2F9VA

Hcv ns3 protease domain with ns4a peptide and a ketoamide inhibitor with p1 and p2 cyclopropylalannines
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
183
structure length
183
Chain Sequence
MGAPITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Depeptidization efforts on P3-P2 a-ketoamide inhibitors of HCV NS3-4A serine protease: Effect on HCV replicon activity.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein
molecule keywords NS3 protease/helicase
total genus 43
structure length 183
sequence length 183
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2f9vA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2f9vA01
1HV7A 2XBXA 3M7TA 5LH8A 4D9QA 1C2FA 1O36A 3RXDA 4SGBE 3URDA 3OU0A 1DS2E 1DWDH 4A1XA 1LHGH 1W8BH 3BTME 1SPJA 2QV1A 1AIXH 2TBSA 2XTTB 2BDHA 3SGQE 1DPOA 3D65E 1YPHC 1TMTH 1AO5A 3LJJA 1C1MA 2VIWA 4K8YA 1TGTA 2ZQ2A 3TH3H 1GHBG 3LH3A 4AG2A 5GWZA 1GGDB 3LGIA 1O2RA 4D8NA 5C1XA 4NWKA 1TBRH 3CENA 4M9FA 1C5QA 1G37A 2Z9KA 4ASHA 5F8ZA 4GLYA 1WBGB 2UUFB 1BTWA 2ZIQH 1V2OT 2TIOA 3RP2A 5E8EH 1ZHPA 3UUZA 1TGNA 1OWEA 5K7RA 1O35A 3ITIA 5DP4A 3PTNA 2OUAA 3TNSA 2JKHA 2JH0D 3ZZ6A 3CP7A 1HAVA 3M5LA 2A4QA 4MPWA 2ZDKA 1BUIA 2JETC 1SQOA 1F5LA 1TNHA 5GJ4B 1TGSZ 2V6NA 1FAKH 4BNRA 1GL0E 1SGFA 3SU2A 1FLEE 1KXFA 1GCDA 2A32A 1DM4B 3SJ9A 2J34A 2PW8H 3TVJB 1HAVB 1HJAB 3D49H 1TYNA 2BTCE 2FOMB 2UUJB 1P2IA 3MOCA 3HK3B 1EAUA 3OSYA 3SNAA 2PUXB 1TOCB 2BZ6H 1VITH 1OX1A 3ATKA 2ULLA 4JMYA 1G32B 1BITA 4MPUA 4HGCA 2XXLA 2QAAA 1EZXC 2BB4A 3M36A 1NN6A 2VIVA 5TCCA 1SG8B 3SORA 4A6LA 4K1EA 2ZCHP 2BLWA 2ZWLH 3GY4A 1GG6C 1LPZB 5GIBA 1T7CA 1FY4A 2O8WA 1WUNH 4K5ZA 2UWPA 1EAXA 1V2PT 2PKAA 1O2SA 1GMCG 3F9GA 2H5CA 3M61U 1HNEE 1C5OH 4XOJA 1NFXA 1XVMA 2ZHQH 2PUQH 2R0KA 4IGDA 1MU6B 3RXTA 3C1KA 3E91A 2WUBA 2Q6GA 4GHTA 3LGUA 2BXTH 5PTPA 4IC6A 2GT8A 1ESTA 2BD7A 4FUCA 1GDUA 5E2PA 3ATLA 3M3VA 1F5RA 2LPRA 1TNJA 4AFQA 1N8OB 1P11E 4DW2U 5GNDA 1OWHA 3MU5A 4X8UH 3UWIA 4AB8A 2FOHA 3H7TA 3OY6U 2Z3EA 4UFDH 3DHKH 3ESTA 1IQFA 1GJAB 2BD3A 4BOHA 1O3AA 3OTPA 2P3FH 2ZI2H 1C5UA 1D3TB 1TNGA 1S85A 1YGCH 2BDGA 4Y8ZA 1KTTB 3IWMA 4Y71A 1JBUH 3EA7A 1AI8H 1GBJA 5AFZH 1AQ7A 2VINA 2P3UB 3B9FH 1O2HA 1FQ3A 5GDSH 2I6QA 1EUFA 1P2OA 1A61H 2PLXA 5EQSA 3IG6B 2C93B 1BHXB 4NA8A 1O3CA 3PWCA 4HI3A 1HJ9A 1AY6H 2ZECA 4WMDA 5FX5A 5GCHG 2QXJA 2Y7ZA 2FTMA 1NFUA 1NRQH 2ANWA 3DT0H 1QA7A 2FYRA 4BTTB 3RC5A 1KXDA 4Y0YE 3ZZAA 3SJ8A 2YNAA 1V2WT 2EC9H 1GJ7B 1WTGH 3E16B 4U2WA 4B76A 1A4WH 1UTLM 1C9TA 2FWWA 3ZZCA 1T8LA 2ZU2A 3CS7A 3PROA 2BDYA 1WAYB 2AYWA 1O3GA 3RDZA 1O2MA 2H6MA 1GHVH 2HALA 1XUGA 3TGKE 2UUKB 2ZTYA 3RXLA 1P2NA 1P09A 3MWIU 4WVPE 1AU8A 1F2SE 4I8LA 4MDSA 3UNSA 1Z7KA 1GI6A 1G3EA 2A7JA 1BTPA 4B6FA 5JYIA 4AYYB 4MLFB 2A4RA 1CE5A 2ZFFH 1MKXH 3FVFB 5DP8A 2HNTE 1EXFA 1WQSA 2ZKSA 2B8OH 4CR9A 1Y5AT 2GZ8A 2Z9JA 1V2JT 1IOEA 2HPQH 1W12U 1MTVA 2VIQA 2CGAA 3ATWA 4DT7B 4H6TA 5DP5A 3QN7A 1SGRE 1PQ5A 1TABE 2A0QB 1IQNA 4MTBA 1GGDC 1O3NA 4H4FA 1M9UA 2BHGA 3A87A 3TJUA 1N1LA 1HJ8A 2ALPA 1A1RA 4NA7A 2AMDA 1NY22 1V2QT 3RMNH 4ISOA 4TWWA 4F4OC 2AFQB 3PMHB 3BEFB 1GDQA 1KLTA 3PM3A 2WUCA 3U69H 2IJD1 1VGCC 4OS7A 4XBBA 4JK5A 1RFNA 2YOLA 1L1NA 3LKWA 4UFFH 5DP6A 4INKA 2GX4A 2UUYA 4ZH8A 4IS5A 1SQTA 2W7SA 3JZ2B 3BN9A 1OXGA 3U8OH 3SYJA 3KQCA 5CHAB 1O2LA 5EW1H 2ZGXH 3A83A 3SJIA 1ELAA 3E90B 4NZQA 2FP7B 1DWBH 4JZFH 4RKOB 4KP0A 2WV4A 3PLPA 1JRTA 1GJCB 3UNQA 4JYVH 1UVPA 3E8LA 1IQLA 2XBYA 1FXYA 2ODYB 3BG8A 4JCNA 4B74A 2FOCA 1O2PA 4INLA 1CHGA 2BVRH 1Z6EA 3SOSA 3ENSB 3SU3A 1H4WA 3HKJB 1BTUA 3NCLA 1XMNB 1YBWA 2THFB 2VB0A 5FPTA 2BY9X 2V35A 1V2RT 4TY7A 4YTAA 5J4QA 2VWMA 1HAPH 4AX9H 1ZSJA 3TNTA 2STBE 3E0PB 1TGBA 2TGTA 1LCYA 1Y3YA 3GCTG 1AE5A 3TK5A 1VITG 2GGVB 1RIWC 1C2LA 1MMJN 2FIRH 2ZQ1A 2TRMA 3SU6A 2J2UA 3U8RH 1DITH 1CVWH 4KTSA 1DSUA 3RU4D 1FY1A 4NZLA 2Q6FA 2TGPZ 4CBNA 2VWLA 5DG6A 5JB9S 1OWIA 1D6WA 3QO6A 1GI5A 2FZZA 1V6DA 2FOAA 2VNTA 1UTQA 3KQBA 3UY9A 3AW1A 1BRAA 1A5IA 2F9PA 1LMWB 1KDQB 2J92A 3V12A 1LVMA 3RXAA 3KL6A 1Y3XA 2OC8A 4B6EA 3T2NA 4BANB 2QY0B 3MNCA 2BOKA 1HB0B 4DCDA 2BDIA 4X8VH 3PMJA 1ESAA 3WY8A 3P92A 2SGQE 1DY8A 1ORFA 1VGCB 1MTNC 1ZPZA 2XW9A 3RXQA 4MG3A 3FAOA 4Y11E 1AD8H 1GHBF 1EAIA 2ALVA 4K1TA 2BMGB 1UTJA 2NU1E 1OP8A 2J38A 1RGQA 1E37B 2ZFPH 3FP8E 3VB6A 4OGXA 3BIUH 2F9NA 3M3TA 2FS8A 4X6NA 4DURA 4FU9A 1N8OC 3GY7A 4YO9A 2GCTB 5LPEA 1LKAA 2HLCA 5TJXA 2B9LA 2QF0A 3SBKA 1U6QA 4SGAE 3LC3A 1S82A 4O3TA 4JK6A 1EB1H 1O2WA 3LIWA 5HM2A 1TX6A 1O2XA 3A82A 3KQDA 4OGYA 1OYTH 1GBHA 3V3MA 1C2EA 4ABIA 1T4VH 2BVXH 3L3TA 4B73A 5DK1A 1GI3A 2Z9GA 4KTCA 4WWYA 1V2NT 5A0CA 1MD8A 1QRWA 1QJ1B 1AFQC 1DUEA 1YPMH 4WXIA 5EPNA 3SUFA 1AWHB 4ABJA 1P8VC 4CREA 1C1VH 3VFEA 1AWFH 1UO6A 4X6OA 4ZXYH 2G5NA 2XC4A 1J14A 3A88A 1KDQA 2C4FH 1TIOA 1JRSA 1EB2A 5B6OA 3BTKE 5C67A 1V2VT 3E0NB 1LTOA 3A84A 4VGCB 1SGNE 4TWYA 3T25A 3U98H 1GVZA 1NRNH 2QN5T 1GI4A 1BA8B 2P95A 1BTHH 3DFJA 3SU4A 1RRKA 2Z9LA 5F6MA 1JWTA 2BQWB 1KXCA 1P2JA 2A5KA 3BIVH 3UOPA 3SI4H 1UTNA 1SGEE 2ZEBA 5FAHA 5FPYA 3GDUA 1TOMH 8ESTE 3T29A 1ELEE 4X2XA 2FI5E 2PR3A 4BAKB 1UJ1A 2F4LA 3GYLB 4Y76A 2BQ6B 1W7GH 4FUFA 3B23B 2FI4E 1P02A 4B2CA 1Y3WA 3TJOA 1J9CH 1GHAG 3DFLA 3KQEA 3TH4H 4D7FA 1AB9B 1GHZA 1GJ5H 1BTXA 5JBCS 1SMFE 1C2MA 2ZCKP 1Z6JH 1BQYA 2GV6A 4O9VA 1TRMA 4DG4A 2OBQA 3LGWA 4X6PA 5JBTA 4UEHH 3EQ0H 4ABHA 1S6HA 3PO1C 1GJBB 1NT1A 2FYQA 1HYLA 1OKXA 2G5VA 3PV5A 4I7YH 1J8AA 1LPGB 3ZZDA 1QRZA 1FI8A 4AORA 2DE9A 1P3CA 2WPKS 1GJDB 3W95A 1TA2A 2GT7A 1NM6A 1C5ZB 3RXPA 3QGJA 5DKMA 2PTNA 5E0JA 4BAMB 3P8FA 1O30A 3LJOA 2OTVA 1FPHH 1OWJA 3ZVEA 3AAUA 3BTTE 1ETTH 1HFDA 3C27B 1YPEH 3A7ZA 3GISB 1BMNH 8LPRA 3S9CA 2STAE 3P70B 3SHCH 1Z1IA 1O3EA 3QX5H 3A81A 5F8XA 1SGQE 1TFXA 3URCA 4A1TA 1AUJA 1OYQA 4NG9H 4CH2B 1B7XB 1YPLH 1ANDA 3VB5A 4CHAB 1TPPA 1GHYH 3QTOH 3GY8A 1P04A 3BF6H 1UHBA 2FLBH 3ZVFA 4XBCA 2QF3A 4WMEA 1C5SA 4NIYA 2Z9IA 3FFGA 1LHDH 1VCWA 2O9QA 1NS3A 1DFPA 1AKSB 3PLKA 5AFYH 1O39A 1C2DA 3Q77A 3AK5A 5DP9A 3QK1A 2UWLA 4NIXA 1TRNA 3O8BA 4Y7BA 2ZGBH 1SOTA 4OS6A 1C1OA 1K1PA 4ZKNU 1CO7E 1HLTH 3UR6A 2PWXA 1SFQB 3P95A 4BAHB 3NKKA 4X0WU 1O3HA 3D23A 4ZHAA 2XRCA 2UWOA 4X8SH 2Y7XA 4I8KA 6ESTA 1W3CA 4D76A 2J9NA 1QQUA 4E05H 1QIXB 2VBCA 7LPRA 1L2EA 4WH6A 1O34A 4GHQA 2H1UA 1P03A 3LGTA 4BTUB 1FNIA 3QTVH 3RXBA 1MZAA 1THSH 3VPKA 1EZUC 2G81E 5HGGA 2CHAC 5DJ7A 1Z1JA 2ZFRH 3ZZ8A 2P8OB 2ZPRA 1GJ6A 5EOKA 1O2OA 1D3PB 2BDCA 1GHWH 2VIOA 3P17H 1F0UA 1QL8A 3TJNA 4DGJA 2WPMS 1C1NA 2ZU4A 1JIRA 1P9UA 2ZU3A 3PTBA 4OS1A 2GMTB 1DVAH 2BYAX 4BAQB 2NU2E 4BXWA 8GCHG 3ZVBA 1XUIA 2FODA 1UTMA 4JZ1A 4NIWA 2GZ9A 1BOQA 1W11U 1AVGH 2RCEA 2XBWA 2BY5X 2BX4A 3TK6A 1P12E 4I8GA 4HTCH 5A09A 2RDLA 1TGCA 3BTEE 2EA3A 3QLPH 1BT7A 2VIPA 5C2ZA 2H9HA 1CQQA 1MBMA 3GDSA 2VH0A 1LQEA 1E0FD 2ZGHA 4Q2KA 3SV2H 4KGAA 1GWAA 1ZMJA 2CF8H 1O2ZA 1AUTC 4R8TB 1O2KA 1ZSKA 4K2YA 2ZNKH 1LQDB 4WH8A 3SNDA 5ABWA 3P6ZB 4FVDA 5LPFA 1ZGIA 1CU1A 1QRXA 2GP9B 1WSSH 1O38A 5LGOA 3M5NA 3TK9A 1C4V2 1GI1A 1F0TA 1QFKH 1LVBA 4JZIA 2BDAA 3ZZ7A 4A5TS 2KAIB 3S9AA 4IMQA 2H9TH 4J1YA 2WPJS 1ZTKA 1MZDA 1F7ZA 1A3EH 1K9OE 2ZDVH 1C1UH 1NRRH 1GG6B 3TH2H 4ZMAH 4IMZA 3I29A 1C1SA 1WYKA 2ZGJA 3SQHE 2Q6DA 4VGCC 4CHAC 3V13A 4E7RG 1HUTH 3SUGA 1TE0A 3A85A 1O3LA 3RM2H 1A0LA 3PMBB 4LOYH 4CRBA 2AGIX 3RMOH 2OXSA 4FUDA 5EGMA 1O3JA 5A0AE 2SGEE 5LPRA 2HVXA 1DT2A 4A7IB 2FI3E 1JOUB 1LVYA 5A0BA 1L1GA 3HPTB 3KCGH 5EODA 1IHSH 6CHAC 3RXEA 3TITA 1C4Y2 5EU8A 5EXNA 2FOGA 1T31A 2WV5A 1O33A 5FCRA 5A8XA 1AZZA 2R9PA 3EA9A 2D8WA 2JH5D 4TY6A 2BM2A 2OC7A 3MTYA 3LU9B 3UPEA 1K22H 2O8TA 3GCNA 1BDAA 1XUHA 2A4GA 2IJOB 1KXAA 1WOFA 3VB4A 1DUAA 5FPSA 1GMHG 4CRCA 1SGIB 1O3KA 3SHAH 1A2CH 3GY3A 1A0JA 2VU8E 4MPVA 4FUGA 3S69A 1EX3A 2G55A 5J4SA 1NROH 1O5AB 1ETRH 3LC5A 3A86A 1QA0A 4Y8XA 1WXRA 4ABAA 4BTIB 1H1BA 2D1JA 2OINA 1HIAA 1SFIA 2WZQA 1TMUH 2HGTH 2XCFA 3RXSA 3ZVGA 3KHVA 2DE8A 3QDZB 4I8JA 4E7NA 1C1PA 7ESTE 2ZFTA 4YOGA 1SGPE 3A7XA 3GCHB 3A8DA 1L0ZA 3MU4A 1ZSLA 3AW0A 1SHYA 5HYOA 5AF9H 2SFAA 1Y8TA 2VVCA 1PQAA 1NRPH 1ZPCA 2GDDA 3K2UA 4NCYA 3SNEA 1AFEH 1O3MA 1YYY1 2P3TB 2OC0A 1FUJA 1FPCH 1UCYK 1ZGVA 1OWDA 3ZVAA 3RXJA 3A80A 2W5EA 4AFSA 2QCYA 4A92A 1SBWA 1TMBH 1C5NH 7GCHG 2ANKH 2ANMH 1KSNA 4FUEA 3NUMA 3EE0B 3ATMA 1GI8B 3PMAB 1XUFA 1FIZA 1MTNB 3ZZBA 8KME2 1C5WB 2ZC9H 1W10U 3RC4A 2BVSH 1MKXK 2Y80A 2YNBA 1UVOA 4A1VA 1MCVA 2G4UA 4O3UA 3SUEA 2BY6X 3HATH 4XFQA 2QA9E 2EI6A 1G3CA 4NFFA 2BD8A 4GSOA 1E34B 1G9IE 3A8CA 3M7QA 1OWKA 1IQHA 1IHTH 5HM9A 1SLXB 2CHAB 5EQQA 2SGPE 1C5VA 3LGVA 3FZZA 4Z6AH 2ZZUH 1P2KA 3ZYDA 1L4ZA 4FUBA 1W2KH 3TLOA 2PHBA 3A7WA 1Z8IB 1SB1H 1SGCA 1DICA 2GDEH 4Q7XA 1CHOF 6LPRA 1J15A 2Z7FE 4Y79A 4Y0ZE 1DANH 2OP9A 1XUKA 2QIQA 1DX5M 1SI5H 1GJ4H 3SV7A 2Y6TA 1OS8A 1W13U 2FO9A 1CGIE 2ODPA 5L2YH 2OD3B 1FN8A 1P9SA 1G2LA 1CT2E 1F0SA 3M5MA 1AMHA 4HFPB 1EASA 2FX6A 2SNVA 4DIHH 4MQAA 4YT7H 1QY6A 5G4BA 4X1RU 1EP6A 2A31A 4NGAH 2ANYA 1DXWA 3VEQB 3K65B 2G8TA 1FY5A 3MH6A 9ESTA 1ZMNA 1K1IA 2BZAA 4ZROA 5EXLA 4B2BA 3PB1E 1ZJKA 3A8AA 5T6FA 1V2MT 3O8DA 1TQ7B 2TGDA 1FMGA 5DGJA 3RXHA 5A8YA 1ZRBA 1ELTA 4ZKRU 2ZDMA 2FPZA 2GMTC 1ELVA 2BD9A 7KMEH 2BLOA 1IAUA 2HOBA 1KIGH 4ZXXH 2DUCA 3RU4T 5AHGH 1Y5UT 4YM9A 3A7VA 3BSQA 4ZKOU 1SGDE 1KXEA 3A7YA 2B5TB 4CRFA 2D26C 2VVVA 1ABIH 4GPGA 5H4IB 2XC0A 1BJVA 1Z8RA 2Z3CA 1DWEH 1AZ8A 1NTPA 3UFAA 2CN0H 3F9HA 3K9XB 3MI4A 2C90B 1UTKA 1K2I1 4K3JA 1V2LT 4NIVA 2PV9B 3O8CA 2ZFQH 1RTLA 3LDXH 2BDBA 4AB9A 3A89A 1O37A 1TWXB 2O8MA 4XBDA 3T27A 3VGCC 4U32A 3PO1B 1TNLA 1GPZA 2VIDA 1C1QA 1QNJA 4B71A 4PROA 4NWLA 2W3IA 5FX6A 1NZQH 1C2IA 3UR9A 3UREA 3LT3A 1V2TT 3E1XB 3RU4E 2FOBA 1KXBA 2PSYA 3R3GB 4X1QU 3SJKA 1YPKH 1ETSH 1EATA 1Q2WA 2QGRA 4K1SA 3L33A 1A5GH 4DJZB 1EP5A 5CMXH 4D7GA 1BBRE 1C2JA 3MYWA 2CV3A 1TALA 3RMMH 1S83A 3ZZ9A 3UIRA 2Y5FA 4GCHF 1GCTC 3F9EA 4MVNA 3TGIE 3HGNA 3IITA 1UCYE 3DUXH 2XWAA 1FIWA 5DP3A 5ESBA 1S5SA 2FOEA 3BTFE 1S0QA 3NK8A 4TYDA 1DSTA 2A4OA 3U8TH 1XXDA 1Y3UA 2F9BH 4XSKU 2P94A 3RUOA 2SGAA 2ZU1A 1O3PB 3BG4C 3F68H 3Q3XA 2BX3A 1GBDA 2VWNA 5EXMA 4UE7H 4AZ2B 6CHAB 2ASUB 4UD9H 1HAYB 1MKWH 5EG4A 2ESTE 2FTLE 3GY2A 5JB8S 4FUIA 1Y59T 4Z0KA 2GCHG 5E0GA 1LKBA 3JZ1B 1OSSA 1GBFA 1D4PB 1WTHD 1H8IH 1AVWA 2XNIA 7GCHF 2ILNA 1RJXB 4Y10E 2LNCA 3SJOA 1CT4E 3SUDA 2FM2A 1PJPA 2ZPQA 1AKSA 5T6GA 2ZDLA 2TGAA 3M35A 1BZXE 3TJVA 3UQVA 2AMPA 4MPXA 2BQ7B 1P05A 1G3BA 4RKJB 4CBOA 3SZEA 1IQEA 3M3SA 2FXRA 4LXBH 1D6RA 3RMLH 2ODQA 1FONA 2ZDAH 3GCHC 4ABFA 1JIMA 2XWBI 5CHAC 1SC8U 4CH8B 2BOHB 1GBAA 4IC5A 1PPGE 1PQ8A 1UTPA 5C3NA 4JYUH 1MBQA 1IQKA 1A0HB 1G30B 1BHXF 3EYDA 1EOJA 2BD5A 3S9BA 5T3HA 2VH6A 2GVFA 1F5KU 1AHTH 1XVOA 4LZ4B 3RXMA 2Q1JA 5L6NH 3GCTF 1DOJA 2QXHA 1MAYA 1DLKB 1LPKB 1UTOA 4AGJA 2QXGA 3DD2H 4CRGA 3VXEH 1UHBB 3SQEE 3MO6A 2FDAA 1QTFA 5I46H 2G52A 2BD4A 2RA0A 3ZYEA 1PPFE 1QHRB 2P16A 3HGPA 4RSPA 1THRH 3SV6A 1MH0A 1C2KA 1E35B 2SGFE 1F92A 3NZIA 2WHXA 1WQVH 3VB3A 3S7HB 1ANCA 1C5PA 4ESTE 3HKIB 1FAXA 1O5CB 2V0BA 3M7UA 1YCPK 1XM1A 4DOQA 4OS4A 5F8TA 1SGTA 3BTGE 1SGFG 1NESE 1P3EA 1ZPBA 1ZHRA 4ZHMU 2AH4X 2BY8X 3OTJE 2BD2A 4YESB 1MAXA 1JMOH 1VZQH 1GVKB 1BMLA 4UFGH 5GPIB 1ZTJA 1MU8B 3SV9A 3L6PA 2FS9A 3LGYA 2WV9A 4B1TA 1LHFH 1S84A 1UMAH 4NA9H 1YLCA 1O3FA 3QUMP 1HXFH 1RD3B 3RXGA 4HZHA 4ZHLU 2PFEA 1T32A 5AVDA 5JDUB 1P2MA 1O5DH 2W3KA 3MO9A 4Q7YA 5BRRE 2Z3DA 4YT6H 1O5GH 4X2YA 1SR5C 2PKSC 1K1OA 1MQ5A 3MNBA 3P8GA 1K1NA 5JBBS 4R0IA 1SGYE 3M5OA 1MUEB 5K0HA 2O8UA 1W14U 1YLDA 4O97A 1MTUA 3SW2B 2G00A 1GBCA 2J94A 2R3YA 2H2ZA 2GTBA 5T6DA 1W0ZU 1RTFB 2WPIS 3SV8A 4DVAU 3ZZ5A 1QR3E 3PV4A 1YCPM 2ZHDA 2GCTC 4Y6DA 3T26A 2C8XB 1GMCF 4FXGH 1MQ6A 1A46H 5GXPA 1K1LA 1ELFA 4ABEA 3MO3A 1QGFA 1PPZA 1HAHH 2J4IA 2Z94A 3T62A 1B5GH 1KY9A 2OC1A 3Q3KA 1N6YA 2R3UA 1TPOA 3U1IB 2OQUA 3MH4A 1AFQB 4Q7ZA 3RM0H 1HAIH 1GMDF 1MD7A 2JH6D 5IDKA 2R2MB 1BJUA 3SU0A 3VGCB 1RTKA 1YP9A 1O2NA 3GCOA 5A2MH 2F83A 2ZHEH 3SU1A 1BTZA 5B6LA 1J17T 1CGHA 4UDWH 1H8DH 5I25A 2ZGCA 1NU9A 4X2WA 3I77A 4B2AA 4TPYA 1ELBA 1HJAC 2FMJA 3QZQA 2P8OC 1T8MA 1IQMA 1OOKB 2I6SA 2VJ1A 3I78A 3H09A 3ELAH 1ABJH 1K28D 2OBOA 4D9RA 1GI2A 1NFYA 2HNTC 1ZLRA 1EZSC 3BTHE 1O2UA 1SLWB 1C1TA 2AGEX 4O03A 3RC6A 1INCA 1F0RA 1X7AC 1O2GH 1D3DB 3RXUA 2Y82A 1YPJH 1O5BB 1A7SA 1V3XA 1CGJE 3ZV8A 1GI0A 1FV9A 2CF9H 1Q31A 1HAGE 3SO3A 2AERH 4TPIZ 1O2QA 1C5MD 2WPHS 3MH7A 4OS5A 3OY5U 2AMQA 1DXPA 2GKVE 2ZTXA 1RIWB 1UCYH 3FANA 1ACBE 1DDJA 4Y8YA 2A1DB 2HRVA 5FCKA 2Y5GA 1JXPA 1ZTLA 1KLIH 4BXSA 1IQIA 3ZV9A 1H9HE 2A45B 2PKSB 2HNTF 1H9IE 1AB9C 1S6FA 3TIUA 2ZO3H 1VITF 1GHAF 1THPB 1Z8JB 1CA8B 3S0NA 6GCHF 1QB6A 4CR5A 2V3OH 4WJG2 3LPRA 4AFUA 1ANBA 5FXLA 4ZAEA 1O3BA 1O3IA 2WPLS 2C8YB 1SSXA 2P93A 1ZJDA 3AASA 3AVZA 1P57B 2FLRH 2WINI 9LPRA 4AYVB 4OM9A 1NC6A 1BRUP 2BLQA 4XDEA 1HRTH 2W26A 4ISIH 4MNXA 2NU4E 2WYJA 1NFWA 2F9OA 4JYTA 1EJMA 4CRAA 5E2OA 4JZDH 2K1QA 1GMHF 2ZHWH 3Q3YA 2OCVB 5JPMH 1VJ9U 3KN2A 1GJ8B 1SOZA 2JETB 1ARCA 3SU5A 1TONA 5F03A 1E36B 1K1MA 1XXFA 2CJIA 1ANEA 3G01A 2A2QH 2EI7A 1S0RA 4MNWA 1Y5BT 4F49A 3ODDA 3KEEA 1HPGA 1P01A 1GI9B 3EAJA 5T1VA 3GOVB 2ZCLP 1OP0A 1RS0A 5A8ZA 3M37A 1CBWB 4YOIA 1QCPA 1YPGH 4BAOB 3ZZ4A 1CA0B 3VXFH 2AEIH 3H5CB 3HK6B 1QQ4A 2SGDE 3GYMA 1O3DA 1CT0E 1O2IA 4ISHH 3SNCA 2PSXA 4Y7AA 4AFZA 1HAZB 1GBTA 3MHWU 4IN2A 3SGAE 1BTYA 4X1NU 3E3TA 1Z71A 2R0LA 4MNYA 2XCNA 1HAXB 1B0EA 5EW2H 1IQGA 5IYTA 3ZZ3A 3K6YA 3KGPA 3DA9B 1FN6A 1CSOE 4B75A 1C2GA 1ELGA 1K21H 1HXEH 1P10A 1A3BH 2GV7A 4ABGA 1QBNA 3F1SB 3NPSA 2ZTZA 2FOFA 2M5TA 1HGTH 1NO9H 1BB0B 3QWCH 2Z6BD 1O5EH 1S81A 4XE4A 1D3QB 5CE1A 4AG1A 3UQOA 5JBAS 1DE7H 2PTCE 1Z8GA 1ESBA 1HBTH 3P8NA 4UFEH 1C5YB 5FHTA 1PQ7A 2GCHF 2KAIA 3A8BA 3V7TA 1IQJA 1LHCH 1C5RA 4QT8C 4ZUHA 3RXIA 2QYIA 1T4UH 2IPHA 4OS2A 2ZHFH 1ZYOA 3GICB 2NU0E 3ZVCA 1Q3XA 1QL9A 1EAWA 3NWUA 1BBRH 4LZ1H 5C1YA 2XC5A 4J2YB 2R2WU 1TAWA 3QGNB 3RXRA 8GCHF 3FP6E 1W0YH 2GD4B 2XBVA 1UVSH 2GZ7A 1UK3A 4X1SU 4FUJA 3MU0A 4CRDA 1K1JA 4ZKSU 4NSYA 1AVXA 3R0FA 1BCUH 3RXCA 3RXOA 1C5TA 1O32A 2BY7X 4MNVA 1PPCE 3SNBA 4K60A 1J16A 1KLJH 2C3SA 3KF2A 3EGKH 2OLGA 3RLWH 3PWBA 3BG4B 1AGJA 3MNSA 2AIPA 1QJ7B 4I33A 1NU7B 1O31A 2FESH 1PPHE 1L1JA 1TBZH 3SGBE 4DIIH 3EDXB 2CMYA 2H9EH 4U01A 2QXIA 4AN7A 4NFEA 1TPSA 3FZDA 2A7CA 1MKWK 1FJSA 3PV2A 3KNXA 1GBEA 1W7XH 3GDVA 2PGQB 2VGCB 1BRBE 4FVBA 1DY9A 1YF4A 1TLDA 2RA3A 3OX7U 1VCQA 1CBWC 1EPTA 3SN8A 3U1JB 1LO6A 1GDNA 2G51A 3CS0A 1TPAE 2C8ZB 2H5DA 1YKTA 1XKAC 1O3OA 1UVTH 3V0XA 1UK4A 1E38B 3H7OA 1C5LH 3LOXA 3W94A 1ZOMA 1GBLA 2HWLB 1FDPA 1N6XA 5TCAA 3UTUH 3UNRA 1LVOA 1QJ6B 1SHHB 1V2KT 1EPTC 3BV9B 1QBVH 1O2TA 1H9LB 3LONA 2ZF0H 1PYTC 3FP7E 4JZEH 1SL3A 4FUHA 1LHEH 1NPMA 3MFJA 1TX7A 4FU8A 5ESTE 1ZRKA 2AGGX 1XUJA 2V3HH 1EJAA 2PKAB 1YM0A 1G3DA 1AE8H 1GBIA 1O5FH 1TRYA 3MH5A 1YC0A 1T8NA 1C1RA 1ZMLA 1V2UT 2EI8A 5EPYA 1WV7H 4GVUA 1DLEA 3RXKA 1C5XB 4IW4E 3T28A 5GCHF 1DWCH 2NU3E 3RXVA 1GHXH 1FZZA 1ELDE 1GCTB 3QZRA 3MU8A 4AGKA 2FX4A 1BMAA 4GUXA 3RLYH 2A5AA 1QBOA 2B0FA 2A7HA 1SQAA 4KELA 2TPIZ 1GBBA 2PGBB 1L4DA 1V2ST 1Y3VA 4YLQH 3TPIZ 1LDTT 2CXVA 4KKDA 3D62A 2ZG0H 1GJ9B 1KYNA 1GBMA 2F91A 4K8BA 5FBEA 2NWNA 3UOUA 3TU7H 5HMAA 4E06H 1TA6A 3N7OA 2HPPH 3BTWE 3T5FH 4X6MA 1VR1H 4WXVA 3OYPA 1P2QA 4IN1A 5SGAE 1KTSB 5BPEA 1FY8E 2F3CE 4ABDA 4FU7A 4IBLH 2A2XH 1PYTD 3BTDE 3BTQE 3NXPA 3ODFA 2BXUH 2VGCC 2ZDNA 1HDTH 1CA0C 1FY3A 4ISNA 4WMFA 3RXFA 5HXFA 1EOLA 3MNXA 3E6PH 4I32A 3Q00A 1QB9A 4NSVA 1P0SH 4KTUA 2Y81A 1WCZA 4YZUA 3GY5A 2ZU5A 4X2VA 1OP2A 2SNWA 1P06A 1GL1A 1AN1E 3KIDU 4X1PU 4DY7B 5DPAA 1BRCE 2EEKA 1GVLA 3B8JA 2ZA5A 3UWJH 2P59A 2IOTA 1TNKA 3ATIA 3MU1A 4ISLA 4Q80A 1BIOA 2W7UA 4WF8A 3ZVDA 1WU1A 2C8WB 3U9AH 1C4U2 1PFXC 1EPTB 1SLUB 2XYAA 2ZFSA 4I8HA 4M7GA 4GCHG 2F9VA 1GBKA 4WY3A 4INHA 1ID5H 2A5IA 2OK5A 1QB1A 1RXPA 1PPBH 1OPHB 2ZP0H 5C5NA 1EZQA 1O2JA 3S7KB 2AIQA 5DO4H 2F9UA 1TB6H 1CHOG 3A7TA 3Q76A 2IN2A 1YPHE 1TQ0B 1HIAB 2O8LA 5DP7A 4RN6A 2OQ5A 3MMGA 1BBRK 1D9IA 3F9FA 3BEUA 2ZPSA 1ARBA 1TX8A 1ZR0A 4GAWA 3K6ZA 5EQRA 4AOQA 1TBQH 3GY6A 3SZNA 5C1UA 2WYGA 3STIA 1HAOH 1NRSH 2Y5HA 4I31A 1XX9A 1O0DH 3BEIB 4X8TH 4YLUA 1EKBB 2AS9A 1QL7A 2J95A 1O2VA 1O2YA 3SI3H 3EA8A 1SLVB 1GI7B 1MCTA 1ZZZA 4RI0A 1G36A 5C20A 5L30H 4H6SB 1MTSA 1HCGA 1MTWA 1PPEE 2VVUA 2D2DA 1C9PA 1EQ9A 4LK4A 3STJA 3VB7A 3F6UH 2FEQH 5ETXA 3O8RA 1C1WH 5FBIA 1BMMH 3PYHA 4U30A 2BLVA 4ABBA 2G4TA 3TGJE 1YCPH 1VJAU 1B0FA 2VWOA 3LH1A 1QURH 1TNIA 4K69A 1A5HA 1ZHMA 1GMDG 1UVUH 1SVPA 4H42U 4THNH 2B7DH 1UK2A 1C2HA 1ELCA 5C5OA 1EJNA 2QC2A 4UONA 3PLBA 5L2ZH 6GCHG 4YOJA 2RG3A 1G2MA 1XKBC 3AAVA 5E0HA 1VCPA 1T8OA 3P8OA
chains in the Genus database with same CATH superfamily
1HV7A 2XBXA 3M7TA 3OAAD 5LH8A 4D9QA 1C2FA 1O36A 3RXDA 4SGBE 3URDA 3OU0A 1DS2E 1DWDH 4A1XA 1LHGH 1W8BH 2RDEA 3BTME 1SPJA 2QV1A 1AIXH 2TBSA 2XTTB 2BDHA 3SGQE 1DPOA 1SQRA 3D65E 1YPHC 1TMTH 1AO5A 3LJJA 1C1MA 2VIWA 4K8YA 1TGTA 2ZQ2A 3TH3H 1GHBG 3LH3A 4AG2A 5GWZA 4FETA 1GGDB 3LGIA 1O2RA 4D8NA 5C1XA 4NWKA 1TBRH 3CENA 4M9FA 1C5QA 1G37A 2Z9KA 4ASHA 5F8ZA 4GLYA 1WBGB 2UUFB 1BTWA 2ZIQH 1V2OT 2TIOA 3RP2A 5E8EH 1ZHPA 3UUZA 1TGNA 1OWEA 5K7RA 1O35A 2YMSB 3ITIA 5DP4A 3PTNA 2OUAA 3TNSA 2JKHA 2JH0D 3ZZ6A 3CP7A 1HAVA 3M5LA 2A4QA 4MPWA 2ZDKA 1BUIA 2JETC 1SQOA 1F5LA 1TNHA 5GJ4B 1TGSZ 2KCAA 1FAKH 2V6NA 4BNRA 1GL0E 1SGFA 3SU2A 1FLEE 1KXFA 1GCDA 2A32A 1DM4B 3SJ9A 2J34A 2PW8H 3TVJB 1HAVB 1HJAB 3D49H 1TYNA 2BTCE 2KR7A 2FOMB 2UUJB 1P2IA 3MOCA 3HK3B 1EAUA 3OSYA 3SNAA 2PUXB 5EIYA 4ASUD 1TOCB 2BZ6H 1VITH 4AC9A 1OX1A 3ATKA 2ULLA 4JMYA 1G32B 1BITA 4MPUA 3UB0A 4HGCA 2XXLA 2QAAA 1EZXC 2BB4A 3M36A 1NN6A 4ACBA 2JJ2D 2VIVA 5TCCA 1SG8B 3SORA 4A6LA 4K1EA 2ZCHP 2BLWA 2ZWLH 3GY4A 1GG6C 5HKKD 1LPZB 5GIBA 1T7CA 1FY4A 2O8WA 1WUNH 4K5ZA 1YY3A 2UWPA 1EAXA 1V2PT 2PKAA 1O2SA 1GMCG 3F9GA 2H5CA 3M61U 1HNEE 1C5OH 4XOJA 3FN8A 1NFXA 1XVMA 2ZHQH 2PUQH 2R0KA 4IGDA 1MU6B 3RXTA 3C1KA 3E91A 2WUBA 2Q6GA 4GHTA 3LGUA 2BXTH 5PTPA 4IC6A 2GT8A 1ESTA 2BD7A 4FUCA 1GDUA 5E2PA 2KZ4A 3ATLA 3M3VA 1F5RA 2LPRA 1TNJA 5GNDA 1N8OB 1P11E 4AFQA 4DW2U 1OWHA 3MU5A 4X8UH 3UWIA 4AB8A 2FOHA 3H7TA 3OY6U 2Z3EA 4UFDH 3DHKH 3ESTA 1IQFA 1GJAB 2BD3A 4BOHA 1UW7A 1O3AA 3OTPA 2P3FH 2ZI2H 1C5UA 1D3TB 3KYFA 1TNGA 1S85A 1YGCH 2BDGA 4Y8ZA 1KTTB 3IWMA 4Y71A 1JBUH 4Z1MD 3EA7A 1AI8H 1GBJA 5AFZH 1AQ7A 2VINA 2P3UB 3B9FH 1O2HA 1FQ3A 5GDSH 2I6QA 1EUFA 1P2OA 1A61H 2PLXA 5EQSA 3IG6B 2C93B 1BHXB 4NA8A 1O3CA 3PWCA 4HI3A 1HJ9A 1AY6H 2ZECA 4WMDA 5FX5A 5GCHG 2QXJA 2Y7ZA 2FTMA 1NFUA 1NRQH 2LELA 3U28C 2ANWA 3DT0H 1QA7A 2FYRA 4BTTB 3RC5A 1KXDA 4Y0YE 3ZZAA 3SJ8A 2YNAA 1V2WT 2EC9H 1GJ7B 1WTGH 3E16B 3F2GA 4U2WA 1A4WH 1UTLM 4B76A 1C9TA 2FWWA 3ZZCA 1T8LA 2ZU2A 3CS7A 3PROA 2BDYA 1WAYB 2AYWA 1O3GA 3RDZA 1O2MA 2H6MA 1GHVH 2HALA 1XUGA 3TGKE 2UUKB 2ZTYA 3RXLA 1P2NA 1P09A 3MWIU 2KCOA 4WVPE 1AU8A 1F2SE 4I8LA 4MDSA 3UNSA 1Z7KA 1GI6A 4P02A 1G3EA 2A7JA 1BTPA 4B6FA 3ZIAD 5JYIA 4AYYB 4MLFB 2A4RA 1CE5A 2ZFFH 1MKXH 3FVFB 5DP8A 2HNTE 1EXFA 4YXWD 5C17A 1WQSA 2ZKSA 2B8OH 4CR9A 1Y5AT 2GZ8A 2Z9JA 1V2JT 1IOEA 2HPQH 1W12U 1MTVA 2VIQA 2CGAA 3ATWA 4DT7B 4H6TA 5DP5A 3QN7A 1SGRE 1PQ5A 1TABE 2A0QB 1IQNA 4MTBA 1GGDC 1O3NA 4H4FA 1M9UA 2BHGA 2J98B 3A87A 3TJUA 1N1LA 1HJ8A 2ALPA 1A1RA 4NA7A 2AMDA 3N7EA 1NY22 1V2QT 3RMNH 4ISOA 4TWWA 4TT3D 4F4OC 2AFQB 2WPDD 3PMHB 3BEFB 4RT0A 1GDQA 1KLTA 2IJD1 2WUCA 3PM3A 3U69H 1VGCC 4OS7A 4XBBA 4JK5A 1RFNA 2YOLA 1L1NA 3LKWA 4UFFH 5DP6A 4INKA 2GX4A 2UUYA 2KCPA 4ZH8A 4IS5A 1SQTA 2W6ID 2W7SA 3JZ2B 3BN9A 1OXGA 3U8OH 3SYJA 3KQCA 5CHAB 1O2LA 5EW1H 5EJLA 2ZGXH 3A83A 3SJIA 1ELAA 3E90B 4NZQA 2FP7B 1QZ8A 1DWBH 4JZFH 4RKOB 4KP0A 2WV4A 3PLPA 1JRTA 1GJCB 3UNQA 4JYVH 1UVPA 3E8LA 1IQLA 2XBYA 3EE7A 1FXYA 2ODYB 2RFKC 3BG8A 4JCNA 4B74A 2FOCA 3FKSD 1O2PA 4INLA 1CHGA 2BVRH 1Z6EA 3SOSA 3ENSB 3SU3A 1H4WA 3HKJB 1BTUA 3NCLA 1XMNB 1YBWA 2THFB 2VB0A 5FPTA 2BY9X 2V35A 1V2RT 4TY7A 4YTAA 5J4QA 2VWMA 1HAPH 4AX9H 1ZSJA 3TNTA 2STBE 1VKYA 3E0PB 1TGBA 2TGTA 1LCYA 1Y3YA 3GCTG 1AE5A 3TK5A 1VITG 2GGVB 1RIWC 1C2LA 1MMJN 2FIRH 2ZQ1A 2TRMA 3SU6A 2J2UA 3U8RH 1DITH 1CVWH 4KTSA 1DSUA 3RU4D 1FY1A 4NZLA 2Q6FA 2TGPZ 4CBNA 2VWLA 5DG6A 5JB9S 1OWIA 1D6WA 3QO6A 1GI5A 2FZZA 1V6DA 5C0TA 2FOAA 2VNTA 1UTQA 3KQBA 3UY9A 3AW1A 1BRAA 1A5IA 2F9PA 1LMWB 1KDQB 2J92A 3V12A 1LVMA 3RXAA 3KL6A 1Y3XA 2OC8A 4B6EA 3T2NA 4BANB 2QY0B 3MNCA 2BOKA 1HB0B 4DCDA 2BDIA 4X8VH 3PMJA 1ESAA 3WY8A 3WWBA 3P92A 2SGQE 1DY8A 1ORFA 1VGCB 1MTNC 1ZPZA 2KCYA 2XW9A 3RXQA 4MG3A 3FAOA 4Y11E 1AD8H 1GHBF 1EAIA 2ALVA 4K1TA 2BMGB 1UTJA 2NU1E 1OP8A 2J38A 1RGQA 1E37B 2ZFPH 3FP8E 3VB6A 4OGXA 3BIUH 2F9NA 3M3TA 2FS8A 4X6NA 4DURA 4FU9A 1N8OC 3GY7A 4YO9A 2GCTB 5LPEA 1LKAA 2HLCA 5TJXA 2B9LA 2QF0A 3SBKA 1U6QA 4SGAE 3LC3A 1S82A 4O3TA 4JK6A 1EB1H 1O2WA 3LIWA 5HM2A 1TX6A 1O2XA 2QF4A 3A82A 3KQDA 4OGYA 1OYTH 1GBHA 3V3MA 1C2EA 4ABIA 1T4VH 2BVXH 3L3TA 4B73A 5DK1A 1GI3A 2Z9GA 4KTCA 4WWYA 1V2NT 5A0CA 1MD8A 1QRWA 1QJ1B 1AFQC 1DUEA 1YPMH 4WXIA 5EPNA 3SUFA 1AWHB 4ABJA 1P8VC 4CREA 1C1VH 3VFEA 1AWFH 1UO6A 4X6OA 4ZXYH 2G5NA 2XC4A 1J14A 3A88A 1KDQA 2C4FH 1TIOA 1JRSA 1EB2A 5B6OA 3BTKE 5C67A 1V2VT 3E0NB 1LTOA 3A84A 4VGCB 1SGNE 4TWYA 3T25A 3U98H 1GVZA 1NRNH 2QN5T 4XD7D 1GI4A 1BA8B 2P95A 1BTHH 3DFJA 3SU4A 1RRKA 2Z9LA 5F6MA 1JWTA 2BQWB 1KXCA 1P2JA 2A5KA 3BIVH 3UOPA 5FL7D 3SI4H 1UTNA 1SGEE 2ZEBA 5FAHA 5FPYA 3GDUA 1TOMH 8ESTE 5DSFA 1ELEE 3T29A 4X2XA 2FI5E 2PR3A 4BAKB 1UJ1A 2F4LA 3GYLB 4Y76A 2BQ6B 1W7GH 4FUFA 3B23B 2FI4E 1P02A 4B2CA 1Y3WA 1YWUA 3TJOA 1J9CH 1GHAG 3DFLA 3KQEA 3TH4H 4D7FA 1AB9B 1GHZA 1GJ5H 1BTXA 5JBCS 3N7DA 1SMFE 1C2MA 2ZCKP 1Z6JH 1BQYA 2GV6A 4O9VA 1TRMA 4DG4A 2OBQA 3LGWA 4X6PA 5JBTA 4UEHH 2J97A 3EQ0H 4ABHA 1S6HA 3PO1C 1GJBB 1NT1A 2FYQA 1HYLA 1OKXA 2G5VA 3PV5A 4I7YH 1J8AA 1LPGB 3ZZDA 1QRZA 1FI8A 4AORA 2DE9A 1P3CA 2WPKS 1GJDB 3W95A 4XRNA 1TA2A 2GT7A 1NM6A 1C5ZB 2WSSD 3RXPA 3QGJA 5DKMA 2PTNA 5E0JA 4BAMB 3P8FA 1O30A 3LJOA 2OTVA 1FPHH 1OWJA 3ZVEA 1OHHD 3AAUA 3BTTE 1ETTH 1HFDA 3C27B 1YPEH 3A7ZA 3GISB 1BMNH 8LPRA 3S9CA 2STAE 3OFND 3P70B 5EJZA 3SHCH 1Z1IA 1O3EA 3QX5H 3A81A 5F8XA 1SGQE 1TFXA 3URCA 4A1TA 1AUJA 1OYQA 1W0KD 4NG9H 1B7XB 4CH2B 1YPLH 1ANDA 3VB5A 4CHAB 1TPPA 1GHYH 3QTOH 3GY8A 1P04A 3BF6H 3W1EA 1UHBA 2FLBH 3ZVFA 4XBCA 2QF3A 4WMEA 1C5SA 4NIYA 2Z9IA 3FFGA 1LHDH 1VCWA 2O9QA 1NS3A 1DFPA 1AKSB 3PLKA 5AFYH 1O39A 2KM0A 1C2DA 3Q77A 3AK5A 5DP9A 3QK1A 2UWLA 4NIXA 1TRNA 3O8BA 4Y7BA 2ZGBH 1SOTA 4OS6A 1C1OA 1K1PA 5KGOA 1CO7E 1HLTH 4ZKNU 3UR6A 2PWXA 1SFQB 3P95A 4BAHB 3NKKA 4X0WU 1O3HA 3D23A 4ZHAA 2XRCA 2UWOA 4X8SH 2Y7XA 4I8KA 6ESTA 1W3CA 4D76A 2J9NA 1QQUA 4E05H 1QIXB 2VBCA 7LPRA 1L2EA 4WH6A 1O34A 4GHQA 2H1UA 2PP6A 1P03A 3LGTA 4BTUB 1FNIA 3QTVH 3RXBA 1MZAA 1THSH 3VPKA 1EZUC 2G81E 5HGGA 2CHAC 5DJ7A 1Z1JA 2ZFRH 3ZZ8A 2P8OB 2ZPRA 1GJ6A 2JDID 5EOKA 1O2OA 1D3PB 2BDCA 1GHWH 2VIOA 3P17H 1F0UA 1QL8A 3TJNA 4DGJA 1H8ED 2WPMS 1C1NA 2ZU4A 1JIRA 1P9UA 2ZU3A 3PTBA 4OS1A 2GMTB 1DVAH 2BYAX 4BAQB 2NU2E 4BXWA 8GCHG 3ZVBA 1XUIA 2FODA 1UTMA 4JZ1A 4NIWA 2GZ9A 1BOQA 1W11U 1AVGH 2RCEA 2BX4A 2BY5X 2XBWA 3TK6A 1P12E 4I8GA 5CHBA 4HTCH 5A09A 2RDLA 1TGCA 3BTEE 2EA3A 3PRDA 3QLPH 1BT7A 2VIPA 5C2ZA 2H9HA 1CQQA 1MBMA 3GDSA 2VH0A 1LQEA 1E0FD 2ZGHA 4Q2KA 3SV2H 4KGAA 1GWAA 1ZMJA 2CF8H 1O2ZA 1AUTC 2AHME 1O2KA 1ZSKA 4K2YA 2ZNKH 1LQDB 4R8TB 4WH8A 5ABWA 3P6ZB 4FVDA 5LPFA 3KQ5A 1ZGIA 1CU1A 1QRXA 3FOAA 2GP9B 1WSSH 1O38A 5LGOA 3M5NA 3TK9A 1C4V2 2GJGA 1GI1A 1F0TA 1QFKH 1LVBA 4JZIA 2BDAA 3ZZ7A 4A5TS 2KAIB 4DIIH 3S9AA 4IMQA 2H9TH 4J1YA 2WPJS 1ZTKA 1MZDA 1F7ZA 2KX4A 1A3EH 1K9OE 2ZDVH 1C1UH 1NRRH 1GG6B 3TH2H 4ZMAH 4IMZA 3I29A 1C1SA 1WYKA 2ZGJA 3SQHE 2Q6DA 4VGCC 2CK3D 4CHAC 3V13A 4E7RG 1HUTH 3SUGA 1TE0A 3A85A 1O3LA 3RM2H 1A0LA 3PMBB 4LOYH 4CRBA 2AGIX 3RMOH 2OXSA 4FUDA 5EGMA 1O3JA 5A0AE 2SGEE 5LPRA 2HVXA 1DT2A 4A7IB 2FI3E 1JOUB 1LVYA 5A0BA 1L1GA 3HPTB 3KCGH 5EODA 1IHSH 6CHAC 3RXEA 3TITA 1C4Y2 5EU8A 5EXNA 2FOGA 1T31A 2WV5A 1O33A 5FCRA 5A8XA 1AZZA 2R9PA 3EA9A 2D8WA 2JH5D 4TY6A 2BM2A 2OC7A 3MTYA 3LU9B 3UPEA 1K22H 2O8TA 3GCNA 1BDAA 1XUHA 2A4GA 2IJOB 1KXAA 1WOFA 3VB4A 5KEDA 1DUAA 5FPSA 1GMHG 4CRCA 1SGIB 1O3KA 3SHAH 1A2CH 3GY3A 1A0JA 2VU8E 4MPVA 4FUGA 3S69A 1EX3A 2G55A 5J4SA 1NROH 1O5AB 1ETRH 3LC5A 3A86A 1QA0A 4Y8XA 1WXRA 4ABAA 4BTIB 1H1BA 2D1JA 2OINA 1HIAA 1SFIA 2WZQA 1TMUH 4Q63A 2HGTH 2XCFA 3RXSA 3ZVGA 3KHVA 2DE8A 3QDZB 4I8JA 4E7NA 1C1PA 7ESTE 2ZFTA 4YOGA 1SGPE 3A7XA 3GCHB 3A8DA 1L0ZA 3MU4A 1ZSLA 3AW0A 1SHYA 5HYOA 5AF9H 2SFAA 1Y8TA 2VVCA 1PQAA 1NRPH 1ZPCA 2GDDA 3K2UA 4NCYA 3SNEA 1AFEH 1O3MA 1YYY1 2P3TB 2OC0A 1FUJA 1FPCH 1UCYK 1ZGVA 1OWDA 3ZVAA 3RXJA 3A80A 2W5EA 4AFSA 2QCYA 4A92A 1SBWA 1TMBH 1C5NH 7GCHG 2ANKH 2ANMH 1KSNA 4FUEA 2YMSC 3NUMA 3EE0B 3ATMA 1GI8B 4Q4LA 3PMAB 1XUFA 1FIZA 1MTNB 3ZZBA 8KME2 1C5WB 2ZC9H 1W10U 3RC4A 2BVSH 1MKXK 2Y80A 2YNBA 1UVOA 4A1VA 1MCVA 2G4UA 4O3UA 4P00A 3SUEA 3CNRA 2BY6X 3HATH 4XFQA 2QA9E 2EI6A 1G3CA 4NFFA 2BD8A 4GSOA 1E34B 1G9IE 3A8CA 3M7QA 1OWKA 1IQHA 1IHTH 5HM9A 1SLXB 2CHAB 5EQQA 2SGPE 1C5VA 3LGVA 3FZZA 4Z6AH 2ZZUH 1P2KA 3ZYDA 1L4ZA 4FUBA 1W2KH 3TLOA 2PHBA 2V3MA 3A7WA 1Z8IB 1SB1H 1SGCA 1DICA 2GDEH 4Q7XA 1CHOF 6LPRA 1J15A 2Z7FE 4Y79A 4Y0ZE 1DANH 2OP9A 1XUKA 2QIQA 1DX5M 1SI5H 1GJ4H 3SV7A 1WDIA 2Y6TA 1OS8A 1W13U 2FO9A 1CGIE 2ODPA 5L2YH 2OD3B 1FN8A 1K0HA 1P9SA 1G2LA 1CT2E 1F0SA 3M5MA 1AMHA 4HFPB 1EASA 2FX6A 2SNVA 4DIHH 4MQAA 4YT7H 1QY6A 5G4BA 4X1RU 1EP6A 2A31A 4NGAH 2ANYA 1DXWA 3VEQB 3K65B 2G8TA 1FY5A 3MH6A 9ESTA 1ZMNA 5C94A 1K1IA 2BZAA 4ZROA 5EXLA 4B2BA 3PB1E 1ZJKA 5HIZA 3A8AA 5T6FA 1V2MT 3O8DA 1TQ7B 2TGDA 1FMGA 5DGJA 3RXHA 5A8YA 1ZRBA 1ELTA 4ZKRU 2ZDMA 2FPZA 2GMTC 1ELVA 2BD9A 7KMEH 2BLOA 1IAUA 2HOBA 1KIGH 4ZXXH 2DUCA 3RU4T 5AHGH 1Y5UT 4YM9A 3A7VA 3BSQA 4ZKOU 1SGDE 1KXEA 3A7YA 2B5TB 4CRFA 2D26C 2VVVA 1ABIH 4GPGA 5H4IB 2XC0A 1BJVA 1Z8RA 2Z3CA 1DWEH 1AZ8A 1NTPA 3UFAA 4DT4A 2CN0H 3F9HA 3K9XB 3MI4A 1E1QD 2C90B 1UTKA 1K2I1 4K3JA 1V2LT 4NIVA 2PV9B 3O8CA 1E79D 2ZFQH 1RTLA 3LDXH 2BDBA 4AB9A 3A89A 1O37A 1TWXB 2O8MA 4XBDA 3T27A 3VGCC 4U32A 3PO1B 1TNLA 3WWFA 1GPZA 3MQKC 2VIDA 1C1QA 1QNJA 4B71A 4PROA 1NBME 4NWLA 2W3IA 5FX6A 1NZQH 1C2IA 3UR9A 3UREA 3LT3A 1V2TT 3E1XB 3RU4E 3DSPA 2FOBA 1KXBA 2PSYA 3R3GB 4X1QU 3SJKA 1YPKH 1ETSH 1EATA 1Q2WA 2QGRA 4K1SA 3L33A 1A5GH 4DJZB 1EP5A 5CMXH 4D7GA 1BBRE 1C2JA 3MYWA 2CV3A 1TALA 3RMMH 1S83A 3ZZ9A 3UIRA 2Y5FA 4GCHF 1GCTC 3F9EA 4MVNA 3TGIE 3HGNA 5CDFE 3IITA 1UCYE 3DUXH 4FOUC 2XWAA 1FIWA 5DP3A 5ESBA 1S5SA 2FOEA 3BTFE 1S0QA 3NK8A 4TYDA 1DSTA 2A4OA 3U8TH 1XXDA 1Y3UA 2F9BH 4XSKU 2P94A 3RUOA 2SGAA 2ZU1A 1O3PB 3BG4C 3F68H 3Q3XA 2BX3A 1GBDA 2VWNA 5EXMA 4UE7H 4AZ2B 6CHAB 2ASUB 4UD9H 1HAYB 1MKWH 5EG4A 3OEHD 2ESTE 2FTLE 3GY2A 5JB8S 4FUIA 1Y59T 4Z0KA 2GCHG 5E0GA 1LKBA 3JZ1B 1OSSA 1GBFA 1D4PB 1WTHD 1H8IH 1AVWA 2XNIA 7GCHF 2ILNA 1RJXB 4Y10E 2LNCA 3SJOA 1CT4E 3SUDA 5DN6D 2FM2A 1PJPA 2ZPQA 1AKSA 5T6GA 2ZDLA 2TGAA 3M35A 1BZXE 3TJVA 3UQVA 2AMPA 4MPXA 2BQ7B 1P05A 1G3BA 4RKJB 4CBOA 3SZEA 1IQEA 3M3SA 2FXRA 4LXBH 1D6RA 3RMLH 2ODQA 1MABB 1FONA 2ZDAH 5IK2D 3GCHC 4ABFA 1JIMA 2XWBI 5CHAC 1SC8U 4CH8B 2BOHB 1GBAA 4IC5A 1PPGE 1PQ8A 1UTPA 5C3NA 4JYUH 1MBQA 1IQKA 2LP6A 1A0HB 1G30B 3F2HA 1BHXF 3EYDA 1EOJA 2BD5A 3S9BA 2YMSD 2VH6A 5T3HA 2GVFA 3OE7D 1E1RD 1F5KU 1AHTH 1XVOA 4LZ4B 3RXMA 2Q1JA 5L6NH 3GCTF 1DOJA 2QXHA 1MAYA 1DLKB 1LPKB 3DSOA 1UTOA 4AGJA 2QXGA 3DD2H 4CRGA 3VXEH 1UHBB 3SQEE 3MO6A 2FDAA 1QTFA 5I46H 2G52A 2BD4A 2RA0A 3ZYEA 1PPFE 1QHRB 2P16A 3HGPA 4RSPA 1THRH 3SV6A 1MH0A 1C2KA 4TSFD 4HG6A 1E35B 2SGFE 1F92A 3NZIA 2WHXA 1WQVH 3VB3A 3S7HB 1ANCA 1C5PA 4ESTE 3HKIB 1FAXA 1O5CB 2V0BA 3M7UA 1YCPK 1XM1A 4DOQA 4OS4A 5F8TA 1SGTA 3BTGE 1SGFG 1NESE 1YLNA 2V7QD 1P3EA 1ZPBA 1ZHRA 4ZHMU 2AH4X 2BY8X 3OTJE 2BD2A 4YESB 1MAXA 1JMOH 5KECA 1VZQH 1GVKB 1BMLA 4UFGH 5GPIB 1ZTJA 1MU8B 3SV9A 3L6PA 2FS9A 2WV9A 3LGYA 4B1TA 1LHFH 1S84A 1UMAH 4NA9H 1YLCA 1O3FA 3QUMP 1HXFH 1RD3B 3RXGA 4HZHA 4ZHLU 2PFEA 1T32A 5AVDA 5JDUB 1P2MA 1O5DH 2W3KA 3MO9A 4Q7YA 5BRRE 5C0UA 2Z3DA 4YT6H 1O5GH 4X2YA 1SR5C 2PKSC 1K1OA 1MQ5A 3MNBA 3P8GA 1K1NA 5JBBS 3FO8D 4R0IA 1SGYE 3M5OA 1MUEB 5K0HA 2O8UA 1W14U 1YLDA 4O97A 1MTUA 3SW2B 2G00A 1GBCA 2J94A 1COWD 2R3YA 5EJ1A 2H2ZA 3PRBA 3N99A 2GTBA 5T6DA 1W0ZU 1RTFB 2WPIS 3SV8A 4DVAU 3ZZ5A 1QR3E 3PV4A 2XNDD 1YCPM 2ZHDA 2GCTC 4Y6DA 3T26A 2C8XB 3F3BA 1GMCF 4FXGH 2QF5A 1MQ6A 1A46H 5GXPA 5HIYA 1K1LA 1ELFA 4I86A 4ABEA 3MO3A 1QGFA 1PPZA 1HAHH 2J4IA 2Z94A 3T62A 1B5GH 1KY9A 2OC1A 3Q3KA 1N6YA 2JIZD 2R3UA 1TPOA 3U1IB 2OQUA 3MH4A 1AFQB 4Q7ZA 3RM0H 1HAIH 1GMDF 1MD7A 2JH6D 5IDKA 2R2MB 1BJUA 3OEED 3SU0A 3VGCB 1RTKA 1YP9A 1O2NA 3GCOA 5A2MH 2F83A 2ZHEH 3SU1A 1BTZA 5B6LA 1J17T 1CGHA 3GS9A 4UDWH 1H8DH 5I25A 2ZGCA 1NU9A 4X2WA 3I77A 4B2AA 4TPYA 1ELBA 1HJAC 2FMJA 3QZQA 2P8OC 1T8MA 1IQMA 1OOKB 2I6SA 2VJ1A 3I78A 3H09A 3ELAH 1ABJH 1K28D 2OBOA 4D9RA 1GI2A 1NFYA 2HNTC 1ZLRA 1EZSC 3BTHE 1O2UA 1SLWB 1C1TA 2AGEX 4O03A 2K0QA 3RC6A 1INCA 1F0RA 1X7AC 1O2GH 1D3DB 3RXUA 2Y82A 1YPJH 1O5BB 1A7SA 1V3XA 1CGJE 3ZV8A 1GI0A 1FV9A 2CF9H 1Q31A 2L74A 2W6JD 1HAGE 3SO3A 2AERH 4TPIZ 1O2QA 1C5MD 2WPHS 3MH7A 4OS5A 3OY5U 2AMQA 1DXPA 2GKVE 2ZTXA 1RIWB 1UCYH 3FANA 1ACBE 1DDJA 4Y8YA 2A1DB 2HRVA 5FCKA 2Y5GA 1JXPA 1ZTLA 1KLIH 4BXSA 1IQIA 3ZV9A 1H9HE 2A45B 2PKSB 2HNTF 1H9IE 1AB9C 1S6FA 3TIUA 2ZO3H 1VITF 1GHAF 1THPB 1Z8JB 1CA8B 3S0NA 6GCHF 1QB6A 4CR5A 2V3OH 4WJG2 3LPRA 4AFUA 1ANBA 5FXLA 4ZAEA 1O3BA 1O3IA 2WPLS 2C8YB 1SSXA 2P93A 1ZJDA 3AASA 3AVZA 1P57B 2FLRH 2WINI 9LPRA 4AYVB 4OM9A 1NC6A 1BRUP 2BLQA 4XDEA 1HRTH 2W26A 4ISIH 4MNXA 2NU4E 2WYJA 1NFWA 2F9OA 4JYTA 1EJMA 4CRAA 5E2OA 4JZDH 2K1QA 1GMHF 2ZHWH 3F0OA 3Q3YA 2OCVB 5JPMH 1VJ9U 3KN2A 1GJ8B 1SOZA 2JETB 1ARCA 3SU5A 1KMHB 1TONA 5F03A 1E36B 1K1MA 1XXFA 2CJIA 1ANEA 3G01A 2A2QH 2EI7A 1S0RA 4MNWA 1Y5BT 4F49A 3ODDA 3KEEA 1HPGA 1P01A 1GI9B 3EAJA 5T1VA 3GOVB 2ZCLP 1OP0A 1RS0A 5A8ZA 3M37A 2HVYB 2K8IA 3DCLA 1CBWB 4YOIA 1QCPA 1YPGH 4BAOB 3ZZ4A 1CA0B 3VXFH 2AEIH 3H5CB 2KFWA 3HK6B 1QQ4A 2SGDE 3GYMA 1O3DA 1CT0E 1O2IA 4ISHH 3SNCA 2PSXA 4Y7AA 4AFZA 1HAZB 1GBTA 3MHWU 4IN2A 3SGAE 1BTYA 4X1NU 3E3TA 1Z71A 2R0LA 4MNYA 2XCNA 1HAXB 1B0EA 5EW2H 1IQGA 5IYTA 3ZZ3A 3K6YA 3KGPA 3DA9B 1FN6A 1CSOE 4B75A 1C2GA 1ELGA 1K21H 1HXEH 1P10A 1A3BH 2GV7A 4ABGA 1QBNA 3F1SB 3NPSA 2ZTZA 2FOFA 2M5TA 4F55A 1HGTH 1NO9H 1BB0B 3QWCH 2Z6BD 1O5EH 1S81A 4XE4A 1D3QB 5CE1A 4AG1A 3UQOA 5JBAS 1DE7H 1NBMD 2PTCE 1Z8GA 1ESBA 1HBTH 3P8NA 4UFEH 1C5YB 5FHTA 1PQ7A 2GCHF 2KAIA 3A8BA 3V7TA 1IQJA 1LHCH 1C5RA 4QT8C 4ZUHA 3RXIA 2QYIA 1T4UH 2IPHA 4OS2A 5F53A 2ZHFH 1ZYOA 3GICB 2NU0E 3ZVCA 1Q3XA 1QL9A 1EAWA 3NWUA 1BBRH 4LZ1H 5C1YA 2XC5A 4J2YB 1EFRD 2R2WU 1TAWA 3QGNB 3RXRA 2EQNA 8GCHF 3FP6E 1W0YH 2GD4B 2XBVA 1UVSH 2GZ7A 1UK3A 4X1SU 2F43B 4FUJA 3MU0A 4CRDA 1K1JA 4ZKSU 4NSYA 1AVXA 3R0FA 1BCUH 3RXCA 3RXOA 1C5TA 1O32A 2BY7X 4MNVA 1PPCE 3SNBA 4K60A 1J16A 1KLJH 2C3SA 3KF2A 3EGKH 2OLGA 3RLWH 3PWBA 3BG4B 1AGJA 3MNSA 2AIPA 3UAIC 1QJ7B 4I33A 1NU7B 1O31A 2FESH 1H8HD 1L1JA 1PPHE 1TBZH 3SGBE 3EDXB 2CMYA 2H9EH 4U01A 2QXIA 4AN7A 4NFEA 1TPSA 3FZDA 2A7CA 1MKWK 1FJSA 3PV2A 3KNXA 1GBEA 1W7XH 3GDVA 2PGQB 2VGCB 1BRBE 4FVBA 1DY9A 1YF4A 1TLDA 2RA3A 3OX7U 1VCQA 1CBWC 1EPTA 3SN8A 3U1JB 1LO6A 1GDNA 2G51A 3SNDA 3CS0A 1TPAE 2C8ZB 2H5DA 1YKTA 1XKAC 1O3OA 1UVTH 3V0XA 1UK4A 1E38B 3H7OA 1C5LH 3LOXA 3WW7A 3W94A 1ZOMA 1GBLA 2HWLB 1FDPA 1N6XA 5TCAA 3UTUH 3UNRA 1LVOA 1QJ6B 2L6OA 1SHHB 1V2KT 3VG8A 1EPTC 3BV9B 1QBVH 3NRLA 1O2TA 1H9LB 3LONA 1FX0B 2ZF0H 1PYTC 3FP7E 4JZEH 1SL3A 4FUHA 1LHEH 1NPMA 2EY4C 4ACAA 1BMFD 3MFJA 1TX7A 4FU8A 5ESTE 1ZRKA 2AGGX 1XUJA 2V3HH 1EJAA 2PKAB 1YM0A 1G3DA 1AE8H 1GBIA 1O5FH 1TRYA 3MH5A 1YC0A 1T8NA 1C1RA 1ZMLA 1V2UT 2EI8A 5EPYA 1WV7H 4GVUA 1DLEA 3RXKA 1C5XB 4IW4E 3T28A 5GCHF 1DWCH 2NU3E 3RXVA 1GHXH 1FZZA 1ELDE 1GCTB 3QZRA 3MU8A 4AGKA 2FX4A 1BMAA 4GUXA 3RLYH 2A5AA 1QBOA 2B0FA 2A7HA 1SQAA 4KELA 2TPIZ 2J5UA 1GBBA 2PGBB 1L4DA 1V2ST 1Y3VA 4YLQH 3TPIZ 1LDTT 2CXVA 4KKDA 3D62A 2ZG0H 1GJ9B 2IPQX 1SKYE 1KYNA 1GBMA 2F91A 1S6LA 4K8BA 5FBEA 2NWNA 3UOUA 3TU7H 2JJ1D 5HMAA 4E06H 1TA6A 3N7OA 2HPPH 3BTWE 3T5FH 4X6MA 1VR1H 4WXVA 3OYPA 1P2QA 4IN1A 5SGAE 1KTSB 5BPEA 1FY8E 2F3CE 4ABDA 4FU7A 4ZCNA 4IBLH 2A2XH 1PYTD 3BTDE 3BTQE 3NXPA 3ODFA 2BXUH 2VGCC 2ZDNA 1HDTH 1CA0C 1FY3A 4ISNA 4WMFA 3RXFA 5HXFA 1EOLA 3MNXA 3E6PH 4I32A 3Q00A 1QB9A 4NSVA 1P0SH 4KTUA 2Y81A 1WCZA 4YZUA 3GY5A 2ZU5A 4X2VA 1OP2A 2SNWA 1P06A 1GL1A 1AN1E 3KIDU 4X1PU 4DY7B 5DPAA 1BRCE 2EEKA 1GVLA 3B8JA 2ZA5A 3UWJH 2M2AA 2P59A 2IOTA 1TNKA 3ATIA 3MU1A 4ISLA 4Q80A 1BIOA 2W7UA 4WF8A 3ZVDA 1WU1A 2C8WB 3U9AH 1C4U2 1PFXC 1EPTB 1SLUB 2XYAA 2ZFSA 4I8HA 4M7GA 4GCHG 2F9VA 1GBKA 4WY3A 4INHA 1ID5H 2A5IA 2OK5A 1QB1A 3F0PA 1RXPA 1PPBH 1OPHB 2ZP0H 5C5NA 1EZQA 1O2JA 3S7KB 2AIQA 2QE7D 5DO4H 2F9UA 1TB6H 1CHOG 3A7TA 3Q76A 2IN2A 1YPHE 1TQ0B 2XOKD 1HIAB 2O8LA 5DP7A 4RN6A 2OQ5A 3MMGA 1BBRK 1D9IA 3F9FA 3BEUA 2ZPSA 1ARBA 1TX8A 1ZR0A 4GAWA 3K6ZA 5EQRA 4AOQA 1TBQH 3GY6A 3SZNA 5C1UA 2WYGA 3STIA 1HAOH 1NRSH 2Y5HA 4I31A 1XX9A 1O0DH 3BEIB 4X8TH 4YLUA 1EKBB 4F48B 2AS9A 1QL7A 2J95A 1O2VA 1O2YA 3SI3H 3EA8A 1SLVB 1GI7B 1MCTA 1ZZZA 4RI0A 1G36A 5C20A 5L30H 4H6SB 1MTSA 1HCGA 1MTWA 1PPEE 2J98A 2VVUA 2D2DA 1C9PA 1EQ9A 3F2FA 4LK4A 1W0JD 3STJA 3VB7A 3F6UH 2FEQH 5ETXA 3O8RA 1C1WH 3KYGA 5FBIA 1BMMH 3PYHA 4U30A 2BLVA 4ABBA 2G4TA 3TGJE 1YCPH 1VJAU 1B0FA 2VWOA 4RT1A 3LH1A 1QURH 1TNIA 4K69A 1A5HA 1ZHMA 1GMDG 1UVUH 1SVPA 4H42U 4THNH 2HLDD 2B7DH 1UK2A 1C2HA 1ELCA 5C5OA 1EJNA 2QC2A 4UONA 3DSGA 3PLBA 5L2ZH 6GCHG 4YOJA 2RG3A 1G2MA 1XKBC 3AAVA 5E0HA 1VCPA 1T8OA 3P8OA
chains in the Genus database with same CATH topology
1HV7A 2XBXA 3M7TA 5LH8A 3OAAD 4D9QA 1C2FA 1O36A 3RXDA 4SGBE 3URDA 3OU0A 1DS2E 1DWDH 4A1XA 1LHGH 1W8BH 3BTME 1SPJA 2QV1A 1AIXH 2TBSA 2XTTB 2BDHA 3SGQE 1DPOA 3D65E 1YPHC 1TMTH 1AO5A 3LJJA 1C1MA 2VIWA 4K8YA 1TGTA 2ZQ2A 3TH3H 1GHBG 3LH3A 4AG2A 5GWZA 4FETA 1GGDB 3LGIA 1O2RA 4D8NA 5C1XA 4NWKA 1TBRH 3CENA 4M9FA 1C5QA 1G37A 2Z9KA 4ASHA 5F8ZA 4GLYA 1WBGB 2UUFB 1BTWA 2ZIQH 1V2OT 2TIOA 3RP2A 5E8EH 1ZHPA 3UUZA 1TGNA 1OWEA 5K7RA 1O35A 2YMSB 3ITIA 5DP4A 3PTNA 2OUAA 3TNSA 2JKHA 2JH0D 3ZZ6A 3CP7A 1HAVA 3M5LA 2A4QA 4MPWA 2ZDKA 1BUIA 2JETC 1SQOA 1F5LA 1TNHA 5GJ4B 1TGSZ 2V6NA 1FAKH 4BNRA 2KCAA 1GL0E 1SGFA 3SU2A 1FLEE 1KXFA 1GCDA 2A32A 1DM4B 3SJ9A 2J34A 2PW8H 3TVJB 1HAVB 1HJAB 3D49H 1TYNA 2BTCE 2FOMB 2UUJB 2KR7A 1P2IA 3MOCA 3HK3B 1EAUA 3OSYA 3SNAA 2PUXB 4ASUD 1TOCB 2BZ6H 1VITH 1OX1A 3ATKA 2ULLA 4JMYA 1G32B 1BITA 4MPUA 3UB0A 4HGCA 2XXLA 2QAAA 1EZXC 2BB4A 3M36A 1NN6A 2VIVA 2JJ2D 5TCCA 1SG8B 3SORA 4A6LA 4K1EA 2ZCHP 2BLWA 2ZWLH 3GY4A 1GG6C 5HKKD 1LPZB 5GIBA 1T7CA 1FY4A 2O8WA 1WUNH 4K5ZA 2UWPA 1EAXA 1V2PT 2PKAA 1O2SA 1GMCG 3F9GA 2H5CA 3M61U 1HNEE 1C5OH 4XOJA 3FN8A 1NFXA 1XVMA 2ZHQH 2PUQH 2R0KA 4IGDA 1MU6B 3RXTA 3C1KA 3E91A 2WUBA 2Q6GA 4GHTA 3LGUA 2BXTH 5PTPA 4IC6A 2GT8A 1ESTA 2BD7A 4FUCA 1GDUA 5E2PA 2KZ4A 3ATLA 3M3VA 1F5RA 2LPRA 1TNJA 4AFQA 1N8OB 1P11E 4DW2U 5GNDA 1OWHA 3MU5A 4X8UH 3UWIA 4AB8A 2FOHA 3H7TA 3OY6U 2Z3EA 4UFDH 3DHKH 3ESTA 1IQFA 1GJAB 2BD3A 4BOHA 1O3AA 3OTPA 2P3FH 2ZI2H 1C5UA 1D3TB 1TNGA 1S85A 1YGCH 2BDGA 4Y8ZA 1KTTB 3IWMA 4Y71A 1JBUH 4Z1MD 3EA7A 1AI8H 1GBJA 5AFZH 1AQ7A 2VINA 2P3UB 3B9FH 1O2HA 1FQ3A 5GDSH 2I6QA 1EUFA 1P2OA 1A61H 2PLXA 5EQSA 3IG6B 2C93B 1BHXB 4NA8A 1O3CA 3PWCA 4HI3A 1HJ9A 1AY6H 2ZECA 4WMDA 5FX5A 5GCHG 2QXJA 2Y7ZA 2FTMA 1NFUA 1NRQH 2LELA 2ANWA 3DT0H 1QA7A 2FYRA 4BTTB 3RC5A 1KXDA 4Y0YE 3ZZAA 3SJ8A 2YNAA 1V2WT 2EC9H 1GJ7B 1WTGH 3E16B 4U2WA 4B76A 1A4WH 1UTLM 3F2GA 1C9TA 2FWWA 3ZZCA 1T8LA 2ZU2A 3CS7A 3PROA 2BDYA 1WAYB 2AYWA 1O3GA 3RDZA 1O2MA 2H6MA 1GHVH 2HALA 1XUGA 3TGKE 2UUKB 2ZTYA 3RXLA 1P2NA 1P09A 3MWIU 2KCOA 4WVPE 1AU8A 1F2SE 4I8LA 4MDSA 3UNSA 1Z7KA 1GI6A 1G3EA 2A7JA 1BTPA 4B6FA 3ZIAD 5JYIA 4AYYB 4MLFB 2A4RA 1CE5A 2ZFFH 1MKXH 3FVFB 5DP8A 2HNTE 1EXFA 4YXWD 5C17A 1WQSA 2ZKSA 2B8OH 4CR9A 1Y5AT 2GZ8A 2Z9JA 1V2JT 1IOEA 2HPQH 1W12U 1MTVA 2VIQA 2CGAA 3ATWA 4DT7B 4H6TA 5DP5A 3QN7A 1SGRE 1PQ5A 1TABE 2A0QB 1IQNA 4MTBA 1GGDC 1O3NA 4H4FA 1M9UA 2BHGA 3A87A 3TJUA 1N1LA 1HJ8A 2ALPA 1A1RA 4NA7A 2AMDA 3N7EA 1NY22 1V2QT 3RMNH 4ISOA 4TWWA 4F4OC 4TT3D 2AFQB 3PMHB 2WPDD 3BEFB 1GDQA 1KLTA 3PM3A 2WUCA 3U69H 2IJD1 1VGCC 4OS7A 4XBBA 4JK5A 1RFNA 2YOLA 1L1NA 3LKWA 4UFFH 5DP6A 4INKA 2GX4A 2UUYA 2KCPA 4ZH8A 4IS5A 1SQTA 2W7SA 2W6ID 3JZ2B 3BN9A 1OXGA 3U8OH 3SYJA 3KQCA 5CHAB 1O2LA 5EW1H 2ZGXH 3A83A 3SJIA 1ELAA 3E90B 4NZQA 2FP7B 1DWBH 4JZFH 4RKOB 4KP0A 2WV4A 3PLPA 1JRTA 1GJCB 3UNQA 4JYVH 1UVPA 3E8LA 1IQLA 2XBYA 1FXYA 2ODYB 3BG8A 4JCNA 4B74A 2FOCA 3FKSD 1O2PA 4INLA 1CHGA 2BVRH 1Z6EA 3SOSA 3ENSB 3SU3A 1H4WA 3HKJB 1BTUA 3NCLA 1XMNB 1YBWA 2THFB 2VB0A 5FPTA 2BY9X 2V35A 1V2RT 4TY7A 4YTAA 5J4QA 2VWMA 1HAPH 4AX9H 1ZSJA 3TNTA 2STBE 3E0PB 1TGBA 2TGTA 1LCYA 1Y3YA 3GCTG 1AE5A 3TK5A 1VITG 2GGVB 1RIWC 1C2LA 1MMJN 2FIRH 2ZQ1A 2TRMA 3SU6A 2J2UA 3U8RH 1DITH 1CVWH 4KTSA 1DSUA 3RU4D 1FY1A 4NZLA 2Q6FA 2TGPZ 4CBNA 2VWLA 5DG6A 5JB9S 1OWIA 1D6WA 3QO6A 1GI5A 2FZZA 1V6DA 5C0TA 2FOAA 2VNTA 1UTQA 3KQBA 3UY9A 3AW1A 1BRAA 1A5IA 2F9PA 1LMWB 1KDQB 2J92A 3V12A 1LVMA 3RXAA 3KL6A 1Y3XA 2OC8A 4B6EA 3T2NA 4BANB 2QY0B 3MNCA 2BOKA 1HB0B 4DCDA 2BDIA 4X8VH 3PMJA 1ESAA 3WY8A 3WWBA 3P92A 2SGQE 1DY8A 1ORFA 1VGCB 1MTNC 1ZPZA 2XW9A 3RXQA 2KCYA 4MG3A 3FAOA 4Y11E 1AD8H 1GHBF 1EAIA 2ALVA 4K1TA 2BMGB 1UTJA 2NU1E 1OP8A 2J38A 1RGQA 1E37B 2ZFPH 3FP8E 3VB6A 4OGXA 3BIUH 2F9NA 3M3TA 2FS8A 4X6NA 4DURA 4FU9A 1N8OC 3GY7A 4YO9A 2GCTB 5LPEA 1LKAA 2HLCA 5TJXA 2B9LA 2QF0A 3SBKA 1U6QA 4SGAE 3LC3A 1S82A 4O3TA 4JK6A 1EB1H 1O2WA 3LIWA 5HM2A 1TX6A 1O2XA 2QF4A 3A82A 3KQDA 4OGYA 1OYTH 1GBHA 3V3MA 1C2EA 4ABIA 1T4VH 2BVXH 3L3TA 4B73A 5DK1A 1GI3A 2Z9GA 4KTCA 4WWYA 1V2NT 5A0CA 1MD8A 1QRWA 1QJ1B 1AFQC 1DUEA 1YPMH 1H8HD 4WXIA 5EPNA 3SUFA 1AWHB 4ABJA 1P8VC 4CREA 1C1VH 3VFEA 1AWFH 1UO6A 4X6OA 4ZXYH 2G5NA 2XC4A 1J14A 3A88A 1KDQA 2C4FH 1TIOA 1JRSA 1EB2A 5B6OA 3BTKE 5C67A 1V2VT 3E0NB 1LTOA 3A84A 4VGCB 1SGNE 4TWYA 3T25A 3U98H 1GVZA 1NRNH 2QN5T 4XD7D 1GI4A 1BA8B 2P95A 1BTHH 3DFJA 3SU4A 1RRKA 2Z9LA 5F6MA 1JWTA 2BQWB 1KXCA 1P2JA 2A5KA 3BIVH 3UOPA 5FL7D 3SI4H 1UTNA 1SGEE 2ZEBA 5FAHA 5FPYA 3GDUA 1TOMH 8ESTE 3T29A 1ELEE 5DSFA 4X2XA 2FI5E 2PR3A 4BAKB 1UJ1A 2F4LA 3GYLB 4Y76A 2BQ6B 1W7GH 4FUFA 3B23B 2FI4E 1P02A 4B2CA 1Y3WA 3TJOA 1J9CH 1GHAG 3DFLA 3KQEA 3TH4H 4D7FA 1AB9B 1GHZA 1GJ5H 1BTXA 5JBCS 3N7DA 1SMFE 1C2MA 2ZCKP 1Z6JH 1BQYA 2GV6A 4O9VA 1TRMA 4DG4A 2OBQA 3LGWA 4X6PA 5JBTA 4UEHH 3EQ0H 4ABHA 1S6HA 3PO1C 1GJBB 1NT1A 2FYQA 1HYLA 1OKXA 2G5VA 3PV5A 4I7YH 1J8AA 1LPGB 3ZZDA 1QRZA 1FI8A 4AORA 2DE9A 1P3CA 2WPKS 1GJDB 3W95A 1TA2A 2GT7A 1NM6A 1C5ZB 2WSSD 3RXPA 3QGJA 5DKMA 2PTNA 5E0JA 4BAMB 3P8FA 1O30A 3LJOA 2OTVA 1FPHH 1OWJA 3ZVEA 3AAUA 1OHHD 3BTTE 1ETTH 1HFDA 3C27B 1YPEH 3A7ZA 3GISB 1BMNH 8LPRA 3S9CA 2STAE 3OFND 3P70B 3SHCH 1Z1IA 1O3EA 3QX5H 3A81A 5F8XA 1SGQE 1TFXA 3URCA 4A1TA 1AUJA 1OYQA 4NG9H 4CH2B 1B7XB 1W0KD 1YPLH 1ANDA 3VB5A 4CHAB 1TPPA 1GHYH 3QTOH 3GY8A 1P04A 3BF6H 3W1EA 1UHBA 2FLBH 3ZVFA 4XBCA 2QF3A 4WMEA 1C5SA 4NIYA 2Z9IA 3FFGA 1LHDH 1VCWA 2O9QA 1NS3A 1DFPA 1AKSB 3PLKA 5AFYH 1O39A 2KM0A 1C2DA 3Q77A 3AK5A 5DP9A 3QK1A 2UWLA 4NIXA 1TRNA 3O8BA 4Y7BA 2ZGBH 1SOTA 4OS6A 1C1OA 1K1PA 4ZKNU 1CO7E 1HLTH 3UR6A 2PWXA 1SFQB 3P95A 4BAHB 3NKKA 4X0WU 1O3HA 3D23A 4ZHAA 2XRCA 2UWOA 4X8SH 2Y7XA 4I8KA 6ESTA 1W3CA 4D76A 2J9NA 1QQUA 4E05H 1QIXB 2VBCA 7LPRA 1L2EA 4WH6A 1O34A 4GHQA 2H1UA 1P03A 3LGTA 4BTUB 1FNIA 3QTVH 3RXBA 1MZAA 1THSH 3VPKA 1EZUC 2G81E 5HGGA 2CHAC 5DJ7A 1Z1JA 2ZFRH 3ZZ8A 2P8OB 2ZPRA 1GJ6A 2JDID 5EOKA 1O2OA 1D3PB 2BDCA 1GHWH 2VIOA 3P17H 1F0UA 1QL8A 3TJNA 4DGJA 1H8ED 2WPMS 1C1NA 2ZU4A 1JIRA 1P9UA 2ZU3A 3PTBA 4OS1A 2GMTB 1DVAH 2BYAX 4BAQB 2NU2E 4BXWA 8GCHG 3ZVBA 1XUIA 2FODA 1UTMA 4JZ1A 4NIWA 2GZ9A 1BOQA 1W11U 1AVGH 2RCEA 2XBWA 2BY5X 2BX4A 3TK6A 1P12E 4I8GA 5CHBA 4HTCH 5A09A 2RDLA 1TGCA 3BTEE 2EA3A 3QLPH 1BT7A 3PRDA 2VIPA 5C2ZA 2H9HA 1CQQA 1MBMA 3GDSA 2VH0A 1LQEA 1E0FD 2ZGHA 4Q2KA 3SV2H 4KGAA 1GWAA 1ZMJA 2CF8H 1O2ZA 1AUTC 4R8TB 1O2KA 1ZSKA 4K2YA 2ZNKH 1LQDB 4WH8A 3SNDA 5ABWA 3P6ZB 4FVDA 5LPFA 1ZGIA 1CU1A 1QRXA 3FOAA 2GP9B 1WSSH 1O38A 5LGOA 3M5NA 3TK9A 1C4V2 1GI1A 1F0TA 1QFKH 1LVBA 4JZIA 2BDAA 3ZZ7A 4A5TS 2KAIB 3S9AA 4IMQA 2H9TH 4J1YA 2WPJS 1ZTKA 1MZDA 1F7ZA 1A3EH 1K9OE 2ZDVH 1C1UH 1NRRH 1GG6B 3TH2H 4ZMAH 4IMZA 3I29A 1C1SA 1WYKA 2ZGJA 3SQHE 2Q6DA 4VGCC 2CK3D 4CHAC 3V13A 4E7RG 1HUTH 3SUGA 1TE0A 3A85A 1O3LA 3RM2H 1A0LA 3PMBB 4LOYH 4CRBA 2AGIX 3RMOH 2OXSA 4FUDA 5EGMA 1O3JA 5A0AE 2SGEE 5LPRA 2HVXA 1DT2A 4A7IB 2FI3E 1JOUB 1LVYA 5A0BA 1L1GA 3HPTB 3KCGH 5EODA 1IHSH 6CHAC 3RXEA 3TITA 1C4Y2 5EU8A 5EXNA 2FOGA 1T31A 2WV5A 1O33A 5FCRA 5A8XA 1AZZA 2R9PA 3EA9A 2D8WA 2JH5D 4TY6A 2BM2A 2OC7A 3MTYA 3LU9B 3UPEA 1K22H 2O8TA 3GCNA 1BDAA 1XUHA 2A4GA 2IJOB 1KXAA 1WOFA 3VB4A 1DUAA 5FPSA 1GMHG 4CRCA 1SGIB 1O3KA 3SHAH 1A2CH 3GY3A 1A0JA 2VU8E 4MPVA 4FUGA 3S69A 1EX3A 2G55A 5J4SA 1NROH 1O5AB 1ETRH 3LC5A 3A86A 1QA0A 4Y8XA 1WXRA 4ABAA 4BTIB 1H1BA 2D1JA 2OINA 1HIAA 1SFIA 2WZQA 1TMUH 4Q63A 2HGTH 2XCFA 3RXSA 3ZVGA 3KHVA 2DE8A 3QDZB 4I8JA 4E7NA 1C1PA 7ESTE 2ZFTA 4YOGA 1SGPE 3A7XA 3GCHB 3A8DA 1L0ZA 3MU4A 1ZSLA 3AW0A 1SHYA 5HYOA 5AF9H 2SFAA 1Y8TA 2VVCA 1PQAA 1NRPH 1ZPCA 2GDDA 3K2UA 4NCYA 3SNEA 1AFEH 1O3MA 1YYY1 2P3TB 2OC0A 1FUJA 1FPCH 1UCYK 1ZGVA 1OWDA 3ZVAA 3RXJA 3A80A 2W5EA 4AFSA 2QCYA 4A92A 1SBWA 1TMBH 1C5NH 7GCHG 2ANKH 2ANMH 1KSNA 4FUEA 3NUMA 2YMSC 3EE0B