2F9VA

Hcv ns3 protease domain with ns4a peptide and a ketoamide inhibitor with p1 and p2 cyclopropylalannines
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
183
structure length
183
Chain Sequence
MGAPITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords NS3 protease/helicase
publication title Depeptidization efforts on P3-P2 a-ketoamide inhibitors of HCV NS3-4A serine protease: Effect on HCV replicon activity.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 43
structure length 183
sequence length 183
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2f9vA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2f9vA01
2QF0A 3GY7A 2FOHA 1GCTB 2V6NA 3RMMH 1AVXA 3TGKE 3PV2A 1ZJDA 1MKWH 3P70B 1INCA 1SGQE 1TNLA 3D49H 5A0CA 4U01A 3BTME 1GCTC 2BZ6H 1EB1H 4B1TA 1YC0A 2DE8A 4ISHH 4CRCA 3C1KA 2FXRA 4OS5A 1PJPA 5EXLA 1TYNA 2ZPSA 3FANA 1ZMNA 1H9LB 1TPPA 3M5NA 3W94A 1Z8JB 2BZAA 1GMCG 1BTPA 1G3BA 1V6DA 4H42U 1B0EA 3SORA 4AYVB 2BQWB 5FPYA 1XXFA 4JZDH 1UVTH 1Z6EA 1FV9A 1WSSH 1SB1H 3RXQA 1HIAB 5SGAE 4NZQA 1G2MA 1SGIB 4DG4A 4DIIH 4XBBA 1VITG 1Y3WA 3QGJA 1G32B 3SU1A 2BDIA 2ZHEH 1O30A 1F0UA 1QQUA 1SG8B 4ZXYH 1AE8H 3ZV8A 1YLDA 1UTMA 2VIOA 1ELCA 1PQ5A 1P02A 3M3VA 3ENSB 4GVUA 4B2AA 1N8OC 2H2ZA 1FQ3A 2AGGX 2VINA 1W7XH 3RXFA 1GMHG 3KEEA 4MPVA 2HLCA 2FLRH 2W5EA 4BTIB 1S83A 1EXFA 3G01A 5GIBA 1KXDA 5BPEA 2G8TA 2VIWA 5LPFA 3M7TA 1MD8A 3KIDU 3TVJB 3UY9A 1YCPH 1HDTH 2BMGB 2SNWA 5GDSH 2VNTA 4YTAA 1MKXH 4MNYA 5EXNA 4DIHH 1MCVA 4ZMAH 1C1RA 4KTCA 2ZU1A 2ZC9H 1ARBA 4JK5A 3SI4H 1J14A 4AG1A 3BV9B 1ELEE 2F4LA 3OU0A 1UK2A 2OCVB 3BTHE 2LPRA 1BDAA 3V13A 2A5KA 1TOMH 4M7GA 1K21H 1MTUA 1GVLA 1HYLA 3A7YA 3GDUA 1GJAB 4AB9A 4IGDA 1MUEB 3EYDA 3SHAH 2FO9A 1ABIH 1XKAC 1GHAG 1QB1A 3OX7U 1C1MA 1QFKH 1HLTH 1XKBC 3IWMA 3LGYA 3TK5A 2F3CE 4RKJB 3U8OH 2A5IA 3M35A 1V2OT 2ZFTA 5E0GA 2AIQA 2BDCA 2FYQA 1B7XB 4XE4A 1VR1H 1UVSH 1YPLH 1Z1JA 2Y5FA 3RXVA 2J38A 3A89A 2KAIB 2A4QA 4NA7A 3SU4A 4E7RG 1GBFA 1NRRH 1O5EH 3GY5A 3TGJE 2UWOA 1TFXA 1O3CA 4Y7AA 4DT7B 1O3NA 2BY6X 1P05A 4FXGH 1GHBG 1ZPZA 1MH0A 3VXFH 3VB7A 4FUEA 3LC5A 1O2YA 5PTPA 5BRRE 1G36A 3PO1B 2YNAA 1AQ7A 1SLXB 4X8SH 3SJOA 1SPJA 1P57B 1AY6H 1DSUA 2FS8A 4XSKU 5B6LA 3JZ1B 2AYWA 3PO1C 1IAUA 3B23B 5TCCA 3TNSA 1HAHH 2BY9X 4WVPE 3A81A 3SJ9A 1THRH 1W10U 2EI7A 1WV7H 1LHFH 2VGCB 3SNCA 1SQAA 1TA2A 4JZFH 1TMUH 4F49A 1DM4B 1XM1A 1V2NT 1VITH 2VGCC 1AVWA 3PV4A 5DO4H 1QNJA 1FUJA 5ESTE 5CMXH 1K2I1 1MKWK 4X8VH 4IC6A 1TIOA 1O36A 2M5TA 2F9PA 2FODA 3GCTG 1TBQH 4X2YA 1C1TA 2O8UA 3SUFA 1ELGA 1IQNA 2VWOA 1GMDF 1LVMA 3P8GA 4D9RA 5FPSA 1YPJH 2ZQ2A 4X1RU 4FVBA 4A92A 5E2PA 3MU8A 1WBGB 1BTZA 1UCYE 5T6FA 1BZXE 3UNRA 2PGBB 3QDZB 4YT6H 2XBVA 1UTOA 1MD7A 1NESE 1M9UA 3UQVA 2R3UA 1XUKA 2ESTE 2OQUA 3A84A 2SFAA 4ABAA 1QTFA 1ZR0A 4SGBE 2OTVA 1C5PA 1AKSA 3DD2H 1O0DH 4ZHLU 1NC6A 4X6MA 2FLBH 1GBDA 1O2SA 2JH6D 3GY8A 1C1UH 1DDJA 3BTKE 3F68H 2ZQ1A 1HAGE 2ZFPH 1GBIA 3RLWH 1ELTA 1HXEH 8GCHG 3U8TH 2ZP0H 4AYYB 2CN0H 1IQGA 5FHTA 1KLTA 1TRNA 2XC4A 1GHZA 3T25A 1HJAB 1GBEA 3VGCC 3TJOA 5AVDA 1ZZZA 4NIXA 3RXTA 1G9IE 5DG6A 3HKJB 3K65B 1HJAC 2EC9H 1RRKA 4OS4A 2HNTC 2FI3E 1C1NA 2FDAA 4O9VA 4B6FA 1DUAA 1YCPK 1MKXK 1GVKB 3KN2A 3MH5A 4NFEA 4MTBA 4X1SU 4AFUA 2IN2A 1CA0B 3ITIA 3KQDA 3SJKA 1O3JA 1TX8A 7LPRA 2J94A 2JKHA 1T8MA 2TGDA 2BD3A 1MQ5A 1ZMLA 1WOFA 2FOEA 2XCFA 4Y6DA 4XDEA 1SGYE 2FTLE 1Z8RA 1SSXA 1BRCE 1V2WT 1ZSLA 1VCWA 2AMDA 3ZZ8A 2BDYA 3RC5A 1ZPBA 5CHAB 1BTXA 1EAWA 1V2PT 2OBOA 4I8GA 5C3NA 1SL3A 4FUHA 1KXFA 1OWIA 3DFJA 4UFFH 1TPSA 2AGIX 2ZZUH 1TALA 2NU4E 1G3EA 4Y0ZE 1XVOA 1T31A 1PPHE 2P94A 2ZF0H 3ATIA 3ZZ7A 5JBTA 5DP8A 2J4IA 3DUXH 1SGFA 3V0XA 1ZTKA 3BEUA 1RS0A 3UREA 4X0WU 3S9AA 1QA7A 3W95A 1DICA 2NU1E 3EA9A 1P8VC 3EDXB 3A8DA 3SO3A 1ESTA 4QT8C 3EGKH 2ZA5A 4X6PA 3V12A 1ZHRA 4WXVA 2F91A 2J95A 4YT7H 2ZU2A 2GV6A 3MO9A 1CGJE 3A88A 3RXDA 1O2HA 4B6EA 1C5MD 1ETSH 1P03A 4JMYA 3LGUA 1PPFE 3MO6A 5E2OA 1GHVH 5A8XA 4XBDA 1EP5A 2OLGA 1AUJA 1L2EA 1NT1A 2TRMA 2BVRH 8KME2 3S9BA 2LNCA 1MAXA 1SMFE 1FDPA 5I46H 4MDSA 1GJ9B 3PMJA 3RXHA 1X7AC 3ZV9A 5F8XA 4AFQA 2P3UB 2ZU3A 2P3TB 3NZIA 3T27A 1CQQA 3OY6U 1NFYA 4A1VA 5DP3A 4FUDA 4ZKSU 1S5SA 1C2KA 3R3GB 2FYRA 2BD7A 3FZZA 3P17H 2UUYA 1WXRA 3NUMA 1K28D 1NU9A 1TBRH 1V2KT 1O34A 3UR9A 1MZDA 3PB1E 3PTNA 4CHAC 5T1VA 4X2VA 1G3CA 2ZGBH 1NTPA 1O32A 4KGAA 2Z3DA 1ZHMA 2BQ6B 4Q2KA 3SNDA 3ZYEA 1PPCE 3MU1A 2OP9A 5A8YA 1SFQB 1C5YB 1P2NA 1P2QA 3SU3A 1K9OE 4BAHB 1EJAA 3TH2H 1F5LA 4X6OA 1DX5M 1SGRE 2GT7A 1IQEA 1QRZA 2SGEE 4E06H 4IC5A 1O3GA 1OOKB 1CHGA 4YOIA 2QXHA 5A09A 4K3JA 1EJMA 4WXIA 1O35A 5DJ7A 3KF2A 1TQ0B 2ANYA 2CF9H 1D4PB 1JOUB 3D62A 3GY2A 4GCHF 2GD4B 3RC4A 1GMCF 1WQVH 3P6ZB 2G51A 4GUXA 3A80A 1GBBA 1JRSA 1UTPA 1YCPM 2GX4A 1ELFA 1EKBB 1NROH 2Z9KA 4MPUA 1C1PA 2FMJA 5JBBS 4JCNA 2BX3A 1HAVA 1Q31A 1GBAA 4TWYA 1HAZB 1O3FA 3ATWA 2BXUH 5F8TA 3SUDA 1FIWA 1O2LA 2PKSC 3UWJH 3SGQE 4Q7YA 3TK6A 3RXPA 1MTNB 2H9EH 1KTTB 1QQ4A 2G5VA 1VITF 2AGEX 5EPNA 1O2QA 5H4IB 1GBTA 2TBSA 1MTNC 4AGKA 4X2XA 3PLBA 3SHCH 1SFIA 2QN5T 4ZAEA 4X1QU 9ESTA 1NRNH 4H6TA 2C8XB 3LKWA 1SR5C 1AU8A 4AORA 3TU7H 1GWAA 3SGBE 1GGDB 1SHYA 4HI3A 4OS1A 2F83A 4OS2A 1HAIH 1SOTA 4YOJA 4UONA 2FPZA 2VB0A 1P09A 1C5LH 1O3BA 2A1DB 4X8TH 1SOZA 4B76A 1O38A 1W8BH 4YM9A 1O2RA 2DE9A 1A5GH 1AVGH 1ZSJA 1GGDC 4YLUA 1JIMA 1O2XA 1EZXC 4NSYA 1LHCH 1MTVA 2FWWA 1ETRH 4CR5A 1PFXC 1BJVA 2XTTB 1FY1A 3E91A 1GDNA 1MU6B 1IHSH 1PQAA 1UJ1A 4LXBH 4BTTB 5L2ZH 1QJ1B 4OS7A 2BY7X 4YZUA 2QF3A 1D3PB 1ANCA 1ESAA 5IDKA 1A46H 1OS8A 1TWXB 2ZG0H 3LT3A 4I7YH 3Q3KA 5I25A 3SU6A 1O3PB 1O5AB 4AG2A 1DWEH 2Y5GA 2V35A 3MO3A 1JMOH 2ZDKA 1FPCH 1C9PA 1HUTH 3LH3A 1QURH 4THNH 1Y59T 5FCRA 4Z6AH 1OYTH 1ZRBA 1P2OA 1BRBE 1H9IE 1AKSB 2AH4X 1ABJH 1QHRB 5FBIA 2BY8X 4FUJA 1AUTC 2GV7A 2BDHA 2TIOA 2VVUA 4HZHA 1W2KH 1GHXH 2H5DA 2QAAA 3GISB 1GBLA 1BBRH 1QRWA 3K9XB 3LGWA 3M7QA 4A1XA 3HGPA 1LQDB 3SV7A 2A4RA 1ELAA 5K7RA 2BD2A 2I6SA 2W3IA 1G37A 1C2EA 1GI2A 1ANDA 4JZIA 1Z7KA 2Y6TA 3ATLA 1AMHA 1OWKA 2OQ5A 1CSOE 5L2YH 1GJ8B 2EA3A 1GDQA 3O8CA 1QRXA 1LDTT 4BNRA 7ESTE 3MNCA 5T6DA 2CMYA 4NA8A 2QIQA 1HJ8A 3ZVEA 1S0RA 2Z6BD 1C1OA 4GHTA 1GPZA 5EGMA 4AFSA 1ELBA 3ZVDA 1O2IA 1GBHA 2GMTB 1O5DH 3SJIA 1EOJA 1WU1A 1IQLA 2HNTF 1CE5A 2FIRH 1ELVA 1QCPA 1TNGA 2AMQA 1CHOF 4BTUB 1UK4A 2GMTC 1XUHA 4ZUHA 3PLPA 5T6GA 3ZVGA 1L1NA 1C5ZB 3PMHB 4PROA 1V2LT 1PPGE 4J2YB 1F5RA 1F0SA 1LHDH 1N8OB 3L33A 3L6PA 4MNWA 1P2IA 3A8CA 3Q3XA 5JB9S 2XBXA 1CT4E 2FOAA 4ZXXH 1FNIA 3RXEA 1GL0E 2O8LA 1KDQA 3LPRA 1N6YA 2RA3A 1AFQB 2IOTA 2PSYA 1O39A 3E0PB 1KXAA 2NU3E 2AERH 1TNJA 1L0ZA 1F7ZA 1S81A 4D9QA 1P10A 1AFQC 3M5MA 3E0NB 3JZ2B 2HOBA 3VFEA 1YPHE 3RXUA 1EUFA 1SC8U 1SVPA 2Q1JA 4UEHH 5C1UA 3PWBA 1AZZA 1N1LA 1TRYA 3GY3A 1C2GA 1RIWB 3BEFB 4GPGA 1V2JT 3A8AA 4INLA 4NZLA 1TMTH 1F2SE 3MU0A 2ODYB 5DGJA 1RIWC 1Z71A 4CREA 1YYY1 1E37B 1HJ9A 1SBWA 2BD9A 1TRMA 2F9BH 1QA0A 3A7WA 2XC0A 2G4UA 5HM9A 5CE1A 2QXIA 2PTNA 1TE0A 4TPIZ 1BTUA 1DS2E 3ZVBA 1OKXA 1LKAA 2QGRA 2Y7XA 4WY3A 1O2TA 3SZNA 2RG3A 1AB9B 2EI8A 2O9QA 1EAXA 2UUFB 3I78A 1C2FA 1VZQH 2ZU5A 1AN1E 1V2VT 3E6PH 3SW2B 1WTGH 1UVOA 2VIVA 3F9EA 2H9TH 1AB9C 3PMBB 3RC6A 1EJNA 1KLIH 4MLFB 1Y3VA 3STJA 4CR9A 3E8LA 3QTVH 1FY8E 1Z1IA 2ANWA 1HNEE 4Q80A 2H6MA 3S7KB 2C4FH 3RUOA 1P2KA 3RU4T 5A0AE 1OP0A 1OWDA 5LH8A 2J92A 5F8ZA 1G30B 4ISIH 4WH6A 2ZDNA 1Z8GA 3EAJA 2B9LA 1L4ZA 1ZRKA 5GJ4B 3PM3A 2SGPE 1O3AA 1KTSB 2ZFFH 1C2DA 2FM2A 1GI1A 1KSNA 1K1MA 2Y81A 1DITH 1S0QA 2A4GA 2Z9JA 1TMBH 4MPXA 2ZGXH 1H8IH 1HCGA 4KTSA 4MPWA 4OM9A 2BDGA 4AOQA 2K1QA 4MNVA 3A85A 5L30H 1S85A 3NKKA 4XBCA 4UD9H 5HMAA 3L3TA 1BT7A 1L4DA 1PPEE 3UPEA 6LPRA 1EB2A 2PKAA 3RXKA 1D3DB 1O3OA 2PSXA 3SOSA 1OYQA 1Z8IB 4IMQA 3URDA 4RI0A 1XUJA 1YGCH 1O3KA 1BBRK 1QIXB 1TGBA 1UO6A 3SN8A 1TLDA 1HAVB 1WUNH 5EQQA 3Q00A 1F5KU 3S9CA 1Y5UT 1O33A 4NIVA 2HALA 3T5FH 1V2ST 1SLVB 4NCYA 3KL6A 4X2WA 3ZVAA 1BHXB 3PV5A 3LOXA 2BQ7B 2H9HA 3AAVA 4X8UH 1P04A 4Y0YE 2XWAA 2BYAX 1P06A 2F9VA 3MFJA 2G81E 2PTCE 3FZDA 5T3HA 4OGYA 1QR3E 1QB6A 2BLOA 3PTBA 2VU8E 4K1TA 3PWCA 1DSTA 1ZYOA 2BDAA 2WINI 3AW1A 1J9CH 3GCOA 2A2XH 3GDVA 1GL1A 1YPEH 1GJCB 2G00A 2ZDAH 3ZZ6A 1O3EA 1MU8B 1P12E 2OC1A 3RU4D 3KGPA 4X6NA 3AASA 2FOCA 4UFEH 1A61H 5E0JA 3GY6A 3TK9A 3VGCB 1CBWC 4JYVH 3QWCH 5EXMA 1YF4A 3M5LA 5IYTA 1A0LA 2HPQH 3B9FH 2QA9E 1OWJA 2W3KA 3LIWA 2B0FA 2ZKSA 3S69A 2VWNA 3ZVFA 3LJOA 1B0FA 3UQOA 3NWUA 4TY6A 5GCHF 1JRTA 2F9NA 2OD3B 1UHBA 1MBMA 1ZOMA 4BAKB 2BOKA 4JYTA 3SUEA 3MNSA 4A5TS 3S7HB 1XMNB 1O37A 3UNSA 1ZSKA 1O2KA 1HGTH 1KLJH 1P9UA 2FOFA 4CH8B 2H5CA 1L1JA 2XCNA 3RXJA 1QBOA 4Y8XA 3ZZ3A 1K1IA 1SGCA 4B74A 4DURA 4BXWA 3TNTA 2CHAB 1E0FD 3A7ZA 1LO6A 2WPIS 1H8DH 3H7TA 2OK5A 2B5TB 5HXFA 1VJAU 2CHAC 3Q3YA 2UUJB 4KKDA 3RM0H 4IN2A 1ZGVA 3MTYA 4ISNA 4HTCH 1C5NH 4ABEA 2BDBA 2QY0B 4FUFA 3TH4H 2J2UA 2NU0E 4LZ4B 1FONA 1C5VA 9LPRA 2GZ9A 3H09A 1ORFA 3ZZAA 2Y5HA 4RKOB 3PYHA 5AFZH 3T26A 2C90B 4Y8YA 3PMAB 3U8RH 2HVXA 3S0NA 1PQ7A 1XVMA 1MTSA 3ZZBA 2J34A 2AIPA 5JYIA 2FESH 1HPGA 3UTUH 2G52A 1FXYA 3V3MA 4NWKA 3M3SA 2GCHF 4K1SA 5A0BA 3M3TA 2SGDE 1SQTA 4JZ1A 1VGCB 3GYLB 4NIYA 2GCTC 3CENA 1QB9A 2C8YB 1DXWA 2W26A 3BF6H 1RTLA 3GDSA 2OUAA 1VGCC 2AFQB 2TGAA 1KXBA 2WPJS 1MZAA 5LPRA 1D9IA 1ZGIA 7GCHF 3ZZCA 1GCDA 4F4OC 4MNXA 2ZU4A 2XW9A 5FX6A 1C9TA 4D7FA 1S82A 2FTMA 4CH2B 3DA9B 2ZI2H 5DK1A 1SLUB 1KDQB 4B75A 1KXEA 6GCHF 2PW8H 1GI8B 2A5AA 4I8HA 1A3EH 8LPRA 2WUCA 1CGHA 1O3LA 2V0BA 5DP6A 2ZFQH 4GSOA 1GJDB 3RMOH 3RXRA 1HXFH 2TPIZ 3MYWA 2WHXA 5JB8S 1A5IA 3R0FA 3A7VA 1QBVH 3KQCA 4I32A 3VB6A 3TITA 4ABHA 4Y76A 4CHAB 4I31A 1FAXA 1UTKA 4HGCA 4K60A 2BLQA 4BANB 3M5OA 4TWWA 1DUEA 3U1JB 3HK6B 4XFQA 3U98H 1VJ9U 3VXEH 1PPZA 1C2HA 3P92A 2ALVA 2JH0D 1RGQA 4A1TA 1C1WH 3IITA 2R0LA 2V3HH 3MH7A 1HAPH 1BRUP 1TPAE 1D3QB 1OWHA 4CRBA 5C67A 2PWXA 3K2UA 5F6MA 3EA7A 4OS6A 5E0HA 1C4U2 5LGOA 4ABGA 4AB8A 2ZHWH 3MH6A 3QX5H 3TJUA 1BMMH 4IS5A 1WTHD 3TH3H 1Y3UA 5AF9H 2ZEBA 5TCAA 1AIXH 2ANKH 1SGTA 2DUCA 1C5XB 2CGAA 2PR3A 2JH5D 2ANMH 2WPHS 2ULLA 1HFDA 1H1BA 4ISOA 1THSH 4WWYA 3URCA 5K0HA 2P8OB 2Q6DA 2THFB 1CGIE 3QK1A 1YKTA 2ZHFH 1BMNH 4Y79A 5EW1H 1RJXB 2PKSB 3HGNA 2ZDLA 1C5OH 2VVCA 2OC7A 2VWLA 4GLYA 2P8OC 3QTOH 3M61U 1KY9A 5C1XA 3A83A 1EOLA 3QUMP 1TGCA 4HFPB 1IQJA 3F6UH 2V3OH 1Q2WA 1OSSA 2Z9IA 1EASA 3SU5A 3RXMA 3BIUH 3VB3A 2VWMA 4IN1A 2YNBA 1NS3A 1SGEE 4K69A 2BVXH 2QYIA 2SGQE 4DW2U 2WV9A 4M9FA 1C5SA 2PKAB 4FU7A 4LOYH 3RXOA 1GMHF 1ZJKA 2NU2E 3D65E 1C2LA 1HAOH 3FFGA 1C5WB 4AX9H 3SYJA 2BY5X 2ZPQA 1KIGH 1J8AA 2W7SA 4D8NA 2IJOB 4R0IA 4Y11E 4CRAA 4BOHA 3O8RA 2C3SA 2IJD1 1O5CB 1EPTC 1THPB 1GJBB 1BTHH 1D6RA 1TNKA 4WJG2 1DFPA 2A32A 2AS9A 2VBCA 1BCUH 1UTLM 1HAYB 5EU8A 5FXLA 1OX1A 2CV3A 1UVUH 2UWPA 2FOBA 4YESB 3MI4A 5C1YA 3K6YA 3M37A 3TIUA 2ODQA 1BHXF 4I33A 1C1SA 1BRAA 1JBUH 1VCPA 4DY7B 1V2MT 4NA9H 4B73A 3H7OA 2WZQA 2WPMS 1GHAF 2BLVA 3CP7A 3SNAA 3E1XB 4X1PU 5EG4A 1UTQA 1GI0A 2GKVE 4ASHA 5LPEA 2XXLA 4BXSA 1YM0A 2CF8H 1KXCA 4DGJA 4WMFA 1GBCA 2VIQA 1GI7B 1T7CA 3UFAA 2G4TA 5DPAA 3ZYDA 3TJVA 1PQ8A 1TB6H 2G5NA 1G2LA 1FI8A 1AO5A 4CBOA 3BG4B 3RXCA 4IW4E 2WYJA 1T4VH 5ABWA 5ESBA 2ZTZA 5AHGH 5EPYA 3BG4C 3UWIA 2R2MB 5A2MH 1IHTH 1UHBB 2QC2A 1DE7H 3I77A 4TYDA 1K1OA 2OC8A 1GHBF 2CJIA 1SHHB 3QO6A 2BHGA 1QY6A 1AI8H 1B5GH 2BM2A 2BX4A 1ETTH 2XYAA 1V2UT 1C4Y2 1Y3YA 1NRSH 3DFLA 2A0QB 2GZ8A 3FAOA 2I6QA 2BD5A 1EQ9A 2PV9B 5GPIB 5C5NA 3GOVB 1XUFA 1GI9B 3ESTA 5EW2H 1OP2A 1O3DA 4GCHG 1K1JA 3DT0H 2UWLA 1OXGA 2BB4A 1ZMJA 2AMPA 2RDLA 3OTJE 1E38B 1FPHH 1A0HB 4FUGA 3E90B 1ACBE 1P2MA 2GDEH 1CT2E 1NO9H 3HPTB 4IMZA 1BBRE 5EOKA 1LVYA 3OSYA 1W12U 1QGFA 1FN8A 2A7HA 3GCTF 4MVNA 1O31A 3SI3H 1DPOA 3ODFA 1FY3A 1O2MA 2BOHB 1QL7A 5FAHA 4TY7A 3CS0A 5FBEA 3UR6A 3A87A 1E35B 2R9PA 1IQKA 3BTWE 1XX9A 3A86A 1MMJN 2A7CA 2VH6A 4E05H 4AGJA 2H1UA 1A2CH 1HAXB 4Y7BA 4ISLA 3A7XA 2OXSA 2BD8A 4BAMB 2BVSH 2HWLB 1NN6A 2D2DA 5DP5A 3ZZ5A 1DVAH 2CXVA 4FUCA 1NPMA 1NM6A 3A7TA 1BMLA 1C1QA 2ZFSA 3M36A 2Q6FA 4LZ1H 4I8JA 1GI4A 2VIDA 1NRQH 3P8FA 3SGAE 1LPZB 1HB0B 1BOQA 1LVBA 2B7DH 3MMGA 2HGTH 1MTWA 3UIRA 4WMEA 3RXGA 2A2QH 2GZ7A 1ESBA 6CHAB 3GYMA 3NXPA 8GCHF 1BITA 1W0ZU 1S6HA 4MQAA 4WH8A 3ATKA 1LMWB 2G55A 5A8ZA 1PPBH 1EATA 1O5BB 6CHAC 2QCYA 1C2JA 1FMGA 1O2UA 3AAUA 1BIOA 4ZROA 2XNIA 5C2ZA 3LDXH 1O3HA 3RXLA 1NFUA 1A7SA 1T8OA 2PGQB 4ZHAA 1BJUA 3T29A 4SGAE 1T8LA 2R2WU 1GHWH 1MAYA 4UE7H 1DWCH 3BTFE 5AFYH 5EODA 2R0KA 3E16B 1BQYA 4JK6A 1K1NA 4IBLH 1UTNA 2RA0A 1DWBH 4XOJA 1EZQA 3KHVA 3RXBA 1GBJA 1LTOA 1O5GH 3MU5A 2J9NA 1O2WA 4YLQH 4I8KA 2F9OA 2P59A 3RXSA 5E8EH 1AWHB 2SGFE 4JZEH 1XUGA 3O8BA 3TJNA 1FY4A 2Z3CA 1O2JA 3VPKA 3P8NA 1GG6B 4B71A 1ANEA 1TGNA 1CU1A 1T4UH 1RTKA 1K1PA 3AW0A 4H4FA 1TAWA 1TPOA 1HRTH 2PHBA 4ABDA 1YP9A 1GDUA 1OPHB 1GG6C 1A0JA 1UCYH 2VIPA 5GWZA 2WPKS 1EP6A 1XXDA 1T32A 1O5FH 3KQEA 4DJZB 3P95A 2P16A 4Z0KA 3DHKH 1AGJA 1C2IA 3SQHE 1O3IA 1XUIA 2Y82A 2OBQA 2WPLS 3LGTA 4AZ2B 5DP7A 3RDZA 4Y8ZA 4B2BA 2WYGA 1FLEE 5C20A 3GICB 1EPTA 3FVFB 2ZCKP 1JXPA 1FY5A 2GGVB 3V7TA 4BAQB 1PYTC 1A3BH 3Q77A 3TGIE 1CHOG 4NG9H 3ATMA 4Y71A 3GY4A 3IG6B 3B8JA 4FVDA 1SGPE 3PLKA 3T2NA 1IOEA 1QJ7B 1A4WH 2RCEA 3A8BA 1RXPA 3STIA 2FI4E 1GI6A 1SGNE 1WCZA 4K2YA 4ZHMU 4CBNA 2VVVA 2EI6A 2ZGCA 1UVPA 1DY9A 3I29A 1LKBA 2VH0A 1C5RA 3Q76A 2UUKB 4ABJA 7KMEH 3UNQA 4RSPA 5JBCS 4FUBA 1HV7A 2O8TA 2ZDMA 4Q7XA 3ZVCA 1SQOA 2JETB 2TGPZ 4ABFA 3MU4A 2BLWA 1HBTH 1CBWB 4NFFA 1FN6A 1V2QT 2C93B 2JETC 4UDWH 5C5OA 4D7GA 3SNEA 4K1EA 1W14U 1GI5A 3RM2H 2Z9GA 2Y80A 2QXGA 1CA8B 1ID5H 2Z3EA 3RP2A 2IPHA 1FZZA 3LH1A 1Q3XA 2WV4A 3BTQE 3SQEE 1W7GH 1JIRA 3LJJA 1OP8A 1LHEH 3AVZA 2R3YA 4K8BA 3U69H 2BD4A 1P11E 1AFEH 1H9HE 2BTCE 1IQFA 3RU4E 1SLWB 2FS9A 3MOCA 1CT0E 1LVOA 2F9UA 1NZQH 1V2RT 1UK3A 3U9AH 1GJ7B 4VGCB 2Z9LA 1O2GH 2ZO3H 2HRVA 2Y7ZA 1VCQA 2ZIQH 1AD8H 3ELAH 1QL8A 1CO7E 3FP8E 1DANH 3NPSA 4VGCC 3HK3B 2OC0A 1Y8TA 4K8YA 1PYTD 2B8OH 1LPKB 1ARCA 1TNIA 2ZWLH 4Q7ZA 1BUIA 2WV5A 4O97A 1WAYB 1BA8B 3LONA 3MH4A 1TX6A 3F9GA 1GVZA 8ESTE 1S84A 4BAOB 2ZGJA 1Y5BT 1FIZA 1TBZH 1YBWA 1W3CA 6ESTA 5G4BA 3OTPA 2ZECA 1Z6JH 1BTYA 3GCHB 3U1IB 1CA0C 3SU0A 1BMAA 1ELDE 4FU8A 4KELA 1HIAA 3BG8A 1DOJA 3LGIA 4ABBA 3GCHC 1GJ4H 1LQEA 3MNBA 1SI5H 1TGSZ 2GCTB 2ZHQH 3RXIA 3CS7A 2C8ZB 1AWFH 3OYPA 3TPIZ 3T28A 3FP6E 3K6ZA 4U30A 1C5TA 2W7UA 2A31A 1IQMA 1EAIA 2Z7FE 3RMNH 3SU2A 2FOGA 4YOGA 1IQHA 5CHAC 1FJSA 5J4SA 4ABIA 3QZQA 2P93A 1DXPA 1YLCA 1S6FA 4CRFA 2SNVA 3BTGE 4CRDA 3SV9A 4MG3A 1WYKA 1DLEA 2XBYA 5DP9A 1P3EA 1TA6A 3H5CB 2FOMB 3ODDA 4I8LA 4RN6A 1EAUA 3KNXA 4B2CA 4K5ZA 4ZH8A 2OINA 1NRPH 2FX4A 2WUBA 1GMDG 1NFWA 1RTFB 3NK8A 3BTTE 4FU9A 3HATH 2FP7B 1C5UA 1UCYK 2O8WA 3ZZDA 1GJ5H 1N6XA 2EEKA 1O2VA 2HPPH 1EX3A 1DLKB 4JYUH 5DKMA 3RMLH 1A1RA 1P01A 3F9FA 2HNTE 4A7IB 2ZGHA 1DT2A 2QXJA 2D26C 3EQ0H 4U2WA 4E7NA 1UMAH 1J15A 1TOCB 4UFDH 1G3DA 1O2PA 3KCGH 3SBKA 1O3MA 1RD3B 2A45B 3HKIB 2NWNA 3TLOA 1ANBA 3BIVH 1BB0B 1J17T 4O3TA 3BEIB 3C27B 3MWIU 2Q6GA 5B6OA 2O8MA 3SV6A 3QLPH 2C8WB 2ZTYA 1D6WA 3SV2H 4DCDA 1P3CA 3O8DA 1QBNA 2ZTXA 1QJ6B 2KAIA 2ZFRH 2TGTA 3FP7E 3LC3A 3M7UA 4OGXA 1T8NA 1H4WA 3BTDE 1OWEA 1SGDE 1TQ7B 3VB4A 1GHYH 5GCHG 1AE5A 3UOPA 1D3TB 4Y10E 2GVFA 1YPMH 1LPGB 4GHQA 4WF8A 5HGGA 1ZTLA 2A7JA 1GBKA 3VEQB 2PLXA 1ZTJA 2ZCLP 3BN9A 2D1JA 1TGTA 4UFGH 4GAWA 4NWLA 1CVWH 1KYNA 2FX6A 4INHA 3UOUA 2STBE 5HM2A 1RFNA 1E36B 1V3XA 2AEIH 3E3TA 3F1SB 4H6SB 4D76A 2BXTH 2XRCA 1C4V2 1MBQA 4U32A 2P95A 1UTJA 3MNXA 1YPGH 1GI3A 1TABE 2YOLA 4KP0A 2GTBA 2QV1A 1NFXA 5DP4A 3RXAA 2ZDVH 5FPTA 1W13U 3PROA 1O2OA 5J4QA 3BTEE 1FAKH 1DY8A 4FUIA 2XC5A 2P3FH 3F9HA 1O2NA 3N7OA 1L1GA 4O3UA 1AZ8A 4DOQA 1F0RA 5ETXA 2D8WA 2PUQH 1A5HA 5FX5A 1K22H 3AK5A 5F03A 4INKA 1EZSC 2FI5E 4TPYA 1Y3XA 4X1NU 1F92A 3A82A 2GCHG 1C1VH 1EPTB 3D23A 1BTWA 1K1LA 2ZCHP 1TONA 2STAE 5EQRA 1W0YH 1ZHPA 1LCYA 3RLYH 4O03A 1ZLRA 1E34B 3OY5U 1ZPCA 1U6QA 1V2TT 4ZKRU 1C5QA 3EE0B 3NCLA 4LK4A 1GJ6A 7GCHG 3KQBA 3WY8A 2ZNKH 1P2JA 4CRGA 4WMDA 5HYOA 2FZZA 4J1YA 5TJXA 2GDDA 3QN7A 1C2MA 1DWDH 4YO9A 4DVAU 3QZRA 2ZPRA 3SV8A 4NSVA 1W11U 2Z94A 2PUXB 6GCHG 2GP9B 4ESTE 3SZEA 1AHTH 1IQIA 5L6NH 4R8TB 2VJ1A 5GXPA 5JDUB 1TNHA 3ZZ4A 1NU7B 2ZHDA 4NIWA 2PFEA 1P9SA 3P8OA 2ASUB 1EZUC 1QL9A 1O2ZA 3UUZA 2XBWA 5JBAS 3EA8A 1YPKH 1F0TA 2FEQH 3QGNB 5GNDA 3SNBA 4AFZA 4NGAH 1TX7A 5EQSA 1Y5AT 1YPHC 5JPMH 1JWTA 1P0SH 2A4OA 1MCTA 1LHGH 1MQ6A 3LU9B 3T62A 2ODPA 4KTUA 3SJ8A 3VB5A 2XWBI 1GBMA 2ALPA 3LGVA 3BSQA 3MHWU 4AN7A 4ZKOU 2SGAA 5FCKA 4ZKNU 1NY22 2ILNA 4A6LA 1SGFG 2GT8A 3SUGA 1J16A 3ZZ9A 1WQSA 3GCNA
chains in the Genus database with same CATH superfamily
2QF0A 3GY7A 2FOHA 1GCTB 2V6NA 3RMMH 1AVXA 3DSPA 3TGKE 3PV2A 1ZJDA 1MKWH 3P70B 1INCA 1SGQE 1TNLA 3D49H 5A0CA 4U01A 3BTME 1GCTC 2BZ6H 2J5UA 1EB1H 4B1TA 1EFRD 1YC0A 2DE8A 4ISHH 4CRCA 3C1KA 2FXRA 2QE7D 3F3BA 4OS5A 1PJPA 5EXLA 1TYNA 2ZPSA 3FANA 1ZMNA 1H9LB 1TPPA 3M5NA 3W94A 1Z8JB 2BZAA 1GMCG 1BTPA 1G3BA 1V6DA 4H42U 1B0EA 3SORA 4AYVB 2BQWB 5FPYA 1XXFA 4JZDH 1UVTH 1Z6EA 2EY4C 1FV9A 1WSSH 1SB1H 2K0QA 3RXQA 1HIAB 5SGAE 4NZQA 1G2MA 1SGIB 4DG4A 4DIIH 4XBBA 1VITG 1Y3WA 3QGJA 1G32B 3SU1A 2BDIA 2ZHEH 1O30A 1YWUA 1F0UA 1QQUA 1BMFD 1SG8B 4ZXYH 1AE8H 1E1RD 3ZV8A 1YLDA 1UTMA 2VIOA 1ELCA 1PQ5A 1P02A 3M3VA 3ENSB 4GVUA 4B2AA 1N8OC 2H2ZA 1FQ3A 2AGGX 2VINA 1W7XH 3RXFA 1GMHG 3KEEA 4MPVA 2HLCA 2FLRH 2W5EA 4BTIB 1S83A 1EXFA 3G01A 5GIBA 1KXDA 5BPEA 4F55A 2G8TA 2VIWA 5LPFA 3M7TA 1MD8A 3KIDU 3TVJB 3UY9A 1YCPH 1HDTH 2BMGB 2SNWA 3KYGA 5GDSH 2VNTA 4YTAA 1MKXH 4MNYA 5EXNA 4DIHH 1MCVA 4HG6A 4ZMAH 1C1RA 4KTCA 2ZU1A 2ZC9H 1ARBA 4JK5A 3SI4H 1J14A 4AG1A 3BV9B 1ELEE 2F4LA 3OU0A 1UK2A 2OCVB 3BTHE 2LPRA 1BDAA 3V13A 2A5KA 1TOMH 4M7GA 1K21H 1MTUA 1GVLA 1HYLA 3A7YA 3GDUA 1GJAB 4AB9A 4IGDA 1MUEB 3EYDA 3SHAH 2FO9A 1ABIH 1XKAC 1GHAG 1QB1A 3OX7U 1C1MA 5KGOA 1QFKH 1HLTH 1XKBC 3IWMA 2JJ2D 3LGYA 3TK5A 2F3CE 4RKJB 3U8OH 2A5IA 3M35A 5DN6D 1V2OT 2ZFTA 5E0GA 2AIQA 2BDCA 2FYQA 1B7XB 3N99A 4XE4A 1VR1H 1UVSH 1YPLH 1Z1JA 2Y5FA 3RXVA 2J38A 3A89A 2KAIB 2A4QA 4NA7A 2YMSD 3SU4A 4E7RG 1GBFA 1NRRH 1O5EH 3GY5A 3TGJE 2UWOA 1TFXA 2KCYA 1O3CA 4Y7AA 4DT7B 1O3NA 2BY6X 1P05A 4FXGH 1GHBG 1ZPZA 1MH0A 4I86A 3VXFH 3VB7A 4FUEA 3LC5A 1O2YA 5PTPA 5BRRE 1G36A 3PO1B 2YNAA 1AQ7A 1SLXB 4X8SH 3SJOA 1SPJA 1P57B 1AY6H 1DSUA 2FS8A 4XSKU 5B6LA 3JZ1B 2AYWA 3PO1C 1IAUA 3B23B 5TCCA 3F0PA 3TNSA 1HAHH 2BY9X 4WVPE 3A81A 3SJ9A 1THRH 1W10U 2EI7A 1WV7H 1LHFH 2VGCB 3SNCA 1SQAA 1TA2A 4JZFH 1TMUH 4F49A 1DM4B 4ZCNA 1XM1A 1V2NT 1VITH 2VGCC 1AVWA 3PV4A 5DO4H 1QNJA 1FUJA 5ESTE 5CMXH 2EQNA 1K2I1 1MKWK 4X8VH 4IC6A 1TIOA 1O36A 2M5TA 2F9PA 2FODA 3GCTG 1TBQH 4X2YA 1C1TA 2O8UA 3SUFA 1ELGA 1IQNA 2VWOA 1GMDF 1LVMA 3P8GA 4D9RA 5FPSA 1YPJH 2ZQ2A 4X1RU 4FVBA 4A92A 5E2PA 3MU8A 1WBGB 1BTZA 1UCYE 5T6FA 1BZXE 3UNRA 2PGBB 3QDZB 4YT6H 2XBVA 1UTOA 1MD7A 1NESE 1M9UA 3UQVA 2R3UA 4ACBA 1XUKA 2ESTE 2OQUA 3A84A 2SFAA 4ABAA 1QTFA 1ZR0A 2HLDD 4SGBE 2OTVA 1C5PA 1AKSA 3DD2H 4ACAA 1O0DH 4ZHLU 1NC6A 4X6MA 2FLBH 1GBDA 1O2SA 2JH6D 3GY8A 1C1UH 1DDJA 3BTKE 3F68H 2ZQ1A 2HVYB 3OFND 1HAGE 2ZFPH 1GBIA 3RLWH 1ELTA 1HXEH 8GCHG 3U8TH 2ZP0H 4AYYB 2CN0H 5CDFE 1IQGA 5FHTA 1KLTA 1TRNA 2XC4A 1GHZA 3T25A 1HJAB 1GBEA 3VGCC 3TJOA 5AVDA 1ZZZA 4NIXA 3RXTA 3WW7A 1G9IE 5DG6A 3HKJB 3K65B 1HJAC 2EC9H 1RRKA 4OS4A 2HNTC 2FI3E 1C1NA 2FDAA 4O9VA 4B6FA 1DUAA 1YCPK 5C0UA 1MKXK 1GVKB 3KN2A 3MH5A 4NFEA 4MTBA 4X1SU 4AFUA 1UW7A 3F2FA 2IN2A 1CA0B 3ITIA 3KQDA 3SJKA 1O3JA 1TX8A 7LPRA 2J94A 2JKHA 1T8MA 2TGDA 2BD3A 1MQ5A 1ZMLA 1WOFA 2FOEA 2XCFA 4Y6DA 4XDEA 2JJ1D 1SGYE 2FTLE 1Z8RA 3OE7D 1SSXA 1BRCE 1V2WT 1ZSLA 1VCWA 2AMDA 3ZZ8A 2BDYA 3RC5A 3PRBA 1ZPBA 5CHAB 1BTXA 1EAWA 1V2PT 2OBOA 4I8GA 5C3NA 1SL3A 4FUHA 4XRNA 1KXFA 1OWIA 3DFJA 4UFFH 1TPSA 2AGIX 2ZZUH 1TALA 2NU4E 1G3EA 4Y0ZE 1XVOA 1T31A 1COWD 1PPHE 2P94A 2ZF0H 3ATIA 2WSSD 3ZZ7A 5JBTA 5DP8A 2J4IA 3DUXH 1SGFA 3V0XA 1ZTKA 3BEUA 1RS0A 3UREA 4X0WU 3S9AA 1QA7A 3W95A 1DICA 2NU1E 3EA9A 1P8VC 3EDXB 3A8DA 3SO3A 1ESTA 4QT8C 3EGKH 2ZA5A 4X6PA 3V12A 1ZHRA 4WXVA 2F91A 2J95A 4YT7H 2ZU2A 2GV6A 3MO9A 1CGJE 3A88A 3RXDA 1O2HA 4B6EA 1C5MD 1ETSH 1P03A 3PRDA 4JMYA 3LGUA 1PPFE 3MO6A 5E2OA 1GHVH 5A8XA 4XBDA 1EP5A 2OLGA 1AUJA 1L2EA 1NT1A 2TRMA 2BVRH 8KME2 3S9BA 2LNCA 1MAXA 1SMFE 1FDPA 5I46H 4MDSA 1GJ9B 3PMJA 3RXHA 1X7AC 3ZV9A 5F8XA 4AFQA 2P3UB 2ZU3A 2P3TB 3NZIA 3T27A 1CQQA 3OY6U 1NFYA 5CHBA 4A1VA 5DP3A 4FUDA 4ZKSU 1S5SA 1C2KA 3R3GB 2FYRA 2KCOA 2BD7A 3FZZA 3P17H 2UUYA 1WXRA 3NUMA 1K28D 1NU9A 1TBRH 1V2KT 1O34A 3UR9A 1MZDA 3PB1E 3PTNA 5T1VA 4CHAC 4X2VA 1G3CA 2ZGBH 1NTPA 1O32A 4KGAA 2Z3DA 1ZHMA 2BQ6B 4Q2KA 3SNDA 3ZYEA 1PPCE 4FETA 3MU1A 2OP9A 5A8YA 1SFQB 1C5YB 1P2NA 1P2QA 3SU3A 1K9OE 4BAHB 1EJAA 3TH2H 1F5LA 4X6OA 1DX5M 1SGRE 2GT7A 1IQEA 1QRZA 2SGEE 3OAAD 4E06H 4IC5A 1O3GA 1OOKB 1CHGA 4YOIA 2QXHA 5A09A 4K3JA 1EJMA 4WXIA 1O35A 5DJ7A 3KF2A 1TQ0B 2ANYA 2CF9H 1D4PB 1JOUB 3D62A 3GY2A 4GCHF 2GD4B 3RC4A 1GMCF 1WQVH 3P6ZB 2G51A 4GUXA 3A80A 1GBBA 1JRSA 1UTPA 1YCPM 2GX4A 1ELFA 1EKBB 1NROH 2Z9KA 4MPUA 1C1PA 2FMJA 5JBBS 4JCNA 1H8ED 2BX3A 1HAVA 1Q31A 1GBAA 4TWYA 1HAZB 1O3FA 2W6JD 3ATWA 2BXUH 5F8TA 3SUDA 1FIWA 1H8HD 1O2LA 2PKSC 3UWJH 3SGQE 1E1QD 4Q7YA 3TK6A 3RXPA 4Q63A 1MTNB 2H9EH 1KTTB 1QQ4A 2G5VA 1VITF 2AGEX 5EPNA 1O2QA 5H4IB 1GBTA 1S6LA 2TBSA 1MTNC 4AGKA 4X2XA 3PLBA 3SHCH 1SFIA 2QN5T 4ZAEA 4X1QU 2KX4A 9ESTA 1NRNH 4H6TA 2C8XB 3LKWA 1SR5C 1AU8A 4AORA 3TU7H 1GWAA 3SGBE 1GGDB 1SHYA 2K8IA 4HI3A 2F83A 4OS1A 1HAIH 1SOTA 4OS2A 4YOJA 4UONA 2FPZA 2VB0A 1P09A 1C5LH 1O3BA 2A1DB 2GJGA 4X8TH 1SOZA 4B76A 1O38A 1W8BH 4YM9A 2DE9A 1O2RA 1A5GH 1AVGH 1ZSJA 3FO8D 1GGDC 4YLUA 1JIMA 1O2XA 1EZXC 4NSYA 1LHCH 1MTVA 2FWWA 1ETRH 4CR5A 1PFXC 1BJVA 2XTTB 1FY1A 3DCLA 3E91A 1GDNA 4RT1A 1MU6B 1IHSH 1PQAA 1UJ1A 4LXBH 4BTTB 5L2ZH 1QJ1B 4OS7A 2BY7X 4YZUA 2QF3A 1D3PB 1ANCA 1ESAA 3UB0A 5IDKA 1A46H 1OS8A 1TWXB 2ZG0H 3LT3A 4I7YH 3Q3KA 5I25A 3SU6A 1O3PB 1O5AB 4AG2A 1DWEH 2Y5GA 2V35A 3MO3A 1JMOH 2ZDKA 1FPCH 1C9PA 1HUTH 3LH3A 1QURH 5HKKD 4THNH 1Y59T 5FCRA 2JDID 4Z6AH 1OYTH 1ZRBA 2QF5A 1P2OA 1BRBE 1H9IE 1AKSB 1WDIA 1ABJH 1QHRB 2AH4X 5FBIA 1KMHB 2BY8X 4FUJA 1AUTC 2GV7A 2BDHA 2TIOA 2VVUA 4HZHA 1W2KH 1GHXH 2H5DA 2QAAA 3GISB 1GBLA 1BBRH 1QRWA 3K9XB 3LGWA 3M7QA 4A1XA 3HGPA 1LQDB 3SV7A 2A4RA 1ELAA 5K7RA 2BD2A 2I6SA 2LELA 1G37A 2W3IA 1C2EA 1GI2A 1ANDA 4JZIA 1Z7KA 2Y6TA 3ATLA 4YXWD 1AMHA 1OWKA 2OQ5A 1CSOE 5L2YH 1K0HA 1GJ8B 4XD7D 2EA3A 1GDQA 2V3MA 3O8CA 1QRXA 1LDTT 4BNRA 7ESTE 3MNCA 5T6DA 2CMYA 4NA8A 2QIQA 1HJ8A 3ZVEA 1S0RA 2Z6BD 1C1OA 4GHTA 1GPZA 5EGMA 4AFSA 1ELBA 3ZVDA 1O2IA 1GBHA 2GMTB 1O5DH 3SJIA 3F0OA 1EOJA 1WU1A 1IQLA 2HNTF 1CE5A 2FIRH 3FOAA 1ELVA 1QCPA 1TNGA 2AMQA 1CHOF 4BTUB 1UK4A 2GMTC 1XUHA 4ZUHA 2F43B 3PLPA 5T6GA 3ZVGA 1L1NA 1C5ZB 3PMHB 4PROA 1V2LT 1PPGE 4J2YB 4ASUD 2M2AA 1F5RA 1F0SA 1LHDH 1N8OB 3L33A 3L6PA 4MNWA 1P2IA 3A8CA 3Q3XA 5JB9S 2XBXA 1CT4E 2FOAA 4ZXXH 1FNIA 3RXEA 1GL0E 2O8LA 1KDQA 3LPRA 1N6YA 2RA3A 1AFQB 2IOTA 2PSYA 1O39A 3E0PB 1KXAA 2NU3E 2AERH 1TNJA 1L0ZA 1F7ZA 1S81A 4D9QA 1P10A 1AFQC 3M5MA 3E0NB 3JZ2B 2HOBA 3VFEA 3FKSD 1YPHE 2KCPA 3RXUA 1EUFA 1SC8U 1SVPA 2Q1JA 4UEHH 5C1UA 3PWBA 1AZZA 1N1LA 1TRYA 3GY3A 1C2GA 1RIWB 3BEFB 4GPGA 1V2JT 3A8AA 4INLA 4NZLA 1TMTH 1F2SE 3MU0A 3KYFA 2ODYB 5DGJA 1RIWC 1Z71A 4CREA 1YYY1 1E37B 1HJ9A 1SBWA 2BD9A 1TRMA 2F9BH 1QA0A 3A7WA 2XC0A 2G4UA 5HM9A 5CE1A 2QXIA 2PTNA 1TE0A 4TPIZ 1BTUA 1DS2E 3ZVBA 1OKXA 1LKAA 2QGRA 2Y7XA 4WY3A 1O2TA 3SZNA 2RG3A 1AB9B 2EI8A 2O9QA 1EAXA 2UUFB 3I78A 1C2FA 1VZQH 2ZU5A 1AN1E 1V2VT 3E6PH 3SW2B 1WTGH 4F48B 1UVOA 1QZ8A 2RFKC 2VIVA 3F9EA 2H9TH 1AB9C 3PMBB 3RC6A 1EJNA 1KLIH 4MLFB 1Y3VA 3STJA 4CR9A 3E8LA 3QTVH 1FY8E 1Z1IA 1SQRA 2ANWA 1HNEE 4Q80A 2H6MA 3S7KB 2C4FH 3RUOA 1P2KA 3RU4T 5A0AE 1OP0A 1OWDA 5LH8A 2J92A 5F8ZA 1G30B 4ISIH 4WH6A 2ZDNA 1Z8GA 3EAJA 2B9LA 1L4ZA 1ZRKA 5GJ4B 3PM3A 2SGPE 1O3AA 1KTSB 2ZFFH 1C2DA 2FM2A 1GI1A 1KSNA 1K1MA 2Y81A 1DITH 1S0QA 2A4GA 2Z9JA 1TMBH 4MPXA 2ZGXH 1H8IH 1HCGA 4KTSA 4MPWA 4OM9A 2BDGA 4AOQA 2K1QA 4MNVA 3A85A 5L30H 1S85A 3NKKA 4XBCA 4UD9H 5HMAA 3L3TA 1BT7A 1L4DA 1PPEE 3UPEA 6LPRA 1EB2A 2PKAA 3RXKA 1D3DB 1O3OA 2PSXA 3SOSA 1OYQA 1Z8IB 4IMQA 3URDA 4RI0A 5EJZA 1XUJA 1YGCH 1O3KA 1BBRK 1QIXB 1TGBA 1UO6A 3SN8A 1TLDA 1HAVB 1WUNH 5EQQA 3Q00A 1F5KU 3S9CA 1Y5UT 1O33A 4NIVA 2HALA 3T5FH 1V2ST 4AC9A 1SLVB 4NCYA 3KL6A 3PV5A 4X2WA 1BHXB 3ZVAA 3LOXA 2BQ7B 2H9HA 3AAVA 4X8UH 1P04A 4Y0YE 2XWAA 2BYAX 1P06A 2F9VA 3MFJA 2G81E 2PTCE 2XOKD 3FZDA 4OGYA 1QR3E 5T3HA 1QB6A 2BLOA 3PTBA 2VU8E 4K1TA 3PWCA 1DSTA 1ZYOA 2BDAA 2WINI 3CNRA 3AW1A 1J9CH 3GCOA 2A2XH 3GDVA 1GL1A 1YPEH 1GJCB 2G00A 2ZDAH 3ZZ6A 2KFWA 1O3EA 1MU8B 2KR7A 1P12E 2OC1A 3RU4D 3KGPA 4X6NA 4Z1MD 3AASA 2FOCA 4UFEH 1A61H 5E0JA 3GY6A 3TK9A 3VGCB 1CBWC 4JYVH 3QWCH 5EXMA 1YF4A 3M5LA 5IYTA 1A0LA 2HPQH 3B9FH 2QA9E 2J97A 4RT0A 1OWJA 2JIZD 2W3KA 3LIWA 2B0FA 2ZKSA 3S69A 2VWNA 3ZVFA 3LJOA 1B0FA 3UQOA 3NWUA 4TY6A 5GCHF 1JRTA 3N7EA 2F9NA 1UHBA 2OD3B 1MBMA 1ZOMA 4BAKB 2BOKA 4JYTA 3SUEA 3MNSA 4A5TS 3S7HB 1XMNB 1O37A 3UNSA 1ZSKA 1O2KA 1HGTH 1KLJH 1P9UA 2FOFA 4CH8B 2H5CA 1L1JA 2XCNA 3RXJA 1QBOA 4Y8XA 3ZZ3A 1K1IA 1SGCA 4B74A 4DURA 4BXWA 3TNTA 2CHAB 3NRLA 1E0FD 3A7ZA 1LO6A 2WPIS 1H8DH 3H7TA 2OK5A 2B5TB 5HXFA 1VJAU 2CHAC 3Q3YA 2UUJB 4KKDA 3RM0H 4IN2A 1ZGVA 3MTYA 4ISNA 4HTCH 1C5NH 3W1EA 4ABEA 2BDBA 2QY0B 4FUFA 3TH4H 2J2UA 2NU0E 4LZ4B 1FONA 1C5VA 9LPRA 2GZ9A 3H09A 1ORFA 3ZZAA 2Y5HA 4RKOB 3PYHA 5AFZH 3T26A 5HIZA 2C90B 4Y8YA 3PMAB 5KEDA 3U8RH 2HVXA 3S0NA 1PQ7A 1XVMA 1MTSA 3ZZBA 2J34A 2AIPA 5JYIA 4FOUC 2FESH 1HPGA 3UTUH 2G52A 1FXYA 3V3MA 4NWKA 3M3SA 2GCHF 4K1SA 5A0BA 3M3TA 2SGDE 1SQTA 4JZ1A 1VGCB 3GYLB 4NIYA 2GCTC 3CENA 1QB9A 2C8YB 1DXWA 2W26A 3BF6H 1RTLA 3GDSA 2LP6A 2OUAA 1VGCC 2AFQB 2TGAA 1KXBA 2WPJS 1MZAA 5LPRA 1D9IA 1ZGIA 7GCHF 3ZZCA 1GCDA 4F4OC 4MNXA 2ZU4A 2XW9A 5FX6A 1C9TA 4D7FA 1S82A 2FTMA 4CH2B 3DA9B 2ZI2H 5DK1A 1SLUB 1KDQB 4B75A 1KXEA 6GCHF 1SKYE 2PW8H 1GI8B 2A5AA 4I8HA 1A3EH 8LPRA 2WUCA 1CGHA 1O3LA 2V0BA 5DP6A 2ZFQH 4GSOA 1GJDB 3RMOH 3RXRA 1HXFH 2TPIZ 3MYWA 2WHXA 5JB8S 1A5IA 3R0FA 3A7VA 1QBVH 3KQCA 4I32A 3VB6A 1YLNA 3TITA 4ABHA 4Y76A 2XNDD 4CHAB 4I31A 1FAXA 1UTKA 4HGCA 4K60A 2BLQA 4BANB 3M5OA 4TWWA 1DUEA 3U1JB 3HK6B 4XFQA 3U98H 1VJ9U 3VXEH 5F53A 1PPZA 1C2HA 3P92A 2ALVA 1MABB 2JH0D 2KZ4A 1FX0B 1RGQA 4A1TA 1C1WH 3IITA 2R0LA 2V3HH 3OEED 3MH7A 1HAPH 5KECA 1BRUP 1TPAE 1D3QB 1OWHA 4CRBA 5C67A 2PWXA 3K2UA 5F6MA 3EA7A 4OS6A 5E0HA 1C4U2 5LGOA 4ABGA 4AB8A 3DSGA 2ZHWH 3MH6A 3QX5H 3TJUA 1BMMH 4IS5A 1WTHD 3TH3H 1Y3UA 5AF9H 2ZEBA 5TCAA 1AIXH 2ANKH 1SGTA 2DUCA 5EIYA 1C5XB 2CGAA 2PR3A 2JH5D 2ANMH 2WPHS 2ULLA 1HFDA 1H1BA 4ISOA 1THSH 4WWYA 3URCA 5K0HA 2P8OB 2Q6DA 2THFB 1CGIE 3QK1A 3ZIAD 1YKTA 2ZHFH 1BMNH 4Y79A 5EW1H 1RJXB 2PKSB 3HGNA 2ZDLA 1C5OH 2VVCA 2OC7A 2VWLA 3F2GA 4GLYA 2P8OC 3QTOH 3M61U 1KY9A 5C1XA 3A83A 1EOLA 3QUMP 1TGCA 4HFPB 2V7QD 1IQJA 3F6UH 2V3OH 1Q2WA 1OSSA 2Z9IA 1EASA 3SU5A 3RXMA 3BIUH 3VB3A 2VWMA 4IN1A 2YNBA 1NS3A 1SGEE 4K69A 2BVXH 2QYIA 2SGQE 4DW2U 2WV9A 2KCAA 4M9FA 1C5SA 2J98A 2PKAB 4FU7A 4LOYH 3RXOA 1GMHF 1ZJKA 2NU2E 3D65E 1C2LA 1HAOH 3FFGA 1C5WB 4AX9H 3SYJA 2BY5X 2ZPQA 1KIGH 1J8AA 2W7SA 4D8NA 2IJOB 4R0IA 4Y11E 4CRAA 4BOHA 3O8RA 2C3SA 2IJD1 1O5CB 1EPTC 1THPB 1GJBB 1BTHH 1D6RA 1TNKA 4WJG2 1DFPA 2A32A 2AS9A 2VBCA 1BCUH 1UTLM 1HAYB 5EU8A 5FXLA 1OX1A 2CV3A 1UVUH 2UWPA 4TSFD 2CK3D 2FOBA 4YESB 3MI4A 5C1YA 3K6YA 3M37A 3TIUA 5C17A 2ODQA 1BHXF 4I33A 1C1SA 1BRAA 1JBUH 1VCPA 4DY7B 1V2MT 4NA9H 4B73A 3H7OA 2WZQA 2WPMS 1GHAF 2BLVA 3CP7A 3SNAA 3E1XB 4X1PU 5EG4A 1UTQA 1GI0A 2GKVE 4ASHA 5LPEA 2XXLA 4BXSA 1YM0A 2CF8H 1KXCA 4DGJA 4WMFA 1GBCA 2VIQA 1GI7B 1T7CA 3UFAA 2G4TA 5DPAA 3ZYDA 3TJVA 1PQ8A 3OEHD 1TB6H 2G5NA 1G2LA 1FI8A 1AO5A 4CBOA 3BG4B 3RXCA 3F2HA 4IW4E 2WYJA 1T4VH 5ABWA 5ESBA 2ZTZA 5AHGH 5EPYA 3DSOA 3BG4C 3UWIA 2R2MB 5A2MH 1IHTH 1UHBB 2QC2A 1DE7H 3I77A 4TYDA 1K1OA 2OC8A 1GHBF 2CJIA 1SHHB 3QO6A 2BHGA 1QY6A 1AI8H 1B5GH 2BM2A 2BX4A 1ETTH 2XYAA 1V2UT 1C4Y2 1Y3YA 1NRSH 3DFLA 2A0QB 2GZ8A 3FAOA 2I6QA 2BD5A 1EQ9A 2PV9B 5GPIB 5C5NA 3GOVB 1XUFA 1GI9B 3ESTA 5EW2H 1OP2A 3MQKC 1O3DA 4GCHG 1K1JA 3DT0H 2UWLA 1OXGA 2BB4A 1ZMJA 2AMPA 2RDLA 4TT3D 3OTJE 1YY3A 1E38B 2AHME 1FPHH 1A0HB 1E79D 4FUGA 3E90B 1VKYA 1ACBE 1P2MA 2GDEH 1CT2E 1NO9H 3HPTB 4P00A 4IMZA 1BBRE 5EOKA 1LVYA 3OSYA 1W12U 1QGFA 1FN8A 2A7HA 3GCTF 4MVNA 1O31A 3SI3H 1DPOA 3ODFA 1FY3A 1O2MA 2YMSB 2BOHB 1QL7A 5FAHA 4TY7A 3CS0A 5FBEA 3UR6A 3A87A 1E35B 2R9PA 1IQKA 3BTWE 1XX9A 3A86A 1MMJN 2YMSC 2A7CA 2VH6A 4E05H 4AGJA 2H1UA 1A2CH 1HAXB 4Y7BA 4ISLA 3A7XA 2OXSA 2BD8A 4BAMB 2BVSH 2HWLB 1NN6A 2D2DA 5DP5A 3ZZ5A 1DVAH 2CXVA 4FUCA 1NPMA 1NM6A 3A7TA 1BMLA 1C1QA 2ZFSA 3M36A 2Q6FA 4LZ1H 4I8JA 1GI4A 2VIDA 1NRQH 3P8FA 3SGAE 1LPZB 1HB0B 1BOQA 1LVBA 2B7DH 3MMGA 2HGTH 1MTWA 3UIRA 4WMEA 3RXGA 2A2QH 2GZ7A 1ESBA 6CHAB 3GYMA 3NXPA 8GCHF 1BITA 1W0ZU 1S6HA 4MQAA 4WH8A 3ATKA 1LMWB 2G55A 5A8ZA 1PPBH 1EATA 1O5BB 6CHAC 2QCYA 1C2JA 1FMGA 5IK2D 1O2UA 3AAUA 1BIOA 4ZROA 2XNIA 5C2ZA 3LDXH 2WPDD 1O3HA 3RXLA 1NFUA 1A7SA 1T8OA 2PGQB 4ZHAA 1BJUA 3T29A 4SGAE 1T8LA 2R2WU 1GHWH 1MAYA 4UE7H 1DWCH 3BTFE 5AFYH 5EODA 2R0KA 3E16B 1BQYA 4JK6A 1K1NA 4IBLH 1UTNA 2RA0A 1DWBH 4XOJA 1EZQA 3KHVA 3RXBA 1GBJA 1LTOA 1O5GH 3MU5A 2J9NA 1O2WA 5HIYA 4YLQH 4I8KA 2F9OA 2P59A 3RXSA 5E8EH 1AWHB 2SGFE 4JZEH 1XUGA 3O8BA 3TJNA 1FY4A 2Z3CA 1O2JA 3VPKA 3P8NA 1GG6B 4B71A 1ANEA 1TGNA 1CU1A 1T4UH 1RTKA 1K1PA 3AW0A 4H4FA 1TAWA 1TPOA 1HRTH 2PHBA 4ABDA 1YP9A 1GDUA 1OPHB 1GG6C 1A0JA 1UCYH 2VIPA 5GWZA 2WPKS 1EP6A 1XXDA 1T32A 1O5FH 3KQEA 2L6OA 4DJZB 3P95A 2P16A 4Z0KA 3DHKH 1AGJA 1C2IA 3SQHE 1O3IA 1XUIA 2Y82A 3KQ5A 3UAIC 2OBQA 2WPLS 3LGTA 4AZ2B 5DP7A 3RDZA 4Y8ZA 4B2BA 2WYGA 1FLEE 5C20A 3GICB 1EPTA 3FVFB 2ZCKP 1JXPA 1FY5A 2GGVB 3V7TA 4BAQB 1PYTC 1A3BH 3Q77A 3TGIE 1CHOG 4NG9H 3ATMA 4Y71A 3GY4A 3IG6B 3B8JA 4FVDA 1SGPE 3PLKA 3T2NA 1IOEA 1QJ7B 1A4WH 2RCEA 3A8BA 1RXPA 3STIA 2FI4E 1GI6A 1SGNE 1WCZA 4K2YA 4ZHMU 4CBNA 2VVVA 2EI6A 2J98B 2ZGCA 1UVPA 1DY9A 3I29A 1LKBA 2VH0A 1C5RA 3Q76A 2UUKB 4ABJA 7KMEH 3UNQA 4RSPA 5JBCS 4FUBA 1HV7A 2O8TA 2ZDMA 4Q7XA 3ZVCA 1SQOA 2JETB 2TGPZ 4ABFA 3MU4A 2BLWA 1HBTH 1CBWB 4NFFA 1FN6A 1V2QT 2C93B 2JETC 4UDWH 5C5OA 4D7GA 3SNEA 4K1EA 1W14U 1GI5A 3RM2H 2Z9GA 2Y80A 2QXGA 1CA8B 1ID5H 2Z3EA 3RP2A 2IPHA 1FZZA 3LH1A 1Q3XA 2WV4A 3BTQE 3SQEE 1W7GH 1JIRA 3LJJA 1OP8A 1LHEH 1NBMD 2R3YA 3AVZA 4K8BA 3U69H 2BD4A 1P11E 1AFEH 1H9HE 2BTCE 1IQFA 3RU4E 1SLWB 2FS9A 3MOCA 1CT0E 1LVOA 2F9UA 1NZQH 1V2RT 1UK3A 3U9AH 1GJ7B 4VGCB 2Z9LA 1O2GH 2ZO3H 2KM0A 2HRVA 2Y7ZA 1VCQA 2ZIQH 1AD8H 3ELAH 1QL8A 1CO7E 3FP8E 1DANH 3NPSA 4VGCC 1NBME 3HK3B 2OC0A 1Y8TA 4K8YA 1PYTD 2B8OH 2RDEA 1LPKB 1ARCA 1TNIA 2ZWLH 4Q7ZA 1BUIA 2WV5A 4O97A 1WAYB 1BA8B 3LONA 3MH4A 1TX6A 3F9GA 1GVZA 8ESTE 5C94A 1S84A 4BAOB 2ZGJA 1Y5BT 1FIZA 1TBZH 1YBWA 1W3CA 6ESTA 5G4BA 3OTPA 2ZECA 1Z6JH 1BTYA 3GCHB 3U1IB 1CA0C 3SU0A 1BMAA 1ELDE 4FU8A 4KELA 1HIAA 3BG8A 1DOJA 3LGIA 4ABBA 3GCHC 1GJ4H 1LQEA 3MNBA 2L74A 1SI5H 1TGSZ 2GCTB 2ZHQH 3RXIA 3CS7A 2C8ZB 1AWFH 3OYPA 3TPIZ 2IPQX 3T28A 3FP6E 3K6ZA 4U30A 5FL7D 1C5TA 3U28C 2W7UA 2A31A 1IQMA 1EAIA 2Z7FE 3FN8A 3RMNH 3SU2A 2FOGA 4YOGA 1IQHA 5CHAC 1FJSA 5J4SA 4ABIA 3QZQA 2P93A 1DXPA 1YLCA 1S6FA 4Q4LA 4CRFA 2SNVA 3BTGE 4CRDA 3SV9A 4MG3A 1WYKA 1DLEA 2XBYA 5DP9A 1P3EA 1TA6A 3H5CB 2FOMB 3ODDA 4I8LA 4RN6A 1EAUA 3KNXA 4B2CA 4K5ZA 4ZH8A 2OINA 1NRPH 2FX4A 2WUBA 1GMDG 1NFWA 1RTFB 3NK8A 3BTTE 4FU9A 3HATH 2FP7B 1C5UA 1UCYK 2O8WA 3ZZDA 1GJ5H 1N6XA 2EEKA 1O2VA 3WWFA 2HPPH 1EX3A 1DLKB 4JYUH 3EE7A 5DKMA 4DT4A 2W6ID 3RMLH 3GS9A 1A1RA 1P01A 3F9FA 2HNTE 4A7IB 2ZGHA 1DT2A 2QXJA 2D26C 3EQ0H 4U2WA 4E7NA 1UMAH 1W0JD 1J15A 1TOCB 4UFDH 1G3DA 1O2PA 3KCGH 3SBKA 1O3MA 1RD3B 2A45B 3HKIB 2NWNA 3TLOA 1ANBA 3BIVH 1BB0B 1J17T 4O3TA 3BEIB 3C27B 3MWIU 2Q6GA 5B6OA 2O8MA 3SV6A 3QLPH 2C8WB 2ZTYA 1D6WA 3SV2H 4DCDA 1P3CA 3O8DA 5DSFA 1QBNA 2ZTXA 1QJ6B 2KAIA 2ZFRH 2TGTA 3FP7E 3LC3A 3M7UA 4OGXA 1T8NA 1H4WA 3BTDE 1OWEA 1SGDE 1TQ7B 2PP6A 1GHYH 5GCHG 1AE5A 3UOPA 3VB4A 1D3TB 4Y10E 2GVFA 1YPMH 1LPGB 4GHQA 4WF8A 5HGGA 1ZTLA 2A7JA 1GBKA 3VEQB 2PLXA 1ZTJA 2ZCLP 3BN9A 2D1JA 1TGTA 4UFGH 4GAWA 4NWLA 1CVWH 1KYNA 2FX6A 4INHA 3UOUA 2STBE 5HM2A 1RFNA 1E36B 1V3XA 2AEIH 3E3TA 3F1SB 4H6SB 4D76A 2BXTH 2XRCA 1C4V2 5EJ1A 1MBQA 4U32A 2P95A 1UTJA 3MNXA 1YPGH 1GI3A 1TABE 2YOLA 4KP0A 2GTBA 2QV1A 1NFXA 5DP4A 3RXAA 2ZDVH 5FPTA 2QF4A 1W13U 3PROA 1O2OA 5J4QA 3BTEE 1FAKH 1DY8A 4FUIA 2XC5A 2P3FH 3F9HA 1O2NA 3N7OA 1L1GA 4O3UA 1AZ8A 4P02A 4DOQA 1F0RA 5ETXA 2D8WA 2PUQH 1A5HA 5FX5A 1K22H 3AK5A 1OHHD 5F03A 4INKA 1EZSC 2FI5E 4TPYA 1Y3XA 4X1NU 1F92A 3VG8A 3A82A 2GCHG 1C1VH 1EPTB 3D23A 1BTWA 1K1LA 2ZCHP 1TONA 2STAE 5EQRA 1W0YH 1ZHPA 1LCYA 3RLYH 4O03A 1ZLRA 1E34B 3OY5U 1ZPCA 1U6QA 5EJLA 1V2TT 4ZKRU 1C5QA 3EE0B 3NCLA 4LK4A 1GJ6A 3WWBA 7GCHG 3KQBA 3WY8A 2ZNKH 1P2JA 4CRGA 4WMDA 5HYOA 2FZZA 4J1YA 5TJXA 2GDDA 3QN7A 1C2MA 1DWDH 4YO9A 4DVAU 3QZRA 2ZPRA 3SV8A 4NSVA 1W11U 2Z94A 2PUXB 6GCHG 2GP9B 4ESTE 3SZEA 1AHTH 1IQIA 5C0TA 5L6NH 4R8TB 2VJ1A 5GXPA 5JDUB 1TNHA 3ZZ4A 1NU7B 2ZHDA 4NIWA 2PFEA 1P9SA 3P8OA 2ASUB 1EZUC 1QL9A 1O2ZA 3UUZA 2XBWA 5JBAS 3EA8A 1YPKH 1F0TA 2FEQH 3QGNB 5GNDA 3SNBA 4AFZA 4NGAH 1TX7A 5EQSA 1Y5AT 1YPHC 5JPMH 1JWTA 1P0SH 2A4OA 1MCTA 1LHGH 1MQ6A 3LU9B 3T62A 2ODPA 1W0KD 4KTUA 3SJ8A 3VB5A 2XWBI 1GBMA 2ALPA 3LGVA 3BSQA 3MHWU 4AN7A 4ZKOU 2SGAA 5FCKA 4ZKNU 1NY22 3N7DA 2ILNA 4A6LA 1SGFG 2GT8A 3SUGA 1J16A 3ZZ9A 1WQSA 3GCNA
chains in the Genus database with same CATH topology
2QF0A 3GY7A 2FOHA 1GCTB 2V6NA 3RMMH 1AVXA 3DSPA 3TGKE 3PV2A 1ZJDA 1MKWH 3P70B 1INCA 1SGQE 1TNLA 3D49H 5A0CA 4U01A 3BTME 1GCTC 2BZ6H 2J5UA 1EB1H 4B1TA 1EFRD 1YC0A 2DE8A 4ISHH 4CRCA 3C1KA 2FXRA 2QE7D 3F3BA 4OS5A 1PJPA 5EXLA 1TYNA 2ZPSA 3FANA 1ZMNA 1H9LB 1TPPA 3M5NA 3W94A 1Z8JB 2BZAA 1GMCG 1BTPA 1G3BA 1V6DA 4H42U 1B0EA 3SORA 4AYVB 2BQWB 5FPYA 1XXFA 4JZDH 1UVTH 1Z6EA 1FV9A 1WSSH 1SB1H 2K0QA 3RXQA 1HIAB 5SGAE 4NZQA 1G2MA 1SGIB 4DG4A 4DIIH 4XBBA 1VITG 1Y3WA 3QGJA 1G32B 3SU1A 2BDIA 2ZHEH 1O30A 1F0UA 1QQUA 1BMFD 1SG8B 4ZXYH 1AE8H 1E1RD 3ZV8A 1YLDA 1UTMA 2VIOA 1ELCA 1PQ5A 1P02A 3M3VA 3ENSB 4GVUA 4B2AA 1N8OC 2H2ZA 1FQ3A 2AGGX 2VINA 1W7XH 3RXFA 1GMHG 3KEEA 4MPVA 2HLCA 2FLRH 2W5EA 4BTIB 1S83A 1EXFA 3G01A 5GIBA 1KXDA 5BPEA 4F55A 2G8TA 2VIWA 5LPFA 3M7TA 1MD8A 3KIDU 3TVJB 3UY9A 1YCPH 1HDTH 2BMGB 2SNWA 5GDSH 2VNTA 4YTAA 1MKXH 4MNYA 5EXNA 4DIHH 1MCVA 4ZMAH 1C1RA 4KTCA 2ZU1A 2ZC9H 1ARBA 4JK5A 3SI4H 1J14A 4AG1A 3BV9B 1ELEE 2F4LA 3OU0A 1UK2A 2OCVB 3BTHE 2LPRA 1BDAA 3V13A 2A5KA 1TOMH 4M7GA 1K21H 1MTUA 1GVLA 1HYLA 3A7YA 3GDUA 1GJAB 4AB9A 4IGDA 1MUEB 3EYDA 3SHAH 2FO9A 1ABIH 1XKAC 1GHAG 1QB1A 3OX7U 1C1MA 1QFKH 1HLTH 1XKBC 3IWMA 2JJ2D 3LGYA 3TK5A 2F3CE 4RKJB 3U8OH 2A5IA 3M35A 5DN6D 1V2OT 2ZFTA 5E0GA 2AIQA 2BDCA 2FYQA 1B7XB 3N99A 4XE4A 1VR1H 1UVSH 1YPLH 1Z1JA 2Y5FA 3RXVA 2J38A 3A89A 2KAIB 2A4QA 4NA7A 2YMSD 3SU4A 4E7RG 1GBFA 1NRRH 1O5EH 3GY5A 3TGJE 2UWOA 1TFXA 2KCYA 1O3CA 4Y7AA 4DT7B 1O3NA 2BY6X 1P05A 4FXGH 1GHBG 1ZPZA 1MH0A 3VXFH 3VB7A 4FUEA 3LC5A 1O2YA 5PTPA 5BRRE 1G36A 3PO1B 2YNAA 1AQ7A 1SLXB 4X8SH 3SJOA 1SPJA 1P57B 1AY6H 1DSUA 2FS8A 4XSKU 5B6LA 3JZ1B 2AYWA 3PO1C 1IAUA 3B23B 5TCCA 3TNSA 3F0PA 1HAHH 2BY9X 4WVPE 3A81A 3SJ9A 1THRH 1W10U 2EI7A 1WV7H 1LHFH 2VGCB 3SNCA 1SQAA 1TA2A 4JZFH 1TMUH 4F49A 1DM4B 4ZCNA 1XM1A 1V2NT 1VITH 2VGCC 1AVWA 3PV4A 5DO4H 1QNJA 1FUJA 5ESTE 5CMXH 1K2I1 1MKWK 4X8VH 4IC6A 1TIOA 1O36A 2M5TA 2F9PA 2FODA 3GCTG 1TBQH 4X2YA 1C1TA 2O8UA 3SUFA 1ELGA 1IQNA 2VWOA 1GMDF 1LVMA 3P8GA 4D9RA 5FPSA 1YPJH 2ZQ2A 4X1RU 4FVBA 4A92A 5E2PA 3MU8A 1WBGB 1BTZA 1UCYE 5T6FA 1BZXE 3UNRA 2PGBB 3QDZB 4YT6H 2XBVA 1UTOA 1MD7A 1NESE 1M9UA 3UQVA 2R3UA 1XUKA 2ESTE 2OQUA 3A84A 2SFAA 4ABAA 1QTFA 1ZR0A 2HLDD 4SGBE 2OTVA 1C5PA 1AKSA 3DD2H 1O0DH 4ZHLU 1NC6A 4X6MA 2FLBH 1GBDA 1O2SA 2JH6D 3GY8A 1C1UH 1DDJA 3BTKE 3F68H 2ZQ1A 3OFND 1HAGE 2ZFPH 1GBIA 3RLWH 1ELTA 1HXEH 8GCHG 3U8TH 2ZP0H 4AYYB 2CN0H 5CDFE 1IQGA 5FHTA 1KLTA 1TRNA 2XC4A 1GHZA 3T25A 1HJAB 1GBEA 3VGCC 3TJOA 5AVDA 1ZZZA 4NIXA 3RXTA 3WW7A 1G9IE 5DG6A 3HKJB 3K65B 1HJAC 2EC9H 1RRKA 4OS4A 2HNTC 2FI3E 1C1NA 2FDAA 4O9VA 4B6FA 1DUAA 1YCPK 5C0UA 1MKXK 1GVKB 3KN2A 3MH5A 4NFEA 4MTBA 4X1SU 4AFUA 3F2FA 2IN2A 1CA0B 3ITIA 3KQDA 3SJKA 1O3JA 1TX8A 7LPRA 2J94A 2JKHA 1T8MA 2TGDA 2BD3A 1MQ5A 1ZMLA 1WOFA 2FOEA 2XCFA 4Y6DA 4XDEA 2JJ1D 1SGYE 2FTLE 1Z8RA 3OE7D 1SSXA 1BRCE 1V2WT 1ZSLA 1VCWA 2AMDA 3ZZ8A 2BDYA 3RC5A 3PRBA 1ZPBA 5CHAB 1BTXA 1EAWA 1V2PT 2OBOA 4I8GA 5C3NA 1SL3A 4FUHA 1KXFA 1OWIA 3DFJA 4UFFH 1TPSA 2AGIX 2ZZUH 1TALA 2NU4E 1G3EA 4Y0ZE 1XVOA 1T31A 1COWD 1PPHE 2P94A 2ZF0H 3ATIA 2WSSD 3ZZ7A 5JBTA 5DP8A 2J4IA 3DUXH 1SGFA 3V0XA 1ZTKA 3BEUA 1RS0A 3UREA 4X0WU 3S9AA 1QA7A 3W95A 1DICA 2NU1E 3EA9A 1P8VC 3EDXB 3A8DA 3SO3A 1ESTA 4QT8C 3EGKH 2ZA5A 4X6PA 3V12A 1ZHRA 4WXVA 2F91A 2J95A 4YT7H 2ZU2A 2GV6A 3MO9A 1CGJE 3A88A 3RXDA 1O2HA 4B6EA 1C5MD 1ETSH 1P03A 3PRDA 4JMYA 3LGUA 1PPFE 3MO6A 5E2OA 1GHVH 5A8XA 4XBDA 1EP5A 2OLGA 1AUJA 1L2EA 1NT1A 2TRMA 2BVRH 8KME2 3S9BA 2LNCA 1MAXA 1SMFE 1FDPA 5I46H 4MDSA 1GJ9B 3PMJA 3RXHA 1X7AC 3ZV9A 5F8XA 4AFQA 2P3UB 2ZU3A 2P3TB 3NZIA 3T27A 1CQQA 3OY6U 1NFYA 5CHBA 4A1VA 5DP3A 4FUDA 4ZKSU 1S5SA 1C2KA 3R3GB 2FYRA 2KCOA 2BD7A 3FZZA 3P17H 2UUYA 1WXRA 3NUMA 1K28D 1NU9A 1TBRH 1V2KT 1O34A 3UR9A 1MZDA 3PB1E 3PTNA 4CHAC 5T1VA 4X2VA 1G3CA 2ZGBH 1NTPA 1O32A 4KGAA 2Z3DA 1ZHMA 2BQ6B 4Q2KA 3SNDA 3ZYEA 1PPCE 4FETA 3MU1A 2OP9A 5A8YA 1SFQB 1C5YB 1P2NA 1P2QA 3SU3A 1K9OE 4BAHB 1EJAA 3TH2H 1F5LA 4X6OA 1DX5M 1SGRE 2GT7A 1IQEA 1QRZA 2SGEE 3OAAD 4E06H 4IC5A 1O3GA 1OOKB 1CHGA 4YOIA 2QXHA 5A09A 4K3JA 1EJMA 4WXIA 1O35A 5DJ7A 3KF2A 1TQ0B 2ANYA 2CF9H 1D4PB 1JOUB 3D62A 3GY2A 4GCHF 2GD4B 3RC4A 1GMCF 1WQVH 3P6ZB 2G51A 4GUXA 3A80A 1GBBA 1JRSA 1UTPA 1YCPM 2GX4A 1ELFA 1EKBB 1NROH 2Z9KA 4MPUA 1C1PA 2FMJA 5JBBS 4JCNA 1H8ED 2BX3A 1HAVA 1Q31A 1GBAA 4TWYA 1HAZB 1O3FA 3ATWA 2W6JD 2BXUH 5F8TA 3SUDA 1FIWA 1O2LA 2PKSC 3UWJH 1H8HD 3SGQE 4Q7YA 3TK6A 1E1QD 3RXPA 4Q63A 1MTNB 2H9EH 1KTTB 1QQ4A 2G5VA 1VITF 2AGEX 5EPNA 1O2QA 5H4IB 1GBTA 2TBSA 1S6LA 1MTNC 4AGKA 4X2XA 3PLBA 3SHCH 1SFIA 2QN5T 4ZAEA 4X1QU 9ESTA 1NRNH 4H6TA 2C8XB 3LKWA 1SR5C 1AU8A 4AORA 3TU7H 1GWAA 3SGBE 1GGDB 1SHYA 4HI3A 4OS1A 2F83A 4OS2A 1HAIH 1SOTA 4YOJA 2K8IA 4UONA 2FPZA 2VB0A 1P09A 1C5LH 1O3BA 2A1DB 4X8TH 1SOZA 4B76A 1O38A 1W8BH 4YM9A 1O2RA 2DE9A 1A5GH 1AVGH 1ZSJA 3FO8D 1GGDC 4YLUA 1JIMA 1O2XA 1EZXC 4NSYA 1LHCH 1MTVA 2FWWA 1ETRH 4CR5A 1PFXC 1BJVA 2XTTB 1FY1A 3DCLA 3E91A 1GDNA 1MU6B 1IHSH 1PQAA 1UJ1A 4LXBH 4BTTB 5L2ZH 1QJ1B 4OS7A 2BY7X 4YZUA 2QF3A 1D3PB 1ANCA 1ESAA 3UB0A 5IDKA 1A46H 1OS8A 1TWXB 2ZG0H 3LT3A 4I7YH 3Q3KA 5I25A 3SU6A 1O3PB 1O5AB 4AG2A 1DWEH 2Y5GA 2V35A 3MO3A 1JMOH 2ZDKA 1FPCH 1C9PA 1HUTH 3LH3A 1QURH 5HKKD 4THNH 1Y59T 5FCRA 2JDID 4Z6AH 1OYTH 1ZRBA 2QF5A 1P2OA 1BRBE 1H9IE 1AKSB 2AH4X 1ABJH 1QHRB 5FBIA 1KMHB 2BY8X 4FUJA 1AUTC 2GV7A 2BDHA 2TIOA 2VVUA 4HZHA 1W2KH 1GHXH 2H5DA 2QAAA 3GISB 1GBLA 1BBRH 1QRWA 3K9XB 3LGWA 3M7QA 4A1XA 3HGPA 1LQDB 3SV7A 2A4RA 1ELAA 5K7RA 2BD2A 2I6SA 2W3IA 1G37A 2LELA 1C2EA 1GI2A 1ANDA 4JZIA 1Z7KA 2Y6TA 3ATLA 4YXWD 1AMHA 1OWKA 2OQ5A 1CSOE 5L2YH 1GJ8B 4XD7D 2EA3A 1GDQA 3O8CA 1QRXA 1LDTT 4BNRA 7ESTE 3MNCA 5T6DA 2CMYA 4NA8A 2QIQA 1HJ8A 3ZVEA 1S0RA 2Z6BD 1C1OA 4GHTA 1GPZA 5EGMA 4AFSA 1ELBA 3ZVDA 1O2IA 1GBHA 2GMTB 1O5DH 3SJIA 3F0OA 1EOJA 1WU1A 1IQLA 2HNTF 1CE5A 2FIRH 3FOAA 1ELVA 1QCPA 1TNGA 2AMQA 1CHOF 4BTUB 1UK4A 2GMTC 1XUHA 4ZUHA 3PLPA 5T6GA 2F43B 3ZVGA 1L1NA 1C5ZB 3PMHB 4PROA 1V2LT 1PPGE 4J2YB 4ASUD 2M2AA 1F5RA 1F0SA 1LHDH 1N8OB 3L33A 3L6PA 4MNWA 1P2IA 3A8CA 3Q3XA 5JB9S 2XBXA 1CT4E 2FOAA 4ZXXH 1FNIA 3RXEA 1GL0E 2O8LA 1KDQA 3LPRA 1N6YA 2RA3A 1AFQB 2IOTA 2PSYA 1O39A 3E0PB 1KXAA 2NU3E 2AERH 1TNJA 1L0ZA 1F7ZA 1S81A 4D9QA 1P10A 1AFQC 3M5MA 3E0NB 3JZ2B 2HOBA 3VFEA 3FKSD 1YPHE 2KCPA 3RXUA 1EUFA 1SC8U 1SVPA 2Q1JA 4UEHH 5C1UA 3PWBA 1AZZA 1N1LA 1TRYA 3GY3A 1C2GA 1RIWB 3BEFB 4GPGA 1V2JT 3A8AA 4INLA 4NZLA 1TMTH 1F2SE 3MU0A 2ODYB 5DGJA 1RIWC 1Z71A 4CREA 1YYY1 1E37B 1HJ9A 1SBWA 2BD9A 1TRMA 2F9BH 1QA0A 3A7WA 2XC0A 2G4UA 5HM9A 5CE1A 2QXIA 2PTNA 1TE0A 4TPIZ 1BTUA 1DS2E 3ZVBA 1OKXA 1LKAA 2QGRA 2Y7XA 4WY3A 1O2TA 3SZNA 2RG3A 1AB9B 2EI8A 2O9QA 1EAXA 2UUFB 3I78A 1C2FA 1VZQH 2ZU5A 1AN1E 1V2VT 3E6PH 3SW2B 1WTGH 1UVOA 2VIVA 3F9EA 2H9TH 1AB9C 3PMBB 3RC6A 1EJNA 1KLIH 4MLFB 1Y3VA 3STJA 4CR9A 3E8LA 3QTVH 1FY8E 1Z1IA 2ANWA 1HNEE 4Q80A 2H6MA 3S7KB 2C4FH 3RUOA 1P2KA 3RU4T 5A0AE 1OP0A 1OWDA 5LH8A 2J92A 5F8ZA 1G30B 4ISIH 4WH6A 2ZDNA 1Z8GA 3EAJA 2B9LA 1L4ZA 1ZRKA 5GJ4B 3PM3A 2SGPE 1O3AA 1KTSB 2ZFFH 1C2DA 2FM2A 1GI1A 1KSNA 1K1MA 2Y81A 1DITH 1S0QA 2A4GA 2Z9JA 1TMBH 4MPXA 2ZGXH 1H8IH 1HCGA 4KTSA 4MPWA 4OM9A 2BDGA 4AOQA 2K1QA 4MNVA 3A85A 5L30H 1S85A 3NKKA 4XBCA 4UD9H 5HMAA 3L3TA 1BT7A 1L4DA 1PPEE 3UPEA 6LPRA 1EB2A 2PKAA 3RXKA 1D3DB 1O3OA 2PSXA 3SOSA 1OYQA 1Z8IB 4IMQA 3URDA 4RI0A 1XUJA 1YGCH 1O3KA 1BBRK 1QIXB 1TGBA 1UO6A 3SN8A 1TLDA 1HAVB 1WUNH 5EQQA 3Q00A 1F5KU 3S9CA 1Y5UT 1O33A 4NIVA 2HALA 3T5FH 1V2ST 1SLVB 4NCYA 3KL6A 4X2WA 3ZVAA 1BHXB 3PV5A 3LOXA 2BQ7B 2H9HA 3AAVA 4X8UH 1P04A 4Y0YE 2XWAA 2BYAX 1P06A 2F9VA 3MFJA 2G81E 2PTCE 3FZDA 5T3HA 4OGYA 1QR3E 2XOKD 1QB6A 2BLOA 3PTBA 2VU8E 4K1TA 3PWCA 1DSTA 1ZYOA 2BDAA 2WINI 3AW1A 1J9CH 3GCOA 2A2XH 3GDVA 1GL1A 1YPEH 1GJCB 2G00A 2ZDAH