1BOQA

Pro region c-terminus: protease active site interactions are critical in catalyzing the folding of alpha-lytic protease
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNITANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ALPHA-LYTIC PROTEASE)
publication title Pro region C-terminus:protease active site interactions are critical in catalyzing the folding of alpha-lytic protease.
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1998-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1boqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1boqA01
3MO6A 1TABE 1O2WA 2ZECA 4MVNA 1P11E 1ABJH 1W10U 1KXCA 1ORFA 1VCPA 4B71A 3UREA 1DX5M 2AEIH 4BXWA 2SNWA 1O33A 5GIBA 1HYLA 3VFEA 1P2QA 2A7JA 1D3QB 2P59A 4XBCA 3ZZ8A 1IQGA 3BTWE 4IC5A 4NWLA 2FLBH 1ELAA 1EAUA 1GBEA 4H6TA 6CHAB 1VGCB 1TNJA 3RC6A 1BT7A 1NFXA 5F6MA 1BTUA 1C5VA 4AG1A 1W0YH 3UQVA 2ZCLP 3U98H 2KAIA 3K9XB 4RKJB 1VGCC 2ZGHA 2ZIQH 4X8UH 1O2QA 4E05H 5L2YH 1J14A 3PMBB 2GP9B 3VEQB 5T3HA 1P03A 1O3LA 4WMDA 2P16A 4K5ZA 3RU4T 3RXIA 1ZRKA 4RKOB 1Z8GA 1XX9A 4GVUA 4Y6DA 3EE0B 1CHGA 4X1PU 1V2NT 2CGAA 1SGFA 1QTFA 2BZAA 1Z1IA 3I29A 2RDLA 4FVDA 1C1RA 3ITIA 3E6PH 2OC8A 1D3TB 1O3CA 1SGNE 2AS9A 3GY7A 3ZZBA 2BY9X 4F4OC 4GHQA 3M3VA 1SLVB 1GVLA 3VGCC 3FZDA 4X1SU 1ZRBA 1Z7KA 1OYTH 2R2WU 5A8ZA 2VGCC 3DFJA 2WYJA 1O5BB 5T6DA 3ATMA 2WUBA 1SL3A 1ZMNA 3RXQA 3T5FH 3ZV8A 1QFKH 2XCNA 3RMOH 2UUJB 4Q7XA 5EPNA 3SV9A 2ZTYA 2VH6A 1LDTT 2EI7A 1BZXE 1DSUA 1DS2E 3MOCA 3BTEE 3VB6A 4MQAA 2BXTH 3V0XA 2C8WB 2P94A 1AVGH 6GCHF 4Y11E 1OWJA 3HPTB 1HAZB 1T4UH 1QGFA 1BMAA 4ZXYH 2OTVA 1TPSA 1C5QA 1AMHA 2R9PA 2A4GA 3BEFB 1JRTA 1Z6JH 3EQ0H 2THFB 1O5CB 4MDSA 1HJ9A 5C1UA 2Q6FA 1GJAB 5CE1A 1LHFH 1WTGH 1DWDH 2VH0A 3MH4A 2AYWA 2PGBB 2O8LA 2O9QA 1BHXB 2WPIS 1KTSB 1GMHF 1PPBH 3GICB 1OXGA 1L1JA 1Y3UA 2FTLE 4Q2KA 3U9AH 4WF8A 1GMHG 1NFUA 1EB2A 1AZ8A 1O2KA 3E1XB 1GHXH 1G32B 2Z9IA 2ZDLA 3F9GA 1GCDA 1YPGH 3P17H 3VB3A 1BTPA 4CRBA 4BTTB 2ZF0H 2XWBI 3FP6E 3Q00A 4GCHF 1A0HB 3A84A 1SQAA 1XM1A 4Y0ZE 1YM0A 2V0BA 1KYNA 2PV9B 3MFJA 3VXFH 5CHAB 1W7XH 1ESTA 3ZZ5A 4OS4A 1B5GH 1KDQA 4CBNA 2BD2A 2F9UA 4DURA 1GG6B 2TPIZ 1PPHE 4NCYA 3D23A 4WY3A 1MBMA 1O5AB 1LO6A 1GJCB 4IC6A 1ETRH 1ELEE 1O2YA 2Z9GA 1C2JA 2QYIA 1N6XA 1Z6EA 1FZZA 1GG6C 1BHXF 8GCHF 3SORA 9ESTA 3D65E 3LU9B 1O3DA 2BD7A 5JDUB 5EXNA 3UQOA 2TGAA 1RFNA 3VB5A 1QBVH 3ZZDA 2DE8A 4DOQA 2B0FA 1CSOE 2C8ZB 1FAXA 3URDA 2FESH 1SLXB 3B9FH 1FY5A 3O8DA 3SUGA 1DUEA 1RRKA 2XWAA 4Y0YE 5C1XA 2AIPA 5HGGA 1G3BA 4FUBA 5EW2H 3Q3KA 1FLEE 1G2MA 3RM2H 1QQ4A 5K7RA 4ABFA 3SJ8A 2Z3DA 2BLOA 2ZZUH 3LONA 1S83A 2IJOB 2OUAA 5JYIA 1OWEA 4AYVB 1O30A 1N1LA 1VZQH 2PWXA 1THPB 1TPAE 5HM2A 2BVXH 3RXUA 1O2PA 3QTVH 1C2KA 1GBJA 2ZHQH 2AMPA 4DGJA 3NUMA 5DG6A 3RC5A 1ELFA 1GJ7B 2VIQA 3RXVA 3BIUH 1XVMA 3RUOA 1GI4A 2ZTZA 7ESTE 4WH6A 3ZZ6A 2FMJA 3CS0A 1VJ9U 4JZDH 1RIWB 1W11U 3ZVCA 4NIYA 1DICA 3E91A 4DW2U 2XBYA 1HIAA 1O3GA 1IQEA 2CHAC 4LXBH 1C2DA 1G37A 2UWLA 4AGKA 2B9LA 1FDPA 1G2LA 2Z3CA 1ID5H 3A7ZA 3LKWA 1JRSA 3PROA 1MCVA 3PLBA 1ZHPA 5FBIA 5A8YA 3ZYEA 1C5MD 5F8ZA 2BQ6B 2GVFA 2F83A 1D6RA 1TGTA 4B1TA 1CA0C 2G5VA 1BBRK 1C2FA 1JBUH 4Y8YA 1YCPH 1HPGA 1EXFA 1FPCH 3OY5U 3M5LA 1AHTH 1DXWA 2D2DA 1BMLA 1QB6A 5AFZH 1XUJA 1ZHMA 3RC4A 3GCTG 4XE4A 1RTKA 4H4FA 4MPUA 1WU1A 5DP3A 5EXMA 4YESB 4R8TB 2CN0H 2PKSB 2B7DH 3ODFA 4MLFB 3SOSA 2VWNA 5L30H 1D3DB 3MI4A 1MD7A 1SGYE 4Q80A 1FPHH 1V2VT 3PYHA 3SGAE 2QV1A 1UVSH 2ESTE 5JBTA 1IQHA 3UY9A 3TGIE 2I6QA 3LT3A 1NFYA 2FOEA 2Q6DA 2VVUA 1P2IA 5DJ7A 2ZTXA 2GX4A 3N7OA 5GJ4B 1GBMA 3M35A 3GY4A 1QL7A 2FTMA 1AVXA 2PUQH 1MTSA 1TRNA 1SQOA 2UUFB 1P06A 2H5DA 4D7FA 3KQEA 1RTLA 1T32A 2SGDE 1L1GA 7GCHF 1CGIE 1MTWA 7GCHG 1DE7H 1EAIA 1QURH 2G00A 1UTOA 3BTTE 3SNBA 2EEKA 2HALA 4JK6A 1DWCH 5FXLA 3SNDA 1GL1A 4WJG2 4JZIA 2JETB 1GL0E 2FOHA 1BTYA 3HATH 4DJZB 1RD3B 1EOLA 3D62A 1O3NA 1FY3A 1C2IA 4JYVH 1K1MA 2BD5A 3TPIZ 3ENSB 1O3AA 1AE8H 1L1NA 1UMAH 3QN7A 3UTUH 1QIXB 1TE0A 2VU8E 4BANB 1MQ6A 1GGDB 3CENA 3UOPA 3M3SA 2JETC 1DANH 4X1RU 1N8OB 4Y71A 4JZEH 2ZDNA 2UWOA 2PTNA 1AWFH 1OS8A 5E8EH 2ZU2A 5DGJA 1MUEB 2O8MA 4LOYH 1H9IE 3SQEE 1GGDC 5EXLA 1ZSLA 4Y79A 2Z9KA 4K3JA 4A6LA 3ZYDA 1EX3A 2C90B 4YOJA 2UUKB 3STIA 5FPSA 2BDHA 1GBIA 3CP7A 4AYYB 1GDUA 3MNXA 2FI4E 1OWHA 1X7AC 3GY8A 4OGYA 1C2GA 1DDJA 3FP7E 2H9EH 2NWNA 2GMTB 2O8TA 1MKWH 1TFXA 1EOJA 1UCYK 2ZCKP 1SVPA 4O3TA 4MG3A 1XKAC 1LVBA 1UTLM 2F9NA 3WY8A 1A5IA 1DPOA 1G3EA 3RXFA 1VCQA 1P2NA 4I8GA 1QB1A 2ZPQA 1THSH 5E0JA 1Q2WA 1NRQH 3LC5A 3EAJA 1HDTH 3RXGA 1H1BA 2VWOA 1UTKA 1P04A 2ZHDA 3AW0A 2XC5A 1F0SA 2BDIA 2A2QH 2VWLA 4YTAA 3S0NA 1E36B 4JYUH 1ZJKA 1PPCE 4MPWA 1K1JA 1O2OA 2F3CE 1JIRA 1XUFA 2OP9A 1A1RA 2H9HA 1KXAA 1O3HA 3W95A 5JB9S 2V35A 3GDVA 5IYTA 4H6SB 3B8JA 1BITA 1FY4A 1S84A 1ZYOA 1HUTH 3UFAA 2ZFRH 3BTKE 1DY8A 3FP8E 1AU8A 2J95A 4K69A 4Q7ZA 3TU7H 1A61H 1EZXC 3NCLA 1SI5H 1OX1A 2Q6GA 1AFQB 1W8BH 2R3UA 3SUFA 1ANBA 2XC4A 4CRCA 1RGQA 1MZAA 4INHA 3ZZ4A 1ABIH 1DT2A 1LVOA 2SGAA 2SGFE 4B73A 1W2KH 3BTDE 2D26C 1TNHA 2HPPH 4VGCB 4U32A 4WH8A 3A86A 3EA9A 3C1KA 1AFQC 2BZ6H 4ZHMU 2V3HH 4ZKNU 2AGGX 4F49A 3SGBE 3M7TA 3IG6B 2F9BH 1GBLA 1TBQH 1KXEA 1P2KA 4VGCC 1K1LA 2J34A 3L6PA 4X6NA 1C1QA 2QY0B 4D9RA 5A0CA 1O2SA 1SR5C 1MCTA 4M7GA 4I33A 2GCTC 5E0GA 3VB4A 1BTXA 1MD8A 3SHAH 2FDAA 5ABWA 1MTNB 2HNTC 1FQ3A 2RA3A 1EZSC 3RP2A 3T62A 1SBWA 1HAXB 1KLTA 2SGPE 1JWTA 1SMFE 3SW2B 2CMYA 3S7KB 5L6NH 1D9IA 1GHYH 1HXFH 3PMJA 1AUTC 4X6OA 3PM3A 1FY8E 4OS1A 1HAIH 2F9OA 1JOUB 3P8FA 3QZRA 2R3YA 2QF3A 3M61U 1PQ5A 3S7HB 1SFQB 4D9QA 1FIZA 1MKXH 3GY5A 1BOQA 3L33A 1J9CH 3U69H 4BAQB 1WBGB 1YBWA 1ZSKA 3MH6A 1C5SA 1NRSH 4NWKA 4YOIA 3UPEA 4ZH8A 4FUJA 1N6YA 1TA6A 2H6MA 4X2VA 1IQMA 2PTCE 2Y80A 4NSYA 1CT4E 1EPTC 3L3TA 5AHGH 1NT1A 1D6WA 1YPEH 4TWYA 3ZVBA 2V6NA 1RS0A 1NU9A 2ZEBA 2AIQA 3Q77A 4SGBE 1AVWA 1Z8RA 2H9TH 3VPKA 4KKDA 2QF0A 3MH7A 3KHVA 1NM6A 1NO9H 2ZGJA 1E37B 3E0PB 2FZZA 2GZ7A 2H1UA 1FV9A 3Q3YA 5LH8A 5C67A 1W12U 2VIDA 1O5DH 2J2UA 1T31A 1HJAC 1UCYE 1BJUA 3ODDA 1O3EA 2QAAA 2AGIX 3OY6U 1ESBA 2A7HA 4OS7A 1O39A 4E06H 3JZ1B 5DPAA 4GHTA 2IN2A 1ZR0A 1W7GH 1GI7B 1K1IA 1PQ8A 2HOBA 5ESBA 1EAXA 2I6SA 3STJA 1C4U2 1WV7H 2XRCA 4KTUA 5ETXA 2A31A 5FX6A 4A5TS 2A4RA 1GBFA 3T27A 3EA8A 1NFWA 3PWBA 1DY9A 4HTCH 4X8SH 4CBOA 3M5OA 2A5AA 2LNCA 1ELGA 5GCHF 1OOKB 3K2UA 3QX5H 2NU2E 3GY3A 5GCHG 3P92A 1C5PA 2GD4B 1WOFA 5E2OA 1HLTH 3NKKA 2PHBA 1HAOH 4BAHB 3VGCB 5T6FA 1GBBA 1PPZA 4Y8ZA 5BRRE 1V2WT 2VGCB 3AVZA 4ESTE 4AX9H 3T25A 2BDGA 1MH0A 4H42U 1KTTB 1AE5A 4KP0A 1U6QA 3KN2A 4O03A 4Y10E 1O3PB 3B23B 2KAIB 1MAXA 1V2PT 2GZ9A 3SV7A 5F03A 2H5CA 1SGDE 1E0FD 1CBWC 4INKA 4A7IB 3RXLA 2OQUA 4I7YH 1SOTA 1GCTB 1LCYA 2PLXA 4ZKOU 1P3EA 3SNCA 4CH8B 3TGJE 4I8LA 1ELTA 3F1SB 3S69A 4A1XA 1Z71A 2ZQ2A 1GCTC 2FP7B 3ATKA 4ZMAH 2ILNA 2VVVA 2ZHEH 1F5RA 3BG4B 1O3KA 3URCA 4CH2B 1SGIB 4A92A 3LOXA 3MWIU 3S9AA 1HXEH 3RDZA 1SGTA 2ZU4A 2M5TA 1Z8IB 3TNTA 1ELVA 1QJ7B 1BA8B 5FPTA 1DM4B 1V2MT 4NSVA 3BG4C 1MZDA 2ZKSA 3A7TA 3UUZA 1JMOH 1G3CA 1WQSA 1JXPA 1LHCH 1YPHC 2D1JA 3SO3A 1EATA 1W0ZU 3DFLA 2ODQA 2BB4A 3F6UH 3RM0H 1T8LA 2XW9A 4CRDA 4KTCA 1QY6A 1ZMLA 2FYRA 4U30A 3TK6A 1ZPZA 4NG9H 3SU6A 1JIMA 1SGCA 2ZCHP 2HNTE 2RCEA 2W3KA 2G8TA 3Q3XA 3V7TA 2QXIA 3TJUA 4X2YA 8LPRA 2BY6X 3BN9A 1BMNH 3IITA 1K1NA 1HV7A 1MTVA 3SU0A 3ZZ3A 1IQNA 1SGFG 2TRMA 5DP6A 2GT7A 2ZGCA 1O3BA 2FI3E 1V2KT 2W3IA 2ZFPH 1HCGA 1GJ4H 1P10A 2NU4E 4CREA 5JBAS 1QR3E 2EA3A 3ATIA 2ZO3H 1P57B 4BAKB 3G01A 2Y5GA 3A81A 3A83A 1Z8JB 4YM9A 5GWZA 2F91A 2WPJS 1TX7A 4FUIA 2FWWA 2OC7A 1BCUH 3RXMA 2PW8H 1NTPA 4HI3A 1K1PA 1O3OA 2H2ZA 3A82A 2Z94A 1O2UA 5EOKA 1C1PA 2ANYA 2SFAA 4YLUA 2GTBA 4XDEA 1V2QT 3SHCH 1GBTA 3F9FA 1QHRB 2A2XH 2A7CA 1A46H 1PPGE 1O2JA 1Z1JA 4D8NA 1EASA 2SGQE 1Q31A 3F68H 3DT0H 1UK2A 1UVOA 1GDQA 2PR3A 1KDQB 2WPHS 1AO5A 1TNKA 2Y6TA 4JZ1A 1ELBA 2FX4A 4TWWA 1O2ZA 4JMYA 4NIVA 1ELCA 2QXHA 4CR9A 1HJ8A 2UUYA 1C5WB 2EI8A 5C20A 3ZZ7A 3OSYA 1H8DH 1FXYA 3TIUA 1UK4A 3RXAA 1CE5A 4JYTA 1GI3A 1SLUB 2CHAB 5TJXA 3SU2A 1O2TA 1TWXB 1K22H 4NA9H 3RU4D 3S9BA 1YCPM 1S0QA 5DP4A 1ETSH 2O8UA 1T7CA 3DD2H 1A3EH 1BB0B 1K1OA 1PQAA 1C1UH 1KXDA 2WUCA 1L4DA 2Y81A 3UWIA 1O32A 3E3TA 1V3XA 2STAE 3KQDA 1CA0B 2WPMS 3ESTA 2BQWB 1GHAF 4FUEA 2W5EA 3AASA 3M37A 2TGPZ 1IAUA 1F5KU 1GHAG 1A5HA 4ISLA 4AOQA 4AGJA 1PYTD 1WTHD 1Y59T 3PV4A 4ABIA 3RXPA 2XBXA 3MU1A 3SV2H 2ZFSA 1C2EA 3BTHE 3DA9B 1ESAA 1TGCA 3FAOA 2R0KA 3NZIA 1O3FA 5I25A 2C8YB 1YPKH 5E2PA 3GCTF 4CRFA 1OP0A 3KCGH 3T2NA 2Y82A 2BDCA 3QDZB 4D76A 1YPLH 5IDKA 2BHGA 2ZDKA 5DKMA 1O38A 3HGNA 4ZXXH 1D4PB 3KNXA 1HIAB 3LH3A 1C5XB 3SU5A 3LGUA 1UJ1A 5HXFA 4GUXA 1C2LA 1KY9A 1ZPCA 1YLCA 3MU5A 4B2AA 4IMQA 3U1JB 3DUXH 2CV3A 2PKAA 3SGQE 2A5KA 3RMLH 1BBRH 2BQ7B 1DLKB 1SOZA 5A0BA 1DLEA 5GXPA 1WSSH 2WINI 4IN2A 2Z7FE 2FEQH 3MTYA 1MMJN 1ZZZA 1TNGA 1E38B 2LPRA 1YPHE 1FN6A 1TBRH 4FUGA 3A8AA 2BM2A 3GYMA 2GDDA 3AAUA 1O3IA 1C4Y2 1OP8A 1Y5AT 3TH3H 2FI5E 3P8NA 2JH0D 1BMMH 1TOCB 5CMXH 1S5SA 4I8JA 2K1QA 1GJDB 6ESTA 1C9TA 1VCWA 1FJSA 3SUEA 3SV8A 3OU0A 3P95A 2NU3E 1M9UA 3O8RA 1GPZA 3MNBA 3C27B 4AORA 2J4IA 1J16A 5E0HA 1FI8A 4UEHH 1GMCF 2FS9A 1HRTH 1RJXB 2A45B 1VJAU 2ZHFH 3P8OA 1GMCG 1F0TA 5I46H 1KXFA 2TGDA 1C5ZB 1YKTA 5EGMA 2ANMH 2W7UA 1A2CH 4B2BA 2ZDVH 2OC0A 3LC3A 3EA7A 3MNCA 1TMBH 3SBKA 5G4BA 3FZZA 4NFFA 1TQ0B 1EP5A 3VB7A 4CRAA 4B74A 1LHGH 1QCPA 1P12E 4ABGA 2G52A 1C2MA 1IHTH 3RXOA 1C1MA 1XXFA 5FAHA 1UTJA 3SN8A 3LGVA 4OGXA 3W94A 5ESTE 1GI6A 3ATWA 1QA7A 4U01A 4B75A 1SSXA 1PPFE 1F7ZA 1PYTC 1QRZA 2IOTA 2G4UA 1ETTH 2ZU3A 4KTSA 1T8MA 2ZU1A 2STBE 3MNSA 3TGKE 1VITG 3SU3A 4B2CA 3F9EA 3PTNA 1ZTJA 2BDAA 1A0LA 1LMWB 2QC2A 1MU6B 2QN5T 1O3MA 1TRMA 1VITH 1YYY1 4NZQA 1BJVA 1F5LA 2WPKS 3TH2H 1L4ZA 1ZHRA 7LPRA 1ZTLA 1O36A 3M3TA 2R2MB 4CRGA 1K28D 5FX5A 2BLVA 1AIXH 3EYDA 1B0EA 5EW1H 5C3NA 1UCYH 4U2WA 1LHDH 3MU8A 1AD8H 1FAKH 1NY22 4ISNA 1IQJA 1ZGVA 1MAYA 4A1TA 2BY8X 3SUDA 1IQLA 1BBRE 5LPEA 4MNXA 3H7OA 1Q3XA 5J4QA 5HYOA 1HBTH 2BX3A 4ISIH 5EPYA 2VWMA 2IPHA 2PFEA 2BDBA 4NA7A 2P8OC 1DITH 4K8YA 4ABHA 1W14U 3QO6A 1C5RA 1AB9B 3LIWA 4ISOA 2GV7A 1OPHB 1O5GH 4ZKRU 2QIQA 4X6MA 5JBBS 3HK3B 4FXGH 3ZZ9A 2VNTA 1NS3A 2FYQA 1AB9C 4IBLH 4TY7A 1Y8TA 2OINA 1K2I1 1OWIA 1ZGIA 3Q76A 2YNBA 1EJMA 1FN8A 3QTOH 3RXJA 5DK1A 2GCTB 3QGNB 2ZDMA 2FOCA 2P3UB 3V3MA 4UFEH 1ZJDA 1LHEH 3RXKA 1TNIA 2FLRH 4IS5A 4FVBA 5PTPA 4MNYA 4WWYA 4X1NU 1EPTA 4Y8XA 2OLGA 4I8KA 1GHZA 4AG2A 5AF9H 1XXDA 8ESTE 2BYAX 4ABEA 3OX7U 1BRUP 4OS5A 1CT2E 1HGTH 1HAVA 3E0NB 2VVCA 2P93A 1V2ST 3PO1B 3SQHE 1GJ6A 2BD3A 3JZ2B 2R0LA 4YO9A 1YC0A 3GCNA 3PTBA 1QJ1B 2AMDA 4Z0KA 3TITA 2BOHB 4BXSA 2GT8A 4FU9A 1AKSA 3LH1A 4AFQA 1V2UT 1ARBA 2ALPA 1NN6A 4X1QU 4BAMB 4ZKSU 2EI6A 1HAYB 2FPZA 1FIWA 3PO1C 2BVRH 1O5FH 1A0JA 3ATLA 1OYQA 1O31A 1MKXK 3MU0A 1NESE 1TGNA 1FY1A 1SB1H 4A1VA 2XBWA 3HKIB 5DP8A 3ZZCA 3SV6A 1V6DA 1BUIA 2F9PA 1EKBB 1RTFB 2OBQA 1EPTB 1TGSZ 2CXVA 1GI0A 1CA8B 2ZFFH 3M5MA 3ZV9A 1P9UA 4THNH 1MTUA 3SU4A 1SG8B 3GY2A 1BTWA 4MPVA 2AH4X 4OS6A 1HAVB 1TBZH 2BD9A 5L2ZH 3PMAB 1EB1H 4IGDA 3BTGE 3ZVFA 1UO6A 2G55A 2C93B 4GPGA 4K1TA 1WYKA 3PWCA 2ZFQH 2FIRH 4MNVA 1AKSB 3RU4E 2TBSA 1HJAB 3EDXB 1CHOF 1K21H 2F9VA 3FFGA 2QCYA 3GCHC 3QWCH 4XBDA 3FANA 4YLQH 1ANCA 1CHOG 3BTME 1P05A 1P2JA 2HPQH 1GI2A 1AUJA 2CF8H 5C1YA 1XVOA 4MTBA 3RMNH 2XTTB 1INCA 1OKXA 2CJIA 1NRNH 1GBAA 2P3TB 1GI9B 4DVAU 3GDSA 1EAWA 3TJVA 1TQ7B 2Z6BD 1NRPH 4K2YA 1UK3A 1GJ8B 3SZNA 3P8GA 1IOEA 3SJIA 3SNEA 1SHHB 1G30B 1O5EH 1S82A 2P95A 1W3CA 4Y76A 3A8CA 2QXJA 3A8BA 4BAOB 6CHAC 1DFPA 6LPRA 1AY6H 3GY6A 4WMEA 3RXDA 2BOKA 2Y5HA 4INLA 1G9IE 2FO9A 1GBHA 1GI8B 1CBWB 2FXRA 5J4SA 4TPYA 1H4WA 3BSQA 3PB1E 3QK1A 1OP2A 3UOUA 1NPMA 2ALVA 1C5TA 3GCOA 4NGAH 4ABDA 4SGAE 4XFQA 1SPJA 2FOMB 3RXHA 2C3SA 3KQBA 3KGPA 2WYGA 2AGEX 1SLWB 4BNRA 5HMAA 1TIOA 3AW1A 1PJPA 4YOGA 3E90B 3VXEH 1TNLA 1E34B 1TX8A 5JBCS 4XOJA 2FOFA 3MYWA 5GPIB 3FVFB 2BD8A 2VIVA 3E16B 4NA8A 4TY6A 4B76A 1P0SH 1IQKA 4YT6H 4Q7YA 1TALA 1T8NA 1IQIA 4X6PA 3RXBA 4RSPA 2J92A 3BTFE 2B5TB 4I31A 3NK8A 1P09A 3SNAA 4CHAB 1IQFA 5SGAE 4DY7B 1B7XB 1SHYA 4IW4E 4DCDA 5A2MH 5DP9A 4HFPB 1THRH 3PMHB 1SGRE 4GSOA 2JH6D 1PPEE 4NIXA 5TCCA 2VIPA 2AMQA 1BDAA 3RLWH 6GCHG 4CHAC 1AFEH 2W26A 3V13A 1GDNA 1C9PA 1GJ5H 2QXGA 1NU7B 5BPEA 1C5YB 1T8OA 4Z6AH 3OTJE 5A0AE 3A88A 5EQRA 1P3CA 1GBDA 2ZQ1A 1UTQA 1C5OH 1TGBA 3K6ZA 3UNRA 3ZVEA 1E35B 1Y5BT 2FOBA 3K6YA 2V3OH 3I77A 3U1IB 1YLDA 1DXPA 1IHSH 2BMGB 1BTZA 1TB6H 3UR6A 1QRXA 2A4OA 3GOVB 1F0RA 1UTPA 3UIRA 1EUFA 1TOMH 4ZAEA 3RXEA 1Y3WA 4DG4A 1ANDA 1BQYA 1RXPA 1CGJE 1EJNA 2VIWA 2P3FH 1QB9A 2BXUH 2QGRA 1UVUH 2VIOA 1LVMA 2J94A 4UFFH 4LZ1H 1O2GH 2GCHF 3BG8A 4X2WA 1O34A 3LGWA 4GCHG 1KLJH 2GCHG 2ULLA 7KMEH 4ZHLU 1UTNA 3A7XA 1QBOA 4X2XA 4ZROA 3O8CA 2SGEE 1LKBA 1J17T 1GBKA 1ARCA 1H8IH 3BIVH 1O2RA 2BLQA 1QBNA 1SGPE 2DUCA 2OBOA 2BVSH 2Q1JA 5CHAC 1Y3XA 1AN1E 2BD4A 2J38A 2DE9A 3IWMA 1O2HA 1V2TT 1H9LB 2GV6A 5F8TA 2SNVA 2FX6A 2BDYA 1CT0E 1VR1H 1BTHH 1D3PB 1QQUA 2G4TA 3BTQE 1UTMA 4ZHAA 5FCRA 1CGHA 1DWBH 8GCHG 3TJOA 1YF4A 5GDSH 1LQDB 4ABJA 1DUAA 3KL6A 1TLDA 3M5NA 2GDEH 4TPIZ 1C1WH 1ZTKA 4FUHA 4ISHH 4J2YB 4UFGH 3TNSA 1FUJA 1BRAA 1KSNA 2JKHA 2OXSA 1TPPA 3V12A 4DT7B 2ZGBH 1KLIH 4AN7A 1GVKB 3M7QA 3NPSA 1NC6A 3BEIB 3P6ZB 2VJ1A 4AZ2B 4FUDA 2Y7XA 1PFXC 1CO7E 3KEEA 3R0FA 3SI4H 4X8VH 1WQVH 1LPKB 1ZLRA 1F2SE 1MU8B 4K1SA 2WPLS 2PSXA 4OS2A 1GHVH 2ZPRA 4RN6A 1V2RT 1YCPK 2ZHWH 1EQ9A 5FHTA 2ASUB 4NZLA 5FPYA 3SJ9A 3TK9A 2QA9E 1CQQA 2ANKH 4Y7BA 1LPZB 1BIOA 2CF9H 2BX4A 2W7SA 3BV9B 1AZZA 3H5CB 1YPJH 4DIHH 2YNAA 2WV5A 4YZUA 4ABAA 4I32A 2G51A 2VB0A 1FNIA 1HFDA 1DWEH 1RIWC 4O3UA 5DO4H 1OWDA 3BEUA 3RXCA 2J9NA 1O0DH 1F92A 1F0UA 2ZC9H 4XSKU 1BRCE 2A32A 1B0FA 5LPRA 5C5OA 1EZUC 2RA0A 2HRVA 3PLKA 3QUMP 3F9HA 2PGQB 3ZVGA 2RG3A 3P70B 1QJ6B 3LGIA 1P2OA 1LVYA 5FCKA 4BOHA 1TX6A 4LZ4B 5H4IB 5C2ZA 1C4V2 2ZA5A 3RXSA 3LGTA 3LPRA 4PROA 4O97A 1UVPA 4MPXA 5DP7A 3ELAH 2B8OH 2HGTH 2JH5D 1GJ9B 4X8TH 3M36A 2A1DB 2VINA 2FOAA 2XBVA 2AERH 2YOLA 3PLPA 3MO3A 1CU1A 2PKSC 2AFQB 1AWHB 3MO9A 2G5NA 3TJNA 1LTOA 4UONA 1A5GH 2TGTA 4E7NA 3A87A 2D8WA 4Y7AA 1GHBF 4E7RG 2A0QB 1C1SA 2ZDAH 3NWUA 5C5NA 3KF2A 1GHBG 4HGCA 1J8AA 4NIWA 2FODA 2ZP0H 1C2HA 2PKAB 2ZNKH 4ABBA 4X0WU 4K60A 1EJAA 2BY7X 4AB9A 4ZUHA 1FONA 5AFYH 1P01A 1A4WH 2ZGXH 3H7TA 1A7SA 2XNIA 3TLOA 3QGJA 1O2NA 1ZPBA 4BTUB 2HLCA 5B6OA 1O2LA 2ZPSA 5JB8S 1O35A 3TK5A 4I8HA 2OD3B 1YP9A 3CS7A 1S6HA 3HKJB 3A8DA 1S0RA 3SU1A 3U8OH 3GDUA 4J1YA 4NFEA 3RMMH 4TYDA 1TMUH 4FU8A 3SJKA 4UFDH 3TVJB 1KXBA 1MKWK 2A5IA 4JCNA 1O2IA 1NROH 3HK6B 1P9SA 2OQ5A 3K65B 4HZHA 4MNWA 1YPMH 2ZU5A 3U8RH 4DIIH 2A4QA 4KELA 4AFZA 3R3GB 1QA0A 4R0IA 2TIOA 2ODPA 1N8OC 1P8VC 1DVAH 1GVZA 1VITF 2BY5X 5K0HA 3UNQA 1LKAA 2XYAA 1TAWA 2NU1E 3MH5A 1ZOMA 4O9VA 1K9OE 1MQ5A 4UD9H 4GAWA 5EQQA 2UWPA 1G36A 1HAPH 4JK5A 1SC8U 3UWJH 1AI8H 1Y5UT 1V2JT 3QZQA 4IN1A 2ZG0H 4UDWH 3RLYH 1TA2A 2G81E 1SGQE 1TONA 1XUIA 1HAHH 3MHWU 1GBCA 1P2MA 5FBEA 3SJOA 2FOGA 4XBBA 1QL8A 3A7VA 4AFUA 1GJBB 2Z9JA 2Z3EA 1SQTA 2GMTC 1WUNH 5EU8A 1XMNB 2P8OB 1TPOA 4WVPE 2EC9H 1L0ZA 2ANWA 1A3BH 1LQEA 5A8XA 4K1EA 2GZ8A 5TCAA 1O3JA 3KIDU 3EGKH 1NRRH 2FM2A 1MBQA 5LGOA 1NZQH 4K8BA 2O8WA 4UE7H 4ASHA 3TH4H 1P02A 1HB0B 1AQ7A 3A80A 4CR5A 1H9HE 2BTCE 1GHWH 4BTIB 3HGPA 1QL9A 2ZFTA 4WXIA 2GGVB 5JPMH 3T28A 1TYNA 5F8XA 1S85A 3OYPA 1Y3YA 3AAVA 3KQCA 1C5LH 2Y7ZA 3DHKH 3A89A 2HWLB 2C4FH 2ZWLH 1BRBE 4D7GA 4JZFH 4LK4A 2XCFA 2Z9LA 3D49H 1WAYB 5T6GA 3ZVDA 3LJJA 3LDXH 5AVDA 1UHBA 3MU4A 1ANEA 4FUCA 1LPGB 3E8LA 3T29A 5EQSA 1HNEE 1OWKA 3ZVAA 1ZSJA 2XXLA 3RXRA 1O2VA 4FU7A 1S81A 9LPRA 4WMFA 3O8BA 2GKVE 5EG4A 3MMGA 2FS8A 1Y3VA 1DOJA 1HAGE 1C5UA 1C1VH 5HM9A 1C1TA 1O37A 4YT7H 1C1OA 1ZMJA 3GISB 3BF6H 2Y5FA 1WCZA 2ZI2H 3RXTA 2PSYA 2OC1A 1SGEE 1GMDF 1V2LT 1XUGA 5DP5A 4IMZA 1ELDE 1CVWH 1OSSA 1GMDG 1XUKA 4KGAA 3T26A 1O2MA 2PUXB 3M7UA 1PQ7A 3UR9A 1GI5A 4AB8A 3SI3H 2ODYB 2OCVB 1QRWA 2C8XB 3UNSA 4QT8C 2HVXA 1J15A 1UHBB 3S9CA 1YGCH 2XC0A 3A85A 1V2OT 3A7WA 1EZQA 1UVTH 1QNJA 1KIGH 4FUFA 5LPFA 5A09A 3NXPA 3A7YA 2NU0E 1SFIA 1GWAA 2HNTF 1C1NA 5EODA 1DSTA 3QLPH 4WXVA 1MTNC 1T4VH 1GI1A 1TMTH 1FMGA 1AGJA 2BLWA 3GCHB 4GLYA 1O2XA 3LGYA 1ACBE 1W13U 8KME2 1XKBC 3ZZAA 2WV4A 1C5NH 3GYLB 3U8TH 4AFSA 3I78A 1L2EA 3LJOA 1S6FA 1TRYA 1G3DA 1XUHA 1EP6A
chains in the Genus database with same CATH superfamily
3MO6A 1TABE 1O2WA 2ZECA 3WWBA 4MVNA 1P11E 1ABJH 1W10U 1KXCA 1ORFA 1VCPA 4B71A 3UREA 1DX5M 2AEIH 4BXWA 2SNWA 1O33A 5GIBA 1HYLA 2K0QA 1YLNA 3VFEA 1P2QA 2A7JA 1D3QB 2P59A 4XBCA 3ZZ8A 1IQGA 3BTWE 4IC5A 4NWLA 2FLBH 1ELAA 1EAUA 1GBEA 4H6TA 6CHAB 1VGCB 1TNJA 3RC6A 1BT7A 1NFXA 5F6MA 1BTUA 1C5VA 4AG1A 1W0YH 3UQVA 2ZCLP 3U98H 2KAIA 3K9XB 4RKJB 1VGCC 2KZ4A 2ZGHA 2W6JD 2ZIQH 4X8UH 1O2QA 4E05H 5L2YH 1J14A 3PMBB 2GP9B 3VEQB 5DN6D 5T3HA 1P03A 1O3LA 4WMDA 2P16A 4K5ZA 3RU4T 3RXIA 1ZRKA 4RKOB 1Z8GA 2LELA 1XX9A 4GVUA 4Y6DA 3EE0B 1CHGA 4X1PU 1V2NT 2CGAA 1SGFA 1QTFA 2BZAA 1Z1IA 3I29A 1UW7A 2RDLA 4FVDA 1C1RA 3ITIA 3E6PH 2OC8A 1D3TB 1O3CA 1SGNE 2AS9A 3GY7A 5C17A 3ZZBA 2BY9X 4F4OC 4GHQA 2LP6A 3M3VA 1SLVB 1GVLA 3VGCC 3FZDA 4X1SU 1ZRBA 1Z7KA 1OYTH 2R2WU 5A8ZA 2VGCC 3DFJA 2WYJA 1O5BB 5T6DA 3ATMA 2WUBA 1SL3A 1ZMNA 3RXQA 3T5FH 3ZV8A 1QFKH 2XCNA 3RMOH 2UUJB 4Q7XA 5EPNA 2HVYB 3SV9A 2ZTYA 2VH6A 1LDTT 2EI7A 1BZXE 1DSUA 1DS2E 3MOCA 3BTEE 5CDFE 3VB6A 4MQAA 2BXTH 3V0XA 2C8WB 2P94A 1AVGH 6GCHF 4Y11E 1OWJA 2YMSC 3HPTB 1HAZB 1T4UH 1QGFA 1BMAA 4ZXYH 4XRNA 2KCOA 2OTVA 1TPSA 1C5QA 1AMHA 2R9PA 2A4GA 3U28C 3BEFB 1JRTA 1Z6JH 3EQ0H 2THFB 1O5CB 4MDSA 1HJ9A 5C1UA 2Q6FA 1GJAB 5CE1A 1LHFH 1WTGH 1DWDH 2VH0A 3MH4A 2AYWA 2PGBB 2O8LA 4ACAA 2O9QA 1BHXB 2WPIS 1KTSB 1GMHF 1PPBH 3GICB 1OXGA 1L1JA 1Y3UA 2FTLE 4Q2KA 4TT3D 3U9AH 4WF8A 1GMHG 2JDID 1NFUA 1EB2A 1AZ8A 1O2KA 3E1XB 1GHXH 1G32B 2Z9IA 2ZDLA 3F9GA 1GCDA 1YPGH 3P17H 3VB3A 1BTPA 4CRBA 4BTTB 4DT4A 2ZF0H 2XWBI 3FP6E 3Q00A 4GCHF 1A0HB 3A84A 1SQAA 1XM1A 4Y0ZE 1YM0A 2V0BA 1KYNA 2PV9B 3MFJA 3VXFH 5CHAB 1W7XH 1ESTA 3ZZ5A 4OS4A 1B5GH 1KDQA 2KX4A 4CBNA 2BD2A 2F9UA 4DURA 1GG6B 2TPIZ 1PPHE 4NCYA 3D23A 4WY3A 1MBMA 1O5AB 1LO6A 1GJCB 4IC6A 1ETRH 1ELEE 1H8HD 1O2YA 2Z9GA 1C2JA 2QYIA 1N6XA 1Z6EA 1FZZA 1GG6C 1BHXF 2M2AA 8GCHF 3SORA 9ESTA 3D65E 3LU9B 1O3DA 2BD7A 5JDUB 5EXNA 3UQOA 2TGAA 1RFNA 3VB5A 1QBVH 3ZZDA 2DE8A 4DOQA 2B0FA 1CSOE 2C8ZB 1FAXA 3URDA 1E1QD 1SLXB 2FESH 3B9FH 2IPQX 1FY5A 3O8DA 3SUGA 1DUEA 1RRKA 2XWAA 4HG6A 4Y0YE 5C1XA 2AIPA 5HGGA 1G3BA 4FUBA 5EW2H 3Q3KA 1FLEE 1G2MA 3RM2H 1QQ4A 5K7RA 4ABFA 3SJ8A 2Z3DA 2BLOA 2ZZUH 5IK2D 3LONA 4ACBA 1S83A 2IJOB 2OUAA 5JYIA 1OWEA 4AYVB 1O30A 1N1LA 1VZQH 2PWXA 1THPB 1TPAE 5HM2A 2BVXH 3FN8A 1O2PA 3QTVH 1C2KA 3DSPA 3RXUA 1GBJA 2ZHQH 1WDIA 2AMPA 4DGJA 3NUMA 5DG6A 3RC5A 1ELFA 1GJ7B 2VIQA 3RXVA 3BIUH 1XVMA 3RUOA 1GI4A 2ZTZA 7ESTE 4WH6A 3ZZ6A 2FMJA 3CS0A 1VJ9U 4JZDH 2VBCA 1RIWB 1W11U 4RT0A 3ZVCA 4NIYA 1DICA 3E91A 4DW2U 2XBYA 1HIAA 1O3GA 1IQEA 2CHAC 4LXBH 1C2DA 1G37A 2UWLA 4AGKA 2B9LA 1FDPA 1G2LA 2Z3CA 1ID5H 3A7ZA 3LKWA 1JRSA 3PROA 1MCVA 3PLBA 1ZHPA 5FBIA 5A8YA 3ZYEA 1C5MD 5F8ZA 2BQ6B 2GVFA 2F83A 1D6RA 1TGTA 4B1TA 1CA0C 2G5VA 1BBRK 1C2FA 1JBUH 4Y8YA 1YCPH 1HPGA 1EXFA 1FPCH 3OY5U 3M5LA 1AHTH 1DXWA 2D2DA 1BMLA 1QB6A 5AFZH 1XUJA 1ZHMA 3RC4A 3GCTG 4XE4A 1RTKA 4H4FA 4MPUA 1WU1A 5DP3A 5EXMA 4YESB 2RDEA 4R8TB 1NBMD 2CN0H 2PKSB 2B7DH 3ODFA 4MLFB 3SOSA 2VWNA 5L30H 1D3DB 2J98A 3MI4A 1MD7A 1SGYE 4Q80A 1FPHH 1V2VT 3PYHA 2L74A 3SGAE 2QV1A 3F2HA 1UVSH 2ESTE 5JBTA 1IQHA 3UY9A 3TGIE 2I6QA 3LT3A 1NFYA 2KCYA 2FOEA 2Q6DA 2VVUA 1P2IA 3F2GA 5DJ7A 2ZTXA 2GX4A 3N7OA 5GJ4B 1GBMA 3M35A 3GY4A 1QL7A 2FTMA 1AVXA 2PUQH 1MTSA 1TRNA 1SQOA 2UUFB 1P06A 2IJD1 2H5DA 4D7FA 3KQEA 1RTLA 1T32A 2SGDE 1L1GA 7GCHF 1CGIE 1MTWA 7GCHG 1DE7H 1EAIA 1QURH 2G00A 1UTOA 2J98B 3BTTE 3SNBA 1YWUA 2EEKA 2HALA 4JK6A 1DWCH 5FXLA 3SNDA 3OEED 1GL1A 4WJG2 4JZIA 1KMHB 2JETB 1GL0E 2FOHA 1BTYA 3HATH 4DJZB 1RD3B 1EOLA 3D62A 1O3NA 1FY3A 1C2IA 4JYVH 1K1MA 2BD5A 3TPIZ 3ENSB 1O3AA 1AE8H 1L1NA 1UMAH 3QN7A 3UTUH 1QIXB 1TE0A 2VU8E 4BANB 1MQ6A 1GGDB 3CENA 2WHXA 3M3SA 2JETC 3UOPA 1DANH 4X1RU 1N8OB 4Y71A 4JZEH 2ZDNA 2UWOA 2PTNA 1AWFH 1OS8A 5E8EH 2ZU2A 5DGJA 1MUEB 2O8MA 4LOYH 1H9IE 3SQEE 1GGDC 5EXLA 1ZSLA 3PV5A 4Y79A 2Z9KA 4K3JA 4A6LA 3ZYDA 1EX3A 2C90B 4YOJA 1W0JD 2UUKB 3STIA 5FPSA 4OM9A 2BDHA 1GBIA 3CP7A 4AYYB 1GDUA 3MNXA 2FI4E 1OWHA 1X7AC 3GY8A 4OGYA 1C2GA 4AC9A 1DDJA 3FP7E 2H9EH 2NWNA 2GMTB 2O8TA 1MKWH 1TFXA 1EOJA 1UCYK 2ZCKP 1SVPA 4O3TA 4MG3A 1YY3A 1XKAC 1LVBA 1UTLM 2F9NA 3WY8A 1A5IA 1DPOA 1G3EA 3RXFA 1VCQA 1P2NA 4I8GA 1QB1A 2ZPQA 1THSH 5E0JA 1Q2WA 1NRQH 3LC5A 3EAJA 1HDTH 3RXGA 1H1BA 2VWOA 1UTKA 1P04A 2ZHDA 3AW0A 2XC5A 1F0SA 2BDIA 2A2QH 2VWLA 4YTAA 1COWD 3S0NA 1E36B 4JYUH 1ZJKA 1PPCE 4MPWA 1K1JA 1O2OA 2F3CE 1JIRA 1XUFA 2OP9A 1A1RA 3OFND 2H9HA 1KXAA 1O3HA 3W95A 5JB9S 2V35A 3GDVA 5IYTA 4H6SB 3B8JA 1BITA 1FY4A 3KQ5A 1S84A 1ZYOA 1HUTH 3UFAA 2ZFRH 3BTKE 1DY8A 3FP8E 1AU8A 2J95A 4K69A 4Q7ZA 3TU7H 1A61H 1EZXC 3NCLA 1SI5H 1OX1A 2Q6GA 1AFQB 1W8BH 2R3UA 3SUFA 1ANBA 2XC4A 4CRCA 1RGQA 1MZAA 4INHA 3ZZ4A 1ABIH 1DT2A 1LVOA 2SGAA 2SGFE 4B73A 1W0KD 1W2KH 3BTDE 2D26C 1TNHA 2HPPH 4VGCB 4U32A 4WH8A 3A86A 3EA9A 3C1KA 1AFQC 2BZ6H 4ZHMU 2V3HH 4ZKNU 2AGGX 4F49A 5CHBA 3SGBE 3M7TA 3IG6B 2F9BH 1GBLA 1TBQH 1KXEA 1P2KA 4VGCC 1K1LA 2J34A 3L6PA 4X6NA 1C1QA 2QY0B 5HIZA 4D9RA 5A0CA 1O2SA 1SR5C 1MCTA 4M7GA 4I33A 2GCTC 5E0GA 3VB4A 1BTXA 1MD8A 3SHAH 3OEHD 2FDAA 5ABWA 1MTNB 2HNTC 1FQ3A 2RA3A 1EZSC 3RP2A 3T62A 2EY4C 1SBWA 5HIYA 1HAXB 1KLTA 3W1EA 2SGPE 1JWTA 1SMFE 3SW2B 2CMYA 3S7KB 5L6NH 1D9IA 1GHYH 1HXFH 3PMJA 1AUTC 4X6OA 3PM3A 1FY8E 4OS1A 1HAIH 2F9OA 1JOUB 3P8FA 3QZRA 2R3YA 2QF3A 3M61U 1PQ5A 3S7HB 1SFQB 4D9QA 1FIZA 1MKXH 3GY5A 1BOQA 3L33A 1J9CH 3U69H 4BAQB 1WBGB 1YBWA 1ZSKA 3MH6A 1C5SA 1NRSH 4NWKA 3F3BA 4YOIA 3UPEA 4ZH8A 2QF4A 1N6YA 1TA6A 4FUJA 5EIYA 2H6MA 4X2VA 1IQMA 2PTCE 2Y80A 4NSYA 1CT4E 1EPTC 3L3TA 5AHGH 1NT1A 1D6WA 1YPEH 4TWYA 3ZVBA 2V6NA 1RS0A 1NU9A 2ZEBA 2AIQA 3Q77A 4SGBE 1AVWA 1Z8RA 2H9TH 3VPKA 4KKDA 2QF0A 3MH7A 3KHVA 1NM6A 1NO9H 2ZGJA 1E37B 3E0PB 2FZZA 2GZ7A 2H1UA 1FV9A 3Q3YA 4M9FA 5LH8A 5C67A 2KM0A 3F0OA 1W12U 2VIDA 1O5DH 2J2UA 1T31A 1HJAC 1UCYE 1BJUA 3ODDA 1O3EA 2QAAA 2AGIX 3OY6U 1ESBA 2A7HA 4OS7A 1O39A 4E06H 3OE7D 3JZ1B 5DPAA 4GHTA 2IN2A 1ZR0A 1W7GH 1GI7B 1K1IA 1PQ8A 2HOBA 5ESBA 1EAXA 2I6SA 3STJA 1C4U2 1WV7H 2XRCA 4KTUA 5ETXA 2A31A 5FX6A 4A5TS 2A4RA 2WV9A 3FOAA 1GBFA 3T27A 3EA8A 1NFWA 3PWBA 1DY9A 4HTCH 4X8SH 4CBOA 3M5OA 2A5AA 2LNCA 1ELGA 5GCHF 1OOKB 3K2UA 3QX5H 2NU2E 3GY3A 5GCHG 3P92A 1C5PA 2GD4B 1WOFA 1NBME 5E2OA 1HLTH 3NKKA 3KYFA 4Z1MD 2PHBA 1HAOH 4BAHB 4ZCNA 3VGCB 5T6FA 1GBBA 1PPZA 4Y8ZA 5BRRE 1V2WT 2VGCB 3AVZA 4ESTE 4AX9H 3T25A 2BDGA 1MH0A 4H42U 1KTTB 1AE5A 4KP0A 1U6QA 3KN2A 4O03A 4Y10E 1O3PB 3B23B 3OAAD 3PV2A 2KAIB 1MAXA 1V2PT 2GZ9A 3SV7A 5F03A 2H5CA 1SGDE 1E0FD 1CBWC 4INKA 4A7IB 3RXLA 2OQUA 4I7YH 1SOTA 1GCTB 1LCYA 2PLXA 4ZKOU 1P3EA 3SNCA 5T1VA 4CH8B 3TGJE 4I8LA 1ELTA 2YMSB 3F1SB 3S69A 4A1XA 1Z71A 2ZQ2A 1GCTC 2FP7B 3ATKA 4ZMAH 2ILNA 2VVVA 2ZHEH 1F5RA 3BG4B 1O3KA 3URCA 4CH2B 1SGIB 4A92A 3LOXA 3MWIU 3S9AA 1HXEH 3RDZA 1SGTA 2ZU4A 2M5TA 3SYJA 1Z8IB 3TNTA 1ELVA 1QJ7B 1BA8B 5FPTA 1DM4B 1V2MT 4NSVA 1SQRA 3BG4C 1MZDA 2ZKSA 3A7TA 3UUZA 1JMOH 1G3CA 1WQSA 1JXPA 1LHCH 1YPHC 2D1JA 3SO3A 1EATA 1W0ZU 3DFLA 2ODQA 2BB4A 3F6UH 1VKYA 3RM0H 1T8LA 5EJZA 2XW9A 4CRDA 4KTCA 1QY6A 1ZMLA 2FYRA 4U30A 3TK6A 1ZPZA 4NG9H 3SU6A 1JIMA 1SGCA 2ZCHP 2HNTE 2RCEA 2W3KA 2G8TA 3Q3XA 3V7TA 2QXIA 3TJUA 4X2YA 8LPRA 2BY6X 5C94A 3BN9A 1BMNH 3IITA 1K1NA 1HV7A 1MTVA 3SU0A 3ZZ3A 1IQNA 1SGFG 2TRMA 5DP6A 2GT7A 2ZGCA 1O3BA 2FI3E 1V2KT 2W3IA 2ZFPH 1HCGA 1GJ4H 1P10A 2NU4E 4CREA 5JBAS 1QR3E 4B6FA 2EA3A 3ATIA 2ZO3H 1P57B 4BAKB 3G01A 2Y5GA 3A81A 3A83A 1Z8JB 4YM9A 5GWZA 2F91A 2WPJS 1TX7A 4FUIA 5KEDA 2FWWA 2OC7A 1BCUH 3RXMA 2PW8H 1NTPA 4HI3A 1K1PA 1O3OA 2H2ZA 3A82A 1MABB 2Z94A 1O2UA 5EOKA 1C1PA 2ANYA 2SFAA 4YLUA 2GTBA 4YXWD 4XDEA 1V2QT 3SHCH 1GBTA 3F9FA 1QHRB 2A2XH 2A7CA 1A46H 1PPGE 1O2JA 1Z1JA 4D8NA 1EASA 2SGQE 1Q31A 3F68H 3DT0H 1UK2A 1UVOA 1GDQA 2PR3A 1KDQB 2WPHS 1AO5A 1TNKA 2Y6TA 4JZ1A 1ELBA 2FX4A 4TWWA 4RI0A 1O2ZA 4JMYA 4NIVA 1ELCA 2QXHA 4CR9A 1HJ8A 2UUYA 1C5WB 2JJ1D 2EI8A 3ZZ7A 5C20A 3OSYA 1H8DH 1FXYA 3TIUA 3GS9A 1UK4A 3RXAA 1CE5A 4JYTA 1GI3A 1SLUB 2CHAB 5TJXA 3SU2A 1O2TA 1TWXB 1K22H 4NA9H 3RU4D 3S9BA 1YCPM 1S0QA 5DP4A 1ETSH 2O8UA 1T7CA 3DD2H 1A3EH 2F43B 1BB0B 1K1OA 1PQAA 1C1UH 1KXDA 2WUCA 1L4DA 2Y81A 3UWIA 1O32A 3E3TA 1V3XA 2STAE 3KQDA 1CA0B 2WPMS 3ESTA 2BQWB 1GHAF 4FUEA 2W5EA 3AASA 3M37A 2TGPZ 1IAUA 5F53A 1F5KU 1GHAG 1A5HA 4ISLA 4AOQA 4AGJA 1PYTD 1WTHD 1Y59T 3PV4A 4ABIA 3RXPA 3AK5A 2XBXA 3MU1A 3SV2H 2ZFSA 1C2EA 3BTHE 3DA9B 1ESAA 1TGCA 3FAOA 4FOUC 2R0KA 3NZIA 1O3FA 5I25A 2C8YB 1YPKH 5E2PA 3GCTF 4CRFA 1OP0A 3KCGH 3T2NA 2Y82A 2BDCA 3QDZB 4D76A 1YPLH 5IDKA 2BHGA 2ZDKA 5DKMA 1O38A 3HGNA 4ZXXH 1D4PB 3EE7A 3KNXA 3VG8A 1HIAB 3LH3A 1C5XB 3SU5A 3LGUA 1UJ1A 5HXFA 4GUXA 1C2LA 1KY9A 1ZPCA 1YLCA 3MU5A 4B2AA 4IMQA 3U1JB 3DUXH 2CV3A 2PKAA 3SGQE 2A5KA 3RMLH 1BBRH 2BQ7B 1DLKB 1SOZA 5A0BA 1DLEA 5GXPA 1WSSH 2WINI 4IN2A 2Z7FE 2FEQH 3MTYA 1MMJN 1ZZZA 1TNGA 1E38B 2LPRA 1YPHE 1FN6A 1TBRH 4FUGA 3A8AA 2BM2A 3GYMA 2EQNA 2GDDA 3AAUA 1O3IA 1C4Y2 1OP8A 1Y5AT 3TH3H 2FI5E 3P8NA 2JH0D 2V3MA 3WW7A 1BMMH 1TOCB 5CMXH 1S5SA 3N99A 4I8JA 2K1QA 1GJDB 6ESTA 1C9TA 3FKSD 1VCWA 1FJSA 3SUEA 3SV8A 3OU0A 3P95A 2NU3E 2XNDD 1M9UA 3O8RA 1GPZA 3MNBA 2WSSD 3CNRA 3C27B 4AORA 2J4IA 1J16A 5E0HA 1FI8A 4UEHH 1GMCF 2FS9A 1HRTH 1RJXB 2A45B 2V7QD 1VJAU 5EJLA 2ZHFH 3P8OA 1GMCG 1F0TA 5I46H 1KXFA 2TGDA 1C5ZB 1YKTA 5EGMA 2ANMH 2W7UA 1A2CH 4B2BA 2ZDVH 2OC0A 3LC3A 3EA7A 3MNCA 1TMBH 3SBKA 5G4BA 3FZZA 4NFFA 1TQ0B 1EP5A 3VB7A 4CRAA 4B74A 1LHGH 1QCPA 2KCAA 1P12E 4ABGA 2G52A 1C2MA 1OHHD 3H09A 1IHTH 3RXOA 1C1MA 1XXFA 5FAHA 1UTJA 3SN8A 3LGVA 4OGXA 3W94A 5ESTE 1GI6A 3ATWA 1QA7A 4U01A 4B75A 1SSXA 1PPFE 1F7ZA 1PYTC 1QRZA 2IOTA 2G4UA 1ETTH 2ZU3A 4KTSA 1T8MA 2ZU1A 2STBE 3MNSA 3TGKE 1VITG 3SU3A 4B2CA 1EFRD 3F9EA 3PTNA 1ZTJA 2BDAA 1A0LA 1LMWB 2QC2A 1MU6B 2QN5T 1O3MA 1TRMA 1VITH 1YYY1 4NZQA 1BJVA 1F5LA 2WPKS 3TH2H 1L4ZA 1ZHRA 7LPRA 1ZTLA 1O36A 3M3TA 2R2MB 4CRGA 1K28D 5FX5A 4P02A 2BLVA 1AIXH 3EYDA 1B0EA 5EW1H 5C3NA 1UCYH 4U2WA 1LHDH 3MU8A 1AD8H 1FAKH 1NY22 4ISNA 1IQJA 1ZGVA 1MAYA 4A1TA 2RFKC 2BY8X 3SUDA 1FX0B 1IQLA 1BBRE 5LPEA 4MNXA 3H7OA 1Q3XA 5J4QA 5HYOA 1HBTH 2BX3A 4ISIH 5EPYA 2VWMA 2IPHA 2PFEA 2BDBA 4NA7A 2P8OC 1DITH 4K8YA 4ABHA 1W14U 3QO6A 1C5RA 1AB9B 3LIWA 4ISOA 2GV7A 1OPHB 1O5GH 4ZKRU 2QIQA 4X6MA 5JBBS 3HK3B 4FXGH 2JIZD 3ZZ9A 5GNDA 2VNTA 1NS3A 2FYQA 1AB9C 4IBLH 4TY7A 1K0HA 1Y8TA 2OINA 1K2I1 1OWIA 1ZGIA 3Q76A 2YNBA 1EJMA 1FN8A 3QTOH 3RXJA 5DK1A 2GCTB 3QGNB 2ZDMA 2FOCA 2P3UB 3V3MA 4UFEH 1ZJDA 1LHEH 3RXKA 1TNIA 2FLRH 4IS5A 4FVBA 5PTPA 3DCLA 4MNYA 4WWYA 3N7EA 4X1NU 1EPTA 4Y8XA 2OLGA 4I8KA 1GHZA 4AG2A 5AF9H 1E79D 1XXDA 8ESTE 2BYAX 4ABEA 2F4LA 3OX7U 1BRUP 4OS5A 1CT2E 1HGTH 1HAVA 3E0NB 2VVCA 2P93A 1V2ST 3PO1B 3SQHE 1GJ6A 2BD3A 3JZ2B 2R0LA 4YO9A 1YC0A 3GCNA 3PTBA 1QJ1B 2AMDA 4Z0KA 3TITA 2BOHB 4BXSA 2GT8A 4FU9A 1AKSA 3LH1A 4AFQA 1V2UT 1ARBA 2ALPA 1NN6A 4X1QU 4BAMB 4FETA 4ZKSU 2EI6A 1HAYB 2FPZA 1FIWA 3PO1C 2BVRH 1O5FH 1A0JA 3ATLA 1OYQA 1O31A 1MKXK 3MU0A 1NESE 1TGNA 1FY1A 1SB1H 4A1VA 2HLDD 2XBWA 3HKIB 5DP8A 3ZZCA 3SV6A 1V6DA 1BUIA 2F9PA 1EKBB 1RTFB 2OBQA 1EPTB 1TGSZ 2CXVA 1GI0A 1CA8B 2ZFFH 3M5MA 3ZV9A 1P9UA 2J5UA 4THNH 1MTUA 3SU4A 1SG8B 2W6ID 3GY2A 1BTWA 4MPVA 2AH4X 4OS6A 1HAVB 1TBZH 2BD9A 5L2ZH 3PMAB 1EB1H 4IGDA 3BTGE 3ZVFA 1UO6A 2G55A 2C93B 4GPGA 4K1TA 1WYKA 3PWCA 2ZFQH 2FIRH 1S6LA 4MNVA 1AKSB 1H8ED 3RU4E 2TBSA 1HJAB 3EDXB 1CHOF 1K21H 2F9VA 3FFGA 2QCYA 3GCHC 3QWCH 4XBDA 3FANA 4YLQH 1ANCA 1CHOG 3BTME 4F55A 1P05A 4B6EA 1P2JA 2HPQH 1GI2A 2WZQA 5KGOA 1AUJA 2CF8H 2KCPA 5C1YA 4XD7D 1XVOA 4MTBA 2J97A 3RMNH 2XTTB 1INCA 1OKXA 2CJIA 1NRNH 1GBAA 2P3TB 1GI9B 4DVAU 3GDSA 1EAWA 3TJVA 1TQ7B 2Z6BD 1NRPH 4K2YA 1UK3A 1GJ8B 3SZNA 3P8GA 1IOEA 3SJIA 3SNEA 2AHME 1SHHB 1G30B 1O5EH 1S82A 2P95A 1W3CA 4Y76A 3A8CA 2QXJA 3A8BA 4BAOB 6CHAC 1DFPA 6LPRA 1AY6H 3GY6A 4WMEA 3RXDA 2BOKA 2KR7A 2Y5HA 4INLA 1G9IE 2FO9A 1GBHA 1GI8B 1CBWB 2FXRA 5J4SA 4TPYA 4Q4LA 1H4WA 3BSQA 3PB1E 3QK1A 1OP2A 3UOUA 1NPMA 2ALVA 1C5TA 3GCOA 4NGAH 4ABDA 4SGAE 4XFQA 1SPJA 2FOMB 3RXHA 2C3SA 3KQBA 3KGPA 2WYGA 2AGEX 1SLWB 4BNRA 5HMAA 1TIOA 3AW1A 2XOKD 1PJPA 4YOGA 3E90B 3VXEH 1TNLA 1E34B 1TX8A 5JBCS 4XOJA 2FOFA 3MYWA 3OTPA 3DSOA 5GPIB 3FVFB 2BD8A 2VIVA 3E16B 4NA8A 4TY6A 4B76A 1P0SH 5C0TA 1IQKA 4YT6H 4Q7YA 1TALA 1T8NA 1IQIA 4X6PA 3RXBA 4RSPA 2J92A 3BTFE 2B5TB 4I31A 3NK8A 1P09A 3SNAA 1WXRA 4CHAB 1IQFA 5SGAE 4DY7B 1B7XB 1SHYA 4IW4E 4DCDA 5A2MH 5DP9A 4HFPB 1THRH 3PMHB 1SGRE 4GSOA 2JH6D 1PPEE 4NIXA 5TCCA 2VIPA 2AMQA 3PRBA 1BDAA 3RLWH 3WWFA 6GCHG 1AFEH 2W26A 3V13A 4CHAC 1GDNA 1C9PA 1GJ5H 2QXGA 1NU7B 5BPEA 1C5YB 1T8OA 4Z6AH 3OTJE 5A0AE 3A88A 5EQRA 1P3CA 1GBDA 2ZQ1A 1UTQA 1C5OH 1TGBA 3K6ZA 3UNRA 3ZVEA 1E35B 1Y5BT 2FOBA 3K6YA 2V3OH 3I77A 5C0UA 3U1IB 1YLDA 1DXPA 1IHSH 2BMGB 1BTZA 1TB6H 3UR6A 1QRXA 2A4OA 3GOVB 1F0RA 1UTPA 3UIRA 1EUFA 1TOMH 4ZAEA 3RXEA 1Y3WA 4DG4A 1ANDA 1BQYA 1RXPA 1CGJE 1EJNA 2VIWA 2P3FH 1QB9A 2BXUH 2QGRA 1UVUH 2VIOA 1LVMA 2J94A 4UFFH 4LZ1H 1O2GH 2GCHF 3BG8A 4X2WA 1O34A 3LGWA 4GCHG 1KLJH 2GCHG 2ULLA 7KMEH 4ZHLU 1UTNA 3A7XA 1QBOA 4X2XA 4ZROA 3O8CA 2SGEE 1LKBA 1J17T 1GBKA 1ARCA 1H8IH 3BIVH 1O2RA 2BLQA 1QBNA 1SGPE 2DUCA 2OBOA 2BVSH 2Q1JA 5CHAC 4ASUD 1Y3XA 1AN1E 2BD4A 2J38A 2DE9A 3IWMA 1O2HA 1V2TT 1H9LB 2GV6A 5F8TA 2SNVA 2FX6A 2BDYA 1CT0E 1VR1H 1BTHH 5HKKD 1D3PB 1QQUA 2G4TA 3BTQE 1UTMA 2JJ2D 4ZHAA 5FCRA 1CGHA 1DWBH 8GCHG 3TJOA 1YF4A 5GDSH 1LQDB 4ABJA 4P00A 1DUAA 3KL6A 1TLDA 3M5NA 2GDEH 4TPIZ 2CK3D 1C1WH 1ZTKA 4FUHA 4ISHH 4J2YB 4UFGH 3TNSA 1FUJA 1BRAA 1KSNA 3ZIAD 2JKHA 2OXSA 1TPPA 3V12A 4DT7B 2ZGBH 1KLIH 4AN7A 1GVKB 3M7QA 3NPSA 1NC6A 3BEIB 3P6ZB 2VJ1A 4AZ2B 4FUDA 2Y7XA 1PFXC 3F0PA 1CO7E 3KEEA 3NRLA 3R0FA 3SI4H 4X8VH 1WQVH 1LPKB 1ZLRA 4F48B 3UAIC 1F2SE 1MU8B 4K1SA 2WPLS 2PSXA 4OS2A 1GHVH 2ZPRA 4RN6A 1V2RT 1YCPK 2ZHWH 4TSFD 1EQ9A 5FHTA 2ASUB 4NZLA 5FPYA 3SJ9A 3TK9A 2QA9E 1CQQA 2ANKH 4Y7BA 1LPZB 1BIOA 2CF9H 2BX4A 2QF5A 2W7SA 4RT1A 3BV9B 1AZZA 3H5CB 1YPJH 4DIHH 2YNAA 2WV5A 4YZUA 4ABAA 4I32A 2G51A 2VB0A 1FNIA 1HFDA 1DWEH 1RIWC 4O3UA 5DO4H 2WPDD 1OWDA 3BEUA 3KYGA 3RXCA 2J9NA 1O0DH 1F92A 1F0UA 2ZC9H 4XSKU 1BRCE 2A32A 2K8IA 1B0FA 5LPRA 5C5OA 1EZUC 2RA0A 2HRVA 3PLKA 3QUMP 3F9HA 2PGQB 3ZVGA 2RG3A 3P70B 1QJ6B 3LGIA 1P2OA 1LVYA 5FCKA 4BOHA 1TX6A 4LZ4B 5H4IB 5C2ZA 1C4V2 2ZA5A 3RXSA 3LGTA 3LPRA 4PROA 4O97A 1UVPA 4MPXA 5DP7A 3ELAH 2B8OH 2HGTH 2JH5D 1GJ9B 4X8TH 3M36A 2A1DB 2VINA 2FOAA 3N7DA 4Q63A 2XBVA 2AERH 2YOLA 3PLPA 3MO3A 1CU1A 2PKSC 2AFQB 1AWHB 3MO9A 2G5NA 3TJNA 1LTOA 4UONA 1A5GH 2TGTA 4E7NA 3A87A 2D8WA 4Y7AA 1GHBF 4E7RG 2A0QB 1C1SA 2ZDAH 3NWUA 4I86A 5C5NA 3KF2A 1GHBG 3SZEA 4HGCA 5FL7D 1J8AA 4NIWA 2FODA 2ZP0H 1C2HA 2PKAB 2ZNKH 4ABBA 4X0WU 4K60A 1EJAA 2BY7X 4AB9A 4ZUHA 1FONA 5AFYH 1P01A 1A4WH 2ZGXH 3H7TA 1BMFD 1A7SA 2XNIA 3TLOA 3QGJA 1O2NA 1ZPBA 4BTUB 2HLCA 5B6OA 1O2LA 2ZPSA 5JB8S 1O35A 3TK5A 4I8HA 2OD3B 1YP9A 3CS7A 1S6HA 3HKJB 3A8DA 1S0RA 3SU1A 3U8OH 3GDUA 4J1YA 4NFEA 3RMMH 4TYDA 1TMUH 4FU8A 3SJKA 4UFDH 3TVJB 5EJ1A 1KXBA 1MKWK 2A5IA 4JCNA 1O2IA 1NROH 3HK6B 1P9SA 2OQ5A 3K65B 4HZHA 4MNWA 1YPMH 2ZU5A 3U8RH 4DIIH 2A4QA 3FO8D 4KELA 4AFZA 3R3GB 1QA0A 4R0IA 2TIOA 2ODPA 1N8OC 1P8VC 1DVAH 1GVZA 1VITF 2BY5X 5K0HA 3UNQA 1LKAA 2XYAA 1TAWA 2NU1E 3MH5A 1ZOMA 4O9VA 1K9OE 1MQ5A 4UD9H 4GAWA 5EQQA 2UWPA 1G36A 1HAPH 4JK5A 1SC8U 3UWJH 1AI8H 1Y5UT 1QZ8A 1V2JT 3QZQA 4IN1A 2ZG0H 4UDWH 3RLYH 1TA2A 2G81E 1SGQE 1TONA 1XUIA 1HAHH 3MHWU 1GBCA 1P2MA 5FBEA 3SJOA 2FOGA 4XBBA 1QL8A 3A7VA 4AFUA 1GJBB 2Z9JA 2Z3EA 1SQTA 2GMTC 1WUNH 5EU8A 1XMNB 2P8OB 3MQKC 1TPOA 2L6OA 1E1RD 4WVPE 2EC9H 1L0ZA 2ANWA 1A3BH 1LQEA 5A8XA 4K1EA 2GZ8A 5TCAA 1O3JA 3KIDU 3EGKH 1NRRH 2OK5A 2FM2A 1MBQA 5LGOA 1NZQH 4K8BA 2O8WA 4UE7H 4ASHA 3TH4H 1P02A 1HB0B 1AQ7A 3A80A 4CR5A 1H9HE 2BTCE 1GHWH 4BTIB 3HGPA 1QL9A 2ZFTA 4WXIA 2GGVB 5JPMH 3T28A 1TYNA 5F8XA 1S85A 3OYPA 1Y3YA 3AAVA 3KQCA 1C5LH 3DSGA 2Y7ZA 3DHKH 3A89A 2HWLB 2C4FH 2ZWLH 1BRBE 4D7GA 4JZFH 4LK4A 2XCFA 2Z9LA 3D49H 1WAYB 5T6GA 3ZVDA 3LJJA 3LDXH 5AVDA 1UHBA 3MU4A 1ANEA 4FUCA 1LPGB 3E8LA 3T29A 5EQSA 1HNEE 5B6LA 1OWKA 3ZVAA 1ZSJA 2XXLA 3RXRA 1SKYE 1O2VA 4FU7A 1S81A 9LPRA 4WMFA 3O8BA 2GKVE 5EG4A 3MMGA 2FS8A 1Y3VA 5DSFA 1DOJA 1HAGE 1C5UA 1C1VH 5HM9A 1C1TA 1O37A 4YT7H 1C1OA 1ZMJA 3GISB 3BF6H 2Y5FA 5KECA 1WCZA 2ZI2H 3RXTA 2PSYA 2OC1A 2PP6A 1SGEE 1GMDF 1V2LT 1XUGA 5DP5A 4IMZA 1ELDE 1CVWH 1OSSA 1GMDG 1XUKA 4KGAA 3T26A 1O2MA 2PUXB 3M7UA 1PQ7A 3UR9A 1GI5A 4AB8A 3SI3H 2ODYB 2OCVB 1QRWA 2C8XB 3UNSA 4QT8C 2HVXA 1J15A 1UHBB 3S9CA 1YGCH 2XC0A 3A85A 1V2OT 3F2FA 3A7WA 1EZQA 2KFWA 1UVTH 1QNJA 1KIGH 4FUFA 5LPFA 5A09A 3NXPA 3A7YA 2NU0E 1SFIA 1GWAA 2HNTF 1C1NA 5EODA 2YMSD 1DSTA 3QLPH 4WXVA 1MTNC 2GJGA 1T4VH 3PRDA 1GI1A 1TMTH 1FMGA 1AGJA 2BLWA 3GCHB 4GLYA 1O2XA 3LGYA 1ACBE 1W13U 8KME2 2QE7D 1XKBC 3ZZAA 2WV4A 1C5NH 3GYLB 3U8TH 4AFSA 3I78A 1L2EA 3UB0A 3LJOA 1S6FA 1TRYA 1G3DA 1XUHA 1EP6A
chains in the Genus database with same CATH topology
3MO6A 1TABE 1O2WA 2ZECA 4MVNA 1P11E 1ABJH 1W10U 1KXCA 1ORFA 1VCPA 4B71A 3UREA 1DX5M 2AEIH 4BXWA 2SNWA 1O33A 5GIBA 1HYLA 3VFEA 1P2QA 2A7JA 1D3QB 2P59A 4XBCA 3ZZ8A 1IQGA 3BTWE 4IC5A 4NWLA 2FLBH 1ELAA 1EAUA 1GBEA 4H6TA 6CHAB 1VGCB 1TNJA 3RC6A 1BT7A 1NFXA 5F6MA 1BTUA 1C5VA 4AG1A 1W0YH 3UQVA 2ZCLP 3U98H 2KAIA 3K9XB 4RKJB 1VGCC 2ZGHA 2ZIQH 4X8UH 1O2QA 4E05H 5L2YH 1J14A 3PMBB 2GP9B 3VEQB 5T3HA 1P03A 1O3LA 4WMDA 2P16A 4K5ZA 3RU4T 3RXIA 1ZRKA 4RKOB 1Z8GA 1XX9A 4GVUA 4Y6DA 3EE0B 1CHGA 4X1PU 1V2NT 2CGAA 1SGFA 1QTFA 2BZAA 1Z1IA 3I29A 2RDLA 4FVDA 1C1RA 3ITIA 3E6PH 2OC8A 1D3TB 1O3CA 1SGNE 2AS9A 3GY7A 3ZZBA 2BY9X 4F4OC 4GHQA 3M3VA 1SLVB 1GVLA 3VGCC 3FZDA 4X1SU 1ZRBA 1Z7KA 1OYTH 2R2WU 5A8ZA 2VGCC 3DFJA 2WYJA 1O5BB 5T6DA 3ATMA 2WUBA 1SL3A 1ZMNA 3RXQA 3T5FH 3ZV8A 1QFKH 2XCNA 3RMOH 2UUJB 4Q7XA 5EPNA 3SV9A 2ZTYA 2VH6A 1LDTT 2EI7A 1BZXE 1DSUA 1DS2E 3MOCA 3BTEE 3VB6A 4MQAA 2BXTH 3V0XA 2C8WB 2P94A 1AVGH 6GCHF 4Y11E 1OWJA 3HPTB 1HAZB 1T4UH 1QGFA 1BMAA 4ZXYH 2OTVA 1TPSA 1C5QA 1AMHA 2R9PA 2A4GA 3BEFB 1JRTA 1Z6JH 3EQ0H 2THFB 1O5CB 4MDSA 1HJ9A 5C1UA 2Q6FA 1GJAB 5CE1A 1LHFH 1WTGH 1DWDH 2VH0A 3MH4A 2AYWA 2PGBB 2O8LA 2O9QA 1BHXB 2WPIS 1KTSB 1GMHF 1PPBH 3GICB 1OXGA 1L1JA 1Y3UA 2FTLE 4Q2KA 3U9AH 4WF8A 1GMHG 1NFUA 1EB2A 1AZ8A 1O2KA 3E1XB 1GHXH 1G32B 2Z9IA 2ZDLA 3F9GA 1GCDA 1YPGH 3P17H 3VB3A 1BTPA 4CRBA 4BTTB 2ZF0H 2XWBI 3FP6E 3Q00A 4GCHF 1A0HB 3A84A 1SQAA 1XM1A 4Y0ZE 1YM0A 2V0BA 1KYNA 2PV9B 3MFJA 3VXFH 5CHAB 1W7XH 1ESTA 3ZZ5A 4OS4A 1B5GH 1KDQA 4CBNA 2BD2A 2F9UA 4DURA 1GG6B 2TPIZ 1PPHE 4NCYA 3D23A 4WY3A 1MBMA 1O5AB 1LO6A 1GJCB 4IC6A 1ETRH 1ELEE 1O2YA 2Z9GA 1C2JA 2QYIA 1N6XA 1Z6EA 1FZZA 1GG6C 1BHXF 8GCHF 3SORA 9ESTA 3D65E 3LU9B 1O3DA 2BD7A 5JDUB 5EXNA 3UQOA 2TGAA 1RFNA 3VB5A 1QBVH 3ZZDA 2DE8A 4DOQA 2B0FA 1CSOE 2C8ZB 1FAXA 3URDA 2FESH 1SLXB 3B9FH 1FY5A 3O8DA 3SUGA 1DUEA 1RRKA 2XWAA 4Y0YE 5C1XA 2AIPA 5HGGA 1G3BA 4FUBA 5EW2H 3Q3KA 1FLEE 1G2MA 3RM2H 1QQ4A 5K7RA 4ABFA 3SJ8A 2Z3DA 2BLOA 2ZZUH 3LONA 1S83A 2IJOB 2OUAA 5JYIA 1OWEA 4AYVB 1O30A 1N1LA 1VZQH 2PWXA 1THPB 1TPAE 5HM2A 2BVXH 3RXUA 1O2PA 3QTVH 1C2KA 1GBJA 2ZHQH 2AMPA 4DGJA 3NUMA 5DG6A 3RC5A 1ELFA 1GJ7B 2VIQA 3RXVA 3BIUH 1XVMA 3RUOA 1GI4A 2ZTZA 7ESTE 4WH6A 3ZZ6A 2FMJA 3CS0A 1VJ9U 4JZDH 1RIWB 1W11U 3ZVCA 4NIYA 1DICA 3E91A 4DW2U 2XBYA 1HIAA 1O3GA 1IQEA 2CHAC 4LXBH 1C2DA 1G37A 2UWLA 4AGKA 2B9LA 1FDPA 1G2LA 2Z3CA 1ID5H 3A7ZA 3LKWA 1JRSA 3PROA 1MCVA 3PLBA 1ZHPA 5FBIA 5A8YA 3ZYEA 1C5MD 5F8ZA 2BQ6B 2GVFA 2F83A 1D6RA 1TGTA 4B1TA 1CA0C 2G5VA 1BBRK 1C2FA 1JBUH 4Y8YA 1YCPH 1HPGA 1EXFA 1FPCH 3OY5U 3M5LA 1AHTH 1DXWA 2D2DA 1BMLA 1QB6A 5AFZH 1XUJA 1ZHMA 3RC4A 3GCTG 4XE4A 1RTKA 4H4FA 4MPUA 1WU1A 5DP3A 5EXMA 4YESB 4R8TB 2CN0H 2PKSB 2B7DH 3ODFA 4MLFB 3SOSA 2VWNA 5L30H 1D3DB 3MI4A 1MD7A 1SGYE 4Q80A 1FPHH 1V2VT 3PYHA 3SGAE 2QV1A 1UVSH 2ESTE 5JBTA 1IQHA 3UY9A 3TGIE 2I6QA 3LT3A 1NFYA 2FOEA 2Q6DA 2VVUA 1P2IA 5DJ7A 2ZTXA 2GX4A 3N7OA 5GJ4B 1GBMA 3M35A 3GY4A 1QL7A 2FTMA 1AVXA 2PUQH 1MTSA 1TRNA 1SQOA 2UUFB 1P06A 2H5DA 4D7FA 3KQEA 1RTLA 1T32A 2SGDE 1L1GA 7GCHF 1CGIE 1MTWA 7GCHG 1DE7H 1EAIA 1QURH 2G00A 1UTOA 3BTTE 3SNBA 2EEKA 2HALA 4JK6A 1DWCH 5FXLA 3SNDA 1GL1A 4WJG2 4JZIA 2JETB 1GL0E 2FOHA 1BTYA 3HATH 4DJZB 1RD3B 1EOLA 3D62A 1O3NA 1FY3A 1C2IA 4JYVH 1K1MA 2BD5A 3TPIZ 3ENSB 1O3AA 1AE8H 1L1NA 1UMAH 3QN7A 3UTUH 1QIXB 1TE0A 2VU8E 4BANB 1MQ6A 1GGDB 3CENA 3UOPA 3M3SA 2JETC 1DANH 4X1RU 1N8OB 4Y71A 4JZEH 2ZDNA 2UWOA 2PTNA 1AWFH 1OS8A 5E8EH 2ZU2A 5DGJA 1MUEB 2O8MA 4LOYH 1H9IE 3SQEE 1GGDC 5EXLA 1ZSLA 4Y79A 2Z9KA 4K3JA 4A6LA 3ZYDA 1EX3A 2C90B 4YOJA 2UUKB 3STIA 5FPSA 2BDHA 1GBIA 3CP7A 4AYYB 1GDUA 3MNXA 2FI4E 1OWHA 1X7AC 3GY8A 4OGYA 1C2GA 1DDJA 3FP7E 2H9EH 2NWNA 2GMTB 2O8TA 1MKWH 1TFXA 1EOJA 1UCYK 2ZCKP 1SVPA 4O3TA 4MG3A 1XKAC 1LVBA 1UTLM 2F9NA 3WY8A 1A5IA 1DPOA 1G3EA 3RXFA 1VCQA 1P2NA 4I8GA 1QB1A 2ZPQA 1THSH 5E0JA 1Q2WA 1NRQH 3LC5A 3EAJA 1HDTH 3RXGA 1H1BA 2VWOA 1UTKA 1P04A 2ZHDA 3AW0A 2XC5A 1F0SA 2BDIA 2A2QH 2VWLA 4YTAA 3S0NA 1E36B 4JYUH 1ZJKA 1PPCE 4MPWA 1K1JA 1O2OA 2F3CE 1JIRA 1XUFA 2OP9A 1A1RA 2H9HA 1KXAA 1O3HA 3W95A 5JB9S 2V35A 3GDVA 5IYTA 4H6SB 3B8JA 1BITA 1FY4A 1S84A 1ZYOA 1HUTH 3UFAA 2ZFRH 3BTKE 1DY8A 3FP8E 1AU8A 2J95A 4K69A 4Q7ZA 3TU7H 1A61H 1EZXC 3NCLA 1SI5H 1OX1A 2Q6GA 1AFQB 1W8BH 2R3UA 3SUFA 1ANBA 2XC4A 4CRCA 1RGQA 1MZAA 4INHA 3ZZ4A 1ABIH 1DT2A 1LVOA 2SGAA 2SGFE 4B73A 1W2KH 3BTDE 2D26C 1TNHA 2HPPH 4VGCB 4U32A 4WH8A 3A86A 3EA9A 3C1KA 1AFQC 2BZ6H 4ZHMU 2V3HH 4ZKNU 2AGGX 4F49A 3SGBE 3M7TA 3IG6B 2F9BH 1GBLA 1TBQH 1KXEA 1P2KA 4VGCC 1K1LA 2J34A 3L6PA 4X6NA 1C1QA 2QY0B 4D9RA 5A0CA 1O2SA 1SR5C 1MCTA 4M7GA 4I33A 2GCTC 5E0GA 3VB4A 1BTXA 1MD8A 3SHAH 2FDAA 5ABWA 1MTNB 2HNTC 1FQ3A 2RA3A 1EZSC 3RP2A 3T62A 1SBWA 1HAXB 1KLTA 2SGPE 1JWTA 1SMFE 3SW2B 2CMYA 3S7KB 5L6NH 1D9IA 1GHYH 1HXFH 3PMJA 1AUTC 4X6OA 3PM3A 1FY8E 4OS1A 1HAIH 2F9OA 1JOUB 3P8FA 3QZRA 2R3YA 2QF3A 3M61U 1PQ5A 3S7HB 1SFQB 4D9QA 1FIZA 1MKXH 3GY5A 1BOQA 3L33A 1J9CH 3U69H 4BAQB 1WBGB 1YBWA 1ZSKA 3MH6A 1C5SA 1NRSH 4NWKA 4YOIA 3UPEA 4ZH8A 4FUJA 1N6YA 1TA6A 2H6MA 4X2VA 1IQMA 2PTCE 2Y80A 4NSYA 1CT4E 1EPTC 3L3TA 5AHGH 1NT1A 1D6WA 1YPEH 4TWYA 3ZVBA 2V6NA 1RS0A 1NU9A 2ZEBA 2AIQA 3Q77A 4SGBE 1AVWA 1Z8RA 2H9TH 3VPKA 4KKDA 2QF0A 3MH7A 3KHVA 1NM6A 1NO9H 2ZGJA 1E37B 3E0PB 2FZZA 2GZ7A 2H1UA 1FV9A 3Q3YA 5LH8A 5C67A 1W12U 2VIDA 1O5DH 2J2UA 1T31A 1HJAC 1UCYE 1BJUA 3ODDA 1O3EA 2QAAA 2AGIX 3OY6U 1ESBA 2A7HA 4OS7A 1O39A 4E06H 3JZ1B 5DPAA 4GHTA 2IN2A 1ZR0A 1W7GH 1GI7B 1K1IA 1PQ8A 2HOBA 5ESBA 1EAXA 2I6SA 3STJA 1C4U2 1WV7H 2XRCA 4KTUA 5ETXA 2A31A 5FX6A 4A5TS 2A4RA 1GBFA 3T27A 3EA8A 1NFWA 3PWBA 1DY9A 4HTCH 4X8SH 4CBOA 3M5OA 2A5AA 2LNCA 1ELGA 5GCHF 1OOKB 3K2UA 3QX5H 2NU2E 3GY3A 5GCHG 3P92A 1C5PA 2GD4B 1WOFA 5E2OA 1HLTH 3NKKA 2PHBA 1HAOH 4BAHB 3VGCB 5T6FA 1GBBA 1PPZA 4Y8ZA 5BRRE 1V2WT 2VGCB 3AVZA 4ESTE 4AX9H 3T25A 2BDGA 1MH0A 4H42U 1KTTB 1AE5A 4KP0A 1U6QA 3KN2A 4O03A 4Y10E 1O3PB 3B23B 2KAIB 1MAXA 1V2PT 2GZ9A 3SV7A 5F03A 2H5CA 1SGDE 1E0FD 1CBWC 4INKA 4A7IB 3RXLA 2OQUA 4I7YH 1SOTA 1GCTB 1LCYA 2PLXA 4ZKOU 1P3EA 3SNCA 4CH8B 3TGJE 4I8LA 1ELTA 3F1SB 3S69A 4A1XA 1Z71A 2ZQ2A 1GCTC 2FP7B 3ATKA 4ZMAH 2ILNA 2VVVA 2ZHEH 1F5RA 3BG4B 1O3KA 3URCA 4CH2B 1SGIB 4A92A 3LOXA 3MWIU 3S9AA 1HXEH 3RDZA 1SGTA 2ZU4A 2M5TA 1Z8IB 3TNTA 1ELVA 1QJ7B 1BA8B 5FPTA 1DM4B 1V2MT 4NSVA 3BG4C 1MZDA 2ZKSA 3A7TA 3UUZA 1JMOH 1G3CA 1WQSA 1JXPA 1LHCH 1YPHC 2D1JA 3SO3A 1EATA 1W0ZU 3DFLA 2ODQA 2BB4A 3F6UH 3RM0H 1T8LA 2XW9A 4CRDA 4KTCA 1QY6A 1ZMLA 2FYRA 4U30A 3TK6A 1ZPZA 4NG9H 3SU6A 1JIMA 1SGCA 2ZCHP 2HNTE 2RCEA 2W3KA 2G8TA 3Q3XA 3V7TA 2QXIA 3TJUA 4X2YA 8LPRA 2BY6X 3BN9A 1BMNH 3IITA 1K1NA 1HV7A 1MTVA 3SU0A 3ZZ3A 1IQNA 1SGFG 2TRMA 5DP6A 2GT7A 2ZGCA 1O3BA 2FI3E 1V2KT 2W3IA 2ZFPH 1HCGA 1GJ4H 1P10A 2NU4E 4CREA 5JBAS 1QR3E 2EA3A 3ATIA 2ZO3H 1P57B 4BAKB 3G01A 2Y5GA 3A81A 3A83A 1Z8JB 4YM9A 5GWZA 2F91A 2WPJS 1TX7A 4FUIA 2FWWA 2OC7A 1BCUH 3RXMA 2PW8H 1NTPA 4HI3A 1K1PA 1O3OA 2H2ZA 3A82A 2Z94A 1O2UA 5EOKA 1C1PA 2ANYA 2SFAA 4YLUA 2GTBA 4XDEA 1V2QT 3SHCH 1GBTA 3F9FA 1QHRB 2A2XH 2A7CA 1A46H 1PPGE 1O2JA 1Z1JA 4D8NA 1EASA 2SGQE 1Q31A 3F68H 3DT0H 1UK2A 1UVOA 1GDQA 2PR3A 1KDQB 2WPHS 1AO5A 1TNKA 2Y6TA 4JZ1A 1ELBA 2FX4A 4TWWA 1O2ZA 4JMYA 4NIVA 1ELCA 2QXHA 4CR9A 1HJ8A 2UUYA 1C5WB 2EI8A 5C20A 3ZZ7A 3OSYA 1H8DH 1FXYA 3TIUA 1UK4A 3RXAA 1CE5A 4JYTA 1GI3A 1SLUB 2CHAB 5TJXA 3SU2A 1O2TA 1TWXB 1K22H 4NA9H 3RU4D 3S9BA 1YCPM 1S0QA 5DP4A 1ETSH 2O8UA 1T7CA 3DD2H 1A3EH 1BB0B 1K1OA 1PQAA 1C1UH 1KXDA 2WUCA 1L4DA 2Y81A 3UWIA 1O32A 3E3TA 1V3XA 2STAE 3KQDA 1CA0B 2WPMS 3ESTA 2BQWB 1GHAF 4FUEA 2W5EA 3AASA 3M37A 2TGPZ 1IAUA 1F5KU 1GHAG 1A5HA 4ISLA 4AOQA 4AGJA 1PYTD 1WTHD 1Y59T 3PV4A 4ABIA 3RXPA 2XBXA 3MU1A 3SV2H 2ZFSA 1C2EA 3BTHE 3DA9B 1ESAA 1TGCA 3FAOA 2R0KA 3NZIA 1O3FA 5I25A 2C8YB 1YPKH 5E2PA 3GCTF 4CRFA 1OP0A 3KCGH 3T2NA 2Y82A 2BDCA 3QDZB 4D76A 1YPLH 5IDKA 2BHGA 2ZDKA 5DKMA 1O38A 3HGNA 4ZXXH 1D4PB 3KNXA 1HIAB 3LH3A 1C5XB 3SU5A 3LGUA 1UJ1A 5HXFA </