5CHBA

Crystal structure of nvpizza2-s16h58 coordinating a cdcl2 nanocrystal
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
84
Chain Sequence
MFTGLNTPSGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVLPFTGLNTPHGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nvPizza2-S16H58
publication title Biomineralization of a Cadmium Chloride Nanocrystal by a Designed Symmetrical Protein
pubmed doi rcsb
molecule tags De novo protein
total genus 13
structure length 84
sequence length 84
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.500 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5chbA00
5F53A 3WW7A 3WWBA 3WWFA 4ZCNA 5CHBA
chains in the Genus database with same CATH superfamily
1TX8A 2D26C 3QGNB 4K2YA 3LGWA 1IQLA 2IJOB 2W26A 2HWLB 1TRMA 1Z8IB 2G4UA 1O34A 3T5FH 3KYFA 1V2JT 1QRXA 2BOKA 5EW2H 4RN6A 4ABJA 2Z9GA 5PTPA 3UNQA 1NROH 1BOQA 3FOAA 2HNTF 5T6DA 3RLWH 1GBDA 1C2HA 2CF9H 3M3VA 5JYIA 1A4WH 1O2TA 1W7XH 4WXVA 2BXTH 1ZR0A 1QJ6B 1O2RA 4AFQA 1WCZA 2NU3E 1GHWH 2ASUB 1UVTH 2BVRH 2OXSA 2VIVA 1EZQA 2QGRA 2AEIH 3R3GB 2AIQA 1EASA 2CXVA 1CGJE 4CR9A 1SPJA 3ZZAA 3MH4A 2OC0A 3O8RA 3RMMH 1QQUA 1VGCC 1E0FD 3FP7E 2D2DA 2JH5D 4TY7A 1AUTC 3M7TA 2C3SA 3SJOA 3OAAD 1H8HD 1L1GA 1NFYA 5FPYA 1F0UA 1YLNA 3SJKA 4AG1A 2ZP0H 3BG4B 1W0YH 1MKWK 1BRBE 1O5FH 4GSOA 4X8VH 1B5GH 1RRKA 1O2HA 1UCYK 2HVXA 5DP8A 3DCLA 4JCNA 1BMNH 2BDHA 4ISLA 4D9QA 2ZGCA 4ZCNA 3LGYA 5CHBA 1Z6JH 1ZGIA 1RJXB 2A5IA 1HXEH 3C27B 4F49A 1GDNA 2SFAA 3PTNA 1GHVH 1TGTA 1BIOA 3K9XB 5A8ZA 1FY3A 3RXEA 2PKSC 3TGIE 3BN9A 3RM2H 1PQ5A 1A0JA 1KMHB 1GJDB 1DWDH 1J15A 1N6YA 4TYDA 2ZPSA 3ZVAA 1Y5AT 3LPRA 4FOUC 3U8TH 3P70B 1MTSA 4BOHA 8GCHF 1XVOA 1W3CA 1BTZA 1DS2E 1GG6B 3QX5H 4UFDH 3TVJB 1ETTH 3KQ5A 4FUFA 3PO1B 1C2KA 2VIDA 4X1NU 4DG4A 2BD4A 3SV8A 3V7TA 3PTBA 3H09A 1DICA 1ESTA 3UR9A 1YPJH 1T7CA 5H4IB 1QCPA 3QTVH 1Y59T 2BVXH 1UTOA 1OPHB 3MU4A 3RC6A 3EGKH 3Q00A 3R0FA 2WUBA 4OGYA 1LVBA 2WPLS 1TRNA 2FI4E 1EAXA 1O2IA 3U1JB 1GMDF 1DM4B 1Q2WA 1B7XB 2B9LA 2VWOA 3M35A 2NU1E 7ESTE 1SQOA 4FETA 3T28A 1LMWB 1YM0A 1HAIH 2DE8A 1MUEB 3OTPA 2F9NA 1LHCH 1QB6A 3L33A 4X2WA 3MO3A 1MBMA 1FN6A 1KTTB 4ACBA 2ZI2H 1C2EA 3GICB 1A61H 3ZZ7A 2XBWA 4X6OA 1O3OA 1NRRH 5C0UA 3SNAA 2M2AA 4XBBA 2H2ZA 4MG3A 3MH7A 1ZRBA 4HFPB 2H6MA 1NRSH 2W6JD 1V2VT 1ACBE 1JBUH 4X6MA 3M5MA 5FX5A 1C1SA 2V7QD 3FO8D 2J98B 5KECA 1SQRA 2H5CA 4DCDA 1O31A 5FPTA 2Y82A 3UFAA 2BQ7B 2KAIB 1C1MA 3U69H 1VCPA 1WQSA 5T3HA 4IC5A 3URCA 2JH0D 4ABHA 7KMEH 1XVMA 1WYKA 2FODA 2QXIA 2SGFE 4MDSA 4A7IB 3GDVA 2B5TB 1ORFA 3KQEA 1PPCE 4ZKSU 5C5OA 2HPQH 2BQ6B 2ZCKP 5L2ZH 1AWFH 1D6WA 1CGIE 5JBCS 1F0RA 1KXDA 1ZTLA 3SI4H 4INHA 4TWWA 4WJG2 4X1SU 3RXSA 2Z3EA 2NU4E 1THPB 3O8DA 1FMGA 4NWLA 2EI7A 3SHAH 3ODDA 1HCGA 2QE7D 3QZRA 2AGEX 1ANEA 2F9UA 4FUJA 2KZ4A 2PGBB 3FVFB 4I7YH 7GCHG 3A89A 1FPHH 1YPHC 1HAOH 3CS0A 5C67A 1F0SA 4NA8A 3A7TA 1TGNA 4IC6A 4NZQA 1FQ3A 1Z8RA 5DGJA 4ZROA 2FLRH 2F9PA 2FZZA 2GV6A 5EXNA 2CJIA 1UHBA 3LKWA 4J1YA 1SL3A 5FCRA 1W7GH 4FUHA 4NFEA 4ZXYH 4FUCA 4HGCA 4ACAA 1GHYH 1C9PA 3HK3B 4BAKB 5JDUB 5A2MH 1S5SA 1C1WH 3PRBA 1GJCB 3LGIA 2ZFSA 5JPMH 3BTEE 2KCOA 2YNBA 2WV5A 3P6ZB 1Y3XA 3PMBB 2EQNA 3M36A 4FUEA 3WW7A 2ZCHP 4AYYB 5A0CA 2HOBA 2FIRH 1AB9B 1C5UA 3M3SA 3EQ0H 2ZECA 3KF2A 2ZFFH 5IK2D 4A1TA 3SJIA 3GY7A 2GTBA 2HGTH 1XUHA 3BTME 2JH6D 1TB6H 4B76A 2F3CE 3MI4A 3BTHE 1OP0A 2QXHA 2P59A 1CT0E 1DT2A 4NG9H 2AIPA 3TK6A 3ZYDA 5FX6A 1FZZA 5C1YA 1ZSJA 3T2NA 2W5EA 1J14A 3ZV9A 4FVBA 5JBBS 3ZZCA 1AHTH 1BTYA 1X7AC 3SNDA 2ZHDA 2XOKD 2FTLE 2O9QA 5CHAC 4UDWH 4BNRA 1J8AA 1BT7A 1MKXH 2G5NA 3LJOA 1HAVB 4U2WA 2RCEA 3D23A 3HGNA 4F55A 3RLYH 3D65E 4NIVA 2VNTA 1P2MA 3AK5A 1SI5H 5AF9H 3PWBA 1G37A 1WSSH 5ETXA 1GJBB 1GVLA 1Z1JA 2ANKH 3K6ZA 5EXLA 4CBOA 3BG4C 1OS8A 3A84A 4ZHLU 1O5GH 1QBOA 2BLOA 2ZDVH 4RI0A 1O3KA 4U32A 4K69A 1DX5M 4Y0ZE 6GCHF 2H1UA 4WXIA 2JDID 4FUBA 3DFLA 3QZQA 2FM2A 1V2LT 5F53A 1YY3A 3ZVDA 3KL6A 1ETRH 3BEFB 5ESBA 1XM1A 5DKMA 2RDEA 3U9AH 3A87A 3TLOA 3HK6B 4BAOB 1EAUA 3W94A 3F2GA 2ZPRA 2ZDKA 3SUFA 4KKDA 1W2KH 5C0TA 3U28C 1EJMA 1UVSH 2ZGJA 2QF5A 1EB2A 1ABIH 1RGQA 2FS8A 3G01A 3DSGA 2KCPA 4ASUD 5I46H 2P93A 2ZDNA 3VEQB 3SUEA 2FX6A 2OC1A 3RXBA 1CA8B 4U01A 5B6LA 2PTCE 3PRDA 4TY6A 1SLVB 1NTPA 1KXAA 2ZTYA 2W7SA 2BD2A 5EJLA 1XXDA 1AFQB 1DY9A 2PUXB 1UTPA 1P3EA 1YWUA 4INKA 1QL9A 5K7RA 4DVAU 1GI1A 1KXFA 2M5TA 3OY5U 1UO6A 2QA9E 3TH4H 4Y7AA 2XNIA 2GKVE 4YOIA 1FJSA 1Z1IA 5HGGA 3UPEA 3V0XA 2VIOA 2K8IA 2XCFA 3K65B 1KXBA 3RXIA 2OQ5A 1RTFB 1E38B 1TA2A 3HGPA 4YT6H 1KTSB 1THSH 2QAAA 1VCWA 3QDZB 4O03A 1GCDA 2F43B 2ZU2A 3LJJA 1ZSKA 1DY8A 2VGCC 1FN8A 2W7UA 1AMHA 3LGTA 3PM3A 4DGJA 4MPWA 1SQTA 3GY5A 2R3YA 2A2QH 2PKAA 1F5RA 4MTBA 3SU0A 1Q31A 1ZHMA 4TPIZ 3JZ2B 4I8KA 5F8ZA 1O36A 1TNIA 1D4PB 4YESB 3SNEA 2BY9X 2RA0A 1T8NA 1O2XA 1EPTA 5FPSA 3S9BA 1IQJA 3ODFA 1GI4A 3SGBE 4I33A 4KTCA 2FWWA 3ZZBA 5A0BA 1A46H 1HJ9A 6LPRA 3A81A 1TPAE 1WTHD 1SGFG 2OP9A 3ZZ5A 1G3BA 1EJNA 4M9FA 8GCHG 5FBIA 3UQVA 2KAIA 1ABJH 3E0NB 3SUGA 3W95A 1CVWH 3QLPH 2SGQE 1NC6A 5GCHF 3ATKA 3A7ZA 4AC9A 4A92A 2WV4A 3A7VA 4NFFA 3TNTA 3BTGE 5AVDA 4AB8A 3E16B 1C2IA 2NU0E 2ZDLA 1L1NA 1CT2E 2LNCA 2ZDAH 1PYTC 1IQKA 2WPJS 1DSUA 4JYVH 3RXJA 3S7KB 1ELBA 1JIRA 1Y3YA 2TGTA 3BG8A 2OCVB 5HIYA 1O3HA 3I29A 1ANDA 3FN8A 3U1IB 3TGKE 1WUNH 1P02A 3T27A 2B7DH 2YNAA 3ATIA 1GBLA 1C5QA 1O3NA 4WF8A 3BTQE 4JZDH 1LQDB 4IW4E 2YMSC 2R9PA 4NA9H 1P2QA 1P9UA 1J16A 1O33A 3GY6A 2VIQA 3FFGA 2UUJB 2ZNKH 1TQ0B 3PMJA 5DK1A 4CREA 1XUJA 4Y8ZA 1O39A 1PQ7A 2FS9A 2IPQX 1TBQH 1BJUA 1G32B 1HNEE 2K0QA 5HM9A 1LPGB 1BMMH 1SGIB 3M3TA 1M9UA 3NZIA 1YCPK 3DT0H 2R2WU 3F1SB 1RFNA 3GYLB 5E0GA 5EQSA 1DPOA 2A4OA 1P04A 4GCHF 5DP5A 3OFND 1IQNA 2O8UA 4XOJA 3A7WA 1TPSA 1ETSH 4ZKNU 3E91A 3GY3A 4UD9H 1AD8H 1FPCH 1TBZH 1BMFD 4JYUH 1SGDE 2XC5A 4H4FA 1C2GA 2P3FH 1BBRK 3I77A 1T4UH 1Y3WA 1PPGE 1GBMA 3KQBA 2GZ8A 1OWHA 1NRPH 2ZWLH 1SGCA 2D1JA 1C5YB 1DXWA 2OQUA 1WQVH 5GWZA 1AVWA 3ZZ8A 1H1BA 3MNSA 2PWXA 3AW1A 4AFZA 1BRCE 1FY8E 1TGSZ 4RKJB 4Y8YA 4CR5A 1K1NA 2XXLA 2CN0H 2Z94A 1O3IA 2C8YB 1QIXB 1QHRB 1TQ7B 4DURA 4K5ZA 1F7ZA 2PTNA 1V2ST 2A2XH 3C1KA 3E6PH 3LH3A 1O3LA 5JBAS 3F9HA 1BDAA 1C1NA 4ZXXH 5A09A 1MKWH 2EY4C 1A5HA 3AAVA 2XBYA 1BCUH 1XUFA 1EQ9A 1LCYA 1BMLA 1V6DA 5DJ7A 4A5TS 1UCYH 3UTUH 2Q6FA 3SU6A 2BLWA 1C1PA 2GGVB 1HV7A 4IMQA 1GGDC 3SBKA 3F3BA 2WPIS 1K9OE 4ZAEA 4ZMAH 4JZEH 2UWPA 3RXMA 1MTVA 3A83A 2V3MA 3UWIA 1JIMA 1FV9A 1HXFH 2RA3A 4MNWA 3MU8A 1TMBH 4JZ1A 1IQGA 1FAKH 1GJ6A 2ALVA 1XUGA 3MU0A 1T8MA 1P03A 3BTDE 2BX3A 1P9SA 1MD8A 1XX9A 2IPHA 3ZZ3A 4DY7B 3KYGA 1P01A 2FOFA 1GI0A 2C8XB 3VB6A 1H9LB 1LVYA 1SQAA 3MNXA 2ZG0H 3N7DA 4AOQA 1FX0B 5ESTE 1SG8B 4GPGA 1UTQA 1F2SE 3RXLA 1TNGA 6CHAC 3OSYA 2VB0A 1SVPA 1AFEH 2A45B 3ZV8A 3SNBA 1AQ7A 1PPZA 1OKXA 1A3EH 1BHXF 4O9VA 2W3KA 1OOKB 2AGGX 1C5VA 1LDTT 4CHAB 1UK4A 2TGAA 3ELAH 5FCKA 1DWBH 1GBAA 2VWMA 9ESTA 1O0DH 2G00A 3UB0A 3UUZA 2AGIX 1C5SA 5DP7A 6GCHG 1GMCF 3F0PA 4JZFH 1O37A 1TX7A 2BD3A 2DE9A 1C2DA 2H9TH 1NFXA 3Q3YA 1YPMH 1UMAH 1FI8A 2GMTC 2QC2A 4MLFB 1ELEE 4FU7A 1MBQA 4Z6AH 4KGAA 2W6ID 3H5CB 2QY0B 2ZGHA 1O2ZA 5SGAE 3RC5A 1KXCA 1O3BA 4DT7B 1LHFH 1MAYA 3BF6H 4ESTE 4JZIA 1IQFA 1K1OA 1UCYE 1P2IA 1SC8U 2KM0A 2XRCA 2XWAA 4XBCA 2A31A 1D3DB 4FUGA 3EE7A 2Y80A 1D3PB 3JZ1B 3MO9A 3DHKH 4Y0YE 4D8NA 1E35B 1HJ8A 1ZPZA 1K1LA 1OWIA 3FP6E 1AIXH 4I32A 3MU5A 1THRH 2J95A 9LPRA 2B0FA 2FOMB 1CU1A 1ZJKA 1H9IE 3EA7A 1MTUA 2VH0A 1EOJA 3KQCA 1Q3XA 1V3XA 2FEQH 1HAXB 3BSQA 5FXLA 3S9CA 3GOVB 1O3EA 1HRTH 1P3CA 3RMOH 2CMYA 2PFEA 3DUXH 3MNBA 1TE0A 3PLBA 1O3JA 5GNDA 1CE5A 1YLCA 4XFQA 4X6PA 3LC5A 5C1UA 2Z3DA 4UFGH 1K28D 1EXFA 4Y76A 1V2OT 2XC4A 2ZU5A 2FYRA 1GBIA 4KTUA 2PKAB 3HPTB 1ELGA 2ZFPH 3ZZ4A 4YXWD 3GCNA 1C2LA 1CA0B 4IGDA 3RXVA 1IHSH 2BM2A 1C1VH 4ABEA 2STAE 2UWOA 2ZHWH 3Q3KA 3RM0H 5HXFA 4Q80A 3SI3H 3RXGA 3KNXA 2IJD1 4GHQA 1EP5A 2ODYB 1O2GH 4AYVB 4X1PU 1CBWC 1SHYA 2A4QA 1EPTB 1SGTA 4X1QU 3SV7A 1YPGH 1ZJDA 3DFJA 3I78A 2BTCE 1RXPA 4TSFD 1KIGH 2BLQA 4BTUB 1Z7KA 2TGPZ 3VGCB 2J5UA 1OX1A 1SOTA 1Y8TA 3ESTA 5GCHG 2D8WA 3RXUA 4BXWA 1COWD 2AS9A 4OGXA 4OS6A 1YC0A 4Y71A 1ZLRA 2EI8A 4Y79A 3ZVCA 5A8YA 4I8LA 4K1EA 3UR6A 3NK8A 4JMYA 1JOUB 1JMOH 1BTWA 2O8LA 1BUIA 4LXBH 3SQEE 1RS0A 3SJ8A 4CH8B 5BPEA 2I6SA 1QRWA 4DW2U 1FONA 5TJXA 2A4RA 2ZC9H 1FDPA 2H9HA 5TCAA 2UWLA 4I31A 3SV9A 1S6LA 1P2JA 2BB4A 5HIZA 2GCHF 1AUJA 1ANBA 2ZCLP 1NU7B 1QNJA 4XBDA 3SN8A 3ZVFA 4U30A 4E7RG 4B75A 2JETC 1RTKA 2OLGA 4Q2KA 5EQQA 2QCYA 3MHWU 2HLDD 5JB8S 1V2UT 1W8BH 1JXPA 1GDQA 4Y11E 1BHXB 5LH8A 1DDJA 2G8TA 1AZZA 4XD7D 3GCHB 1N8OC 1S85A 1YYY1 2ZU4A 3A82A 4I86A 5DPAA 3VXFH 1KY9A 1QB1A 2CF8H 1PPHE 3KCGH 1E36B 4GCHG 1O3AA 4SGBE 1AWHB 2I6QA 4YOJA 1SFQB 1GBHA 5DP9A 2F9VA 3P8OA 1C2MA 2BDCA 3MO6A 3SU1A 1P12E 2BD9A 4VGCC 2JJ2D 3ZVBA 1CSOE 1GJ4H 5J4SA 1YCPM 2XW9A 1VCQA 4AZ2B 2BHGA 1Y5UT 3B9FH 3GDSA 5FAHA 1XMNB 2ANYA 5EPYA 1DWCH 1AY6H 4K1TA 1OWEA 1GJ8B 1SHHB 2A7CA 4UEHH 1QB9A 4Y8XA 4Q7YA 4NCYA 3F6UH 1UTJA 1HAGE 3AASA 1P09A 3F2FA 2KCAA 1GI3A 1BJVA 3EA9A 2Z9KA 1NPMA 4WH6A 2G55A 1LVMA 3PYHA 2WINI 3A88A 3SZNA 1PJPA 3T29A 8ESTE 1O5EH 2BOHB 1EX3A 3BEUA 1HBTH 5DP4A 2W3IA 1OWDA 3M61U 3SUDA 2CHAB 1WOFA 4H6SB 1IAUA 1NT1A 1VR1H 2WHXA 3Q3XA 1TRYA 6ESTA 4I8GA 5L6NH 4CHAC 4Q63A 3RXTA 3URDA 1GDUA 3QTOH 3RXQA 1MTNB 4INLA 3TK5A 5DO4H 3RU4E 2BDYA 1C5PA 1UW7A 5DP6A 2BZAA 1TPOA 2SGEE 1MU8B 1VITF 2BDBA 3E1XB 2FOHA 1V2MT 2GT8A 1NBME 5J4QA 2BZ6H 2OD3B 3RUOA 1VJAU 3RU4D 1O2SA 2GJGA 3VB7A 1TGBA 2BD5A 1ID5H 4BAMB 4CH2B 1UJ1A 1IQIA 4ABDA 4CRDA 1O2JA 2PW8H 4TWYA 1TOMH 1MTWA 4OS5A 1C5LH 4B2BA 1NBMD 1V2TT 1QY6A 2Z7FE 3BTFE 1TPPA 1AI8H 1SGPE 1YPHE 3PROA 2GCTB 1SGYE 3OEED 1WDIA 2TGDA 3PV4A 3GCTF 1O3GA 2GDEH 3AVZA 1GBCA 2R3UA 3KEEA 3GY2A 4PROA 5CE1A 4FU9A 4Q4LA 4MPVA 3NCLA 2BDIA 3MWIU 4WVPE 1Z8JB 1ZHPA 5E0HA 1P10A 1GG6C 4YZUA 1BRUP 4B6FA 4D7FA 3KGPA 4AFSA 4WY3A 5LPFA 3BIUH 3PO1C 1FIWA 2ZTXA 2J94A 4DIHH 1SR5C 1INCA 3KHVA 1MCVA 1TAWA 2OUAA 3EA8A 2STBE 5EXMA 3SGQE 1IQHA 3FZZA 3N7EA 1V2PT 4AX9H 1GMCG 1K1JA 2Z9LA 1YPEH 1OHHD 2WPHS 1J9CH 2QN5T 3TJUA 1VGCB 4A6LA 3L3TA 4HZHA 1NRQH 5A8XA 5IYTA 1ESAA 1OP8A 1AN1E 1EZUC 4NIXA 4A1XA 4CRCA 1LKAA 1AE8H 1EUFA 1F5LA 1KLJH 1Z71A 5L30H 2VIPA 3FANA 1TFXA 4YM9A 4YLUA 3VFEA 2ZGBH 3P8NA 1AO5A 2QIQA 2O8WA 4FXGH 3DD2H 1E1QD 1O2UA 3LONA 2GDDA 2ZTZA 5CMXH 2VVUA 1JRTA 4X8TH 2BXUH 3SU5A 3ATMA 1DFPA 1HLTH 4RT1A 1UTMA 3A8CA 3OY6U 2ZPQA 1B0FA 3M7QA 1WTGH 4IN2A 1P06A 2BD8A 3BTKE 4LK4A 4IBLH 4Q7XA 3SQHE 1SGRE 1T32A 2ZKSA 1P2OA 1D6RA 1UTLM 2VINA 2AMPA 2PSXA 2FOCA 2PKSB 1NESE 2VU8E 3TNSA 1QA0A 5DG6A 3STJA 3H7TA 1ZYOA 1PPBH 2Y6TA 4KP0A 3T25A 3D62A 1TA6A 2PV9B 3OX7U 3HKJB 3TGJE 4D76A 4OS4A 1AKSB 1J17T 1ZPBA 2Y7ZA 2OTVA 1EOLA 1BRAA 2Y5HA 3N99A 4J2YB 3A80A 1GWAA 1O2NA 1W13U 5KGOA 4WH8A 4WWYA 2ZHQH 3F0OA 1EATA 4YLQH 2HNTC 2BY5X 1C1QA 3OEHD 1YGCH 2GZ9A 1T31A 5F8TA 1QA7A 1GBFA 4FUIA 4R0IA 1IQMA 2ZO3H 2QF0A 4B2CA 1V2KT 2Q6DA 3S7HB 4CRGA 1DWEH 1U6QA 1ZZZA 3LC3A 4GHTA 3RP2A 3GY8A 3RXDA 3NPSA 1LQEA 3A7XA 3RXPA 3KIDU 1SLUB 1E1RD 4KELA 2V3OH 1TX6A 2PLXA 2FOBA 1G3DA 1A7SA 4X2XA 1LPZB 2F83A 1MAXA 1WBGB 3E90B 3ZYEA 3SU2A 2BQWB 2J34A 4MQAA 4AG2A 4IN1A 3PMHB 3SYJA 2BX4A 1AB9C 3F9GA 1WAYB 3UREA 1OP2A 1QQ4A 4HG6A 2H9EH 3A8DA 1O2VA 3O8BA 5EODA 1TGCA 1C1UH 5T1VA 1QTFA 2WPDD 2VH6A 2GCHG 3ATLA 2ZA5A 1O38A 5JBTA 3TIUA 3NXPA 4NSYA 2A5KA 1O5CB 2FO9A 3M37A 1V2RT 4SGAE 1ELTA 1P8VC 1BQYA 1CHGA 3W1EA 3MU1A 2AHME 2GD4B 3SV6A 2PR3A 4BAHB 1GHAF 2O8TA 1LPKB 2CV3A 1GJ7B 1KXEA 1SGQE 2CHAC 3MH5A 1SGNE 3RXKA 4BXSA 2BDAA 3MTYA 1GBJA 3CENA 2H5DA 2ZF0H 3L6PA 3KQDA 1C1TA 5HMAA 5FL7D 3QUMP 1NN6A 5GIBA 1QL8A 4AGJA 4ZUHA 1O5AB 2VBCA 4H42U 4NGAH 1SKYE 1GI2A 1NFWA 2R2MB 2FXRA 1QBNA 1O3PB 3SW2B 1D3TB 5TCCA 1V2QT 4X8SH 3TK9A 1XUKA 1CHOG 4MVNA 2AFQB 5C2ZA 1EAWA 1PYTD 3NKKA 3H7OA 2G52A 3OYPA 2UUYA 3HATH 4B6EA 1G30B 4E06H 1C5OH 1HUTH 1EAIA 8KME2 1TONA 2AMQA 2PHBA 1YP9A 2G4TA 2F91A 3M7UA 2ZHEH 1MABB 2J38A 2RFKC 2R0LA 3UOUA 2ZGXH 3CP7A 2Y7XA 3EE0B 3TH3H 5EIYA 2FLBH 2Z3CA 4UONA 1NRNH 1FY1A 1Y3UA 1KSNA 2YMSD 5T6FA 3WWBA 3U98H 3SOSA 3RMNH 1HAHH 2BDGA 4X1RU 1ELAA 1S82A 1AFQC 3ZVEA 1V2NT 1XUIA 3DSOA 4O3UA 1HIAB 3RXAA 3SV2H 1D9IA 1P05A 3GDUA 1XKAC 3ZZ9A 1VZQH 1K2I1 1ANCA 3OU0A 4XRNA 3MOCA 1ZTKA 1K1PA 3LU9B 4FU8A 3LH1A 3M5LA 5CHAB 1VITG 3BTTE 2G81E 2OBOA 1FNIA 1YLDA 1ZOMA 5C5NA 3ENSB 1C5TA 1YBWA 1HDTH 1L4DA 3RXRA 1O2KA 4Z1MD 3FAOA 2HPPH 3EAJA 4ABFA 4K1SA 4B73A 3LDXH 3Q76A 4OM9A 1QFKH 1LO6A 3TJOA 1DLEA 1BB0B 3UNRA 1A0HB 5JB9S 3SU3A 1NFUA 1ELDE 1W12U 2KCYA 1MQ6A 4ISIH 5AFZH 1O2OA 4ISHH 5EG4A 1MZAA 2B8OH 5E2PA 4CRFA 5C1XA 5C3NA 1NO9H 3GCTG 3TITA 4AORA 4ZHAA 2OBQA 4X2YA 1XKBC 2SGPE 1GJAB 4NZLA 1RD3B 5F03A 1EJAA 2C8ZB 1C1OA 3SHCH 1OWKA 1CGHA 1FUJA 2BY6X 4XE4A 3HKIB 2SGDE 2P8OB 2TRMA 2Y5FA 1HGTH 5AFYH 1TMUH 4Y7BA 1CT4E 4UE7H 1B0EA 1DXPA 3SORA 3Q77A 5G4BA 3NRLA 1EZSC 1GVKB 1BITA 4NWKA 1MMJN 5EGMA 3LIWA 2LP6A 4YOGA 1DLKB 1AKSA 1PFXC 5HYOA 3K2UA 4BTTB 2ZQ1A 1N1LA 1TABE 1Z8GA 1WXRA 4BTIB 5GJ4B 5E8EH 2PGQB 1FY5A 1A5GH 5AHGH 3RXHA 4TT3D 1HJAB 3A86A 2OK5A 3LT3A 4KTSA 5EW1H 2C93B 3RXOA 1LVOA 2Q1JA 2ZFRH 1Y5BT 2P94A 4K8BA 1GI9B 1TBRH 2FI5E 1G3CA 1SMFE 2SGAA 2FESH 3OE7D 1A3BH 1GBTA 3F9FA 1P2KA 1P57B 2VGCB 2OC8A 4ABIA 5C20A 3EYDA 3A8AA 3PV2A 2F9OA 1CQQA 4IS5A 3M5OA 3P8GA 1MQ5A 4UFFH 3FZDA 3EDXB 5T6GA 2ESTE 1XXFA 2WUCA 1O30A 1SFIA 1O3MA 3E0PB 5I25A 1C5WB 1GMHF 2WV9A 1VITH 2LPRA 2ZEBA 2P95A 4LOYH 4AFUA 2FTMA 1RIWB 3SGAE 3LGVA 1H9HE 2ODPA 2FX4A 1YPKH 1LHDH 1GI5A 3S0NA 1ZMNA 1SLXB 3MQKC 1O3DA 1BA8B 3P17H 4OS2A 2ZQ2A 1O3CA 3P95A 2AH4X 4RT0A 1GHBF 2GP9B 1AVXA 1BTPA 2TPIZ 2WPMS 2ZFQH 4ZKRU 3RU4T 1RTLA 1ZRKA 1UTNA 1T8OA 4FVDA 2AERH 4B74A 1OYTH 2V3HH 3NWUA 3VXEH 3QGJA 1TNKA 1HB0B 1BTHH 1ZSLA 2VWNA 3MH6A 2FMJA 2A32A 4JK6A 4NSVA 4CRAA 5DN6D 1ZTJA 2A0QB 1ZHRA 4D9RA 5GXPA 4JYTA 2G5VA 5EPNA 2JJ1D 2VWLA 1S0QA 1O35A 4O3TA 1HYLA 4HI3A 2ZIQH 1GI7B 3F68H 2Y5GA 4X0WU 2NU2E 1W0JD 2Q6GA 3MYWA 1C5NH 3GY4A 4NIWA 5FBEA 4LZ4B 4ZH8A 3AW0A 2QXJA 5EU8A 1SSXA 2VVVA 4AN7A 3SNCA 3FP8E 3P92A 4ZHMU 4FUDA 3RDZA 1ZMLA 4DJZB 2GZ7A 2OINA 2YMSB 7LPRA 1W0ZU 1LKBA 1G9IE 1NS3A 1VJ9U 2FDAA 2FYQA 4OS7A 3U8OH 1QRZA 2HRVA 1K1IA 2V6NA 4XDEA 1HAZB 5EJZA 3RC4A 1TALA 1UVUH 3LOXA 1GVZA 1P0SH 2ZZUH 2ZU1A 3E3TA 3WY8A 1PQAA 2ANWA 4WMEA 2J2UA 1E34B 1YKTA 3E8LA 1KYNA 1MH0A 1CHOF 1TLDA 1A5IA 3ZZDA 2HALA 1C5XB 4K3JA 1IQEA 2BYAX 1AE5A 2RG3A 4K60A 1OYQA 3TJVA 1KLIH 2XBVA 4IMZA 1DUEA 1QZ8A 1PPEE 1ELCA 3SU4A 4X6NA 1K0HA 1GHXH 5HKKD 1AU8A 1SOZA 2P16A 5F8XA 1GHAG 1GBBA 3VG8A 2Z9JA 5EQRA 5E2OA 4B71A 3STIA 1G2LA 2DUCA 5BRRE 4H6TA 2EEKA 3ZIAD 2ULLA 2KX4A 1L4ZA 5B6OA 3LGUA 3NUMA 3ITIA 1HIAA 1HAYB 3A8BA 4P00A 3N7OA 1K22H 4DOQA 1GPZA 2WPKS 3SJ9A 2EI6A 3QK1A 4A1VA 1E79D 1W11U 1WU1A 4GAWA 4I8JA 1MZDA 1SGEE 2WYGA 1BTUA 1O5BB 4QT8C 2JKHA 1O5DH 2ZHFH 5KEDA 3MNCA 1GBEA 1C4Y2 1IOEA 1L0ZA 3BV9B 3UOPA 2HVYB 2UUFB 1H8DH 2XC0A 4RKOB 1QL7A 3K6YA 3BEIB 1OWJA 1WV7H 2KFWA 1KLTA 4ISNA 5CDFE 1SBWA 1GGDB 3VB3A 1TMTH 3CS7A 1VKYA 2ZU3A 2FOEA 2ZFTA 1E37B 1LHGH 3UNSA 4AGKA 4DIIH 1KDQB 2WZQA 3ZVGA 1YF4A 1P11E 3VB5A 2AMDA 3RXFA 1NM6A 1A1RA 1GCTB 1N6XA 1TNJA 2BMGB 1FAXA 1C2FA 1FIZA 3UY9A 2A1DB 2BD7A 8LPRA 2IN2A 1S83A 4ZKOU 3GYMA 3RXCA 1AGJA 1GI8B 2GT7A 1MD7A 4TPYA 2A4GA 1LHEH 1O2WA 1ARCA 1Y3VA 1C5RA 1D3QB 3BIVH 3PMAB 1QJ1B 1UK3A 2P8OC 4ABAA 1FY4A 1SB1H 3U8RH 3O8CA 1ZPCA 2YOLA 3TU7H 3F9EA 5EOKA 1EKBB 1GJ5H 2V0BA 1HAPH 1PPFE 1DE7H 1G36A 2EA3A 2VVCA 2VIWA 1LTOA 1S6HA 1GHZA 1EFRD 2CK3D 6CHAB 2QF4A 2O8MA 4Z0KA 5GDSH 3A7YA 3ATWA 4CRBA 1UTKA 2IOTA 4YO9A 2XYAA 3IG6B 2XTTB 1C4V2 1HPGA 1W14U 3OTJE 2ZDMA 2A5AA 4HTCH 4M7GA 1O2PA 1HJAC 1GI6A 3FKSD 1V2WT 4WMDA 4E05H 2PSYA 4YTAA 5GPIB 2KR7A 1IHTH 2C8WB 2BVSH 1QJ7B 3T26A 1AVGH 1YCPH 3T62A 2L74A 1F0TA 4P02A 1CA0C 3WWFA 3UIRA 1NZQH 4DT4A 1ZMJA 3D49H 1MKXK 1QBVH 3QWCH 5LPRA 1O3FA 3MFJA 2GMTB 1EPTC 2L6OA 1O2QA 3MMGA 3B23B 3V3MA 1CO7E 3TH2H 4I8HA 1EP6A 4E7NA 1BBRH 1GJ9B 2Z6BD 1TWXB 1TNHA 3VGCC 1O2LA 1S84A 1UVOA 2BY8X 3BTWE 5LPEA 4THNH 1T8LA 5F6MA 1F5KU 1RIWC 1T4VH 1L1JA 2HLCA 4B1TA 1G2MA 1H8IH 5IDKA 5HM2A 2RDLA 2J92A 1DOJA 1A2CH 2QXGA 2Y81A 1K21H 1C5MD 2EC9H 3UQOA 5C17A 2J98A 2G51A 3F2HA 1MCTA 2SNVA 1S6FA 2A7HA 1BZXE 1ESBA 4GLYA 2XCNA 3TPIZ 1QR3E 3P8FA 1O2YA 4MNXA 2XWBI 1JWTA 1QGFA 4O97A 5C94A 4MNYA 5ABWA 2J97A 3VB4A 3QN7A 3PB1E 2A7JA 2V35A 2ANMH 4B2AA 3AAUA 1UVPA 1PQ8A 2XNDD 4Q7ZA 4JK5A 4UFEH 1TNLA 1F92A 1DITH 1OSSA 4ABGA 2FI3E 1GMDG 3UAIC 1YPLH 3B8JA 4YT7H 3IITA 1O2MA 3GCHC 3GCOA 3PLKA 1GMHG 2JIZD 3KN2A 1JRSA 2TIOA 1FLEE 2NWNA 2F9BH 2UUKB 2BLVA 2F4LA 7GCHF 4X2VA 4Y6DA 2J9NA 4Y10E 1CBWB 1TYNA 5L2YH 1DANH 1Z6EA 2C4FH 2FOGA 1S0RA 1GHBG 1HFDA 3VPKA 3S9AA 3S69A 3GS9A 3PWCA 2P3UB 2GX4A 1TOCB 3V13A 4BANB 5EJ1A 2GVFA 4WMFA 1C4U2 2PUQH 3CNRA 1DUAA 3M5NA 2CGAA 2VJ1A 2WSSD 1C1RA 1NY22 2SNWA 3PV5A 1NU9A 2ALPA 3V12A 5A0AE 1EB1H 1BBRE 1H8ED 2TBSA 5FHTA 1FXYA 1MU6B 2AYWA 1GBKA 1ELVA 1OXGA 1SLWB 4K8YA 3ZZ6A 4MNVA 4GVUA 2PP6A 2BY7X 1C2JA 5DSFA 4F4OC 2ILNA 1O32A 5E0JA 1AZ8A 1L2EA 3QO6A 4ISOA 1DVAH 4MPXA 3TJNA 1W10U 3UWJH 1BTXA 3RMLH 1UK2A 4D7GA 3GISB 1ZGVA 4F48B 2OC7A 4BAQB 4X8UH 1SGFA 2FOAA 2FPZA 2GV7A 4XSKU 2THFB 4OS1A 4NA7A 4MPUA 1DSTA 1S81A 2JETB 3A85A 3DSPA 1MTNC 3DA9B 3SO3A 2J4IA 1ARBA 2P3TB 2LELA 2XBXA 1HAVA 1EZXC 2FP7B 1TIOA 4LZ1H 4NIYA 5LGOA 1N8OB 2QF3A 4ASHA 1W0KD 1BMAA 1G3EA 1ELFA 1QURH 1K1MA 4GUXA 2HNTE 2Z9IA 4R8TB 3SZEA 2WYJA 5DP3A 1KDQA 1C9TA 5K0HA 1C5ZB 4RSPA 2ODQA 3IWMA 1A0LA 2R0KA 1UHBB 2C90B 2QV1A 1GL0E 2QYIA 3PLPA 4VGCB 1GCTC 2GCTC 1GL1A 4CBNA 1P2NA 4AB9A 4ABBA 1H4WA 2K1QA
chains in the Genus database with same CATH topology
3F2GA 3SU4A 1E1QD 3LONA 5T1VA 3M5LA 3SV8A 2WPDD 5HKKD 2KM0A 3SUFA 2OBOA 3H09A 2WV9A 2IJOB 2F4LA 3SU5A 2A4RA 3SU6A 5C0TA 2GGVB 3VG8A 3FKSD 5EQRA 5H4IB 2QF5A 4Z1MD 1RGQA 4I31A 5GPIB 2KR7A 4B71A 1S6LA 3F3BA 2KCPA 3FN8A 3U1IB 4ASUD 3SV9A 3ZIAD 3SUEA 3W1EA 4B73A 3RC6A 2OC1A 2AHME 3GS9A 3SV6A 3FOAA 4OM9A 4U01A 3LKWA 5B6LA 1NBME 3WWFA 2GVFA 3PRDA 4WF8A 4DT4A 4A1VA 3SU3A 4B75A 3U1JB 2KCYA 1DY9A 4I32A 3M5NA 1E79D 3PRBA 2WSSD 4FETA 5EQQA 2YMSC 2HLDD 2KCOA 2L6OA 3PV5A 1JXPA 2FOMB 1CU1A 1RTLA 3L6PA 1NBMD 1H8ED 2XNIA 3OTPA 4XD7D 5FL7D 3WW7A 4B74A 2OBQA 3KF2A 3O8RA 2OC0A 3OEED 4A1TA 5IK2D 2K8IA 3N99A 2VBCA 2XCFA 2K0QA 1SKYE 5C0UA 4WH8A 4B76A 2M2AA 3F0OA 5DSFA 3KEEA 5DN6D 4Q4LA 2F43B 2F9VA 2KFWA 1FX0B 3N7DA 3OEHD 3P8OA 5EPNA 2JJ1D 5GNDA 5IDKA 3OAAD 1DY8A 1H8HD 2P59A 5FPYA 5CDFE 2W6JD 5EQSA 3SU1A 3M5MA 1DXPA 3NRLA 2V7QD 3FO8D 3OFND 5C17A 2JJ2D 2OC7A 4B6FA 4NWKA 1W0JD 3F2HA 5FPTA 4YXWD 2WZQA 3OYPA 2XCNA 1BMFD 3SU0A 4B6EA 1A1RA 2XOKD 5EPYA 1N1LA 3DCLA 3KNXA 3DSPA 2IJD1 1WXRA 1BT7A 2OINA 1E1RD 2LELA 2YMSB 3N7EA 5GJ4B 1MABB 2A4QA 4ZCNA 1NS3A 5CHBA 5FPSA 3SV7A 2A4GA 2FP7B 4TT3D 2OK5A 4F55A 1DXWA 1OHHD 3RC4A 4I33A 4KTCA 3F2FA 3AK5A 3LOXA 4TSFD 2KCAA 3UB0A 2YMSD 3WWBA 1W0KD 5ETXA 2J5UA 4WH6A 3F0PA 4K8BA 2XNDD 3O8CA 4R8TB 3O8DA 3SZEA 2YOLA 1KMHB 4M9FA 4NWLA 3E90B 3OE7D 4TYDA 2QE7D 3DSOA 1COWD 4A1XA 4RI0A 3SU2A 2OC8A 3SUGA 2F9UA 2JDID 2W6ID 3EYDA 3PV2A 2KZ4A 1W3CA 3SYJA 1EFRD 3SUDA 2CK3D 2FM2A 3M5OA 2QV1A 4JMYA 2QF4A 5F53A 3RC5A 2JIZD 2O8MA 2WHXA 3KN2A 3P8NA 5ESBA 3O8BA 4A92A 2K1QA 4Q63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F53 A;  3WW7 A;  3WWB A;  3WWF A;  4ZCN A;  5CHB A; 
#chains in the Genus database with same CATH topology
 1TX8 A;  2D26 C;  3QGN B;  4K2Y A;  3LGW A;  1IQL A;  2IJO B;  2W26 A;  2HWL B;  1TRM A;  1Z8I B;  2G4U A;  1O34 A;  3T5F H;  3KYF A;  1V2J T;  1QRX A;  2BOK A;  5EW2 H;  4RN6 A;  4ABJ A;  2Z9G A;  5PTP A;  3UNQ A;  1NRO H;  1BOQ A;  3FOA A;  2HNT F;  5T6D A;  3RLW H;  1GBD A;  1C2H A;  2CF9 H;  3M3V A;  5JYI A;  1A4W H;  1O2T A;  1W7X H;  4WXV A;  2BXT H;  1ZR0 A;  1QJ6 B;  1O2R A;  4AFQ A;  1WCZ A;  2NU3 E;  1GHW H;  2ASU B;  1UVT H;  2BVR H;  2OXS A;  2VIV A;  1EZQ A;  2QGR A;  2AEI H;  3R3G B;  2AIQ A;  1EAS A;  2CXV A;  1CGJ E;  4CR9 A;  1SPJ A;  3ZZA A;  3MH4 A;  2OC0 A;  3O8R A;  3RMM H;  1QQU A;  1VGC C;  1E0F D;  3FP7 E;  2D2D A;  2JH5 D;  4TY7 A;  1AUT C;  3M7T A;  2C3S A;  3SJO A;  3OAA D;  1H8H D;  1L1G A;  1NFY A;  5FPY A;  1F0U A;  1YLN A;  3SJK A;  4AG1 A;  2ZP0 H;  3BG4 B;  1W0Y H;  1MKW K;  1BRB E;  1O5F H;  4GSO A;  4X8V H;  1B5G H;  1RRK A;  1O2H A;  1UCY K;  2HVX A;  5DP8 A;  3DCL A;  4JCN A;  1BMN H;  2BDH A;  4ISL A;  4D9Q A;  2ZGC A;  4ZCN A;  3LGY A;  5CHB A;  1Z6J H;  1ZGI A;  1RJX B;  2A5I A;  1HXE H;  3C27 B;  4F49 A;  1GDN A;  2SFA A;  3PTN A;  1GHV H;  1TGT A;  1BIO A;  3K9X B;  5A8Z A;  1FY3 A;  3RXE A;  2PKS C;  3TGI E;  3BN9 A;  3RM2 H;  1PQ5 A;  1A0J A;  1KMH B;  1GJD B;  1DWD H;  1J15 A;  1N6Y A;  4TYD A;  2ZPS A;  3ZVA A;  1Y5A T;  3LPR A;  4FOU C;  3U8T H;  3P70 B;  1MTS A;  4BOH A;  8GCH F;  1XVO A;  1W3C A;  1BTZ A;  1DS2 E;  1GG6 B;  3QX5 H;  4UFD H;  3TVJ B;  1ETT H;  3KQ5 A;  4FUF A;  3PO1 B;  1C2K A;  2VID A;  4X1N U;  4DG4 A;  2BD4 A;  3SV8 A;  3V7T A;  3PTB A;  3H09 A;  1DIC A;  1EST A;  3UR9 A;  1YPJ H;  1T7C A;  5H4I B;  1QCP A;  3QTV H;  1Y59 T;  2BVX H;  1UTO A;  1OPH B;  3MU4 A;  3RC6 A;  3EGK H;  3Q00 A;  3R0F A;  2WUB A;  4OGY A;  1LVB A;  2WPL S;  1TRN A;  2FI4 E;  1EAX A;  1O2I A;  3U1J B;  1GMD F;  1DM4 B;  1Q2W A;  1B7X B;  2B9L A;  2VWO A;  3M35 A;  2NU1 E;  7EST E;  1SQO A;  4FET A;  3T28 A;  1LMW B;  1YM0 A;  1HAI H;  2DE8 A;  1MUE B;  3OTP A;  2F9N A;  1LHC H;  1QB6 A;  3L33 A;  4X2W A;  3MO3 A;  1MBM A;  1FN6 A;  1KTT B;  4ACB A;  2ZI2 H;  1C2E A;  3GIC B;  1A61 H;  3ZZ7 A;  2XBW A;  4X6O A;  1O3O A;  1NRR H;  5C0U A;  3SNA A;  2M2A A;  4XBB A;  2H2Z A;  4MG3 A;  3MH7 A;  1ZRB A;  4HFP B;  2H6M A;  1NRS H;  2W6J D;  1V2V T;  1ACB E;  1JBU H;  4X6M A;  3M5M A;  5FX5 A;  1C1S A;  2V7Q D;  3FO8 D;  2J98 B;  5KEC A;  1SQR A;  2H5C A;  4DCD A;  1O31 A;  5FPT A;  2Y82 A;  3UFA A;  2BQ7 B;  2KAI B;  1C1M A;  3U69 H;  1VCP A;  1WQS A;  5T3H A;  4IC5 A;  3URC A;  2JH0 D;  4ABH A;  7KME H;  1XVM A;  1WYK A;  2FOD A;  2QXI A;  2SGF E;  4MDS A;  4A7I B;  3GDV A;  2B5T B;  1ORF A;  3KQE A;  1PPC E;  4ZKS U;  5C5O A;  2HPQ H;  2BQ6 B;  2ZCK P;  5L2Z H;  1AWF H;  1D6W A;  1CGI E;  5JBC S;  1F0R A;  1KXD A;  1ZTL A;  3SI4 H;  4INH A;  4TWW A;  4WJG 2;  4X1S U;  3RXS A;  2Z3E A;  2NU4 E;  1THP B;  3O8D A;  1FMG A;  4NWL A;  2EI7 A;  3SHA H;  3ODD A;  1HCG A;  2QE7 D;  3QZR A;  2AGE X;  1ANE A;  2F9U A;  4FUJ A;  2KZ4 A;  2PGB B;  3FVF B;  4I7Y H;  7GCH G;  3A89 A;  1FPH H;  1YPH C;  1HAO H;  3CS0 A;  5C67 A;  1F0S A;  4NA8 A;  3A7T A;  1TGN A;  4IC6 A;  4NZQ A;  1FQ3 A;  1Z8R A;  5DGJ A;  4ZRO A;  2FLR H;  2F9P A;  2FZZ A;  2GV6 A;  5EXN A;  2CJI A;  1UHB A;  3LKW A;  4J1Y A;  1SL3 A;  5FCR A;  1W7G H;  4FUH A;  4NFE A;  4ZXY H;  4FUC A;  4HGC A;  4ACA A;  1GHY H;  1C9P A;  3HK3 B;  4BAK B;  5JDU B;  5A2M H;  1S5S A;  1C1W H;  3PRB A;  1GJC B;  3LGI A;  2ZFS A;  5JPM H;  3BTE E;  2KCO A;  2YNB A;  2WV5 A;  3P6Z B;  1Y3X A;  3PMB B;  2EQN A;  3M36 A;  4FUE A;  3WW7 A;  2ZCH P;  4AYY B;  5A0C A;  2HOB A;  2FIR H;  1AB9 B;  1C5U A;  3M3S A;  3EQ0 H;  2ZEC A;  3KF2 A;  2ZFF H;  5IK2 D;  4A1T A;  3SJI A;  3GY7 A;  2GTB A;  2HGT H;  1XUH A;  3BTM E;  2JH6 D;  1TB6 H;  4B76 A;  2F3C E;  3MI4 A;  3BTH E;  1OP0 A;  2QXH A;  2P59 A;  1CT0 E;  1DT2 A;  4NG9 H;  2AIP A;  3TK6 A;  3ZYD A;  5FX6 A;  1FZZ A;  5C1Y A;  1ZSJ A;  3T2N A;  2W5E A;  1J14 A;  3ZV9 A;  4FVB A;  5JBB S;  3ZZC A;  1AHT H;  1BTY A;  1X7A C;  3SND A;  2ZHD A;  2XOK D;  2FTL E;  2O9Q A;  5CHA C;  4UDW H;  4BNR A;  1J8A A;  1BT7 A;  1MKX H;  2G5N A;  3LJO A;  1HAV B;  4U2W A;  2RCE A;  3D23 A;  3HGN A;  4F55 A;  3RLY H;  3D65 E;  4NIV A;  2VNT A;  1P2M A;  3AK5 A;  1SI5 H;  5AF9 H;  3PWB A;  1G37 A;  1WSS H;  5ETX A;  1GJB B;  1GVL A;  1Z1J A;  2ANK H;  3K6Z A;  5EXL A;  4CBO A;  3BG4 C;  1OS8 A;  3A84 A;  4ZHL U;  1O5G H;  1QBO A;  2BLO A;  2ZDV H;  4RI0 A;  1O3K A;  4U32 A;  4K69 A;  1DX5 M;  4Y0Z E;  6GCH F;  2H1U A;  4WXI A;  2JDI D;  4FUB A;  3DFL A;  3QZQ A;  2FM2 A;  1V2L T;  5F53 A;  1YY3 A;  3ZVD A;  3KL6 A;  1ETR H;  3BEF B;  5ESB A;  1XM1 A;  5DKM A;  2RDE A;  3U9A H;  3A87 A;  3TLO A;  3HK6 B;  4BAO B;  1EAU A;  3W94 A;  3F2G A;  2ZPR A;  2ZDK A;  3SUF A;  4KKD A;  1W2K H;  5C0T A;  3U28 C;  1EJM A;  1UVS H;  2ZGJ A;  2QF5 A;  1EB2 A;  1ABI H;  1RGQ A;  2FS8 A;  3G01 A;  3DSG A;  2KCP A;  4ASU D;  5I46 H;  2P93 A;  2ZDN A;  3VEQ B;  3SUE A;  2FX6 A;  2OC1 A;  3RXB A;  1CA8 B;  4U01 A;  5B6L A;  2PTC E;  3PRD A;  4TY6 A;  1SLV B;  1NTP A;  1KXA A;  2ZTY A;  2W7S A;  2BD2 A;  5EJL A;  1XXD A;  1AFQ B;  1DY9 A;  2PUX B;  1UTP A;  1P3E A;  1YWU A;  4INK A;  1QL9 A;  5K7R A;  4DVA U;  1GI1 A;  1KXF A;  2M5T A;  3OY5 U;  1UO6 A;  2QA9 E;  3TH4 H;  4Y7A A;  2XNI A;  2GKV E;  4YOI A;  1FJS A;  1Z1I A;  5HGG A;  3UPE A;  3V0X A;  2VIO A;  2K8I A;  2XCF A;  3K65 B;  1KXB A;  3RXI A;  2OQ5 A;  1RTF B;  1E38 B;  1TA2 A;  3HGP A;  4YT6 H;  1KTS B;  1THS H;  2QAA A;  1VCW A;  3QDZ B;  4O03 A;  1GCD A;  2F43 B;  2ZU2 A;  3LJJ A;  1ZSK A;  1DY8 A;  2VGC C;  1FN8 A;  2W7U A;  1AMH A;  3LGT A;  3PM3 A;  4DGJ A;  4MPW A;  1SQT A;  3GY5 A;  2R3Y A;  2A2Q H;  2PKA A;  1F5R A;  4MTB A;  3SU0 A;  1Q31 A;  1ZHM A;  4TPI Z;  3JZ2 B;  4I8K A;  5F8Z A;  1O36 A;  1TNI A;  1D4P B;  4YES B;  3SNE A;  2BY9 X;  2RA0 A;  1T8N A;  1O2X A;  1EPT A;  5FPS A;  3S9B A;  1IQJ A;  3ODF A;  1GI4 A;  3SGB E;  4I33 A;  4KTC A;  2FWW A;  3ZZB A;  5A0B A;  1A46 H;  1HJ9 A;  6LPR A;  3A81 A;  1TPA E;  1WTH D;  1SGF G;  2OP9 A;  3ZZ5 A;  1G3B A;  1EJN A;  4M9F A;  8GCH G;  5FBI A;  3UQV A;  2KAI A;  1ABJ H;  3E0N B;  3SUG A;  3W95 A;  1CVW H;  3QLP H;  2SGQ E;  1NC6 A;  5GCH F;  3ATK A;  3A7Z A;  4AC9 A;  4A92 A;  2WV4 A;  3A7V A;  4NFF A;  3TNT A;  3BTG E;  5AVD A;  4AB8 A;  3E16 B;  1C2I A;  2NU0 E;  2ZDL A;  1L1N A;  1CT2 E;  2LNC A;  2ZDA H;  1PYT C;  1IQK A;  2WPJ S;  1DSU A;  4JYV H;  3RXJ A;  3S7K B;  1ELB A;  1JIR A;  1Y3Y A;  2TGT A;  3BG8 A;  2OCV B;  5HIY A;  1O3H A;  3I29 A;  1AND A;  3FN8 A;  3U1I B;  3TGK E;  1WUN H;  1P02 A;  3T27 A;  2B7D H;  2YNA A;  3ATI A;  1GBL A;  1C5Q A;  1O3N A;  4WF8 A;  3BTQ E;  4JZD H;  1LQD B;  4IW4 E;  2YMS C;  2R9P A;  4NA9 H;  1P2Q A;  1P9U A;  1J16 A;  1O33 A;  3GY6 A;  2VIQ A;  3FFG A;  2UUJ B;  2ZNK H;  1TQ0 B;  3PMJ A;  5DK1 A;  4CRE A;  1XUJ A;  4Y8Z A;  1O39 A;  1PQ7 A;  2FS9 A;  2IPQ X;  1TBQ H;  1BJU A;  1G32 B;  1HNE E;  2K0Q A;  5HM9 A;  1LPG B;  1BMM H;  1SGI B;  3M3T A;  1M9U A;  3NZI A;  1YCP K;  3DT0 H;  2R2W U;  3F1S B;  1RFN A;  3GYL B;  5E0G A;  5EQS A;  1DPO A;  2A4O A;  1P04 A;  4GCH F;  5DP5 A;  3OFN D;  1IQN A;  2O8U A;  4XOJ A;  3A7W A;  1TPS A;  1ETS H;  4ZKN U;  3E91 A;  3GY3 A;  4UD9 H;  1AD8 H;  1FPC H;  1TBZ H;  1BMF D;  4JYU H;  1SGD E;  2XC5 A;  4H4F A;  1C2G A;  2P3F H;  1BBR K;  3I77 A;  1T4U H;  1Y3W A;  1PPG E;  1GBM A;  3KQB A;  2GZ8 A;  1OWH A;  1NRP H;  2ZWL H;  1SGC A;  2D1J A;  1C5Y B;  1DXW A;  2OQU A;  1WQV H;  5GWZ A;  1AVW A;  3ZZ8 A;  1H1B A;  3MNS A;  2PWX A;  3AW1 A;  4AFZ A;  1BRC E;  1FY8 E;  1TGS Z;  4RKJ B;  4Y8Y A;  4CR5 A;  1K1N A;  2XXL A;  2CN0 H;  2Z94 A;  1O3I A;  2C8Y B;  1QIX B;  1QHR B;  1TQ7 B;  4DUR A;  4K5Z A;  1F7Z A;  2PTN A;  1V2S T;  2A2X H;  3C1K A;  3E6P H;  3LH3 A;  1O3L A;  5JBA S;  3F9H A;  1BDA A;  1C1N A;  4ZXX H;  5A09 A;  1MKW H;  2EY4 C;  1A5H A;  3AAV A;  2XBY A;  1BCU H;  1XUF A;  1EQ9 A;  1LCY A;  1BML A;  1V6D A;  5DJ7 A;  4A5T S;  1UCY H;  3UTU H;  2Q6F A;  3SU6 A;  2BLW A;  1C1P A;  2GGV B;  1HV7 A;  4IMQ A;  1GGD C;  3SBK A;  3F3B A;  2WPI S;  1K9O E;  4ZAE A;  4ZMA H;  4JZE H;  2UWP A;  3RXM A;  1MTV A;  3A83 A;  2V3M A;  3UWI A;  1JIM A;  1FV9 A;  1HXF H;  2RA3 A;  4MNW A;  3MU8 A;  1TMB H;  4JZ1 A;  1IQG A;  1FAK H;  1GJ6 A;  2ALV A;  1XUG A;  3MU0 A;  1T8M A;  1P03 A;  3BTD E;  2BX3 A;  1P9S A;  1MD8 A;  1XX9 A;  2IPH A;  3ZZ3 A;  4DY7 B;  3KYG A;  1P01 A;  2FOF A;  1GI0 A;  2C8X B;  3VB6 A;  1H9L B;  1LVY A;  1SQA A;  3MNX A;  2ZG0 H;  3N7D A;  4AOQ A;  1FX0 B;  5EST E;  1SG8 B;  4GPG A;  1UTQ A;  1F2S E;  3RXL A;  1TNG A;  6CHA C;  3OSY A;  2VB0 A;  1SVP A;  1AFE H;  2A45 B;  3ZV8 A;  3SNB A;  1AQ7 A;  1PPZ A;  1OKX A;  1A3E H;  1BHX F;  4O9V A;  2W3K A;  1OOK B;  2AGG X;  1C5V A;  1LDT T;  4CHA B;  1UK4 A;  2TGA A;  3ELA H;  5FCK A;  1DWB H;  1GBA A;  2VWM A;  9EST A;  1O0D H;  2G00 A;  3UB0 A;  3UUZ A;  2AGI X;  1C5S A;  5DP7 A;  6GCH G;  1GMC F;  3F0P A;  4JZF H;  1O37 A;  1TX7 A;  2BD3 A;  2DE9 A;  1C2D A;  2H9T H;  1NFX A;  3Q3Y A;  1YPM H;  1UMA H;  1FI8 A;  2GMT C;  2QC2 A;  4MLF B;  1ELE E;  4FU7 A;  1MBQ A;  4Z6A H;  4KGA A;  2W6I D;  3H5C B;  2QY0 B;  2ZGH A;  1O2Z A;  5SGA E;  3RC5 A;  1KXC A;  1O3B A;  4DT7 B;  1LHF H;  1MAY A;  3BF6 H;  4EST E;  4JZI A;  1IQF A;  1K1O A;  1UCY E;  1P2I A;  1SC8 U;  2KM0 A;  2XRC A;  2XWA A;  4XBC A;  2A31 A;  1D3D B;  4FUG A;  3EE7 A;  2Y80 A;  1D3P B;  3JZ1 B;  3MO9 A;  3DHK H;  4Y0Y E;  4D8N A;  1E35 B;  1HJ8 A;  1ZPZ A;  1K1L A;  1OWI A;  3FP6 E;  1AIX H;  4I32 A;  3MU5 A;  1THR H;  2J95 A;  9LPR A;  2B0F A;  2FOM B;  1CU1 A;  1ZJK A;  1H9I E;  3EA7 A;  1MTU A;  2VH0 A;  1EOJ A;  3KQC A;  1Q3X A;  1V3X A;  2FEQ H;  1HAX B;  3BSQ A;  5FXL A;  3S9C A;  3GOV B;  1O3E A;  1HRT H;  1P3C A;  3RMO H;  2CMY A;  2PFE A;  3DUX H;  3MNB A;  1TE0 A;  3PLB A;  1O3J A;  5GND A;  1CE5 A;  1YLC A;  4XFQ A;  4X6P A;  3LC5 A;  5C1U A;  2Z3D A;  4UFG H;  1K28 D;  1EXF A;  4Y76 A;  1V2O T;  2XC4 A;  2ZU5 A;  2FYR A;  1GBI A;  4KTU A;  2PKA B;  3HPT B;  1ELG A;  2ZFP H;  3ZZ4 A;  4YXW D;  3GCN A;  1C2L A;  1CA0 B;  4IGD A;  3RXV A;  1IHS H;  2BM2 A;  1C1V H;  4ABE A;  2STA E;  2UWO A;  2ZHW H;  3Q3K A;  3RM0 H;  5HXF A;  4Q80 A;  3SI3 H;  3RXG A;  3KNX A;  2IJD 1;  4GHQ A;  1EP5 A;  2ODY B;  1O2G H;  4AYV B;  4X1P U;  1CBW C;  1SHY A;  2A4Q A;  1EPT B;  1SGT A;  4X1Q U;  3SV7 A;  1YPG H;  1ZJD A;  3DFJ A;  3I78 A;  2BTC E;  1RXP A;  4TSF D;  1KIG H;  2BLQ A;  4BTU B;  1Z7K A;  2TGP Z;  3VGC B;  2J5U A;  1OX1 A;  1SOT A;  1Y8T A;  3EST A;  5GCH G;  2D8W A;  3RXU A;  4BXW A;  1COW D;  2AS9 A;  4OGX A;  4OS6 A;  1YC0 A;  4Y71 A;  1ZLR A;  2EI8 A;  4Y79 A;  3ZVC A;  5A8Y A;  4I8L A;  4K1E A;  3UR6 A;  3NK8 A;  4JMY A;  1JOU B;  1JMO H;  1BTW A;  2O8L A;  1BUI A;  4LXB H;  3SQE E;  1RS0 A;  3SJ8 A;  4CH8 B;  5BPE A;  2I6S A;  1QRW A;  4DW2 U;  1FON A;  5TJX A;  2A4R A;  2ZC9 H;  1FDP A;  2H9H A;  5TCA A;  2UWL A;  4I31 A;  3SV9 A;  1S6L A;  1P2J A;  2BB4 A;  5HIZ A;  2GCH F;  1AUJ A;  1ANB A;  2ZCL P;  1NU7 B;  1QNJ A;  4XBD A;  3SN8 A;  3ZVF A;  4U30 A;  4E7R G;  4B75 A;  2JET C;  1RTK A;  2OLG A;  4Q2K A;  5EQQ A;  2QCY A;  3MHW U;  2HLD D;  5JB8 S;  1V2U T;  1W8B H;  1JXP A;  1GDQ A;  4Y11 E;  1BHX B;  5LH8 A;  1DDJ A;  2G8T A;  1AZZ A;  4XD7 D;  3GCH B;  1N8O C;  1S85 A;  1YYY 1;  2ZU4 A;  3A82 A;  4I86 A;  5DPA A;  3VXF H;  1KY9 A;  1QB1 A;  2CF8 H;  1PPH E;  3KCG H;  1E36 B;  4GCH G;  1O3A A;  4SGB E;  1AWH B;  2I6Q A;  4YOJ A;  1SFQ B;  1GBH A;  5DP9 A;  2F9V A;  3P8O A;  1C2M A;  2BDC A;  3MO6 A;  3SU1 A;  1P12 E;  2BD9 A;  4VGC C;  2JJ2 D;  3ZVB A;  1CSO E;  1GJ4 H;  5J4S A;  1YCP M;  2XW9 A;  1VCQ A;  4AZ2 B;  2BHG A;  1Y5U T;  3B9F H;  3GDS A;  5FAH A;  1XMN B;  2ANY A;  5EPY A;  1DWC H;  1AY6 H;  4K1T A;  1OWE A;  1GJ8 B;  1SHH B;  2A7C A;  4UEH H;  1QB9 A;  4Y8X A;  4Q7Y A;  4NCY A;  3F6U H;  1UTJ A;  1HAG E;  3AAS A;  1P09 A;  3F2F A;  2KCA A;  1GI3 A;  1BJV A;  3EA9 A;  2Z9K A;  1NPM A;  4WH6 A;  2G55 A;  1LVM A;  3PYH A;  2WIN I;  3A88 A;  3SZN A;  1PJP A;  3T29 A;  8EST E;  1O5E H;  2BOH B;  1EX3 A;  3BEU A;  1HBT H;  5DP4 A;  2W3I A;  1OWD A;  3M61 U;  3SUD A;  2CHA B;  1WOF A;  4H6S B;  1IAU A;  1NT1 A;  1VR1 H;  2WHX A;  3Q3X A;  1TRY A;  6EST A;  4I8G A;  5L6N H;  4CHA C;  4Q63 A;  3RXT A;  3URD A;  1GDU A;  3QTO H;  3RXQ A;  1MTN B;  4INL A;  3TK5 A;  5DO4 H;  3RU4 E;  2BDY A;  1C5P A;  1UW7 A;  5DP6 A;  2BZA A;  1TPO A;  2SGE E;  1MU8 B;  1VIT F;  2BDB A;  3E1X B;  2FOH A;  1V2M T;  2GT8 A;  1NBM E;  5J4Q A;  2BZ6 H;  2OD3 B;  3RUO A;  1VJA U;  3RU4 D;  1O2S A;  2GJG A;  3VB7 A;  1TGB A;  2BD5 A;  1ID5 H;  4BAM B;  4CH2 B;  1UJ1 A;  1IQI A;  4ABD A;  4CRD A;  1O2J A;  2PW8 H;  4TWY A;  1TOM H;  1MTW A;  4OS5 A;  1C5L H;  4B2B A;  1NBM D;  1V2T T;  1QY6 A;  2Z7F E;  3BTF E;  1TPP A;  1AI8 H;  1SGP E;  1YPH E;  3PRO A;  2GCT B;  1SGY E;  3OEE D;  1WDI A;  2TGD A;  3PV4 A;  3GCT F;  1O3G A;  2GDE H;  3AVZ A;  1GBC A;  2R3U A;  3KEE A;  3GY2 A;  4PRO A;  5CE1 A;  4FU9 A;  4Q4L A;  4MPV A;  3NCL A;  2BDI A;  3MWI U;  4WVP E;  1Z8J B;  1ZHP A;  5E0H A;  1P10 A;  1GG6 C;  4YZU A;  1BRU P;  4B6F A;  4D7F A;  3KGP A;  4AFS A;  4WY3 A;  5LPF A;  3BIU H;  3PO1 C;  1FIW A;  2ZTX A;  2J94 A;  4DIH H;  1SR5 C;  1INC A;  3KHV A;  1MCV A;  1TAW A;  2OUA A;  3EA8 A;  2STB E;  5EXM A;  3SGQ E;  1IQH A;  3FZZ A;  3N7E A;  1V2P T;  4AX9 H;  1GMC G;  1K1J A;  2Z9L A;  1YPE H;  1OHH D;  2WPH S;  1J9C H;  2QN5 T;  3TJU A;  1VGC B;  4A6L A;  3L3T A;  4HZH A;  1NRQ H;  5A8X A;  5IYT A;  1ESA A;  1OP8 A;  1AN1 E;  1EZU C;  4NIX A;  4A1X A;  4CRC A;  1LKA A;  1AE8 H;  1EUF A;  1F5L A;  1KLJ H;  1Z71 A;  5L30 H;  2VIP A;  3FAN A;  1TFX A;  4YM9 A;  4YLU A;  3VFE A;  2ZGB H;  3P8N A;  1AO5 A;  2QIQ A;  2O8W A;  4FXG H;  3DD2 H;  1E1Q D;  1O2U A;  3LON A;  2GDD A;  2ZTZ A;  5CMX H;  2VVU A;  1JRT A;  4X8T H;  2BXU H;  3SU5 A;  3ATM A;  1DFP A;  1HLT H;  4RT1 A;  1UTM A;  3A8C A;  3OY6 U;  2ZPQ A;  1B0F A;  3M7Q A;  1WTG H;  4IN2 A;  1P06 A;  2BD8 A;  3BTK E;  4LK4 A;  4IBL H;  4Q7X A;  3SQH E;  1SGR E;  1T32 A;  2ZKS A;  1P2O A;  1D6R A;  1UTL M;  2VIN A;  2AMP A;  2PSX A;  2FOC A;  2PKS B;  1NES E;  2VU8 E;  3TNS A;  1QA0 A;  5DG6 A;  3STJ A;  3H7T A;  1ZYO A;  1PPB H;  2Y6T A;  4KP0 A;  3T25 A;  3D62 A;  1TA6 A;  2PV9 B;  3OX7 U;  3HKJ B;  3TGJ E;  4D76 A;  4OS4 A;  1AKS B;  1J17 T;  1ZPB A;  2Y7Z A;  2OTV A;  1EOL A;  1BRA A;  2Y5H A;  3N99 A;  4J2Y B;  3A80 A;  1GWA A;  1O2N A;  1W13 U;  5KGO A;  4WH8 A;  4WWY A;  2ZHQ H;  3F0O A;  1EAT A;  4YLQ H;  2HNT C;  2BY5 X;  1C1Q A;  3OEH D;  1YGC H;  2GZ9 A;  1T31 A;  5F8T A;  1QA7 A;  1GBF A;  4FUI A;  4R0I A;  1IQM A;  2ZO3 H;  2QF0 A;  4B2C A;  1V2K T;  2Q6D A;  3S7H B;  4CRG A;  1DWE H;  1U6Q A;  1ZZZ A;  3LC3 A;  4GHT A;  3RP2 A;  3GY8 A;  3RXD A;  3NPS A;  1LQE A;  3A7X A;  3RXP A;  3KID U;  1SLU B;  1E1R D;  4KEL A;  2V3O H;  1TX6 A;  2PLX A;  2FOB A;  1G3D A;  1A7S A;  4X2X A;  1LPZ B;  2F83 A;  1MAX A;  1WBG B;  3E90 B;  3ZYE A;  3SU2 A;  2BQW B;  2J34 A;  4MQA A;  4AG2 A;  4IN1 A;  3PMH B;  3SYJ A;  2BX4 A;  1AB9 C;  3F9G A;  1WAY B;  3URE A;  1OP2 A;  1QQ4 A;  4HG6 A;  2H9E H;  3A8D A;  1O2V A;  3O8B A;  5EOD A;  1TGC A;  1C1U H;  5T1V A;  1QTF A;  2WPD D;  2VH6 A;  2GCH G;  3ATL A;  2ZA5 A;  1O38 A;  5JBT A;  3TIU A;  3NXP A;  4NSY A;  2A5K A;  1O5C B;  2FO9 A;  3M37 A;  1V2R T;  4SGA E;  1ELT A;  1P8V C;  1BQY A;  1CHG A;  3W1E A;  3MU1 A;  2AHM E;  2GD4 B;  3SV6 A;  2PR3 A;  4BAH B;  1GHA F;  2O8T A;  1LPK B;  2CV3 A;  1GJ7 B;  1KXE A;  1SGQ E;  2CHA C;  3MH5 A;  1SGN E;  3RXK A;  4BXS A;  2BDA A;  3MTY A;  1GBJ A;  3CEN A;  2H5D A;  2ZF0 H;  3L6P A;  3KQD A;  1C1T A;  5HMA A;  5FL7 D;  3QUM P;  1NN6 A;  5GIB A;  1QL8 A;  4AGJ A;  4ZUH A;  1O5A B;  2VBC A;  4H42 U;  4NGA H;  1SKY E;  1GI2 A;  1NFW A;  2R2M B;  2FXR A;  1QBN A;  1O3P B;  3SW2 B;  1D3T B;  5TCC A;  1V2Q T;  4X8S H;  3TK9 A;  1XUK A;  1CHO G;  4MVN A;  2AFQ B;  5C2Z A;  1EAW A;  1PYT D;  3NKK A;  3H7O A;  2G52 A;  3OYP A;  2UUY A;  3HAT H;  4B6E A;  1G30 B;  4E06 H;  1C5O H;  1HUT H;  1EAI A;  8KME 2;  1TON A;  2AMQ A;  2PHB A;  1YP9 A;  2G4T A;  2F91 A;  3M7U A;  2ZHE H;  1MAB B;  2J38 A;  2RFK C;  2R0L A;  3UOU A;  2ZGX H;  3CP7 A;  2Y7X A;  3EE0 B;  3TH3 H;  5EIY A;  2FLB H;  2Z3C A;  4UON A;  1NRN H;  1FY1 A;  1Y3U A;  1KSN A;  2YMS D;  5T6F A;  3WWB A;  3U98 H;  3SOS A;  3RMN H;  1HAH H;  2BDG A;  4X1R U;  1ELA A;  1S82 A;  1AFQ C;  3ZVE A;  1V2N T;  1XUI A;  3DSO A;  4O3U A;  1HIA B;  3RXA A;  3SV2 H;  1D9I A;  1P05 A;  3GDU A;  1XKA C;  3ZZ9 A;  1VZQ H;  1K2I 1;  1ANC A;  3OU0 A;  4XRN A;  3MOC A;  1ZTK A;  1K1P A;  3LU9 B;  4FU8 A;  3LH1 A;  3M5L A;  5CHA B;  1VIT G;  3BTT E;  2G81 E;  2OBO A;  1FNI A;  1YLD A;  1ZOM A;  5C5N A;  3ENS B;  1C5T A;  1YBW A;  1HDT H;  1L4D A;  3RXR A;  1O2K A;  4Z1M D;  3FAO A;  2HPP H;  3EAJ A;  4ABF A;  4K1S A;  4B73 A;  3LDX H;  3Q76 A;  4OM9 A;  1QFK H;  1LO6 A;  3TJO A;  1DLE A;  1BB0 B;  3UNR A;  1A0H B;  5JB9 S;  3SU3 A;  1NFU A;  1ELD E;  1W12 U;  2KCY A;  1MQ6 A;  4ISI H;  5AFZ H;  1O2O A;  4ISH H;  5EG4 A;  1MZA A;  2B8O H;  5E2P A;  4CRF A;  5C1X A;  5C3N A;  1NO9 H;  3GCT G;  3TIT A;  4AOR A;  4ZHA A;  2OBQ A;  4X2Y A;  1XKB C;  2SGP E;  1GJA B;  4NZL A;  1RD3 B;  5F03 A;  1EJA A;  2C8Z B;  1C1O A;  3SHC H;  1OWK A;  1CGH A;  1FUJ A;  2BY6 X;  4XE4 A;  3HKI B;  2SGD E;  2P8O B;  2TRM A;  2Y5F A;  1HGT H;  5AFY H;  1TMU H;  4Y7B A;  1CT4 E;  4UE7 H;  1B0E A;  1DXP A;  3SOR A;  3Q77 A;  5G4B A;  3NRL A;  1EZS C;  1GVK B;  1BIT A;  4NWK A;  1MMJ N;  5EGM A;  3LIW A;  2LP6 A;  4YOG A;  1DLK B;  1AKS A;  1PFX C;  5HYO A;  3K2U A;  4BTT B;  2ZQ1 A;  1N1L A;  1TAB E;  1Z8G A;  1WXR A;  4BTI B;  5GJ4 B;  5E8E H;  2PGQ B;  1FY5 A;  1A5G H;  5AHG H;  3RXH A;  4TT3 D;  1HJA B;  3A86 A;  2OK5 A;  3LT3 A;  4KTS A;  5EW1 H;  2C93 B;  3RXO A;  1LVO A;  2Q1J A;  2ZFR H;  1Y5B T;  2P94 A;  4K8B A;  1GI9 B;  1TBR H;  2FI5 E;  1G3C A;  1SMF E;  2SGA A;  2FES H;  3OE7 D;  1A3B H;  1GBT A;  3F9F A;  1P2K A;  1P57 B;  2VGC B;  2OC8 A;  4ABI A;  5C20 A;  3EYD A;  3A8A A;  3PV2 A;  2F9O A;  1CQQ A;  4IS5 A;  3M5O A;  3P8G A;  1MQ5 A;  4UFF H;  3FZD A;  3EDX B;  5T6G A;  2EST E;  1XXF A;  2WUC A;  1O30 A;  1SFI A;  1O3M A;  3E0P B;  5I25 A;  1C5W B;  1GMH F;  2WV9 A;  1VIT H;  2LPR A;  2ZEB A;  2P95 A;  4LOY H;  4AFU A;  2FTM A;  1RIW B;  3SGA E;  3LGV A;  1H9H E;  2ODP A;  2FX4 A;  1YPK H;  1LHD H;  1GI5 A;  3S0N A;  1ZMN A;  1SLX B;  3MQK C;  1O3D A;  1BA8 B;  3P17 H;  4OS2 A;  2ZQ2 A;  1O3C A;  3P95 A;  2AH4 X;  4RT0 A;  1GHB F;  2GP9 B;  1AVX A;  1BTP A;  2TPI Z;  2WPM S;  2ZFQ H;  4ZKR U;  3RU4 T;  1RTL A;  1ZRK A;  1UTN A;  1T8O A;  4FVD A;  2AER H;  4B74 A;  1OYT H;  2V3H H;  3NWU A;  3VXE H;  3QGJ A;  1TNK A;  1HB0 B;  1BTH H;  1ZSL A;  2VWN A;  3MH6 A;  2FMJ A;  2A32 A;  4JK6 A;  4NSV A;  4CRA A;  5DN6 D;  1ZTJ A;  2A0Q B;  1ZHR A;  4D9R A;  5GXP A;  4JYT A;  2G5V A;  5EPN A;  2JJ1 D;  2VWL A;  1S0Q A;  1O35 A;  4O3T A;  1HYL A;  4HI3 A;  2ZIQ H;  1GI7 B;  3F68 H;  2Y5G A;  4X0W U;  2NU2 E;  1W0J D;  2Q6G A;  3MYW A;  1C5N H;  3GY4 A;  4NIW A;  5FBE A;  4LZ4 B;  4ZH8 A;  3AW0 A;  2QXJ A;  5EU8 A;  1SSX A;  2VVV A;  4AN7 A;  3SNC A;  3FP8 E;  3P92 A;  4ZHM U;  4FUD A;  3RDZ A;  1ZML A;  4DJZ B;  2GZ7 A;  2OIN A;  2YMS B;  7LPR A;  1W0Z U;  1LKB A;  1G9I E;  1NS3 A;  1VJ9 U;  2FDA A;  2FYQ A;  4OS7 A;  3U8O H;  1QRZ A;  2HRV A;  1K1I A;  2V6N A;  4XDE A;  1HAZ B;  5EJZ A;  3RC4 A;  1TAL A;  1UVU H;  3LOX A;  1GVZ A;  1P0S H;  2ZZU H;  2ZU1 A;  3E3T A;  3WY8 A;  1PQA A;  2ANW A;  4WME A;  2J2U A;  1E34 B;  1YKT A;  3E8L A;  1KYN A;  1MH0 A;  1CHO F;  1TLD A;  1A5I A;  3ZZD A;  2HAL A;  1C5X B;  4K3J A;  1IQE A;  2BYA X;  1AE5 A;  2RG3 A;  4K60 A;  1OYQ A;  3TJV A;  1KLI H;  2XBV A;  4IMZ A;  1DUE A;  1QZ8 A;  1PPE E;  1ELC A;  3SU4 A;  4X6N A;  1K0H A;  1GHX H;  5HKK D;  1AU8 A;  1SOZ A;  2P16 A;  5F8X A;  1GHA G;  1GBB A;  3VG8 A;  2Z9J A;  5EQR A;  5E2O A;  4B71 A;  3STI A;  1G2L A;  2DUC A;  5BRR E;  4H6T A;  2EEK A;  3ZIA D;  2ULL A;  2KX4 A;  1L4Z A;  5B6O A;  3LGU A;  3NUM A;  3ITI A;  1HIA A;  1HAY B;  3A8B A;  4P00 A;  3N7O A;  1K22 H;  4DOQ A;  1GPZ A;  2WPK S;  3SJ9 A;  2EI6 A;  3QK1 A;  4A1V A;  1E79 D;  1W11 U;  1WU1 A;  4GAW A;  4I8J A;  1MZD A;  1SGE E;  2WYG A;  1BTU A;  1O5B B;  4QT8 C;  2JKH A;  1O5D H;  2ZHF H;  5KED A;  3MNC A;  1GBE A;  1C4Y 2;  1IOE A;  1L0Z A;  3BV9 B;  3UOP A;  2HVY B;  2UUF B;  1H8D H;  2XC0 A;  4RKO B;  1QL7 A;  3K6Y A;  3BEI B;  1OWJ A;  1WV7 H;  2KFW A;  1KLT A;  4ISN A;  5CDF E;  1SBW A;  1GGD B;  3VB3 A;  1TMT H;  3CS7 A;  1VKY A;  2ZU3 A;  2FOE A;  2ZFT A;  1E37 B;  1LHG H;  3UNS A;  4AGK A;  4DII H;  1KDQ B;  2WZQ A;  3ZVG A;  1YF4 A;  1P11 E;  3VB5 A;  2AMD A;  3RXF A;  1NM6 A;  1A1R A;  1GCT B;  1N6X A;  1TNJ A;  2BMG B;  1FAX A;  1C2F A;  1FIZ A;  3UY9 A;  2A1D B;  2BD7 A;  8LPR A;  2IN2 A;  1S83 A;  4ZKO U;  3GYM A;  3RXC A;  1AGJ A;  1GI8 B;  2GT7 A;  1MD7 A;  4TPY A;  2A4G A;  1LHE H;  1O2W A;  1ARC A;  1Y3V A;  1C5R A;  1D3Q B;  3BIV H;  3PMA B;  1QJ1 B;  1UK3 A;  2P8O C;  4ABA A;  1FY4 A;  1SB1 H;  3U8R H;  3O8C A;  1ZPC A;  2YOL A;  3TU7 H;  3F9E A;  5EOK A;  1EKB B;  1GJ5 H;  2V0B A;  1HAP H;  1PPF E;  1DE7 H;  1G36 A;  2EA3 A;  2VVC A;  2VIW A;  1LTO A;  1S6H A;  1GHZ A;  1EFR D;  2CK3 D;  6CHA B;  2QF4 A;  2O8M A;  4Z0K A;  5GDS H;  3A7Y A;  3ATW A;  4CRB A;  1UTK A;  2IOT A;  4YO9 A;  2XYA A;  3IG6 B;  2XTT B;  1C4V 2;  1HPG A;  1W14 U;  3OTJ E;  2ZDM A;  2A5A A;  4HTC H;  4M7G A;  1O2P A;  1HJA C;  1GI6 A;  3FKS D;  1V2W T;  4WMD A;  4E05 H;  2PSY A;  4YTA A;  5GPI B;  2KR7 A;  1IHT H;  2C8W B;  2BVS H;  1QJ7 B;  3T26 A;  1AVG H;  1YCP H;  3T62 A;  2L74 A;  1F0T A;  4P02 A;  1CA0 C;  3WWF A;  3UIR A;  1NZQ H;  4DT4 A;  1ZMJ A;  3D49 H;  1MKX K;  1QBV H;  3QWC H;  5LPR A;  1O3F A;  3MFJ A;  2GMT B;  1EPT C;  2L6O A;  1O2Q A;  3MMG A;  3B23 B;  3V3M A;  1CO7 E;  3TH2 H;  4I8H A;  1EP6 A;  4E7N A;  1BBR H;  1GJ9 B;  2Z6B D;  1TWX B;  1TNH A;  3VGC C;  1O2L A;  1S84 A;  1UVO A;  2BY8 X;  3BTW E;  5LPE A;  4THN H;  1T8L A;  5F6M A;  1F5K U;  1RIW C;  1T4V H;  1L1J A;  2HLC A;  4B1T A;  1G2M A;  1H8I H;  5IDK A;  5HM2 A;  2RDL A;  2J92 A;  1DOJ A;  1A2C H;  2QXG A;  2Y81 A;  1K21 H;  1C5M D;  2EC9 H;  3UQO A;  5C17 A;  2J98 A;  2G51 A;  3F2H A;  1MCT A;  2SNV A;  1S6F A;  2A7H A;  1BZX E;  1ESB A;  4GLY A;  2XCN A;  3TPI Z;  1QR3 E;  3P8F A;  1O2Y A;  4MNX A;  2XWB I;  1JWT A;  1QGF A;  4O97 A;  5C94 A;  4MNY A;  5ABW A;  2J97 A;  3VB4 A;  3QN7 A;  3PB1 E;  2A7J A;  2V35 A;  2ANM H;  4B2A A;  3AAU A;  1UVP A;  1PQ8 A;  2XND D;  4Q7Z A;  4JK5 A;  4UFE H;  1TNL A;  1F92 A;  1DIT H;  1OSS A;  4ABG A;  2FI3 E;  1GMD G;  3UAI C;  1YPL H;  3B8J A;  4YT7 H;  3IIT A;  1O2M A;  3GCH C;  3GCO A;  3PLK A;  1GMH G;  2JIZ D;  3KN2 A;  1JRS A;  2TIO A;  1FLE E;  2NWN A;  2F9B H;  2UUK B;  2BLV A;  2F4L A;  7GCH F;  4X2V A;  4Y6D A;  2J9N A;  4Y10 E;  1CBW B;  1TYN A;  5L2Y H;  1DAN H;  1Z6E A;  2C4F H;  2FOG A;  1S0R A;  1GHB G;  1HFD A;  3VPK A;  3S9A A;  3S69 A;  3GS9 A;  3PWC A;  2P3U B;  2GX4 A;  1TOC B;  3V13 A;  4BAN B;  5EJ1 A;  2GVF A;  4WMF A;  1C4U 2;  2PUQ H;  3CNR A;  1DUA A;  3M5N A;  2CGA A;  2VJ1 A;  2WSS D;  1C1R A;  1NY2 2;  2SNW A;  3PV5 A;  1NU9 A;  2ALP A;  3V12 A;  5A0A E;  1EB1 H;  1BBR E;  1H8E D;  2TBS A;  5FHT A;  1FXY A;  1MU6 B;  2AYW A;  1GBK A;  1ELV A;  1OXG A;  1SLW B;  4K8Y A;  3ZZ6 A;  4MNV A;  4GVU A;  2PP6 A;  2BY7 X;  1C2J A;  5DSF A;  4F4O C;  2ILN A;  1O32 A;  5E0J A;  1AZ8 A;  1L2E A;  3QO6 A;  4ISO A;  1DVA H;  4MPX A;  3TJN A;  1W10 U;  3UWJ H;  1BTX A;  3RML H;  1UK2 A;  4D7G A;  3GIS B;  1ZGV A;  4F48 B;  2OC7 A;  4BAQ B;  4X8U H;  1SGF A;  2FOA A;  2FPZ A;  2GV7 A;  4XSK U;  2THF B;  4OS1 A;  4NA7 A;  4MPU A;  1DST A;  1S81 A;  2JET B;  3A85 A;  3DSP A;  1MTN C;  3DA9 B;  3SO3 A;  2J4I A;  1ARB A;  2P3T B;  2LEL A;  2XBX A;  1HAV A;  1EZX C;  2FP7 B;  1TIO A;  4LZ1 H;  4NIY A;  5LGO A;  1N8O B;  2QF3 A;  4ASH A;  1W0K D;  1BMA A;  1G3E A;  1ELF A;  1QUR H;  1K1M A;  4GUX A;  2HNT E;  2Z9I A;  4R8T B;  3SZE A;  2WYJ A;  5DP3 A;  1KDQ A;  1C9T A;  5K0H A;  1C5Z B;  4RSP A;  2ODQ A;  3IWM A;  1A0L A;  2R0K A;  1UHB B;  2C90 B;  2QV1 A;  1GL0 E;  2QYI A;  3PLP A;  4VGC B;  1GCT C;  2GCT C;  1GL1 A;  4CBN A;  1P2N A;  4AB9 A;  4ABB A;  1H4W A;  2K1Q A; 
#chains in the Genus database with same CATH homology
 3F2G A;  3SU4 A;  1E1Q D;  3LON A;  5T1V A;  3M5L A;  3SV8 A;  2WPD D;  5HKK D;  2KM0 A;  3SUF A;  2OBO A;  3H09 A;  2WV9 A;  2IJO B;  2F4L A;  3SU5 A;  2A4R A;  3SU6 A;  5C0T A;  2GGV B;  3VG8 A;  3FKS D;  5EQR A;  5H4I B;  2QF5 A;  4Z1M D;  1RGQ A;  4I31 A;  5GPI B;  2KR7 A;  4B71 A;  1S6L A;  3F3B A;  2KCP A;  3FN8 A;  3U1I B;  4ASU D;  3SV9 A;  3ZIA D;  3SUE A;  3W1E A;  4B73 A;  3RC6 A;  2OC1 A;  2AHM E;  3GS9 A;  3SV6 A;  3FOA A;  4OM9 A;  4U01 A;  3LKW A;  5B6L A;  1NBM E;  3WWF A;  2GVF A;  3PRD A;  4WF8 A;  4DT4 A;  4A1V A;  3SU3 A;  4B75 A;  3U1J B;  2KCY A;  1DY9 A;  4I32 A;  3M5N A;  1E79 D;  3PRB A;  2WSS D;  4FET A;  5EQQ A;  2YMS C;  2HLD D;  2KCO A;  2L6O A;  3PV5 A;  1JXP A;  2FOM B;  1CU1 A;  1RTL A;  3L6P A;  1NBM D;  1H8E D;  2XNI A;  3OTP A;  4XD7 D;  5FL7 D;  3WW7 A;  4B74 A;  2OBQ A;  3KF2 A;  3O8R A;  2OC0 A;  3OEE D;  4A1T A;  5IK2 D;  2K8I A;  3N99 A;  2VBC A;  2XCF A;  2K0Q A;  1SKY E;  5C0U A;  4WH8 A;  4B76 A;  2M2A A;  3F0O A;  5DSF A;  3KEE A;  5DN6 D;  4Q4L A;  2F43 B;  2F9V A;  2KFW A;  1FX0 B;  3N7D A;  3OEH D;  3P8O A;  5EPN A;  2JJ1 D;  5GND A;  5IDK A;  3OAA D;  1DY8 A;  1H8H D;  2P59 A;  5FPY A;  5CDF E;  2W6J D;  5EQS A;  3SU1 A;  3M5M A;  1DXP A;  3NRL A;  2V7Q D;  3FO8 D;  3OFN D;  5C17 A;  2JJ2 D;  2OC7 A;  4B6F A;  4NWK A;  1W0J D;  3F2H A;  5FPT A;  4YXW D;  2WZQ A;  3OYP A;  2XCN A;  1BMF D;  3SU0 A;  4B6E A;  1A1R A;  2XOK D;  5EPY A;  1N1L A;  3DCL A;  3KNX A;  3DSP A;  2IJD 1;  1WXR A;  1BT7 A;  2OIN A;  1E1R D;  2LEL A;  2YMS B;  3N7E A;  5GJ4 B;  1MAB B;  2A4Q A;  4ZCN A;  1NS3 A;  5CHB A;  5FPS A;  3SV7 A;  2A4G A;  2FP7 B;  4TT3 D;  2OK5 A;  4F55 A;  1DXW A;  1OHH D;  3RC4 A;  4I33 A;  4KTC A;  3F2F A;  3AK5 A;  3LOX A;  4TSF D;  2KCA A;  3UB0 A;  2YMS D;  3WWB A;  1W0K D;  5ETX A;  2J5U A;  4WH6 A;  3F0P A;  4K8B A;  2XND D;  3O8C A;  4R8T B;  3O8D A;  3SZE A;  2YOL A;  1KMH B;  4M9F A;  4NWL A;  3E90 B;  3OE7 D;  4TYD A;  2QE7 D;  3DSO A;  1COW D;  4A1X A;  4RI0 A;  3SU2 A;  2OC8 A;  3SUG A;  2F9U A;  2JDI D;  2W6I D;  3EYD A;  3PV2 A;  2KZ4 A;  1W3C A;  3SYJ A;  1EFR D;  3SUD A;  2CK3 D;  2FM2 A;  3M5O A;  2QV1 A;  4JMY A;  2QF4 A;  5F53 A;  3RC5 A;  2JIZ D;  2O8M A;  2WHX A;  3KN2 A;  3P8N A;  5ESB A;  3O8B A;  4A92 A;  2K1Q A;  4Q63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...