1BOQA

Pro region c-terminus: protease active site interactions are critical in catalyzing the folding of alpha-lytic protease
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNITANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ALPHA-LYTIC PROTEASE)
publication title Pro region C-terminus:protease active site interactions are critical in catalyzing the folding of alpha-lytic protease.
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1998-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1boqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1boqA01
3U1JB 4BAOB 1IQHA 1DXPA 1W0ZU 5EG4A 2ZFTA 5JBBS 4F4OC 2ZF0H 2GMTC 1BRBE 1N6YA 2BXUH 5LPFA 5G4BA 1TNHA 2ZFSA 1EP6A 2FEQH 3RXPA 3LIWA 1FUJA 1G36A 5L2ZH 2NU3E 1MKWH 2B5TB 1GBBA 1MD8A 1TX7A 5HXFA 1ZHMA 2C8XB 1C9PA 4BXSA 1O3LA 1VR1H 2A4GA 1GBCA 1UVSH 1AHTH 2BZAA 2QC2A 1GJDB 2THFB 3E3TA 1NFYA 1NRPH 4GAWA 2J4IA 4FUIA 2ASUB 2ZPSA 4UFDH 4Q80A 2A7JA 4HTCH 3OYPA 1JXPA 1O30A 2FTLE 1Q31A 3F1SB 4TY7A 5EPYA 1O3FA 1P01A 1Z71A 3NKKA 1ZPBA 1BRUP 1ZMLA 2GT7A 2ULLA 1GHBG 4FXGH 1EAWA 5BPEA 1P2OA 3Q77A 9ESTA 1O2YA 2TIOA 1EKBB 1ZHRA 3BIVH 3RLYH 1QB1A 1ELCA 4THNH 3SV2H 1TRNA 3ELAH 4HFPB 1UK3A 4IS5A 1GI4A 1WUNH 1ELAA 4IW4E 1Y5UT 3MH5A 1BHXF 3SJIA 3R0FA 1DICA 1C1MA 2FESH 3VGCB 3CP7A 1PJPA 4TY6A 4NZLA 2QV1A 2K1QA 1SMFE 1GDQA 2WPLS 3RXQA 1C2MA 1X7AC 4KELA 1C9TA 4DURA 2O8TA 2BMGB 4I8JA 2AH4X 1O3MA 1EATA 1DUAA 3MO9A 2KAIB 1O3IA 4YT7H 1C5LH 1BRCE 2SGAA 1ARBA 4B73A 3S7KB 5GWZA 2ZDMA 1FIWA 4BOHA 2HVXA 4U30A 3SU1A 1GJ7B 4I8LA 1C5TA 2FX6A 1O3HA 2F3CE 3RXEA 1W13U 3C1KA 1MQ5A 3B8JA 2ZHWH 4X8TH 4JZFH 2FLBH 3ZVDA 2SFAA 1SC8U 1TNJA 1F0RA 1WTHD 3F9GA 1THRH 2SGQE 2A1DB 1GHBF 4BTTB 3A7YA 1GJCB 4MDSA 3TJUA 4GHQA 4OGXA 3PM3A 3A8AA 4WXIA 4AG1A 3W94A 1MQ6A 5EOKA 1DWEH 1TPAE 2H6MA 1EPTB 2ZGCA 3PO1B 2VNTA 4ZROA 1PQ8A 3SJOA 1SGRE 2KAIA 2FO9A 1HPGA 3GYMA 2ZDVH 1C5YB 4I8KA 1RTFB 3A87A 4IC6A 3I29A 1BHXB 4KTCA 2Y7XA 4AFZA 1ELTA 1DANH 1AY6H 2Z9JA 3NZIA 2HLCA 5T3HA 1QA0A 1AO5A 3RXIA 2FP7B 5GJ4B 1KDQB 5ABWA 2ODQA 3MO3A 3M3TA 2GV7A 2EA3A 1VCPA 2SGPE 3OY6U 2BX3A 3FZZA 4BAQB 2TGPZ 3RU4T 4ABGA 1QY6A 3HATH 1ZGVA 1HAOH 3D65E 3STIA 1EPTA 1ESAA 2FI3E 3UNRA 1T32A 3FVFB 3I77A 5CHAC 1HFDA 1C5VA 3JZ2B 2D1JA 4BANB 2WV5A 2XBWA 1FMGA 1TOCB 4E7NA 3AASA 3E91A 3VEQB 3ZV9A 5EW2H 1F7ZA 1MU6B 3TK5A 1MTSA 1QGFA 2FOAA 1LDTT 1KDQA 2W5EA 3RUOA 3VB3A 3M7QA 2RA3A 1UHBA 2H2ZA 8ESTE 2GP9B 3LGIA 3GISB 3P6ZB 3E0NB 1ANCA 2ZEBA 4NIWA 1ZOMA 1ZRBA 1VGCB 2FYQA 3U8TH 1UTLM 1BTWA 2ZDAH 2A31A 1D3DB 3MO6A 1SGFA 4NA9H 1ZRKA 1AFQC 4WY3A 1SLUB 1O38A 2OCVB 3UNQA 4ZKRU 2WYJA 5H4IB 1QBOA 3TVJB 1O5GH 1QNJA 4Y0YE 4XBDA 2XRCA 1SFIA 1O39A 3GCHC 1C4V2 3BSQA 1OX1A 2ZFFH 4X6NA 1TBQH 1W7XH 1WQSA 4DGJA 2ILNA 2A4RA 5DP6A 1B0FA 5AFZH 3Q3XA 2EI8A 1V2TT 3BEFB 1MKXK 1A61H 4AFUA 3DFLA 1C5RA 1LHGH 1IHSH 1RFNA 4H6SB 5GXPA 2HNTC 4YOGA 2W7SA 1GMDG 4AFQA 2DE9A 1YLCA 1QIXB 4Y71A 3GY7A 5C3NA 1A0JA 1K1NA 1XUFA 4X8VH 3TH3H 1F2SE 4INKA 5FPSA 2BX4A 2V0BA 4NGAH 2A5AA 2F9OA 4XE4A 1U6QA 4NWKA 1GCTC 2ZTZA 1FDPA 3LC3A 1TALA 2CHAC 1FPHH 3PB1E 4Y11E 4K8BA 1YCPM 4BNRA 2AERH 1NFWA 1SVPA 5EODA 2FX4A 1BMLA 1QBVH 4X1RU 3O8CA 5LPEA 4GCHF 3HGPA 4X1QU 2PKSB 3PMBB 5K0HA 2PUXB 2GCHF 2FM2A 2P8OC 2FOCA 4ASHA 2GDDA 1WOFA 3RXJA 1ANBA 1RIWC 2BD4A 1BTPA 1WSSH 4MNWA 2PW8H 1EJMA 1C2EA 1CHGA 1TNIA 3SUFA 4ZXYH 2WPJS 1L1NA 2AMDA 1GMDF 1A46H 1V2LT 1ANDA 1G9IE 1TGBA 3BTTE 3O8BA 1V3XA 1P8VC 3RXBA 1S81A 4LOYH 5A8YA 1XMNB 3TGJE 1NRRH 4X6OA 3T62A 2JETB 2RA0A 2G4TA 4IBLH 1D3PB 3QZQA 3A7ZA 2VIPA 4ZMAH 1SGEE 1HNEE 3B23B 3LH1A 4SGBE 3UOPA 3VB4A 3A80A 2SGEE 2XNIA 4Y7AA 1G30B 1ABIH 1MAXA 2TGAA 4ESTE 4H6TA 2BM2A 2FOEA 3NXPA 4ZHMU 1QFKH 3T27A 1E35B 3SV7A 1XVMA 2B0FA 4MPXA 3STJA 2M5TA 1LVYA 1ABJH 2CV3A 1Z6EA 1C1TA 1MZAA 1RTKA 4WH6A 1UCYH 1HJAB 4I7YH 1E38B 2GDEH 3VB7A 3QX5H 1FI8A 5GDSH 2Z3CA 1C5XB 4F49A 1MMJN 2GX4A 4WMFA 2Y5GA 2ZKSA 1IHTH 1AQ7A 1GJ5H 5CHAB 2JH5D 4Y8XA 1A3BH 2R2MB 2JH0D 4DG4A 1O2KA 1TPPA 1V2OT 1ZMJA 3E1XB 3GOVB 1GHYH 3A8CA 2H9HA 2QF3A 1C5NH 2QIQA 3BTGE 1ESBA 2WV4A 5DP8A 2P59A 3TGKE 1TRYA 2TRMA 3HGNA 1MTNC 1QL8A 1C1VH 5C1XA 1SQTA 5C20A 1PPCE 4FUCA 4AG2A 1JIMA 1PPGE 1EB1H 1O2ZA 5PTPA 1AU8A 3F9FA 3TJNA 1QRXA 2D2DA 1Y3VA 2BDHA 3M3SA 4HGCA 4R0IA 4JMYA 5FCKA 1W10U 1GG6C 5GCHF 3EQ0H 1HAYB 4RSPA 1O35A 5JYIA 4MNYA 1BBRE 3GCHB 4OS1A 1TONA 2PGQB 4JYTA 2ZCLP 3KQBA 3NUMA 1DSTA 3PLPA 1KXFA 1P2MA 3SOSA 3OX7U 2GZ8A 5C5NA 1NRQH 2Z3DA 1TPOA 2V3HH 2EEKA 1K1LA 1FY4A 2G52A 1TYNA 4WMEA 4K1EA 5ESTE 2AMPA 3H7OA 5DP5A 1C2KA 2C8ZB 1ZGIA 2W3KA 2GVFA 4A1VA 1O3EA 5A0AE 1T4VH 4TYDA 3SHAH 2OBOA 4KGAA 3M36A 1S5SA 1WQVH 1JBUH 2SGDE 1EP5A 1GBLA 1RGQA 4YO9A 2BDBA 1SFQB 1O33A 1GCTB 1UTNA 2OC1A 4IMQA 4CR9A 3P8OA 5FHTA 4ABDA 4DOQA 1TX8A 2PHBA 1SR5C 1NY22 1YF4A 1C4U2 1FJSA 1LVBA 1O2PA 5DG6A 3NK8A 1TX6A 2P8OB 3RXVA 4YLUA 2VIOA 1C1WH 1Z8IB 3TK6A 1TGCA 1P06A 5GPIB 2PTNA 1P3CA 2Q6DA 4AGKA 1BMNH 1GI3A 4DY7B 1ETSH 3F6UH 1Y3XA 1G32B 1CGIE 5T6GA 2GKVE 5AFYH 3VGCC 4KKDA 4ZHAA 1FZZA 1AUJA 2QCYA 1HV7A 1GVLA 4GSOA 2ZTYA 1MU8B 4AYYB 1YPMH 1CGJE 1AVWA 2Y81A 1P0SH 1IQKA 5F8XA 3V0XA 2BLOA 3DT0H 3V13A 1N8OC 2F9UA 3SJ9A 1EB2A 2WPIS 1OWDA 2ZG0H 7LPRA 2A4OA 1PPEE 3VB6A 1P2IA 2OD3B 2BDYA 2FI5E 2XC4A 2BVRH 2I6SA 1GI7B 2Y5HA 4Q2KA 1NU9A 2GV6A 3V7TA 2A5KA 4MLFB 1YCPK 3KGPA 1TGNA 1DVAH 1NT1A 2ZHEH 3BF6H 4Q7XA 2Z94A 4A1TA 4BAMB 2TGDA 1EPTC 4JZ1A 2AYWA 3PO1C 1FLEE 2BOHB 1WV7H 1TBZH 1TNGA 2ZU1A 3PYHA 4J1YA 2ZA5A 3SNDA 1TIOA 1ZSKA 3O8RA 4YOJA 1P2JA 2OBQA 4UONA 4TPIZ 3ZVAA 3U98H 2ANMH 3RXHA 3V12A 1T8LA 1TNLA 1OP2A 3UY9A 2VIDA 3BTWE 1T4UH 4DJZB 3PTBA 2PR3A 4CHAC 3Q3KA 1LPGB 3U69H 1C5ZB 5L30H 3U8RH 2DE8A 1ANEA 1NS3A 2F9VA 2HNTE 1IQLA 3M5MA 1C2GA 1C2FA 1P2QA 1Y59T 4MPWA 1O3JA 3VFEA 3A7VA 1TRMA 4AN7A 4X1NU 3C27B 2AIPA 3MNSA 1P12E 4FU7A 1Z7KA 6CHAC 1P9SA 2Y6TA 3OU0A 2ZDNA 3GDVA 3QK1A 1GI5A 2VVCA 3VXEH 4OS6A 3ODFA 3SUDA 1GBMA 2ZNKH 4DVAU 4Z0KA 3QDZB 3SV8A 4X1SU 5FCRA 1S0QA 1VGCC 1V2WT 1T7CA 2V35A 3IWMA 1F5RA 2A45B 2Y7ZA 5JBAS 1A3EH 3UOUA 4K2YA 1EZXC 2HPPH 5IYTA 3UQVA 1BBRK 1J8AA 4QT8C 1LPZB 3SHCH 2FYRA 3RP2A 2VINA 3ZZ3A 3P70B 4FU8A 1HJ9A 1TNKA 1KLJH 1EJAA 1C5WB 2WINI 3IG6B 1O3AA 1V2ST 2ZPRA 1TGTA 1VCWA 1RXPA 1NPMA 4NFFA 3LPRA 1GPZA 1AZ8A 3A84A 1GBIA 4NZQA 2CMYA 4WMDA 1QR3E 4U01A 4XBBA 1C1NA 1E0FD 1O2XA 2BDAA 4A5TS 1C5OH 3H5CB 4H42U 2ZI2H 3A86A 3UTUH 2VU8E 3SU5A 3A89A 5HM9A 4GPGA 1GJ8B 2G81E 3EA8A 1SQAA 3KN2A 1IQGA 2AMQA 4ABHA 1D4PB 1BOQA 3MU0A 3KEEA 2PKSC 4X2YA 1W3CA 1ZZZA 3PMAB 1P2KA 1O0DH 3L33A 3RC4A 2FOFA 3A82A 3SGQE 1BUIA 1C2HA 3BEIB 1HUTH 2A2XH 2R2WU 1EX3A 1N8OB 1F0UA 3TPIZ 4BTIB 1Z6JH 1VCQA 1ZMNA 3AW0A 3K2UA 2Q6FA 3IITA 1GI9B 1IQJA 4JYUH 1ACBE 1L2EA 4O97A 1IQFA 2ZTXA 3MNBA 4FUGA 1TB6H 3ZZ9A 5JBCS 1J14A 3UR6A 1DY8A 2XWAA 3DA9B 1AIXH 1LHCH 2CXVA 1MTUA 2JETC 1MKWK 1DLEA 3JZ1B 4MPVA 1O2SA 2BQ6B 3EGKH 3Q00A 4B2CA 6LPRA 3E6PH 1ID5H 1B0EA 1O5EH 1YGCH 1O2LA 2PGBB 4FVBA 1K1OA 1V6DA 3MOCA 2FPZA 1DWCH 1AFEH 3UWIA 4Y0ZE 1CVWH 3LH3A 3MMGA 4FUBA 4FUEA 1LVOA 2A5IA 1MKXH 2FWWA 1O5DH 1DPOA 4VGCB 4JK6A 5DP3A 3M5NA 4MPUA 2P3TB 2B7DH 1GBHA 3LU9B 4LK4A 4CHAB 1IQIA 2ZQ2A 1IQNA 3A81A 2XBVA 1HJAC 2B8OH 1HYLA 1O3OA 2O8MA 3RDZA 2WUBA 1OWKA 3SQEE 1LPKB 1HAHH 2P94A 3TNTA 2XYAA 2VVVA 3FAOA 3MYWA 4I33A 2VIVA 4X8SH 3UPEA 2RCEA 4MNXA 2BQWB 2ZPQA 1CBWB 1ETRH 2IOTA 4Y79A 1C1PA 1ELDE 1ESTA 1Y5BT 6CHAB 5EW1H 5L6NH 3SGAE 3AAUA 1PPHE 1LMWB 1O2QA 5A8XA 4ZKNU 1EASA 3M37A 2BVSH 2P95A 5FX5A 2TPIZ 1NFXA 2BD2A 1O2RA 4WXVA 3EE0B 4B2BA 1WU1A 4CH2B 2GTBA 1BB0B 1EQ9A 3RMOH 3Q76A 4GLYA 1MCTA 2XCFA 2G8TA 4YT6H 1GVZA 1CT4E 1FY3A 1JRSA 1GJ4H 2AGGX 2BD7A 5GIBA 4NSYA 3HKIB 1G3BA 1BJUA 4IN1A 1O3DA 1LKAA 3FZDA 2BY8X 1QL9A 4XOJA 1A2CH 3FP6E 1CQQA 1K9OE 5ETXA 3LJOA 1FY1A 3LGUA 4XFQA 1O2JA 1SBWA 1UCYE 5T6DA 1O3CA 4ZXXH 5LH8A 4ISLA 2FODA 1HAXB 3T29A 3DHKH 1H8IH 2G5VA 5E0GA 1T8OA 2W26A 1LKBA 1GBAA 2QGRA 1YC0A 1SG8B 1OOKB 4D9QA 3TIUA 1MTWA 1XKAC 1TOMH 3KL6A 3PMHB 1K21H 8LPRA 2I6QA 1FIZA 1S84A 4X8UH 3PTNA 2BXTH 1OXGA 1FXYA 2FZZA 5L2YH 1QRZA 1CO7E 2BDIA 1GHAG 5JB8S 1UMAH 2J95A 5FPYA 1GGDB 2Y82A 4ZUHA 3KQEA 1KTTB 5JBTA 2V6NA 1YP9A 1D3TB 3N7OA 1ELFA 2AIQA 1OWIA 1MZDA 4J2YB 2NWNA 2FS9A 2CN0H 3SU2A 2BVXH 3EA7A 4B75A 1UTJA 3URCA 3HK6B 3LC5A 1ZPCA 4K1SA 5EXMA 3ATKA 3RXUA 5DK1A 4WJG2 1YYY1 2R0LA 3E90B 3SBKA 1E36B 1G3DA 1AZZA 1E37B 3RXRA 2OC8A 2VGCB 2J94A 1EUFA 1SGIB 4HZHA 4K1TA 1XX9A 4ISIH 4K3JA 3UIRA 3ODDA 2F9NA 1GBTA 2BY7X 2QY0B 1TMBH 4ZKOU 2AGIX 1O2VA 2IPHA 2C8YB 1O2IA 1HXEH 3LT3A 4KTUA 2BY5X 2QXJA 2OINA 2FMJA 1GHAF 4Z6AH 4CREA 1H9IE 2VWMA 1THPB 2ZGHA 2UWOA 5C5OA 1KY9A 4GVUA 3FANA 1DDJA 2ZC9H 3FP7E 4A7IB 1JRTA 5FBIA 3BTHE 2TGTA 1O31A 2R3YA 1S83A 3KQCA 1TQ0B 5A2MH 4YLQH 5DKMA 1O5AB 1ZR0A 1A0LA 1T8NA 5FAHA 3SNBA 2PFEA 4AX9H 2C3SA 1GMCG 5DPAA 1BITA 1KTSB 5DP4A 2R9PA 4FU9A 1O3KA 3UFAA 1Q2WA 1DWBH 2BHGA 3LKWA 2AFQB 4U2WA 3EDXB 5J4QA 1CE5A 2OUAA 3GDSA 5F8ZA 1H9HE 1AB9B 2ZU4A 1S85A 1V2QT 4UDWH 1SQOA 2RG3A 1HDTH 2TBSA 2YNBA 2RDLA 3SN8A 4LZ4B 4RKOB 5LPRA 1W2KH 3SORA 3RXGA 1V2JT 2VVUA 3GY8A 3QZRA 3RXKA 4NWLA 1GI6A 1AD8H 2R3UA 1Y5AT 1YPLH 1PPZA 3P8NA 4E06H 3K6YA 1OYQA 4JYVH 4B1TA 3W95A 5J4SA 1PYTD 1PQ5A 4YZUA 3HKJB 4D76A 1P9UA 2QYIA 1GI8B 4O3UA 5DJ7A 3BV9B 1C2IA 1XUHA 1NM6A 4FUHA 4OGYA 1QBNA 1XUIA 1E34B 1D6RA 1IOEA 3G01A 2Z9GA 1NROH 1D6WA 3EAJA 2FLRH 1VITG 1P04A 3ZVGA 2B9LA 5AF9H 3QGJA 1W8BH 3KF2A 2C8WB 2G00A 3SNEA 2VH0A 1KXCA 1NESE 2ZCKP 5HGGA 1CU1A 2PWXA 4X2VA 1RJXB 1W11U 1ZTLA 1BA8B 3R3GB 1Z8GA 4AFSA 2ZCHP 3AW1A 4E05H 1NTPA 1YBWA 1SGYE 1Y3WA 1HAIH 5DP9A 2EI6A 3PWBA 1K2I1 1XM1A 2O8LA 1G2LA 1SGQE 1CT0E 1S82A 1UCYK 5AHGH 3RLWH 1GVKB 4UE7H 1F5LA 2FI4E 3L3TA 1BRAA 2J2UA 1HB0B 4NIXA 2ZGBH 2NU0E 1NO9H 1BTXA 6ESTA 1OWHA 1SLXB 2OP9A 3NCLA 4Y6DA 3BEUA 1O2WA 2J92A 1VITF 5JDUB 2CGAA 4CRAA 1QJ7B 4K8YA 3EA9A 3SW2B 3ZYEA 4DIHH 2ODPA 1ELBA 4KP0A 3TJVA 3T2NA 1ETTH 4MNVA 2GCTC 1XUGA 1FPCH 3K9XB 3RXTA 2UUFB 3UNSA 3GY3A 4JZIA 1QA7A 1SLVB 3MNXA 2GT8A 3KNXA 1VJAU 3RXMA 5LGOA 1O2MA 4NCYA 2ZQ1A 2NU4E 1EAIA 2ANWA 1GHWH 4DT7B 1D9IA 3GY6A 3LJJA 2W7UA 1PYTC 3K6ZA 5TJXA 1TA6A 5A0BA 4ISNA 4A6LA 2FDAA 3ATWA 3SGBE 2FIRH 1QJ1B 1HGTH 1OKXA 3D62A 1L4DA 4FUFA 4NIYA 3CS7A 1C2DA 1ZSJA 1C2LA 1Y8TA 2Z6BD 1YPKH 5DGJA 3RXCA 1J17T 3S9BA 2BLWA 3E8LA 1OWJA 3M5LA 1TBRH 1GJ6A 1S0RA 3F9HA 3NPSA 5HYOA 1V2RT 1QCPA 2XWBI 1BCUH 1EZQA 1O2GH 2GZ9A 3GY5A 1C1QA 2Y80A 4VGCC 1O3NA 2J34A 1O2NA 2ODYB 2VH6A 2FTMA 2ZO3H 5E0HA 3BTME 1YPHC 3ZZ6A 4XSKU 3LONA 1SGCA 4UEHH 3RXAA 3ATMA 3MTYA 2ANKH 4O9VA 2A4QA 2VJ1A 2V3OH 1F0SA 3KIDU 3D49H 1ZPZA 1EZSC 2J9NA 1TWXB 1NN6A 1A1RA 2VB0A 2UWLA 1OPHB 5E8EH 1FY8E 1N1LA 1CBWC 4O03A 1WBGB 3A83A 2O9QA 4X2XA 1TABE 3B9FH 1AVGH 2OC0A 2WPHS 2LPRA 3HK3B 5C67A 1J16A 3URDA 1UO6A 1AWFH 2BOKA 5C1YA 4CRFA 2AEIH 4MQAA 1MUEB 1ZSLA 1A7SA 1FN6A 1QL7A 2H9TH 3QTOH 1HIAB 3GICB 3BG8A 1O5FH 2F91A 1HJ8A 1SI5H 2ZHDA 1AMHA 3SUGA 3AAVA 1F5KU 1V2MT 1VZQH 3KHVA 5C1UA 1AKSB 1BTHH 1VJ9U 4YOIA 4RN6A 1IAUA 5I46H 2XBYA 2FS8A 1Z1IA 3SU6A 1O32A 1GBKA 1FONA 1SLWB 3TK9A 3VPKA 2ZHFH 2OQUA 2C93B 1WTGH 3ESTA 1BT7A 3RU4E 2BY6X 1FAKH 1HIAA 1KXBA 3QLPH 1UJ1A 2QA9E 4INHA 1B7XB 1OSSA 3QWCH 1BQYA 3BTQE 2Q1JA 1QTFA 3MH6A 1KLIH 1MTVA 1AKSA 2VIWA 1JOUB 2IN2A 3I78A 2H9EH 4X6PA 3ZVEA 1SGNE 3OTJE 2BB4A 3BTKE 1SGFG 4AYVB 1A4WH 1O3BA 1QHRB 4A1XA 3RC5A 3E0PB 4M7GA 1GCDA 1K1PA 1O2HA 2ZECA 4BTUB 1V2VT 3QN7A 1GWAA 2STAE 2P93A 1C1RA 2G51A 3BTDE 1BTUA 4OS7A 5CMXH 2GCTB 1L4ZA 1DOJA 4MG3A 1KXDA 3S7HB 1MH0A 1DY9A 4Y76A 4CRGA 1GGDC 3T25A 4A92A 1AE5A 1GBDA 1CA0C 3BTFE 3S9AA 1C2JA 4Y8ZA 5K7RA 1ZYOA 1J15A 2ZDKA 2BLQA 1BMMH 1QQUA 2WPMS 1GI2A 1EOLA 5F03A 2QXIA 4CBNA 4H4FA 1C1OA 2JKHA 1MD7A 3GCTG 1O2OA 3UR9A 1GJBB 1O3PB 5AVDA 2PSYA 2XCNA 1QQ4A 1XUJA 1OP0A 1LHDH 2ZGXH 1LO6A 1LQEA 2GGVB 8GCHG 3OSYA 1Y3UA 1ZTJA 3PLKA 2VGCC 1SHYA 4AORA 2ZFRH 2FXRA 2O8UA 4CH8B 1UK4A 2VWLA 1T31A 1GHZA 2XBXA 3P95A 1YLDA 3DUXH 4WWYA 1GI1A 3S69A 2Z9IA 3ZVCA 3BIUH 3SU0A 4OS5A 2Z7FE 4AOQA 3TLOA 3A7WA 2WPKS 3H7TA 1EXFA 4GUXA 1RRKA 3VB5A 1XKBC 4WVPE 2ZFPH 3RM0H 1GBEA 1EAXA 1EJNA 1SGDE 1P3EA 2ZU3A 3FFGA 1K1MA 1OYTH 3RXFA 1TQ7B 1CSOE 4FUDA 1GDNA 3BTEE 4O3TA 3ZZ4A 2BQ7B 3ZYDA 3TGIE 4UFEH 1UTPA 4DIIH 2OC7A 1HXFH 1DWDH 2XXLA 2C90B 3SO3A 3P92A 3GCTF 1UHBB 1GHXH 1NU7B 3MH7A 3P8FA 1A5GH 5EPNA 3ZV8A 4YESB 8GCHF 3RU4D 1GMHG 1A5IA 1P10A 1AB9C 3QGNB 1MCVA 3MU4A 5JB9S 2CJIA 2SNWA 1UVUH 3UREA 3MU5A 3SV6A 1FN8A 1NZQH 2XTTB 3TH2H 4ABEA 1TFXA 2CF8H 4CRBA 8KME2 1RS0A 3HPTB 5JPMH 2NU1E 3ATLA 1NC6A 2H5CA 1N6XA 5I25A 1O2TA 3ENSB 1GL1A 3KQDA 3PMJA 1SOTA 2ZWLH 3SJKA 1FAXA 2ZIQH 3L6PA 1GJAB 3ZZDA 1ELGA 2BTCE 5TCCA 3RC6A 3SU3A 4JZDH 1VITH 3OY5U 2GMTB 2ZU5A 2A0QB 3A7TA 2BD9A 1HAZB 3A85A 4XBCA 3ZZBA 1HLTH 2PV9B 1RD3B 2ZU2A 5EQRA 2QAAA 3ATIA 1A0HB 1SL3A 4ABFA 2STBE 5A09A 1RTLA 1K22H 3M35A 4JZEH 4X1PU 3RXOA 1KYNA 2P3UB 5EQSA 4GCHG 4CR5A 1PFXC 1CT2E 2GCHG 1GMHF 4NA7A 4B71A 1PQ7A 3ZZAA 4D8NA 1QRWA 1S6FA 3SUEA 1DX5M 1EAUA 1G2MA 4CBOA 2R0KA 1SB1H 1DSUA 4IN2A 3CS0A 1KXEA 1SPJA 4YTAA 3SJ8A 1TMTH 1QURH 4DW2U 1OP8A 3T5FH 4ABBA 5FBEA 2H5DA 4D7GA 1ARCA 3Q3YA 1FNIA 1CA8B 1C5UA 2YOLA 4JCNA 1GBJA 3A8BA 1UVOA 2A32A 1NRSH 1KXAA 1ZLRA 3WY8A 5BRRE 3ZZCA 5E0JA 3MU8A 1HAGE 1KLTA 1CA0B 1O37A 1LTOA 1O34A 1BZXE 3SZNA 3ZVFA 1IQMA 3MFJA 3T26A 2HALA 2QXGA 4K5ZA 4BAHB 3PV4A 2P16A 1YPHE 2ALVA 1DUEA 1L1JA 1GBFA 4Q7YA 4TPYA 4Y8YA 4CRCA 1GL0E 1O2UA 3BG4C 1Z8JB 1O5BB 1ZTKA 2A2QH 2ZGJA 1T8MA 1Z8RA 1LVMA 1K1IA 4ABJA 2ZDLA 1LQDB 3U8OH 2HOBA 4X0WU 1AGJA 4CRDA 3MI4A 4WF8A 3QO6A 3QTVH 5A0CA 3A88A 4OS2A 2HGTH 4WH8A 3GY2A 3ZVBA 3UUZA 3KCGH 4FUJA 1C1UH 3M7UA 1J9CH 2XW9A 3EYDA 2OXSA 1P05A 1TMUH 1YM0A 5F8TA 5DO4H 4RKJB 1W12U 2WUCA 2ZP0H 4UFGH 1DM4B 1UVPA 1XUKA 1ELEE 5FXLA 1P03A 2NU2E 4I8HA 5TCAA 4IC5A 3GYLB 1ELVA 4JK5A 1UTQA 4E7RG 2FOGA 3SI4H 1KIGH 9LPRA 2ANYA 3QUMP 1AWHB 2VWNA 1F92A 2Z9LA 1BJVA 2UUJB 4ABIA 3CENA 5GCHG 1HBTH 1P09A 1C1SA 3U1IB 1V2KT 5EXLA 1BIOA 4D9RA 4B76A 3LGWA 1AN1E 4K69A 4MTBA 4AGJA 2XC0A 2UUYA 3PROA 4UD9H 1H9LB 1P02A 2BYAX 2HNTF 3TU7H 6GCHG 1FV9A 1NFUA 2HWLB 1OWEA 4X2WA 1EOJA 3M5OA 1P57B 2BD8A 2H1UA 4LZ1H 2AGEX 2FOMB 4YM9A 4NIVA 2O8WA 2J38A 1G37A 2BD5A 1TLDA 3T28A 3AVZA 1DE7H 1JIRA 3D23A 2JH6D 5C2ZA 2A7HA 2LNCA 1O5CB 4Y7BA 1ZJKA 4FVDA 3F9EA 2PUQH 3VXFH 1PPFE 3SU4A 1C5PA 1BTZA 1W7GH 4INLA 5HMAA 4BAKB 2FOBA 1AFQB 3TJOA 3FP8E 4Y10E 1IQEA 3SNAA 1GMCF 5EXNA 1HAPH 1KSNA 1UTOA 5CE1A 2BDGA 2ALPA 1PQAA 4K60A 1P2NA 2QN5T 1UK2A 1Z1JA 4B74A 1TAWA 1YPGH 3LGTA 3MH4A 1QB9A 1P11E 4NA8A 1THSH 4AZ2B 1HRTH 1YCPH 2Y5FA 4ABAA 3UQOA 1BMAA 6GCHF 5IDKA 3O8DA 2QF0A 5F6MA 2OLGA 2BLVA 1INCA 3M3VA 3RMLH 4NFEA 1O36A 5A8ZA 1A5HA 4AB8A 4XDEA 2GZ7A 1FQ3A 1YKTA 2CF9H 1DS2E 1FY5A 2A7CA 2EC9H 4Q7ZA 2UWPA 1S6HA 1WAYB 1DFPA 4I8GA 4PROA 1LHFH 2ZFQH 5B6OA 3U9AH 3GCNA 1V2NT 4BXWA 1H8DH 2OTVA 4KTSA 2ZHQH 1HCGA 2CHAB 5HM2A 3V3MA 3ITIA 1SHHB 3SNCA 1SSXA 1M9UA 1GJ9B 2SNVA 1WCZA 4B2AA 4R8TB 3MU1A 1C5QA 1SGTA 1QB6A 3A8DA 5E2PA 3PLBA 4TWWA 1RIWB 3M7TA 1H4WA 3RXSA 1DLKB 1AI8H 1K1JA 3RXDA 3BG4B 3SQHE 1LCYA 1HAVB 1UTKA 4GHTA 1TE0A 4UFFH 3MWIU 2PKAB 4ZKSU 3SV9A 2ESTE 1ORFA 2BZ6H 1BDAA 7GCHG 2HPQH 5DP7A 1TPSA 2Q6GA 5ESBA 1MBQA 1V2UT 4I32A 2AS9A 3RMNH 1PPBH 2HRVA 3LGVA 7ESTE 2BDCA 1EZUC 2QXHA 2YNAA 1AUTC 3GCOA 2G5NA 1CHOG 4HI3A 2G4UA 4OS4A 2OQ5A 2WYGA 1UVTH 5EQQA 1G3CA 1GDUA 3PWCA 2W3IA 2FOHA 3TNSA 1C4Y2 4D7FA 1G3EA 1B5GH 7KMEH 3BN9A 3LOXA 3UWJH 2VIQA 4IGDA 3TITA 3NWUA 4SGAE 1LHEH 2F9BH 3S9CA 1HAVA 1GHVH 5EGMA 1F0TA 2F83A 2GD4B 1AVXA 1AE8H 2PKAA 4I31A 1BBRH 1MBMA 4IMZA 4MVNA 1DXWA 1JMOH 1XVOA 3DFJA 5SGAE 3GDUA 4NG9H 2BD3A 3A7XA 1W14U 3MHWU 1SOZA 2G55A 5T6FA 1TA2A 2D8WA 2BY9X 3P17H 1O3GA 3M61U 2ZZUH 3TH4H 2VWOA 3RM2H 2Z3EA 4AB9A 1XXFA 2F9PA 5FX6A 3SI3H 1C5SA 7GCHF 3S0NA 2P3FH 1TGSZ 3F68H 4U32A 5FPTA 3LGYA 3P8GA 2PLXA 2SGFE 4ISHH 3K65B 4ZHLU 1K28D 1YPJH 1UTMA 1CHOF 2C4FH 1SGPE 4NSVA 3LDXH 1V2PT 1DT2A 2PSXA 1C5MD 1DITH 1L0ZA 4TWYA 2Z9KA 5EU8A 4ZAEA 4LXBH 4ISOA 2XC5A 1YPEH 1OS8A 2DUCA 3MNCA 1ZHPA 1MTNB 2D26C 4DCDA 3RMMH 1ZJDA 3E16B 3DD2H 3ZZ7A 1D3QB 1WYKA 2PTCE 3GY4A 1W0YH 1MAYA 1L1GA 1QJ6B 1GI0A 2UUKB 1BTYA 1H1BA 1Q3XA 1Y3YA 4X6MA 3ZZ5A 5E2OA 3ZZ8A 1JWTA 3RXLA 1XXDA 1NRNH 2EI7A 2IJOB 1CGHA 1GG6B 4ZH8A
chains in the Genus database with same CATH superfamily
3U1JB 4BAOB 1IQHA 1DXPA 1W0ZU 5EG4A 2CK3D 2ZFTA 5JBBS 4F4OC 2ZF0H 2GMTC 1BRBE 1N6YA 2BXUH 1OHHD 5G4BA 5LPFA 1TNHA 2ZFSA 1EP6A 5KECA 2FEQH 3RXPA 3LIWA 1FUJA 1UW7A 2KCPA 1G36A 5L2ZH 2L74A 2NU3E 1MKWH 2B5TB 1GBBA 1MD8A 1TX7A 5HXFA 1ZHMA 5IK2D 2C8XB 1C9PA 4BXSA 1O3LA 4F55A 1VR1H 2A4GA 1GBCA 1UVSH 1AHTH 2BZAA 2QC2A 1GJDB 2THFB 3E3TA 1NFYA 1NRPH 4GAWA 2J4IA 4FUIA 2ASUB 2ZPSA 4UFDH 4Q80A 2A7JA 4HTCH 3OYPA 1JXPA 1O30A 2FTLE 2HVYB 1Q31A 3F1SB 4TY7A 5EPYA 1O3FA 1P01A 1Z71A 3NKKA 1ZPBA 3PV2A 1BRUP 1ZMLA 2GT7A 2ULLA 1GHBG 4FXGH 1EAWA 1NBMD 5BPEA 1P2OA 3Q77A 9ESTA 1O2YA 2TIOA 1EKBB 1ZHRA 3BIVH 3RLYH 1QB1A 1ELCA 4THNH 3SV2H 1TRNA 3ELAH 4HFPB 1UK3A 4IS5A 1GI4A 1WUNH 1ELAA 4IW4E 1Y5UT 3MH5A 1BHXF 3SJIA 3R0FA 1DICA 1C1MA 2FESH 3VGCB 3CP7A 1PJPA 4TY6A 4NZLA 4B6EA 2QV1A 2K1QA 1SMFE 1GDQA 2WPLS 3RXQA 1C2MA 1X7AC 4KELA 1C9TA 4DURA 2O8TA 2BMGB 4I8JA 2LELA 2WPDD 2AH4X 1O3MA 5F53A 1EATA 1DUAA 3MO9A 2KAIB 1O3IA 4YT7H 1C5LH 1BRCE 2SGAA 1ARBA 4B73A 3S7KB 5GWZA 2ZDMA 1FIWA 4BOHA 2HVXA 4U30A 3SU1A 1GJ7B 4I8LA 1C5TA 2FX6A 1O3HA 2F3CE 3RXEA 1W13U 3C1KA 1MQ5A 3B8JA 2ZHWH 4X8TH 4JZFH 2FLBH 3ZVDA 2SFAA 1SC8U 1TNJA 1F0RA 1WTHD 3F9GA 1THRH 2SGQE 2A1DB 1GHBF 5EJZA 4BTTB 3A7YA 1GJCB 4MDSA 3TJUA 4GHQA 4OGXA 3PM3A 3A8AA 4WXIA 4AG1A 3W94A 1MQ6A 5EOKA 1DWEH 1TPAE 2H6MA 1EPTB 2ZGCA 3PO1B 2VNTA 4ZROA 1PQ8A 3SJOA 1SGRE 2KAIA 2FO9A 1HPGA 3GYMA 2ZDVH 1C5YB 4I8KA 1RTFB 3A87A 4IC6A 3I29A 1BHXB 4KTCA 2Y7XA 4AFZA 1ELTA 1DANH 1AY6H 2Z9JA 3NZIA 2HLCA 5T3HA 1QA0A 1AO5A 3RXIA 2FP7B 5GJ4B 1KDQB 5ABWA 2ODQA 3MO3A 3M3TA 2GV7A 2EA3A 1VCPA 2SGPE 3OY6U 2BX3A 3FZZA 1SKYE 4BAQB 2TGPZ 3RU4T 4ABGA 1QY6A 3HATH 1ZGVA 1HAOH 3F0PA 3D65E 3STIA 1EPTA 1ESAA 2FI3E 3UNRA 1T32A 3FVFB 3I77A 5CHAC 1HFDA 1C5VA 3JZ2B 2VBCA 2D1JA 4BANB 2WV5A 2XBWA 1FMGA 1TOCB 4E7NA 3AASA 3E91A 3VEQB 3ZV9A 5EW2H 1F7ZA 1MU6B 3TK5A 1MTSA 1QGFA 2FOAA 1LDTT 1KDQA 2W5EA 3RUOA 3VB3A 3M7QA 2RA3A 1UHBA 4YXWD 2H2ZA 8ESTE 2GP9B 3LGIA 3GISB 3P6ZB 3E0NB 1ANCA 2ZEBA 4NIWA 1ZOMA 1ZRBA 2KR7A 1VGCB 2FYQA 3U8TH 1UTLM 1BTWA 2ZDAH 2A31A 1D3DB 2KCYA 3MO6A 2M2AA 1SGFA 4NA9H 1ZRKA 1AFQC 3H09A 1SLUB 1O38A 4WY3A 2OCVB 3UNQA 4ZKRU 2WYJA 5H4IB 1QBOA 3TVJB 1O5GH 1QNJA 4Y0YE 4XBDA 2XRCA 1SFIA 1O39A 3GCHC 1C4V2 3BSQA 1OX1A 2ZFFH 4X6NA 1TBQH 1W7XH 1WQSA 4DGJA 2ILNA 2A4RA 5DP6A 1B0FA 5AFZH 3Q3XA 2EI8A 1V2TT 3BEFB 1MKXK 1A61H 4AFUA 2L6OA 3DFLA 1C5RA 1LHGH 1IHSH 1RFNA 4H6SB 5GXPA 2HNTC 4YOGA 2W7SA 1GMDG 4AFQA 2DE9A 1YLCA 1QIXB 4Y71A 3GY7A 5C3NA 1A0JA 1K1NA 1XUFA 4X8VH 3MQKC 3TH3H 1F2SE 4TSFD 4INKA 5FPSA 2BX4A 2V0BA 4NGAH 2A5AA 2F9OA 4XE4A 1U6QA 4NWKA 1GCTC 2ZTZA 1FDPA 3LC3A 1TALA 2CHAC 1FPHH 3PB1E 4Y11E 4K8BA 1YCPM 4BNRA 2AERH 1NFWA 1SVPA 5EODA 2FX4A 1BMLA 1QBVH 4X1RU 3O8CA 2KFWA 5LPEA 4GCHF 3HGPA 4X1QU 2PKSB 3PMBB 5K0HA 2PUXB 2GCHF 2FM2A 2P8OC 2FOCA 4ASHA 2GDDA 1WOFA 3RXJA 1ANBA 1RIWC 2BD4A 1BTPA 1WSSH 4MNWA 2PW8H 1EJMA 1C2EA 1CHGA 1TNIA 3SUFA 4ZXYH 2WPJS 1L1NA 2AMDA 1GMDF 1A46H 2WSSD 1V2LT 1ANDA 1G9IE 1TGBA 3BTTE 3O8BA 1V3XA 1P8VC 3RXBA 1S81A 4LOYH 5A8YA 1XMNB 3TGJE 1NRRH 4X6OA 3T62A 5FL7D 2JETB 2RA0A 1S6LA 2G4TA 4IBLH 1D3PB 3QZQA 3A7ZA 2VIPA 4ZMAH 1SGEE 1HNEE 4AC9A 3B23B 3LH1A 4SGBE 3UOPA 3VB4A 3A80A 2SGEE 2XNIA 4Y7AA 1G30B 1ABIH 1MAXA 2TGAA 4ESTE 4H6TA 2BM2A 2FOEA 3NXPA 4ZHMU 1QFKH 3T27A 1E35B 3SV7A 1XVMA 2B0FA 4MPXA 3STJA 2M5TA 1LVYA 1ABJH 2CV3A 1Z6EA 1C1TA 1MZAA 1RTKA 4WH6A 1UCYH 1HJAB 4I7YH 1E38B 2GDEH 3VB7A 3QX5H 1FI8A 5GDSH 2Z3CA 1C5XB 4F49A 1MMJN 2GX4A 4WMFA 2Y5GA 2ZKSA 1IHTH 5CHBA 1AQ7A 1GJ5H 5CHAB 2JH5D 4Y8XA 1A3BH 5KGOA 2R2MB 2JH0D 4DG4A 1O2KA 1TPPA 1V2OT 1ZMJA 3E1XB 3GOVB 1GHYH 3A8CA 2H9HA 2QF3A 1C5NH 2QIQA 3BTGE 1ESBA 2WV4A 5DP8A 2P59A 3TGKE 1TRYA 2TRMA 3HGNA 1MTNC 1QL8A 1C1VH 5C1XA 1SQTA 5C20A 1PPCE 3OEED 4FUCA 4AG2A 1JIMA 1PPGE 1E1QD 1EB1H 1O2ZA 5PTPA 1AU8A 3F9FA 3TJNA 1QRXA 2D2DA 1Y3VA 2BDHA 3M3SA 4HGCA 4R0IA 4JMYA 5FCKA 1W10U 1GG6C 5GCHF 2JIZD 3EQ0H 1YY3A 1HAYB 4RSPA 1O35A 5JYIA 4MNYA 1BBRE 3GCHB 4OS1A 1TONA 2PGQB 4JYTA 2ZCLP 3KQBA 3NUMA 5C0TA 1DSTA 3PLPA 1KXFA 1P2MA 3SOSA 3OX7U 2GZ8A 5C5NA 1NRQH 2Z3DA 5HKKD 1TPOA 2V3HH 2EEKA 1K1LA 1FY4A 2G52A 1TYNA 4WMEA 4K1EA 5ESTE 2AMPA 3H7OA 5DP5A 1C2KA 2C8ZB 1ZGIA 4XD7D 2W3KA 2GVFA 4A1VA 1O3EA 5A0AE 1T4VH 4TYDA 3SHAH 2OBOA 4KGAA 3M36A 1S5SA 1WQVH 1JBUH 2SGDE 1EP5A 1GBLA 1RGQA 4YO9A 2BDBA 1SFQB 1O33A 5C94A 1GCTB 1UTNA 2OC1A 4IMQA 4CR9A 3P8OA 5FHTA 4ABDA 4DOQA 1TX8A 2PHBA 1SR5C 1NY22 1YF4A 3SYJA 1C4U2 3UAIC 1FJSA 1LVBA 1O2PA 1BMFD 5DG6A 1KMHB 3NK8A 1TX6A 2P8OB 3RXVA 4YLUA 2VIOA 1C1WH 1Z8IB 3TK6A 1TGCA 1P06A 5GPIB 2PTNA 1P3CA 2Q6DA 4AGKA 1BMNH 1GI3A 4DY7B 1ETSH 3F6UH 1Y3XA 1G32B 1CGIE 5T6GA 2GKVE 1MABB 5AFYH 3VGCC 4KKDA 4ZHAA 1FZZA 1AUJA 2QCYA 1HV7A 1GVLA 4GSOA 2ZTYA 2LP6A 1MU8B 4AYYB 1YPMH 1CGJE 1AVWA 2Y81A 1P0SH 1IQKA 5F8XA 3V0XA 2BLOA 3DT0H 3V13A 1N8OC 2F9UA 3SJ9A 1EB2A 2WPIS 1OWDA 2ZG0H 7LPRA 2A4OA 1PPEE 3VB6A 1P2IA 2V7QD 2OD3B 2BDYA 2KCAA 2FI5E 3ZIAD 1NBME 2XC4A 2BVRH 2I6SA 1GI7B 2Y5HA 4Q2KA 1NU9A 2GV6A 3V7TA 2A5KA 4MLFB 1YCPK 3KGPA 2IPQX 1TGNA 1DVAH 1NT1A 2ZHEH 3BF6H 4Q7XA 2Z94A 4A1TA 4BAMB 2TGDA 1EPTC 4JZ1A 2AYWA 3PO1C 1FLEE 2BOHB 1WV7H 1TBZH 1TNGA 4P02A 2ZU1A 3PYHA 4J1YA 2ZA5A 3SNDA 1TIOA 1ZSKA 3O8RA 4YOJA 1P2JA 2OBQA 4UONA 4TPIZ 3ZVAA 3U98H 2ANMH 4HG6A 3RXHA 3V12A 1T8LA 1TNLA 1OP2A 3UY9A 2VIDA 3BTWE 1T4UH 4DJZB 3PTBA 2PR3A 4CHAC 3Q3KA 1LPGB 3U69H 5T1VA 1C5ZB 5L30H 3U8RH 2DE8A 1ANEA 1NS3A 2F9VA 1WXRA 2HNTE 1IQLA 3M5MA 1C2GA 1C2FA 1P2QA 1Y59T 4MPWA 5DN6D 1O3JA 3VFEA 3A7VA 1TRMA 4AN7A 4X1NU 3OFND 3C27B 2AIPA 3MNSA 1P12E 4FU7A 1Z7KA 6CHAC 1P9SA 2Y6TA 3OU0A 2ZDNA 3GDVA 3QK1A 1GI5A 2KM0A 2VVCA 3VXEH 4OS6A 3ODFA 3SUDA 1GBMA 2ZNKH 4DVAU 4Z0KA 2YMSC 3QDZB 3SV8A 4Q4LA 4X1SU 5FCRA 1S0QA 1VGCC 1V2WT 1T7CA 4TT3D 2V35A 3IWMA 1F5RA 2A45B 2Y7ZA 5JBAS 1A3EH 3UOUA 3KYFA 4K2YA 1EZXC 2HPPH 5IYTA 3UQVA 1BBRK 1J8AA 4QT8C 1LPZB 3SHCH 2FYRA 3RP2A 2VINA 3ZZ3A 3P70B 4FU8A 1HJ9A 1TNKA 1KLJH 1EJAA 1C5WB 2WINI 3IG6B 1O3AA 1V2ST 1YLNA 2ZPRA 1TGTA 3N7DA 1SQRA 1VCWA 1RXPA 1NPMA 2KX4A 4NFFA 3LPRA 1GPZA 1AZ8A 3A84A 1GBIA 4NZQA 2CMYA 4WMDA 1QR3E 4U01A 4XBBA 1C1NA 1E0FD 1O2XA 2BDAA 4A5TS 1C5OH 3H5CB 4H42U 2J97A 2ZI2H 3A86A 3UTUH 2VU8E 3SU5A 3A89A 5HM9A 4GPGA 1GJ8B 2G81E 2WZQA 3EA8A 1SQAA 3KN2A 1IQGA 2AMQA 4ABHA 1D4PB 1BOQA 3MU0A 3KEEA 2PKSC 4X2YA 1W3CA 1ZZZA 3PMAB 1P2KA 1O0DH 3L33A 3RC4A 5DSFA 2FOFA 3A82A 3SGQE 3VG8A 1BUIA 1C2HA 3BEIB 1HUTH 2A2XH 2R2WU 1EX3A 1N8OB 1F0UA 3TPIZ 4BTIB 1Z6JH 1VCQA 1ZMNA 3AW0A 3K2UA 2Q6FA 3IITA 1GI9B 1IQJA 4JYUH 1ACBE 1L2EA 4O97A 1IQFA 2ZTXA 3MNBA 4FUGA 1TB6H 3ZZ9A 5JBCS 1J14A 3UR6A 1DY8A 2XWAA 3DA9B 1AIXH 1LHCH 2CXVA 1MTUA 2JETC 1MKWK 1DLEA 3JZ1B 4MPVA 1O2SA 2BQ6B 3EGKH 3Q00A 4B2CA 6LPRA 3E6PH 1ID5H 1B0EA 1O5EH 1YGCH 1O2LA 2PGBB 4FVBA 1K1OA 1V6DA 3MOCA 2EQNA 2FPZA 1DWCH 1AFEH 3UWIA 4Y0ZE 1CVWH 3LH3A 3MMGA 4FUBA 4FUEA 1LVOA 2A5IA 1MKXH 2FWWA 1O5DH 1DPOA 4VGCB 4JK6A 5DP3A 3M5NA 4MPUA 2P3TB 2B7DH 1GBHA 3LU9B 4LK4A 2RFKC 4CHAB 1IQIA 2ZQ2A 1IQNA 3A81A 2XBVA 1HJAC 4B6FA 2B8OH 1HYLA 1O3OA 2O8MA 3RDZA 2WUBA 2GJGA 1OWKA 3SQEE 1LPKB 1HAHH 2P94A 3TNTA 2XYAA 2VVVA 3FAOA 3MYWA 4I33A 2VIVA 4X8SH 3UPEA 2RCEA 4MNXA 2BQWB 2ZPQA 1CBWB 1ETRH 2IOTA 4Y79A 1C1PA 1ELDE 1ESTA 1Y5BT 6CHAB 5EW1H 5L6NH 3SGAE 3AAUA 1PPHE 1LMWB 1O2QA 5A8XA 4ZKNU 1EASA 3M37A 2BVSH 2J5UA 2P95A 5FX5A 2TPIZ 1NFXA 2BD2A 1O2RA 4WXVA 3EE0B 4B2BA 2YMSB 1WU1A 4CH2B 2GTBA 1BB0B 1EQ9A 3RMOH 3Q76A 4GLYA 1MCTA 2XCFA 2G8TA 4YT6H 1GVZA 1CT4E 1FY3A 1JRSA 1GJ4H 2AGGX 2BD7A 5GIBA 4NSYA 3HKIB 1G3BA 1BJUA 4IN1A 1O3DA 1LKAA 3FZDA 2BY8X 1QL9A 4XOJA 1A2CH 3FP6E 1CQQA 1K9OE 2F4LA 5ETXA 3LJOA 1FY1A 3LGUA 4XFQA 5GNDA 1O2JA 1SBWA 1UCYE 5HIYA 5T6DA 1O3CA 4ZXXH 5LH8A 4ISLA 2FODA 1HAXB 3T29A 3DHKH 1H8IH 2G5VA 5E0GA 1T8OA 2W26A 1LKBA 4RI0A 1GBAA 2QGRA 1YC0A 1SG8B 1OOKB 4D9QA 3TIUA 1MTWA 1XKAC 1TOMH 3KL6A 3PMHB 1K21H 8LPRA 2I6QA 1FIZA 1S84A 4X8UH 3PTNA 2BXTH 1OXGA 1FXYA 2FZZA 5L2YH 1QRZA 1CO7E 2BDIA 1GHAG 5JB8S 1UMAH 2J95A 2IJD1 5FPYA 1GGDB 2Y82A 4ZUHA 3KQEA 1KTTB 5JBTA 2V6NA 1YP9A 4M9FA 1D3TB 3N7OA 1ELFA 2AIQA 1OWIA 1MZDA 4J2YB 2NWNA 2FS9A 2CN0H 3SU2A 2OK5A 2BVXH 4I86A 3EA7A 4B75A 1UTJA 2JJ1D 3URCA 3HK6B 3LC5A 1ZPCA 4K1SA 5EXMA 3ATKA 2XOKD 3RXUA 5DK1A 4WJG2 1YYY1 2R0LA 3E90B 3SBKA 1E36B 1G3DA 1AZZA 1E37B 3RXRA 2OC8A 2VGCB 2J94A 1EUFA 1SGIB 4HZHA 4K1TA 1XX9A 4ISIH 4K3JA 3UIRA 3ODDA 2F9NA 1GBTA 2BY7X 2QY0B 1TMBH 4ZKOU 2AGIX 1O2VA 2IPHA 2C8YB 1O2IA 1HXEH 3LT3A 4KTUA 2BY5X 2QXJA 2OINA 2FMJA 1GHAF 4Z6AH 4CREA 1H9IE 2VWMA 1THPB 3AK5A 2ZGHA 2UWOA 5C5OA 1KY9A 4GVUA 3FANA 1DDJA 2ZC9H 3FP7E 4A7IB 1JRTA 5FBIA 2KCOA 3BTHE 2TGTA 1O31A 2R3YA 1S83A 3KQCA 1TQ0B 5A2MH 4YLQH 5DKMA 1O5AB 1ZR0A 1A0LA 1T8NA 5FAHA 3N99A 3SNBA 2PFEA 4AX9H 2C3SA 1GMCG 5DPAA 1BITA 1KTSB 5DP4A 2R9PA 4FU9A 1O3KA 3UFAA 1Q2WA 1DWBH 2BHGA 3LKWA 2AFQB 4U2WA 3EDXB 5J4QA 1CE5A 2OUAA 3GDSA 4ZCNA 5F8ZA 1H9HE 1AB9B 2ZU4A 1S85A 1V2QT 4UDWH 1SQOA 3FKSD 2RG3A 1HDTH 2TBSA 2YNBA 2RDLA 3SN8A 4LZ4B 4RKOB 5LPRA 1W2KH 3SORA 3RXGA 1V2JT 2VVUA 3GY8A 3QZRA 3RXKA 4NWLA 1GI6A 1AD8H 2R3UA 1Y5AT 1YPLH 1PPZA 3P8NA 4E06H 2PP6A 3K6YA 4OM9A 1OYQA 4JYVH 4B1TA 3W95A 5J4SA 1PYTD 1PQ5A 4YZUA 3HKJB 4D76A 1P9UA 2QYIA 1GI8B 4O3UA 5DJ7A 3BV9B 1C2IA 1XUHA 1NM6A 4FUHA 4OGYA 1QBNA 1XUIA 1E34B 1D6RA 1IOEA 3G01A 2Z9GA 1NROH 1D6WA 3EAJA 2FLRH 1VITG 3F3BA 1P04A 3ZVGA 2B9LA 5AF9H 3QGJA 1W8BH 3KF2A 2C8WB 2G00A 3SNEA 2VH0A 1KXCA 3F0OA 1NESE 2ZCKP 5HGGA 1CU1A 2PWXA 4X2VA 1RJXB 1W11U 1ZTLA 1BA8B 1EFRD 3R3GB 1Z8GA 3OAAD 4AFSA 2ZCHP 3AW1A 4E05H 1NTPA 1YBWA 1SGYE 1Y3WA 1HAIH 5DP9A 2EI6A 3PWBA 1K2I1 1XM1A 2O8LA 1G2LA 1SGQE 1CT0E 1S82A 1UCYK 5AHGH 3PV5A 3RLWH 1GVKB 4UE7H 1F5LA 2FI4E 3L3TA 1BRAA 3OEHD 2EY4C 2J2UA 1HB0B 4NIXA 2ZGBH 3W1EA 2NU0E 1NO9H 1BTXA 6ESTA 1OWHA 1SLXB 3CNRA 2OP9A 3NCLA 4Y6DA 3BEUA 1O2WA 2J92A 1VITF 5JDUB 2CGAA 4CRAA 1QJ7B 4K8YA 3EA9A 2K8IA 3SW2B 2YMSD 3ZYEA 4DIHH 2ODPA 3WWBA 1ELBA 2V3MA 4KP0A 3TJVA 3T2NA 2QF5A 1ETTH 4MNVA 2GCTC 1XUGA 1FPCH 3K9XB 3RXTA 2UUFB 3UNSA 3GY3A 4JZIA 1QA7A 1SLVB 3MNXA 3NRLA 2GT8A 3KNXA 3U28C 1VJAU 3RXMA 5LGOA 1O2MA 4NCYA 2ZQ1A 2NU4E 5EJ1A 2W6ID 1EAIA 2ANWA 1GHWH 1VKYA 4DT7B 1D9IA 3GY6A 3LJJA 2W7UA 1PYTC 1E1RD 3K6ZA 5TJXA 1TA6A 5A0BA 4ISNA 4A6LA 2FDAA 3ATWA 3SGBE 3PRBA 2FIRH 1QJ1B 1HGTH 1OKXA 3D62A 1L4DA 4FUFA 4NIYA 3CS7A 1C2DA 1ZSJA 1C2LA 1Y8TA 2Z6BD 1YPKH 5DGJA 3RXCA 1J17T 1E79D 3S9BA 2BLWA 3E8LA 1OWJA 3M5LA 1TBRH 1GJ6A 2HLDD 1S0RA 4FOUC 3F9HA 3NPSA 5HYOA 1V2RT 1QCPA 2XWBI 1BCUH 1EZQA 1O2GH 2GZ9A 3GY5A 1C1QA 3EE7A 3FOAA 2Y80A 4VGCC 1O3NA 2J34A 1O2NA 2ODYB 2VH6A 2FTMA 4F48B 2ZO3H 5E0HA 3BTME 1YPHC 3ZZ6A 4XSKU 3LONA 1SGCA 4UEHH 3RXAA 3ATMA 3MTYA 2ANKH 4O9VA 2A4QA 2VJ1A 2V3OH 5C17A 1F0SA 3KIDU 3D49H 1ZPZA 1EZSC 2J9NA 1TWXB 1NN6A 1A1RA 2VB0A 2UWLA 1OPHB 5E8EH 1FY8E 1N1LA 1CBWC 4O03A 1WBGB 3A83A 2O9QA 4X2XA 1TABE 3B9FH 1AVGH 2OC0A 2JDID 2WPHS 2LPRA 3HK3B 1QZ8A 5C67A 1J16A 4DT4A 3URDA 1UO6A 1AWFH 2BOKA 5C1YA 4CRFA 2AEIH 4MQAA 1MUEB 1ZSLA 1A7SA 1FN6A 1QL7A 2H9TH 3QTOH 1HIAB 3GICB 3BG8A 1O5FH 2F91A 1HJ8A 1SI5H 2ZHDA 1AMHA 3SUGA 3AAVA 1F5KU 1V2MT 1VZQH 3KHVA 5C1UA 1AKSB 1BTHH 1VJ9U 4YOIA 3ZZ8A 4FETA 4RN6A 1IAUA 5I46H 2XBYA 2W6JD 2FS8A 1Z1IA 3SU6A 1O32A 1GBKA 1FONA 1SLWB 3FO8D 3TK9A 3VPKA 2ZHFH 2OQUA 2C93B 1WTGH 3ESTA 1BT7A 3RU4E 2BY6X 1FAKH 1HIAA 1KXBA 3QLPH 1UJ1A 2QA9E 4INHA 1B7XB 1OSSA 3QWCH 1BQYA 3BTQE 2Q1JA 1QTFA 3MH6A 1KLIH 1MTVA 2WHXA 1AKSA 2VIWA 1JOUB 2IN2A 3I78A 2H9EH 4X6PA 3ZVEA 1SGNE 3OTJE 2BB4A 3BTKE 1SGFG 4AYVB 1A4WH 1O3BA 1QHRB 4A1XA 3RC5A 3E0PB 4M7GA 1GCDA 1K1PA 1O2HA 2ZECA 4BTUB 1V2VT 3QN7A 1GWAA 2STAE 2P93A 5EJLA 1C1RA 2G51A 1YWUA 3BTDE 1BTUA 4OS7A 5CMXH 2GCTB 1L4ZA 1DOJA 4MG3A 1KXDA 3S7HB 1MH0A 2J98B 1DY9A 4Y76A 5B6LA 4CRGA 1GGDC 3T25A 4A92A 1AE5A 1GBDA 3KQ5A 1CA0C 3BTFE 3S9AA 1C2JA 4Y8ZA 5K7RA 1ZYOA 1J15A 2RDEA 2ZDKA 2BLQA 1BMMH 1QQUA 2WPMS 1GI2A 1EOLA 5F03A 2QXIA 4CBNA 4H4FA 1C1OA 2JKHA 1MD7A 3GCTG 1O2OA 3UR9A 1GJBB 1O3PB 3F2GA 2PSYA 5AVDA 2XCNA 1QQ4A 1XUJA 1OP0A 1LHDH 2ZGXH 1LO6A 1LQEA 2GGVB 3FN8A 8GCHG 3OSYA 1Y3UA 1ZTJA 3PLKA 2VGCC 1SHYA 4AORA 2ZFRH 2FXRA 2O8UA 5EIYA 4CH8B 1UK4A 2VWLA 1T31A 2J98A 1GHZA 2XBXA 3P95A 1YLDA 3DSPA 3DUXH 4WWYA 1GI1A 3S69A 2Z9IA 3ZVCA 3BIUH 3SU0A 4OS5A 2Z7FE 4AOQA 3TLOA 3A7WA 2WPKS 3H7TA 1EXFA 4GUXA 1RRKA 3VB5A 1XKBC 4WVPE 2ZFPH 3RM0H 1GBEA 1EAXA 1EJNA 1SGDE 1P3EA 2ZU3A 3FFGA 1K1MA 1OYTH 3RXFA 1TQ7B 1CSOE 4FUDA 1GDNA 3BTEE 4O3TA 3ZZ4A 2BQ7B 3ZYDA 3TGIE 4UFEH 1UTPA 4DIIH 2OC7A 1HXFH 1DWDH 2XXLA 2C90B 3SO3A 4P00A 3P92A 3GCTF 1UHBB 1GHXH 1NU7B 3MH7A 3P8FA 1A5GH 5EPNA 3ZV8A 3GS9A 4YESB 8GCHF 3RU4D 1GMHG 1A5IA 1P10A 1AB9C 3QGNB 1MCVA 3MU4A 5JB9S 2CJIA 2SNWA 1UVUH 3UREA 3MU5A 3SV6A 1FN8A 1NZQH 2XTTB 3TH2H 4ABEA 1TFXA 2CF8H 4CRBA 8KME2 1RS0A 3HPTB 5JPMH 2NU1E 3ATLA 1NC6A 2H5CA 1N6XA 5I25A 1O2TA 3ENSB 1GL1A 3KQDA 3PMJA 1SOTA 2ZWLH 3SJKA 1FAXA 2ZIQH 3L6PA 1GJAB 3ZZDA 1ELGA 2BTCE 5TCCA 3RC6A 3SU3A 4JZDH 1VITH 3OY5U 2GMTB 2ZU5A 2A0QB 3A7TA 2BD9A 4Z1MD 1HAZB 3A85A 4XBCA 3ZZBA 1HLTH 2PV9B 4ACBA 1RD3B 2ZU2A 5EQRA 2QAAA 3ATIA 4RT1A 1A0HB 1SL3A 4ABFA 2STBE 5A09A 1RTLA 1K22H 3M35A 4JZEH 4X1PU 3RXOA 1KYNA 3F2FA 2P3UB 5EQSA 4GCHG 4CR5A 1PFXC 1CT2E 2GCHG 1GMHF 2QF4A 4NA7A 4B71A 1PQ7A 3ZZAA 4D8NA 1QRWA 1S6FA 3SUEA 1DX5M 1EAUA 1G2MA 4CBOA 1COWD 2R0KA 1SB1H 1DSUA 4IN2A 3CS0A 1KXEA 1SPJA 4YTAA 3SJ8A 1TMTH 1QURH 4DW2U 1OP8A 3T5FH 4ABBA 5FBEA 2H5DA 4D7GA 1ARCA 3DCLA 3Q3YA 1FNIA 1CA8B 1C5UA 2YOLA 4JCNA 1GBJA 3A8BA 1UVOA 2A32A 1NRSH 1KXAA 1ZLRA 3WY8A 3WW7A 5BRRE 3DSOA 3ZZCA 5E0JA 3MU8A 1HAGE 1KLTA 1CA0B 1O37A 1LTOA 1O34A 1BZXE 3SZNA 3ZVFA 1IQMA 3MFJA 3T26A 2HALA 2QXGA 4K5ZA 4BAHB 3PV4A 1YPHE 2ALVA 2P16A 4ACAA 1DUEA 1L1JA 1GBFA 4Q7YA 4TPYA 4Y8YA 4CRCA 1GL0E 1O2UA 3BG4C 1Z8JB 1O5BB 1ZTKA 2A2QH 2ZGJA 1T8MA 1Z8RA 1LVMA 3UB0A 1K1IA 4ABJA 2ZDLA 1W0JD 1LQDB 3U8OH 2HOBA 4X0WU 1AGJA 4CRDA 2XNDD 3MI4A 4WF8A 3QO6A 3SZEA 3QTVH 1FX0B 5A0CA 3A88A 4OS2A 2HGTH 3DSGA 3GY2A 1H8ED 4WH8A 3UUZA 2AHME 3KCGH 3ZVBA 4FUJA 1C1UH 3M7UA 1J9CH 2XW9A 3EYDA 2OXSA 1P05A 1TMUH 1YM0A 5F8TA 5DO4H 4RKJB 1W12U 2WUCA 2ZP0H 4UFGH 1DM4B 1UVPA 1XUKA 1ELEE 5FXLA 1P03A 2NU2E 4I8HA 5TCAA 2F43B 4IC5A 3GYLB 1ELVA 4JK5A 1UTQA 4E7RG 2FOGA 3SI4H 1KIGH 9LPRA 2ANYA 3QUMP 1AWHB 2VWNA 1F92A 2Z9LA 1BJVA 2UUJB 4ABIA 3CENA 5GCHG 1HBTH 1P09A 1C1SA 4RT0A 3U1IB 1V2KT 5EXLA 1BIOA 4D9RA 4B76A 3LGWA 1AN1E 4K69A 4MTBA 4AGJA 2XC0A 2UUYA 3PROA 4UD9H 1H9LB 1P02A 2BYAX 2HNTF 3TU7H 6GCHG 1FV9A 1NFUA 2HWLB 2QE7D 1OWEA 4X2WA 1EOJA 3M5OA 1P57B 2BD8A 2H1UA 4LZ1H 2AGEX 2FOMB 4YM9A 4NIVA 2O8WA 2J38A 1G37A 2BD5A 1TLDA 3T28A 3AVZA 1DE7H 1JIRA 3D23A 5CDFE 2JH6D 5C2ZA 2A7HA 2LNCA 1O5CB 4Y7BA 1ZJKA 4FVDA 3F9EA 2PUQH 3VXFH 1PPFE 3SU4A 1C5PA 1BTZA 1W7GH 4INLA 5HMAA 4BAKB 1H8HD 2FOBA 1AFQB 3TJOA 3FP8E 4Y10E 1IQEA 3SNAA 1GMCF 5EXNA 1HAPH 1KSNA 1UTOA 5CE1A 2BDGA 2ALPA 1PQAA 4K60A 1P2NA 2QN5T 1UK2A 1Z1JA 4B74A 1TAWA 1YPGH 3LGTA 3MH4A 1QB9A 1P11E 4NA8A 1THSH 4AZ2B 1HRTH 1YCPH 2Y5FA 4ABAA 3UQOA 1BMAA 6GCHF 5IDKA 3O8DA 2QF0A 5F6MA 2OLGA 2BLVA 1INCA 3M3VA 3F2HA 3RMLH 4NFEA 1O36A 5A8ZA 1A5HA 4AB8A 4XDEA 2GZ7A 1FQ3A 1YKTA 2CF9H 2JJ2D 1DS2E 1FY5A 2A7CA 2EC9H 4Q7ZA 2UWPA 1S6HA 1WAYB 1DFPA 4I8GA 4PROA 1LHFH 2ZFQH 5B6OA 3U9AH 3GCNA 1V2NT 4BXWA 1H8DH 2OTVA 4KTSA 2ZHQH 1HCGA 2CHAB 5HM2A 3V3MA 3ITIA 1SHHB 3SNCA 1SSXA 1M9UA 1GJ9B 2SNVA 1WCZA 4B2AA 4R8TB 3MU1A 1C5QA 1SGTA 1QB6A 3A8DA 5E2PA 3PLBA 4TWWA 1RIWB 3M7TA 1H4WA 3RXSA 1DLKB 1AI8H 1K1JA 3RXDA 3BG4B 3SQHE 1LCYA 1HAVB 1UTKA 2K0QA 1W0KD 4GHTA 1TE0A 4UFFH 3MWIU 2PKAB 4XRNA 4ZKSU 2ESTE 1ORFA 2BZ6H 3SV9A 1BDAA 7GCHG 2HPQH 5DP7A 1TPSA 2Q6GA 5ESBA 5C0UA 1MBQA 1V2UT 4I32A 2AS9A 3RMNH 1PPBH 2HRVA 3LGVA 7ESTE 2BDCA 1EZUC 2QXHA 2YNAA 1AUTC 3GCOA 2G5NA 1CHOG 4HI3A 2G4UA 4OS4A 1K0HA 2OQ5A 2WYGA 1UVTH 5EQQA 1G3CA 1GDUA 3PWCA 2W3IA 2FOHA 3TNSA 1C4Y2 4D7FA 1G3EA 1B5GH 7KMEH 3BN9A 3LOXA 3UWJH 2VIQA 4IGDA 3TITA 3NWUA 4SGAE 1LHEH 2F9BH 3S9CA 1HAVA 1GHVH 5EGMA 1F0TA 2F83A 2GD4B 1AVXA 1AE8H 2PKAA 4I31A 1BBRH 1MBMA 4IMZA 4MVNA 1DXWA 1JMOH 1XVOA 3DFJA 5SGAE 3GDUA 4NG9H 2BD3A 3A7XA 1W14U 3MHWU 1SOZA 2G55A 5T6FA 1TA2A 2D8WA 2BY9X 3P17H 1O3GA 3M61U 2ZZUH 3TH4H 2VWOA 3RM2H 2Z3EA 4AB9A 1XXFA 2F9PA 3OTPA 5FX6A 3SI3H 1C5SA 7GCHF 3S0NA 2P3FH 1TGSZ 3F68H 4U32A 5FPTA 3LGYA 3P8GA 2PLXA 2SGFE 4ISHH 3K65B 4ZHLU 1K28D 5KEDA 1YPJH 1UTMA 1CHOF 2C4FH 1SGPE 4NSVA 3LDXH 1V2PT 1DT2A 2PSXA 1C5MD 1DITH 1L0ZA 4TWYA 2Z9KA 4Q63A 5EU8A 4ZAEA 4LXBH 4ASUD 4ISOA 2XC5A 1YPEH 3N7EA 1OS8A 2DUCA 3MNCA 1ZHPA 1MTNB 2D26C 4DCDA 3RMMH 1ZJDA 3PRDA 3E16B 3DD2H 3ZZ7A 1D3QB 1WYKA 3KYGA 2PTCE 3GY4A 1W0YH 1MAYA 1L1GA 1QJ6B 1GI0A 2UUKB 3OE7D 2KZ4A 1BTYA 1H1BA 1Q3XA 1Y3YA 4X6MA 1WDIA 5E2OA 3WWFA 1JWTA 3ZZ5A 3RXLA 1XXDA 1NRNH 2WV9A 2EI7A 5HIZA 2IJOB 1CGHA 1GG6B 4ZH8A
chains in the Genus database with same CATH topology
3U1JB 4BAOB 1IQHA 1DXPA 1W0ZU 5EG4A 2ZFTA 5JBBS 4F4OC 2ZF0H 2GMTC 1BRBE 1N6YA 2BXUH 5LPFA 5G4BA 1TNHA 2ZFSA 1EP6A 2FEQH 3RXPA 3LIWA 1FUJA 1G36A 5L2ZH 2NU3E 1MKWH 2B5TB 1GBBA 1MD8A 1TX7A 5HXFA 1ZHMA 2C8XB 1C9PA 4BXSA 1O3LA 1VR1H 2A4GA 1GBCA 1UVSH 1AHTH 2BZAA 2QC2A 1GJDB 2THFB 3E3TA 1NFYA 1NRPH 4GAWA 2J4IA 4FUIA 2ASUB 2ZPSA 4UFDH 4Q80A 2A7JA 4HTCH 3OYPA 1JXPA 1O30A 2FTLE 1Q31A 3F1SB 4TY7A 5EPYA 1O3FA 1P01A 1Z71A 3NKKA 1ZPBA 1BRUP 1ZMLA 2GT7A 2ULLA 1GHBG 4FXGH 1EAWA 5BPEA 1P2OA 3Q77A 9ESTA 1O2YA 2TIOA 1EKBB 1ZHRA 3BIVH 3RLYH 1QB1A 1ELCA 4THNH 3SV2H 1TRNA 3ELAH 4HFPB 1UK3A 4IS5A 1GI4A 1WUNH 1ELAA 4IW4E 1Y5UT 3MH5A 1BHXF 3SJIA 3R0FA 1DICA 1C1MA 2FESH 3VGCB 3CP7A 1PJPA 4TY6A 4NZLA 2QV1A 2K1QA 1SMFE 1GDQA 2WPLS 3RXQA 1C2MA 1X7AC 4KELA 1C9TA 4DURA 2O8TA 2BMGB 4I8JA 2AH4X 1O3MA 1EATA 1DUAA 3MO9A 2KAIB 1O3IA 4YT7H 1C5LH 1BRCE 2SGAA 1ARBA 4B73A 3S7KB 5GWZA 2ZDMA 1FIWA 4BOHA 2HVXA 4U30A 3SU1A 1GJ7B 4I8LA 1C5TA 2FX6A 1O3HA 2F3CE 3RXEA 1W13U 3C1KA 1MQ5A 3B8JA 2ZHWH 4X8TH 4JZFH 2FLBH 3ZVDA 2SFAA 1SC8U 1TNJA 1F0RA 1WTHD 3F9GA 1THRH 2SGQE 2A1DB 1GHBF 4BTTB 3A7YA 1GJCB 4MDSA 3TJUA 4GHQA 4OGXA 3PM3A 3A8AA 4WXIA 4AG1A 3W94A 1MQ6A 5EOKA 1DWEH 1TPAE 2H6MA 1EPTB 2ZGCA 3PO1B 2VNTA 4ZROA 1PQ8A 3SJOA 1SGRE 2KAIA 2FO9A 1HPGA 3GYMA 2ZDVH 1C5YB 4I8KA 1RTFB 3A87A 4IC6A 3I29A 1BHXB 4KTCA 2Y7XA 4AFZA 1ELTA 1DANH 1AY6H 2Z9JA 3NZIA 2HLCA 5T3HA 1QA0A 1AO5A 3RXIA 2FP7B 5GJ4B 1KDQB 5ABWA 2ODQA 3MO3A 3M3TA 2GV7A 2EA3A 1VCPA 2SGPE 3OY6U 2BX3A 3FZZA 4BAQB 2TGPZ 3RU4T 4ABGA 1QY6A 3HATH 1ZGVA 1HAOH 3D65E 3STIA 1EPTA 1ESAA 2FI3E 3UNRA 1T32A 3FVFB 3I77A 5CHAC 1HFDA 1C5VA 3JZ2B 2D1JA 4BANB 2WV5A 2XBWA 1FMGA 1TOCB 4E7NA 3AASA 3E91A 3VEQB 3ZV9A 5EW2H 1F7ZA 1MU6B 3TK5A 1MTSA 1QGFA 2FOAA 1LDTT 1KDQA 2W5EA 3RUOA 3VB3A 3M7QA 2RA3A 1UHBA 2H2ZA 8ESTE 2GP9B 3LGIA 3GISB 3P6ZB 3E0NB 1ANCA 2ZEBA 4NIWA 1ZOMA 1ZRBA 1VGCB 2FYQA 3U8TH 1UTLM 1BTWA 2ZDAH 2A31A 1D3DB 3MO6A 1SGFA 4NA9H 1ZRKA 1AFQC 4WY3A 1SLUB 1O38A 2OCVB 3UNQA 4ZKRU 2WYJA 5H4IB 1QBOA 3TVJB 1O5GH 1QNJA 4Y0YE 4XBDA 2XRCA 1SFIA 1O39A 3GCHC 1C4V2 3BSQA 1OX1A 2ZFFH 4X6NA 1TBQH 1W7XH 1WQSA 4DGJA 2ILNA 2A4RA 5DP6A 1B0FA 5AFZH 3Q3XA 2EI8A 1V2TT 3BEFB 1MKXK 1A61H 4AFUA 3DFLA 1C5RA 1LHGH 1IHSH 1RFNA 4H6SB 5GXPA 2HNTC 4YOGA 2W7SA 1GMDG 4AFQA 2DE9A 1YLCA 1QIXB 4Y71A 3GY7A 5C3NA 1A0JA 1K1NA 1XUFA 4X8VH 3TH3H 1F2SE 4INKA 5FPSA 2BX4A 2V0BA 4NGAH 2A5AA 2F9OA 4XE4A 1U6QA 4NWKA 1GCTC 2ZTZA 1FDPA 3LC3A 1TALA 2CHAC 1FPHH 3PB1E 4Y11E 4K8BA 1YCPM 4BNRA 2AERH 1NFWA 1SVPA 5EODA 2FX4A 1BMLA 1QBVH 4X1RU 3O8CA 5LPEA 4GCHF 3HGPA 4X1QU 2PKSB 3PMBB 5K0HA 2PUXB 2GCHF 2FM2A 2P8OC 2FOCA 4ASHA 2GDDA 1WOFA 3RXJA 1ANBA 1RIWC 2BD4A 1BTPA 1WSSH 4MNWA 2PW8H 1EJMA 1C2EA 1CHGA 1TNIA 3SUFA 4ZXYH 2WPJS 1L1NA 2AMDA 1GMDF 1A46H 1V2LT 1ANDA 1G9IE 1TGBA 3BTTE 3O8BA 1V3XA 1P8VC 3RXBA 1S81A 4LOYH 5A8YA 1XMNB 3TGJE 1NRRH 4X6OA 3T62A 2JETB 2RA0A 2G4TA 4IBLH 1D3PB 3QZQA 3A7ZA 2VIPA 4ZMAH 1SGEE 1HNEE 3B23B 3LH1A 4SGBE 3UOPA 3VB4A 3A80A 2SGEE 2XNIA 4Y7AA 1G30B 1ABIH 1MAXA 2TGAA 4ESTE 4H6TA 2BM2A 2FOEA 3NXPA 4ZHMU 1QFKH 3T27A 1E35B 3SV7A 1XVMA 2B0FA 4MPXA 3STJA 2M5TA 1LVYA 1ABJH 2CV3A 1Z6EA 1C1TA 1MZAA 1RTKA 4WH6A 1UCYH 1HJAB 4I7YH 1E38B 2GDEH 3VB7A 3QX5H 1FI8A 5GDSH 2Z3CA 1C5XB 4F49A 1MMJN 2GX4A 4WMFA 2Y5GA 2ZKSA 1IHTH 1AQ7A 1GJ5H 5CHAB 2JH5D 4Y8XA 1A3BH 2R2MB 2JH0D 4DG4A 1O2KA 1TPPA 1V2OT 1ZMJA 3E1XB 3GOVB 1GHYH 3A8CA 2H9HA 2QF3A 1C5NH 2QIQA 3BTGE 1ESBA 2WV4A 5DP8A 2P59A 3TGKE 1TRYA 2TRMA 3HGNA 1MTNC 1QL8A 1C1VH 5C1XA 1SQTA 5C20A 1PPCE 4FUCA 4AG2A 1JIMA 1PPGE 1EB1H 1O2ZA 5PTPA 1AU8A 3F9FA 3TJNA 1QRXA 2D2DA 1Y3VA 2BDHA 3M3SA 4HGCA 4R0IA 4JMYA 5FCKA 1W10U 1GG6C 5GCHF 3EQ0H 1HAYB 4RSPA 1O35A 5JYIA 4MNYA 1BBRE 3GCHB 4OS1A 1TONA 2PGQB 4JYTA 2ZCLP 3KQBA 3NUMA 1DSTA 3PLPA 1KXFA 1P2MA 3SOSA 3OX7U 2GZ8A 5C5NA 1NRQH 2Z3DA 1TPOA 2V3HH 2EEKA 1K1LA 1FY4A 2G52A 1TYNA 4WMEA 4K1EA 5ESTE 2AMPA 3H7OA 5DP5A 1C2KA 2C8ZB 1ZGIA 2W3KA 2GVFA 4A1VA 1O3EA 5A0AE 1T4VH 4TYDA 3SHAH 2OBOA 4KGAA 3M36A 1S5SA 1WQVH 1JBUH 2SGDE 1EP5A 1GBLA 1RGQA 4YO9A 2BDBA 1SFQB 1O33A 1GCTB 1UTNA 2OC1A 4IMQA 4CR9A 3P8OA 5FHTA 4ABDA 4DOQA 1TX8A 2PHBA 1SR5C 1NY22 1YF4A 1C4U2 1FJSA 1LVBA 1O2PA 5DG6A 3NK8A 1TX6A 2P8OB 3RXVA 4YLUA 2VIOA 1C1WH 1Z8IB 3TK6A 1TGCA 1P06A 5GPIB 2PTNA 1P3CA 2Q6DA 4AGKA 1BMNH 1GI3A 4DY7B 1ETSH 3F6UH 1Y3XA 1G32B 1CGIE 5T6GA 2GKVE 5AFYH 3VGCC 4KKDA 4ZHAA 1FZZA 1AUJA 2QCYA 1HV7A 1GVLA 4GSOA 2ZTYA 1MU8B 4AYYB 1YPMH 1CGJE 1AVWA 2Y81A 1P0SH 1IQKA 5F8XA 3V0XA 2BLOA 3DT0H 3V13A 1N8OC 2F9UA 3SJ9A 1EB2A 2WPIS 1OWDA 2ZG0H 7LPRA 2A4OA 1PPEE 3VB6A 1P2IA 2OD3B 2BDYA 2FI5E 2XC4A 2BVRH 2I6SA 1GI7B 2Y5HA 4Q2KA 1NU9A 2GV6A 3V7TA 2A5KA 4MLFB 1YCPK 3KGPA 1TGNA 1DVAH 1NT1A 2ZHEH 3BF6H 4Q7XA 2Z94A 4A1TA 4BAMB 2TGDA 1EPTC 4JZ1A 2AYWA 3PO1C 1FLEE 2BOHB 1WV7H 1TBZH 1TNGA 2ZU1A 3PYHA 4J1YA 2ZA5A 3SNDA 1TIOA 1ZSKA 3O8RA 4YOJA 1P2JA 2OBQA 4UONA 4TPIZ 3ZVAA 3U98H 2ANMH 3RXHA 3V12A 1T8LA 1TNLA 1OP2A 3UY9A 2VIDA 3BTWE 1T4UH 4DJZB 3PTBA 2PR3A 4CHAC 3Q3KA 1LPGB 3U69H 1C5ZB 5L30H 3U8RH 2DE8A 1ANEA 1NS3A 2F9VA 2HNTE 1IQLA 3M5MA 1C2GA 1C2FA 1P2QA 1Y59T 4MPWA 1O3JA 3VFEA 3A7VA 1TRMA 4AN7A 4X1NU 3C27B 2AIPA 3MNSA 1P12E 4FU7A 1Z7KA 6CHAC 1P9SA 2Y6TA 3OU0A 2ZDNA 3GDVA 3QK1A 1GI5A 2VVCA 3VXEH 4OS6A 3ODFA 3SUDA 1GBMA 2ZNKH 4DVAU 4Z0KA 3QDZB 3SV8A 4X1SU 5FCRA 1S0QA 1VGCC 1V2WT 1T7CA 2V35A 3IWMA 1F5RA 2A45B 2Y7ZA 5JBAS 1A3EH 3UOUA 4K2YA 1EZXC 2HPPH 5IYTA 3UQVA 1BBRK 1J8AA 4QT8C 1LPZB 3SHCH 2FYRA 3RP2A 2VINA 3ZZ3A 3P70B 4FU8A 1HJ9A 1TNKA 1KLJH 1EJAA 1C5WB 2WINI 3IG6B 1O3AA 1V2ST 2ZPRA 1TGTA 1VCWA 1RXPA 1NPMA 4NFFA 3LPRA 1GPZA 1AZ8A 3A84A 1GBIA 4NZQA 2CMYA 4WMDA 1QR3E 4U01A 4XBBA 1C1NA 1E0FD 1O2XA 2BDAA 4A5TS 1C5OH 3H5CB 4H42U 2ZI2H 3A86A 3UTUH 2VU8E 3SU5A 3A89A 5HM9A 4GPGA 1GJ8B 2G81E 3EA8A 1SQAA 3KN2A 1IQGA 2AMQA 4ABHA 1D4PB 1BOQA 3MU0A 3KEEA 2PKSC 4X2YA 1W3CA 1ZZZA 3PMAB 1P2KA 1O0DH 3L33A 3RC4A 2FOFA 3A82A 3SGQE 1BUIA 1C2HA 3BEIB 1HUTH 2A2XH 2R2WU 1EX3A 1N8OB 1F0UA 3TPIZ 4BTIB 1Z6JH 1VCQA 1ZMNA 3AW0A 3K2UA 2Q6FA 3IITA 1GI9B 1IQJA 4JYUH 1ACBE 1L2EA 4O97A 1IQFA 2ZTXA 3MNBA 4FUGA 1TB6H 3ZZ9A 5JBCS 1J14A 3UR6A 1DY8A 2XWAA 3DA9B 1AIXH 1LHCH 2CXVA 1MTUA 2JETC 1MKWK 1DLEA 3JZ1B 4MPVA 1O2SA 2BQ6B 3EGKH 3Q00A 4B2CA 6LPRA 3E6PH 1ID5H 1B0EA 1O5EH 1YGCH 1O2LA 2PGBB 4FVBA 1K1OA 1V6DA 3MOCA 2FPZA 1DWCH 1AFEH 3UWIA 4Y0ZE 1CVWH 3LH3A 3MMGA 4FUBA 4FUEA 1LVOA 2A5IA 1MKXH 2FWWA 1O5DH 1DPOA 4VGCB 4JK6A 5DP3A 3M5NA 4MPUA 2P3TB 2B7DH 1GBHA 3LU9B 4LK4A 4CHAB 1IQIA 2ZQ2A 1IQNA 3A81A 2XBVA 1HJAC 2B8OH 1HYLA 1O3OA 2O8MA 3RDZA 2WUBA 1OWKA 3SQEE 1LPKB 1HAHH 2P94A 3TNTA 2XYAA 2VVVA 3FAOA 3MYWA 4I33A 2VIVA 4X8SH 3UPEA 2RCEA 4MNXA 2BQWB 2ZPQA 1CBWB 1ETRH 2IOTA 4Y79A 1C1PA 1ELDE 1ESTA 1Y5BT 6CHAB 5EW1H 5L6NH 3SGAE 3AAUA 1PPHE 1LMWB 1O2QA 5A8XA 4ZKNU 1EASA 3M37A 2BVSH 2P95A 5FX5A 2TPIZ 1NFXA 2BD2A 1O2RA 4WXVA 3EE0B 4B2BA 1WU1A 4CH2B 2GTBA 1BB0B 1EQ9A 3RMOH 3Q76A 4GLYA 1MCTA 2XCFA 2G8TA 4YT6H 1GVZA 1CT4E 1FY3A 1JRSA 1GJ4H 2AGGX 2BD7A 5GIBA 4NSYA 3HKIB 1G3BA 1BJUA 4IN1A 1O3DA 1LKAA 3FZDA 2BY8X 1QL9A 4XOJA 1A2CH 3FP6E 1CQQA 1K9OE 5ETXA 3LJOA 1FY1A 3LGUA 4XFQA 1O2JA 1SBWA 1UCYE 5T6DA 1O3CA 4ZXXH 5LH8A 4ISLA 2FODA 1HAXB 3T29A 3DHKH 1H8IH 2G5VA 5E0GA 1T8OA 2W26A 1LKBA 1GBAA 2QGRA 1YC0A 1SG8B 1OOKB 4D9QA 3TIUA 1MTWA 1XKAC 1TOMH 3KL6A 3PMHB 1K21H 8LPRA 2I6QA 1FIZA 1S84A 4X8UH 3PTNA 2BXTH 1OXGA 1FXYA 2FZZA 5L2YH 1QRZA 1CO7E 2BDIA 1GHAG 5JB8S 1UMAH 2J95A 5FPYA 1GGDB 2Y82A 4ZUHA 3KQEA 1KTTB 5JBTA 2V6NA 1YP9A 1D3TB 3N7OA 1ELFA 2AIQA 1OWIA 1MZDA 4J2YB 2NWNA 2FS9A 2CN0H 3SU2A 2BVXH 3EA7A 4B75A 1UTJA 3URCA 3HK6B 3LC5A 1ZPCA 4K1SA 5EXMA 3ATKA 3RXUA 5DK1A 4WJG2 1YYY1 2R0LA 3E90B 3SBKA 1E36B 1G3DA 1AZZA 1E37B 3RXRA 2OC8A 2VGCB 2J94A 1EUFA 1SGIB 4HZHA 4K1TA 1XX9A 4ISIH 4K3JA 3UIRA 3ODDA 2F9NA 1GBTA 2BY7X 2QY0B 1TMBH 4ZKOU 2AGIX 1O2VA 2IPHA 2C8YB 1O2IA 1HXEH 3LT3A 4KTUA 2BY5X 2QXJA 2OINA 2FMJA 1GHAF 4Z6AH 4CREA 1H9IE 2VWMA 1THPB 2ZGHA </