2F9VA

Hcv ns3 protease domain with ns4a peptide and a ketoamide inhibitor with p1 and p2 cyclopropylalannines
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
183
structure length
183
Chain Sequence
MGAPITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS3 protease/helicase
publication title Depeptidization efforts on P3-P2 a-ketoamide inhibitors of HCV NS3-4A serine protease: Effect on HCV replicon activity.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein
total genus 43
structure length 183
sequence length 183
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2f9vA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2f9vA01
1EJNA 1QRZA 2FLBH 2Y7ZA 4YM9A 1AIXH 1EJAA 3A8CA 5CE1A 1ELVA 1KTSB 1IQMA 4HTCH 3TK5A 2P16A 1MTUA 3NUMA 4WH8A 3E6PH 1C5VA 2BY6X 3B8JA 1H9LB 1V2VT 1FN6A 3QZQA 3RXGA 1N8OB 1MTSA 1TNJA 2UUFB 4DCDA 4A92A 1J8AA 1SQOA 1NC6A 1SGQE 3H7OA 1GI2A 2V35A 1A4WH 2BQWB 4JK6A 1NO9H 1LTOA 2UUJB 3A89A 3ELAH 2BVSH 4VGCB 1VGCB 4X2VA 2GCHF 3BEUA 2Z94A 3PMBB 3B23B 1MZDA 1YCPK 2FYQA 1BTZA 1Y5AT 4X8TH 2EI7A 3LGVA 3LC3A 5GPIB 3EDXB 1P01A 1EJMA 1G3DA 1AFQC 2CXVA 4RI0A 3FFGA 4THNH 4NIWA 3UWJH 3MU8A 2O8WA 1DWCH 3E8LA 4U2WA 3VB3A 2WPKS 4OS1A 4CR9A 4A1XA 3VXEH 2GP9B 2VVCA 1VITH 1AVXA 1P8VC 1BRUP 2P59A 3S9CA 2NU3E 2ANYA 1T4UH 2VIPA 4DGJA 2ZFTA 5DP7A 1TRNA 3KQCA 3SHCH 2BB4A 3SU6A 2FESH 4B6EA 1AMHA 1HYLA 3QUMP 1XVOA 1DFPA 1GHWH 1ELAA 1E36B 2R9PA 5DP9A 3KNXA 2F9OA 3A81A 4YO9A 1GJBB 4OGXA 4WMEA 1C1RA 1YYY1 3UPEA 3K2UA 3ZZAA 4B76A 1GBCA 5FXLA 4I32A 3M3VA 3BF6H 5FPTA 2ODPA 3A83A 5EGMA 4ABIA 1OS8A 3TGIE 1A5GH 2HLCA 1NS3A 4K3JA 2G51A 2PKAB 4Y8YA 2J95A 1MH0A 2ZI2H 1HBTH 5DP4A 2DE8A 3RXAA 2VWMA 1W2KH 3A80A 4MVNA 3V7TA 4O3TA 3JZ2B 4JYTA 3ZYEA 3RXCA 2H9HA 2J9NA 5B6OA 2AIQA 3ITIA 1LDTT 1VCQA 2GDEH 1ESBA 1O2KA 4Q7YA 2O8MA 2H5DA 3UOUA 4I8KA 1P0SH 2OLGA 1IQJA 1T8MA 3UIRA 4B74A 4AGJA 1NT1A 1P2MA 1O2LA 2YOLA 1D9IA 1H1BA 3TVJB 1J17T 5HMAA 1TGCA 3A7TA 2BLWA 2ZGXH 1MMJN 1YM0A 4JZDH 3QO6A 1DSTA 1PPFE 1WOFA 2KAIB 4UFEH 5E0HA 1C1QA 1AVGH 2ZHWH 2OK5A 3A7ZA 4MPVA 1S81A 3Q3XA 2C93B 1OWJA 4X2XA 1AZ8A 4AX9H 2AMQA 2QV1A 1DM4B 1FY1A 3U8TH 1ESTA 1V3XA 1UMAH 1GMCF 5F8ZA 1CE5A 4X0WU 4B73A 1C5LH 2FDAA 1FLEE 1Y59T 5T6GA 1Z8GA 1TE0A 1YPGH 9LPRA 2PTNA 5DO4H 2F9UA 5J4SA 1W7XH 3DA9B 1HIAA 1RGQA 5E0JA 1PPHE 1CA0C 1GBKA 3MWIU 3A7XA 4UFGH 2BX3A 3ZZ4A 2H6MA 1SPJA 1EOLA 1O2VA 2P3UB 2BD5A 3A82A 2ZCKP 3MYWA 1HPGA 4RKJB 1ANDA 4I31A 5E2OA 3U9AH 4OM9A 4I33A 2GCTB 3D62A 2BHGA 1C5QA 1GVKB 1ELTA 2ZECA 2XCNA 3T2NA 1V2NT 1UVTH 5C3NA 3H09A 1GI4A 3SN8A 1KSNA 1UTKA 4MNXA 1O32A 2ZTZA 1GHAG 1BMAA 3RXTA 2SGPE 1F0UA 1UTNA 5K0HA 1WCZA 1FUJA 1TFXA 1K9OE 4XDEA 3QGNB 1QBNA 1DWDH 1HJAC 1F5LA 1IAUA 2BOKA 3RXPA 4RSPA 1EB1H 5AHGH 5EG4A 3SQHE 1PQ5A 1HXFH 3EA8A 2AMDA 1MKXH 4O97A 1LHFH 4RKOB 1RFNA 5TCAA 3BTDE 1JXPA 4B1TA 1OP0A 4R8TB 1DANH 5DP3A 1T31A 1L4DA 3TGKE 1K1JA 1YKTA 1CHGA 1A1RA 2XTTB 1GBAA 1HAGE 4Y79A 1SLUB 4MPWA 3MFJA 4K5ZA 2Y81A 2VIWA 1V2ST 3RXOA 3FAOA 2Z9LA 3S7HB 1QCPA 3FVFB 1SGFA 1T7CA 3C27B 4LOYH 2EC9H 1L2EA 1TNLA 2W5EA 1O2UA 2VINA 1NN6A 1Y5UT 1TNIA 2ZU3A 3LONA 3U1IB 5A8ZA 2ZF0H 1J15A 1GJ8B 1UCYH 2OC0A 3P70B 1BBRH 2SNVA 2I6QA 1ESAA 4XBCA 2QYIA 3DFJA 2WPJS 4INLA 2F9NA 7GCHG 8KME2 2VGCB 3SYJA 1HDTH 1D6WA 5L2ZH 2BDAA 1ZLRA 1V6DA 3S9BA 1B0EA 4DW2U 2JH5D 1GI9B 1K1LA 2FOHA 1GBJA 1QRXA 2GGVB 4LXBH 1FN8A 1WTHD 4CRFA 1RRKA 3Q3YA 1AFQB 1JOUB 2PGBB 1Z1IA 3FP7E 2J92A 2BDCA 1OWHA 1SFIA 2ASUB 5F8XA 2CV3A 3M7UA 2HALA 3UNRA 1TYNA 4TPYA 2ZCLP 3SNCA 4FUHA 1C2LA 1FIWA 2PKAA 3LT3A 1DXWA 2PWXA 3VGCC 3SV8A 5EQRA 1ZPZA 3SU1A 1HCGA 1ABIH 1P2KA 2Z9GA 2GDDA 2A7CA 1GBTA 1A46H 2FMJA 2F9PA 3ZZDA 3OY5U 4AGKA 1XUGA 3SORA 4CRDA 1O3AA 1GJ9B 1SBWA 3ODDA 2B9LA 2ZDNA 4NFEA 1LHEH 2ZU4A 1UVPA 1XM1A 1HAIH 2AGEX 7LPRA 1O3IA 1UJ1A 4WXIA 1C2DA 1D3TB 3MNSA 1PYTD 1W10U 2H9EH 4X6NA 5GWZA 1SLVB 2TBSA 4DJZB 4AYVB 4LZ4B 3GCTF 1FI8A 4ASHA 1OWKA 2ZWLH 4X8UH 1MTWA 1T4VH 2KAIA 3DUXH 3LPRA 4WMDA 1G36A 3EA9A 1ANEA 2BY7X 1HAHH 5FBIA 1G9IE 4ABJA 2RA3A 3NKKA 1GI3A 1F0SA 1HAXB 3RC4A 2P8OC 5FPYA 1GI5A 3AAVA 1HUTH 3PV5A 2A45B 4INHA 1NROH 1AFEH 5A8XA 1TGSZ 4A6LA 3HK3B 2QXHA 1RTLA 1C2EA 1GCDA 3LOXA 3Q77A 1C2IA 2FWWA 4E7NA 5HYOA 3BTQE 2WPLS 4K2YA 7GCHF 1TMTH 4BXSA 1W11U 1LPKB 1C1OA 4SGAE 2VIQA 1ZGIA 3ZVCA 2Y82A 4PROA 3T5FH 4Y0YE 4ISHH 2BOHB 2V3HH 2BXUH 1HV7A 3V13A 5EXNA 3U98H 1C9PA 2A5AA 7ESTE 1EAUA 5LPFA 3K65B 1ANBA 3S69A 2FOBA 1TB6H 2J38A 3N7OA 3UTUH 4B75A 3LJOA 3A86A 3OY6U 4Y11E 1LHDH 2FM2A 1RIWC 2Z3CA 2ANWA 5GIBA 4E05H 1F5KU 1CSOE 2F4LA 3GDVA 1CA0B 1A3BH 2Q6GA 2PW8H 1AZZA 4MNWA 2A7JA 1A7SA 4XFQA 3SU2A 3IWMA 1KLIH 3ENSB 4R0IA 4MQAA 4X1NU 1LMWB 2NU0E 2PUXB 2B5TB 1ZYOA 1NFUA 3P8FA 1UTOA 4D8NA 1EASA 3SJOA 2G5NA 4BAKB 1GCTC 1GGDC 1ZJDA 3QK1A 3GOVB 1C2GA 2JH6D 1AHTH 3F68H 1W8BH 3SNDA 2PSYA 1V2TT 2P95A 1C4V2 3CENA 4GAWA 2FOMB 1ZPBA 1TALA 1V2MT 2IJD1 1TAWA 2UWOA 1O5BB 2AYWA 3RXUA 4ABHA 1S0QA 1O30A 1UHBB 1ZJKA 3TIUA 1YPLH 3ZVAA 1RD3B 4O9VA 5C2ZA 1EZSC 4ZXYH 4D7GA 1DWEH 1HJAB 1SQAA 3VB5A 4DG4A 4Q80A 1BMNH 1E37B 1FJSA 3ZZ7A 3OX7U 1GI1A 2P93A 3OTJE 1UK3A 1FQ3A 3D23A 3O8CA 1ELEE 1FY8E 1GBLA 1NRSH 1O5FH 2GCHG 1Y3YA 1AI8H 4YLUA 4YTAA 5TCCA 2O8UA 2HGTH 4FUIA 5E0GA 3T26A 2YNBA 1GBEA 5GXPA 3LGIA 5A0CA 2G5VA 5GNDA 4Q2KA 2ZDAH 1EOJA 3GDSA 4GHTA 2OTVA 4ZKRU 3LKWA 2ALVA 5C67A 1YPHC 5F6MA 3SHAH 1ZMJA 1O5AB 1UTLM 2ZFSA 2D2DA 1XUKA 3O8DA 1HIAB 5JBAS 3WY8A 3ZZ5A 3GY5A 4Y7AA 2UUYA 3UQVA 1Y5BT 4FUJA 4AN7A 3PYHA 1WTGH 1V2LT 4K60A 1V2RT 1Z7KA 1BA8B 4DT7B 5JBTA 1F0TA 2OP9A 1LPGB 2ZU1A 3MHWU 2BD7A 1A3EH 4AFZA 1G37A 4WMFA 3HGPA 1VJAU 3MO9A 2H9TH 2HNTE 2BVRH 3JZ1B 3ZZBA 3ZVFA 4KTUA 1OX1A 3TJVA 5CHAC 1O0DH 2ANKH 4JCNA 2ZP0H 3NZIA 1KXDA 2BLQA 4X6OA 4M9FA 1GHXH 1BDAA 4K8BA 1QL8A 2PV9B 5DKMA 3RM2H 3TLOA 2J34A 1XX9A 2Z9KA 4CH8B 3MO6A 1B0FA 4K1EA 1MQ5A 5EPYA 1SOTA 1TWXB 1C1WH 1O5GH 2ZGJA 2NU4E 3VGCB 5JBCS 1DSUA 4YT7H 2R2MB 3VXFH 2FLRH 1T8LA 1GBBA 2TGAA 1EAXA 2SGEE 4UONA 4FUCA 2AGGX 1O3HA 5IYTA 3F9FA 2W7SA 2JH0D 1GJAB 2ZA5A 4Y76A 5JB8S 1BITA 4ABGA 1GVZA 1O5CB 1QR3E 1KXAA 1DWBH 3GY2A 2R0LA 3SW2B 1JMOH 3BIUH 1OP2A 1QBVH 3RLWH 1W0YH 1GJ6A 1MKWH 1BTPA 1P9UA 1P2JA 2ZTYA 4ZHLU 3MU1A 1GMCG 3U8OH 1LHCH 1DLEA 4INKA 1BZXE 2SGFE 2FYRA 4DVAU 2QIQA 3PV2A 2SFAA 2QXGA 3PB1E 5B6LA 3GISB 4Y10E 2XBWA 3BTTE 4KGAA 4ABEA 3U1JB 2O8LA 1A5HA 1EXFA 1O5EH 2P8OB 3RXQA 3MI4A 4AFQA 3HK6B 2VNTA 1CU1A 3BG4B 1K21H 3LJJA 3QGJA 4Q7XA 3UR6A 1Z1JA 3QDZB 1B7XB 2BZ6H 4CRCA 2GV6A 5EQQA 1GPZA 5J4QA 2OD3B 2IN2A 3PM3A 3MMGA 5I46H 2A1DB 1T8NA 1ABJH 2OBOA 5BPEA 1PQ7A 1XUHA 1SC8U 1BTWA 3ATKA 2FTLE 3NWUA 1NPMA 4AB8A 4B71A 4WXVA 3P92A 1GBIA 1O2QA 2VWLA 2GKVE 3LGYA 3KCGH 1PPCE 1NFYA 3SJIA 3K9XB 1CBWC 3RXSA 2SGDE 1LO6A 3V0XA 4Y71A 5EQSA 1BRCE 1C5XB 4IBLH 2XYAA 2THFB 1PPBH 9ESTA 1Z6EA 5AVDA 1TBQH 1LVYA 2ZU2A 4GLYA 1AKSB 1ZTLA 4NA8A 1GI0A 3E3TA 1HXEH 4JZEH 1RIWB 3A87A 3L6PA 5FPSA 1Z6JH 3RP2A 3MNCA 1L0ZA 3ATWA 1NM6A 2VIOA 5A8YA 2A7HA 2ZC9H 3MOCA 3NCLA 3ZVDA 4Y7BA 4UE7H 1KLJH 5EXMA 1UHBA 5SGAE 1BIOA 5FCKA 1THPB 2HPPH 2A4OA 1DICA 1UK4A 1BMLA 1TX6A 4Y6DA 1GCTB 4B2CA 3RU4T 1GGDB 3KEEA 2H2ZA 2WPIS 1AN1E 2ZIQH 1SB1H 3D65E 2VH6A 1NRPH 1EAWA 3RC6A 2A31A 4ZKNU 1ZSKA 3SNBA 5JYIA 1DITH 2IJOB 3UFAA 2ZQ2A 5C1XA 1ELFA 1D4PB 1AY6H 3UR9A 5ABWA 3HKIB 1QJ7B 2WPHS 2O9QA 5EW1H 1QIXB 3R0FA 4ZHMU 2RA0A 3HGNA 1XUFA 4ZMAH 1GJ5H 3KHVA 3RXRA 1PYTC 3ZV8A 1O3BA 5DJ7A 1YPKH 1S6HA 2HNTF 3R3GB 1D6RA 1MTNC 3QZRA 4YESB 2CHAC 3TH2H 4D76A 1YGCH 2AEIH 2Q1JA 1O38A 1VCPA 1ETRH 2OQUA 3F9HA 4JYUH 3A7YA 2R2WU 3GCHB 1XVMA 1TLDA 2XNIA 4I8JA 4BAHB 8GCHF 1GG6C 1OWDA 1BOQA 5DK1A 2D8WA 3P6ZB 4D9RA 5HM2A 1H4WA 1LQDB 2XWAA 2FS8A 3RXHA 4RN6A 1W0ZU 5DP6A 3M7TA 3AAUA 3UNSA 2QCYA 4NCYA 3SQEE 5ESBA 1ELCA 1EUFA 2ILNA 3PO1B 1FY5A 1O3OA 1F2SE 1MBQA 1NZQH 3MU4A 2F9VA 1ELDE 3M3TA 1HAVA 4GVUA 4D7FA 4FU9A 3PLPA 1GDNA 2ZPSA 1L4ZA 3P8GA 1FAKH 1P3CA 3PV4A 3FP8E 1O37A 3STIA 3NXPA 4KKDA 4TY6A 2A0QB 3VB4A 5GCHF 2BD2A 3OU0A 1K1IA 1YF4A 1QGFA 1V2WT 1VZQH 4YLQH 4ISLA 1V2QT 4YZUA 1VCWA 2FOFA 5E8EH 4X1QU 5CHAB 2ULLA 3ESTA 3GCTG 1E38B 6CHAC 4MDSA 2I6SA 1XUJA 2HPQH 5AFYH 1KXFA 4BTIB 1O3DA 3HKJB 5L6NH 4NIYA 3STJA 3BV9B 2NU1E 1FV9A 1EKBB 1FAXA 1A0HB 4ZAEA 1XKAC 2ODYB 4UDWH 2FZZA 2PSXA 2A4GA 2VWNA 3IG6B 1P02A 3TK9A 3RUOA 2ODQA 3RXKA 1Q3XA 4KTCA 2FOAA 1BT7A 2PR3A 2XBVA 3RM0H 1ZHMA 4JZIA 1TGNA 3C1KA 1ETSH 4UD9H 3CP7A 1O2ZA 2WUCA 3RXJA 3SU4A 4YOGA 3S0NA 1F7ZA 3TJOA 1XMNB 2GD4B 4WJG2 1TMBH 1TOMH 2Q6DA 4WWYA 3SUDA 1P05A 3HPTB 1G3EA 3L33A 3K6ZA 5JDUB 3FZZA 2B7DH 1LKAA 1SSXA 3TJUA 2PLXA 5FBEA 1O31A 2FIRH 1MUEB 2FOEA 4NG9H 1DLKB 5GJ4B 3QTOH 1W12U 1CVWH 1GI7B 1G30B 1VITG 4H6TA 1K22H 1QL9A 1QA7A 1V2OT 1KXBA 3EE0B 1KDQB 1BB0B 3VB6A 1RXPA 3A84A 2PKSC 2XRCA 3QLPH 1LVMA 1DY9A 2BYAX 1YP9A 1O2GH 2ZDKA 3M35A 2GV7A 4TPIZ 3UQOA 1SQTA 1AE8H 1O35A 2ZGCA 3ZZ8A 3TJNA 2W3KA 2XBXA 1WV7H 3TH3H 3SNEA 1MAYA 2ZFQH 5JBBS 4U32A 2VWOA 4LZ1H 3KQEA 2ZU5A 1EATA 3NPSA 1AKSA 1KYNA 2G4TA 1Z71A 2VIVA 4MNVA 4D9QA 5HM9A 4Y8XA 4IS5A 1S85A 1QURH 3DFLA 1O36A 4I8HA 2BX4A 1C2KA 4YT6H 3QN7A 1O3NA 2G4UA 3AW0A 1NFWA 1CBWB 1EZUC 4AZ2B 2Z3EA 2ZTXA 1O3PB 1N8OC 1W3CA 4I7YH 4JK5A 1BHXB 4FXGH 4IW4E 3MU5A 1P2OA 2XC5A 2P94A 3KIDU 1GJ4H 1IQNA 4ABAA 1Y3VA 1HRTH 2P3FH 2Y5FA 1GBHA 3GY7A 1WBGB 1VGCC 5EW2H 8LPRA 3OSYA 2BLVA 6GCHF 4JZ1A 2PGQB 1YLCA 2VVVA 4IC5A 1E35B 4XBDA 1MKXK 1ELGA 3ATIA 3SI4H 1GI8B 3LGWA 4WF8A 1SG8B 1VJ9U 5DPAA 1V2PT 3BG8A 1O2IA 8ESTE 3FANA 3A7VA 1Q2WA 1THRH 1GJCB 3MNXA 2HOBA 1K1OA 2A2XH 1AUTC 1TNHA 1O2HA 3PWCA 3SV2H 1OP8A 4ZHAA 3A8DA 1JWTA 2ZFPH 1QJ6B 1DXPA 1S82A 1VITF 3LH3A 4A7IB 3P17H 4MTBA 1EX3A 1SL3A 5C5OA 2BDGA 1ACBE 1MTNB 3P95A 1GHVH 1OKXA 4B2AA 4J1YA 2CHAB 3GYLB 2TGPZ 2QY0B 3A88A 3BSQA 4FU8A 1NRNH 2ZQ1A 2BDIA 2ZDLA 2A5KA 3PMAB 1GDQA 1FIZA 2FX4A 4WH6A 1WQVH 1GG6B 4XSKU 2C3SA 1J14A 1A2CH 1H8IH 1UCYE 3MH4A 1NU9A 4K1TA 1BBRE 3UOPA 4E7RG 2Y5HA 1P04A 2GMTC 1AWFH 1H8DH 4A5TS 5C5NA 3SJ8A 1GVLA 1O3GA 1C4U2 1NRRH 4NIVA 4KELA 1O2NA 2ZFRH 2PFEA 3BEFB 1K2I1 3ATMA 2GZ8A 1CT2E 4DY7B 1FDPA 1NY22 1O2PA 4MG3A 3SJ9A 4X6PA 3QX5H 1PFXC 4AG1A 2XBYA 1IQFA 2BDBA 1BTXA 2EEKA 2EI6A 1G3CA 2GT7A 2HRVA 1P11E 1KXCA 1P2NA 3W94A 1FPHH 4BOHA 1YCPH 1Z8RA 2BM2A 2TRMA 2R3UA 3TNSA 3PLKA 2BD9A 3T29A 1C9TA 3BTKE 2TGTA 3G01A 4JYVH 1O3CA 1SHHB 1QQ4A 3BIVH 1RS0A 3TU7H 2CMYA 1Y8TA 1BUIA 2BD3A 3T25A 4MLFB 4A1VA 1JRTA 1QB9A 2FI5E 1V2KT 3V12A 1IQKA 6CHAB 1C5OH 1RTFB 1ZHPA 1LPZB 3M37A 1A61H 5T6DA 2Y6TA 5L2YH 1C5ZB 4FVBA 4H4FA 3VFEA 4BAOB 4YOIA 1P57B 1ZMNA 2HNTC 1CO7E 2G81E 5LPEA 1A0JA 2W7UA 1OWIA 4ZUHA 5FX6A 2BVXH 5A09A 1QTFA 1AU8A 1K1NA 3BTEE 5FHTA 1GJ7B 3E91A 4GCHF 5C20A 1Z8JB 1P12E 1KY9A 1IQIA 1P2QA 1O3JA 1N6XA 3S7KB 2ZDMA 2ANMH 2DUCA 2EA3A 1HAZB 1SGIB 3VPKA 4IGDA 5GDSH 1KDQA 1O33A 1F92A 3SU5A 1G2MA 2AIPA 5JPMH 3LDXH 3PMHB 1TONA 4UEHH 1O2WA 1BCUH 4X1SU 3ZVGA 1M9UA 4B2BA 3AK5A 1X7AC 5DGJA 1TPSA 3EQ0H 1MCVA 3BEIB 5PTPA 1O34A 2FO9A 1TRYA 4CBOA 3BTFE 1GJDB 2GX4A 1SHYA 4GPGA 2UUKB 2WPMS 4CR5A 4CH2B 1HAVB 1T32A 3FZDA 1GHZA 4OS5A 3SO3A 3MU0A 2WZQA 1O2TA 1K1MA 1HJ8A 2O8TA 4CHAC 1J9CH 1IQEA 2PKSB 1QB6A 3FP6E 3GDUA 4CREA 2A4QA 3SV6A 3H5CB 3EYDA 1HNEE 1EB2A 4K69A 3M5MA 3SBKA 1DX5M 3A85A 1QHRB 1C1VH 1WU1A 1YPHE 1AQ7A 1GBMA 2OQ5A 1MBMA 3Q76A 1TIOA 1ARCA 1EPTC 1GHBF 1O2MA 1PPGE 2Z9IA 4BAMB 3LIWA 1OXGA 4A1TA 3U69H 3UREA 2J94A 2PHBA 2FTMA 1NTPA 2ZFFH 3BTHE 1ETTH 2ZNKH 4FUEA 3SUGA 3IITA 2VJ1A 2ZKSA 2F91A 1GL0E 4AYYB 3E0PB 1C2MA 3F9GA 1F0RA 1UTPA 4XBBA 2VGCC 3LU9B 4AORA 1DY8A 4Z0KA 4FUGA 6LPRA 1JIRA 1S6FA 4KTSA 1O3MA 2JETC 3PMJA 1S84A 5T1VA 2WYJA 4AFUA 1D3QB 3LGTA 4NGAH 1GMDF 4B6FA 3SGAE 1O2RA 2FOGA 1HFDA 2V6NA 2OC1A 3L3TA 4IN2A 2ZO3H 5EXLA 8GCHG 1OOKB 2ZPRA 3E0NB 4ZKSU 1BRBE 2IPHA 3MNBA 1C5NH 3AW1A 5L30H 4OS2A 1Z8IB 1HAYB 5I25A 1ZPCA 3SOSA 4CRAA 1EP6A 1ZGVA 1LQEA 1OSSA 1T8OA 3ZV9A 2OC8A 1GMHF 3W95A 7KMEH 4YOJA 4F4OC 3I77A 4BNRA 4ISNA 1DOJA 2RCEA 1CGHA 3F1SB 4TWYA 2V3OH 3CS0A 1AO5A 1WQSA 2RDLA 4ABDA 1LCYA 1VR1H 1ZSJA 4IC6A 3RXMA 4DIIH 1DS2E 1GHYH 1YPJH 1IHSH 1O2JA 2BXTH 2FOCA 5GCHG 1SI5H 1L1GA 2FS9A 2QF3A 2SNWA 3RU4E 3KF2A 3E16B 2GZ7A 2UWLA 2QC2A 3PLBA 1P06A 2WUBA 3O8RA 1ARBA 2ZDVH 1DUEA 4X8SH 1ZTJA 2VH0A 3SZEA 4NIXA 1L1NA 3ZYDA 3KL6A 2RG3A 2GMTB 4NFFA 3RMNH 1A5IA 1GI6A 1C1NA 2VU8E 3GCOA 3MH5A 1W13U 1ELBA 1MTVA 1XXFA 5LPRA 4FUBA 1FPCH 5ETXA 1TX7A 1MQ6A 4GSOA 1NU7B 1TPOA 1C1UH 1BJUA 1XUIA 2ZGBH 1SOZA 4K1SA 3A7WA 5CMXH 1UTJA 4LK4A 3SZNA 1P9SA 2BY8X 1QJ1B 3A8AA 3ZVBA 3UNQA 1UTQA 1YPEH 2FEQH 1H9IE 4X8VH 2G55A 4ISOA 1O2SA 3KQDA 1GWAA 2H1UA 1K1PA 2ZHDA 2GZ9A 3TNTA 1HGTH 3RMMH 3T62A 1C1SA 3D49H 5F8TA 3E1XB 3ZZ9A 1LVBA 4SGBE 2ZPQA 3E90B 4OS6A 2Y7XA 1TABE 1SMFE 2UWPA 2NU2E 1O3FA 2R0KA 2CF8H 3TH4H 4Q7ZA 1PPEE 1UVOA 1SGCA 4Z6AH 1DPOA 1BJVA 4FVDA 1TNKA 1CA8B 4Y0ZE 2ZHEH 1FY4A 1QRWA 2ZEBA 2WINI 3GY8A 4JZFH 2XCFA 4CRGA 3Q00A 1Y3UA 2AMPA 1BQYA 2OCVB 4OS7A 4BANB 2OC7A 4WVPE 2F9BH 3ODFA 4X2WA 1FY3A 1SGPE 1MU6B 2BMGB 1HB0B 1MKWK 1E0FD 1EP5A 1SGRE 1C1TA 5FX5A 1S83A 3GYMA 4NA9H 2BDYA 3EAJA 3EA7A 5A0AE 1OYQA 4J2YB 4TY7A 1QL7A 4BTUB 3M5LA 3RLYH 5BRRE 1LHGH 4FUDA 2QXJA 1O3LA 4BXWA 1AB9C 5FAHA 1NRQH 2BY9X 3RXBA 5EPNA 3TPIZ 2GVFA 4NWLA 1G2LA 2A32A 2G8TA 1C1PA 2FX6A 5DG6A 3SGBE 4AOQA 1WYKA 1NESE 1TGBA 1FMGA 1DE7H 5AF9H 5TJXA 1MZAA 1O2YA 1MD7A 2BY5X 1ZZZA 4TYDA 1WUNH 1FONA 1FNIA 2BQ7B 2Q6FA 1P03A 1C5PA 3OYPA 5C1UA 4WY3A 4CRBA 4BTTB 5A0BA 4X2YA 1AD8H 3DT0H 4CHAB 4NA7A 2A5IA 1C2HA 5E2PA 1P09A 4I8GA 2J4IA 4DURA 4CBNA 2VBCA 1CT0E 2BLOA 1TBZH 5DP8A 1C5YB 2OUAA 5T6FA 2BZAA 4XE4A 3RU4D 3TITA 6GCHG 3HATH 1HJ9A 1UVSH 3RDZA 1DVAH 1PQ8A 1EPTB 3KN2A 4OGYA 2C90B 1Y3XA 1WSSH 2OBQA 4BAQB 2Z7FE 3GY6A 3I29A 2B8OH 1QNJA 1G3BA 2QA9E 2C8YB 3LGUA 3ZZ3A 2STBE 5EOKA 2QXIA 3SU0A 3MH7A 4KP0A 2C4FH 5G4BA 1BTHH 1CGIE 3RXDA 1OPHB 1O3KA 1HAOH 1ZMLA 3K6YA 1OWEA 3SUFA 3RMLH 2WV5A 2WV9A 2AERH 2TIOA 1UTMA 3RC5A 1LVOA 2BD8A 2HWLB 1UVUH 1YBWA 1FXYA 2VIDA 5DP5A 4ZXXH 1C5UA 4H42U 3F9EA 4F49A 3RXLA 1XXDA 1UO6A 3M5NA 4K8YA 1TQ0B 2JKHA 2PTCE 1N6YA 1JIMA 2W26A 3P8OA 1CQQA 2CGAA 4E06H 1MAXA 2LPRA 2JETB 2XC4A 3QWCH 5HXFA 1C4Y2 1C5WB 2Z6BD 1G32B 1DT2A 2ZGHA 4Y8ZA 4X1PU 2J2UA 3MTYA 3SV7A 1EZXC 4ESTE 4AB9A 1BMMH 1QA0A 1TQ7B 1TRMA 1TOCB 1B5GH 3ZVEA 1ZHRA 2FXRA 3F6UH 1TA6A 4O3UA 3ZZCA 1KTTB 1AWHB 4QT8C 2D26C 1U6QA 2V0BA 3NK8A 4IMQA 3P8NA 1C5MD 1XKBC 1N1LA 4MNYA 3SJKA 1GHAF 3M36A 3AVZA 2Z9JA 1O3EA 2QAAA 1AUJA 1BHXF 1ID5H 1MU8B 1O5DH 3MH6A 5F03A 5K7RA 1MCTA 1TNGA 1PQAA 1OYTH 3GY4A 3UUZA 3KQBA 2A2QH 3PTNA 5EODA 4VGCC 4JMYA 1MD8A 2TPIZ 4HI3A 1Y3WA 1UK2A 3SV9A 2Y80A 4M7GA 1IHTH 4OS4A 2Y5GA 5FCRA 3A8BA 1C5TA 4DOQA 2DE9A 1HLTH 2C8ZB 2A4RA 3DHKH 4DIHH 1IQLA 3PROA 4AFSA 1INCA 4MPUA 2QN5T 1NFXA 4GHQA 4O03A 5EU8A 2OXSA 2BDHA 1AGJA 1ZRKA 3U8RH 1QB1A 4MPXA 3SUEA 4ABFA 4U30A 4UFFH 1YPMH 1QBOA 2K1QA 4ZKOU 2XXLA 2ESTE 1BTYA 4NZLA 4NZQA 3UY9A 3VB7A 3CS7A 3BG4C 4ZH8A 1C2FA 1JRSA 2M5TA 4GCHG 2XC0A 1TPPA 3ZZ6A 4NWKA 1KIGH 5H4IB 2ZCHP 1YLDA 1ZR0A 1BRAA 5LGOA 2XWBI 3PWBA 1K28D 1SGTA 2P3TB 1EZQA 2C8WB 1SVPA 2PUQH 3V3MA 3PTBA 3RMOH 1ORFA 1IQGA 2EI8A 2H5CA 4NSYA 2GT8A 5IDKA 2B0FA 4H6SB 1UCYK 2F3CE 1BBRK 2CF9H 3GCNA 3B9FH 2STAE 1GL1A 2QGRA 1CHOG 4FUFA 1O39A 1ANCA 1KLTA 2Z3DA 3BTWE 1TA2A 3SU3A 4FU7A 2HVXA 1SR5C 1CT4E 4ISIH 1TPAE 1RTKA 3H7TA 4HGCA 3TK6A 4ABBA 1ZOMA 3S9AA 2W3IA 3QTVH 1ZTKA 4X6MA 3BTGE 2IOTA 1ZSLA 2AS9A 3I78A 3T28A 1DDJA 1HAPH 3M7QA 2WYGA 3Q3KA 2FPZA 1C5SA 1V2UT 2AFQB 1SGNE 3ATLA 1GBFA 1THSH 1A0LA 1GBDA 5AFZH 2WHXA 1AB9B 1AE5A 3GICB 5HGGA 4IN1A 6ESTA 1GHBG 2OINA 2GTBA 3EGKH 3AASA 3GY3A 3UWIA 5JB9S 2QF0A 4I8LA 4UFDH 5T3HA 2FP7B 2R3YA 2ZG0H 1P2IA 3M3SA 2G52A 3MO3A 2LNCA 3LH1A 3VEQB 1BTUA 5A2MH 3BTME 1YCPM 1TBRH 4NSVA 1SLXB 2TGDA 1PPZA 1SGFG 1EPTA 3O8BA 1IOEA 1SGEE 2ZZUH 1D3DB 2FI3E 2BD4A 2VVUA 2FODA 1JBUH 1O2OA 2AGIX 4HFPB 1QQUA 2CJIA 4XOJA 1TX8A 1RJXB 1W14U 3KGPA 1AVWA 4GUXA 1KXEA 2SGAA 5C1YA 1SGDE 2G00A 1GDUA 3T27A 1P3EA 3TGJE 3DD2H 5LH8A 1F5RA 1GMDG 1SLWB 3GCHC 4ZROA 5ESTE 1DUAA 2SGQE 2ZHQH 4U01A 2AH4X 2YNAA 1TGTA 1E34B 2C8XB 3RXEA 1L1JA 2WV4A 1Q31A 2CN0H 1SFQB 2ZHFH 4AG2A 1WAYB 2GCTC 1FZZA 3SGQE 1P10A 1EQ9A 1S0RA 1LKBA 1V2JT 2ALPA 2BTCE 4TWWA 1C5RA 3PO1C 2XW9A 3SI3H 1QFKH 3M5OA 1QY6A 1J16A 1C2JA 2F83A 1CHOF 3M61U 3URDA 3URCA 1WXRA 1EAIA 3BN9A 1GMHG 1C1MA 1D3PB 3RXFA 2VB0A 3RXIA 1IQHA 2NWNA 2FI4E 3LC5A 1W7GH 4IMZA 1PJPA 3OTPA 4HZHA 2BQ6B 3SNAA 4X1RU 1H9HE 1TMUH 3RXVA 1S5SA 1O2XA 1ZRBA 1CGJE 1YC0A 2D1JA 1SGYE
chains in the Genus database with same CATH superfamily
2LP6A 2KZ4A 1EJNA 1QRZA 2FLBH 2Y7ZA 4YM9A 1AIXH 1EJAA 3A8CA 5CE1A 1ELVA 4AC9A 1KTSB 1IQMA 4HTCH 3TK5A 4Z1MD 2P16A 1MTUA 3NUMA 4WH8A 3E6PH 4RT1A 1C5VA 2BY6X 3B8JA 1H9LB 1V2VT 1FN6A 3QZQA 3RXGA 1N8OB 1MTSA 1TNJA 2UUFB 4DCDA 4A92A 1J8AA 1SQOA 1NC6A 1SGQE 3H7OA 1GI2A 2V35A 1A4WH 2BQWB 4JK6A 1NO9H 1LTOA 2UUJB 3A89A 3ELAH 2BVSH 4VGCB 1VGCB 4X2VA 2GCHF 3BEUA 2Z94A 3PMBB 3B23B 1MZDA 1YCPK 2FYQA 1BTZA 1Y5AT 4X8TH 2EI7A 3LGVA 3LC3A 5GPIB 3DSGA 3EDXB 1P01A 1EJMA 1G3DA 1AFQC 2CXVA 4RI0A 1UW7A 3FFGA 4THNH 4NIWA 3UWJH 3MU8A 2O8WA 1DWCH 3E8LA 4U2WA 3VB3A 2WPKS 4OS1A 4CR9A 4A1XA 3VXEH 2GP9B 2VVCA 1VITH 1AVXA 1P8VC 1BRUP 2P59A 3S9CA 2NU3E 2ANYA 1T4UH 2VIPA 4DGJA 2ZFTA 5DP7A 1TRNA 3KQCA 3SHCH 2KCYA 2BB4A 3SU6A 2FESH 4B6EA 1AMHA 1HYLA 3QUMP 1XVOA 1DFPA 1GHWH 1ELAA 4P02A 1E36B 2R9PA 5DP9A 3KNXA 2F9OA 3A81A 4YO9A 1GJBB 4OGXA 4WMEA 1C1RA 1YYY1 3UPEA 3K2UA 3ZZAA 4B76A 1GBCA 5FXLA 4I32A 3M3VA 3BF6H 5FPTA 2ODPA 3A83A 5EGMA 4ABIA 1OS8A 3TGIE 1A5GH 2HLCA 1NS3A 4K3JA 2G51A 2PKAB 4Y8YA 2J95A 1MH0A 5FL7D 2ZI2H 1HBTH 5DP4A 2DE8A 3RXAA 2XOKD 2VWMA 1W2KH 3A80A 4MVNA 3V7TA 4O3TA 3JZ2B 4JYTA 3ZYEA 3RXCA 5EIYA 2H9HA 2J9NA 5B6OA 2V7QD 2AIQA 3ITIA 1LDTT 1VCQA 2GDEH 1ESBA 1O2KA 4Q7YA 2J5UA 2O8MA 2H5DA 3UOUA 4I8KA 1P0SH 2OLGA 1IQJA 1T8MA 3UIRA 4B74A 4FETA 4AGJA 1NT1A 1P2MA 1O2LA 2YOLA 1D9IA 1H1BA 3TVJB 1J17T 5HMAA 1TGCA 3A7TA 2BLWA 2ZGXH 1MMJN 1YM0A 4JZDH 3QO6A 1DSTA 1PPFE 1WOFA 2KAIB 4UFEH 5E0HA 1C1QA 1AVGH 2ZHWH 2OK5A 3A7ZA 4MPVA 1S81A 3Q3XA 2C93B 1OWJA 5EJ1A 4X2XA 1AZ8A 4AX9H 2AMQA 2QV1A 1DM4B 1FY1A 3U8TH 1ESTA 1V3XA 1UMAH 2RDEA 1GMCF 5F8ZA 1CE5A 4X0WU 4I86A 4B73A 1C5LH 2FDAA 1FLEE 1Y59T 5T6GA 1Z8GA 1TE0A 1YPGH 9LPRA 2PTNA 5DO4H 2F9UA 5J4SA 1W7XH 3DA9B 1HIAA 1RGQA 5E0JA 1PPHE 1CA0C 1GBKA 3MWIU 3A7XA 4UFGH 2BX3A 3ZZ4A 3U28C 4XD7D 2H6MA 1SPJA 1EOLA 1O2VA 2P3UB 2BD5A 3A82A 2ZCKP 3MYWA 1HPGA 4RKJB 5CDFE 1ANDA 4I31A 5E2OA 3U9AH 4OM9A 4I33A 2GCTB 3D62A 2BHGA 1C5QA 1GVKB 1ELTA 2ZECA 2XCNA 3T2NA 1V2NT 1UVTH 5C3NA 3H09A 1GI4A 3SN8A 2KM0A 2YMSD 1QZ8A 1KSNA 1UTKA 4MNXA 1O32A 2WSSD 2ZTZA 1GHAG 1BMAA 3RXTA 2SGPE 1F0UA 1UTNA 5K0HA 1WCZA 1FUJA 1TFXA 1K9OE 4XDEA 3QGNB 1QBNA 1DWDH 1HJAC 2CK3D 1F5LA 1IAUA 2BOKA 3RXPA 4RSPA 1EB1H 5AHGH 5EG4A 3SQHE 4ACBA 1PQ5A 1HXFH 3EA8A 2L6OA 4TSFD 2AMDA 1MKXH 4O97A 1LHFH 4RKOB 1RFNA 5TCAA 3BTDE 1JXPA 4B1TA 1OP0A 4R8TB 1DANH 5DP3A 1T31A 1L4DA 3TGKE 5KECA 1K1JA 1YKTA 1CHGA 1A1RA 2XTTB 1GBAA 1HAGE 4Y79A 1SLUB 4MPWA 3MFJA 4K5ZA 2Y81A 2VIWA 1V2ST 3RXOA 3FAOA 2Z9LA 3S7HB 1QCPA 3FVFB 1SGFA 1T7CA 3C27B 4LOYH 2EC9H 1L2EA 1TNLA 2W5EA 1O2UA 2VINA 1NN6A 1Y5UT 1TNIA 2ZU3A 3LONA 3U1IB 5A8ZA 2ZF0H 1J15A 1GJ8B 1UCYH 2OC0A 3P70B 1BBRH 2SNVA 2I6QA 1ESAA 4XBCA 2QYIA 3DFJA 2WPJS 4INLA 2F9NA 7GCHG 8KME2 2VGCB 3SYJA 1HDTH 1D6WA 5L2ZH 2BDAA 1ZLRA 1V6DA 3S9BA 1B0EA 4DW2U 2JH5D 1GI9B 1K1LA 2FOHA 1GBJA 1QRXA 2GGVB 4LXBH 1FN8A 1WTHD 4CRFA 1RRKA 3Q3YA 1AFQB 1JOUB 2KCPA 2PGBB 1Z1IA 3FP7E 2J92A 2BDCA 1OWHA 1SFIA 2ASUB 4ZCNA 5F8XA 2CV3A 3M7UA 2HALA 3UNRA 1TYNA 4TPYA 2ZCLP 3SNCA 1H8ED 4FUHA 1C2LA 1FIWA 2PKAA 1SQRA 3LT3A 1DXWA 4Q4LA 2PWXA 3VGCC 3SV8A 5EQRA 1ZPZA 3SU1A 1HCGA 1ABIH 1P2KA 2Z9GA 2GDDA 2A7CA 5C0TA 1GBTA 1A46H 2FMJA 2F9PA 3ZZDA 3OY5U 4AGKA 1XUGA 3SORA 4CRDA 1O3AA 1GJ9B 1SBWA 3ODDA 2B9LA 2ZDNA 4NFEA 1LHEH 2ZU4A 1UVPA 1XM1A 1HAIH 2AGEX 7LPRA 5KGOA 1O3IA 1UJ1A 4WXIA 1C2DA 1D3TB 3MNSA 1PYTD 1W10U 2H9EH 4X6NA 5GWZA 1SLVB 2TBSA 4DJZB 4AYVB 2PP6A 4LZ4B 3GCTF 1FI8A 4ASHA 1OWKA 2ZWLH 4X8UH 1MTWA 1T4VH 2KAIA 3DUXH 3LPRA 4WMDA 1G36A 3EA9A 1ANEA 2BY7X 1HAHH 2J97A 5FBIA 1G9IE 4ABJA 2RA3A 3NKKA 1GI3A 1F0SA 1HAXB 3RC4A 2P8OC 5FPYA 1GI5A 3AAVA 1HUTH 3PV5A 2A45B 4INHA 1NROH 1AFEH 5A8XA 1TGSZ 4A6LA 1WDIA 3HK3B 2QXHA 1RTLA 1C2EA 1GCDA 3LOXA 3Q77A 1C2IA 2FWWA 4E7NA 5HYOA 3BTQE 2WPLS 4K2YA 7GCHF 1TMTH 4BXSA 1W11U 1LPKB 1C1OA 4SGAE 2VIQA 1ZGIA 3ZVCA 2Y82A 4PROA 3T5FH 4Y0YE 4ISHH 2BOHB 2V3HH 2BXUH 1HV7A 3V13A 5EXNA 3U98H 1C9PA 2A5AA 7ESTE 1EAUA 5LPFA 3K65B 1ANBA 3S69A 2FOBA 1TB6H 2J38A 3N7OA 3UTUH 4B75A 3LJOA 3A86A 3OY6U 4Y11E 1LHDH 2FM2A 1RIWC 2RFKC 2Z3CA 2ANWA 5GIBA 4E05H 3DSOA 1F5KU 1CSOE 2F4LA 3GDVA 1CA0B 1A3BH 2Q6GA 2PW8H 1AZZA 4MNWA 2A7JA 1A7SA 4XFQA 3SU2A 3IWMA 2IPQX 1KLIH 3ENSB 4R0IA 4MQAA 4X1NU 1LMWB 2NU0E 1E1QD 2B5TB 1ZYOA 1NFUA 2PUXB 3P8FA 1UTOA 4D8NA 1EASA 3SJOA 2G5NA 4BAKB 1GCTC 1GGDC 1ZJDA 3QK1A 3GOVB 1C2GA 2JH6D 1AHTH 3F68H 4P00A 1W8BH 3SNDA 2PSYA 1V2TT 2P95A 1C4V2 3CENA 4GAWA 2FOMB 1ZPBA 1TALA 1V2MT 2IJD1 1TAWA 2UWOA 1O5BB 2AYWA 3RXUA 4ABHA 1S0QA 1O30A 1UHBB 1ZJKA 3TIUA 1YPLH 3ZVAA 1RD3B 4O9VA 5C2ZA 1EZSC 4ZXYH 4D7GA 1DWEH 1HJAB 1SQAA 3VB5A 4DG4A 4Q80A 1BMNH 4ASUD 1E37B 5EJLA 1FJSA 3ZZ7A 3OX7U 1GI1A 2P93A 3OTJE 1UK3A 1FQ3A 3D23A 3O8CA 1ELEE 1FY8E 1GBLA 1NRSH 1O5FH 2GCHG 1Y3YA 1AI8H 4YLUA 4YTAA 5TCCA 2JDID 2O8UA 3WW7A 2HGTH 4FUIA 5E0GA 3T26A 2YNBA 1GBEA 5GXPA 1COWD 3LGIA 1OHHD 5A0CA 2G5VA 5GNDA 4Q2KA 2ZDAH 1EOJA 3GDSA 4GHTA 2OTVA 4ZKRU 3LKWA 2ALVA 5C67A 1YPHC 5F6MA 3SHAH 1ZMJA 1O5AB 1UTLM 2ZFSA 2D2DA 1XUKA 3O8DA 1HIAB 5JBAS 3WY8A 3ZZ5A 3GY5A 4Y7AA 2UUYA 3UQVA 1Y5BT 4FUJA 4AN7A 3PYHA 2GJGA 1WTGH 2KCOA 1V2LT 4K60A 1V2RT 1Z7KA 1BA8B 4DT7B 1NBME 5JBTA 1F0TA 2OP9A 1LPGB 2ZU1A 3MHWU 2BD7A 1A3EH 4AFZA 1G37A 4WMFA 3HGPA 1VJAU 3MO9A 2H9TH 2HNTE 2BVRH 3JZ1B 3ZZBA 3ZVFA 4KTUA 1OX1A 3TJVA 5CHAC 1O0DH 2ANKH 4JCNA 2ZP0H 3NZIA 1KXDA 2BLQA 4X6OA 4M9FA 4RT0A 1GHXH 1BDAA 4K8BA 1QL8A 2PV9B 5DKMA 3RM2H 3TLOA 2J34A 1XX9A 2Z9KA 4CH8B 3MO6A 1B0FA 4K1EA 1MQ5A 5EPYA 1SOTA 1TWXB 1C1WH 1O5GH 2ZGJA 2NU4E 3VGCB 5JBCS 1DSUA 4YT7H 2R2MB 3VXFH 2FLRH 1T8LA 1GBBA 2TGAA 1EAXA 2SGEE 2YMSC 4UONA 4FUCA 2AGGX 1O3HA 5IYTA 3F9FA 2W7SA 2JH0D 1GJAB 2ZA5A 4Y76A 5JB8S 1BITA 2XNDD 4ABGA 1GVZA 1O5CB 1QR3E 1KXAA 3FOAA 1DWBH 3GY2A 5C94A 2R0LA 3SW2B 1JMOH 3BIUH 1OP2A 1QBVH 3RLWH 1W0YH 1GJ6A 1MKWH 1BTPA 1P9UA 1P2JA 2ZTYA 4ZHLU 3MU1A 5HIZA 1GMCG 3U8OH 1LHCH 1DLEA 4INKA 1BZXE 2SGFE 2FYRA 3PV2A 2QIQA 4DVAU 2SFAA 2QXGA 3PB1E 5B6LA 3GISB 4Y10E 2XBWA 3BTTE 4KGAA 4ABEA 3U1JB 2O8LA 1A5HA 1EXFA 1O5EH 2P8OB 3RXQA 3MI4A 4AFQA 3HK6B 2VNTA 1CU1A 3BG4B 1K21H 3LJJA 3QGJA 4Q7XA 3UR6A 1Z1JA 3QDZB 5C17A 1B7XB 2BZ6H 4CRCA 2GV6A 5EQQA 1GPZA 5J4QA 2OD3B 2IN2A 3PM3A 3MMGA 5I46H 1FX0B 1T8NA 2A1DB 1ABJH 2OBOA 5BPEA 1PQ7A 1XUHA 1SC8U 1BTWA 3ATKA 2FTLE 3NWUA 1NPMA 4AB8A 4B71A 4WXVA 3P92A 1GBIA 1O2QA 2VWLA 2GKVE 3LGYA 3KCGH 1PPCE 1NFYA 3SJIA 3K9XB 1CBWC 3RXSA 2SGDE 1LO6A 3V0XA 4Y71A 5EQSA 1BRCE 1C5XB 4IBLH 2XYAA 2THFB 1PPBH 9ESTA 1Z6EA 5AVDA 1TBQH 1LVYA 2ZU2A 4GLYA 1AKSB 1ZTLA 4NA8A 1GI0A 3E3TA 1HXEH 4JZEH 1RIWB 1NBMD 3A87A 3L6PA 3NRLA 5FPSA 1Z6JH 3RP2A 3MNCA 1L0ZA 3ATWA 1NM6A 2VIOA 5A8YA 2A7HA 2ZC9H 3MOCA 3NCLA 3ZVDA 4Y7BA 4UE7H 1KLJH 5EXMA 1UHBA 2M2AA 1BIOA 5SGAE 5FCKA 1THPB 2HPPH 2A4OA 1DICA 1UK4A 1BMLA 1TX6A 4Y6DA 1GCTB 4B2CA 3RU4T 1GGDB 3KEEA 2H2ZA 2WPIS 1AN1E 2ZIQH 1SB1H 3D65E 2VH6A 1NRPH 1EAWA 3RC6A 2A31A 4ZKNU 1ZSKA 3SNBA 5JYIA 1DITH 2IJOB 3UFAA 2ZQ2A 5C1XA 1ELFA 1D4PB 1AY6H 3UR9A 5ABWA 3HKIB 1QJ7B 2WPHS 2O9QA 5EW1H 1QIXB 3R0FA 4ZHMU 2RA0A 3HGNA 1XUFA 4ZMAH 1GJ5H 3KHVA 1MABB 1PYTC 3RXRA 3ZV8A 1O3BA 5DJ7A 1YPKH 1S6HA 2HNTF 3R3GB 1D6RA 1MTNC 3QZRA 4YESB 2CHAC 3TH2H 4D76A 3F2HA 1YGCH 2AEIH 2Q1JA 1O38A 1VCPA 1ETRH 2OQUA 3F9HA 4JYUH 3A7YA 2R2WU 3GCHB 1XVMA 1TLDA 2XNIA 4I8JA 3WWFA 4BAHB 8GCHF 1GG6C 1OWDA 1BOQA 5DK1A 2D8WA 3P6ZB 4D9RA 5HM2A 1H4WA 1LQDB 2XWAA 2FS8A 3RXHA 4RN6A 1W0ZU 5DP6A 4XRNA 3M7TA 3AAUA 3UNSA 2QCYA 4NCYA 3SQEE 5ESBA 1ELCA 1EUFA 2ILNA 3PO1B 1FY5A 1O3OA 1F2SE 1MBQA 1NZQH 3MU4A 2F9VA 1ELDE 3M3TA 1HAVA 4GVUA 4D7FA 4FU9A 3PLPA 1GDNA 2ZPSA 1L4ZA 3P8GA 1FAKH 1P3CA 3PV4A 3FP8E 1O37A 3STIA 3F0OA 3NXPA 4KKDA 4TY6A 2A0QB 3VB4A 5GCHF 2BD2A 3OU0A 1K1IA 1YF4A 1QGFA 1V2WT 1VZQH 4YLQH 4ISLA 1V2QT 4YZUA 1VCWA 2FOFA 5E8EH 4X1QU 5CHAB 2ULLA 3ESTA 3GCTG 1E38B 6CHAC 4MDSA 3F2FA 2I6SA 1XUJA 2HPQH 5AFYH 1KXFA 4BTIB 1O3DA 3HKJB 5L6NH 4NIYA 1BMFD 3BV9B 3STJA 2NU1E 1FV9A 3EE7A 1EKBB 1FAXA 1A0HB 4ZAEA 1XKAC 2ODYB 4UDWH 2FZZA 2PSXA 2A4GA 2KR7A 2VWNA 3IG6B 1P02A 3TK9A 3RUOA 2ODQA 3RXKA 1Q3XA 4KTCA 2FOAA 1BT7A 2PR3A 2XBVA 3RM0H 3F2GA 1ZHMA 4JZIA 2YMSB 1TGNA 3C1KA 1ETSH 4UD9H 3CP7A 1O2ZA 2JIZD 2WUCA 3RXJA 3SU4A 4YOGA 3S0NA 1F7ZA 3TJOA 1XMNB 2GD4B 4WJG2 1TMBH 1TOMH 2Q6DA 4WWYA 3SUDA 1P05A 3HPTB 1G3EA 3L33A 3K6ZA 5JDUB 3FZZA 2B7DH 1LKAA 1SSXA 3TJUA 2PLXA 5FBEA 1O31A 2FIRH 1MUEB 2FOEA 4NG9H 1DLKB 5GJ4B 2JJ2D 3QTOH 1W12U 1CVWH 1GI7B 1G30B 1VITG 4H6TA 1K22H 1QL9A 1QA7A 1V2OT 1KXBA 3EE0B 4Q63A 1KDQB 1BB0B 3VB6A 1RXPA 3A84A 2PKSC 2XRCA 5CHBA 3QLPH 1LVMA 1DY9A 2BYAX 1YP9A 1O2GH 2ZDKA 3M35A 2GV7A 4TPIZ 3UQOA 1SQTA 1AE8H 1O35A 2ZGCA 3ZZ8A 3TJNA 2W3KA 2XBXA 1WV7H 3TH3H 3SNEA 1MAYA 2ZFQH 5JBBS 4U32A 2VWOA 4LZ1H 3KQEA 2ZU5A 1EATA 2W6ID 4FOUC 3NPSA 1AKSA 1KYNA 2G4TA 1Z71A 2VIVA 4MNVA 4D9QA 5HM9A 4Y8XA 4IS5A 1S85A 1QURH 3DFLA 1O36A 4I8HA 2BX4A 1C2KA 4YT6H 3QN7A 1O3NA 2G4UA 3AW0A 1NFWA 1CBWB 1EZUC 4AZ2B 2Z3EA 3OEHD 1VKYA 2ZTXA 1O3PB 3OE7D 1N8OC 1W3CA 4I7YH 4JK5A 1BHXB 4FXGH 4IW4E 3MU5A 1P2OA 2XC5A 2P94A 3KIDU 1GJ4H 1IQNA 4ABAA 1Y3VA 1HRTH 2P3FH 2Y5FA 1GBHA 3GY7A 1WBGB 1VGCC 3ZIAD 5EW2H 8LPRA 3OSYA 2BLVA 6GCHF 4JZ1A 2PGQB 1YLCA 2VVVA 4IC5A 1E35B 4XBDA 1W0JD 1MKXK 1ELGA 3ATIA 4F55A 3SI4H 1K0HA 1GI8B 3LGWA 4WF8A 1SG8B 1VJ9U 5DPAA 1E79D 1V2PT 3BG8A 1O2IA 8ESTE 3FANA 3A7VA 1Q2WA 1THRH 1GJCB 3MNXA 2KX4A 2HOBA 1K1OA 2A2XH 1AUTC 1TNHA 1O2HA 3PWCA 3SV2H 1OP8A 4YXWD 4ZHAA 3A8DA 1JWTA 2ZFPH 1QJ6B 1DXPA 1S82A 1VITF 3LH3A 4A7IB 3P17H 4MTBA 1EX3A 1SL3A 5C5OA 2BDGA 1ACBE 1MTNB 3P95A 1GHVH 1OKXA 4B2AA 5DN6D 4J1YA 2CHAB 3GYLB 2TGPZ 2QY0B 1KMHB 3A88A 3MQKC 3BSQA 4FU8A 1NRNH 2ZQ1A 2BDIA 2ZDLA 5IK2D 2A5KA 3PMAB 1GDQA 1FIZA 2FX4A 4WH6A 1WQVH 1GG6B 4XSKU 2C3SA 1J14A 1A2CH 1H8IH 1UCYE 3MH4A 1NU9A 4K1TA 1BBRE 3UOPA 3WWBA 4E7RG 2Y5HA 1P04A 2GMTC 1AWFH 1H8DH 4A5TS 5C5NA 3SJ8A 1GVLA 1O3GA 1C4U2 1NRRH 4NIVA 4KELA 1O2NA 2ZFRH 2PFEA 3BEFB 1K2I1 3ATMA 2GZ8A 1CT2E 4DY7B 1FDPA 1NY22 1O2PA 4MG3A 3SJ9A 4X6PA 3QX5H 1PFXC 4AG1A 2XBYA 1IQFA 2BDBA 1BTXA 2EEKA 2EI6A 1G3CA 2GT7A 2HRVA 1P11E 1KXCA 1P2NA 3OFND 3W94A 1FPHH 4BOHA 1YCPH 1Z8RA 2BM2A 2TRMA 2R3UA 3TNSA 3PLKA 2BD9A 3T29A 1C9TA 3BTKE 2TGTA 3G01A 4JYVH 1O3CA 1SHHB 1QQ4A 2EY4C 3BIVH 1RS0A 3TU7H 2CMYA 1Y8TA 1BUIA 2BD3A 3T25A 4MLFB 4A1VA 1JRTA 1QB9A 2QF5A 2FI5E 1V2KT 3V12A 5C0UA 1IQKA 6CHAB 2K0QA 1C5OH 1RTFB 1ZHPA 1LPZB 3M37A 1A61H 5T6DA 2Y6TA 5L2YH 1C5ZB 4FVBA 4H4FA 3VFEA 4BAOB 4YOIA 1P57B 1ZMNA 2HNTC 1CO7E 2G81E 5LPEA 1A0JA 2W7UA 1OWIA 4ZUHA 5FX6A 2BVXH 5A09A 1QTFA 1AU8A 1K1NA 3BTEE 5FHTA 1GJ7B 3E91A 4GCHF 5C20A 1Z8JB 1P12E 1KY9A 1IQIA 1P2QA 1O3JA 1N6XA 3S7KB 2ZDMA 2ANMH 2DUCA 2EA3A 1HAZB 1SGIB 3VPKA 4IGDA 5GDSH 4TT3D 1KDQA 1S6LA 1O33A 1F92A 3KQ5A 3KYFA 3SU5A 1G2MA 2AIPA 5JPMH 3LDXH 3PMHB 1TONA 4UEHH 1O2WA 1BCUH 4X1SU 3ZVGA 1M9UA 4B2BA 3AK5A 2JJ1D 1X7AC 5DGJA 1TPSA 3EQ0H 1MCVA 3BEIB 5PTPA 1O34A 2FO9A 1TRYA 4CBOA 3BTFE 2QF4A 1GJDB 2GX4A 1SHYA 4GPGA 2UUKB 2WPMS 4CR5A 4CH2B 1HAVB 1T32A 3FZDA 1GHZA 4OS5A 2WZQA 3MU0A 3SO3A 1O2TA 1K1MA 1HJ8A 2O8TA 4CHAC 1J9CH 1IQEA 2PKSB 3KYGA 3N99A 3F0PA 1QB6A 3FP6E 3GDUA 4CREA 2A4QA 3SV6A 3H5CB 4F48B 3EYDA 1HNEE 1EB2A 4K69A 1EFRD 3M5MA 3SBKA 1DX5M 3A85A 1QHRB 1C1VH 1WU1A 1YPHE 1AQ7A 1GBMA 2OQ5A 1MBMA 3Q76A 1TIOA 1ARCA 1EPTC 3N7EA 1GHBF 1O2MA 1PPGE 5DSFA 2Z9IA 4BAMB 3LIWA 1OXGA 4A1TA 3U69H 3UREA 2J94A 2PHBA 2FTMA 1NTPA 2ZFFH 3BTHE 1ETTH 2ZNKH 4FUEA 3SUGA 3IITA 2VJ1A 2ZKSA 2F91A 1GL0E 4AYYB 3E0PB 1C2MA 3F9GA 1F0RA 1UTPA 2KFWA 2V3MA 4XBBA 2VGCC 3LU9B 1E1RD 4AORA 1DY8A 4Z0KA 4FUGA 6LPRA 1JIRA 1S6FA 4KTSA 1O3MA 2JETC 3PMJA 1S84A 5T1VA 2WYJA 4AFUA 2AHME 1D3QB 3LGTA 4NGAH 1GMDF 4B6FA 3SGAE 1O2RA 2FOGA 1HFDA 2V6NA 2OC1A 3L3TA 3OEED 4IN2A 2ZO3H 5EXLA 8GCHG 1OOKB 2ZPRA 3E0NB 4ZKSU 1BRBE 2IPHA 3MNBA 1C5NH 3AW1A 5L30H 4OS2A 1Z8IB 1HAYB 5I25A 3CNRA 1ZPCA 3SOSA 4CRAA 1EP6A 2W6JD 1ZGVA 1LQEA 1OSSA 3VG8A 1T8OA 3ZV9A 1YLNA 2OC8A 2J98A 1GMHF 3W95A 7KMEH 4YOJA 2HLDD 4F4OC 3I77A 4BNRA 4ISNA 1DOJA 2RCEA 1CGHA 5HIYA 3F1SB 4TWYA 2V3OH 3CS0A 1AO5A 1WQSA 2RDLA 4ABDA 1LCYA 1VR1H 1ZSJA 4IC6A 3RXMA 4DIIH 1DS2E 1GHYH 1YPJH 1IHSH 1O2JA 2BXTH 2FOCA 5GCHG 1SI5H 1L1GA 2FS9A 2QF3A 2SNWA 3RU4E 3KF2A 3E16B 2GZ7A 2UWLA 2QC2A 3PLBA 1P06A 2WUBA 3O8RA 1ARBA 2ZDVH 1DUEA 4X8SH 1ZTJA 2VH0A 3SZEA 4NIXA 1L1NA 3ZYDA 3KL6A 2RG3A 2GMTB 4NFFA 3RMNH 1A5IA 1GI6A 1C1NA 2VU8E 3GCOA 3MH5A 1W13U 1ELBA 1MTVA 1XXFA 5LPRA 4FUBA 1FPCH 5ETXA 1TX7A 1MQ6A 4GSOA 1NU7B 1TPOA 1C1UH 1BJUA 1XUIA 2ZGBH 1SOZA 4K1SA 2HVYB 3A7WA 5CMXH 1UTJA 4LK4A 3SZNA 1P9SA 2BY8X 1QJ1B 3A8AA 3ZVBA 3UNQA 1UTQA 1YPEH 2FEQH 1H9IE 4X8VH 2G55A 4ISOA 3DSPA 1O2SA 3KQDA 1GWAA 2H1UA 1K1PA 2ZHDA 2GZ9A 3TNTA 1HGTH 3RMMH 3T62A 1C1SA 3D49H 5F8TA 3UAIC 3E1XB 3ZZ9A 1LVBA 4SGBE 2ZPQA 3E90B 4OS6A 2Y7XA 1TABE 1SMFE 2UWPA 2NU2E 1O3FA 2R0KA 2CF8H 3TH4H 4Q7ZA 1PPEE 1UVOA 1SGCA 4Z6AH 1DPOA 1BJVA 4FVDA 1TNKA 1CA8B 4Y0ZE 2ZHEH 1FY4A 1QRWA 2ZEBA 2WINI 3GY8A 4JZFH 2XCFA 4CRGA 3Q00A 1Y3UA 2AMPA 1BQYA 2OCVB 4OS7A 4BANB 2OC7A 4WVPE 2F9BH 3ODFA 4X2WA 1FY3A 1SGPE 1MU6B 2BMGB 1HB0B 2QE7D 1MKWK 1E0FD 1EP5A 1SGRE 1C1TA 5FX5A 1S83A 2K8IA 3GYMA 4NA9H 2BDYA 3EAJA 3EA7A 5A0AE 1OYQA 3PRDA 4J2YB 4TY7A 1QL7A 5EJZA 4BTUB 3M5LA 3RLYH 5BRRE 1LHGH 4FUDA 2QXJA 1O3LA 4BXWA 1AB9C 5FAHA 1NRQH 2BY9X 3RXBA 5EPNA 3TPIZ 2GVFA 4NWLA 1G2LA 2WPDD 2A32A 2G8TA 1C1PA 2FX6A 5DG6A 3SGBE 4AOQA 1WYKA 1NESE 1TGBA 1FMGA 1DE7H 5AF9H 5TJXA 1MZAA 1O2YA 1MD7A 2BY5X 1ZZZA 4TYDA 1WUNH 1FONA 1FNIA 2BQ7B 2Q6FA 1P03A 1C5PA 3OYPA 5C1UA 4WY3A 4CRBA 4BTTB 5A0BA 4X2YA 1AD8H 3DT0H 4CHAB 4NA7A 2A5IA 1C2HA 5E2PA 1P09A 4I8GA 2J4IA 4DURA 2VBCA 4CBNA 1CT0E 2BLOA 1TBZH 5DP8A 1C5YB 2OUAA 5T6FA 2BZAA 4XE4A 3RU4D 3TITA 6GCHG 3HATH 1HJ9A 1UVSH 3RDZA 1DVAH 1PQ8A 1EPTB 3KN2A 4OGYA 2C90B 1Y3XA 1WSSH 2OBQA 4BAQB 2Z7FE 3GY6A 3I29A 2B8OH 1QNJA 1G3BA 2QA9E 2C8YB 3LGUA 3ZZ3A 2STBE 5EOKA 2QXIA 3SU0A 3MH7A 4KP0A 2C4FH 2L74A 5G4BA 1BTHH 1CGIE 3RXDA 2F43B 1OPHB 1O3KA 1HAOH 1ZMLA 3K6YA 1OWEA 3SUFA 3RMLH 2WV5A 2WV9A 2AERH 2TIOA 1UTMA 3RC5A 1LVOA 2BD8A 2HWLB 1UVUH 1H8HD 1YBWA 1FXYA 2VIDA 5DP5A 4ZXXH 1C5UA 4H42U 3F9EA 4F49A 3RXLA 1XXDA 1UO6A 3M5NA 4K8YA 3W1EA 1TQ0B 2JKHA 2PTCE 1N6YA 5KEDA 1JIMA 2W26A 3P8OA 1CQQA 2CGAA 4E06H 1MAXA 2LPRA 2JETB 2XC4A 3QWCH 5HXFA 1C4Y2 1C5WB 2Z6BD 1G32B 1DT2A 2ZGHA 4Y8ZA 4X1PU 2J2UA 3MTYA 3SV7A 3DCLA 1EZXC 4ESTE 4AB9A 1BMMH 1QA0A 1TQ7B 1TRMA 1TOCB 1YWUA 1B5GH 3ZVEA 1ZHRA 2FXRA 3F6UH 1TA6A 4O3UA 3ZZCA 1KTTB 1AWHB 4QT8C 2D26C 1U6QA 2V0BA 3NK8A 4IMQA 3P8NA 1C5MD 1XKBC 1N1LA 4MNYA 3SJKA 1GHAF 5HKKD 3M36A 3AVZA 2Z9JA 1O3EA 2QAAA 3FO8D 1AUJA 1BHXF 1ID5H 1MU8B 1O5DH 2LELA 3MH6A 5F03A 5K7RA 1MCTA 1TNGA 1PQAA 1OYTH 3GY4A 3UUZA 3KQBA 2A2QH 3PTNA 5EODA 4VGCC 4JMYA 1MD8A 2TPIZ 4HI3A 4DT4A 1Y3WA 1UK2A 3SV9A 2Y80A 4M7GA 1IHTH 4OS4A 2Y5GA 5FCRA 3A8BA 1C5TA 4DOQA 2DE9A 1HLTH 3N7DA 2C8ZB 2A4RA 3DHKH 4DIHH 1IQLA 3PROA 4AFSA 1INCA 4MPUA 2QN5T 1NFXA 4GHQA 4O03A 5EU8A 2OXSA 2BDHA 1AGJA 1ZRKA 3U8RH 1QB1A 4MPXA 3SUEA 4ABFA 4U30A 4UFFH 1YPMH 1QBOA 2K1QA 4ZKOU 2XXLA 2ESTE 1BTYA 4NZLA 4NZQA 3UY9A 3VB7A 3CS7A 4HG6A 3BG4C 4ZH8A 1C2FA 1JRSA 2M5TA 4GCHG 2XC0A 1TPPA 3ZZ6A 4NWKA 1KIGH 5H4IB 2ZCHP 1YLDA 1ZR0A 1BRAA 5LGOA 2XWBI 3PRBA 3PWBA 1K28D 1SGTA 2P3TB 1EZQA 2C8WB 1SVPA 2PUQH 1SKYE 3V3MA 3PTBA 3RMOH 1ORFA 1IQGA 2EI8A 2H5CA 4NSYA 2GT8A 5IDKA 2B0FA 4H6SB 1UCYK 2F3CE 1BBRK 2CF9H 3GCNA 3B9FH 2STAE 1GL1A 2QGRA 1CHOG 4FUFA 1O39A 1ANCA 1KLTA 2Z3DA 3BTWE 1TA2A 2EQNA 3SU3A 4FU7A 2HVXA 1SR5C 1CT4E 2J98B 4ISIH 1TPAE 1RTKA 3H7TA 4HGCA 3TK6A 4ABBA 3F3BA 1ZOMA 3S9AA 2W3IA 3QTVH 1ZTKA 4X6MA 3BTGE 2IOTA 1ZSLA 2AS9A 3I78A 3T28A 1DDJA 1HAPH 3M7QA 2WYGA 3Q3KA 2FPZA 1C5SA 1V2UT 2AFQB 1SGNE 3ATLA 1GBFA 1THSH 1A0LA 1GBDA 2WHXA 5AFZH 1AB9B 1AE5A 3GICB 5HGGA 4IN1A 6ESTA 1GHBG 1W0KD 2GTBA 2OINA 3AASA 3EGKH 3GY3A 3UWIA 5JB9S 2QF0A 4I8LA 4UFDH 5T3HA 2FP7B 2R3YA 2ZG0H 1P2IA 3M3SA 2G52A 3MO3A 2LNCA 3LH1A 3VEQB 1BTUA 5A2MH 3BTME 1YCPM 1TBRH 4NSVA 1SLXB 2TGDA 1PPZA 1SGFG 1EPTA 3O8BA 1IOEA 1SGEE 2ZZUH 1D3DB 2FI3E 2BD4A 2VVUA 5F53A 2FODA 1JBUH 4ACAA 1O2OA 2AGIX 4HFPB 1QQUA 2CJIA 4XOJA 1TX8A 1RJXB 1W14U 3OAAD 3UB0A 3KGPA 1AVWA 4GUXA 1KXEA 2SGAA 5C1YA 1SGDE 2G00A 1GDUA 3T27A 1P3EA 3TGJE 3DD2H 5LH8A 1F5RA 1GMDG 1SLWB 3GCHC 4ZROA 5ESTE 1DUAA 2SGQE 2ZHQH 4U01A 2AH4X 2YNAA 3FKSD 1TGTA 1E34B 2C8XB 3RXEA 1L1JA 2WV4A 1Q31A 2CN0H 1SFQB 2ZHFH 4AG2A 1WAYB 3GS9A 2GCTC 1FZZA 3SGQE 1P10A 1EQ9A 1YY3A 1S0RA 1LKBA 1V2JT 2ALPA 2BTCE 4TWWA 1C5RA 3PO1C 2XW9A 2KCAA 3SI3H 1QFKH 3M5OA 3FN8A 1QY6A 1J16A 1C2JA 2F83A 1CHOF 3M61U 3URDA 3URCA 1WXRA 1EAIA 3BN9A 1GMHG 1C1MA 1D3PB 3RXFA 2VB0A 3RXIA 1IQHA 2NWNA 2FI4E 3LC5A 1W7GH 3OTPA 1PJPA 4IMZA 4HZHA 2BQ6B 3SNAA 4X1RU 1H9HE 1TMUH 3RXVA 1S5SA 1O2XA 1ZRBA 1CGJE 1YC0A 2D1JA 1SGYE
chains in the Genus database with same CATH topology
2KZ4A 1EJNA 1QRZA 2FLBH 2Y7ZA 4YM9A 1AIXH 1EJAA 3A8CA 5CE1A 1ELVA 1KTSB 1IQMA 4HTCH 3TK5A 4Z1MD 2P16A 1MTUA 3NUMA 4WH8A 3E6PH 1C5VA 2BY6X 3B8JA 1H9LB 1V2VT 1FN6A 3QZQA 3RXGA 1N8OB 1MTSA 1TNJA 2UUFB 4DCDA 4A92A 1J8AA 1SQOA 1NC6A 1SGQE 3H7OA 1GI2A 2V35A 1A4WH 2BQWB 4JK6A 1NO9H 1LTOA 2UUJB 3A89A 3ELAH 2BVSH 4VGCB 1VGCB 4X2VA 2GCHF 3BEUA 2Z94A 3PMBB 3B23B 1MZDA 1YCPK 2FYQA 1BTZA 1Y5AT 4X8TH 2EI7A 3LGVA 3LC3A 5GPIB 3EDXB 1P01A 1EJMA 1G3DA 1AFQC 2CXVA 4RI0A 3FFGA 4THNH 4NIWA 3UWJH 3MU8A 2O8WA 1DWCH 3E8LA 4U2WA 3VB3A 2WPKS 4OS1A 4CR9A 4A1XA 3VXEH 2GP9B 2VVCA 1VITH 1AVXA 1P8VC 1BRUP 2P59A 3S9CA 2NU3E 2ANYA 1T4UH 2VIPA 4DGJA 2ZFTA 5DP7A 1TRNA 3KQCA 3SHCH 2KCYA 2BB4A 3SU6A 2FESH 4B6EA 1AMHA 1HYLA 3QUMP 1XVOA 1DFPA 1GHWH 1ELAA 1E36B 2R9PA 5DP9A 3KNXA 2F9OA 3A81A 4YO9A 1GJBB 4OGXA 4WMEA 1C1RA 1YYY1 3UPEA 3K2UA 3ZZAA 4B76A 1GBCA 5FXLA 4I32A 3M3VA 3BF6H 5FPTA 2ODPA 3A83A 5EGMA 4ABIA 1OS8A 3TGIE 1A5GH 2HLCA 1NS3A 4K3JA 2G51A 2PKAB 4Y8YA 2J95A 1MH0A 5FL7D 2ZI2H 1HBTH 5DP4A 2DE8A 3RXAA 2XOKD 2VWMA 1W2KH 3A80A 4MVNA 3V7TA 4O3TA 3JZ2B 4JYTA 3ZYEA 3RXCA 2H9HA 2J9NA 5B6OA 2V7QD 2AIQA 3ITIA 1LDTT 1VCQA 2GDEH 1ESBA 1O2KA 4Q7YA 2J5UA 2O8MA 2H5DA 3UOUA 4I8KA 1P0SH 2OLGA 1IQJA 1T8MA 3UIRA 4B74A 4FETA 4AGJA 1NT1A 1P2MA 1O2LA 2YOLA 1D9IA 1H1BA 3TVJB 1J17T 5HMAA 1TGCA 3A7TA 2BLWA 2ZGXH 1MMJN 1YM0A 4JZDH 3QO6A 1DSTA 1PPFE 1WOFA 2KAIB 4UFEH 5E0HA 1C1QA 1AVGH 2ZHWH 2OK5A 3A7ZA 4MPVA 1S81A 3Q3XA 2C93B 1OWJA 4X2XA 1AZ8A 4AX9H 2AMQA 2QV1A 1DM4B 1FY1A 3U8TH 1ESTA 1V3XA 1UMAH 1GMCF 5F8ZA 1CE5A 4X0WU 4B73A 1C5LH 2FDAA 1FLEE 1Y59T 5T6GA 1Z8GA 1TE0A 1YPGH 9LPRA 2PTNA 5DO4H 2F9UA 5J4SA 1W7XH 3DA9B 1HIAA 1RGQA 5E0JA 1PPHE 1CA0C 1GBKA 3MWIU 3A7XA 4UFGH 2BX3A 3ZZ4A 4XD7D 2H6MA 1SPJA 1EOLA 1O2VA 2P3UB 2BD5A 3A82A 2ZCKP 3MYWA 1HPGA 4RKJB 5CDFE 1ANDA 4I31A 5E2OA 3U9AH 4OM9A 4I33A 2GCTB 3D62A 2BHGA 1C5QA 1GVKB 1ELTA 2ZECA 2XCNA 3T2NA 1V2NT 1UVTH 5C3NA 3H09A 1GI4A 3SN8A 2KM0A 2YMSD 1KSNA 1UTKA 4MNXA 1O32A 2WSSD 2ZTZA 1GHAG 1BMAA 3RXTA 2SGPE 1F0UA 1UTNA 5K0HA 1WCZA 1FUJA 1TFXA 1K9OE 4XDEA 3QGNB 1QBNA 1DWDH 1HJAC 2CK3D 1F5LA 1IAUA 2BOKA 3RXPA 4RSPA 1EB1H 5AHGH 5EG4A 3SQHE 1PQ5A 1HXFH 3EA8A 2L6OA 4TSFD 2AMDA 1MKXH 4O97A 1LHFH 4RKOB 1RFNA 5TCAA 3BTDE 1JXPA 4B1TA 1OP0A 4R8TB 1DANH 5DP3A 1T31A 1L4DA 3TGKE 1K1JA 1YKTA 1CHGA 1A1RA 2XTTB 1GBAA 1HAGE 4Y79A 1SLUB 4MPWA 3MFJA 4K5ZA 2Y81A 2VIWA 1V2ST 3RXOA 3FAOA 2Z9LA 3S7HB 1QCPA 3FVFB 1SGFA 1T7CA 3C27B 4LOYH 2EC9H 1L2EA 1TNLA 2W5EA 1O2UA 2VINA 1NN6A 1Y5UT 1TNIA 2ZU3A 3LONA 3U1IB 5A8ZA 2ZF0H 1J15A 1GJ8B 1UCYH 2OC0A 3P70B 1BBRH 2SNVA 2I6QA 1ESAA 4XBCA 2QYIA 3DFJA 2WPJS 4INLA 2F9NA 7GCHG 8KME2 2VGCB 3SYJA 1HDTH 1D6WA 5L2ZH 2BDAA 1ZLRA 1V6DA 3S9BA 1B0EA 4DW2U 2JH5D 1GI9B 1K1LA 2FOHA 1GBJA 1QRXA 2GGVB 4LXBH 1FN8A 1WTHD 4CRFA 1RRKA 3Q3YA 1AFQB 1JOUB 2PGBB 2KCPA 1Z1IA 3FP7E 2J92A 2BDCA 1OWHA 1SFIA 2ASUB 4ZCNA 5F8XA 2CV3A 3M7UA 2HALA 3UNRA 1TYNA 4TPYA 2ZCLP 3SNCA 1H8ED 4FUHA 1C2LA 1FIWA 2PKAA 3LT3A 1DXWA 4Q4LA 2PWXA 3VGCC 3SV8A 5EQRA 1ZPZA 3SU1A 1HCGA 1ABIH 1P2KA 2Z9GA 2GDDA 2A7CA 5C0TA 1GBTA 1A46H 2FMJA 2F9PA 3ZZDA 3OY5U 4AGKA 1XUGA 3SORA 4CRDA 1O3AA 1GJ9B 1SBWA 3ODDA 2B9LA 2ZDNA 4NFEA 1LHEH 2ZU4A 1UVPA 1XM1A 1HAIH 2AGEX 7LPRA 1O3IA 1UJ1A 4WXIA 1C2DA 1D3TB 3MNSA 1PYTD 1W10U 2H9EH 4X6NA 5GWZA 1SLVB 2TBSA 4DJZB 4AYVB 4LZ4B 3GCTF 1FI8A 4ASHA 1OWKA 2ZWLH 4X8UH 1MTWA 1T4VH 2KAIA 3DUXH 3LPRA 4WMDA 1G36A 3EA9A 1ANEA 2BY7X 1HAHH 5FBIA 1G9IE 4ABJA 2RA3A 3NKKA 1GI3A 1F0SA 1HAXB 3RC4A 2P8OC 5FPYA 1GI5A 3AAVA 1HUTH 3PV5A 2A45B 4INHA 1NROH 1AFEH 5A8XA 1TGSZ 4A6LA 3HK3B 2QXHA 1RTLA 1C2EA 1GCDA 3LOXA 3Q77A 1C2IA 2FWWA 4E7NA 5HYOA 3BTQE 2WPLS 4K2YA 7GCHF 1TMTH 4BXSA 1W11U 1LPKB 1C1OA 4SGAE 2VIQA 1ZGIA 3ZVCA 2Y82A 4PROA 3T5FH 4Y0YE 4ISHH 2BOHB 2V3HH 2BXUH 1HV7A 3V13A 5EXNA 3U98H 1C9PA 2A5AA 7ESTE 1EAUA 5LPFA 3K65B 1ANBA 3S69A 2FOBA 1TB6H 2J38A 3N7OA 3UTUH 4B75A 3LJOA 3A86A 3OY6U 4Y11E 1LHDH 2FM2A 1RIWC 2Z3CA 2ANWA 5GIBA 4E05H 3DSOA 1F5KU 1CSOE 2F4LA 3GDVA 1CA0B 1A3BH 2Q6GA 2PW8H 1AZZA 4MNWA 2A7JA 1A7SA 4XFQA 3SU2A 3IWMA 1KLIH 3ENSB 4R0IA 4MQAA 4X1NU 1LMWB 2NU0E 2PUXB 2B5TB 1ZYOA 1NFUA 3P8FA 1E1QD 1UTOA 4D8NA 1EASA 3SJOA 2G5NA 4BAKB 1GCTC 1GGDC 1ZJDA 3QK1A 3GOVB 1C2GA 2JH6D 1AHTH 3F68H 1W8BH 3SNDA 2PSYA 1V2TT 2P95A 1C4V2 3CENA 4GAWA 2FOMB 1ZPBA 1TALA 1V2MT 2IJD1 1TAWA 2UWOA 1O5BB 2AYWA 3RXUA 4ABHA 1S0QA 1O30A 1UHBB 1ZJKA 3TIUA 1YPLH 3ZVAA 1RD3B 4O9VA 5C2ZA 1EZSC 4ZXYH 4D7GA 1DWEH 1HJAB 1SQAA 3VB5A 4DG4A 4Q80A 1BMNH 4ASUD 1E37B 1FJSA 3ZZ7A 3OX7U 1GI1A 2P93A 3OTJE 1UK3A 1FQ3A 3D23A 3O8CA 1ELEE 1FY8E 1GBLA 1NRSH 1O5FH 2GCHG 1Y3YA 1AI8H 4YLUA 4YTAA 5TCCA 2JDID 2O8UA 3WW7A 2HGTH 4FUIA 5E0GA 3T26A 2YNBA 1GBEA 5GXPA 3LGIA 1COWD 1OHHD 5A0CA 2G5VA 5GNDA 4Q2KA 2ZDAH 1EOJA 3GDSA 4GHTA 2OTVA 4ZKRU 3LKWA 2ALVA 5C67A 1YPHC 5F6MA 3SHAH 1ZMJA 1O5AB 1UTLM 2ZFSA 2D2DA 1XUKA 3O8DA 1HIAB 5JBAS 3WY8A 3ZZ5A 3GY5A 4Y7AA 2UUYA 3UQVA 1Y5BT 4FUJA 4AN7A 3PYHA 1WTGH 2KCOA 1V2LT 4K60A 1V2RT 1Z7KA 1BA8B 4DT7B 1NBME 5JBTA 1F0TA 2OP9A 1LPGB 2ZU1A 3MHWU 2BD7A 1A3EH 4AFZA 1G37A 4WMFA 3HGPA 1VJAU 3MO9A 2H9TH 2HNTE 2BVRH 3JZ1B 3ZZBA 3ZVFA 4KTUA 1OX1A 3TJVA 5CHAC 1O0DH 2ANKH 4JCNA 2ZP0H 3NZIA 1KXDA 2BLQA 4X6OA 4M9FA 1GHXH 1BDAA 4K8BA 1QL8A 2PV9B 5DKMA 3RM2H 3TLOA 2J34A 1XX9A 2Z9KA 4CH8B 3MO6A 1B0FA 4K1EA 1MQ5A 5EPYA 1SOTA 1TWXB 1C1WH 1O5GH 2ZGJA 2NU4E 3VGCB 5JBCS 1DSUA 4YT7H 2R2MB 3VXFH 2FLRH 1T8LA 1GBBA 2TGAA 1EAXA 2SGEE 4UONA 2YMSC 4FUCA 2AGGX 1O3HA 5IYTA 3F9FA 2W7SA 2JH0D 1GJAB 2ZA5A 4Y76A 5JB8S 1BITA 2XNDD 4ABGA 1GVZA 1O5CB 1QR3E 1KXAA 3FOAA 1DWBH 3GY2A 2R0LA 3SW2B 1JMOH 3BIUH 1OP2A 1QBVH 3RLWH 1W0YH 1GJ6A 1MKWH 1BTPA 1P9UA 1P2JA 2ZTYA 4ZHLU 3MU1A 1GMCG 3U8OH 1LHCH 1DLEA 4INKA 1BZXE 2SGFE 2FYRA 4DVAU 2QIQA 3PV2A 2SFAA 2QXGA 3PB1E 5B6LA 3GISB 4Y10E 2XBWA 3BTTE 4KGAA 4ABEA 3U1JB 2O8LA 1A5HA 1EXFA 1O5EH 2P8OB 3RXQA 3MI4A 4AFQA 3HK6B 2VNTA 1CU1A 3BG4B 1K21H 3LJJA 3QGJA 4Q7XA 3UR6A 1Z1JA 3QDZB 5C17A 1B7XB 2BZ6H 4CRCA 2GV6A 5EQQA 1GPZA 5J4QA 2OD3B 2IN2A 3PM3A 3MMGA 5I46H 2A1DB 1T8NA 1FX0B 1ABJH 2OBOA 5BPEA 1PQ7A 1XUHA 1SC8U 1BTWA 3ATKA 2FTLE 3NWUA 1NPMA 4AB8A 4B71A 4WXVA 3P92A 1GBIA 1O2QA 2VWLA 2GKVE 3LGYA 3KCGH 1PPCE 1NFYA 3SJIA 3K9XB 1CBWC 3RXSA 2SGDE 1LO6A 3V0XA 4Y71A 5EQSA 1BRCE 1C5XB 4IBLH 2XYAA 2THFB 1PPBH 9ESTA 1Z6EA 5AVDA 1TBQH 1LVYA 2ZU2A 4GLYA 1AKSB 1ZTLA 4NA8A 1GI0A 3E3TA 1HXEH 4JZEH 1RIWB 3A87A 1NBMD 3L6PA 3NRLA 5FPSA 1Z6JH 3RP2A 3MNCA 1L0ZA 3ATWA 1NM6A 2VIOA 5A8YA 2A7HA 2ZC9H 3MOCA 3NCLA 3ZVDA 4Y7BA 4UE7H 1KLJH 5EXMA 1UHBA 5SGAE 1BIOA 2M2AA 5FCKA 1THPB 2HPPH 2A4OA 1DICA 1UK4A 1BMLA 1TX6A 4Y6DA 1GCTB 4B2CA 3RU4T 1GGDB 3KEEA 2H2ZA 2WPIS 1AN1E 2ZIQH 1SB1H 3D65E 2VH6A 1NRPH 1EAWA 3RC6A 2A31A 4ZKNU 1ZSKA 3SNBA 5JYIA 1DITH 2IJOB 3UFAA 2ZQ2A 5C1XA 1ELFA 1D4PB 1AY6H 3UR9A 5ABWA 3HKIB 1QJ7B 2WPHS 2O9QA 5EW1H 1QIXB 3R0FA 4ZHMU 2RA0A 3HGNA 1XUFA 4ZMAH 1GJ5H 3KHVA 3RXRA 1PYTC 1MABB 3ZV8A 1O3BA 5DJ7A 1YPKH 1S6HA 2HNTF 3R3GB 1D6RA 1MTNC 3QZRA 4YESB 2CHAC 3TH2H 4D76A 3F2HA 1YGCH 2AEIH 2Q1JA 1O38A 1VCPA 1ETRH 2OQUA 3F9HA 4JYUH 3A7YA 2R2WU 3GCHB 1XVMA 1TLDA 2XNIA 4I8JA 4BAHB 8GCHF 3WWFA 1GG6C 1OWDA 1BOQA 5DK1A 2D8WA 3P6ZB 4D9RA 5HM2A 1H4WA 1LQDB 2XWAA 2FS8A 3RXHA 4RN6A 1W0ZU 5DP6A 3M7TA 3AAUA 3UNSA 2QCYA 4NCYA 3SQEE 5ESBA 1ELCA 1EUFA 2ILNA 3PO1B 1FY5A 1O3OA 1F2SE 1MBQA 1NZQH 3MU4A 2F9VA 1ELDE 3M3TA 1HAVA 4GVUA 4D7FA 4FU9A 3PLPA 1GDNA 2ZPSA 1L4ZA 3P8GA 1FAKH 1P3CA 3PV4A 3FP8E 1O37A 3STIA 3F0OA 3NXPA 4KKDA 4TY6A 2A0QB 3VB4A 5GCHF 2BD2A 3OU0A 1K1IA 1YF4A 1QGFA 1V2WT 1VZQH 4YLQH 4ISLA 1V2QT 4YZUA 1VCWA 2FOFA 5E8EH 4X1QU 5CHAB 2ULLA 3ESTA 3GCTG 1E38B 6CHAC 4MDSA 3F2FA 2I6SA 1XUJA 2HPQH 5AFYH 1KXFA 4BTIB 1O3DA 3HKJB 5L6NH 4NIYA 3STJA 3BV9B 1BMFD 2NU1E 1FV9A 1EKBB 1FAXA 1A0HB