A 3KCGH 2F9OA 2F9VA 2FI4E 5I46H 1YP9A 4OGXA 2GVFA 3P8FA 1UTLM 1D6RA 2PUQH 3TJOA 3ZVAA 1GMCG 1GBEA 4AGJA 3DD2H 4CRGA 1AO5A 3A7YA 3BTGE 3MWIU 1COWD 4B6FA 3E3TA 1GBMA 3DFLA 1OYQA 1O2RA 3SHAH 1A46H 1GGDC 1GBJA 5JB8S 4CHAC 1B5GH 1KLIH 5B6OA 2OC8A 3ZVFA 3RXAA 1Z8JB 3TK6A 4O97A 2XXLA 5B6LA 1PPZA 5AFZH 2D2DA 2PGBB 1H1BA 4JK6A 2GP9B 3PMBB 3D49H 3S7KB 4LZ4B 4U01A 1K22H 3M5MA 3UUZA 1ZPCA 1P3CA 1YYY1 3OEHD 4HGCA 1PJPA 4U32A 2WINI 3RXSA 3F2HA 3QGJA 1W11U 1K1NA 1GI5A 1YC0A 3PLKA 4FUBA 2C8WB 3E90B 2LP6A 1DY9A 3NKKA 1FZZA 1D3DB 1H8HD 3SW2B 1MAXA 2H9EH 1S84A 3RXVA 1HJAC 1F2SE 1FI8A 1C1WH 3ATMA 1SQOA 2HNTF 1TPPA 1ETSH 1HV7A 2NU2E 3SV9A 5C0UA 3VEQB 5L2YH 2W3IA 4KTCA 4CRAA 5CMXH 4ZHAA 5KEDA 1UMAH 3PV4A 1DM4B 2XC0A 3KYGA 2ZFFH 1VKYA 2Y81A 4YOGA 1P06A 1P03A 3DA9B 2EI7A 2AGGX 1MTVA 1PPCE 1CGIE 2Z3CA 1MZDA 2LNCA 2UUKB 1C5YB 2WPIS 1GBBA 1GI4A 5A8XA 1UHBA 4HG6A 3UOUA 1O2SA 4MPVA 1C4Y2 1DSUA 1G2MA 4IN2A 2YMSB 3F2GA 2M2AA 3RU4E 2VIPA 2O8WA 4UFGH 3WWFA 1BZXE 2WHXA 3TU7H 4SGBE 3TLOA 1HB0B 1XKBC 1O5GH 3SBKA 5DPAA 1KTSB 2OP9A 3L33A 3BTQE 2BLVA 1ZSKA 5JDUB 3TJNA 1O3LA 4O03A 3A8BA 3P92A 1QFKH 4NZLA 3ZVCA 4R8TB 1ZTKA 1GBAA 1B0FA 5L6NH 4RT1A 1SI5H 2GCTB 1ZR0A 3SJ9A 4DOQA 3U1JB 1DWEH 1TMBH 1C5VA 1EKBB 1BTZA 1QTFA 2TRMA 3OX7U 2FOAA 2ZU5A 2J4IA 4ZH8A 1J9CH 4UEHH 1PFXC 1WTHD 2P94A 7LPRA 5GJ4B 1BIOA 1ZPZA 1QQ4A 1VCQA 1HPGA 2Z9GA 1C1NA 3Q77A 1A4WH 1IQLA 1LHDH 2BLWA 4JYTA 4DY7B 4SGAE 2J97A 3OYPA 2A2QH 2F3CE 3F0OA 2ZDLA 4AFZA 1PPFE 1T8NA 2FI3E 4FUHA 3A88A 2IJD1 1O0DH 2HWLB 1DLEA 2Y80A 1MKXK 3BTTE 3PLBA 1BDAA 1XXFA 2VIOA 1P02A 1SGFG 1NFYA 3TK9A 1BBRE 3TJVA 3E8LA 4ZAEA 2JDID 1KTTB 2KAIA 4MQAA 2BZAA 3TIUA 3HKIB 1DANH 1KDQA 1O3BA 1JOUB 1VITG 4IGDA 1NTPA 1P3EA 4ABIA 2QAAA 2B0FA 1C2IA 2DUCA 3LT3A 3SO3A 3SNEA 4D76A 2BY6X 5DGJA 1YY3A 2PTNA 1T4UH 4ESTE 4BAMB 1ANCA 1BOQA 1YLCA 4GVUA 1EOLA 4X2XA 3MH4A 1V2MT 4RKJB 2BD2A 3K6YA 1FIZA 2OK5A 9ESTA 3ZVBA 1L1NA 1TQ0B 3LC5A 3ZV9A 4BNRA 1ZHPA 2BX3A 2OC7A 4OGYA 4E7RG 1SGPE 3DUXH 4BAHB 4JZEH 1O2TA 3SV6A 2FLBH 1FUJA 1O35A 4THNH 1KXDA 2P16A 2KM0A 3M5OA 4U30A 2PHBA 4A92A 2FS8A 4Q4LA 1S0QA 1C5SA 1QRWA 2ZC9H 1XM1A 1ELAA 2FWWA 1UK2A 5LH8A 5FL7D 2ODQA 4NIXA 4BAQB 1FIWA 5GIBA 3T2NA 3A85A 3RXUA 3RXMA 3GY8A 1AU8A 2KFWA 4ISLA 4FUDA 1GDUA 3D65E 4ZKOU 1TNHA 4X1SU 4XRNA 2AMPA 1DWCH 4H4FA 1S6LA 3HK3B 1NBMD 1S83A 2UUJB 4J1YA 4TPYA 4B2BA 1CT0E 5C1UA 1FNIA 5DSFA 2Z9JA 4CRDA 3S7HB 1O3KA 3DSPA 1N8OC 1GJ6A 1GHBF 1Z8GA 2AS9A 2HOBA 2TGPZ 4GCHF 2FODA 1JBUH 4NWLA 1DXWA 2PR3A 1F5KU 2ZFSA 2FOEA 5BPEA 4J2YB 3ZZCA 1HAGE 1LPGB 1MMJN 3N7DA 3FZDA 2V3OH 1A7SA 1O37A 5E0HA 2ZZUH 4UD9H 1GG6B 2W6ID 3PRDA 2Y7ZA 1FMGA 1AIXH 1KMHB 1LVOA 1SLUB 2EI6A 3R3GB 1XMNB 3QTOH 2HVYB 3MH6A 3SYJA 1EX3A 2IN2A 1O2YA 1FAKH 4H42U 2Y5GA 3KNXA 1YWUA 3VB3A 4OS1A 1LPKB 2O8TA 1XXDA 2VIQA 3L6PA 5CHAC 3T5FH 1DPOA 1AGJA 1ZTLA 5F6MA 2WUBA 1C2KA 2CV3A 3MU4A 4D7FA 1O3JA 2STBE 4P02A 2WPJS 3SU2A 3TGKE 1GCTB 3GY4A 1O2UA 4WXIA 1W7GH 4IW4E 1RFNA 1QL8A 3D62A 2YNAA 6CHAC 1TPSA 3OTJE 1O3DA 1TOCB 5HMAA 1EJAA 1OHHD 1AFQB 3RXIA 3RXRA 1MKWK 2Q6GA 5EPYA 1HAIH 3A7WA 4YXWD 3MU1A 1QRXA 1SHHB 1PYTC 2L6OA 3U8OH 1G3DA 3SNDA 4MDSA 2QCYA 1KXCA 2FM2A 5T6DA 3GDUA 2GMTC 1F0SA 3M7UA 4YM9A 1NPMA 1V2UT 2XNDD 3LH1A 3FKSD 2CN0H 3RDZA 1SGQE 3KF2A 1V2JT 1E1QD 3SGAE 5EJ1A 2A7JA 2A4RA 4TWWA 1EP6A 4PROA 2XYAA 1SOZA 1KXEA 1NRQH 2H5CA 1HDTH 1NFUA 1QA0A 1ETRH 2G81E 3O8BA 4BOHA 3PO1B 3MOCA 1QIXB 3ITIA 4RT0A 1GI1A 4B73A 2F9PA 4I8HA 1M9UA 2QYIA 1THSH 3T28A 3LU9B 3RMOH 2OINA 3GCTG 1C2GA 3P70B 3FZZA 2QF0A 3T25A 2V35A 1QBOA 2VIWA 1D9IA 1EB2A 2WYGA 2ZCKP 1WAYB 3VXEH 3GCNA 3ZZ9A 1DITH 1D4PB 1AE8H 3OY6U 1GBHA 3ZZ8A 3M61U 3OSYA 2HGTH 3O8CA 1W0ZU 2XBXA 2V0BA 1C4V2 1AQ7A 4X6OA 2B7DH 4WMEA 4UFDH 2G55A 1FX0B 3PWCA 4INHA 5FHTA 1A0LA 3P95A 3H5CB 1RRKA 1CQQA 1ZJDA 4TYDA 1QQUA 5LPFA 3BG4B 1UTQA 5A2MH 2RG3A 1P01A 4K8BA 2GZ9A 4I8LA 1C2MA 1THRH 4FOUC 1GHWH 2BD9A 1C5MD 1YCPM 2ZGCA 1GBTA 3Q76A 4NGAH 3VB7A 2ZFRH 1CGHA 3OEED 3E0NB 4MPWA 1NFXA 1TBRH 2ZHEH 2W7SA 2ZG0H 4XFQA 1EAXA 1LHGH 2ZGXH 2KCYA 2TGTA 1N1LA 4O3UA 2BY5X 2GX4A 3VB4A 4ISHH 2OC0A 1SFIA 1TA2A 2B5TB 5E2PA 3KYFA 3SUFA 4D7GA 5LPEA 1EZSC 1H4WA 1S5SA 2G4TA 2YNBA 3NPSA 4X0WU 2BDBA 1RTFB 3F9HA 1P2OA 3RXEA 1CA0C 2VU8E 3MTYA 1K1PA 3ZVGA 3WY8A 3ZZ7A 1LMWB 1BTUA 1ZMLA 2KCOA 1MTNB 2HNTC 3QTVH 1ZPBA 2GD4B 1ZZZA 1D3PB 1C9TA 1FQ3A 4GUXA 3BEIB 3HATH 3BTME 1BTHH 1TQ7B 2XWAA 1VGCB 4E7NA 1GL0E 2THFB 3KQBA 1O2HA 2ANWA 1UHBB 3E0PB 2M5TA 1SLVB 4AYVB 3KHVA 5JBCS 3PMAB 4JMYA 3TK5A 5A8YA 4TT3D 1DVAH 3EA8A 1FPCH 1DY8A 1MU6B 1P9UA 2OD3B 4Z1MD 2Z6BD 1C2DA 1E38B 4ISOA 1C5RA 2ANYA 3VPKA 2P3TB 1P2KA 1YPEH 1OWEA 3UFAA 4JZ1A 3SOSA 3OAAD 3PMHB 1C1RA 1Z1IA 1J15A 2ZPSA 1KLJH 5EGMA 2V7QD 1H8ED 4B76A 1GPZA 3M3SA 4FUGA 4WY3A 4X1PU 1ESBA 1EAUA 1S6FA 4OS4A 2XCNA 3LGUA 3M5NA 1C1OA 3WW7A 1EATA 2A2XH 2AFQB 3IWMA 5J4SA 4INKA 1A5GH 1DWBH 2Z3DA 3BTKE 3JZ1B 1G2LA 4BANB 4TWYA 4B75A 1TALA 1V2KT 1CA8B 1AUJA 1HAVA 1QY6A 1H8DH 1O3GA 1Y5UT 1O3PB 2TPIZ 1S82A 2FO9A 1RS0A 1PPGE 4MNVA 1J16A 2BTCE 2PW8H 1HXFH 2ZKSA 3ZZAA 5E0JA 3FAOA 4K2YA 3SORA 3RXDA 3UR9A 2Q6DA 1BBRH 2SGQE 3UQVA 2BXTH 2VWMA 3ZZ4A 1BMAA 5A09A 2KAIB 1GWAA 1A2CH 2BVSH 5C67A 1DUEA 1CT2E 1KDQB 3TGJE 1O5BB 3MHWU 3GISB 2ZPRA 5EW2H 2VWOA 2TIOA 1SGDE 1RD3B 4ZXYH 5HKKD 1ABJH 3PV2A 2A5IA 3MH5A 5FCRA 1YLDA 4GPGA 4A1TA 1FJSA 1FN6A 1TB6H 5LPRA 2BX4A 2GDEH 5GCHG 3SU1A 1AZZA 1ELCA 1FXYA 3MH7A 3ODDA 1TMTH 1DE7H 1OSSA 1Y8TA 3BTWE 1CSOE 1Z6EA 1V3XA 2WSSD 2FI5E 4YLQH 2HPQH 3U69H 1ZMJA 2XRCA 1W0JD 4X1QU 4E05H 3ATIA 2P3FH 3A7VA 2J98A 1SGNE 1P04A 4GHQA 3GCHB 2GCTC 3SU0A 2ZGHA 4DG4A 1YM0A 1IQHA 1RTLA 1TRMA 1ZRBA 2FYRA 3QGNB 4CR5A 3LJJA 1WV7H 2K1QA 5CE1A 1G3CA 2QIQA 1O3OA 4CRFA 2PFEA 1C5WB 1GJ9B 5AFYH 2ZDAH 2I6QA 1LO6A 3EA9A 5G4BA 5C2ZA 3SUDA 3TJUA 1L1JA 4OM9A 3V3MA 1G3BA 1B7XB 2QF5A 4UE7H 1YKTA 1IQMA 4AGKA 3MQKC 2SGEE 5ETXA 4GLYA 2ZQ2A 5GPIB 2VNTA 4RN6A 5C5OA 2BM2A 1NZQH 3SN8A 3V12A 1IQNA 1H9HE 1T8OA 1O3FA 1A3BH 1O2IA 1HBTH 1JXPA 1RIWC 3SGBE 4NG9H 4ABJA 2ZHQH 2W3KA 1WDIA 3EAJA 3M5LA 1WQSA 3RM2H 1GJ8B 1LKAA 2J9NA 3SJOA 2BD5A 1C2LA 1NESE 3JZ2B 4AG1A 1FY8E 2P8OC 1JIMA 1GI0A 1SGRE 3SU6A 9LPRA 4OS2A 4P00A 4F4OC 3B9FH 3MNXA 2EC9H 4X1NU 2YOLA 2A4OA 1TGNA 1SGEE 1EJMA 1ID5H 1TRNA 2DE9A 3A7ZA 1Z8IB 3URDA 1QR3E 5HM2A 1TLDA 1UVOA 1K1OA 2KZ4A 5FAHA 1GVZA 1C1SA 1J14A 3W1EA 2WV9A 1T32A 1ANBA 3SV8A 1TBQH 5FBIA 4ZHLU 1ELGA 4KKDA 1V2PT 5DP8A 1BRAA 3E1XB 1ZHMA 1EZQA 4CBNA 1LHEH 1W7XH 2A31A 1A61H 2GDDA 2BDIA 1MZAA 1ZTJA 3ODFA 2BD7A 1O2ZA 4Q80A 1O3MA 1O5FH 5JB9S 4ZHMU 3AW1A 4O3TA 1GMDF 2STAE 3A8DA 3KQEA 3RXPA 1N6YA 2QXGA 1VJAU 2EEKA 4XBBA 4FXGH 4M9FA 3F3BA 7GCHG 2SNVA 4AX9H 2BQ7B 1XUKA 3EE0B 4ASUD 2ZU2A 5DKMA 3DFJA 1TE0A 1O2PA 2BMGB 4Q7YA 3STIA 1DLKB 3BTEE 4AFQA 2PV9B 3UAIC 2TBSA 4MTBA 2VWNA 5EIYA 3AK5A 1G30B 1GMHG 3RXCA 2BYAX 3F0PA 3RXJA 1CVWH 1SSXA 4WXVA 1HIAB 3F2FA 4ASHA 2A1DB 2ZDVH 1CT4E 3EDXB 3UNQA 1BITA 4K69A 2XWBI 1GGDB 2F9UA 1ANEA 1SQTA 4ABAA 1LKBA 2H9TH 1LVBA 1HAYB 1AVGH 1K28D 2XTTB 3A89A 4GAWA 3GDSA 3UWIA 4I32A 2L74A 3BEUA 3MNSA 1OX1A 3EYDA 4BTIB 1GMCF 2BY9X 1O2MA 1AWHB 1TMUH 1O33A 1U6QA 2GV7A 3MU8A 4XSKU 3GYMA 5HXFA 2O8UA 5FBEA 1QL7A 4XDEA 5F8ZA 1GHAG 1P2JA 5C5NA 2UWLA 1CO7E 1UCYE 5DP9A 3UR6A 1XUGA 3RXKA 1GCTC 1G37A 2IJOB 4BTUB 5GWZA 3OY5U 1C2FA 1DFPA 4Y0ZE 2WUCA 2CF8H 2GGVB 3A8CA 5EXLA 4ABHA 2FP7B 2GZ8A 2Z94A 4BXSA 1INCA 2FLRH 5ABWA 3NCLA 1MBQA 2JH5D 1MD7A 4QT8C 5EXNA 6GCHG 2ZDMA 2A0QB 1UTOA 1ZRKA 2F4LA 5PTPA 5T6FA 2OBQA 1TNKA 4NSYA 2Q1JA 4CH8B 2AMQA 4MNYA 2C93B 1TX8A 2FYQA 3RXGA 1K1LA 1QURH 1IQEA 2JIZD 2JKHA 2EA3A 2ZCHP 1PPHE 2ODYB 1P10A 1UVTH 3U8TH 1C1QA 1A5HA 3RLWH 4KGAA 2ALVA 4OS7A 3PO1C 4Q7ZA 1CE5A 2SGAA 4FVBA 3TGIE 2GJGA 4MG3A 4YOJA 1H9LB 4TY6A 1TFXA 3HKJB 1P2NA 3FP8E 1ZYOA 4MLFB 6LPRA 1DS2E 2F43B 3RXFA 1XUJA 2AEIH 3FANA 2XNIA 3RXQA 1C5PA 5CHBA 3RXOA 1HAPH 1KXAA 2GCHG 3LKWA 3UIRA 2D8WA 1LPZB 3BG8A 1NU7B 4I8JA 1K9OE 4Y11E 1WUNH 5JBTA 4X2YA 2ZF0H 3ZIAD 2BOHB 1SLXB 1HXEH 3ZYDA 4NFEA 7KMEH 3SJIA 1ESTA 1WBGB 1YCPK 1HLTH 3ZZ6A 1EPTA 2CGAA 3SZEA 4DIIH 4ISIH 1F5LA 3G01A 2ZIQH 1Y5BT 4UDWH 4GHTA 4B6EA 1CBWB 2XOKD 4I31A 4BAOB 3DCLA 3BG4C 1OOKB 2ZEBA 4YTAA 1SGTA 2Z3EA 1HUTH 2P59A 3SJKA 1OWKA 2RFKC 1C1PA 1BBRK 1MH0A 3QN7A 3VGCB 1O36A 1BCUH 4Q2KA 1W13U 1F92A 4DT7B 2O8LA 2H5DA 5T3HA 3U98H 1O34A 3VFEA 1KLTA 1N6XA 3V7TA 1YPHE 2SGFE 2LELA 1SFQB 1HFDA 3GICB 1EQ9A 1QCPA 2OTVA 3P8NA 4AC9A 2VH6A 1GMHF 5JBAS 1HAVB 1O3CA 2J95A 1TABE 4FUFA 5A8ZA 1JRSA 1GI8B 2HALA 1G32B 1K0HA 1WSSH 8LPRA 1AFEH 3OFND 4LXBH 1VITH 3DSGA 1UO6A 1ZGVA 3LGVA 5EG4A 1GI2A 1MTNC 4NZQA 1AB9B 2Z7FE 3K9XB 1GJAB 5C20A 3SI3H 1EAWA 1BMFD 2A7HA 2BDCA 4JYUH 3F68H 1Y3XA 1VGCC 2ZWLH 2PP6A 5F53A 1HIAA 1C5ZB 1MD8A 2ULLA 1MBMA 1NM6A 1C5NH 1VITF 1TAWA 2FTMA 3RXHA 1O3IA 4E06H 4F48B 3KQDA 1GHAF 2AHME 4IC5A 3GCOA 3SU3A 4IMQA 1EJNA 1BTWA 5AVDA 1MCTA 1BTXA 1IQIA 1NT1A 1QJ7B 2RA3A 4WMFA 5TJXA 1JMOH 1LQDB 2JETC 2VGCB 1XVMA 3GY5A 3UTUH 1TGCA 1XKAC 3KQ5A 1SG8B 1TGBA 1VCWA 4U2WA 1OP8A 4AYYB 3KEEA 4I8KA 2C4FH 2VB0A 2J98B 2VVUA 4MPXA 1Y3YA 2QXIA 3F9EA 1GI7B 1QZ8A 1K1MA 3SU4A 1SLWB 2ZA5A 1NBME 2PKSB 1T31A 1SPJA 1GBIA 2HRVA 2FTLE 2CHAB 3UPEA 1MAYA 1GHZA 3GY6A 3TPIZ 2IPHA 2ZPQA 3SQHE 3L3TA 4Q63A 8GCHG 1D6WA 1CHOG 5DP6A 2ZU3A 1GBLA 2WV4A 2C3SA 2P95A 3GYLB 1BMNH 2ZDNA 5TCCA 3ZZBA 1SGCA 2PGQB 4WWYA 1L1GA 4ABFA 3ZZDA 2JH6D 3RU4T 5SGAE 4Y8YA 2FPZA 2GCHF 2JJ2D 2XCFA 1P2QA 5ESTE 1RGQA 2ZTXA 3H7OA 1WYKA 3KQCA 1MKXH 2OCVB 1UK3A 1FPHH 2V3MA 3U28C 1BA8B 1ANDA 1UTJA 1C1TA 1DICA 4D8NA 5FPSA 2ZFTA 1JRTA 1HRTH 3A81A 3KN2A 1GJDB 2FOFA 1P09A 5GNDA 2UUYA 1FY1A 1ZLRA 2BLQA 3CNRA 1BRUP 4H6TA 1IQGA 1Y3VA 3S9BA 2J94A 3N7EA 1VJ9U 3FP7E 4ZKNU 1DSTA 1PQAA 1TPOA 2GMTB 2AGIX 1GJ4H 2R0KA 2R0LA 1ACBE 2BY7X 3STJA 3PTBA 3GCHC 3PMJA 2KCAA 1QL9A 5DJ7A 3QK1A 1LHFH 3M3VA 1TNGA 3LGYA 1O5AB 3MO3A 1AMHA 1MABB 4NCYA 4TPIZ 2VH0A 3GS9A 3ATLA 5L2ZH 1NRRH 2WPLS 4CREA 1S85A 3BF6H 1A1RA 3ESTA 2BVRH 1UVPA 2G4UA 2VWLA 1ARBA 1ESAA 5DO4H 2FOGA 1GVLA 2KX4A 1O3HA 1TX7A 1GI9B 3IG6B 2BD3A 2C90B 1DWDH 1EP5A 1UVUH 1IQKA 4X8TH 1O38A 4K1SA 1C5QA 1TPAE 4B1TA 4YO9A 3U8RH 1Q3XA 1O3AA 4RSPA 3ENSB 4AOQA 3SUGA 1QBVH 4X6MA 3TVJB 1P9SA 4JZDH 1YPHC 1SMFE 2QY0B 4GSOA 4WH6A 4CH2B 1NN6A 2OUAA 2D26C 1AN1E 1BRBE 1TIOA 1GI3A 2ASUB 3FOAA 3A87A 5EU8A 1TGSZ 3FO8D 1Z1JA 2ANKH 1UTPA 3HPTB 3GCTF 4FU9A 1L0ZA 2Y5HA 5I25A 5A0AE 2ZNKH 2HLCA 5IYTA 3T62A 1GBFA 1C1MA 1BT7A 2AIPA 1QB9A 4ABBA 1W12U 2FDAA 3T27A 3SUEA 3B23B 3T29A 3P6ZB 4NA9H 4X2WA 2A32A 3RU4D 3RUOA 1QA7A 2K8IA 2QC2A 1UCYH 3GY3A 1AY6H 4ZKRU 1DDJA 4YLUA 5K7RA 3PTNA 2FOMB 1ELTA 1PYTD 2JH0D 2KR7A 2YMSC 3P17H 4ZCNA 1HAHH 1SOTA 2WYJA 2Z9KA 5E8EH 1P57B 3OE7D 2Y6TA 1O2JA 3V13A 3VB6A 1O2WA 1FLEE 4K8YA 3F9GA 4MNXA 2XW9A 1K1JA 5FPTA 5KECA 2HLDD 1UW7A 5HIZA 1V2TT 4K60A 3NRLA 1CA0B 1C2JA 1EAIA 1CHOF 1TA6A 2BOKA 5EQSA 3S69A 3U1IB 2I6SA 1MKWH 2VIDA 2CMYA 2WPHS 4Y8ZA 1EUFA 3QO6A 1T8MA 3TNTA 2P93A 1WCZA 1OWJA 3PRBA 1HNEE 3S9CA 2BVXH 2W6JD 4ACBA 3BN9A 3ZZ5A 1K21H 1SQAA 4Y76A 3TNSA 3ZVDA 1GBDA 3PYHA 3V0XA 1FY4A 5EJZA 4HTCH 1E34B 1BQYA 4ZKSU 3ELAH 1F0RA 1HCGA 2XC4A 5EJLA 4AB9A 4X1RU 1E37B 1Y5AT 2ZP0H 4VGCB 1Y3UA 4X8VH 2R3YA 1OXGA 3A82A 1ZSLA 5FX6A 3DSOA 3RXLA 3S9AA 1ZGIA 1PQ5A 1PPBH 4ZUHA 1BHXB 1XX9A 1BTYA 2PKAA 1ZHRA 5DP5A 2Q6FA 1NY22 2DE8A 3DHKH 1EPTB 3S0NA 2XBVA 3AW0A 3BIUH 2FZZA 1FV9A 2VJ1A 3QWCH 4MVNA 1HAOH 3LGIA 3BTDE 1AVXA 3NUMA 3TH4H 2NU1E 1O2VA 4LK4A 4NSVA 1ZSJA 1T4VH 5JPMH 4AN7A 3Q3XA 1IQJA 1ABIH 3CS0A 5F03A 2BDYA 1MQ5A 2QGRA 2G5NA 3SU5A 1WXRA 4NIWA 4IMZA 3RXBA 5JYIA 2IPQX 1ETTH 1UK4A 1P12E 3R0FA 1CHGA 5L30H 3FP6E 4A7IB 3BTFE 2AGEX 3C27B 4B2AA 1O32A
chains in the Genus database with same CATH topology
2QV1A 1DY9A 3N7DA 2QF4A 4XD7D 3N7EA 3OE7D 3RC5A 2J5UA 1W0KD 5F53A 3UB0A 2QE7D 1H8HD 2F43B 2K1QA 1W3CA 2XNIA 1FX0B 3OAAD 5CHBA 5FPTA 5T1VA 3OTPA 5CDFE 3LKWA 5H4IB 2HLDD 2AHME 2V7QD 1H8ED 2W6ID 2JDID 4A1VA 3SU3A 3PRDA 4B76A 3AK5A 3SUDA 1E1RD 3NRLA 3RC6A 3F0PA 1KMHB 5C17A 5DN6D 3O8DA 4OM9A 5EQSA 2XCNA 2YMSD 3F2FA 4TYDA 5EQQA 4NWKA 5C0UA 2QF5A 3M5NA 4RI0A 3U1IB 3ZIAD 3WW7A 2KCAA 4KTCA 5ETXA 5GPIB 2A4GA 3SYJA 2F9UA 2JJ1D 4FETA 1MABB 1EFRD 4WF8A 4I33A 4K8BA 3KNXA 3GS9A 4WH8A 1JXPA 3SZEA 4B75A 3L6PA 3PRBA 3O8RA 3KEEA 4I32A 2OC1A 2W6JD 1DXPA 1A1RA 1E79D 3M5LA 3SU2A 3EYDA 5FPYA 3SU4A 2KCPA 3PV5A 4B6EA 2XOKD 1NBME 4I31A 3SU6A 3DCLA 3P8OA 2OK5A 1NS3A 3OEED 2F9VA 1OHHD 2YOLA 3FN8A 2P59A 5EPYA 2GVFA 2OC7A 4YXWD 2YMSB 2KCYA 4B74A 3F2GA 1N1LA 2L6OA 2M2AA 2WZQA 3SV6A 3SV9A 3WWFA 2WHXA 2CK3D 2FM2A 2OC0A 3DSOA 4Q63A 3SUGA 5IK2D 2KZ4A 3RC4A 3SUFA 2WPDD 5C0TA 2IJOB 4F55A 2KM0A 2XNDD 3M5OA 5ESBA 3W1EA 2WV9A 4WH6A 3SV8A 3FKSD 4A92A 1COWD 4Q4LA 3KF2A 4B6FA 2GGVB 1E1QD 3WWBA 2A4RA 3FOAA 2LELA 3FO8D 2FP7B 5HKKD 2K0QA 2KCOA 5FL7D 3PV2A 3P8NA 3H09A 2JJ2D 4R8TB 1SKYE 2XCFA 2KFWA 3O8BA 4A1TA 2O8MA 1RGQA 2OC8A 4TSFD 2F4LA 3U1JB 1BT7A 3LONA 1S6LA 3SU1A 4B73A 2OBQA 1NBMD 1CU1A 5B6LA 2VBCA 2OINA 3OFND 3SV7A 2OBOA 4DT4A 5DSFA 2JIZD 2WSSD 3DSPA 3SU5A 4U01A 3M5MA 5GJ4B 1WXRA 3SUEA 4ZCNA 3LOXA 1W0JD 5EQRA 4JMYA 3VG8A 3OEHD 5FPSA 4B71A 4A1XA 2A4QA 2K8IA 5IDKA 4M9FA 4NWLA 4TT3D 1DXWA 3F2HA 3KN2A 1DY8A 3F3BA 3OYPA 5GNDA 3SU0A 4Z1MD 2FOMB 3N99A 2KR7A 3F0OA 1BMFD 2YMSC 5EPNA 4ASUD 3O8CA 1RTLA 3E90B 2IJD1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WW7 A;  5CHB A;  3WWF A;  3WWB A;  5F53 A;  4ZCN A; 
#chains in the Genus database with same CATH topology
 3CP7 A;  4K5Z A;  1GHB G;  5F8T A;  2BXU H;  2QF4 A;  4GCH G;  1FY5 A;  2XBW A;  3BIV H;  4XD7 D;  2QE7 D;  3RM0 H;  1UTK A;  2D1J A;  4FUI A;  4ABD A;  3QZR A;  2C8X B;  4WVP E;  2LPR A;  3D23 A;  2SGP E;  2ZU4 A;  2FX6 A;  1PQ7 A;  1H8I H;  1QB1 A;  2GT8 A;  3ZZ3 A;  3M35 A;  3UNS A;  3AVZ A;  4Z6A H;  4NWK A;  1NRS H;  5IDK A;  4RI0 A;  4O9V A;  1P8V C;  3I29 A;  1K2I 1;  1EOJ A;  1VZQ H;  2JJ1 D;  1D3T B;  4JCN A;  1QRZ A;  1UJ1 A;  2Y5F A;  1Z8R A;  4I33 A;  1AKS A;  1MTW A;  1CGJ E;  4DUR A;  5C94 A;  1BHX F;  1O3N A;  4FUC A;  1LDT T;  1TBZ H;  1V2Q T;  3SNC A;  1F7Z A;  2KCP A;  4WMD A;  4K1E A;  1SL3 A;  1C1U H;  1C5U A;  1D3Q B;  4DIH H;  2RDE A;  3IIT A;  3RLY H;  4IBL H;  3TH2 H;  5DP7 A;  4AG2 A;  2BY8 X;  3SQE E;  5HIY A;  1KY9 A;  2G00 A;  4K3J A;  4CHA B;  2R2W U;  4BTT B;  1GI6 A;  4UFE H;  1J17 T;  1IAU A;  2ZHF H;  4UFF H;  2F9B H;  1P2I A;  1SC8 U;  1WOF A;  3DT0 H;  1GG6 C;  1TRY A;  1C2E A;  3QUM P;  3URE A;  3TIT A;  4XOJ A;  1CBW C;  3ZVE A;  1SGY E;  1O2L A;  1Y59 T;  2ZO3 H;  5GCH F;  4JK5 A;  1YLN A;  6EST A;  2VVC A;  2FEQ H;  5EOK A;  1HJ8 A;  1H9I E;  1Z6J H;  1NRN H;  3E91 A;  1HAX B;  3P8G A;  3UOP A;  3VGC C;  3MU5 A;  2PSY A;  2Y7X A;  4KTU A;  2C8Z B;  2CJI A;  1RIW B;  3QZQ A;  1W14 U;  2B8O H;  2VBC A;  3EE7 A;  4ZMA H;  1GDQ A;  2OBO A;  2WV5 A;  2BDA A;  2F91 A;  1HJA B;  3LOX A;  1C5T A;  3LGW A;  5C3N A;  1P11 E;  2P8O B;  4B71 A;  3E6P H;  2FOC A;  1QBN A;  4YZU A;  3KL6 A;  3SV2 H;  4A6L A;  1AFQ C;  5J4Q A;  2G52 A;  2ILN A;  4FVD A;  2NU4 E;  2IOT A;  1ELV A;  2BB4 A;  2FS9 A;  2ZGJ A;  3RC5 A;  3UB0 A;  1W0K D;  4HFP B;  4INL A;  2TGA A;  2B9L A;  1FAX A;  1QJ1 B;  2ZI2 H;  4YOI A;  1W2K H;  1C2H A;  3MYW A;  3AAV A;  1TNJ A;  1YPK H;  2EY4 C;  1F0U A;  1TNL A;  5DK1 A;  2ZHW H;  1Y3W A;  1V2V T;  3U9A H;  5DN6 D;  1AB9 C;  1G36 A;  1K1I A;  2YMS D;  1T8L A;  1SQR A;  1DUA A;  4IS5 A;  1LQE A;  3SHC H;  4CR9 A;  2C8Y B;  3LJO A;  3A86 A;  2A4G A;  1AUT C;  2ANM H;  1YPG H;  4R0I A;  1BML A;  2PLX A;  2PSX A;  1XUH A;  2OQU A;  2W7U A;  3Q3K A;  2EI8 A;  1PQ8 A;  2A45 B;  4IN1 A;  1GVK B;  1ORF A;  2OC1 A;  3LGT A;  1E79 D;  3F9F A;  1LHC H;  4NIY A;  1GBC A;  4KEL A;  2BD8 A;  1F0T A;  5E0G A;  1ZJK A;  2VGC C;  5EXM A;  1NRO H;  2J38 A;  3GY7 A;  2PUX B;  1O5D H;  2PTC E;  3CEN A;  2HNT E;  3VB5 A;  3AAS A;  2RCE A;  5FX5 A;  2A5A A;  2CK3 D;  1GL1 A;  2QN5 T;  3VXF H;  2FIR H;  2R9P A;  2BDH A;  4Y0Y E;  4ACA A;  5C0T A;  3M37 A;  3SI4 H;  5ESB A;  1RJX B;  1P05 A;  2PKS C;  5HM9 A;  2P3U B;  1O39 A;  3I78 A;  3WWB A;  2RA0 A;  4AB8 A;  2CHA C;  2FES H;  4X6N A;  8KME 2;  1SB1 H;  2OLG A;  5GDS H;  3PLP A;  1SKY E;  2FOB A;  2QXH A;  3URC A;  2Y82 A;  1KXB A;  1GHV H;  1NO9 H;  1THP B;  2WPM S;  3A84 A;  4AZ2 B;  4RKO B;  4OS5 A;  1V6D A;  7GCH F;  1VCP A;  2A5K A;  4I86 A;  2R3U A;  3PB1 E;  1E0F D;  2BLO A;  2J34 A;  3SV7 A;  1O2Q A;  1V2W T;  3UWJ H;  3ATK A;  3GDV A;  4WJG 2;  1MCV A;  5DG6 A;  3Q3Y A;  1HGT H;  2O9Q A;  3ZV8 A;  1G3E A;  1OP2 A;  2A4Q A;  1KXF A;  1TGT A;  2GKV E;  3MO6 A;  4NIV A;  2SFA A;  1NU9 A;  1BMM H;  1UCY K;  4X8U H;  1AD8 H;  1V2L T;  2NU3 E;  3A7X A;  1YPL H;  1S6H A;  2Z9L A;  2VIV A;  1AWF H;  1IHS H;  1X7A C;  5TCA A;  1KSN A;  4YT6 H;  2UWO A;  4TY7 A;  4I8G A;  2UWP A;  2ZFQ H;  1OP0 A;  2WPK S;  1QNJ A;  3PWB A;  4D9Q A;  1O30 A;  2HVX A;  3HK6 B;  3M36 A;  5T1V A;  5CDF E;  2A7C A;  1P2M A;  3QX5 H;  4CRC A;  2FMJ A;  3RXT A;  3EA7 A;  5E2O A;  3M3T A;  5C17 A;  3O8D A;  1DOJ A;  1GBK A;  2H2Z A;  4Y7A A;  2XC5 A;  3A8A A;  1XUI A;  4YT7 H;  1JWT A;  2AER H;  4F49 A;  2H1U A;  3NWU A;  4FET A;  3LC3 A;  1EFR D;  1E35 B;  3ZYE A;  2H6M A;  1C9P A;  2G51 A;  3MNB A;  1TOM H;  3KID U;  1SGI B;  4Y79 A;  1GHY H;  1GJB B;  1ZMN A;  3HGP A;  1T7C A;  1QJ6 B;  5FXL A;  1WQV H;  1MU8 B;  1SHY A;  3LH3 A;  4Q7X A;  1EB1 H;  3A80 A;  1P0S H;  4DGJ A;  1C5L H;  1IQF A;  3M7Q A;  1NS3 A;  2G5V A;  1BJV A;  3FVF B;  1GDN A;  1V2O T;  4CRB A;  3M7T A;  3FN8 A;  4A5T S;  1W10 U;  2GZ7 A;  3A83 A;  1ELB A;  4DVA U;  1TX6 A;  4FUJ A;  4Z0K A;  4B74 A;  3TH3 H;  5BRR E;  4D9R A;  1NC6 A;  3CS7 A;  2SGD E;  1YPJ H;  1Z71 A;  5A0C A;  5IK2 D;  3AAU A;  6GCH F;  3RC4 A;  1QHR B;  2R2M B;  3K65 B;  4KTS A;  4F55 A;  1OS8 A;  4DCD A;  2J92 A;  4JYV H;  4B2C A;  1O2O A;  1JIR A;  5JBB S;  5T6G A;  2G8T A;  3F1S B;  3UQO A;  1XUF A;  3MNC A;  1BUI A;  1N8O B;  3N7O A;  2BDG A;  3H7T A;  1WTG H;  3E16 B;  4KP0 A;  3W95 A;  4XBC A;  2HPP H;  2TGD A;  2CF9 H;  4NFF A;  1EXF A;  1OWH A;  4H6S B;  5C1Y A;  1SVP A;  1EZU C;  1MUE B;  2Z9I A;  1AZ8 A;  2F9N A;  3A7T A;  3LPR A;  3LON A;  1GJ5 H;  1TYN A;  1YGC H;  2AIQ A;  1CU1 A;  2ZEC A;  1A5I A;  1IOE A;  2W5E A;  3C1K A;  1WU1 A;  4I7Y H;  4DT4 A;  1KYN A;  2NWN A;  4NA7 A;  4FU7 A;  1V2S T;  4Y10 E;  1SR5 C;  1ARC A;  1HAZ B;  1V2R T;  1E36 B;  4ZRO A;  4M7G A;  1NRP H;  1OWD A;  1AI8 H;  1QB6 A;  2OXS A;  3EGK H;  3SJ8 A;  1ELD E;  1UTN A;  3NZI A;  1W8B H;  3RMN H;  1O5C B;  2ALP A;  2XBY A;  2ZQ1 A;  4JZI A;  1GJ7 B;  4JZF H;  5KGO A;  2PKA B;  5HGG A;  1W3C A;  1MQ6 A;  2EST E;  2ZGB H;  4BAK B;  1MTU A;  5CHA B;  3I77 A;  3OTP A;  5F8X A;  1O5E H;  3GOV B;  1BJU A;  2BQ6 B;  4LOY H;  5DP4 A;  4A1V A;  1J8A A;  1S81 A;  1E1R D;  3RC6 A;  3EQ0 H;  1O2K A;  1GCD A;  2BQW B;  4IC6 A;  1FDP A;  1TNI A;  3LIW A;  3BTH E;  1LCY A;  6CHA B;  1FY3 A;  1A3E H;  1NFW A;  1OWI A;  2RDL A;  1LVY A;  3Q00 A;  4WF8 A;  1W0Y H;  2ZFP H;  4ZXX H;  1UTM A;  4ABE A;  1F5R A;  8EST E;  3O8R A;  1ELE E;  1Q2W A;  2AMD A;  1DXP A;  2SNW A;  3FFG A;  3SNA A;  1QGF A;  3K2U A;  3B8J A;  1BRC E;  5C1X A;  1MTS A;  5EW1 H;  2F83 A;  3OU0 A;  3MFJ A;  3PV5 A;  1GHX H;  2H9H A;  5AF9 H;  4Y71 A;  1OKX A;  1EAS A;  3BSQ A;  2GTB A;  1Q31 A;  2CXV A;  4X2V A;  1BB0 B;  2QXJ A;  2V3H H;  3T26 A;  3PM3 A;  1RXP A;  2FXR A;  2WZQ A;  5HYO A;  3SGQ E;  3UY9 A;  2AH4 X;  5AHG H;  2W26 A;  1LVM A;  1G9I E;  1KIG H;  1HYL A;  2NU0 E;  2WPD D;  3W94 A;  1YPM H;  1Z7K A;  1L2E A;  2ZTY A;  2PWX A;  2FX4 A;  3RMM H;  4AFU A;  2BD4 A;  1C1V H;  1SGF A;  2AYW A;  1O2G H;  4ISN A;  1AKS B;  1DX5 M;  2QA9 E;  4X8S H;  3QDZ B;  2K0Q A;  4VGC C;  4ABG A;  4AFS A;  4CBO A;  3MU0 A;  3SNB A;  3H09 A;  1PPE E;  3NXP A;  1AHT H;  4K1T A;  2JET B;  1OYT H;  3LDX H;  2O8M A;  5K0H A;  2V6N A;  1EZX C;  5EOD A;  4FU8 A;  3BEF B;  4TSF D;  4UON A;  2ZTZ A;  1O31 A;  3GY2 A;  5A0B A;  3ATW A;  4Y8X A;  1TON A;  1RTK A;  1V2N T;  5LGO A;  1EPT C;  4Y6D A;  1C5X B;  5EQR A;  3VG8 A;  3MI4 A;  4A1X A;  4Y7B A;  2ZU1 A;  1GJC B;  2ZDK A;  3F6U H;  4XE4 A;  2EQN A;  1S0R A;  1LTO A;  1SBW A;  4HZH A;  2ZHD A;  3N99 A;  2FOH A;  1O2X A;  4DW2 U;  5EPN A;  2GT7 A;  1YCP H;  4MNW A;  5H4I B;  1C4U 2;  3KGP A;  2QV1 A;  3SZN A;  4MPU A;  1C5O H;  2GV6 A;  3MMG A;  4BXW A;  7EST E;  2BHG A;  1GMD G;  1IHT H;  2J5U A;  3MO9 A;  4XBD A;  1OPH B;  4X6P A;  2QF3 A;  5FCK A;  1L4D A;  1B0E A;  1L4Z A;  4FUE A;  3K6Z A;  1FN8 A;  3UNR A;  1O2N A;  3PRO A;  5GXP A;  2UUF B;  1YF4 A;  1FON A;  5EQQ A;  4AOR A;  4YES B;  2VIN A;  1ELF A;  5DP3 A;  3NK8 A;  1UVS H;  1HJ9 A;  1AE5 A;  1A0J A;  1O3E A;  4LZ1 H;  1YBW A;  2BZ6 H;  2J2U A;  2VVV A;  3HGN A;  4WH8 A;  4NA8 A;  1VR1 H;  1A0H B;  1XVO A;  2ZCL P;  1BTP A;  1AVW A;  2ODP A;  2OQ5 A;  5FPY A;  3RP2 A;  1ZOM A;  4HI3 A;  3QLP H;  4DJZ B;  3RML H;  3BV9 B;  4OS6 A;  3P8O A;  8GCH F;  1TWX B;  1DT2 A;  3KCG H;  2F9O A;  2F9V A;  2FI4 E;  5I46 H;  1YP9 A;  4OGX A;  2GVF A;  3P8F A;  1UTL M;  1D6R A;  2PUQ H;  3TJO A;  3ZVA A;  1GMC G;  1GBE A;  4AGJ A;  3DD2 H;  4CRG A;  1AO5 A;  3A7Y A;  3BTG E;  3MWI U;  1COW D;  4B6F A;  3E3T A;  1GBM A;  3DFL A;  1OYQ A;  1O2R A;  3SHA H;  1A46 H;  1GGD C;  1GBJ A;  5JB8 S;  4CHA C;  1B5G H;  1KLI H;  5B6O A;  2OC8 A;  3ZVF A;  3RXA A;  1Z8J B;  3TK6 A;  4O97 A;  2XXL A;  5B6L A;  1PPZ A;  5AFZ H;  2D2D A;  2PGB B;  1H1B A;  4JK6 A;  2GP9 B;  3PMB B;  3D49 H;  3S7K B;  4LZ4 B;  4U01 A;  1K22 H;  3M5M A;  3UUZ A;  1ZPC A;  1P3C A;  1YYY 1;  3OEH D;  4HGC A;  1PJP A;  4U32 A;  2WIN I;  3RXS A;  3F2H A;  3QGJ A;  1W11 U;  1K1N A;  1GI5 A;  1YC0 A;  3PLK A;  4FUB A;  2C8W B;  3E90 B;  2LP6 A;  1DY9 A;  3NKK A;  1FZZ A;  1D3D B;  1H8H D;  3SW2 B;  1MAX A;  2H9E H;  1S84 A;  3RXV A;  1HJA C;  1F2S E;  1FI8 A;  1C1W H;  3ATM A;  1SQO A;  2HNT F;  1TPP A;  1ETS H;  1HV7 A;  2NU2 E;  3SV9 A;  5C0U A;  3VEQ B;  5L2Y H;  2W3I A;  4KTC A;  4CRA A;  5CMX H;  4ZHA A;  5KED A;  1UMA H;  3PV4 A;  1DM4 B;  2XC0 A;  3KYG A;  2ZFF H;  1VKY A;  2Y81 A;  4YOG A;  1P06 A;  1P03 A;  3DA9 B;  2EI7 A;  2AGG X;  1MTV A;  1PPC E;  1CGI E;  2Z3C A;  1MZD A;  2LNC A;  2UUK B;  1C5Y B;  2WPI S;  1GBB A;  1GI4 A;  5A8X A;  1UHB A;  4HG6 A;  3UOU A;  1O2S A;  4MPV A;  1C4Y 2;  1DSU A;  1G2M A;  4IN2 A;  2YMS B;  3F2G A;  2M2A A;  3RU4 E;  2VIP A;  2O8W A;  4UFG H;  3WWF A;  1BZX E;  2WHX A;  3TU7 H;  4SGB E;  3TLO A;  1HB0 B;  1XKB C;  1O5G H;  3SBK A;  5DPA A;  1KTS B;  2OP9 A;  3L33 A;  3BTQ E;  2BLV A;  1ZSK A;  5JDU B;  3TJN A;  1O3L A;  4O03 A;  3A8B A;  3P92 A;  1QFK H;  4NZL A;  3ZVC A;  4R8T B;  1ZTK A;  1GBA A;  1B0F A;  5L6N H;  4RT1 A;  1SI5 H;  2GCT B;  1ZR0 A;  3SJ9 A;  4DOQ A;  3U1J B;  1DWE H;  1TMB H;  1C5V A;  1EKB B;  1BTZ A;  1QTF A;  2TRM A;  3OX7 U;  2FOA A;  2ZU5 A;  2J4I A;  4ZH8 A;  1J9C H;  4UEH H;  1PFX C;  1WTH D;  2P94 A;  7LPR A;  5GJ4 B;  1BIO A;  1ZPZ A;  1QQ4 A;  1VCQ A;  1HPG A;  2Z9G A;  1C1N A;  3Q77 A;  1A4W H;  1IQL A;  1LHD H;  2BLW A;  4JYT A;  4DY7 B;  4SGA E;  2J97 A;  3OYP A;  2A2Q H;  2F3C E;  3F0O A;  2ZDL A;  4AFZ A;  1PPF E;  1T8N A;  2FI3 E;  4FUH A;  3A88 A;  2IJD 1;  1O0D H;  2HWL B;  1DLE A;  2Y80 A;  1MKX K;  3BTT E;  3PLB A;  1BDA A;  1XXF A;  2VIO A;  1P02 A;  1SGF G;  1NFY A;  3TK9 A;  1BBR E;  3TJV A;  3E8L A;  4ZAE A;  2JDI D;  1KTT B;  2KAI A;  4MQA A;  2BZA A;  3TIU A;  3HKI B;  1DAN H;  1KDQ A;  1O3B A;  1JOU B;  1VIT G;  4IGD A;  1NTP A;  1P3E A;  4ABI A;  2QAA A;  2B0F A;  1C2I A;  2DUC A;  3LT3 A;  3SO3 A;  3SNE A;  4D76 A;  2BY6 X;  5DGJ A;  1YY3 A;  2PTN A;  1T4U H;  4EST E;  4BAM B;  1ANC A;  1BOQ A;  1YLC A;  4GVU A;  1EOL A;  4X2X A;  3MH4 A;  1V2M T;  4RKJ B;  2BD2 A;  3K6Y A;  1FIZ A;  2OK5 A;  9EST A;  3ZVB A;  1L1N A;  1TQ0 B;  3LC5 A;  3ZV9 A;  4BNR A;  1ZHP A;  2BX3 A;  2OC7 A;  4OGY A;  4E7R G;  1SGP E;  3DUX H;  4BAH B;  4JZE H;  1O2T A;  3SV6 A;  2FLB H;  1FUJ A;  1O35 A;  4THN H;  1KXD A;  2P16 A;  2KM0 A;  3M5O A;  4U30 A;  2PHB A;  4A92 A;  2FS8 A;  4Q4L A;  1S0Q A;  1C5S A;  1QRW A;  2ZC9 H;  1XM1 A;  1ELA A;  2FWW A;  1UK2 A;  5LH8 A;  5FL7 D;  2ODQ A;  4NIX A;  4BAQ B;  1FIW A;  5GIB A;  3T2N A;  3A85 A;  3RXU A;  3RXM A;  3GY8 A;  1AU8 A;  2KFW A;  4ISL A;  4FUD A;  1GDU A;  3D65 E;  4ZKO U;  1TNH A;  4X1S U;  4XRN A;  2AMP A;  1DWC H;  4H4F A;  1S6L A;  3HK3 B;  1NBM D;  1S83 A;  2UUJ B;  4J1Y A;  4TPY A;  4B2B A;  1CT0 E;  5C1U A;  1FNI A;  5DSF A;  2Z9J A;  4CRD A;  3S7H B;  1O3K A;  3DSP A;  1N8O C;  1GJ6 A;  1GHB F;  1Z8G A;  2AS9 A;  2HOB A;  2TGP Z;  4GCH F;  2FOD A;  1JBU H;  4NWL A;  1DXW A;  2PR3 A;  1F5K U;  2ZFS A;  2FOE A;  5BPE A;  4J2Y B;  3ZZC A;  1HAG E;  1LPG B;  1MMJ N;  3N7D A;  3FZD A;  2V3O H;  1A7S A;  1O37 A;  5E0H A;  2ZZU H;  4UD9 H;  1GG6 B;  2W6I D;  3PRD A;  2Y7Z A;  1FMG A;  1AIX H;  1KMH B;  1LVO A;  1SLU B;  2EI6 A;  3R3G B;  1XMN B;  3QTO H;  2HVY B;  3MH6 A;  3SYJ A;  1EX3 A;  2IN2 A;  1O2Y A;  1FAK H;  4H42 U;  2Y5G A;  3KNX A;  1YWU A;  3VB3 A;  4OS1 A;  1LPK B;  2O8T A;  1XXD A;  2VIQ A;  3L6P A;  5CHA C;  3T5F H;  1DPO A;  1AGJ A;  1ZTL A;  5F6M A;  2WUB A;  1C2K A;  2CV3 A;  3MU4 A;  4D7F A;  1O3J A;  2STB E;  4P02 A;  2WPJ S;  3SU2 A;  3TGK E;  1GCT B;  3GY4 A;  1O2U A;  4WXI A;  1W7G H;  4IW4 E;  1RFN A;  1QL8 A;  3D62 A;  2YNA A;  6CHA C;  1TPS A;  3OTJ E;  1O3D A;  1TOC B;  5HMA A;  1EJA A;  1OHH D;  1AFQ B;  3RXI A;  3RXR A;  1MKW K;  2Q6G A;  5EPY A;  1HAI H;  3A7W A;  4YXW D;  3MU1 A;  1QRX A;  1SHH B;  1PYT C;  2L6O A;  3U8O H;  1G3D A;  3SND A;  4MDS A;  2QCY A;  1KXC A;  2FM2 A;  5T6D A;  3GDU A;  2GMT C;  1F0S A;  3M7U A;  4YM9 A;  1NPM A;  1V2U T;  2XND D;  3LH1 A;  3FKS D;  2CN0 H;  3RDZ A;  1SGQ E;  3KF2 A;  1V2J T;  1E1Q D;  3SGA E;  5EJ1 A;  2A7J A;  2A4R A;  4TWW A;  1EP6 A;  4PRO A;  2XYA A;  1SOZ A;  1KXE A;  1NRQ H;  2H5C A;  1HDT H;  1NFU A;  1QA0 A;  1ETR H;  2G81 E;  3O8B A;  4BOH A;  3PO1 B;  3MOC A;  1QIX B;  3ITI A;  4RT0 A;  1GI1 A;  4B73 A;  2F9P A;  4I8H A;  1M9U A;  2QYI A;  1THS H;  3T28 A;  3LU9 B;  3RMO H;  2OIN A;  3GCT G;  1C2G A;  3P70 B;  3FZZ A;  2QF0 A;  3T25 A;  2V35 A;  1QBO A;  2VIW A;  1D9I A;  1EB2 A;  2WYG A;  2ZCK P;  1WAY B;  3VXE H;  3GCN A;  3ZZ9 A;  1DIT H;  1D4P B;  1AE8 H;  3OY6 U;  1GBH A;  3ZZ8 A;  3M61 U;  3OSY A;  2HGT H;  3O8C A;  1W0Z U;  2XBX A;  2V0B A;  1C4V 2;  1AQ7 A;  4X6O A;  2B7D H;  4WME A;  4UFD H;  2G55 A;  1FX0 B;  3PWC A;  4INH A;  5FHT A;  1A0L A;  3P95 A;  3H5C B;  1RRK A;  1CQQ A;  1ZJD A;  4TYD A;  1QQU A;  5LPF A;  3BG4 B;  1UTQ A;  5A2M H;  2RG3 A;  1P01 A;  4K8B A;  2GZ9 A;  4I8L A;  1C2M A;  1THR H;  4FOU C;  1GHW H;  2BD9 A;  1C5M D;  1YCP M;  2ZGC A;  1GBT A;  3Q76 A;  4NGA H;  3VB7 A;  2ZFR H;  1CGH A;  3OEE D;  3E0N B;  4MPW A;  1NFX A;  1TBR H;  2ZHE H;  2W7S A;  2ZG0 H;  4XFQ A;  1EAX A;  1LHG H;  2ZGX H;  2KCY A;  2TGT A;  1N1L A;  4O3U A;  2BY5 X;  2GX4 A;  3VB4 A;  4ISH H;  2OC0 A;  1SFI A;  1TA2 A;  2B5T B;  5E2P A;  3KYF A;  3SUF A;  4D7G A;  5LPE A;  1EZS C;  1H4W A;  1S5S A;  2G4T A;  2YNB A;  3NPS A;  4X0W U;  2BDB A;  1RTF B;  3F9H A;  1P2O A;  3RXE A;  1CA0 C;  2VU8 E;  3MTY A;  1K1P A;  3ZVG A;  3WY8 A;  3ZZ7 A;  1LMW B;  1BTU A;  1ZML A;  2KCO A;  1MTN B;  2HNT C;  3QTV H;  1ZPB A;  2GD4 B;  1ZZZ A;  1D3P B;  1C9T A;  1FQ3 A;  4GUX A;  3BEI B;  3HAT H;  3BTM E;  1BTH H;  1TQ7 B;  2XWA A;  1VGC B;  4E7N A;  1GL0 E;  2THF B;  3KQB A;  1O2H A;  2ANW A;  1UHB B;  3E0P B;  2M5T A;  1SLV B;  4AYV B;  3KHV A;  5JBC S;  3PMA B;  4JMY A;  3TK5 A;  5A8Y A;  4TT3 D;  1DVA H;  3EA8 A;  1FPC H;  1DY8 A;  1MU6 B;  1P9U A;  2OD3 B;  4Z1M D;  2Z6B D;  1C2D A;  1E38 B;  4ISO A;  1C5R A;  2ANY A;  3VPK A;  2P3T B;  1P2K A;  1YPE H;  1OWE A;  3UFA A;  4JZ1 A;  3SOS A;  3OAA D;  3PMH B;  1C1R A;  1Z1I A;  1J15 A;  2ZPS A;  1KLJ H;  5EGM A;  2V7Q D;  1H8E D;  4B76 A;  1GPZ A;  3M3S A;  4FUG A;  4WY3 A;  4X1P U;  1ESB A;  1EAU A;  1S6F A;  4OS4 A;  2XCN A;  3LGU A;  3M5N A;  1C1O A;  3WW7 A;  1EAT A;  2A2X H;  2AFQ B;  3IWM A;  5J4S A;  4INK A;  1A5G H;  1DWB H;  2Z3D A;  3BTK E;  3JZ1 B;  1G2L A;  4BAN B;  4TWY A;  4B75 A;  1TAL A;  1V2K T;  1CA8 B;  1AUJ A;  1HAV A;  1QY6 A;  1H8D H;  1O3G A;  1Y5U T;  1O3P B;  2TPI Z;  1S82 A;  2FO9 A;  1RS0 A;  1PPG E;  4MNV A;  1J16 A;  2BTC E;  2PW8 H;  1HXF H;  2ZKS A;  3ZZA A;  5E0J A;  3FAO A;  4K2Y A;  3SOR A;  3RXD A;  3UR9 A;  2Q6D A;  1BBR H;  2SGQ E;  3UQV A;  2BXT H;  2VWM A;  3ZZ4 A;  1BMA A;  5A09 A;  2KAI B;  1GWA A;  1A2C H;  2BVS H;  5C67 A;  1DUE A;  1CT2 E;  1KDQ B;  3TGJ E;  1O5B B;  3MHW U;  3GIS B;  2ZPR A;  5EW2 H;  2VWO A;  2TIO A;  1SGD E;  1RD3 B;  4ZXY H;  5HKK D;  1ABJ H;  3PV2 A;  2A5I A;  3MH5 A;  5FCR A;  1YLD A;  4GPG A;  4A1T A;  1FJS A;  1FN6 A;  1TB6 H;  5LPR A;  2BX4 A;  2GDE H;  5GCH G;  3SU1 A;  1AZZ A;  1ELC A;  1FXY A;  3MH7 A;  3ODD A;  1TMT H;  1DE7 H;  1OSS A;  1Y8T A;  3BTW E;  1CSO E;  1Z6E A;  1V3X A;  2WSS D;  2FI5 E;  4YLQ H;  2HPQ H;  3U69 H;  1ZMJ A;  2XRC A;  1W0J D;  4X1Q U;  4E05 H;  3ATI A;  2P3F H;  3A7V A;  2J98 A;  1SGN E;  1P04 A;  4GHQ A;  3GCH B;  2GCT C;  3SU0 A;  2ZGH A;  4DG4 A;  1YM0 A;  1IQH A;  1RTL A;  1TRM A;  1ZRB A;  2FYR A;  3QGN B;  4CR5 A;  3LJJ A;  1WV7 H;  2K1Q A;  5CE1 A;  1G3C A;  2QIQ A;  1O3O A;  4CRF A;  2PFE A;  1C5W B;  1GJ9 B;  5AFY H;  2ZDA H;  2I6Q A;  1LO6 A;  3EA9 A;  5G4B A;  5C2Z A;  3SUD A;  3TJU A;  1L1J A;  4OM9 A;  3V3M A;  1G3B A;  1B7X B;  2QF5 A;  4UE7 H;  1YKT A;  1IQM A;  4AGK A;  3MQK C;  2SGE E;  5ETX A;  4GLY A;  2ZQ2 A;  5GPI B;  2VNT A;  4RN6 A;  5C5O A;  2BM2 A;  1NZQ H;  3SN8 A;  3V12 A;  1IQN A;  1H9H E;  1T8O A;  1O3F A;  1A3B H;  1O2I A;  1HBT H;  1JXP A;  1RIW C;  3SGB E;  4NG9 H;  4ABJ A;  2ZHQ H;  2W3K A;  1WDI A;  3EAJ A;  3M5L A;  1WQS A;  3RM2 H;  1GJ8 B;  1LKA A;  2J9N A;  3SJO A;  2BD5 A;  1C2L A;  1NES E;  3JZ2 B;  4AG1 A;  1FY8 E;  2P8O C;  1JIM A;  1GI0 A;  1SGR E;  3SU6 A;  9LPR A;  4OS2 A;  4P00 A;  4F4O C;  3B9F H;  3MNX A;  2EC9 H;  4X1N U;  2YOL A;  2A4O A;  1TGN A;  1SGE E;  1EJM A;  1ID5 H;  1TRN A;  2DE9 A;  3A7Z A;  1Z8I B;  3URD A;  1QR3 E;  5HM2 A;  1TLD A;  1UVO A;  1K1O A;  2KZ4 A;  5FAH A;  1GVZ A;  1C1S A;  1J14 A;  3W1E A;  2WV9 A;  1T32 A;  1ANB A;  3SV8 A;  1TBQ H;  5FBI A;  4ZHL U;  1ELG A;  4KKD A;  1V2P T;  5DP8 A;  1BRA A;  3E1X B;  1ZHM A;  1EZQ A;  4CBN A;  1LHE H;  1W7X H;  2A31 A;  1A61 H;  2GDD A;  2BDI A;  1MZA A;  1ZTJ A;  3ODF A;  2BD7 A;  1O2Z A;  4Q80 A;  1O3M A;  1O5F H;  5JB9 S;  4ZHM U;  3AW1 A;  4O3T A;  1GMD F;  2STA E;  3A8D A;  3KQE A;  3RXP A;  1N6Y A;  2QXG A;  1VJA U;  2EEK A;  4XBB A;  4FXG H;  4M9F A;  3F3B A;  7GCH G;  2SNV A;  4AX9 H;  2BQ7 B;  1XUK A;  3EE0 B;  4ASU D;  2ZU2 A;  5DKM A;  3DFJ A;  1TE0 A;  1O2P A;  2BMG B;  4Q7Y A;  3STI A;  1DLK B;  3BTE E;  4AFQ A;  2PV9 B;  3UAI C;  2TBS A;  4MTB A;  2VWN A;  5EIY A;  3AK5 A;  1G30 B;  1GMH G;  3RXC A;  2BYA X;  3F0P A;  3RXJ A;  1CVW H;  1SSX A;  4WXV A;  1HIA B;  3F2F A;  4ASH A;  2A1D B;  2ZDV H;  1CT4 E;  3EDX B;  3UNQ A;  1BIT A;  4K69 A;  2XWB I;  1GGD B;  2F9U A;  1ANE A;  1SQT A;  4ABA A;  1LKB A;  2H9T H;  1LVB A;  1HAY B;  1AVG H;  1K28 D;  2XTT B;  3A89 A;  4GAW A;  3GDS A;  3UWI A;  4I32 A;  2L74 A;  3BEU A;  3MNS A;  1OX1 A;  3EYD A;  4BTI B;  1GMC F;  2BY9 X;  1O2M A;  1AWH B;  1TMU H;  1O33 A;  1U6Q A;  2GV7 A;  3MU8 A;  4XSK U;  3GYM A;  5HXF A;  2O8U A;  5FBE A;  1QL7 A;  4XDE A;  5F8Z A;  1GHA G;  1P2J A;  5C5N A;  2UWL A;  1CO7 E;  1UCY E;  5DP9 A;  3UR6 A;  1XUG A;  3RXK A;  1GCT C;  1G37 A;  2IJO B;  4BTU B;  5GWZ A;  3OY5 U;  1C2F A;  1DFP A;  4Y0Z E;  2WUC A;  2CF8 H;  2GGV B;  3A8C A;  5EXL A;  4ABH A;  2FP7 B;  2GZ8 A;  2Z94 A;  4BXS A;  1INC A;  2FLR H;  5ABW A;  3NCL A;  1MBQ A;  2JH5 D;  1MD7 A;  4QT8 C;  5EXN A;  6GCH G;  2ZDM A;  2A0Q B;  1UTO A;  1ZRK A;  2F4L A;  5PTP A;  5T6F A;  2OBQ A;  1TNK A;  4NSY A;  2Q1J A;  4CH8 B;  2AMQ A;  4MNY A;  2C93 B;  1TX8 A;  2FYQ A;  3RXG A;  1K1L A;  1QUR H;  1IQE A;  2JIZ D;  2JKH A;  2EA3 A;  2ZCH P;  1PPH E;  2ODY B;  1P10 A;  1UVT H;  3U8T H;  1C1Q A;  1A5H A;  3RLW H;  4KGA A;  2ALV A;  4OS7 A;  3PO1 C;  4Q7Z A;  1CE5 A;  2SGA A;  4FVB A;  3TGI E;  2GJG A;  4MG3 A;  4YOJ A;  1H9L B;  4TY6 A;  1TFX A;  3HKJ B;  1P2N A;  3FP8 E;  1ZYO A;  4MLF B;  6LPR A;  1DS2 E;  2F43 B;  3RXF A;  1XUJ A;  2AEI H;  3FAN A;  2XNI A;  3RXQ A;  1C5P A;  5CHB A;  3RXO A;  1HAP H;  1KXA A;  2GCH G;  3LKW A;  3UIR A;  2D8W A;  1LPZ B;  3BG8 A;  1NU7 B;  4I8J A;  1K9O E;  4Y11 E;  1WUN H;  5JBT A;  4X2Y A;  2ZF0 H;  3ZIA D;  2BOH B;  1SLX B;  1HXE H;  3ZYD A;  4NFE A;  7KME H;  3SJI A;  1EST A;  1WBG B;  1YCP K;  1HLT H;  3ZZ6 A;  1EPT A;  2CGA A;  3SZE A;  4DII H;  4ISI H;  1F5L A;  3G01 A;  2ZIQ H;  1Y5B T;  4UDW H;  4GHT A;  4B6E A;  1CBW B;  2XOK D;  4I31 A;  4BAO B;  3DCL A;  3BG4 C;  1OOK B;  2ZEB A;  4YTA A;  1SGT A;  2Z3E A;  1HUT H;  2P59 A;  3SJK A;  1OWK A;  2RFK C;  1C1P A;  1BBR K;  1MH0 A;  3QN7 A;  3VGC B;  1O36 A;  1BCU H;  4Q2K A;  1W13 U;  1F92 A;  4DT7 B;  2O8L A;  2H5D A;  5T3H A;  3U98 H;  1O34 A;  3VFE A;  1KLT A;  1N6X A;  3V7T A;  1YPH E;  2SGF E;  2LEL A;  1SFQ B;  1HFD A;  3GIC B;  1EQ9 A;  1QCP A;  2OTV A;  3P8N A;  4AC9 A;  2VH6 A;  1GMH F;  5JBA S;  1HAV B;  1O3C A;  2J95 A;  1TAB E;  4FUF A;  5A8Z A;  1JRS A;  1GI8 B;  2HAL A;  1G32 B;  1K0H A;  1WSS H;  8LPR A;  1AFE H;  3OFN D;  4LXB H;  1VIT H;  3DSG A;  1UO6 A;  1ZGV A;  3LGV A;  5EG4 A;  1GI2 A;  1MTN C;  4NZQ A;  1AB9 B;  2Z7F E;  3K9X B;  1GJA B;  5C20 A;  3SI3 H;  1EAW A;  1BMF D;  2A7H A;  2BDC A;  4JYU H;  3F68 H;  1Y3X A;  1VGC C;  2ZWL H;  2PP6 A;  5F53 A;  1HIA A;  1C5Z B;  1MD8 A;  2ULL A;  1MBM A;  1NM6 A;  1C5N H;  1VIT F;  1TAW A;  2FTM A;  3RXH A;  1O3I A;  4E06 H;  4F48 B;  3KQD A;  1GHA F;  2AHM E;  4IC5 A;  3GCO A;  3SU3 A;  4IMQ A;  1EJN A;  1BTW A;  5AVD A;  1MCT A;  1BTX A;  1IQI A;  1NT1 A;  1QJ7 B;  2RA3 A;  4WMF A;  5TJX A;  1JMO H;  1LQD B;  2JET C;  2VGC B;  1XVM A;  3GY5 A;  3UTU H;  1TGC A;  1XKA C;  3KQ5 A;  1SG8 B;  1TGB A;  1VCW A;  4U2W A;  1OP8 A;  4AYY B;  3KEE A;  4I8K A;  2C4F H;  2VB0 A;  2J98 B;  2VVU A;  4MPX A;  1Y3Y A;  2QXI A;  3F9E A;  1GI7 B;  1QZ8 A;  1K1M A;  3SU4 A;  1SLW B;  2ZA5 A;  1NBM E;  2PKS B;  1T31 A;  1SPJ A;  1GBI A;  2HRV A;  2FTL E;  2CHA B;  3UPE A;  1MAY A;  1GHZ A;  3GY6 A;  3TPI Z;  2IPH A;  2ZPQ A;  3SQH E;  3L3T A;  4Q63 A;  8GCH G;  1D6W A;  1CHO G;  5DP6 A;  2ZU3 A;  1GBL A;  2WV4 A;  2C3S A;  2P95 A;  3GYL B;  1BMN H;  2ZDN A;  5TCC A;  3ZZB A;  1SGC A;  2PGQ B;  4WWY A;  1L1G A;  4ABF A;  3ZZD A;  2JH6 D;  3RU4 T;  5SGA E;  4Y8Y A;  2FPZ A;  2GCH F;  2JJ2 D;  2XCF A;  1P2Q A;  5EST E;  1RGQ A;  2ZTX A;  3H7O A;  1WYK A;  3KQC A;  1MKX H;  2OCV B;  1UK3 A;  1FPH H;  2V3M A;  3U28 C;  1BA8 B;  1AND A;  1UTJ A;  1C1T A;  1DIC A;  4D8N A;  5FPS A;  2ZFT A;  1JRT A;  1HRT H;  3A81 A;  3KN2 A;  1GJD B;  2FOF A;  1P09 A;  5GND A;  2UUY A;  1FY1 A;  1ZLR A;  2BLQ A;  3CNR A;  1BRU P;  4H6T A;  1IQG A;  1Y3V A;  3S9B A;  2J94 A;  3N7E A;  1VJ9 U;  3FP7 E;  4ZKN U;  1DST A;  1PQA A;  1TPO A;  2GMT B;  2AGI X;  1GJ4 H;  2R0K A;  2R0L A;  1ACB E;  2BY7 X;  3STJ A;  3PTB A;  3GCH C;  3PMJ A;  2KCA A;  1QL9 A;  5DJ7 A;  3QK1 A;  1LHF H;  3M3V A;  1TNG A;  3LGY A;  1O5A B;  3MO3 A;  1AMH A;  1MAB B;  4NCY A;  4TPI Z;  2VH0 A;  3GS9 A;  3ATL A;  5L2Z H;  1NRR H;  2WPL S;  4CRE A;  1S85 A;  3BF6 H;  1A1R A;  3EST A;  2BVR H;  1UVP A;  2G4U A;  2VWL A;  1ARB A;  1ESA A;  5DO4 H;  2FOG A;  1GVL A;  2KX4 A;  1O3H A;  1TX7 A;  1GI9 B;  3IG6 B;  2BD3 A;  2C90 B;  1DWD H;  1EP5 A;  1UVU H;  1IQK A;  4X8T H;  1O38 A;  4K1S A;  1C5Q A;  1TPA E;  4B1T A;  4YO9 A;  3U8R H;  1Q3X A;  1O3A A;  4RSP A;  3ENS B;  4AOQ A;  3SUG A;  1QBV H;  4X6M A;  3TVJ B;  1P9S A;  4JZD H;  1YPH C;  1SMF E;  2QY0 B;  4GSO A;  4WH6 A;  4CH2 B;  1NN6 A;  2OUA A;  2D26 C;  1AN1 E;  1BRB E;  1TIO A;  1GI3 A;  2ASU B;  3FOA A;  3A87 A;  5EU8 A;  1TGS Z;  3FO8 D;  1Z1J A;  2ANK H;  1UTP A;  3HPT B;  3GCT F;  4FU9 A;  1L0Z A;  2Y5H A;  5I25 A;  5A0A E;  2ZNK H;  2HLC A;  5IYT A;  3T62 A;  1GBF A;  1C1M A;  1BT7 A;  2AIP A;  1QB9 A;  4ABB A;  1W12 U;  2FDA A;  3T27 A;  3SUE A;  3B23 B;  3T29 A;  3P6Z B;  4NA9 H;  4X2W A;  2A32 A;  3RU4 D;  3RUO A;  1QA7 A;  2K8I A;  2QC2 A;  1UCY H;  3GY3 A;  1AY6 H;  4ZKR U;  1DDJ A;  4YLU A;  5K7R A;  3PTN A;  2FOM B;  1ELT A;  1PYT D;  2JH0 D;  2KR7 A;  2YMS C;  3P17 H;  4ZCN A;  1HAH H;  1SOT A;  2WYJ A;  2Z9K A;  5E8E H;  1P57 B;  3OE7 D;  2Y6T A;  1O2J A;  3V13 A;  3VB6 A;  1O2W A;  1FLE E;  4K8Y A;  3F9G A;  4MNX A;  2XW9 A;  1K1J A;  5FPT A;  5KEC A;  2HLD D;  1UW7 A;  5HIZ A;  1V2T T;  4K60 A;  3NRL A;  1CA0 B;  1C2J A;  1EAI A;  1CHO F;  1TA6 A;  2BOK A;  5EQS A;  3S69 A;  3U1I B;  2I6S A;  1MKW H;  2VID A;  2CMY A;  2WPH S;  4Y8Z A;  1EUF A;  3QO6 A;  1T8M A;  3TNT A;  2P93 A;  1WCZ A;  1OWJ A;  3PRB A;  1HNE E;  3S9C A;  2BVX H;  2W6J D;  4ACB A;  3BN9 A;  3ZZ5 A;  1K21 H;  1SQA A;  4Y76 A;  3TNS A;  3ZVD A;  1GBD A;  3PYH A;  3V0X A;  1FY4 A;  5EJZ A;  4HTC H;  1E34 B;  1BQY A;  4ZKS U;  3ELA H;  1F0R A;  1HCG A;  2XC4 A;  5EJL A;  4AB9 A;  4X1R U;  1E37 B;  1Y5A T;  2ZP0 H;  4VGC B;  1Y3U A;  4X8V H;  2R3Y A;  1OXG A;  3A82 A;  1ZSL A;  5FX6 A;  3DSO A;  3RXL A;  3S9A A;  1ZGI A;  1PQ5 A;  1PPB H;  4ZUH A;  1BHX B;  1XX9 A;  1BTY A;  2PKA A;  1ZHR A;  5DP5 A;  2Q6F A;  1NY2 2;  2DE8 A;  3DHK H;  1EPT B;  3S0N A;  2XBV A;  3AW0 A;  3BIU H;  2FZZ A;  1FV9 A;  2VJ1 A;  3QWC H;  4MVN A;  1HAO H;  3LGI A;  3BTD E;  1AVX A;  3NUM A;  3TH4 H;  2NU1 E;  1O2V A;  4LK4 A;  4NSV A;  1ZSJ A;  1T4V H;  5JPM H;  4AN7 A;  3Q3X A;  1IQJ A;  1ABI H;  3CS0 A;  5F03 A;  2BDY A;  1MQ5 A;  2QGR A;  2G5N A;  3SU5 A;  1WXR A;  4NIW A;  4IMZ A;  3RXB A;  5JYI A;  2IPQ X;  1ETT H;  1UK4 A;  1P12 E;  3R0F A;  1CHG A;  5L30 H;  3FP6 E;  4A7I B;  3BTF E;  2AGE X;  3C27 B;  4B2A A;  1O32 A; 
#chains in the Genus database with same CATH homology
 2QV1 A;  1DY9 A;  3N7D A;  2QF4 A;  4XD7 D;  3N7E A;  3OE7 D;  3RC5 A;  2J5U A;  1W0K D;  5F53 A;  3UB0 A;  2QE7 D;  1H8H D;  2F43 B;  2K1Q A;  1W3C A;  2XNI A;  1FX0 B;  3OAA D;  5CHB A;  5FPT A;  5T1V A;  3OTP A;  5CDF E;  3LKW A;  5H4I B;  2HLD D;  2AHM E;  2V7Q D;  1H8E D;  2W6I D;  2JDI D;  4A1V A;  3SU3 A;  3PRD A;  4B76 A;  3AK5 A;  3SUD A;  1E1R D;  3NRL A;  3RC6 A;  3F0P A;  1KMH B;  5C17 A;  5DN6 D;  3O8D A;  4OM9 A;  5EQS A;  2XCN A;  2YMS D;  3F2F A;  4TYD A;  5EQQ A;  4NWK A;  5C0U A;  2QF5 A;  3M5N A;  4RI0 A;  3U1I B;  3ZIA D;  3WW7 A;  2KCA A;  4KTC A;  5ETX A;  5GPI B;  2A4G A;  3SYJ A;  2F9U A;  2JJ1 D;  4FET A;  1MAB B;  1EFR D;  4WF8 A;  4I33 A;  4K8B A;  3KNX A;  3GS9 A;  4WH8 A;  1JXP A;  3SZE A;  4B75 A;  3L6P A;  3PRB A;  3O8R A;  3KEE A;  4I32 A;  2OC1 A;  2W6J D;  1DXP A;  1A1R A;  1E79 D;  3M5L A;  3SU2 A;  3EYD A;  5FPY A;  3SU4 A;  2KCP A;  3PV5 A;  4B6E A;  2XOK D;  1NBM E;  4I31 A;  3SU6 A;  3DCL A;  3P8O A;  2OK5 A;  1NS3 A;  3OEE D;  2F9V A;  1OHH D;  2YOL A;  3FN8 A;  2P59 A;  5EPY A;  2GVF A;  2OC7 A;  4YXW D;  2YMS B;  2KCY A;  4B74 A;  3F2G A;  1N1L A;  2L6O A;  2M2A A;  2WZQ A;  3SV6 A;  3SV9 A;  3WWF A;  2WHX A;  2CK3 D;  2FM2 A;  2OC0 A;  3DSO A;  4Q63 A;  3SUG A;  5IK2 D;  2KZ4 A;  3RC4 A;  3SUF A;  2WPD D;  5C0T A;  2IJO B;  4F55 A;  2KM0 A;  2XND D;  3M5O A;  5ESB A;  3W1E A;  2WV9 A;  4WH6 A;  3SV8 A;  3FKS D;  4A92 A;  1COW D;  4Q4L A;  3KF2 A;  4B6F A;  2GGV B;  1E1Q D;  3WWB A;  2A4R A;  3FOA A;  2LEL A;  3FO8 D;  2FP7 B;  5HKK D;  2K0Q A;  2KCO A;  5FL7 D;  3PV2 A;  3P8N A;  3H09 A;  2JJ2 D;  4R8T B;  1SKY E;  2XCF A;  2KFW A;  3O8B A;  4A1T A;  2O8M A;  1RGQ A;  2OC8 A;  4TSF D;  2F4L A;  3U1J B;  1BT7 A;  3LON A;  1S6L A;  3SU1 A;  4B73 A;  2OBQ A;  1NBM D;  1CU1 A;  5B6L A;  2VBC A;  2OIN A;  3OFN D;  3SV7 A;  2OBO A;  4DT4 A;  5DSF A;  2JIZ D;  2WSS D;  3DSP A;  3SU5 A;  4U01 A;  3M5M A;  5GJ4 B;  1WXR A;  3SUE A;  4ZCN A;  3LOX A;  1W0J D;  5EQR A;  4JMY A;  3VG8 A;  3OEH D;  5FPS A;  4B71 A;  4A1X A;  2A4Q A;  2K8I A;  5IDK A;  4M9F A;  4NWL A;  4TT3 D;  1DXW A;  3F2H A;  3KN2 A;  1DY8 A;  3F3B A;  3OYP A;  5GND A;  3SU0 A;  4Z1M D;  2FOM B;  3N99 A;  2KR7 A;  3F0O A;  1BMF D;  2YMS C;  5EPN A;  4ASU D;  3O8C A;  1RTL A;  3E90 B;  2IJD 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...