1BOQA

Pro region c-terminus: protease active site interactions are critical in catalyzing the folding of alpha-lytic protease
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNITANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (ALPHA-LYTIC PROTEASE)
publication title Pro region C-terminus:protease active site interactions are critical in catalyzing the folding of alpha-lytic protease.
pubmed doi rcsb
total genus 57
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1998-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1boqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1boqA01
4OGXA 1ELBA 4O03A 1LKAA 1AVGH 4MNYA 2OINA 4CBNA 3VFEA 4ESTE 1FXYA 2PSYA 5EPNA 3E3TA 1S82A 1HAVB 1V2TT 1UVTH 3QUMP 5EG4A 1DY8A 3LH3A 5AF9H 1A5GH 1P0SH 3M5MA 1W8BH 1F2SE 1SGFA 3PO1C 1OYTH 2NU1E 3A7XA 2SNVA 3STIA 2C90B 3QO6A 5EGMA 1C2EA 4NIWA 2O8WA 1MUEB 1LTOA 4KKDA 4YT6H 1J8AA 1AWHB 2ZQ2A 1D4PB 1SLWB 3HPTB 1HAGE 1P04A 1S84A 2GZ8A 1MTVA 1C9PA 3LC5A 3RC4A 2BDBA 1BMAA 2VWMA 2A2QH 2Z3DA 1G2MA 1J17T 3KCGH 1WBGB 3E1XB 1NRPH 2VWNA 4GAWA 1XUIA 1DXPA 4AOQA 3ATIA 1GMHG 5L2YH 1C1RA 2D1JA 1DDJA 2P3UB 2ZU1A 2CF8H 5FPYA 3PYHA 1GCDA 1VJ9U 3RXIA 1HAVA 2FX4A 2THFB 3W95A 1FUJA 5EXLA 1MMJN 1E36B 1YPEH 2AYWA 2F9NA 1AFQB 1OOKB 3Q00A 4CHAB 3ZZ3A 1CGJE 1WOFA 2HRVA 3ZZBA 4X1NU 4U01A 1K9OE 3UY9A 4A1VA 2F9OA 1PPCE 1IQFA 1RD3B 2B8OH 2BX3A 4Y7BA 1BHXF 3RXPA 1AQ7A 3SU5A 1ZTKA 1S5SA 3U8OH 3A80A 1YYY1 2ALPA 1OSSA 4A6LA 1HAYB 4AG1A 3B23B 1V2WT 1MTNB 4YLUA 4JMYA 1SGYE 3A85A 1AB9C 2BMGB 2CN0H 4NCYA 3I77A 3L3TA 5EOKA 3S69A 1NFWA 1EQ9A 2OTVA 2LNCA 2G5VA 3R0FA 1EB1H 1BBRH 2PKSB 1GWAA 1EJMA 1BQYA 1D3TB 1LPZB 1O2UA 1XXFA 3V0XA 4LK4A 2FTMA 3OYPA 2ZPRA 4ISHH 1SQTA 3GY2A 2FXRA 4K8BA 4UD9H 1SI5H 3BTHE 1TMTH 1QQ4A 2PW8H 5EU8A 1VR1H 2ZKSA 3CS0A 1KLTA 3QDZB 1ZSKA 3MU8A 1TNHA 5DK1A 4TWYA 3P8OA 2BD3A 5L2ZH 1O33A 2G52A 1N6XA 3BTME 2GMTB 3T62A 1Z8JB 1INCA 4OS4A 2ZQ1A 2O8LA 3PV4A 2FI4E 3GDVA 3BTTE 1OWJA 1W12U 3QWCH 1BBRK 1DS2E 2GTBA 1BTYA 1JXPA 1O0DH 3ZVGA 1C5ZB 4YLQH 1O35A 1HJ9A 1FY4A 3RXLA 1C1UH 1G3CA 2WUCA 3EGKH 3ZV9A 1C1NA 1C1TA 1GGDC 1N1LA 1GJ5H 4AG2A 2ZP0H 2Z9GA 1F0RA 2BY9X 1GI1A 1ZGVA 2BD2A 1UK4A 4A1TA 4YM9A 2JETB 4HZHA 2ZZUH 2BLWA 1S83A 2PUQH 3CS7A 3QTVH 5EODA 3SGQE 4GCHF 3S7HB 1EJAA 1H9IE 1KLIH 2OC7A 1ABJH 2QA9E 5EW1H 4JZIA 1EPTC 1G3BA 1XM1A 1UCYH 1BDAA 2HVXA 2VVCA 3SNDA 2ZHEH 3MU4A 1EB2A 9LPRA 3RU4E 3RMLH 1MTSA 3BG8A 4K3JA 5HGGA 3SJKA 4FUEA 1GL0E 2R3YA 4IMQA 3RXFA 6CHAB 5EQRA 1PQ7A 3M61U 3P8GA 4ISOA 1GI4A 1VGCC 1S6FA 5FHTA 1NRQH 1P2KA 2UWLA 2ZGBH 2Q1JA 2RCEA 1O2QA 4FUHA 4WXVA 2H2ZA 1GI6A 3ATWA 4WWYA 1TALA 5FPTA 1T8NA 3SUFA 4ZHLU 1UCYK 4XDEA 1H8IH 1UVSH 1GBKA 2P59A 1DFPA 2PUXB 5ESBA 1GI0A 1XMNB 1N8OC 2ZDNA 4FUCA 3SHAH 2JKHA 3UQVA 2HOBA 2FZZA 5F6MA 2GX4A 2ODYB 4CREA 1ELTA 1B7XB 3ZZCA 2P95A 1YF4A 2B5TB 4PROA 3SJ8A 3V13A 2AMPA 4RKJB 1C5UA 2OLGA 4X1SU 2UWOA 2AMQA 2BVXH 5EXMA 1TRYA 2ZFQH 2SGFE 3EA8A 2C8YB 1JRSA 1NT1A 4TY7A 1CE5A 1SFQB 2CHAB 3MWIU 1O2ZA 5GIBA 4X8VH 1PYTC 3E0NB 1SBWA 1KDQB 5GWZA 1GI9B 1LVMA 2SGEE 2Z7FE 2R0KA 3D23A 4Q80A 2BM2A 1HBTH 2WV5A 1NRRH 1AIXH 1SLUB 1XUKA 3I78A 1B0EA 2BQWB 2A4RA 5K7RA 1J15A 1CGIE 4Q2KA 2NU2E 1LCYA 1IQKA 1HJ8A 3MNCA 1G32B 3Q3XA 1AVXA 1ZTJA 1P9UA 4DW2U 1T4UH 3SOSA 3EA7A 1PPHE 2C8ZB 2SGPE 1N6YA 1QJ1B 4AFZA 1G9IE 1K1JA 4AFUA 4K69A 1C5MD 5C1UA 1TBRH 4U2WA 3GY4A 1TGSZ 1O3DA 2BQ7B 2ZDMA 3DA9B 3FAOA 4YTAA 1KXEA 3STJA 1GJBB 2QC2A 1KY9A 2GDDA 4ZXYH 1FJSA 2ZEBA 4GLYA 3QTOH 1HJAB 2Q6FA 2UUYA 4Z6AH 4J1YA 3BTWE 3GY7A 4RKOB 2FOCA 1S85A 3PLKA 1Z1JA 1TNLA 1GDUA 1GHXH 4GCHG 2EI6A 3HGPA 1HRTH 3DFLA 4ZMAH 2W3IA 1MAYA 3GCTF 3AAVA 4XSKU 2ZFPH 1EZXC 2P3FH 4KP0A 4X8TH 2Y5HA 5DP4A 5DP6A 2AERH 1Y3VA 3EA9A 3M36A 3RXDA 2BQ6B 1ETRH 4CH2B 2WYJA 1C1PA 3A87A 7KMEH 4ABIA 1OWKA 1IOEA 1QBNA 3GYLB 1GJCB 2ULLA 1W2KH 2AS9A 2ZTXA 2ZFFH 1GHYH 1TOCB 1K2I1 4TPYA 1O2MA 2Z9JA 2P8OB 3LPRA 4R8TB 4AN7A 3LONA 3VB5A 1DWCH 1V2VT 3FZDA 1YM0A 2OC8A 1UK2A 4JYUH 2XWAA 1A0LA 1V2MT 1OWIA 1QR3E 3SW2B 5F8TA 3PMJA 2FOMB 1F0UA 1ANEA 1UO6A 3HK6B 2NU0E 5CHAB 4FUGA 4ZXXH 1HLTH 1SHYA 2XCNA 1A3BH 2VIDA 2BXUH 3RU4D 1ELFA 4MG3A 6GCHG 3E91A 3A82A 5C1YA 1GBLA 2BD8A 4NA7A 3S9AA 1P2OA 3P92A 1SMFE 3SBKA 2VGCC 3UQOA 1C9TA 1TLDA 4B75A 1SGQE 1HCGA 1JBUH 3VB3A 1DSTA 1EAWA 3RXKA 5ETXA 1NO9H 1V2LT 5G4BA 1Y5AT 3F9EA 3QK1A 1RGQA 3RXJA 1ZPBA 3RLYH 1AFQC 1O3FA 4YO9A 1BTWA 1FZZA 1IQJA 1BZXE 4X8SH 1O3LA 5E8EH 4KTUA 3SJOA 2W3KA 1ZSJA 3GICB 4WF8A 4DIIH 1RRKA 1SLVB 3TLOA 1CA0C 1V2PT 7LPRA 3ITIA 2Z6BD 5FCRA 1UTLM 1TRMA 3PROA 4K1EA 2FX6A 5I25A 1JOUB 1UVOA 2J92A 1WTHD 1DUEA 4K5ZA 4XBDA 2ZCLP 2QXGA 3SJ9A 4AGKA 2ZWLH 3A89A 2UUKB 4X6OA 3QLPH 4X1PU 2ZGJA 4WJG2 5A09A 1W13U 1HUTH 1TWXB 1E35B 2VIWA 3MO6A 3S7KB 2ZHQH 3P70B 2ALVA 1O2JA 3ZZAA 1GMHF 2FYQA 4HTCH 1GI2A 3TK5A 2PFEA 1QIXB 3TH2H 3A88A 4OS2A 2PTNA 3UPEA 3EDXB 3MHWU 1MKXH 4E06H 3P8NA 5CE1A 2XC0A 1CGHA 5GPIB 5AHGH 1KXFA 5GDSH 1UTNA 1O2XA 1SQOA 2EA3A 3H5CB 1ZPZA 4JZFH 3RXUA 4JCNA 3GCTG 2ZDVH 4WXIA 1T8OA 2H9TH 3SJIA 1HYLA 4OS6A 1HXEH 4X6PA 3LGUA 2TGDA 1K22H 5E2PA 3BSQA 2EI7A 3SN8A 4BXWA 3BF6H 1LVBA 1MKWH 1W7XH 3SGBE 1LDTT 5DGJA 1SPJA 1ZMLA 1QBOA 1MKXK 1V3XA 3LJOA 2A45B 1FV9A 4WVPE 3BTEE 3AAUA 1GI7B 4TY6A 2OXSA 3TH4H 1HIAB 1W3CA 3VPKA 3PMHB 2Y80A 2BY8X 3RMNH 3LU9B 1UMAH 3BTKE 1O3IA 1NTPA 2RDLA 5DKMA 4H6SB 3GOVB 4FUJA 1EOJA 5L6NH 3NCLA 1B5GH 2ZPQA 5DJ7A 3MNSA 1GI3A 2ZG0H 4X1RU 4ISNA 3SV8A 1SGPE 1GHAF 1MBMA 1MKWK 4I8LA 1VJAU 4VGCB 3LT3A 2QF0A 2QF3A 4CRGA 3FP8E 4FUIA 2ZHWH 1KIGH 1DLEA 1G37A 3VXFH 2I6QA 3RXOA 2GZ9A 1O3JA 1QGFA 3OX7U 1TMBH 1T32A 4WMEA 4X6MA 3SV9A 1NU9A 1UTMA 1SSXA 2BDCA 2HNTE 1K1MA 2ZCKP 4WH8A 2J9NA 1CQQA 2ZTZA 1GCTB 1AWFH 5JDUB 4GPGA 4YESB 1Y5UT 1GDNA 2VH6A 1KTSB 1G36A 1C5RA 1EUFA 1Z7KA 2PLXA 2OC1A 3BEFB 2A7HA 2GV7A 1THSH 3EE0B 3SQHE 1HIAA 3R3GB 1QB1A 2DE9A 3H7OA 2O8TA 3ATKA 1Z8GA 2BDIA 1U6QA 3OU0A 1EP5A 1YPHE 3RM0H 1T7CA 1HB0B 4LXBH 1AMHA 1A0HB 2VNTA 3LGVA 1UK3A 5FBEA 4YOJA 1L1JA 3BV9B 3SQEE 3DHKH 2SFAA 4B1TA 3MH5A 1P9SA 2WPJS 3RM2H 1ZYOA 3OY6U 1HAOH 4CRDA 1SQAA 3A81A 1Y3YA 3M3TA 2EI8A 1QRWA 1C4Y2 2PR3A 3QX5H 1O3MA 3UTUH 3KQEA 1FMGA 2WPIS 2AFQB 3CENA 3LC3A 1XKBC 3TVJB 1OPHB 2ANMH 5HXFA 4GHQA 2J4IA 1C2GA 2FO9A 1XX9A 3GDSA 1MQ6A 4I31A 3SORA 2ZFTA 1Z8IB 1C2FA 2Z3CA 3SU3A 3A84A 4NFEA 3T28A 1Q3XA 3AVZA 2Z9LA 3VGCC 5ABWA 1YC0A 2J34A 1OP0A 3MU1A 1BA8B 3OTJE 1TQ7B 1NPMA 1EASA 4XBBA 1FQ3A 2V6NA 1BCUH 1BRCE 2KAIB 1HFDA 1WAYB 1RIWC 2ILNA 2XTTB 2BVSH 4LZ1H 3O8CA 3EYDA 4GHTA 2AGIX 2D2DA 3O8RA 3GCHC 1TAWA 1HAIH 2P94A 3HKIB 1EAIA 3T26A 1PQ5A 2A4OA 3P8FA 4BOHA 2FODA 4CRFA 2VIOA 3QN7A 2ZHDA 2VINA 3M5NA 1GMCF 5AFZH 4B2BA 3GY5A 4K1TA 1LHGH 1A5HA 1HDTH 1O3NA 2VVUA 1CT2E 1IQIA 2YOLA 5TCCA 1GHAG 5FX6A 1F92A 4U30A 2JH0D 2GGVB 3Q3YA 4JZ1A 4DOQA 3ZVDA 4OS1A 3TK6A 3K9XB 5FXLA 3S0NA 1GG6C 2A32A 1BB0B 2V0BA 3NK8A 2Y82A 4LZ4B 3F68H 3PMBB 3GYMA 1MU8B 1DX5M 4JYVH 5JB8S 2KAIA 2C8XB 4O9VA 2P8OC 1DXWA 1D3QB 2FESH 4IMZA 2OC0A 3UNSA 1A0JA 1TPPA 2HPQH 1C2LA 1TOMH 2P93A 6LPRA 3UR6A 1ID5H 1P2NA 3BG4C 4BTUB 5LPRA 1TRNA 3A8CA 3WY8A 3F6UH 3RP2A 3SZNA 1ELEE 4Y79A 1NS3A 2V35A 3H7TA 1LHEH 3SU4A 2B0FA 4DIHH 1IQEA 2GD4B 1VCQA 1O3EA 1QA7A 4BXSA 3OY5U 2G4UA 1ORFA 4INHA 2HLCA 5HM2A 2G81E 5C3NA 1Y8TA 2VIPA 2WPLS 1GBDA 4B2AA 1BITA 1TMUH 1UHBB 1PFXC 1KSNA 2QXHA 1Y59T 3RU4T 1GI8B 4INKA 2ZF0H 4JYTA 1G3DA 1XVMA 1OP2A 1V2KT 1ANBA 2ZC9H 1CBWB 1DWBH 3UNQA 1GI5A 2W26A 1TQ0B 2B9LA 1O37A 1GBTA 1J9CH 2G51A 3FFGA 2G55A 2IJOB 3D49H 4AYYB 1PQ8A 2AEIH 4ZKSU 1EAXA 4HGCA 1QL9A 1AUJA 2VIVA 3PMAB 3MH4A 5SGAE 2FI5E 1NRSH 1AD8H 1XUGA 1OWHA 5LGOA 2FTLE 1GBBA 3MFJA 3SNEA 2EC9H 3GISB 1DWEH 3RXBA 1MTWA 3ODFA 2A0QB 3MH6A 1O5GH 4BAKB 5C5OA 2Y81A 2CV3A 1TONA 2OQ5A 1C5VA 3V7TA 5A8XA 6GCHF 2DE8A 4SGAE 1O2IA 1UHBA 1NY22 2LPRA 1LHCH 1C5QA 5LPEA 1B0FA 1BRBE 1VZQH 5DP8A 1ESBA 1L4ZA 1XXDA 4MTBA 4E05H 5FAHA 3PO1B 2OD3B 3VXEH 2P16A 3K6YA 4OS5A 3LIWA 2Y5GA 2XRCA 3BN9A 1PJPA 1O2KA 2AH4X 3E0PB 1C2JA 1BUIA 3V3MA 1GMCG 4Y76A 1W14U 1LPGB 3GY6A 1HXFH 4CRCA 4AGJA 1K1OA 1QTFA 3KQBA 1EZSC 1O3BA 1O3PB 2ZHFH 4BAHB 4ZAEA 4ISLA 2TGAA 2GCTB 4H42U 3LGWA 4HFPB 4J2YB 2WUBA 4SGBE 2BDAA 2CF9H 4Y0ZE 2PHBA 2G4TA 1P10A 2ZPSA 3RXAA 1QCPA 3TNTA 1KLJH 1Q31A 1QY6A 2RG3A 3EQ0H 2ZO3H 1UVPA 1W7GH 3E6PH 1TPOA 3NZIA 2GVFA 4ABDA 3PWCA 3HATH 3IG6B 4I8GA 3U8TH 1IQLA 1C5WB 1F5LA 2GZ7A 2R9PA 1JIRA 1AUTC 4QT8C 3PLBA 4FVDA 5C5NA 1ESTA 3D62A 5DP7A 2Q6DA 2Y7XA 1WTGH 2VU8E 5E0GA 1DOJA 5EQQA 2PKAA 1RS0A 2XBWA 1W0YH 2A31A 2PSXA 2GV6A 1IAUA 1QBVH 3SUEA 3SU6A 2ANKH 2XW9A 3PLPA 4MQAA 5FX5A 2K1QA 4MNXA 1ZMJA 2XBVA 1J14A 3MNXA 1BBRE 1HV7A 2J38A 4X2XA 5EW2H 4NWKA 4MPWA 4UFGH 3UR9A 1W10U 1GVLA 1ZHPA 1P3CA 2J2UA 1QNJA 1GBAA 1C5PA 1O2RA 3FANA 4ZUHA 2AGGX 1A2CH 5JPMH 4ABGA 1P02A 5F8ZA 1FONA 4DGJA 3U9AH 4BANB 3A7TA 3A8AA 2ZCHP 2TGTA 4DJZB 3KQCA 3L6PA 3BTFE 1IQHA 1V2ST 2XC4A 1CO7E 1EP6A 2V3HH 1NZQH 2FWWA 1YKTA 2A7JA 1YPGH 5JYIA 3IWMA 5AVDA 1H1BA 1ARCA 3SI3H 3TIUA 2ANYA 1C1SA 3MU5A 1O3AA 3TGJE 3HK3B 1FI8A 3ESTA 1GPZA 2JH6D 1T31A 2BX4A 2FDAA 4BTIB 2ZGHA 1TFXA 4H4FA 1O2GH 1RFNA 4O97A 4D9RA 1BTZA 1GVKB 2QYIA 3P17H 3AASA 3D65E 1SGFG 1O3OA 1AKSA 1S6HA 3TJUA 1K21H 4F4OC 1GL1A 1P09A 2C8WB 1GVZA 1BJVA 3AW0A 3ELAH 2RA3A 1ZTLA 1O3KA 1TX6A 2BDYA 1J16A 3LJJA 5DP5A 1QHRB 4D8NA 3VB4A 4CBOA 1HAZB 4XOJA 4XFQA 4NSYA 1CHGA 4CHAC 1D6RA 1O2VA 1SGNE 1JWTA 1ETTH 5E0HA 5T3HA 2FLBH 1TNJA 1L4DA 1DWDH 1UCYE 4JK5A 3RXGA 1NU7B 1T4VH 4FU8A 2CGAA 3A83A 3ATLA 5IYTA 3ZVBA 1GBHA 1SB1H 3ZZ5A 1C5LH 3E8LA 1FNIA 2PGQB 1C1QA 1V6DA 1ZLRA 1FN8A 1MCVA 1EPTB 2UWPA 1Z8RA 1MTNC 1TX7A 2BOHB 4I8JA 1S81A 1GBJA 1AU8A 1ZSLA 3CP7A 2BYAX 4D76A 3I29A 5HMAA 3ZVFA 4FU9A 3ZV8A 2H9HA 1GDQA 2B7DH 3SNCA 2F9PA 1VGCB 2GKVE 4UDWH 1C2IA 3QGJA 1T8LA 1TA6A 3NWUA 1YGCH 3B9FH 2BXTH 3A86A 2BB4A 3F9HA 2PKSC 3DFJA 2ZIQH 4E7RG 5JBTA 2BTCE 4ZH8A 3RUOA 4Y11E 2J95A 2YNAA 3ATMA 5F03A 2FOFA 2FOAA 3T29A 1C5SA 4HI3A 3KHVA 3ZYEA 1N8OB 4F49A 2STBE 2GMTC 2R0LA 3RXVA 1EPTA 1FPCH 3MNBA 1UTJA 3BEUA 5FCKA 1DM4B 2GCHF 1BRAA 3BIUH 1O2WA 2VB0A 2VIQA 2QV1A 2W5EA 3C1KA 3MO9A 1GHVH 1QQUA 1TBQH 3LH1A 2VVVA 5GJ4B 2ZDAH 1KTTB 4UEHH 2H5CA 1P06A 4AX9H 1MZAA 4IN2A 5C20A 1SHHB 2C3SA 1TNKA 1ESAA 2D8WA 3M5OA 4UFEH 1ELAA 2FOEA 3GCNA 1OX1A 4NIVA 4AORA 2ZU2A 3LGTA 1KYNA 4H6TA 4O3UA 2BVRH 2GP9B 2JH5D 2JETC 1OWEA 4ISIH 1EATA 1W0ZU 1P57B 4DG4A 3RXCA 4FUFA 1FIZA 2P3TB 2WPMS 4B76A 1CA8B 1GJ8B 1P2MA 2VH0A 1O30A 2QIQA 1ETSH 1P2JA 3DUXH 2F3CE 4U32A 1GJDB 3M37A 1TABE 1CBWC 4BAOB 1PYTD 4UE7H 1SC8U 5CMXH 1HAPH 4AFQA 1ZHMA 2A1DB 4NG9H 3TJNA 1NROH 5HM9A 1AVWA 2R3UA 2OCVB 2BZAA 2QXJA 3O8BA 1L0ZA 1ZMNA 2QXIA 6CHAC 3T25A 5C67A 1TGNA 5EQSA 8GCHF 1QJ6B 3FP6E 4CH8B 2BD9A 2D26C 4OGYA 3S9BA 2WYGA 2SNWA 4XBCA 1FDPA 1YLCA 4NFFA 5DP3A 1SLXB 1Z71A 5T6GA 4AB8A 2BOKA 1RTLA 5A0CA 3FP7E 5DP9A 2XCFA 3ZVCA 3M3VA 1JIMA 1AHTH 1GJ9B 1SGDE 2Z9IA 3F9GA 2Z94A 2F91A 1O5FH 1O2HA 4RSPA 2FS8A 4X2WA 4D7FA 1THPB 3GDUA 1HPGA 4I8KA 2ESTE 4Y8ZA 2OBOA 4YZUA 1P05A 1ZOMA 1C5XB 1O5CB 1D3PB 2J94A 1C1MA 1C2DA 1O2LA 1F0TA 2BLVA 4I8HA 5JBCS 1A46H 1FN6A 5E0JA 4TPIZ 1MTUA 3RLWH 1BJUA 2CXVA 3RXRA 1GJAB 2CHAC 1O5BB 3U1IB 4WY3A 1NM6A 1SGRE 4TYDA 3ZZ7A 2IOTA 3SNBA 3SUGA 1O2TA 3LDXH 3MH7A 3ZZ4A 5T6FA 4DY7B 1NN6A 1DUAA 4K8YA 1F7ZA 1Z1IA 4YOGA 1CT0E 2A5KA 1OWDA 1LQDB 5FBIA 4ZHMU 5PTPA 2FIRH 3ZZ9A 2WPHS 1C2MA 2XNIA 2GCTC 3JZ2B 3A7VA 2A2XH 4ABHA 2BD7A 2HALA 2TIOA 1DITH 1NFUA 2BY7X 2G5NA 2BDHA 5HYOA 1EX3A 1PPFE 2VGCB 3MMGA 4GVUA 3SUDA 1BTPA 5GXPA 1QB9A 2GCHG 4E7NA 1AO5A 1TBZH 4CR5A 2CJIA 2BDGA 2NU3E 3MTYA 3ZZ8A 1RXPA 2M5TA 4BAQB 4NSVA 4X8UH 1IHTH 1GJ4H 1DVAH 2QN5T 3KF2A 1LVOA 1WYKA 4Y71A 1CA0B 1ELDE 1C2HA 8ESTE 3M35A 1K1LA 3PWBA 3RXQA 1FY5A 1G2LA 1HJAC 2QGRA 1YCPH 1JRTA 1DPOA 4NIYA 5AFYH 4DCDA 1GJ7B 1QRZA 5K0HA 1TPSA 2ZECA 1GHWH 3BTGE 3RMOH 1UTOA 1TNGA 5BPEA 3LOXA 3RDZA 4MLFB 4FXGH 3BEIB 5A8ZA 3NKKA 1TB6H 3G01A 4MNVA 1LHFH 3A7WA 2Y6TA 3A7ZA 3L33A 4B71A 3PB1E 2AIPA 1K1PA 3FVFB 1ZJDA 5T6DA 3LGIA 4CRBA 4ABJA 3ZVEA 1VCPA 1V2OT 1C5OH 1WSSH 4FUDA 1BMNH 1THRH 1X7AC 4B73A 2Z3EA 1GBIA 4A5TS 1YCPK 1GMDF 4MPUA 5F8XA 4NZLA 5C2ZA 1ZHRA 1AN1E 2BY5X 8GCHG 1NC6A 1YP9A 3TITA 1A7SA 2FMJA 3U98H 2VJ1A 1ACBE 1Z6EA 3VEQB 3RC6A 1UTKA 4Q7XA 4YT7H 2H6MA 3M7TA 3ZYDA 1L1NA 4M7GA 1A5IA 1GBMA 1YPMH 4MPXA 5TJXA 1P8VC 2BLQA 2F9BH 3AW1A 3M3SA 3TH3H 3VB7A 5CHAC 9ESTA 2GT8A 2GDEH 4ZHAA 3NPSA 2SGQE 4Y8XA 3A7YA 6ESTA 1AZ8A 5DG6A 1LQEA 3UIRA 1TGBA 1IQMA 4JZEH 5EPYA 1GJ6A 2G00A 3RXMA 1F5KU 4FUBA 4X2YA 1SR5C 4ZKOU 1O39A 3QZRA 1LO6A 4WMFA 1QRXA 2ODQA 1C4V2 1EXFA 1UJ1A 2TBSA 1GHZA 2FOBA 4THNH 5LH8A 1C1WH 2XWBI 3Q3KA 1YPLH 2RA0A 2ZA5A 7GCHF 2ZFSA 4JK6A 1PPZA 1P3EA 1O5EH 1BMLA 3KL6A 1P03A 3C27B 1MAXA 5E2OA 1O5AB 1ELVA 4LOYH 4I7YH 1ZGIA 3UFAA 1XUJA 2H5DA 4DVAU 1V2JT 3NXPA 2BD5A 1CHOF 5A0BA 3NUMA 4ABEA 4OS7A 3A8DA 1AE5A 3SU0A 2R2WU 2PWXA 4Y8YA 4Z0KA 2F83A 2PV9B 3TGIE 3IITA 3Q76A 1KXAA 2NU4E 1FPHH 1A3EH 2W7SA 3SV2H 1DANH 4IS5A 2ZNKH 4TWWA 1SFIA 2F9VA 3KN2A 3BTDE 1DLKB 1MCTA 1ARBA 1SGEE 2VWOA 3HGNA 3U69H 1H9HE 2Z9KA 4Y0YE 3TNSA 1DICA 3UNRA 1QJ7B 1O3GA 2ZU3A 1YPJH 1ABIH 1HAXB 2OP9A 4ASHA 3RC5A 1Z6JH 1DT2A 2UUFB 3RXSA 3MOCA 2WV4A 4X0WU 1P12E 1Y3XA 3DT0H 3URDA 2AIQA 2ASUB 1FAXA 1NESE 4MNWA 2BHGA 2PKAB 1T8MA 2Q6GA 1ANCA 2XBYA 1QA0A 2FM2A 1P11E 1G30B 3P6ZB 1IQNA 5A0AE 3KNXA 1SOZA 2STAE 3SGAE 1F5RA 1O5DH 2ZDKA 3PTBA 1SGIB 4ZROA 2AMDA 1K28D 1FIWA 1AI8H 4MPVA 3F9FA 1KXCA 4KELA 4R0IA 1OKXA 4KGAA 2VWLA 5DPAA 1O32A 1GMDG 4DT7B 1PPGE 5A8YA 1PQAA 1QB6A 1AE8H 1MD7A 1O31A 3TU7H 2C93B 3VGCB 2ZU4A 4CR9A 3UWJH 1PPEE 2H9EH 3F1SB 5C1XA 1DSUA 4B74A 1E38B 5J4QA 1KXDA 3UWIA 2AGEX 2QCYA 3ZZDA 1WV7H 4AFSA 1GBCA 1TX8A 1O38A 3SI4H 1A4WH 4VGCC 2ANWA 1M9UA 4KTSA 4IGDA 4Y7AA 1WQVH 5B6OA 1EJNA 1TGCA 1VITH 2C4FH 3SO3A 7ESTE 2FS9A 1RIWB 4A1XA 1P01A 3JZ1B 2TRMA 1CSOE 1LMWB 1MU6B 1TIOA 3LGYA 1AB9B 1O36A 1ZZZA 3SHCH 3ODDA 3KGPA 2HPPH 3LKWA 1BTHH 3GCHB 1BMMH 1AKSB 1GCTC 4IC6A 1L1GA 2Y5FA 5JB9S 1CU1A 1KDQA 7GCHG 2IN2A 3VB6A 2HGTH 1MZDA 1ELGA 1YBWA 1TYNA 1C5YB 1Y3WA 3BIVH 3E16B 1JMOH 1QL8A 5J4SA 2A4GA 1QL7A 1SOTA 4WMDA 1OYQA 1E37B 4Y10E 1OP8A 5GCHF 1YPKH 2WPKS 2V3OH 5BRRE 1CHOG 3OSYA 1RTFB 2BZ6H 1GG6B 4NWLA 1GBFA 1P2QA 4KTCA 4ABBA 5JBBS 1AGJA 1OS8A 1V2NT 1EZQA 1MH0A 3GY3A 2ZI2H 1ELCA 1BHXB 1SL3A 3U8RH 2BY6X 1PPBH 4MDSA 3W94A 3PTNA 2EEKA 1WQSA 3TJOA 1EAUA 3RXEA 1RTKA 2TGPZ 1FLEE 2YNBA 3TJVA 3K65B 1QFKH 4ABAA 1SVPA 2BD4A 1HGTH 2IPHA 3KIDU 1C5NH 1ANDA 2O9QA 1GGDB 1MD8A 3BG4B 1DY9A 1EZUC 1MQ5A 3SV6A 2HWLB 3B8JA 1K1IA 1ZJKA 1NRNH 5H4IB 4K2YA 4BAMB 1O2YA 1ZRBA 2ZDLA 4Q7YA 1ZR0A 1VITF 1XUHA 1GHBF 3A8BA 1C1OA 2XYAA 1Y5BT 1EOLA 1E0FD 2ZU5A 1RJXB 1E34B 5IDKA 2W7UA 4AB9A 1P2IA 3M5LA 1AY6H 1G3EA 1FY8E 4X1QU 5TCAA 4XE4A 1BOQA 1WU1A 1D6WA 3GCOA 2UUJB 1NFYA 4AZ2B 2A5IA 1YLDA 3N7OA 4IN1A 2HNTF 2FOGA 2ODPA 5EXNA 5L30H 4IW4E 4A92A 1W11U 2A7CA 1V2RT 3TGKE 2TPIZ 1K1NA 1C2KA 2FP7B 1TA2A 3S9CA 4NA8A 4YOIA 1EKBB 3FZZA 1Q2WA 1BTXA 1O34A 3UOPA 3MI4A 1UTQA 1LVYA 3O8DA 4INLA 4IBLH 1O3HA 4UFFH 1HNEE 2PGBB 1QURH 1S0RA 2A4QA 4RN6A 2ZTYA 4I32A 1XVOA 8KME2 3SNAA 3RXHA 1O2NA 1DE7H 4GSOA 2SGAA 4X2VA 1BRUP 1LKBA 2ZGXH 1YCPM 4NA9H 1HAHH 1LPKB 4A7IB 2I6SA 3SU1A 3KEEA 3GY8A 1SGCA 1BIOA 3RMMH 4BTTB 3MYWA 1D9IA 2FPZA 3BTQE 1OXGA 2FYRA 2OBQA 1V2QT 1H9LB 1C5TA 3QGNB 1O3CA 1F0SA 1TPAE 4O3TA 3SV7A 4ABFA 2HNTC 4MVNA 3T27A 1IHSH 2H1UA 3TPIZ 1H4WA 4Q7ZA 3T5FH 2G8TA 2DUCA 1TGTA 3RXTA 3MU0A 5A2MH 3P95A 1D3DB 4UFDH 4WH6A 2BLOA 3MO3A 1A61H 1FY1A 3Q77A 1UVUH 4ZKRU 2A5AA 1VCWA 1S0QA 3QZQA 2OQUA 2WINI 4ZKNU 1Y3UA 4NZQA 1YPHC 5I46H 4NGAH 1SGTA 5FPSA 1WUNH 4DURA 4B2CA 1BT7A 1AFEH 1UTPA 3K6ZA 4FU7A 2F9UA 5GCHG 1TE0A 1C1VH 1O2SA 3URCA 2QAAA 1CVWH 3UOUA 1XUFA 1O2PA 1XKAC 1ZPCA 3T2NA 3PM3A 4IC5A 1KXBA 2O8MA 5DO4H 4BNRA 4K1SA 4FVBA 3KQDA 1L2EA 3EAJA 3TK9A 3M7QA 1BTUA 2XBXA 1AZZA 2CMYA 2FOHA 4AYVB 2QY0B 2XXLA 2FI3E 4Y6DA 1A1RA 1FAKH 1TNIA 1V2UT 3ENSB 2SGDE 1NFXA 4NIXA 3K2UA 1GBEA 4D7GA 1MBQA 2GT7A 2R2MB 1FY3A 5ESTE 3V12A 4K60A 4I33A 4GUXA 8LPRA 2ZFRH 1CT4E 1C4U2 3U1JB 1LHDH 5LPFA 2PTCE 3SU2A 1H8DH 3ZVAA 1O2OA 2NWNA 4UONA 1VITG 3DD2H 1GHBG 2FLRH 3HKJB 3ZZ6A 3M7UA 4CRAA 3UUZA 3UREA 1SG8B 1WCZA 4D9QA 2XC5A 3E90B 1IQGA 4X6NA 1ZRKA 2FEQH 2ZGCA 5JBAS 4JZDH 2OUAA 2O8UA 2Y7ZA
chains in the Genus database with same CATH superfamily
4OGXA 1ELBA 4O03A 1LKAA 1AVGH 4MNYA 2OINA 4CBNA 3VFEA 4ESTE 1FXYA 2PSYA 5EPNA 3E3TA 1S82A 1HAVB 1V2TT 1UVTH 3QUMP 5EG4A 1DY8A 3LH3A 5AF9H 1A5GH 1P0SH 3M5MA 1W8BH 1F2SE 1SGFA 3PO1C 1OYTH 2NU1E 3A7XA 2SNVA 3STIA 2C90B 3QO6A 5EGMA 1C2EA 4NIWA 2O8WA 1MUEB 1LTOA 4KKDA 4YT6H 1J8AA 1AWHB 2ZQ2A 1D4PB 1SLWB 3HPTB 1HAGE 1P04A 1S84A 2GZ8A 1MTVA 1C9PA 3LC5A 3RC4A 4Q4LA 2BDBA 1BMAA 2VWMA 2A2QH 2Z3DA 3KYFA 1G2MA 1J17T 3KCGH 2OK5A 1WBGB 3E1XB 1NRPH 2KZ4A 2VWNA 4GAWA 1XUIA 1DXPA 4AOQA 3ATIA 1GMHG 5L2YH 1C1RA 2D1JA 1DDJA 2P3UB 2ZU1A 2CF8H 5FPYA 3PYHA 2KX4A 1GCDA 1VJ9U 3RXIA 1HAVA 2FX4A 2THFB 3W95A 4YXWD 1FUJA 5EXLA 1MMJN 1E36B 1YPEH 2AYWA 2F9NA 1AFQB 1OOKB 3Q00A 4CHAB 3ZZ3A 1CGJE 1WOFA 2HRVA 2QF4A 4X1NU 3ZZBA 4U01A 1K9OE 3UY9A 4A1VA 2F9OA 4RT1A 1PPCE 1IQFA 1RD3B 2B8OH 2BX3A 3OEHD 4Y7BA 1BHXF 3RXPA 1AQ7A 3SU5A 1ZTKA 1S5SA 3U8OH 3A80A 1YYY1 2ALPA 1OSSA 4A6LA 1HAYB 3OTPA 4AG1A 3B23B 1V2WT 1MTNB 4YLUA 4JMYA 1SGYE 3A85A 1AB9C 2BMGB 4P00A 2CN0H 4NCYA 3I77A 3L3TA 5EOKA 3S69A 1NFWA 1OHHD 1EQ9A 2OTVA 2LNCA 2G5VA 3R0FA 1EB1H 1BBRH 2PKSB 1GWAA 1VKYA 1EJMA 1BQYA 1D3TB 1LPZB 1O2UA 1XXFA 3V0XA 4LK4A 2FTMA 3OYPA 3U28C 2ZPRA 4ISHH 1SQTA 3GY2A 2FXRA 4K8BA 4UD9H 3PRDA 1SI5H 3BTHE 1TMTH 1QQ4A 2PW8H 5EU8A 1VR1H 2ZKSA 3CS0A 1KLTA 3QDZB 1ZSKA 3MU8A 1TNHA 5DK1A 4TWYA 3P8OA 2BD3A 5L2ZH 1O33A 2G52A 1N6XA 3BTME 2GMTB 3T62A 1Z8JB 1INCA 4FOUC 4OS4A 2ZQ1A 2O8LA 3PV4A 2FI4E 3GDVA 3BTTE 1OWJA 5KEDA 1W12U 3QWCH 1BBRK 1DS2E 2GTBA 1BTYA 1JXPA 1O0DH 3OAAD 3AK5A 3ZVGA 1C5ZB 4YLQH 1O35A 1HJ9A 1FY4A 3RXLA 1C1UH 1G3CA 2WUCA 3EGKH 3ZV9A 1C1NA 1C1TA 1GGDC 1N1LA 1GJ5H 4AG2A 2ZP0H 1FX0B 2Z9GA 1F0RA 2BY9X 1GI1A 1ZGVA 2BD2A 4TT3D 1UK4A 4A1TA 4YM9A 2JETB 4HZHA 2ZZUH 2BLWA 1S83A 2PUQH 3CS7A 3QTVH 5EODA 3SGQE 4GCHF 3S7HB 1EJAA 1H9IE 1KLIH 2OC7A 1ABJH 2QA9E 5EW1H 4JZIA 1EPTC 1G3BA 1XM1A 1UCYH 1BDAA 2HVYB 2HVXA 2VVCA 3SNDA 2ZHEH 3MU4A 1EB2A 9LPRA 3RU4E 3RMLH 1MTSA 3BG8A 4K3JA 4XRNA 5HGGA 3SJKA 4FUEA 1GL0E 2R3YA 4IMQA 5C94A 3RXFA 6CHAB 5EQRA 1PQ7A 3M61U 3P8GA 4ISOA 1GI4A 1VGCC 1S6FA 5FHTA 1NRQH 1P2KA 2UWLA 2ZGBH 2Q1JA 2RCEA 1O2QA 4FUHA 4WXVA 2H2ZA 1GI6A 3ATWA 4WWYA 1TALA 5FPTA 1T8NA 3SUFA 4ZHLU 1UCYK 4XDEA 1H8IH 1UVSH 1GBKA 2P59A 1DFPA 2PUXB 5ESBA 1GI0A 1XMNB 1N8OC 2F4LA 2ZDNA 4FUCA 3SHAH 2JKHA 5HIZA 3UQVA 2HOBA 2FZZA 5F6MA 2GX4A 5CDFE 2ODYB 4CREA 1ELTA 1B7XB 3ZZCA 2P95A 1YF4A 2B5TB 4AC9A 4PROA 3SJ8A 3V13A 2AMPA 4RKJB 1C5UA 3FKSD 2OLGA 4X1SU 2UWOA 2AMQA 2BVXH 5EXMA 1TRYA 2ZFQH 2SGFE 3EA8A 2C8YB 1JRSA 2HLDD 3KYGA 1NT1A 4TY7A 1CE5A 1SFQB 2CHAB 3MWIU 1O2ZA 5GIBA 4Q63A 4X8VH 1PYTC 3E0NB 1SBWA 1KDQB 5GWZA 1GI9B 1LVMA 2SGEE 2Z7FE 2R0KA 3D23A 5DN6D 4Q80A 2BM2A 1HBTH 2WV5A 1NRRH 1AIXH 1SLUB 1XUKA 3I78A 1B0EA 2BQWB 2A4RA 5K7RA 1J15A 1CGIE 4Q2KA 3WW7A 2NU2E 1LCYA 1IQKA 1HJ8A 1WXRA 3MNCA 1G32B 3Q3XA 1AVXA 1ZTJA 1P9UA 4DW2U 1T4UH 3SOSA 3EA7A 1PPHE 2C8ZB 2SGPE 1N6YA 1QJ1B 4AFZA 1G9IE 1K1JA 4AFUA 4K69A 1C5MD 5C1UA 2LP6A 1TBRH 4U2WA 3GY4A 1TGSZ 1O3DA 2BQ7B 2ZDMA 3DA9B 3FAOA 4YTAA 1KXEA 3STJA 3N7DA 1GJBB 2QC2A 1KY9A 2GDDA 4ZXYH 1FJSA 2ZEBA 4GLYA 3QTOH 1HJAB 2Q6FA 2UUYA 4Z6AH 4J1YA 3BTWE 3GY7A 4RKOB 2FOCA 1S85A 3PLKA 1Z1JA 1TNLA 1GDUA 1GHXH 4GCHG 2EI6A 3HGPA 1HRTH 3DFLA 4ZMAH 2W3IA 1MAYA 3GCTF 3AAVA 4XSKU 2ZFPH 1EZXC 2P3FH 4KP0A 4X8TH 2Y5HA 5DP4A 5DP6A 2AERH 4XD7D 1Y3VA 3EA9A 3M36A 3RXDA 2BQ6B 1ETRH 4CH2B 2WYJA 1C1PA 3A87A 7KMEH 4ABIA 1OWKA 1IOEA 1QBNA 3GYLB 1GJCB 2ULLA 1W2KH 2AS9A 2ZTXA 2ZFFH 1GHYH 1TOCB 1K2I1 4TPYA 1O2MA 2Z9JA 4B6FA 2P8OB 3LPRA 4R8TB 4AN7A 3LONA 3VB5A 2XOKD 1DWCH 1V2VT 3FZDA 1YM0A 2OC8A 1UK2A 4FETA 4JYUH 2XWAA 1A0LA 1V2MT 1OWIA 1QR3E 4F48B 3SW2B 5F8TA 3PMJA 2FOMB 1F0UA 1ANEA 1UO6A 3HK6B 2NU0E 5CHAB 4FUGA 4ZXXH 1HLTH 1SHYA 2XCNA 1A3BH 2VIDA 2BXUH 3RU4D 1ELFA 4MG3A 6GCHG 3E91A 3A82A 5C1YA 1GBLA 2BD8A 4NA7A 3S9AA 1P2OA 3P92A 1SMFE 3SBKA 2VGCC 3UQOA 1C9TA 1TLDA 4B75A 1SGQE 1SQRA 1HCGA 1JBUH 3VB3A 1DSTA 1EAWA 3RXKA 5ETXA 1NO9H 1V2LT 5G4BA 1Y5AT 3F9EA 3QK1A 1RGQA 3RXJA 1ZPBA 3RLYH 1AFQC 1O3FA 4YO9A 1BTWA 1FZZA 1IQJA 1BZXE 4X8SH 1O3LA 5E8EH 4KTUA 3SJOA 2W3KA 1ZSJA 3GICB 4WF8A 4DIIH 1RRKA 1SLVB 3TLOA 1CA0C 1V2PT 7LPRA 3ITIA 2Z6BD 5FCRA 1UTLM 1TRMA 3PROA 4K1EA 2FX6A 5I25A 1JOUB 1UVOA 2J92A 1WTHD 1DUEA 4K5ZA 4XBDA 2ZCLP 2QXGA 3SJ9A 4AGKA 2ZWLH 3A89A 2UUKB 4X6OA 3GS9A 3QLPH 4X1PU 2ZGJA 4WJG2 5A09A 1W13U 1HUTH 1TWXB 1E35B 2VIWA 3MO6A 3S7KB 2ZHQH 3P70B 2ALVA 1O2JA 3ZZAA 1GMHF 2FYQA 4HTCH 1GI2A 3TK5A 2PFEA 1QIXB 3TH2H 3A88A 4OS2A 2PTNA 4OM9A 3UPEA 3EDXB 3MHWU 1MKXH 4E06H 3P8NA 5CE1A 2XC0A 1CGHA 5GPIB 5AHGH 1KXFA 5GDSH 1UTNA 1O2XA 1SQOA 2EA3A 3H5CB 3ZIAD 1ZPZA 4JZFH 3RXUA 4JCNA 3GCTG 2ZDVH 4WXIA 1T8OA 2H9TH 3SJIA 1HYLA 4OS6A 1HXEH 4X6PA 3LGUA 2TGDA 1K22H 5E2PA 3BSQA 2EI7A 3SN8A 4BXWA 3BF6H 1LVBA 4TSFD 1MKWH 1W7XH 3SGBE 1LDTT 5DGJA 1SPJA 1ZMLA 1QBOA 1MKXK 1V3XA 3LJOA 2A45B 1FV9A 4WVPE 3BTEE 2KCYA 3AAUA 1GI7B 4TY6A 2OXSA 3TH4H 1HIAB 1W3CA 3VPKA 3PMHB 2Y80A 2BY8X 3RMNH 3LU9B 1UMAH 3BTKE 3DSOA 1O3IA 1NTPA 2RDLA 5DKMA 4H6SB 2AHME 3GOVB 4FUJA 1EOJA 5L6NH 3NCLA 1B5GH 2ZPQA 5DJ7A 3MNSA 1GI3A 2ZG0H 3EE7A 4X1RU 4ISNA 3SV8A 1SGPE 1GHAF 1MBMA 1MKWK 4I8LA 1VJAU 4VGCB 3LT3A 2QF0A 3DSGA 2QF3A 4CRGA 3PRBA 3FP8E 4FUIA 2ZHWH 1KIGH 1DLEA 1G37A 3VXFH 2I6QA 3RXOA 2GZ9A 1O3JA 1QGFA 3OX7U 1TMBH 1T32A 4WMEA 4X6MA 3SV9A 1NU9A 1UTMA 1SSXA 2BDCA 2HNTE 1K1MA 2ZCKP 2KM0A 4WH8A 2J9NA 1CQQA 2ZTZA 5FL7D 1GCTB 1AWFH 5JDUB 4GPGA 4YESB 1Y5UT 3DCLA 1GDNA 2VH6A 1KTSB 1G36A 1C5RA 1EUFA 1Z7KA 2PLXA 2OC1A 3BEFB 2A7HA 2GV7A 1THSH 3EE0B 3SQHE 1HIAA 3R3GB 1QB1A 2DE9A 3H7OA 2O8TA 3ATKA 1Z8GA 2BDIA 1U6QA 3OU0A 5GNDA 1EP5A 1YPHE 3RM0H 1T7CA 1HB0B 4LXBH 1AMHA 1A0HB 2VNTA 3LGVA 1UK3A 5FBEA 4YOJA 1L1JA 3BV9B 3SQEE 3DHKH 2SFAA 4B1TA 3MH5A 1P9SA 2WPJS 3RM2H 1ZYOA 2RFKC 3OY6U 1HAOH 4CRDA 1SQAA 3A81A 1Y3YA 3M3TA 2EI8A 1QRWA 1C4Y2 2PR3A 3QX5H 1O3MA 3UTUH 3KQEA 1FMGA 2WPIS 2AFQB 3CENA 3LC3A 1XKBC 3TVJB 1OPHB 2ANMH 5HXFA 4GHQA 2J4IA 1C2GA 2FO9A 1XX9A 3GDSA 1MQ6A 4I31A 3SORA 2ZFTA 1NBMD 1Z8IB 3F2HA 1C2FA 2Z3CA 3SU3A 5C0TA 3A84A 4NFEA 3T28A 1Q3XA 3AVZA 3N7EA 2Z9LA 2EY4C 3VGCC 5ABWA 1YC0A 2J34A 1OP0A 3MU1A 1BA8B 3OTJE 1TQ7B 1NPMA 1EASA 5EIYA 4XBBA 1FQ3A 2V6NA 1BCUH 1BRCE 2KAIB 1HFDA 1WAYB 1RIWC 2ILNA 2XTTB 2BVSH 4LZ1H 3O8CA 2KFWA 3EYDA 4GHTA 2AGIX 2D2DA 3O8RA 3GCHC 1TAWA 1HAIH 2P94A 3HKIB 1EAIA 1YWUA 3T26A 1PQ5A 2A4OA 3P8FA 4BOHA 2FODA 2YMSC 4CRFA 2VIOA 3QN7A 2ZHDA 2VINA 3M5NA 1GMCF 5AFZH 2WSSD 4B2BA 3GY5A 1YLNA 4K1TA 1LHGH 1A5HA 1HDTH 1O3NA 2VVUA 1CT2E 1IQIA 2YOLA 5TCCA 1GHAG 5FX6A 1F92A 4U30A 2JH0D 1E79D 2GGVB 3Q3YA 4JZ1A 4DOQA 3ZVDA 4OS1A 3TK6A 3K9XB 5FXLA 3S0NA 1GG6C 2A32A 1BB0B 3N99A 2V0BA 3NK8A 2Y82A 4LZ4B 3F68H 3OE7D 3PMBB 3GYMA 1MU8B 1DX5M 4JYVH 5JB8S 2KAIA 2C8XB 4O9VA 4B6EA 2P8OC 1DXWA 1D3QB 2FESH 4IMZA 2OC0A 3UNSA 1A0JA 1TPPA 2HPQH 1C2LA 1TOMH 2P93A 6LPRA 3UR6A 1ID5H 1P2NA 3BG4C 4BTUB 5LPRA 1TRNA 3A8CA 3WY8A 3F6UH 3RP2A 3SZNA 1ELEE 4Y79A 1NS3A 2V35A 3H7TA 2WHXA 1LHEH 3SU4A 2B0FA 4DIHH 1IQEA 2GD4B 1VCQA 1O3EA 1QA7A 4BXSA 3OY5U 2G4UA 1ORFA 4INHA 2HLCA 5HM2A 2G81E 5C3NA 1Y8TA 2VIPA 2WPLS 1GBDA 4B2AA 1BITA 1TMUH 1UHBB 1PFXC 1KSNA 2QXHA 1Y59T 3RU4T 1GI8B 4INKA 2ZF0H 4JYTA 1G3DA 1XVMA 1OP2A 1V2KT 1ANBA 2ZC9H 1CBWB 1DWBH 3UNQA 1GI5A 2W26A 1TQ0B 2B9LA 2CK3D 1YY3A 1O37A 1GBTA 1J9CH 2G51A 3FFGA 2G55A 2IJOB 3D49H 4AYYB 1PQ8A 2AEIH 4ZKSU 1EAXA 4HGCA 1QL9A 1AUJA 2VIVA 3PMAB 3MH4A 5SGAE 2FI5E 1NRSH 1AD8H 1XUGA 1OWHA 5LGOA 2FTLE 1GBBA 3MFJA 3SNEA 2EC9H 3GISB 1DWEH 3RXBA 5EJZA 1MTWA 3ODFA 2A0QB 3MH6A 1O5GH 4BAKB 5C5OA 2Y81A 2CV3A 1TONA 2OQ5A 1C5VA 3V7TA 5A8XA 6GCHF 2DE8A 4SGAE 1O2IA 1UHBA 1NY22 2LPRA 1LHCH 1C5QA 5LPEA 1B0FA 1BRBE 1VZQH 5DP8A 3F2FA 1ESBA 1L4ZA 2XNDD 1XXDA 4MTBA 4E05H 5FAHA 4RI0A 3PO1B 2OD3B 3VXEH 2P16A 3K6YA 4OS5A 5F53A 3LIWA 2Y5GA 4ASUD 2XRCA 3BN9A 1PJPA 1O2KA 2AH4X 1WDIA 3E0PB 1C2JA 2JDID 1BUIA 3V3MA 1GMCG 4Y76A 1W14U 1LPGB 3GY6A 1HXFH 4CRCA 4AGJA 1K1OA 1QTFA 2IJD1 3KQBA 1EZSC 1O3BA 2QE7D 1O3PB 2ZHFH 4BAHB 4ZAEA 4ISLA 2PP6A 2TGAA 2GCTB 4H42U 3LGWA 2W6ID 1QZ8A 4HFPB 4J2YB 2WUBA 4SGBE 2BDAA 2CF9H 4Y0ZE 2PHBA 2G4TA 1P10A 2ZPSA 3RXAA 1QCPA 3TNTA 1KLJH 1Q31A 1QY6A 2RG3A 3EQ0H 2ZO3H 1UVPA 1W0JD 1W7GH 3E6PH 1TPOA 3NZIA 2GVFA 4ABDA 3PWCA 3HATH 3IG6B 3UB0A 4I8GA 3U8TH 3UAIC 1IQLA 1C5WB 1F5LA 2GZ7A 2R9PA 1JIRA 1AUTC 4QT8C 3PLBA 4FVDA 5C5NA 1ESTA 3D62A 5DP7A 2Q6DA 2Y7XA 1WTGH 2VU8E 5E0GA 1DOJA 5EQQA 4F55A 2PKAA 1RS0A 2XBWA 1W0YH 2A31A 2PSXA 2GV6A 1IAUA 1QBVH 3SUEA 3SU6A 2ANKH 2XW9A 3PLPA 4MQAA 5FX5A 2WV9A 4I86A 2K1QA 4MNXA 1ZMJA 2XBVA 1J14A 3MNXA 1BBRE 1HV7A 2J38A 4X2XA 5EW2H 4NWKA 4MPWA 4UFGH 3UR9A 1W10U 1GVLA 1ZHPA 1P3CA 2J2UA 1QNJA 1GBAA 1C5PA 1O2RA 3FANA 4ZUHA 2AGGX 1A2CH 5JPMH 4ABGA 1P02A 5F8ZA 1FONA 4DGJA 3U9AH 4BANB 3A7TA 3A8AA 2ZCHP 2TGTA 4DJZB 3KQCA 3L6PA 3BTFE 1IQHA 1V2ST 2XC4A 1CO7E 1EP6A 2V3HH 1NZQH 2FWWA 1YKTA 2A7JA 1YPGH 5JYIA 4P02A 3IWMA 5AVDA 1H1BA 1ARCA 3SI3H 3TIUA 2ANYA 1C1SA 3MU5A 1O3AA 3TGJE 3HK3B 1FI8A 3ESTA 1GPZA 2JH6D 1T31A 2BX4A 2FDAA 4BTIB 2ZGHA 1TFXA 4H4FA 1O2GH 1RFNA 4O97A 4D9RA 1BTZA 1GVKB 2QYIA 3P17H 3AASA 3D65E 1SGFG 1O3OA 1AKSA 1S6HA 3TJUA 1K21H 4F4OC 1GL1A 1P09A 2C8WB 1GVZA 1BJVA 3AW0A 3ELAH 2RA3A 1ZTLA 1O3KA 1TX6A 2BDYA 1J16A 3LJJA 5DP5A 1QHRB 4D8NA 3VB4A 4CBOA 1HAZB 4XOJA 4XFQA 4NSYA 1CHGA 4CHAC 1D6RA 1O2VA 1SGNE 1JWTA 1ETTH 5E0HA 5T3HA 2FLBH 1TNJA 2KCOA 1L4DA 1DWDH 1UCYE 4JK5A 3RXGA 1NU7B 1T4VH 4FU8A 2CGAA 3A83A 3ATLA 5IYTA 3ZVBA 1GBHA 1K0HA 1SB1H 3ZZ5A 1C5LH 3E8LA 1FNIA 1C1QA 1V6DA 2PGQB 1ZLRA 1FN8A 1MCVA 1EPTB 2L6OA 1S6LA 2UWPA 1Z8RA 1MTNC 1TX7A 2BOHB 4I8JA 1S81A 1GBJA 1AU8A 1ZSLA 3CP7A 2BYAX 4D76A 4ACAA 3I29A 5HMAA 3ZVFA 4FU9A 3ZV8A 2H9HA 1GDQA 2B7DH 3SNCA 2F9PA 1VGCB 2GKVE 4UDWH 1C2IA 3QGJA 1T8LA 2VBCA 1TA6A 3NWUA 1YGCH 3B9FH 2BXTH 3A86A 2BB4A 3F9HA 2PKSC 3DFJA 2ZIQH 4E7RG 5JBTA 2BTCE 4ZH8A 3RUOA 2KCPA 4Y11E 2J95A 2YNAA 2JJ2D 3ATMA 5F03A 2FOFA 2FOAA 2LELA 5HKKD 3T29A 1C5SA 4HI3A 3KHVA 3ZYEA 1N8OB 4DT4A 4F49A 2STBE 2GMTC 2R0LA 3RXVA 3NRLA 2J98A 1EPTA 1FPCH 3MNBA 1UTJA 3BEUA 5FCKA 1DM4B 2GCHF 1BRAA 3BIUH 2J5UA 1O2WA 2VB0A 2VIQA 2QV1A 2W5EA 3C1KA 3MO9A 1GHVH 1QQUA 1TBQH 3LH1A 2VVVA 5GJ4B 2ZDAH 1KTTB 4UEHH 2H5CA 1P06A 4AX9H 1MZAA 4IN2A 5C20A 1SHHB 2C3SA 1TNKA 1ESAA 2D8WA 3M5OA 4UFEH 1ELAA 2FOEA 3GCNA 1OX1A 4NIVA 4AORA 2ZU2A 3LGTA 1KYNA 4H6TA 4O3UA 2BVRH 2GP9B 2JH5D 1E1QD 2JETC 5C0UA 3KQ5A 1OWEA 4ISIH 1EATA 1W0ZU 1P57B 4DG4A 3RXCA 4FUFA 1FIZA 2P3TB 2WPMS 4B76A 1CA8B 3SYJA 1GJ8B 1P2MA 2VH0A 1O30A 2QF5A 2QIQA 1ETSH 1P2JA 3DUXH 3F3BA 2F3CE 4U32A 1GJDB 3M37A 2J97A 1TABE 1CBWC 4BAOB 2EQNA 1PYTD 4UE7H 1SC8U 5CMXH 1HAPH 4AFQA 1ZHMA 2A1DB 4NG9H 3TJNA 1NROH 5HM9A 1AVWA 2R3UA 3W1EA 2OCVB 3F0PA 2BZAA 2QXJA 3O8BA 1L0ZA 1ZMNA 2QXIA 3CNRA 6CHAC 3T25A 5C17A 5C67A 1TGNA 5EQSA 8GCHF 1QJ6B 3FP6E 4CH8B 2BD9A 2D26C 5IK2D 4OGYA 3S9BA 2WYGA 2SNWA 4XBCA 1FDPA 1YLCA 4NFFA 5DP3A 1SLXB 1Z71A 5T6GA 4AB8A 2BOKA 1RTLA 1W0KD 5A0CA 3FP7E 5DP9A 2XCFA 3ZVCA 3M3VA 1JIMA 1AHTH 1GJ9B 1SGDE 2Z9IA 3F9GA 2Z94A 2F91A 1O5FH 1O2HA 4RSPA 2FS8A 4X2WA 4D7FA 1THPB 3GDUA 1HPGA 4I8KA 2ESTE 4Y8ZA 2OBOA 4YZUA 1P05A 1ZOMA 1C5XB 1O5CB 1D3PB 2J94A 1C1MA 1C2DA 1O2LA 1F0TA 2BLVA 2W6JD 4I8HA 5JBCS 1A46H 1FN6A 5E0JA 2RDEA 4TPIZ 1MTUA 3RLWH 1BJUA 2CXVA 3RXRA 1GJAB 2CHAC 1O5BB 3U1IB 4WY3A 1NM6A 1SGRE 4TYDA 3ZZ7A 2IOTA 3SNBA 3SUGA 1O2TA 3LDXH 3MH7A 3ZZ4A 5T6FA 4DY7B 1NN6A 1DUAA 4K8YA 1F7ZA 1Z1IA 4YOGA 1CT0E 2A5KA 1OWDA 1LQDB 5FBIA 4ZHMU 5PTPA 2FIRH 3ZZ9A 2WPHS 3F0OA 1C2MA 2XNIA 2GCTC 3JZ2B 3A7VA 2A2XH 4ABHA 2BD7A 2HALA 2TIOA 1DITH 1NFUA 2BY7X 2G5NA 2BDHA 2K8IA 5HYOA 1EX3A 1PPFE 5CHBA 2VGCB 3MMGA 4GVUA 3SUDA 1BTPA 5GXPA 1QB9A 2GCHG 2KCAA 4E7NA 1AO5A 1TBZH 4CR5A 2CJIA 2BDGA 2NU3E 3MTYA 3ZZ8A 1RXPA 2M5TA 4BAQB 4NSVA 4X8UH 1IHTH 1GJ4H 1DVAH 2QN5T 3KF2A 1LVOA 1WYKA 4Y71A 1CA0B 1ELDE 2KR7A 1C2HA 8ESTE 3M35A 1K1LA 3PWBA 3RXQA 1FY5A 5B6LA 1G2LA 1HJAC 2QGRA 1YCPH 1JRTA 1DPOA 3OFND 4NIYA 5AFYH 4DCDA 1GJ7B 1QRZA 5K0HA 1TPSA 2ZECA 1GHWH 3BTGE 5KGOA 3RMOH 1UTOA 1TNGA 5BPEA 3LOXA 3RDZA 4MLFB 4FXGH 3BEIB 5A8ZA 3NKKA 3F2GA 1TB6H 3G01A 4MNVA 1LHFH 3A7WA 2Y6TA 3A7ZA 3L33A 4B71A 3PB1E 2AIPA 1K1PA 3FVFB 1ZJDA 5T6DA 3LGIA 4CRBA 4ABJA 3ZVEA 1VCPA 1V2OT 1C5OH 1WSSH 4FUDA 1BMNH 1THRH 1X7AC 4B73A 2Z3EA 1GBIA 4A5TS 1YCPK 1GMDF 4MPUA 5F8XA 4NZLA 2L74A 5C2ZA 1ZHRA 1AN1E 2BY5X 8GCHG 1NC6A 1YP9A 3TITA 1A7SA 2FMJA 3U98H 2VJ1A 1ACBE 1Z6EA 3VEQB 3RC6A 1UTKA 4Q7XA 4YT7H 2H6MA 3M7TA 3ZYDA 1L1NA 4M7GA 1A5IA 1GBMA 1YPMH 4MPXA 5TJXA 1P8VC 2BLQA 2F9BH 3AW1A 3M3SA 3TH3H 3VB7A 5CHAC 9ESTA 2GT8A 2GDEH 4ZHAA 3NPSA 2SGQE 4Y8XA 3A7YA 6ESTA 1AZ8A 5DG6A 1LQEA 3UIRA 1TGBA 1IQMA 4JZEH 5EPYA 1GJ6A 2G00A 3RXMA 1F5KU 4FUBA 4X2YA 1SR5C 4ZKOU 1O39A 3QZRA 1LO6A 4WMFA 1QRXA 5EJ1A 2ODQA 1C4V2 1EXFA 1UJ1A 2TBSA 1GHZA 2FOBA 4THNH 5LH8A 1C1WH 2XWBI 3Q3KA 1YPLH 2RA0A 2ZA5A 7GCHF 2ZFSA 4JK6A 1PPZA 1P3EA 1O5EH 1BMLA 4Z1MD 3KL6A 1P03A 2K0QA 3C27B 1MAXA 5E2OA 1O5AB 1ELVA 4LOYH 4I7YH 3FOAA 1ZGIA 3UFAA 1XUJA 2H5DA 4DVAU 1V2JT 3NXPA 2BD5A 1CHOF 5A0BA 3NUMA 4ABEA 4OS7A 3A8DA 1AE5A 3OEED 3SU0A 2R2WU 2PWXA 4Y8YA 4Z0KA 2F83A 2PV9B 3TGIE 3IITA 3Q76A 1KXAA 2NU4E 1FPHH 1A3EH 2W7SA 3SV2H 1DANH 4IS5A 2ZNKH 4TWWA 1SFIA 2F9VA 1UW7A 3KN2A 1E1RD 3BTDE 1DLKB 1MCTA 1ARBA 1SGEE 2VWOA 3HGNA 3U69H 1H9HE 2Z9KA 4Y0YE 3TNSA 1DICA 3UNRA 1QJ7B 1O3GA 2ZU3A 1YPJH 1ABIH 1HAXB 2OP9A 2GJGA 4ASHA 3RC5A 1Z6JH 1DT2A 3DSPA 2UUFB 3RXSA 3MOCA 2WV4A 4X0WU 1P12E 1Y3XA 3DT0H 3URDA 2AIQA 2ASUB 1FAXA 1NESE 4MNWA 2BHGA 2PKAB 1T8MA 2Q6GA 2WZQA 3PV2A 1ANCA 2XBYA 1QA0A 2FM2A 1P11E 1G30B 3P6ZB 1IQNA 5A0AE 3KNXA 1SOZA 2STAE 3SGAE 1F5RA 5EJLA 1O5DH 2ZDKA 3VG8A 3PTBA 1SGIB 4ZROA 2AMDA 1K28D 1FIWA 1AI8H 4MPVA 3F9FA 5KECA 1KXCA 4KELA 4R0IA 1OKXA 2V3MA 4KGAA 2VWLA 5DPAA 1O32A 1GMDG 4DT7B 1PPGE 5A8YA 1PQAA 1QB6A 2JIZD 1AE8H 1MD7A 1O31A 3TU7H 2C93B 3VGCB 2ZU4A 4CR9A 3UWJH 1PPEE 2H9EH 3F1SB 5C1XA 1DSUA 4ACBA 4B74A 1E38B 5J4QA 1KXDA 3UWIA 2AGEX 2QCYA 3ZZDA 1WV7H 4AFSA 1GBCA 1TX8A 1O38A 3SI4H 1A4WH 4VGCC 2ANWA 2M2AA 1M9UA 4KTSA 4IGDA 4Y7AA 1WQVH 5B6OA 1EJNA 1TGCA 1VITH 2C4FH 3SO3A 7ESTE 2FS9A 1RIWB 4A1XA 1P01A 3JZ1B 2TRMA 1CSOE 1LMWB 1MU6B 1TIOA 3LGYA 1AB9B 1O36A 1ZZZA 3SHCH 3ODDA 3KGPA 2HPPH 3LKWA 1BTHH 3GCHB 1BMMH 1AKSB 1GCTC 4IC6A 1L1GA 2Y5FA 5JB9S 1CU1A 1KDQA 7GCHG 2IN2A 3VB6A 2YMSB 2HGTH 1MZDA 1ELGA 1YBWA 1TYNA 1C5YB 1H8ED 1Y3WA 3BIVH 2F43B 3E16B 1JMOH 1QL8A 5J4SA 2A4GA 1QL7A 1SOTA 4WMDA 1OYQA 1E37B 4Y10E 1OP8A 5GCHF 1YPKH 2WPKS 2V3OH 5BRRE 1CHOG 3WWFA 3OSYA 1RTFB 2BZ6H 1GG6B 4NWLA 1GBFA 1P2QA 4KTCA 4ABBA 5JBBS 1AGJA 1OS8A 1V2NT 1EZQA 1MH0A 3GY3A 2ZI2H 1ELCA 1BHXB 1SL3A 3U8RH 2BY6X 1PPBH 4MDSA 3W94A 3PTNA 2EEKA 1WQSA 3TJOA 1EAUA 3RXEA 1RTKA 2TGPZ 1FLEE 2YMSD 2V7QD 2YNBA 3TJVA 3K65B 1QFKH 4ABAA 1SVPA 2BD4A 1HGTH 2IPHA 3KIDU 1C5NH 1ANDA 2O9QA 1GGDB 1MD8A 3BG4B 1DY9A 1EZUC 1MQ5A 3SV6A 2HWLB 1H8HD 3B8JA 1K1IA 1ZJKA 1NRNH 5H4IB 4K2YA 4BAMB 4ZCNA 1O2YA 1ZRBA 2ZDLA 4Q7YA 1COWD 1ZR0A 1VITF 1XUHA 4RT0A 1GHBF 3A8BA 1C1OA 1MABB 2XYAA 1Y5BT 1EOLA 1E0FD 2ZU5A 3WWBA 1RJXB 1E34B 5IDKA 2W7UA 4AB9A 1P2IA 3M5LA 1AY6H 1G3EA 1FY8E 4X1QU 5TCAA 4XE4A 1BOQA 1WU1A 1D6WA 3GCOA 5HIYA 2UUJB 1NFYA 4AZ2B 2A5IA 1YLDA 3N7OA 3MQKC 4IN1A 2HNTF 2FOGA 2ODPA 2J98B 5EXNA 5L30H 4IW4E 5DSFA 3SZEA 4A92A 1W11U 2A7CA 1V2RT 3TGKE 2TPIZ 1K1NA 1C2KA 2FP7B 3PV5A 1TA2A 3S9CA 4NA8A 4YOIA 1EKBB 3FZZA 1Q2WA 1BTXA 1O34A 3UOPA 3MI4A 1NBME 1LVYA 1UTQA 3O8DA 4INLA 4IBLH 1O3HA 4UFFH 1HNEE 2PGBB 1QURH 1S0RA 2A4QA 4RN6A 2ZTYA 4I32A 1XVOA 8KME2 3SNAA 3RXHA 1O2NA 1DE7H 4GSOA 2SGAA 4X2VA 1BRUP 1LKBA 2ZGXH 1YCPM 4NA9H 1HAHH 1LPKB 4A7IB 2I6SA 3SU1A 3KEEA 3GY8A 1SGCA 1BIOA 3RMMH 4BTTB 3MYWA 1D9IA 2FPZA 3BTQE 1OXGA 2FYRA 2OBQA 1KMHB 1V2QT 1H9LB 1C5TA 3QGNB 1O3CA 1F0SA 1TPAE 4O3TA 3SV7A 4ABFA 2HNTC 3FO8D 4MVNA 3T27A 1IHSH 2H1UA 3TPIZ 1H4WA 4Q7ZA 3T5FH 2G8TA 2DUCA 2WPDD 1TGTA 3RXTA 3MU0A 5A2MH 3P95A 1D3DB 4UFDH 4WH6A 2BLOA 4HG6A 3MO3A 1A61H 1FY1A 3Q77A 1UVUH 4ZKRU 2A5AA 1VCWA 1S0QA 3QZQA 2OQUA 1EFRD 2WINI 4ZKNU 1Y3UA 4NZQA 1YPHC 5I46H 4NGAH 1SGTA 5FPSA 1WUNH 4DURA 4B2CA 1BT7A 1AFEH 1UTPA 3K6ZA 4FU7A 2F9UA 5GCHG 1TE0A 1C1VH 1O2SA 5T1VA 3URCA 2QAAA 1CVWH 3UOUA 1XUFA 1O2PA 1XKAC 1ZPCA 3T2NA 3PM3A 4IC5A 3FN8A 1KXBA 2O8MA 5DO4H 4M9FA 4K1SA 4FVBA 4BNRA 3KQDA 1L2EA 3EAJA 3TK9A 3M7QA 1BTUA 2XBXA 1AZZA 2CMYA 2FOHA 4AYVB 2QY0B 2XXLA 2FI3E 2IPQX 4Y6DA 1A1RA 1FAKH 1TNIA 1V2UT 2JJ1D 3ENSB 2SGDE 1NFXA 4NIXA 3K2UA 1GBEA 4D7GA 1MBQA 2GT7A 2R2MB 1FY3A 5ESTE 3V12A 4K60A 4I33A 4GUXA 8LPRA 2ZFRH 1CT4E 1C4U2 3H09A 3U1JB 1LHDH 1SKYE 5LPFA 2PTCE 3SU2A 1H8DH 3ZVAA 1O2OA 2NWNA 4UONA 1VITG 3DD2H 1BMFD 1GHBG 2FLRH 3HKJB 3ZZ6A 3M7UA 4CRAA 3UUZA 3UREA 1SG8B 1WCZA 4D9QA 2XC5A 3E90B 1IQGA 4X6NA 1ZRKA 2FEQH 2ZGCA 5JBAS 4JZDH 2OUAA 2O8UA 2Y7ZA
chains in the Genus database with same CATH topology
4OGXA 1ELBA 4O03A 1LKAA 1AVGH 4MNYA 2OINA 4CBNA 3VFEA 4ESTE 1FXYA 2PSYA 5EPNA 3E3TA 1S82A 1HAVB 1V2TT 1UVTH 3QUMP 5EG4A 1DY8A 3LH3A 5AF9H 1A5GH 1P0SH 3M5MA 1W8BH 1F2SE 1SGFA 3PO1C 1OYTH 2NU1E 3A7XA 2SNVA 3STIA 2C90B 3QO6A 5EGMA 1C2EA 4NIWA 2O8WA 1MUEB 1LTOA 4KKDA 4YT6H 1J8AA 1AWHB 2ZQ2A 1D4PB 1SLWB 3HPTB 1HAGE 1P04A 1S84A 2GZ8A 1MTVA 1C9PA 3LC5A 3RC4A 2BDBA 1BMAA 2VWMA 2A2QH 2Z3DA 1G2MA 1J17T 3KCGH 1WBGB 3E1XB 1NRPH 2VWNA 4GAWA 1XUIA 1DXPA 4AOQA 3ATIA 1GMHG 5L2YH 1C1RA 2D1JA 1DDJA 2P3UB 2ZU1A 2CF8H 5FPYA 3PYHA 1GCDA 1VJ9U 3RXIA 1HAVA 2FX4A 2THFB 3W95A 1FUJA 5EXLA 1MMJN 1E36B 1YPEH 2AYWA 2F9NA 1AFQB 1OOKB 3Q00A 4CHAB 3ZZ3A 1CGJE 1WOFA 2HRVA 3ZZBA 4X1NU 4U01A 1K9OE 3UY9A 4A1VA 2F9OA 1PPCE 1IQFA 1RD3B 2B8OH 2BX3A 4Y7BA 1BHXF 3RXPA 1AQ7A 3SU5A 1ZTKA 1S5SA 3U8OH 3A80A 1YYY1 2ALPA 1OSSA 4A6LA 1HAYB 4AG1A 3B23B 1V2WT 1MTNB 4YLUA 4JMYA 1SGYE 3A85A 1AB9C 2BMGB 2CN0H 4NCYA 3I77A 3L3TA 5EOKA 3S69A 1NFWA 1EQ9A 2OTVA 2LNCA 2G5VA 3R0FA 1EB1H 1BBRH 2PKSB 1GWAA 1EJMA 1BQYA 1D3TB 1LPZB 1O2UA 1XXFA 3V0XA 4LK4A 2FTMA 3OYPA 2ZPRA 4ISHH 1SQTA 3GY2A 2FXRA 4K8BA 4UD9H 1SI5H 3BTHE 1TMTH 1QQ4A 2PW8H 5EU8A 1VR1H 2ZKSA 3CS0A 1KLTA 3QDZB 1ZSKA 3MU8A 1TNHA 5DK1A 4TWYA 3P8OA 2BD3A 5L2ZH 1O33A 2G52A 1N6XA 3BTME 2GMTB 3T62A 1Z8JB 1INCA 4OS4A 2ZQ1A 2O8LA 3PV4A 2FI4E 3GDVA 3BTTE 1OWJA 1W12U 3QWCH 1BBRK 1DS2E 2GTBA 1BTYA 1JXPA 1O0DH 3ZVGA 1C5ZB 4YLQH 1O35A 1HJ9A 1FY4A 3RXLA 1C1UH 1G3CA 2WUCA 3EGKH 3ZV9A 1C1NA 1C1TA 1GGDC 1N1LA 1GJ5H 4AG2A 2ZP0H 2Z9GA 1F0RA 2BY9X 1GI1A 1ZGVA 2BD2A 1UK4A 4A1TA 4YM9A 2JETB 4HZHA 2ZZUH 2BLWA 1S83A 2PUQH 3CS7A 3QTVH 5EODA 3SGQE 4GCHF 3S7HB 1EJAA 1H9IE 1KLIH 2OC7A 1ABJH 2QA9E 5EW1H 4JZIA 1EPTC 1G3BA 1XM1A 1UCYH 1BDAA 2HVXA 2VVCA 3SNDA 2ZHEH 3MU4A 1EB2A 9LPRA 3RU4E 3RMLH 1MTSA 3BG8A 4K3JA 5HGGA 3SJKA 4FUEA 1GL0E 2R3YA 4IMQA 3RXFA 6CHAB 5EQRA 1PQ7A 3M61U 3P8GA 4ISOA 1GI4A 1VGCC 1S6FA 5FHTA 1NRQH 1P2KA 2UWLA 2ZGBH 2Q1JA 2RCEA 1O2QA 4FUHA 4WXVA 2H2ZA 1GI6A 3ATWA 4WWYA 1TALA 5FPTA 1T8NA 3SUFA 4ZHLU 1UCYK 4XDEA 1H8IH 1UVSH 1GBKA 2P59A 1DFPA 2PUXB 5ESBA 1GI0A 1XMNB 1N8OC 2ZDNA 4FUCA 3SHAH 2JKHA 3UQVA 2HOBA 2FZZA 5F6MA 2GX4A 2ODYB 4CREA 1ELTA 1B7XB 3ZZCA 2P95A 1YF4A 2B5TB 4PROA 3SJ8A 3V13A 2AMPA 4RKJB 1C5UA 2OLGA 4X1SU 2UWOA 2AMQA 2BVXH 5EXMA 1TRYA 2ZFQH 2SGFE 3EA8A 2C8YB 1JRSA 1NT1A 4TY7A 1CE5A 1SFQB 2CHAB 3MWIU 1O2ZA 5GIBA 4X8VH 1PYTC 3E0NB 1SBWA 1KDQB 5GWZA 1GI9B 1LVMA 2SGEE 2Z7FE 2R0KA 3D23A 4Q80A 2BM2A 1HBTH 2WV5A 1NRRH 1AIXH 1SLUB 1XUKA 3I78A 1B0EA 2BQWB 2A4RA 5K7RA 1J15A 1CGIE 4Q2KA 2NU2E 1LCYA 1IQKA 1HJ8A 3MNCA 1G32B 3Q3XA 1AVXA 1ZTJA 1P9UA 4DW2U 1T4UH 3SOSA 3EA7A 1PPHE 2C8ZB 2SGPE 1N6YA 1QJ1B 4AFZA 1G9IE 1K1JA 4AFUA 4K69A 1C5MD 5C1UA 1TBRH 4U2WA 3GY4A 1TGSZ 1O3DA 2BQ7B 2ZDMA 3DA9B 3FAOA 4YTAA 1KXEA 3STJA 1GJBB 2QC2A 1KY9A 2GDDA 4ZXYH 1FJSA 2ZEBA 4GLYA 3QTOH 1HJAB 2Q6FA 2UUYA 4Z6AH 4J1YA 3BTWE 3GY7A 4RKOB 2FOCA 1S85A 3PLKA 1Z1JA 1TNLA 1GDUA 1GHXH 4GCHG 2EI6A 3HGPA 1HRTH 3DFLA 4ZMAH 2W3IA 1MAYA 3GCTF 3AAVA 4XSKU 2ZFPH 1EZXC 2P3FH 4KP0A 4X8TH 2Y5HA 5DP4A 5DP6A 2AERH 1Y3VA 3EA9A 3M36A 3RXDA 2BQ6B 1ETRH 4CH2B 2WYJA 1C1PA 3A87A 7KMEH 4ABIA 1OWKA 1IOEA 1QBNA 3GYLB 1GJCB 2ULLA 1W2KH 2AS9A 2ZTXA 2ZFFH 1GHYH 1TOCB 1K2I1 4TPYA 1O2MA 2Z9JA 2P8OB 3LPRA 4R8TB 4AN7A 3LONA 3VB5A 1DWCH 1V2VT 3FZDA 1YM0A 2OC8A 1UK2A 4JYUH 2XWAA 1A0LA 1V2MT 1OWIA 1QR3E 3SW2B 5F8TA 3PMJA 2FOMB 1F0UA 1ANEA 1UO6A 3HK6B 2NU0E 5CHAB 4FUGA 4ZXXH 1HLTH 1SHYA 2XCNA 1A3BH 2VIDA 2BXUH 3RU4D 1ELFA 4MG3A 6GCHG 3E91A 3A82A 5C1YA 1GBLA 2BD8A 4NA7A 3S9AA 1P2OA 3P92A 1SMFE 3SBKA 2VGCC 3UQOA 1C9TA 1TLDA 4B75A 1SGQE 1HCGA 1JBUH 3VB3A 1DSTA 1EAWA 3RXKA 5ETXA 1NO9H 1V2LT 5G4BA 1Y5AT 3F9EA 3QK1A 1RGQA 3RXJA 1ZPBA 3RLYH 1AFQC 1O3FA 4YO9A 1BTWA 1FZZA 1IQJA 1BZXE 4X8SH 1O3LA 5E8EH 4KTUA 3SJOA 2W3KA 1ZSJA 3GICB 4WF8A 4DIIH 1RRKA 1SLVB 3TLOA 1CA0C 1V2PT 7LPRA 3ITIA 2Z6BD 5FCRA 1UTLM 1TRMA 3PROA 4K1EA 2FX6A 5I25A 1JOUB 1UVOA 2J92A 1WTHD 1DUEA 4K5ZA 4XBDA 2ZCLP 2QXGA 3SJ9A 4AGKA 2ZWLH 3A89A 2UUKB 4X6OA 3QLPH 4X1PU 2ZGJA 4WJG2 5A09A 1W13U 1HUTH 1TWXB 1E35B 2VIWA 3MO6A 3S7KB 2ZHQH 3P70B 2ALVA 1O2JA 3ZZAA 1GMHF 2FYQA 4HTCH 1GI2A 3TK5A 2PFEA 1QIXB 3TH2H 3A88A 4OS2A 2PTNA 3UPEA 3EDXB 3MHWU 1MKXH 4E06H 3P8NA 5CE1A 2XC0A 1CGHA 5GPIB 5AHGH 1KXFA 5GDSH 1UTNA 1O2XA 1SQOA 2EA3A 3H5CB 1ZPZA 4JZFH 3RXUA 4JCNA 3GCTG 2ZDVH 4WXIA 1T8OA 2H9TH 3SJIA 1HYLA 4OS6A 1HXEH 4X6PA 3LGUA 2TGDA 1K22H 5E2PA 3BSQA 2EI7A 3SN8A 4BXWA 3BF6H 1LVBA 1MKWH 1W7XH 3SGBE 1LDTT 5DGJA 1SPJA 1ZMLA 1QBOA 1MKXK 1V3XA 3LJOA 2A45B 1FV9A 4WVPE 3BTEE 3AAUA 1GI7B 4TY6A 2OXSA 3TH4H 1HIAB 1W3CA 3VPKA 3PMHB 2Y80A 2BY8X 3RMNH 3LU9B 1UMAH 3BTKE 1O3IA 1NTPA 2RDLA 5DKMA 4H6SB 3GOVB 4FUJA 1EOJA 5L6NH 3NCLA 1B5GH 2ZPQA 5DJ7A 3MNSA 1GI3A 2ZG0H 4X1RU 4ISNA 3SV8A 1SGPE 1GHAF 1MBMA 1MKWK 4I8LA 1VJAU 4VGCB 3LT3A 2QF0A 2QF3A 4CRGA 3FP8E 4FUIA 2ZHWH 1KIGH 1DLEA 1G37A 3VXFH 2I6QA 3RXOA 2GZ9A 1O3JA 1QGFA 3OX7U 1TMBH 1T32A 4WMEA 4X6MA 3SV9A 1NU9A 1UTMA 1SSXA 2BDCA 2HNTE 1K1MA 2ZCKP 4WH8A 2J9NA 1CQQA 2ZTZA 1GCTB 1AWFH 5JDUB 4GPGA 4YESB 1Y5UT 1GDNA 2VH6A 1KTSB 1G36A 1C5RA 1EUFA 1Z7KA 2PLXA 2OC1A 3BEFB 2A7HA 2GV7A 1THSH 3EE0B 3SQHE 1HIAA 3R3GB 1QB1A 2DE9A 3H7OA 2O8TA 3ATKA 1Z8GA 2BDIA 1U6QA 3OU0A 1EP5A 1YPHE 3RM0H 1T7CA 1HB0B 4LXBH 1AMHA 1A0HB 2VNTA 3LGVA 1UK3A 5FBEA 4YOJA 1L1JA 3BV9B 3SQEE 3DHKH 2SFAA 4B1TA 3MH5A 1P9SA 2WPJS 3RM2H 1ZYOA 3OY6U 1HAOH 4CRDA 1SQAA 3A81A 1Y3YA 3M3TA 2EI8A 1QRWA 1C4Y2 2PR3A 3QX5H 1O3MA 3UTUH 3KQEA 1FMGA 2WPIS 2AFQB 3CENA 3LC3A 1XKBC 3TVJB 1OPHB 2ANMH 5HXFA 4GHQA 2J4IA 1C2GA 2FO9A 1XX9A 3GDSA 1MQ6A 4I31A 3SORA 2ZFTA 1Z8IB 1C2FA 2Z3CA 3SU3A 3A84A 4NFEA 3T28A 1Q3XA 3AVZA 2Z9LA 3VGCC 5ABWA 1YC0A 2J34A 1OP0A 3MU1A 1BA8B 3OTJE 1TQ7B 1NPMA 1EASA 4XBBA 1FQ3A 2V6NA 1BCUH 1BRCE 2KAIB 1HFDA 1WAYB 1RIWC 2ILNA 2XTTB 2BVSH 4LZ1H 3O8CA 3EYDA 4GHTA 2AGIX 2D2DA 3O8RA 3GCHC 1TAWA 1HAIH 2P94A 3HKIB 1EAIA 3T26A 1PQ5A 2A4OA 3P8FA 4BOHA 2FODA 4CRFA 2VIOA 3QN7A 2ZHDA 2VINA 3M5NA 1GMCF 5AFZH 4B2BA 3GY5A 4K1TA 1LHGH 1A5HA 1HDTH 1O3NA 2VVUA 1CT2E 1IQIA 2YOLA 5TCCA 1GHAG 5FX6A 1F92A 4U30A 2JH0D 2GGVB 3Q3YA 4JZ1A 4DOQA 3ZVDA 4OS1A 3TK6A 3K9XB 5FXLA 3S0NA 1GG6C 2A32A 1BB0B 2V0BA 3NK8A 2Y82A 4LZ4B 3F68H 3PMBB 3GYMA 1MU8B 1DX5M 4JYVH 5JB8S 2KAIA 2C8XB 4O9VA 2P8OC 1DXWA 1D3QB 2FESH 4IMZA 2OC0A 3UNSA 1A0JA 1TPPA 2HPQH 1C2LA 1TOMH 2P93A 6LPRA 3UR6A 1ID5H 1P2NA 3BG4C 4BTUB 5LPRA 1TRNA 3A8CA 3WY8A 3F6UH 3RP2A 3SZNA 1ELEE 4Y79A 1NS3A 2V35A 3H7TA 1LHEH 3SU4A 2B0FA 4DIHH 1IQEA 2GD4B 1VCQA 1O3EA 1QA7A 4BXSA 3OY5U 2G4UA 1ORFA 4INHA 2HLCA 5HM2A 2G81E 5C3NA 1Y8TA 2VIPA 2WPLS 1GBDA 4B2AA 1BITA 1TMUH 1UHBB 1PFXC 1KSNA 2QXHA 1Y59T 3RU4T 1GI8B 4INKA 2ZF0H 4JYTA 1G3DA 1XVMA 1OP2A 1V2KT 1ANBA 2ZC9H 1CBWB 1DWBH 3UNQA 1GI5A 2W26A 1TQ0B 2B9LA 1O37A 1GBTA 1J9CH 2G51A 3FFGA 2G55A 2IJOB 3D49H 4AYYB 1PQ8A 2AEIH 4ZKSU 1EAXA 4HGCA 1QL9A 1AUJA 2VIVA 3PMAB 3MH4A 5SGAE 2FI5E 1NRSH 1AD8H 1XUGA 1OWHA 5LGOA 2FTLE 1GBBA 3MFJA 3SNEA 2EC9H 3GISB 1DWEH 3RXBA 1MTWA 3ODFA 2A0QB 3MH6A 1O5GH 4BAKB 5C5OA 2Y81A 2CV3A 1TONA 2OQ5A 1C5VA 3V7TA 5A8XA 6GCHF 2DE8A 4SGAE 1O2IA 1UHBA 1NY22 2LPRA 1LHCH 1C5QA 5LPEA 1B0FA 1BRBE 1VZQH 5DP8A 1ESBA 1L4ZA 1XXDA 4MTBA 4E05H 5FAHA 3PO1B 2OD3B 3VXEH 2P16A 3K6YA 4OS5A 3LIWA 2Y5GA 2XRCA 3BN9A 1PJPA 1O2KA 2AH4X 3E0PB 1C2JA 1BUIA 3V3MA 1GMCG 4Y76A 1W14U 1LPGB 3GY6A 1HXFH 4CRCA 4AGJA 1K1OA 1QTFA 3KQBA 1EZSC 1O3BA 1O3PB 2ZHFH 4BAHB 4ZAEA 4ISLA 2TGAA 2GCTB 4H42U 3LGWA 4HFPB 4J2YB 2WUBA 4SGBE 2BDAA 2CF9H 4Y0ZE 2PHBA 2G4TA 1P10A 2ZPSA 3RXAA 1QCPA 3TNTA 1KLJH 1Q31A 1QY6A 2RG3A 3EQ0H 2ZO3H 1UVPA 1W7GH 3E6PH 1TPOA 3NZIA 2GVFA 4ABDA 3PWCA 3HATH 3IG6B 4I8GA 3U8TH 1IQLA 1C5WB 1F5LA 2GZ7A 2R9PA 1JIRA 1AUTC 4QT8C 3PLBA 4FVDA 5C5NA 1ESTA 3D62A 5DP7A 2Q6DA 2Y7XA 1WTGH 2VU8E 5E0GA 1DOJA 5EQQA 2PKAA 1RS0A 2XBWA 1W0YH 2A31A 2PSXA 2GV6A 1IAUA 1QBVH 3SUEA 3SU6A 2ANKH 2XW9A 3PLPA 4MQAA 5FX5A 2K1QA 4MNXA 1ZMJA 2XBVA 1J14A 3MNXA 1BBRE 1HV7A