1YP9A

Trypsin inhibitor complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title A simple protocol to estimate differences in protein binding affinity for enantiomers without prior resolution of racemates
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yp9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yp9A02
3F6UH 4K1TA 3QX5H 3HK6B 4TWYA 1YGCH 5E8EH 3F9HA 4LZ4B 1O3AA 2ZGJA 1QQUA 1TRYA 2BM2A 3E90B 2HOBA 1MTWA 2XXLA 3RXHA 3DFJA 2GT8A 1T32A 4O9VA 4UD9H 4KGAA 1FONA 1A61H 2O8WA 2Z3EA 1FAKH 4OS7A 3KQCA 4UFGH 2PUXB 4DW2U 5C1UA 3MU5A 1P12E 4CBOA 4THNH 3SUDA 3RC5A 4K69A 3SU1A 2CXVA 2XC5A 3ZV8A 3MTYA 3NXPA 3AW1A 1SOTA 2ZQ1A 1O2KA 1SGFA 1C5VA 1UJ1A 3V3MA 1THSH 1BJUA 1EZQA 2QV1A 3PO1B 1PPEE 3U8TH 1JIMA 2G5NA 1DM4B 2V3HH 4B2BA 1AU8A 2A32A 1HAIH 1GDUA 4D7GA 1GBJA 3RXVA 2P8OC 2WPHS 3F1SB 4X6PA 3SV2H 2WPMS 1EAWA 1HNEE 1FDPA 1W3CA 3C1KA 4KKDA 4OS1A 3AAUA 1SGPE 1MTUA 1AMHA 1TMTH 2AIQA 1ZGVA 2BY8X 1CGJE 2SGDE 1OWJA 3QLPH 2ZWLH 1SQTA 1A7SA 3SUFA 1NPMA 1DXWA 1FY1A 1E37B 1CQQA 1FAXA 2BMGB 3RLYH 3TH2H 1SHHB 2Q6DA 4K1SA 4XDEA 4Y10E 1EP5A 4LOYH 5K7RA 1J14A 3VEQB 1LDTT 4SGAE 1IQGA 1C5XB 3M5LA 1O2PA 3V0XA 4AX9H 1ELBA 3TJOA 3LU9B 1HBTH 1P0SH 2AFQB 2BYAX 1MAYA 4YLUA 1DUAA 1BDAA 1KXDA 1K22H 3M3SA 1HGTH 1INCA 1WCZA 5AHGH 1O2TA 1MMJN 2NU2E 2TGPZ 1WU1A 2SNWA 4ISLA 1HXEH 1B0EA 1MH0A 1QB9A 2P93A 1PPHE 1BTUA 1WTGH 1YCPH 1SC8U 5J4QA 1O34A 1YPHE 2VWOA 2XC4A 1GCTB 2HPQH 2ZU1A 1LVOA 3KQBA 2FP7B 1LO6A 1YPJH 1GBMA 1C5TA 2BDHA 2VVCA 4IW4E 3RM0H 2C8WB 3BTTE 3QUMP 3A86A 3A85A 3BG4C 3LJOA 1O2JA 3ATIA 3QZRA 1CE5A 1EOJA 3JZ2B 2FM2A 1GBEA 2GCTB 1T31A 5DJ7A 2A7HA 3DA9B 1D6RA 1G2MA 2QF0A 1P2QA 4DOQA 4IGDA 1P2NA 1DUEA 1O2SA 1Q31A 2ZECA 3HKJB 4U30A 1LCYA 1SQOA 2FODA 2BY7X 3LKWA 1V2QT 1RTKA 3BEIB 2SGQE 3SBKA 2JH0D 1TABE 2J2UA 2GCHF 3HKIB 5EQQA 4A92A 1THPB 2FI5E 3D65E 4UFDH 3OY6U 1KSNA 4Y0ZE 1XKAC 1ABIH 3VGCC 1CSOE 2ZTZA 2H2ZA 2AMDA 1ZOMA 2GDEH 1KXFA 2HGTH 2QXJA 2V6NA 1P2KA 2STBE 4CR9A 2G4TA 1WBGB 2ZP0H 2VB0A 1P05A 4YESB 2PHBA 3K9XB 3RMMH 1GBHA 7ESTE 3NK8A 2XBXA 1GHAF 3PB1E 3ZZ3A 1C5SA 1IQIA 2F9VA 1B5GH 5JPMH 3HPTB 1GGDB 1O3NA 2JETB 2VH6A 4NFFA 3VFEA 5JDUB 1ZMLA 2ZA5A 2BX4A 2EI6A 1UCYH 1ESBA 2IOTA 1UK3A 4ABGA 4AN7A 2A5KA 2OQUA 2WYJA 4HTCH 1K1NA 3EGKH 5HYOA 3GDSA 3UR9A 3ZZ5A 3RXBA 4ABFA 1V2NT 2Z9JA 4YOJA 1OYTH 1IQFA 1V3XA 2BD2A 1MD7A 4XFQA 1FJSA 2B9LA 1CT2E 1CBWB 3LGIA 2R9PA 4DG4A 4ESTE 1Y5UT 2BOKA 3R0FA 1K21H 4X8SH 4X8VH 2ZHWH 2UWLA 1H1BA 2VINA 4QT8C 2FZZA 1T7CA 4IMQA 1C2GA 3GCNA 1W0ZU 5A8XA 4NIXA 1P01A 1IQNA 4I7YH 2ZNKH 4AFQA 1QQ4A 1Y3UA 3SO3A 3UNRA 3FANA 1YPHC 3S9AA 2V3OH 2FI3E 2PKAB 1E36B 2A4GA 2FOMB 4OS6A 3NWUA 2Y6TA 1C5UA 1EQ9A 1HIAB 2ZFRH 7KMEH 1V2KT 3PMJA 3C27B 1VITF 3GCHB 3MH7A 1QRZA 1JMOH 4O3TA 1NRNH 1DWCH 3UOPA 3D62A 1DE7H 4LXBH 4K2YA 1GJ6A 2GKVE 1YPEH 2A4OA 1C9PA 1FPCH 5FPYA 3A89A 1KLTA 4FUCA 1VITH 4CRCA 4I33A 3TVJB 1GJ5H 1KY9A 4A5TS 1K1MA 1ACBE 4AG1A 4IBLH 1MTNB 1UTJA 2LPRA 2Q1JA 2F9OA 5FPTA 2NU0E 3MYWA 2GP9B 1GHXH 1S81A 1O36A 2A31A 3ZZ4A 4Q7ZA 1V2RT 1AIXH 1EXFA 4GSOA 1NRQH 4WWYA 2H9TH 1JRSA 2ZO3H 4BXSA 2VU8E 1A3BH 4CBNA 3E1XB 1QJ1B 1A2CH 1C1MA 1ZMNA 1O37A 2D1JA 4AB9A 4HGCA 3TLOA 1MCTA 2Y80A 1GJBB 1AUJA 4VGCC 2OINA 1XUFA 3KIDU 4YZUA 1TIOA 3KNXA 1KTSB 3TNSA 1TMBH 3UPEA 3HGNA 1LPZB 1D3DB 1XVOA 2QF3A 6ESTA 1BHXF 1AB9C 4DURA 2DUCA 2HNTF 1A5IA 1TFXA 3EA8A 1LHGH 5F8ZA 1ELVA 1O2QA 2XCFA 5T6FA 1MKWH 2SGPE 1TRMA 1QBOA 3BTME 2GMTB 4B74A 1ORFA 2TGTA 2ZU3A 3ZVAA 1S5SA 2G51A 3PWCA 2QXGA 3T25A 4FU8A 1SVPA 4Q7YA 2ZGBH 3SGBE 1CU1A 2ANKH 1VCWA 1J8AA 1C5RA 5F8XA 1O33A 1W14U 1Z8JB 4ABAA 2J9NA 1TGSZ 3UIRA 2UUKB 2WV4A 2A0QB 1ZHMA 2GTBA 1O5GH 5AFZH 8ESTE 1IQJA 1HPGA 1TPSA 1S84A 1SQAA 1XMNB 3SU4A 2H9HA 1TGTA 2ALVA 4YTAA 3P95A 1QHRB 3KN2A 1FN6A 4AGJA 1BA8B 3SHCH 1CT4E 3BTEE 3N7OA 2UWOA 4BTTB 1G3DA 3E0NB 4ISOA 3A8CA 1WQVH 1FXYA 4KTSA 3SQHE 3MU0A 5HXFA 4AYYB 1AZZA 3ATLA 1BTHH 1DSUA 1O2RA 2ZKSA 3E8LA 1A4WH 5HMAA 4JCNA 1O39A 4Y11E 5F8TA 2ZHQH 1AD8H 3T28A 5E2OA 3PO1C 1BRCE 4K60A 3Q3YA 2ZDVH 2G52A 1O2NA 2ODPA 1F5RA 1XX9A 4Y8YA 3GYMA 3U9AH 1HCGA 2FI4E 4F49A 4Z6AH 1PFXC 2TPIZ 2ZDKA 1OSSA 2ZIQH 2QC2A 2VVUA 3V12A 1UVUH 1LHEH 1TNKA 2Y7XA 3BEFB 4ZHLU 4O97A 1GMHG 1X7AC 2BLQA 2Y5HA 1W7XH 1FY4A 1SLXB 1SGDE 1YC0A 4K8BA 3U8OH 3A87A 2H1UA 3F9GA 1VZQH 4NWKA 1EB1H 1F0SA 2WYGA 1C2MA 3BF6H 1P06A 4ISIH 1ESTA 4XOJA 4ZHMU 2VIVA 2VNTA 5H4IB 2HPPH 1QB6A 2CJIA 1GBTA 1H9LB 1T8OA 1UMAH 8LPRA 4MVNA 3SNBA 2QAAA 1C1PA 1Y3YA 2XWBI 2FLRH 5GCHG 1Z8GA 3UNSA 2QY0B 1GJAB 3RU4T 1EUFA 1SGEE 3UUZA 4E06H 1T8LA 2EC9H 4FUJA 3GDVA 1GHBG 3LDXH 1Z6EA 1AE5A 3PMHB 1GI6A 2HALA 5BPEA 1QURH 3SI4H 5A0CA 2PGQB 1GI8B 3SJ8A 1ID5H 1T4UH 4AFUA 1YCPM 3F9EA 3SI3H 2WPLS 2FMJA 1O2ZA 1GCTC 1HAXB 1A1RA 1LPGB 3FFGA 2TGDA 2R3UA 1ZR0A 4MNYA 4ZKRU 2Q6GA 5E2PA 1Q2WA 3UNQA 1GI3A 1GJ7B 1O38A 2ZCLP 2ZGHA 4YM9A 4JK6A 1CT0E 3SV8A 4BANB 2ZCHP 1GVKB 2GCTC 3RXQA 4UE7H 1D4PB 4ZROA 1TQ0B 2V0BA 1DWBH 1Y3WA 2BD4A 4ABDA 3NZIA 4Y76A 1AY6H 1GMDG 1O3IA 3RXMA 1V2LT 2G4UA 1ANCA 1ZTJA 1TB6H 1SGTA 4Y6DA 1C2HA 1HLTH 1GBBA 1HFDA 6GCHF 1A46H 1E0FD 2OP9A 8GCHG 1TPOA 3M61U 2F9BH 3VB5A 2GGVB 1MAXA 2D8WA 1AWFH 3MO6A 4DIIH 1T4VH 2ZGXH 4ZH8A 2P95A 3OYPA 1SOZA 2W26A 3ZZDA 1FY3A 1TONA 5EPNA 1BCUH 1P9UA 1S82A 2BDYA 2KAIB 2NU1E 4OS2A 3HGPA 2BVSH 1AHTH 2RG3A 2JH5D 1V6DA 1GVZA 3ZVDA 1GGDC 3PLBA 2JETC 3ATMA 1HJ8A 1BTWA 1O2OA 3DT0H 1FV9A 2YOLA 2GDDA 3P8NA 1SPJA 3EQ0H 1KXCA 3VXEH 3FVFB 3KGPA 3SJKA 4MNXA 1L2EA 2G00A 1GMCG 2BD5A 3VB6A 2P94A 1RD3B 4JK5A 1ESAA 4A1VA 4NZQA 4ISHH 5AVDA 1M9UA 1ELTA 2BVRH 3EAJA 3TK5A 4TYDA 1SLUB 1XVMA 5EG4A 2P3FH 1TA6A 2O8TA 1DICA 1BMMH 4Y7BA 2K1QA 2OC8A 2SGAA 2BDCA 1ELGA 1RRKA 2GZ8A 1FPHH 4WXIA 3SV9A 3RP2A 4NA8A 1Z6JH 1S0QA 2EI8A 1P57B 4YOGA 1SSXA 3F68H 3A7WA 2AGIX 1MD8A 1PQ5A 3QWCH 2Z6BD 2AGGX 2VVVA 4AZ2B 4BTUB 9LPRA 2FDAA 2A2XH 2BQ6B 3GYLB 3VB3A 4IS5A 3STIA 5AFYH 7GCHG 3GCHC 3RXFA 3SQEE 1QCPA 2PKAA 2J95A 2OC7A 5L6NH 4I8GA 1AN1E 1HIAA 5DP6A 2LNCA 1KLIH 2QXIA 1D3PB 1K1LA 2XTTB 1GBCA 1Y3VA 4JYTA 5IDKA 1AQ7A 2BY9X 2QN5T 5TCAA 1IAUA 4K8YA 4GLYA 2VWMA 2NWNA 3A8AA 3D23A 1DWDH 4ABIA 5DO4H 3IG6B 2AGEX 2FOFA 4AFSA 2O8LA 3SGQE 1O30A 4AYVB 1FI8A 3BTKE 1NN6A 1DX5M 5JBBS 4I8LA 3LGUA 1WV7H 1Y8TA 1L4DA 1MKXK 1BBRE 2FIRH 1DSTA 2HWLB 1CO7E 1GPZA 3D49H 3H5CB 4CH2B 1TX8A 3FZZA 3SV6A 1DPOA 1CHGA 3S0NA 1UTOA 5C3NA 3PM3A 6CHAB 1YKTA 1QR3E 4IN1A 2PW8H 1SR5C 2C8ZB 1W0YH 4ABJA 1UVTH 2J94A 1GJ9B 1QL7A 2SFAA 2UWPA 4B2CA 1IQKA 3SU3A 1FLEE 3KQEA 4OGXA 2ZTYA 3QO6A 1OX1A 3LH1A 3P6ZB 5DKMA 1F5KU 1C5MD 2ZHEH 1THRH 4O03A 1SFIA 4X6MA 2GMTC 3ZZCA 3PTNA 3GDUA 1QRXA 1SGRE 4OGYA 3VXFH 1Z1JA 1V2ST 2FLBH 1AVWA 3KEEA 4H6TA 3PYHA 1UTKA 3K6YA 2A45B 1H4WA 3BIVH 4XBBA 1P09A 4F4OC 3IWMA 1MQ5A 5C20A 1DITH 1UTLM 1YPMH 4BAHB 3M7TA 4ZKOU 1OP0A 3BTWE 4GCHF 1LMWB 1NFXA 1O3OA 1VJAU 2OTVA 3SUGA 3M5OA 3IITA 4BXWA 1O2WA 1HAOH 1N1LA 1JXPA 3I77A 4ASHA 3UQOA 1W13U 4DVAU 1D6WA 2G81E 1F0TA 3MNCA 2Y5FA 1S83A 1EJMA 2ZPSA 2SGFE 2ZFSA 1O3KA 1P11E 1K1JA 4Q2KA 4WY3A 4DJZB 2FOGA 1JRTA 3ZZ8A 5A8ZA 2BQ7B 4H4FA 3M36A 1F0UA 3FP6E 2FX4A 4JMYA 3RC6A 3E16B 2DE8A 2VIWA 3BV9B 1C5WB 3M3TA 3TIUA 1ARBA 1O3EA 3MMGA 3M3VA 4CHAB 1AKSB 1GI0A 3FP8E 3RM2H 2BLVA 1SGIB 1K1OA 3UOUA 3MU1A 2H6MA 2BXUH 4NA9H 4FXGH 3RXLA 1F92A 1IQMA 1O2MA 1NS3A 4DIHH 2VH0A 3LGYA 1C4U2 3RU4E 2AEIH 4OS5A 1WYKA 5DP3A 3OY5U 4D76A 1UVOA 3MFJA 1C1QA 5C2ZA 4R0IA 2ZPRA 1VCQA 3P8OA 3GCTG 4A1XA 1HJAB 3A8DA 1GWAA 2R2MB 2A7JA 3M35A 1G3EA 1GBAA 3SU5A 5EXNA 3LGWA 1YLDA 3MH5A 4X1NU 1O2VA 2A4RA 1NZQH 2CMYA 3TITA 2BDGA 5DK1A 1ZPCA 3SJOA 3ZZ6A 1ZJKA 2CV3A 4MPVA 3ZVBA 1O2UA 1A3EH 2O8UA 2EA3A 3SZNA 2DE9A 3ELAH 5EQSA 1TNJA 1F0RA 1C5ZB 2WPKS 1WSSH 1CHOG 3BSQA 3O8CA 2PV9B 1QJ7B 1FZZA 1PQAA 3UR6A 4MG3A 3BTFE 2XYAA 4TPIZ 1T8NA 2P16A 1QBNA 1PJPA 1N8OB 3RXGA 3I78A 1XUKA 2B8OH 1HRTH 5C1YA 3RXSA 1L4ZA 2Y82A 3NUMA 1QNJA 3T27A 3A88A 3URDA 5T6DA 3RXKA 2FXRA 4CRDA 2HRVA 1SMFE 2UUFB 4B2AA 3QDZB 3I29A 3QZQA 1ZYOA 4Y8XA 3SW2B 1F7ZA 1NC6A 1TOCB 4ZKSU 3LPRA 3E3TA 5BRRE 5EODA 3SU2A 2AMQA 5FX6A 2BXTH 2RA3A 1AVXA 2PTCE 1ETSH 2ALPA 2XRCA 4X6OA 1DOJA 2CHAC 1O3JA 1FN8A 2BOHB 1A0HB 1SL3A 3A7XA 3ATKA 3QK1A 1UK4A 1VCPA 2Z9KA 5FXLA 1QTFA 5T3HA 1AGJA 1K9OE 1OOKB 3R3GB 4CR5A 3T2NA 4FU7A 1RTFB 4SGBE 3T26A 1P03A 3K65B 5C5OA 1TGCA 1BJVA 1VITG 1O0DH 1AWHB 1MZDA 2O9QA 1UK2A 1TNLA 2UUJB 3MWIU 3SHAH 5ABWA 4KELA 2W7UA 5L2ZH 1LKAA 5TCCA 2ZHDA 2QCYA 5FCKA 1Z8IB 2OC0A 3DD2H 1JOUB 4ISNA 1P04A 2FOHA 1T8MA 2KAIA 3DFLA 1NESE 3Q76A 4IMZA 2R0LA 3MNBA 2OC1A 3VPKA 1W10U 2FO9A 4Q80A 2BZ6H 1ZHPA 4A7IB 1RTLA 1K1IA 2BX3A 3M5MA 2A2QH 1O3MA 1O3DA 2Y5GA 1ZGIA 3PROA 3V13A 4I8KA 3S69A 2TIOA 1TOMH 2FX6A 2ANMH 3RDZA 1KDQB 2FTLE 1JBUH 1UO6A 2Z7FE 1TYNA 1XXFA 4U2WA 4AORA 1O2IA 4Y8ZA 4X1RU 3EA9A 1H9HE 4FUHA 5F6MA 3LH3A 1PQ7A 1O5AB 2V35A 3LC5A 1DT2A 1GMHF 2PKSB 1HYLA 1V2UT 3KF2A 3UWJH 1OKXA 1P02A 4YT7H 3PLKA 2PWXA 2A7CA 3GY3A 1L0ZA 5ESBA 3PMAB 1NT1A 5DP7A 1A0LA 1LHCH 1GJDB 1TBZH 4D9RA 3KCGH 1S6FA 3QTVH 4AG2A 5PTPA 1MU8B 1NFUA 4NGAH 1XKBC 3MO3A 1C1TA 3VGCB 2F83A 1Z8RA 1C2EA 3LJJA 1ANDA 1EATA 1B7XB 2QIQA 5GWZA 1O5FH 4Y79A 4WJG2 4MPWA 1KXAA 4ZHAA 1MCVA 2F9PA 5DG6A 4GPGA 1HJ9A 4JZ1A 3MO9A 3GY4A 1TPAE 5GCHF 4FUIA 1CGHA 2ILNA 3S7HB 4BAKB 1FNIA 1UHBB 5EPYA 1U6QA 4IC5A 1QB1A 2R2WU 2XC0A 1BRAA 2STAE 1GHBF 3RLWH 3HK3B 1A0JA 3ZYEA 3RXAA 3A7TA 5EXMA 2P3TB 3BTQE 1ZZZA 1DLKB 4TWWA 1RJXB 2XW9A 1ZTKA 1KIGH 1GI5A 2BY5X 1MUEB 3E91A 4INLA 4KP0A 4M7GA 3RXOA 1O3FA 2SGEE 3ZVGA 5CE1A 1WQSA 1ZHRA 1XXDA 1V2PT 1GBIA 1IQEA 2ZTXA 3UFAA 3SJ9A 4D7FA 1LVBA 4BOHA 1XUHA 3BG8A 2FPZA 2CF8H 1BMAA 3AW0A 2EEKA 1TQ7B 4FUFA 1GJ8B 1VGCB 1DWEH 4CRAA 1ELFA 2BD3A 3ODDA 1YCPK 2P59A 3K6ZA 4ZMAH 4Q7XA 1GMDF 3BTDE 2ZEBA 1QBVH 3QGNB 5GDSH 4K5ZA 5G4BA 2UUYA 1NM6A 2B5TB 1DXPA 1WAYB 2FS9A 2TGAA 4JZDH 1SB1H 5CMXH 5C67A 3RU4D 1IQHA 2F91A 3JZ1B 1GG6B 2FOBA 8GCHF 1P2MA 2ANWA 1EASA 3GICB 4E7RG 3FP7E 1Y59T 4Y7AA 3M7UA 1NU9A 1S6HA 1C1NA 4HFPB 3U98H 3PMBB 1NRPH 1G3BA 1WUNH 1C2DA 1HDTH 1O2YA 1TNGA 1O5EH 1MBMA 1EAIA 2PUQH 2XNIA 1GBDA 1XUJA 3PTBA 2ANYA 3RC4A 4UFEH 5E0HA 3ZZ7A 5F03A 4AB8A 4UONA 4TY6A 3RXJA 4WMEA 3B8JA 3L6PA 2JH6D 2H9EH 3FAOA 3MH6A 1BZXE 1OPHB 4YT6H 5HGGA 1DS2E 2THFB 1EZXC 4XE4A 3Q77A 5EGMA 1MTSA 5GIBA 2ZDNA 3OU0A 2A5IA 1G36A 2OBQA 2J38A 5JB8S 4NZLA 2TRMA 2BZAA 2GV7A 4UDWH 2BD7A 3B23B 1ZJDA 2O8MA 3TGKE 4VGCB 2Z3CA 1HUTH 2G5VA 4HI3A 1EX3A 1G37A 1RIWB 2BHGA 5JYIA 2ASUB 4CHAC 4Z0KA 1ZRKA 1YP9A 1EZSC 1O2HA 4GAWA 1GVLA 1L1JA 1CVWH 1W12U 1UCYK 1BMNH 1IHTH 2XBWA 1AKSA 1B0FA 3RXCA 5DP9A 1O3LA 1AB9B 1C4V2 5EU8A 2J4IA 4Y0YE 1KYNA 2BDBA 2Z3DA 1UTQA 3RXDA 1HJAC 1HAPH 3VB7A 7GCHF 1C1OA 2A5AA 2W3KA 1P2OA 3A83A 1CBWC 2CN0H 3E0PB 4LZ1H 3SGAE 2VWNA 3RMNH 6GCHG 5EOKA 1NRSH 2OBOA 3A8BA 1GHWH 3PV4A 2FYRA 3URCA 1FY5A 1HXFH 5K0HA 2RDLA 2NU3E 4OS4A 3SNDA 4I8JA 8KME2 1BBRH 1SFQB 1C5LH 1ZSLA 1ELDE 2A1DB 3TK6A 1FMGA 3GY7A 1YM0A 1YPGH 2WUBA 1O5BB 1H8IH 4MNWA 3ITIA 4E7NA 1FUJA 2C3SA 2RA0A 2M5TA 1AZ8A 2ZFPH 1FIZA 1AO5A 1TPPA 1BTZA 1E34B 3H7TA 5GPIB 1DDJA 1OWDA 5DGJA 4LK4A 4ZXXH 1ZSKA 3Q3KA 1N8OC 4TPYA 2FWWA 3RUOA 1MQ6A 4RKJB 3S7KB 3CENA 1O32A 3TNTA 3NKKA 1ZPBA 4WMFA 1N6YA 1D3TB 1CA0B 1ELAA 1O3PB 1V2OT 1C2FA 3TGJE 3CP7A 3P17H 2PTNA 3FZDA 3QGJA 1IHSH 4YLQH 2ZQ2A 3A80A 1FIWA 4X2WA 1NFWA 1S85A 2BTCE 1LHDH 4NFEA 1P3EA 2GZ9A 1TX6A 2FESH 3M5NA 4DT7B 1MTNC 2H5CA 3MNXA 4JZFH 3P70B 3ESTA 5FPSA 1O35A 3MH4A 1ELEE 1NROH 1NU7B 3Q00A 3VB4A 5CHAB 1K28D 1J9CH 4X1SU 1C1VH 1KXEA 4X8UH 1GJ4H 2GVFA 2EI7A 3MHWU 1C5YB 3SOSA 2BLOA 1JIRA 3T29A 1SGNE 2ZU4A 1C2IA 2PGBB 3CS0A 1AFQB 1P8VC 1V2JT 5J4SA 1QL8A 2FS8A 3A84A 5L30H 3EYDA 3OSYA 3LGTA 1OWEA 1ZSJA 4B76A 4NA7A 2VIPA 4H6SB 2ZFFH 2ZCKP 3LOXA 1AVGH 1TBQH 1Y3XA 1HAYB 1LQEA 1BRUP 4BAOB 4AOQA 6LPRA 1MKWK 2J92A 1W2KH 3GISB 3GOVB 1ZMJA 1ZTLA 4RKOB 1TNHA 1DY9A 1SGCA 1RS0A 4X1PU 1W7GH 3GY2A 4BAMB 2PFEA 1ANEA 1EB2A 3RXIA 3TPIZ 3GY6A 3O8BA 5C1XA 3PLPA 3ZYDA 5EQRA 2BY6X 2PLXA 3F9FA 1PPFE 2BD8A 5AF9H 1L1GA 3UWIA 1C2JA 4A1TA 5GXPA 1Z1IA 3NCLA 4MLFB 3BEUA 4U32A 2FEQH 4GUXA 2VIQA 1IOEA 3HATH 1GBKA 3OX7U 1KDQA 2ZHFH 3MU8A 4X1QU 1GDQA 3AASA 1UVPA 1BTYA 1SHYA 1O3GA 1UVSH 3P8GA 4WMDA 2VIOA 1PYTC 2PKSC 3T5FH 1GI2A 2WPIS 1ZPZA 3E6PH 1DFPA 1OWIA 3M37A 5B6OA 4NCYA 1AE8H 3RXTA 1K1PA 1GHZA 1TGBA 1RFNA 1O5DH 3GCTF 4MTBA 5LPRA 1GI4A 1SGYE 1SG8B 2TBSA 3RXEA 1QA0A 1XM1A 4FUDA 1E35B 3UQVA 1HAGE 1SBWA 1AI8H 1GHYH 1DY8A 3DHKH 1FY8E 2GV6A 4FUEA 1S0RA 1UTPA 2D2DA 2BD9A 1EPTB 3BTGE 4K3JA 4X0WU 3M7QA 1EOLA 3MOCA 1BHXB 3UREA 4E05H 1OS8A 2WUCA 1CA8B 1GCDA 2YNAA 5EXLA 4MDSA 4CRFA 1J15A 1LTOA 2FOCA 4GCHG 5HM9A 1CHOF 1HAVB 2VGCB 4H42U 3LIWA 5FAHA 1C5NH 1UHBA 4RSPA 3TU7H 4RN6A 3A7VA 2W7SA 3L3TA 4B1TA 2GCHG 3TJUA 4ZXYH 5ESTE 2QYIA 1ZLRA 3WY8A 1D9IA 1EAXA 4KTUA 4X2YA 4CRGA 1MBQA 1BTPA 4NIYA 3SJIA 1AFEH 1UTNA 1C9TA 2HLCA 4X6NA 1DLEA 5JB9S 3ZZ9A 1LHFH 2J34A 2WV5A 4IC6A 1HB0B 1YLCA 4X2XA 3KQDA 3LC3A 2JKHA 1BUIA 3MI4A 1OXGA 4ZAEA 2OCVB 4J1YA 2AH4X 1V2TT 1GHAG 1TBRH 2BB4A 1VGCC 1P3CA 3RMLH 2BDIA 1GI7B 3P8FA 1QJ6B 4DY7B 1TMUH 3U8RH 2G8TA 5I25A 1TX7A 9ESTA 5JBAS 5L2YH 2VJ1A 1J17T 1O5CB 4BAQB 4O3UA 1GG6C 2P3UB 2BDAA 1FQ3A 5JBCS 1HAZB 1ELCA 1H8DH 5I46H 4GHQA 5FX5A 3W95A 2Z94A 2OD3B 1HAHH 1O2LA 3OTJE 1Y5AT 2AS9A 2P8OB 1Z7KA 2QA9E 3A82A 1GL1A 1C2LA 4BNRA 2WINI 1UCYE 1KLJH 4X8TH 1XUIA 2G55A 1YPKH 2BQWB 4CRBA 3BIUH 4AFZA 1N6XA 1Z71A 4A6LA 1V2MT 1A5GH 3U69H 4WH6A 5LPEA 3L33A 1OP8A 1BITA 1BQYA 1EZUC 3RXPA 4B71A 2ULLA 2ZZUH 5LPFA 1TRNA 3AVZA 3KL6A 2PSYA 3UTUH 1PYTD 3SNCA 2ZI2H 1LQDB 3CS7A 1KXBA 4DGJA 2F9UA 1MKXH 2D26C 3EA7A 4MPUA 1RIWC 5TJXA 4JYUH 2OXSA 4WVPE 1Q3XA 4HZHA 1C1WH 3TJVA 1P2IA 1BRBE 1PPGE 4MPXA 2C8XB 3BTHE 5A2MH 2C8YB 2GX4A 1TLDA 1EAUA 4CREA 2ZFQH 1O3HA 1C4Y2 1NTPA 2B0FA 1NO9H 2OQ5A 3A81A 2XBVA 3SV7A 1K2I1 1TGNA 1L1NA 2Z9IA 5DP4A 3G01A 1NFYA 4WF8A 3TH3H 4JZEH 2C90B 3H7OA 1O3BA 2ODYB 4KTCA 1BOQA 1JWTA 1PPBH 2ZGCA 2QGRA 4GVUA 3BG4B 3ZVEA 1OP2A 1BBRK 4CH8B 4DCDA 1SGQE 1TWXB 1P9SA 4XBCA 5ETXA 2ZDMA 1MTVA 2BLWA 2Y7ZA 1KTTB 2ZDAH 4INKA 2BVXH 1UTMA 2C4FH 2I6QA 2AYWA 2ZDLA 1YF4A 4WXVA 4ZKNU 4NSVA 5C5NA 3S9BA 1OYQA 1EP6A 4BTIB 1RGQA 1LPKB 2ZU5A 5GJ4B 1VJ9U 1YBWA 1MU6B 2W5EA 2CGAA 5LH8A 1WOFA 2ESTE 4FU9A 1GI9B 4JYVH 1QFKH 2XWAA 3RXUA 1G30B 2H5DA 3PWBA 4UFFH 2YNBA 1CA0C 2GZ7A 1QL9A 3S9CA 5FCRA 3TJNA 3MU4A 3P92A 2F9NA 5JBTA 4ZUHA 1ARCA 3ZV9A 4MQAA 3K2UA 1OWHA 3SN8A 4I8HA 2ZF0H 1W8BH 3KHVA 1IQLA 4I32A 1YYY1 4FVDA 1EJAA 3TK9A 2ZFTA 3BN9A 5DP5A 3ATWA 2PR3A 3GY8A 3ENSB 4I31A 1BTXA 2NU4E 1EKBB 1SLWB 4Y71A 3V7TA 2AERH 4J2YB 2A4QA 1C1SA 1G3CA 4NG9H 5CHAC 1G2LA 1Y5BT 1TAWA 1TALA 3SU0A 5A09A 2HNTE 2B7DH 2AIPA 1BT7A 4FUGA 2XBYA 4UEHH 1C1RA 1GBLA 5T6GA 5A0AE 3O8RA 1QGFA 1SGFG 4X2VA 1C2KA 4D8NA 3AAVA 1EJNA 4INHA 4FVBA 3SNAA 4XSKU 2WPJS 3B9FH 3RXRA 3ZZAA 5A8YA 1AFQC 3Q3XA 2C93B 2GD4B 3NPSA 3SUEA 4R8TB 6CHAC 1C5QA 1GI1A 1O3CA 5E0JA 1V2WT 4B73A 1QY6A 4NSYA 5EW2H 2Y81A 3U1IB 3STJA 2FOAA 3U1JB 1CGIE 1C1UH 2Q6FA 3MNSA 1H9IE 3LGVA 4NWLA 3EDXB 2SNVA 1BIOA 3LONA 3TH4H 1NY22 1A5HA 1ETTH 1LVYA 1BB0B 2F3CE 1TA2A 2ZG0H 5FBEA 1VR1H 2OUAA 4U01A 3ODFA 3ZVFA 1C5OH 1TE0A 1DVAH 2ZPQA 1QRWA 2IN2A 1P2JA 2ZC9H 2FOEA 2FTMA 2XCNA 2OLGA 2R0KA 4IN2A 4B75A 2QXHA 1YPLH 1ZRBA 7LPRA 1WTHD 4PROA 3SU6A 1G32B 4ABBA 3DUXH 1PQ8A 4MNVA 4TY7A 5HM2A 5FBIA 1DANH 4XBDA 5A0BA 1LVMA 4YO9A 3ZVCA 2HVXA 2I6SA 5DPAA 2IPHA 1SI5H 2ZU2A 2IJOB 2GT7A 4WH8A 5SGAE 1GMCF 5LGOA 2Z9LA 5DP8A 1QIXB 1G9IE 3GY5A 1GDNA 2CHAB 4JZIA 1RXPA 3LT3A 2VWLA 1ETRH 1F5LA 5FHTA 1QA7A 2Z9GA 2W3IA 1O31A 1XUGA 1PPZA 1MZAA 2PSXA 1GBFA 3O8DA 4YOIA 3TGIE 3GCOA 1HV7A 3SORA 4ABHA 2FYQA 3A7ZA 1NRRH 3SNEA 2R3YA 4GHTA 2CF9H 1EPTC 1ANBA 2ODQA 1W11U 3RMOH 4ABEA 1O2XA 1PPCE 3UY9A 1GHVH 3A7YA 1ABJH 1TNIA 1E38B 3EE0B 4K1EA 4FUBA 2HNTC 3W94A 1LKBA 1P10A 1EPTA 1OWKA 1AUTC 5E0GA 1GJCB 3QN7A 1D3QB 2VGCC 5EW1H 2VIDA 4NIVA 4D9QA 4NIWA 1SLVB 1BMLA 3ZZBA 1J16A 1F2SE 1O2GH 3QTOH 5IYTA 1HAVA 1C5PA 2RCEA 3T62A 2AMPA 4AGKA 1V2VT 1GL0E
chains in the Genus database with same CATH superfamily
3VG8A 3F6UH 4K1TA 3QX5H 3HK6B 4TWYA 1YGCH 5E8EH 3F9HA 4LZ4B 1O3AA 2ZGJA 1QQUA 1TRYA 2BM2A 3E90B 2HOBA 2F43B 1MTWA 3H09A 2XXLA 3RXHA 3DFJA 2GT8A 1NBME 1T32A 4O9VA 4UD9H 4KGAA 1FONA 1A61H 2O8WA 2Z3EA 1FAKH 4OS7A 3KQCA 4UFGH 2PUXB 4DW2U 5C1UA 3MU5A 1P12E 4CBOA 4THNH 3SUDA 3RC5A 4K69A 3SU1A 2CXVA 2XC5A 1OHHD 3ZV8A 3MTYA 3NXPA 3AW1A 1SOTA 2ZQ1A 1O2KA 1SGFA 1C5VA 1UJ1A 3V3MA 1THSH 1BJUA 1EZQA 2QV1A 3PO1B 1PPEE 2J97A 3U8TH 1JIMA 2G5NA 1DM4B 2V3HH 3DCLA 4B2BA 1AU8A 2A32A 1HAIH 1GDUA 4D7GA 3N7DA 3UB0A 1GBJA 3RXVA 2P8OC 2WPHS 3F1SB 4X6PA 3SV2H 2WPMS 1EAWA 1HNEE 1FDPA 1W3CA 3C1KA 4KKDA 4OS1A 3AAUA 1SGPE 1MTUA 1AMHA 1TMTH 2AIQA 1ZGVA 2BY8X 1CGJE 2SGDE 1OWJA 3QLPH 2ZWLH 1SQTA 1A7SA 3SUFA 1NPMA 2AHME 1DXWA 1FY1A 1E37B 1CQQA 1FAXA 2BMGB 3RLYH 3TH2H 1SHHB 2Q6DA 4K1SA 4XDEA 3N7EA 4Y10E 3F2GA 1EP5A 4LOYH 5K7RA 1J14A 3PRBA 3VEQB 4Q63A 1LDTT 1K0HA 4SGAE 1IQGA 1C5XB 3M5LA 1O2PA 3V0XA 4AX9H 1ELBA 3TJOA 3LU9B 1HBTH 1P0SH 2AFQB 2BYAX 1MAYA 4YLUA 1DUAA 1BDAA 1KXDA 1K22H 3M3SA 1HGTH 1INCA 1WCZA 5AHGH 1O2TA 1MMJN 2NU2E 2TGPZ 1WU1A 2SNWA 3OAAD 4ISLA 1HXEH 1B0EA 1MH0A 1QB9A 2P93A 1PPHE 3DSGA 1BTUA 1WTGH 1YCPH 1SC8U 5J4QA 1O34A 1YPHE 2VWOA 2XC4A 1GCTB 2HPQH 2ZU1A 2WSSD 1LVOA 3KQBA 2FP7B 1LO6A 1YPJH 2YMSC 1GBMA 1C5TA 2BDHA 3MQKC 2VVCA 4IW4E 3RM0H 2C8WB 3BTTE 2HVYB 3QUMP 3A86A 3A85A 3BG4C 3LJOA 1O2JA 3ATIA 3KYFA 3QZRA 1CE5A 1EOJA 3JZ2B 2FM2A 1GBEA 2GCTB 1T31A 5DJ7A 2A7HA 3DA9B 1D6RA 1G2MA 2QF0A 1P2QA 4DOQA 4IGDA 1P2NA 1DUEA 1O2SA 1Q31A 2ZECA 3HKJB 4TSFD 4U30A 1LCYA 1SQOA 2FODA 2BY7X 3LKWA 1V2QT 1RTKA 2WZQA 3BEIB 2SGQE 3SBKA 2JH0D 3AK5A 1TABE 2J2UA 2GCHF 3HKIB 5EQQA 4A92A 1THPB 2FI5E 3D65E 4UFDH 3OY6U 1KSNA 4Y0ZE 1XKAC 1ABIH 3VGCC 2K8IA 1CSOE 2ZTZA 2H2ZA 2AMDA 4AC9A 1ZOMA 2GDEH 1KXFA 2HGTH 2QXJA 2V6NA 1P2KA 2STBE 3PV2A 4CR9A 2G4TA 1WBGB 2ZP0H 2VB0A 1P05A 4YESB 2PHBA 3K9XB 3RMMH 1GBHA 3F2HA 7ESTE 3NK8A 2XBXA 1GHAF 3PB1E 3ZZ3A 1C5SA 1IQIA 2F9VA 1B5GH 5JPMH 3HPTB 1GGDB 1O3NA 2JETB 2VH6A 4NFFA 3VFEA 5JDUB 1ZMLA 2ZA5A 2BX4A 2EI6A 1UCYH 1ESBA 2IOTA 1UK3A 4ABGA 4AN7A 2A5KA 2OQUA 2WYJA 4HTCH 1K1NA 3EGKH 5HYOA 3GDSA 3UR9A 3ZZ5A 3RXBA 4ABFA 1V2NT 2Z9JA 4YOJA 2VBCA 1OYTH 1IQFA 1V3XA 2BD2A 1MD7A 4XFQA 1FJSA 2B9LA 1CT2E 1CBWB 3LGIA 2R9PA 4DG4A 4ESTE 1Y5UT 2BOKA 3R0FA 1K21H 4X8SH 4X8VH 2ZHWH 2UWLA 1H1BA 2VINA 4QT8C 2FZZA 1T7CA 4IMQA 1C2GA 3GCNA 1W0ZU 5A8XA 4NIXA 1P01A 1IQNA 4I7YH 2ZNKH 4AFQA 1QQ4A 1Y3UA 3SO3A 3UNRA 3FANA 3OTPA 1YPHC 3S9AA 1YWUA 2V3OH 2FI3E 2PKAB 1E36B 2A4GA 2FOMB 4OS6A 3NWUA 2Y6TA 3FN8A 1C5UA 1EQ9A 1HIAB 2ZFRH 7KMEH 1V2KT 3PMJA 3C27B 1VITF 3GCHB 3MH7A 1QRZA 1JMOH 4P02A 4O3TA 1NRNH 1DWCH 3UOPA 3D62A 1DE7H 4LXBH 4K2YA 1GJ6A 2GKVE 1YPEH 2A4OA 1C9PA 1FPCH 5FPYA 3A89A 2JJ2D 1KLTA 4FUCA 1VITH 4CRCA 4I33A 3TVJB 2JJ1D 1GJ5H 1KY9A 4A5TS 1K1MA 1ACBE 4AG1A 4IBLH 1MTNB 1UTJA 1NBMD 2LPRA 2YMSD 2Q1JA 2F9OA 5FPTA 2NU0E 3MYWA 2GP9B 1GHXH 1S81A 1O36A 2A31A 3ZZ4A 1KMHB 4Q7ZA 1V2RT 1AIXH 1EXFA 4GSOA 1NRQH 4WWYA 2H9TH 1JRSA 2ZO3H 4BXSA 2VU8E 1A3BH 4CBNA 3E1XB 1QJ1B 1A2CH 1C1MA 1ZMNA 1O37A 2D1JA 4AB9A 4HGCA 3TLOA 1MCTA 2PP6A 2Y80A 1GJBB 1AUJA 4VGCC 2OINA 1XUFA 3KIDU 4YZUA 1TIOA 3KNXA 1KTSB 3TNSA 1TMBH 3UPEA 3HGNA 1LPZB 1D3DB 1XVOA 2QF3A 6ESTA 1MABB 1BHXF 1AB9C 4DURA 2HLDD 2DUCA 2HNTF 1A5IA 1TFXA 3EA8A 1LHGH 5F8ZA 1ELVA 1O2QA 2XCFA 5T6FA 1MKWH 2SGPE 1TRMA 1QBOA 3BTME 2GMTB 4B74A 1ORFA 2TGTA 2ZU3A 3ZVAA 1S5SA 2G51A 3PWCA 2QXGA 3T25A 4FU8A 1SVPA 4Q7YA 2ZGBH 3SGBE 1CU1A 2ANKH 1VCWA 1J8AA 1C5RA 5F8XA 1O33A 1W14U 1Z8JB 4ABAA 2J9NA 1TGSZ 3PRDA 3UIRA 2UUKB 2WV4A 2A0QB 1ZHMA 2GTBA 1O5GH 5AFZH 8ESTE 1IQJA 1HPGA 1TPSA 1S84A 1SQAA 1XMNB 3SU4A 2H9HA 1TGTA 2ALVA 4YTAA 3P95A 1QHRB 3KN2A 1FN6A 4AGJA 1BA8B 2QE7D 3SHCH 1CT4E 3BTEE 3N7OA 2UWOA 4BTTB 1G3DA 3E0NB 4ISOA 3A8CA 1WQVH 1FXYA 4KTSA 3SQHE 3MU0A 5HXFA 4ZCNA 4AYYB 1AZZA 3ATLA 1BTHH 1DSUA 1O2RA 2ZKSA 3E8LA 2W6JD 1A4WH 5HMAA 4JCNA 3DSOA 1O39A 4Y11E 5F8TA 2ZHQH 1AD8H 3T28A 5E2OA 3PO1C 1BRCE 4K60A 3Q3YA 2ZDVH 2G52A 1O2NA 2ODPA 1F5RA 1XX9A 4Y8YA 3GYMA 3U9AH 1HCGA 2FI4E 4F49A 4Z6AH 1PFXC 2TPIZ 2ZDKA 1OSSA 2ZIQH 2QC2A 2VVUA 3V12A 1UVUH 1LHEH 1TNKA 2Y7XA 3BEFB 4ZHLU 4O97A 1GMHG 1X7AC 2BLQA 2Y5HA 1W7XH 1FY4A 1SLXB 1SGDE 1YC0A 4K8BA 3U8OH 3A87A 2H1UA 3F9GA 2M2AA 1VZQH 4NWKA 1EB1H 1F0SA 2WYGA 1C2MA 3BF6H 1P06A 4ISIH 1ESTA 4XOJA 4ZHMU 2VIVA 2VNTA 5H4IB 2HPPH 1QB6A 2CJIA 1GBTA 1H9LB 1T8OA 1UMAH 8LPRA 4MVNA 3SNBA 2QAAA 1C1PA 1Y3YA 2XWBI 2FLRH 5GCHG 1Z8GA 3UNSA 5KECA 2QY0B 1GJAB 3RU4T 1EUFA 1SGEE 2F4LA 3UUZA 4E06H 1T8LA 2EC9H 4FUJA 3GDVA 1GHBG 3LDXH 5EIYA 1Z6EA 1AE5A 3PMHB 1GI6A 2HALA 5BPEA 1QURH 3SI4H 5A0CA 2PGQB 1GI8B 3SJ8A 1ID5H 1T4UH 4AFUA 1YCPM 5KEDA 3OEED 3F9EA 3SI3H 2WPLS 2FMJA 1O2ZA 1GCTC 1HAXB 1A1RA 1LPGB 3FFGA 2TGDA 2R3UA 1ZR0A 4MNYA 4ZKRU 2Q6GA 5E2PA 1Q2WA 3UNQA 1GI3A 1GJ7B 1O38A 2ZCLP 2ZGHA 4YM9A 4JK6A 1CT0E 3SV8A 4BANB 2ZCHP 1GVKB 2GCTC 3RXQA 4UE7H 1D4PB 4ZROA 1TQ0B 2V0BA 1DWBH 1Y3WA 2BD4A 4ABDA 3NZIA 4I86A 4Y76A 1AY6H 1GMDG 1O3IA 3RXMA 1V2LT 2G4UA 1ANCA 1ZTJA 1TB6H 1SGTA 4Y6DA 1C2HA 1HLTH 1GBBA 1HFDA 6GCHF 1A46H 1E0FD 2OP9A 8GCHG 1TPOA 3M61U 2F9BH 3VB5A 2GGVB 1MAXA 2D8WA 1AWFH 3MO6A 4DIIH 1T4VH 2ZGXH 4ZH8A 2P95A 3OYPA 1SOZA 2W26A 3ZZDA 1FY3A 1TONA 5EPNA 1BCUH 1P9UA 1S82A 2BDYA 2L6OA 2KAIB 2NU1E 4OS2A 3WWFA 3HGPA 2BVSH 1AHTH 2RG3A 2JH5D 1V6DA 1GVZA 3ZVDA 1GGDC 3PLBA 2JETC 3ATMA 1HJ8A 1BTWA 1O2OA 3DT0H 1FV9A 2YOLA 2GDDA 3P8NA 1SPJA 3EQ0H 1KXCA 3VXEH 3FVFB 3KGPA 3SJKA 4MNXA 1VKYA 1L2EA 2G00A 1GMCG 2BD5A 3VB6A 2P94A 1RD3B 2K0QA 4JK5A 1ESAA 4A1VA 4NZQA 4ISHH 5AVDA 1FX0B 1M9UA 1ELTA 2BVRH 3EAJA 3TK5A 4TYDA 1SLUB 1XVMA 5EG4A 2P3FH 1TA6A 2O8TA 1DICA 1BMMH 4Y7BA 2K1QA 2OC8A 2SGAA 2BDCA 1ELGA 1RRKA 2GZ8A 1FPHH 3ZIAD 4WXIA 3SV9A 3RP2A 4NA8A 1Z6JH 1S0QA 2EI8A 1P57B 4YOGA 1SSXA 3F68H 3A7WA 2AGIX 1MD8A 1PQ5A 3QWCH 2Z6BD 2AGGX 2VVVA 4AZ2B 4BTUB 9LPRA 2FDAA 2A2XH 2BQ6B 3GYLB 3VB3A 4IS5A 3STIA 5AFYH 7GCHG 3GCHC 3RXFA 3SQEE 1QCPA 2PKAA 2J95A 2OC7A 5L6NH 4I8GA 1AN1E 1HIAA 5DP6A 2LNCA 1KLIH 2QXIA 1D3PB 1K1LA 2XTTB 1GBCA 2L74A 1Y3VA 4JYTA 5IDKA 1AQ7A 2BY9X 2QN5T 5TCAA 1IAUA 4K8YA 4GLYA 1YY3A 2NWNA 2VWMA 3A8AA 3D23A 1DWDH 4ABIA 5DO4H 3IG6B 2AGEX 2FOFA 4AFSA 2O8LA 2IPQX 5CHBA 3SGQE 1O30A 4AYVB 1FI8A 3BTKE 5HIZA 1NN6A 1DX5M 5JBBS 4I8LA 3LGUA 1WV7H 1Y8TA 1L4DA 1MKXK 1BBRE 2FIRH 1DSTA 2HWLB 2EQNA 1CO7E 1GPZA 3D49H 3H5CB 4CH2B 1TX8A 1QZ8A 3FZZA 3SV6A 1DPOA 1CHGA 3FO8D 3S0NA 1UTOA 5C3NA 3PM3A 6CHAB 1YKTA 1QR3E 4IN1A 2PW8H 4HG6A 1SR5C 2C8ZB 1W0YH 4ABJA 1UVTH 2J94A 1GJ9B 1QL7A 2SFAA 5GNDA 2UWPA 4B2CA 1IQKA 2WHXA 3SU3A 1FLEE 3KQEA 4OGXA 2ZTYA 3QO6A 1OX1A 4DT4A 3LH1A 3P6ZB 5DKMA 1F5KU 1C5MD 2ZHEH 1THRH 4O03A 1SFIA 4X6MA 2GMTC 3ZZCA 3PTNA 1H8ED 3GDUA 1QRXA 1SGRE 4OGYA 3VXFH 1Z1JA 1V2ST 2FLBH 1AVWA 3KEEA 4H6TA 3PYHA 1UTKA 3K6YA 2A45B 1H4WA 3BIVH 3OFND 4XBBA 1P09A 4F4OC 3IWMA 1MQ5A 5C20A 1DITH 1UTLM 1YPMH 4BAHB 3M7TA 4ZKOU 1OP0A 3BTWE 4GCHF 4RI0A 1LMWB 1NFXA 1O3OA 1VJAU 2OTVA 3SUGA 3M5OA 3IITA 4B6EA 4BXWA 1O2WA 1HAOH 1N1LA 3F3BA 2QF4A 1JXPA 3I77A 4ASHA 3UQOA 1W13U 4DVAU 1D6WA 2G81E 1F0TA 3MNCA 4F55A 2Y5FA 1S83A 1EJMA 2ZPSA 4YXWD 2SGFE 2ZFSA 1O3KA 1P11E 1K1JA 4Q2KA 4WY3A 5HIYA 4DJZB 2FOGA 1JRTA 3ZZ8A 5A8ZA 2BQ7B 4H4FA 3M36A 1F0UA 3FP6E 2FX4A 4JMYA 3RC6A 3E16B 2DE8A 2VIWA 3BV9B 1C5WB 3M3TA 3TIUA 1ARBA 3F0PA 1O3EA 3MMGA 5C0TA 3M3VA 4CHAB 1AKSB 1GI0A 2LP6A 3FP8E 3RM2H 2BLVA 1SGIB 1K1OA 3UOUA 3MU1A 2H6MA 2BXUH 4NA9H 4FXGH 3RXLA 1F92A 1IQMA 1O2MA 1NS3A 4DIHH 2VH0A 3LGYA 1C4U2 3RU4E 2AEIH 4OS5A 1WYKA 5DP3A 3OY5U 4D76A 1UVOA 3MFJA 1C1QA 5C2ZA 4R0IA 2ZPRA 1VCQA 3P8OA 3GCTG 4A1XA 1YLNA 1HJAB 3A8DA 1GWAA 2R2MB 2A7JA 3M35A 1G3EA 1GBAA 3SU5A 5EXNA 3LGWA 1YLDA 3MH5A 4X1NU 1O2VA 2A4RA 1NZQH 2CMYA 3TITA 2BDGA 5DK1A 1ZPCA 3SJOA 3ZZ6A 1ZJKA 2CV3A 4MPVA 3ZVBA 1O2UA 1A3EH 2O8UA 2EA3A 3SZNA 2DE9A 3ELAH 5EQSA 1TNJA 1F0RA 1C5ZB 2CK3D 2WPKS 1WSSH 1CHOG 3BSQA 3O8CA 2PV9B 1QJ7B 1FZZA 1PQAA 3UR6A 4MG3A 3BTFE 2XYAA 4TPIZ 1T8NA 2P16A 1QBNA 1H8HD 1PJPA 1N8OB 3RXGA 3I78A 1XUKA 2B8OH 1HRTH 5C1YA 3RXSA 1L4ZA 2Y82A 3NUMA 1QNJA 3T27A 3A88A 4RT0A 3URDA 5T6DA 3RXKA 2FXRA 4CRDA 2HRVA 5KGOA 1SMFE 2UUFB 4B2AA 3QDZB 3I29A 3QZQA 1ZYOA 4Y8XA 3SW2B 1F7ZA 1NC6A 1TOCB 4ZKSU 3LPRA 3E3TA 5BRRE 5EODA 2KCPA 3SU2A 2AMQA 5FX6A 2BXTH 2RA3A 1AVXA 2PTCE 1ETSH 2ALPA 2XRCA 4X6OA 1DOJA 2CHAC 1O3JA 1FN8A 2BOHB 1A0HB 1SL3A 3A7XA 3ATKA 3U28C 3QK1A 1UK4A 1VCPA 2Z9KA 5FXLA 1QTFA 5T3HA 1AGJA 1K9OE 1OOKB 3R3GB 4CR5A 3T2NA 4FU7A 1RTFB 4SGBE 3T26A 1P03A 3K65B 5C5OA 1TGCA 1BJVA 1VITG 1O0DH 1AWHB 1MZDA 2O9QA 1UK2A 1TNLA 2UUJB 3MWIU 3SHAH 5ABWA 4KELA 2W7UA 5L2ZH 1LKAA 5TCCA 2ZHDA 2QCYA 5F53A 4Q4LA 5FCKA 1Z8IB 2OC0A 3DD2H 1JOUB 4ISNA 1P04A 2FOHA 1T8MA 2KAIA 3DFLA 1NESE 3Q76A 4IMZA 2R0LA 3MNBA 2OC1A 3VPKA 1W10U 2FO9A 4Q80A 2BZ6H 1ZHPA 4A7IB 1RTLA 1K1IA 2BX3A 3M5MA 2A2QH 1O3MA 1O3DA 2Y5GA 1ZGIA 3PROA 5FL7D 3V13A 4I8KA 3S69A 2TIOA 1TOMH 2FX6A 2ANMH 3RDZA 1KDQB 2FTLE 2YMSB 1JBUH 1UO6A 2Z7FE 1TYNA 1XXFA 4U2WA 4AORA 1O2IA 2J98B 4Y8ZA 4X1RU 3EA9A 1H9HE 4FUHA 5F6MA 3LH3A 1PQ7A 1O5AB 2V35A 3LC5A 1DT2A 1GMHF 2PKSB 1HYLA 1V2UT 1UW7A 3KF2A 3UWJH 1OKXA 1P02A 4YT7H 3PLKA 2PWXA 2A7CA 3GY3A 1L0ZA 5ESBA 3PMAB 1NT1A 5DP7A 1A0LA 1LHCH 4RT1A 1GJDB 1TBZH 3OE7D 3EE7A 2KCOA 4D9RA 3KCGH 1S6FA 3QTVH 4AG2A 5PTPA 1MU8B 1NFUA 4NGAH 1XKBC 3MO3A 1C1TA 3VGCB 2F83A 1Z8RA 1C2EA 3LJJA 1ANDA 2GJGA 1EATA 1B7XB 2QIQA 5GWZA 1O5FH 4Y79A 4WJG2 4MPWA 1KXAA 4ZHAA 1MCVA 2F9PA 5DG6A 4GPGA 1HJ9A 4JZ1A 3MO9A 3GY4A 1TPAE 5GCHF 4FUIA 5HKKD 1CGHA 2ILNA 3S7HB 4BAKB 1FNIA 1UHBB 5EPYA 1U6QA 4IC5A 1QB1A 2R2WU 2XC0A 1BRAA 2STAE 1GHBF 3RLWH 2KZ4A 3HK3B 1A0JA 3ZYEA 3SZEA 3RXAA 3A7TA 4Z1MD 4XD7D 5EXMA 2P3TB 3BTQE 1ZZZA 1DLKB 4TWWA 1RJXB 2XW9A 1ZTKA 1KIGH 1GI5A 2BY5X 1MUEB 3E91A 4INLA 4KP0A 4M7GA 3RXOA 1O3FA 2SGEE 3ZVGA 5CE1A 1WQSA 1ZHRA 1XXDA 1V2PT 1GBIA 2KM0A 1IQEA 2ZTXA 3UFAA 3SJ9A 4D7FA 1LVBA 4BOHA 1XUHA 3BG8A 2FPZA 2CF8H 1BMAA 3AW0A 2EEKA 1TQ7B 4FUFA 1GJ8B 1VGCB 1DWEH 4CRAA 1ELFA 2BD3A 3ODDA 1YCPK 2P59A 3K6ZA 4ZMAH 4Q7XA 1GMDF 3BTDE 3GS9A 2ZEBA 1QBVH 3QGNB 5GDSH 4K5ZA 5G4BA 2UUYA 1NM6A 2B5TB 1DXPA 1SQRA 1WAYB 2FS9A 2TGAA 4JZDH 1SB1H 5CMXH 5C67A 3RU4D 1IQHA 2F91A 3JZ1B 1GG6B 2FOBA 8GCHF 1P2MA 2ANWA 1EASA 3GICB 4E7RG 3FP7E 1Y59T 4Y7AA 3M7UA 1NU9A 1S6HA 1C1NA 4HFPB 3U98H 3PMBB 1NRPH 1G3BA 1WUNH 1C2DA 1HDTH 1O2YA 1TNGA 1O5EH 1MBMA 1EAIA 2PUQH 2XNIA 1GBDA 1XUJA 3PTBA 2ANYA 3RC4A 4UFEH 5E0HA 3ZZ7A 5F03A 4AB8A 4UONA 4TY6A 3RXJA 4WMEA 3B8JA 3L6PA 2JH6D 2H9EH 3FAOA 3MH6A 1BZXE 1OPHB 4YT6H 5C0UA 5HGGA 1DS2E 2THFB 1EZXC 4XE4A 3Q77A 5EGMA 1MTSA 5GIBA 2ZDNA 3OU0A 2A5IA 1G36A 2OBQA 2J38A 5JB8S 4NZLA 2TRMA 2BZAA 2GV7A 4UDWH 1WXRA 1EFRD 2BD7A 1BMFD 1ZJDA 3B23B 5T1VA 2O8MA 3TGKE 4VGCB 2Z3CA 1HUTH 2G5VA 4HI3A 1EX3A 1G37A 1RIWB 2BHGA 5JYIA 2ASUB 4CHAC 4Z0KA 1ZRKA 1YP9A 1EZSC 1O2HA 4GAWA 1GVLA 1L1JA 1CVWH 1W12U 2KCYA 1UCYK 1BMNH 1IHTH 2XBWA 1AKSA 1B0FA 3RXCA 5DP9A 1O3LA 1AB9B 1C4V2 5EU8A 2J4IA 4Y0YE 3F2FA 1KYNA 2BDBA 2Z3DA 1UTQA 3RXDA 1HJAC 1HAPH 3VB7A 7GCHF 1C1OA 2A5AA 2W3KA 1P2OA 3A83A 1CBWC 2CN0H 3E0PB 4LZ1H 3SGAE 2VWNA 3RMNH 6GCHG 5EOKA 1NRSH 2OBOA 3A8BA 1GHWH 3PV4A 2FYRA 3URCA 1FY5A 1HXFH 5K0HA 2RDLA 2NU3E 4OS4A 3SNDA 4I8JA 8KME2 1BBRH 1SFQB 1C5LH 1ZSLA 1ELDE 2A1DB 3TK6A 1FMGA 3GY7A 1YM0A 1YPGH 2LELA 2WUBA 1O5BB 1H8IH 4MNWA 3CNRA 5EJLA 3ITIA 4E7NA 1FUJA 2C3SA 2RA0A 2M5TA 1AZ8A 2ZFPH 1FIZA 1AO5A 1TPPA 1BTZA 1E34B 3H7TA 5GPIB 1DDJA 1OWDA 5DGJA 4LK4A 4ZXXH 1ZSKA 3Q3KA 1N8OC 4TPYA 2FWWA 3RUOA 1MQ6A 4RKJB 3S7KB 3CENA 1O32A 3TNTA 3NKKA 1ZPBA 4WMFA 1N6YA 3KYGA 1D3TB 1CA0B 1ELAA 1O3PB 1V2OT 1C2FA 3TGJE 3CP7A 3P17H 2PTNA 3FZDA 3QGJA 1IHSH 4YLQH 2ZQ2A 3A80A 1FIWA 4X2WA 1NFWA 1S85A 2BTCE 1LHDH 4NFEA 1P3EA 2GZ9A 1TX6A 2FESH 3M5NA 4DT7B 4ACBA 1MTNC 2H5CA 3MNXA 4JZFH 3P70B 3ESTA 5FPSA 1O35A 3MH4A 1ELEE 1NROH 1NU7B 3Q00A 3VB4A 5CHAB 1K28D 1J9CH 3WWBA 4X1SU 1C1VH 1KXEA 4X8UH 1GJ4H 2GVFA 2EI7A 3MHWU 1C5YB 3SOSA 2BLOA 2JIZD 1JIRA 3T29A 1SGNE 2ZU4A 1C2IA 2PGBB 3CS0A 1AFQB 1P8VC 1V2JT 5J4SA 2QF5A 1QL8A 2FS8A 3A84A 5L30H 3EYDA 3OSYA 3LGTA 1OWEA 1ZSJA 4B76A 4NA7A 4FOUC 2VIPA 4H6SB 5EJZA 2ZFFH 2ZCKP 3LOXA 1AVGH 1TBQH 1Y3XA 2KFWA 1HAYB 1LQEA 1BRUP 4BAOB 4AOQA 6LPRA 1MKWK 2J92A 1W2KH 3GISB 3GOVB 1ZMJA 1ZTLA 4RKOB 1TNHA 1DY9A 1SGCA 1RS0A 4X1PU 1W7GH 2KX4A 3GY2A 4BAMB 2PFEA 1ANEA 1EB2A 3RXIA 3TPIZ 3GY6A 3O8BA 5C1XA 3PLPA 3ZYDA 5EQRA 2BY6X 2PLXA 3F9FA 3FKSD 1PPFE 2BD8A 5AF9H 1L1GA 3UWIA 1C2JA 4A1TA 5GXPA 1Z1IA 2W6ID 3NCLA 4MLFB 3BEUA 4U32A 2FEQH 4GUXA 2VIQA 1IOEA 3HATH 1GBKA 3PV5A 3OX7U 1KDQA 2ZHFH 3MU8A 4X1QU 1GDQA 3AASA 1UVPA 1BTYA 1SHYA 1O3GA 1UVSH 3P8GA 2J98A 4WMDA 2VIOA 2KR7A 1PYTC 2PKSC 3T5FH 1GI2A 2WPIS 1ZPZA 3E6PH 1DFPA 1OWIA 3M37A 5B6OA 4NCYA 1AE8H 3RXTA 1K1PA 1GHZA 1TGBA 1RFNA 1O5DH 3GCTF 4MTBA 5LPRA 1GI4A 1SGYE 1SG8B 2TBSA 3RXEA 1QA0A 1XM1A 4FUDA 1E35B 3UQVA 1HAGE 1SBWA 1E79D 1AI8H 1GHYH 2RDEA 1DY8A 3DHKH 1FY8E 2IJD1 2GV6A 1E1RD 4FUEA 1S0RA 1UTPA 2D2DA 2BD9A 1EPTB 3BTGE 4K3JA 4X0WU 3M7QA 1EOLA 3MOCA 1BHXB 3UREA 4E05H 1OS8A 2WUCA 1CA8B 1GCDA 2YNAA 5EXLA 4MDSA 4CRFA 1J15A 1LTOA 2FOCA 4GCHG 5HM9A 1CHOF 1HAVB 2VGCB 4H42U 3LIWA 5FAHA 1C5NH 4FETA 1UHBA 4RSPA 3TU7H 4RN6A 3A7VA 2W7SA 3L3TA 4ASUD 4B1TA 2GCHG 3TJUA 4ZXYH 5ESTE 2QYIA 1ZLRA 2WPDD 3WY8A 1D9IA 1EAXA 4KTUA 4X2YA 4CRGA 1W0JD 1MBQA 1BTPA 4NIYA 3SJIA 1AFEH 1UTNA 1C9TA 2HLCA 4X6NA 1DLEA 5JB9S 3ZZ9A 1LHFH 2J34A 2WV5A 4IC6A 1HB0B 1YLCA 4X2XA 3KQDA 3LC3A 2JKHA 1BUIA 3MI4A 1OXGA 4ZAEA 2OCVB 1S6LA 4J1YA 2AH4X 1V2TT 1GHAG 1TBRH 2BB4A 1VGCC 1P3CA 3RMLH 2BDIA 1GI7B 3P8FA 1E1QD 1QJ6B 4DY7B 1TMUH 3U8RH 2V7QD 3SYJA 5DSFA 2G8TA 5I25A 1TX7A 9ESTA 5JBAS 5L2YH 2VJ1A 1J17T 4OM9A 1O5CB 4BAQB 4O3UA 1GG6C 2P3UB 2BDAA 1FQ3A 5JBCS 1HAZB 1ELCA 1H8DH 5I46H 5IK2D 4GHQA 5FX5A 3W95A 2Z94A 3OEHD 2OD3B 4XRNA 1HAHH 1O2LA 3OTJE 1Y5AT 2AS9A 1W0KD 2P8OB 1Z7KA 2QA9E 3A82A 1GL1A 1C2LA 4BNRA 2WINI 1UCYE 1KLJH 4X8TH 5DN6D 1XUIA 2G55A 1YPKH 2BQWB 2J5UA 4CRBA 3BIUH 4AFZA 1N6XA 1Z71A 5B6LA 4A6LA 1V2MT 1A5GH 3U69H 4P00A 4WH6A 5CDFE 5LPEA 3L33A 1OP8A 1BITA 1BQYA 1EZUC 3RXPA 4B71A 2ULLA 2V3MA 2ZZUH 5LPFA 1TRNA 3AVZA 3KL6A 2PSYA 3UTUH 1PYTD 4TT3D 3SNCA 2ZI2H 1LQDB 3CS7A 1KXBA 4DGJA 5EJ1A 2F9UA 3KQ5A 1MKXH 2D26C 3EA7A 4MPUA 1RIWC 5TJXA 4JYUH 2OXSA 4WVPE 1Q3XA 4HZHA 1C1WH 3TJVA 4ACAA 1P2IA 1BRBE 1PPGE 4MPXA 2C8XB 3BTHE 5A2MH 2C8YB 2GX4A 1TLDA 1EAUA 4CREA 2ZFQH 1O3HA 1C4Y2 1NTPA 2B0FA 1NO9H 2OQ5A 3A81A 2XBVA 3SV7A 1K2I1 1TGNA 1L1NA 2Z9IA 5DP4A 2XOKD 3G01A 5C17A 1NFYA 4WF8A 3TH3H 4JZEH 2C90B 3H7OA 1O3BA 4F48B 2ODYB 4KTCA 1BOQA 1JWTA 1PPBH 2ZGCA 2QGRA 4GVUA 3BG4B 3ZVEA 1OP2A 1BBRK 4CH8B 3UAIC 4DCDA 1SGQE 1TWXB 1P9SA 4XBCA 5ETXA 2ZDMA 1MTVA 4M9FA 2BLWA 2Y7ZA 1KTTB 2ZDAH 4INKA 2BVXH 1UTMA 2C4FH 2I6QA 2AYWA 2ZDLA 1YF4A 4WXVA 1COWD 4ZKNU 4NSVA 5C5NA 3S9BA 1OYQA 1EP6A 4BTIB 1RGQA 1LPKB 2ZU5A 5GJ4B 1VJ9U 1YBWA 1MU6B 2W5EA 2CGAA 5LH8A 1WOFA 2ESTE 4FU9A 1GI9B 4JYVH 1QFKH 2XWAA 3RXUA 1G30B 3N99A 2H5DA 1SKYE 3PWBA 4UFFH 2YNBA 1CA0C 2GZ7A 1QL9A 3S9CA 5FCRA 3TJNA 3MU4A 3P92A 2F9NA 5JBTA 4ZUHA 1ARCA 3ZV9A 4MQAA 3K2UA 1OWHA 3SN8A 4I8HA 2ZF0H 1W8BH 2XNDD 1IQLA 3KHVA 1YYY1 4FVDA 1EJAA 4I32A 3TK9A 3W1EA 2ZFTA 3BN9A 5DP5A 3ATWA 2PR3A 3GY8A 3ENSB 4I31A 1BTXA 2NU4E 1EKBB 1SLWB 4Y71A 3V7TA 2AERH 4J2YB 2A4QA 1C1SA 1G3CA 4NG9H 5CHAC 1G2LA 1Y5BT 1TAWA 1TALA 3SU0A 5A09A 2HNTE 2B7DH 2AIPA 1BT7A 4FUGA 2XBYA 4UEHH 1C1RA 1GBLA 5C94A 5T6GA 5A0AE 3O8RA 1QGFA 1SGFG 4X2VA 1C2KA 2RFKC 4D8NA 3AAVA 1EJNA 4INHA 4FVBA 3SNAA 4XSKU 2WPJS 3B9FH 3RXRA 3ZZAA 5A8YA 1AFQC 3Q3XA 2C93B 2GD4B 3NPSA 3SUEA 4R8TB 6CHAC 1C5QA 1GI1A 1O3CA 5E0JA 1V2WT 4B73A 1QY6A 4NSYA 5EW2H 2Y81A 3U1IB 3STJA 2FOAA 3U1JB 3FOAA 1CGIE 1C1UH 2Q6FA 3MNSA 1H9IE 3LGVA 2JDID 4NWLA 3DSPA 3F0OA 2EY4C 3EDXB 2SNVA 1BIOA 3LONA 3TH4H 1NY22 1A5HA 1ETTH 1LVYA 2KCAA 1BB0B 2F3CE 1TA2A 2ZG0H 5FBEA 1VR1H 2OUAA 4U01A 3ODFA 3ZVFA 1C5OH 1TE0A 1DVAH 2ZPQA 1QRWA 2IN2A 1P2JA 2ZC9H 2FOEA 2FTMA 2OK5A 2XCNA 2OLGA 2R0KA 4IN2A 4B75A 2QXHA 1YPLH 1ZRBA 7LPRA 1WTHD 4PROA 3SU6A 1G32B 4ABBA 3DUXH 1PQ8A 4MNVA 4TY7A 5HM2A 5FBIA 1DANH 4XBDA 5A0BA 1LVMA 4YO9A 3ZVCA 2HVXA 2I6SA 5DPAA 2IPHA 1SI5H 2ZU2A 2IJOB 2GT7A 4WH8A 5SGAE 1GMCF 5LGOA 2Z9LA 5DP8A 1QIXB 1G9IE 3GY5A 1GDNA 2CHAB 4JZIA 1RXPA 3LT3A 2VWLA 1ETRH 1F5LA 5FHTA 1QA7A 2Z9GA 2W3IA 1O31A 1XUGA 3NRLA 1PPZA 1MZAA 2PSXA 1GBFA 2WV9A 3O8DA 4YOIA 3GCOA 3TGIE 1HV7A 3SORA 4ABHA 2FYQA 3A7ZA 1NRRH 3SNEA 2R3YA 4GHTA 2CF9H 1EPTC 1ANBA 2ODQA 1W11U 3RMOH 4ABEA 1O2XA 1PPCE 3UY9A 1GHVH 3A7YA 1ABJH 1TNIA 1E38B 3EE0B 4K1EA 4FUBA 2HNTC 3W94A 1LKBA 1P10A 1EPTA 1OWKA 1AUTC 5E0GA 4B6FA 1GJCB 3QN7A 1D3QB 1WDIA 2VGCC 5EW1H 2VIDA 4NIVA 3WW7A 4D9QA 4NIWA 1SLVB 1BMLA 3ZZBA 1J16A 1F2SE 1O2GH 3QTOH 5IYTA 1HAVA 1C5PA 2RCEA 3T62A 2AMPA 4AGKA 1V2VT 1GL0E
chains in the Genus database with same CATH topology
3F6UH 4K1TA 3QX5H 3HK6B 4TWYA 1YGCH 5E8EH 3F9HA 4LZ4B 1O3AA 2ZGJA 1QQUA 1TRYA 2BM2A 3E90B 2HOBA 1MTWA 2XXLA 3RXHA 3DFJA 2GT8A 1T32A 4O9VA 4UD9H 4KGAA 1FONA 1A61H 2O8WA 2Z3EA 1FAKH 4OS7A 3KQCA 4UFGH 2PUXB 4DW2U 5C1UA 3MU5A 1P12E 4CBOA 4THNH 3SUDA 3RC5A 4K69A 3SU1A 2CXVA 2XC5A 3ZV8A 3MTYA 3NXPA 3AW1A 1SOTA 2ZQ1A 1O2KA 1SGFA 1C5VA 1UJ1A 3V3MA 1THSH 1BJUA 1EZQA 2QV1A 3PO1B 1PPEE 3U8TH 1JIMA 2G5NA 1DM4B 2V3HH 4B2BA 1AU8A 2A32A 1HAIH 1GDUA 4D7GA 1GBJA 3RXVA 2P8OC 2WPHS 3F1SB 4X6PA 3SV2H 2WPMS 1EAWA 1HNEE 1FDPA 1W3CA 3C1KA 4KKDA 4OS1A 3AAUA 1SGPE 1MTUA 1AMHA 1TMTH 2AIQA 1ZGVA 2BY8X 1CGJE 2SGDE 1OWJA 3QLPH 2ZWLH 1SQTA 1A7SA 3SUFA 1NPMA 1DXWA 1FY1A 1E37B 1CQQA 1FAXA 2BMGB 3RLYH 3TH2H 1SHHB 2Q6DA 4K1SA 4XDEA 4Y10E 1EP5A 4LOYH 5K7RA 1J14A 3VEQB 1LDTT 4SGAE 1IQGA 1C5XB 3M5LA 1O2PA 3V0XA 4AX9H 1ELBA 3TJOA 3LU9B 1HBTH 1P0SH 2AFQB 2BYAX 1MAYA 4YLUA 1DUAA 1BDAA 1KXDA 1K22H 3M3SA 1HGTH 1INCA 1WCZA 5AHGH 1O2TA 1MMJN 2NU2E 2TGPZ 1WU1A 2SNWA 4ISLA 1HXEH 1B0EA 1MH0A 1QB9A 2P93A 1PPHE 1BTUA 1WTGH 1YCPH 1SC8U 5J4QA 1O34A 1YPHE 2VWOA 2XC4A 1GCTB 2HPQH 2ZU1A 1LVOA 3KQBA 2FP7B 1LO6A 1YPJH 1GBMA 1C5TA 2BDHA 2VVCA 4IW4E 3RM0H 2C8WB 3BTTE 3QUMP 3A86A 3A85A 3BG4C 3LJOA 1O2JA 3ATIA 3QZRA 1CE5A 1EOJA 3JZ2B 2FM2A 1GBEA 2GCTB 1T31A 5DJ7A 2A7HA 3DA9B 1D6RA 1G2MA 2QF0A 1P2QA 4DOQA 4IGDA 1P2NA 1DUEA 1O2SA 1Q31A 2ZECA 3HKJB 4U30A 1LCYA 1SQOA 2FODA 2BY7X 3LKWA 1V2QT 1RTKA 3BEIB 2SGQE 3SBKA 2JH0D 1TABE 2J2UA 2GCHF 3HKIB 5EQQA 4A92A 1THPB 2FI5E 3D65E 4UFDH 3OY6U 1KSNA 4Y0ZE 1XKAC 1ABIH 3VGCC 1CSOE 2ZTZA 2H2ZA 2AMDA 1ZOMA 2GDEH 1KXFA 2HGTH 2QXJA 2V6NA 1P2KA 2STBE 4CR9A 2G4TA 1WBGB 2ZP0H 2VB0A 1P05A 4YESB 2PHBA 3K9XB 3RMMH 1GBHA 7ESTE 3NK8A 2XBXA 1GHAF 3PB1E 3ZZ3A 1C5SA 1IQIA 2F9VA 1B5GH 5JPMH 3HPTB 1GGDB 1O3NA 2JETB 2VH6A 4NFFA 3VFEA 5JDUB 1ZMLA 2ZA5A 2BX4A 2EI6A 1UCYH 1ESBA 2IOTA 1UK3A 4ABGA 4AN7A 2A5KA 2OQUA 2WYJA 4HTCH 1K1NA 3EGKH 5HYOA 3GDSA 3UR9A 3ZZ5A 3RXBA 4ABFA 1V2NT 2Z9JA 4YOJA 1OYTH 1IQFA 1V3XA 2BD2A 1MD7A 4XFQA 1FJSA 2B9LA 1CT2E 1CBWB 3LGIA 2R9PA 4DG4A 4ESTE 1Y5UT 2BOKA 3R0FA 1K21H 4X8SH 4X8VH 2ZHWH 2UWLA 1H1BA 2VINA 4QT8C 2FZZA 1T7CA 4IMQA 1C2GA 3GCNA 1W0ZU 5A8XA 4NIXA 1P01A 1IQNA 4I7YH 2ZNKH 4AFQA 1QQ4A 1Y3UA 3SO3A 3UNRA 3FANA 1YPHC 3S9AA 2V3OH 2FI3E 2PKAB 1E36B 2A4GA 2FOMB 4OS6A 3NWUA 2Y6TA 1C5UA 1EQ9A 1HIAB 2ZFRH 7KMEH 1V2KT 3PMJA 3C27B 1VITF 3GCHB 3MH7A 1QRZA 1JMOH 4O3TA 1NRNH 1DWCH 3UOPA 3D62A 1DE7H 4LXBH 4K2YA 1GJ6A 2GKVE 1YPEH 2A4OA 1C9PA 1FPCH 5FPYA 3A89A 1KLTA 4FUCA 1VITH 4CRCA 4I33A 3TVJB 1GJ5H 1KY9A 4A5TS 1K1MA 1ACBE 4AG1A 4IBLH 1MTNB 1UTJA 2LPRA 2Q1JA 2F9OA 5FPTA 2NU0E 3MYWA 2GP9B 1GHXH 1S81A 1O36A 2A31A 3ZZ4A 4Q7ZA 1V2RT 1AIXH 1EXFA 4GSOA 1NRQH 4WWYA 2H9TH 1JRSA 2ZO3H 4BXSA 2VU8E 1A3BH 4CBNA 3E1XB 1QJ1B 1A2CH 1C1MA 1ZMNA 1O37A 2D1JA 4AB9A 4HGCA 3TLOA 1MCTA 2Y80A 1GJBB 1AUJA 4VGCC 2OINA 1XUFA 3KIDU 4YZUA 1TIOA 3KNXA 1KTSB 3TNSA 1TMBH 3UPEA 3HGNA 1LPZB 1D3DB 1XVOA 2QF3A 6ESTA 1BHXF 1AB9C 4DURA 2DUCA 2HNTF 1A5IA 1TFXA 3EA8A 1LHGH 5F8ZA 1ELVA 1O2QA 2XCFA 5T6FA 1MKWH 2SGPE 1TRMA 1QBOA 3BTME 2GMTB 4B74A 1ORFA 2TGTA 2ZU3A 3ZVAA 1S5SA 2G51A 3PWCA 2QXGA 3T25A 4FU8A 1SVPA 4Q7YA 2ZGBH 3SGBE 1CU1A 2ANKH 1VCWA 1J8AA 1C5RA 5F8XA 1O33A 1W14U 1Z8JB 4ABAA 2J9NA 1TGSZ 3UIRA 2UUKB 2WV4A 2A0QB 1ZHMA 2GTBA 1O5GH 5AFZH 8ESTE 1IQJA 1HPGA 1TPSA 1S84A 1SQAA 1XMNB 3SU4A 2H9HA 1TGTA 2ALVA 4YTAA 3P95A 1QHRB 3KN2A 1FN6A 4AGJA 1BA8B 3SHCH 1CT4E 3BTEE 3N7OA 2UWOA 4BTTB 1G3DA 3E0NB 4ISOA 3A8CA 1WQVH 1FXYA 4KTSA 3SQHE 3MU0A 5HXFA 4AYYB 1AZZA 3ATLA 1BTHH 1DSUA 1O2RA 2ZKSA 3E8LA 1A4WH 5HMAA 4JCNA 1O39A 4Y11E 5F8TA 2ZHQH 1AD8H 3T28A 5E2OA 3PO1C 1BRCE 4K60A 3Q3YA 2ZDVH 2G52A 1O2NA 2ODPA 1F5RA 1XX9A 4Y8YA 3GYMA 3U9AH 1HCGA 2FI4E 4F49A 4Z6AH 1PFXC 2TPIZ 2ZDKA 1OSSA 2ZIQH 2QC2A 2VVUA 3V12A 1UVUH 1LHEH 1TNKA 2Y7XA 3BEFB 4ZHLU 4O97A 1GMHG 1X7AC 2BLQA 2Y5HA 1W7XH 1FY4A 1SLXB 1SGDE 1YC0A 4K8BA 3U8OH 3A87A 2H1UA 3F9GA 1VZQH 4NWKA 1EB1H 1F0SA 2WYGA 1C2MA 3BF6H 1P06A 4ISIH 1ESTA 4XOJA 4ZHMU 2VIVA 2VNTA 5H4IB 2HPPH 1QB6A 2CJIA 1GBTA 1H9LB 1T8OA 1UMAH 8LPRA 4MVNA 3SNBA 2QAAA 1C1PA 1Y3YA 2XWBI 2FLRH 5GCHG 1Z8GA 3UNSA 2QY0B 1GJAB 3RU4T 1EUFA 1SGEE 3UUZA 4E06H 1T8LA 2EC9H 4FUJA 3GDVA 1GHBG 3LDXH 1Z6EA 1AE5A 3PMHB 1GI6A 2HALA 5BPEA 1QURH 3SI4H 5A0CA 2PGQB 1GI8B 3SJ8A 1ID5H 1T4UH 4AFUA 1YCPM 3F9EA 3SI3H 2WPLS 2FMJA 1O2ZA 1GCTC 1HAXB 1A1RA 1LPGB 3FFGA 2TGDA 2R3UA 1ZR0A 4MNYA 4ZKRU 2Q6GA 5E2PA 1Q2WA 3UNQA 1GI3A 1GJ7B 1O38A 2ZCLP 2ZGHA 4YM9A 4JK6A 1CT0E 3SV8A 4BANB 2ZCHP 1GVKB 2GCTC 3RXQA 4UE7H 1D4PB 4ZROA 1TQ0B 2V0BA 1DWBH 1Y3WA 2BD4A 4ABDA 3NZIA 4Y76A 1AY6H 1GMDG 1O3IA 3RXMA 1V2LT 2G4UA 1ANCA 1ZTJA 1TB6H 1SGTA 4Y6DA 1C2HA 1HLTH 1GBBA 1HFDA 6GCHF 1A46H 1E0FD 2OP9A 8GCHG 1TPOA 3M61U 2F9BH 3VB5A 2GGVB 1MAXA 2D8WA 1AWFH 3MO6A 4DIIH 1T4VH 2ZGXH 4ZH8A 2P95A 3OYPA 1SOZA 2W26A 3ZZDA 1FY3A 1TONA 5EPNA 1BCUH 1P9UA 1S82A 2BDYA 2KAIB 2NU1E 4OS2A 3HGPA 2BVSH 1AHTH 2RG3A 2JH5D 1V6DA 1GVZA 3ZVDA 1GGDC 3PLBA 2JETC 3ATMA 1HJ8A 1BTWA 1O2OA 3DT0H 1FV9A 2YOLA 2GDDA 3P8NA 1SPJA 3EQ0H 1KXCA 3VXEH 3FVFB 3KGPA 3SJKA 4MNXA 1L2EA 2G00A 1GMCG 2BD5A 3VB6A 2P94A 1RD3B 4JK5A 1ESAA 4A1VA 4NZQA 4ISHH 5AVDA 1M9UA 1ELTA 2BVRH 3EAJA 3TK5A 4TYDA 1SLUB 1XVMA 5EG4A 2P3FH 1TA6A 2O8TA 1DICA 1BMMH 4Y7BA 2K1QA 2OC8A 2SGAA 2BDCA 1ELGA 1RRKA 2GZ8A 1FPHH 4WXIA 3SV9A 3RP2A 4NA8A 1Z6JH 1S0QA 2EI8A 1P57B 4YOGA 1SSXA 3F68H 3A7WA 2AGIX 1MD8A 1PQ5A 3QWCH 2Z6BD 2AGGX 2VVVA 4AZ2B 4BTUB 9LPRA 2FDAA 2A2XH 2BQ6B 3GYLB 3VB3A 4IS5A 3STIA 5AFYH 7GCHG 3GCHC 3RXFA 3SQEE 1QCPA 2PKAA 2J95A 2OC7A 5L6NH 4I8GA 1AN1E 1HIAA 5DP6A 2LNCA 1KLIH 2QXIA 1D3PB 1K1LA 2XTTB 1GBCA 1Y3VA 4JYTA 5IDKA 1AQ7A 2BY9X 2QN5T 5TCAA 1IAUA 4K8YA 4GLYA 2VWMA 2NWNA 3A8AA 3D23A 1DWDH 4ABIA 5DO4H 3IG6B 2AGEX 2FOFA 4AFSA 2O8LA 3SGQE 1O30A 4AYVB 1FI8A 3BTKE 1NN6A 1DX5M 5JBBS 4I8LA 3LGUA 1WV7H 1Y8TA 1L4DA 1MKXK 1BBRE 2FIRH 1DSTA 2HWLB 1CO7E 1GPZA 3D49H 3H5CB 4CH2B 1TX8A 3FZZA 3SV6A 1DPOA 1CHGA 3S0NA 1UTOA 5C3NA 3PM3A 6CHAB 1YKTA 1QR3E 4IN1A 2PW8H 1SR5C 2C8ZB 1W0YH 4ABJA 1UVTH 2J94A 1GJ9B 1QL7A 2SFAA 2UWPA 4B2CA 1IQKA 3SU3A 1FLEE 3KQEA 4OGXA 2ZTYA 3QO6A 1OX1A 3LH1A 3P6ZB 5DKMA 1F5KU 1C5MD 2ZHEH 1THRH 4O03A 1SFIA 4X6MA 2GMTC 3ZZCA 3PTNA 3GDUA 1QRXA 1SGRE 4OGYA 3VXFH 1Z1JA 1V2ST 2FLBH 1AVWA 3KEEA 4H6TA 3PYHA 1UTKA 3K6YA 2A45B 1H4WA 3BIVH 4XBBA 1P09A 4F4OC 3IWMA 1MQ5A 5C20A 1DITH 1UTLM 1YPMH 4BAHB 3M7TA 4ZKOU 1OP0A 3BTWE 4GCHF 1LMWB 1NFXA 1O3OA 1VJAU 2OTVA 3SUGA 3M5OA 3IITA 4BXWA 1O2WA 1HAOH 1N1LA 1JXPA 3I77A 4ASHA 3UQOA 1W13U 4DVAU 1D6WA 2G81E 1F0TA 3MNCA 2Y5FA 1S83A 1EJMA 2ZPSA 2SGFE 2ZFSA 1O3KA 1P11E 1K1JA 4Q2KA 4WY3A 4DJZB 2FOGA 1JRTA 3ZZ8A 5A8ZA 2BQ7B 4H4FA 3M36A 1F0UA 3FP6E 2FX4A 4JMYA 3RC6A 3E16B 2DE8A 2VIWA 3BV9B 1C5WB 3M3TA 3TIUA 1ARBA 1O3EA 3MMGA 3M3VA 4CHAB 1AKSB 1GI0A 3FP8E 3RM2H 2BLVA 1SGIB 1K1OA 3UOUA 3MU1A 2H6MA 2BXUH 4NA9H 4FXGH 3RXLA 1F92A 1IQMA 1O2MA 1NS3A 4DIHH 2VH0A 3LGYA 1C4U2 3RU4E 2AEIH 4OS5A 1WYKA 5DP3A 3OY5U 4D76A 1UVOA 3MFJA 1C1QA 5C2ZA 4R0IA 2ZPRA 1VCQA 3P8OA 3GCTG 4A1XA 1HJAB 3A8DA 1GWAA 2R2MB 2A7JA 3M35A 1G3EA 1GBAA 3SU5A 5EXNA 3LGWA 1YLDA 3MH5A 4X1NU 1O2VA 2A4RA 1NZQH 2CMYA 3TITA 2BDGA 5DK1A 1ZPCA 3SJOA 3ZZ6A 1ZJKA 2CV3A 4MPVA 3ZVBA 1O2UA 1A3EH 2O8UA 2EA3A 3SZNA 2DE9A 3ELAH 5EQSA 1TNJA 1F0RA 1C5ZB 2WPKS 1WSSH 1CHOG 3BSQA 3O8CA 2PV9B 1QJ7B 1FZZA 1PQAA 3UR6A 4MG3A 3BTFE 2XYAA 4TPIZ 1T8NA 2P16A 1QBNA 1PJPA 1N8OB 3RXGA 3I78A 1XUKA 2B8OH 1HRTH 5C1YA 3RXSA 1L4ZA 2Y82A 3NUMA 1QNJA 3T27A 3A88A 3URDA 5T6DA 3RXKA 2FXRA 4CRDA 2HRVA 1SMFE 2UUFB 4B2AA 3QDZB 3I29A 3QZQA 1ZYOA 4Y8XA 3SW2B 1F7ZA 1NC6A 1TOCB 4ZKSU 3LPRA 3E3TA 5BRRE 5EODA 3SU2A 2AMQA 5FX6A 2BXTH 2RA3A 1AVXA 2PTCE 1ETSH 2ALPA 2XRCA 4X6OA 1DOJA 2CHAC 1O3JA 1FN8A 2BOHB 1A0HB 1SL3A 3A7XA 3ATKA 3QK1A 1UK4A 1VCPA 2Z9KA 5FXLA 1QTFA 5T3HA 1AGJA 1K9OE 1OOKB 3R3GB 4CR5A 3T2NA 4FU7A 1RTFB 4SGBE 3T26A 1P03A 3K65B 5C5OA 1TGCA 1BJVA 1VITG 1O0DH 1AWHB 1MZDA 2O9QA 1UK2A