2F9VA

Hcv ns3 protease domain with ns4a peptide and a ketoamide inhibitor with p1 and p2 cyclopropylalannines
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
183
structure length
183
Chain Sequence
MGAPITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS3 protease/helicase
publication title Depeptidization efforts on P3-P2 a-ketoamide inhibitors of HCV NS3-4A serine protease: Effect on HCV replicon activity.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein
total genus 43
structure length 183
sequence length 183
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2f9vA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2f9vA01
4FUHA 4Y71A 2G51A 2WPIS 1UVTH 1C2FA 1GI4A 3TIUA 3LGTA 1GBBA 1AN1E 3ZZ9A 1LHCH 1NM6A 1T31A 2XNIA 1BBRK 3DA9B 2GCTC 1GG6B 4WF8A 4JK5A 4X6PA 3QK1A 1QIXB 2P3UB 1P06A 1TPSA 2P59A 2O8LA 4X8SH 1UCYH 3SHAH 1P03A 4FVBA 2GMTC 3A85A 2G5NA 2AMDA 4A6LA 4BTTB 1A46H 3SJ8A 1A0HB 1W10U 4X6MA 1GHVH 2PR3A 4DG4A 1MUEB 2ZU5A 3K6ZA 2P8OC 3PMAB 3A8BA 3BTQE 1PQAA 3RXDA 1K1IA 3MU4A 1UVSH 2WUBA 1P3CA 1ZTJA 1YPMH 1C1SA 3L6PA 2NU4E 3RXFA 3E1XB 2CHAB 3O8DA 4LOYH 3ZVCA 2D1JA 3RU4E 1W14U 1Z8GA 3S7KB 4YLQH 4BAMB 2C8YB 4B2AA 1HPGA 1NZQH 1UTJA 5AHGH 1MTNB 1XUJA 3MNSA 1GI0A 5T1VA 3DFJA 3SJ9A 2TIOA 1DPOA 1PPEE 1YPGH 1Y5AT 2QY0B 2ZECA 3L3TA 3MNBA 1HAXB 2IPHA 5AFZH 1TQ0B 3AVZA 3V7TA 5HYOA 3S9CA 1GMHF 4TYDA 4ZAEA 5EQQA 1ZMLA 1KXDA 1VITG 3PLPA 2FOGA 3SU1A 1QL8A 2VGCB 3MTYA 3TITA 1GGDB 2BX3A 2WZQA 1DDJA 2BX4A 2UWPA 2Z9GA 2BD4A 1GMDF 2ZPRA 2BDAA 1GJ8B 4B6EA 4NCYA 4BXWA 3RXAA 4WVPE 4XDEA 1TMTH 2JH5D 1TNHA 3BTHE 2H6MA 4JMYA 1OYQA 4K5ZA 2JH6D 1E34B 5C3NA 3K9XB 4HTCH 3E0PB 1ANEA 1A2CH 5EGMA 1GI7B 2BDIA 1HIAA 4FUFA 3HPTB 1F0UA 2OC0A 3QN7A 1H8DH 4I8JA 4XSKU 1TIOA 1LHDH 1P12E 3ZVEA 1CGIE 3TH4H 3M5NA 1ACBE 1UTMA 4AG1A 1O2WA 2FMJA 2XW9A 2WV5A 1N8OC 4VGCC 1IQKA 3UQOA 1O3JA 3P70B 1AO5A 1MQ5A 4X1NU 1WTHD 1BMAA 3ZV9A 2BDBA 1HXFH 1C5QA 3A7YA 4I8HA 5EXMA 1ANCA 4ISLA 2Y7XA 1G3EA 3SU4A 1AE8H 2XWBI 1BT7A 2ZWLH 1O2HA 1AU8A 3U8RH 4BAQB 1OWJA 1P05A 2F9PA 1EJMA 4MPVA 4AN7A 1DLEA 3ZVFA 1P2MA 3OTJE 2EI6A 2ZNKH 1WQSA 2XCNA 3ZVDA 2VVUA 4Y76A 1DUAA 1HAVA 1Y3XA 2SNWA 1YGCH 5DG6A 4MPWA 1EXFA 4IW4E 2FXRA 2THFB 2GT7A 4YOIA 1TGNA 3Q77A 3H09A 1IQFA 5C5OA 1HCGA 1KIGH 4NIYA 1HGTH 1UTKA 1FZZA 4B71A 4O97A 1INCA 2FOBA 4CBOA 2G81E 5EQRA 3ATKA 1EZUC 1GL0E 2ZFTA 5C1XA 1ZGVA 2QIQA 1GHBF 1EASA 1GI2A 1TGBA 1DXPA 1IQEA 3HKIB 1HBTH 4RI0A 3ZV8A 4JYUH 1SGPE 2FOHA 4ZKNU 1TGSZ 4X0WU 5TCAA 3ELAH 3RXMA 4K8BA 2XBXA 5FAHA 1PQ5A 1Z1JA 2UUKB 3RM0H 1G37A 2OC7A 2P94A 3PYHA 2OK5A 4K69A 3STJA 1RIWC 3A87A 4TWWA 1CU1A 1G2LA 2GT8A 3A8AA 4KTUA 1GHXH 4I8LA 1BHXF 1FLEE 3F9EA 1O5CB 5DO4H 3TGKE 4H4FA 1EPTB 1HFDA 3BTEE 3GY8A 4DT7B 2VVVA 5C1UA 6CHAC 1CHOG 3U8TH 5C1YA 1W3CA 1TQ7B 1EAWA 1RRKA 1UTQA 2BDYA 4JYTA 3LC3A 1O2ZA 1AUJA 4DVAU 1K1OA 2AH4X 2I6QA 5E2OA 1T7CA 1AQ7A 1EAUA 2Z94A 1CE5A 2PTCE 1NFXA 4RKOB 1YPHE 1F7ZA 1XXDA 4NA9H 2TGPZ 3QLPH 2GX4A 1S82A 4THNH 1QB1A 2BLOA 1FY5A 1GMCF 2H5CA 4CRDA 2GVFA 2OLGA 2ZGBH 2ZCKP 3SU0A 3DUXH 1V2KT 3GISB 2V6NA 2PKAB 1NO9H 3AAVA 5GIBA 2DE9A 2ZFQH 1TA6A 1OPHB 2VNTA 4CRAA 4INLA 4H6SB 3M5MA 2F9UA 3LJJA 3RU4D 1IQMA 2FZZA 2GP9B 1OWDA 1LHFH 4OGXA 3SU5A 4ABBA 1OWHA 2PLXA 5HXFA 1TLDA 2VWLA 1IHTH 1C1MA 4H42U 5EU8A 2VU8E 1TFXA 3GDUA 1O3DA 1G30B 2Q6GA 1B0EA 3TH3H 1EOJA 4IN2A 1C9TA 4YTAA 3OYPA 4ISNA 5E0HA 1JWTA 1D9IA 3IITA 3SV9A 5GWZA 4ZHMU 1Y3UA 2G52A 3E91A 1G36A 3TH2H 3U1IB 4BXSA 1FN8A 1GI6A 3KIDU 1LHEH 1C5MD 1ARBA 1C1WH 4ZKRU 4YOGA 3UREA 5JB9S 3EA7A 2FP7B 5FPSA 1BQYA 1C5PA 2JH0D 4TWYA 4AGJA 3IG6B 4Z0KA 3LKWA 1P2JA 1XKAC 4F4OC 1ZMJA 3VGCC 2BMGB 1JXPA 1O2RA 2SGPE 4Y8ZA 2Q6FA 4K3JA 1EJNA 2EC9H 3VB7A 2J2UA 3BG8A 3AASA 1AD8H 3M3SA 3RXHA 3SNBA 1AFQC 3FP8E 1SHHB 1K28D 1O3LA 3E16B 3KN2A 4NIVA 4OS6A 3VXEH 5C20A 1GBFA 4IGDA 2GGVB 3F9GA 5H4IB 1GDQA 1Z7KA 4AGKA 1TGTA 1C5UA 1ELDE 1P04A 2NWNA 1VR1H 4B2BA 1T8LA 3CENA 3SZNA 4K1SA 1QJ6B 3S7HB 1G3DA 3P8FA 2XC0A 1S83A 5GJ4B 3RMNH 2A45B 1MTUA 4AFQA 5LPFA 3RXGA 2NU3E 1VJ9U 5F03A 1O5BB 3A89A 1PPFE 2R0LA 1S81A 2FI4E 3UNQA 2BDCA 1MKXH 1K1NA 1X7AC 4HI3A 3VB4A 2ZU1A 1KTTB 2BVRH 5HGGA 5G4BA 1LQDB 1GHYH 2ZDMA 3KNXA 1TNGA 3NZIA 3T29A 1O3EA 3QX5H 2JETB 1LKBA 1EAIA 2Z9LA 3MOCA 4M9FA 2BLVA 3P8GA 1V6DA 1GG6C 5C5NA 1NU7B 5DP5A 1TX8A 1ID5H 3M7UA 1HIAB 3T27A 1G32B 1D3PB 1SPJA 4RN6A 1AE5A 1RTFB 3F6UH 4NFFA 2GCHG 4Q7YA 2HPPH 3LONA 1FJSA 3MU8A 7GCHF 1UVUH 2ODQA 1SHYA 4JK6A 1T8OA 2GZ9A 4IBLH 1MAYA 1Z8IB 2HVXA 2ILNA 5ABWA 2W7SA 4GCHF 3O8BA 1TGCA 1SOZA 1BMNH 1NRNH 2CMYA 1KXCA 1C9PA 2D26C 3SJKA 3ZVBA 4KKDA 4XFQA 1B0FA 1J17T 2CHAC 1GBLA 3SJIA 4AOQA 2FM2A 1TNIA 1QGFA 1B5GH 4YO9A 2LNCA 3RXVA 1MTNC 2J94A 1GHAF 5A8XA 1W12U 3CP7A 1GI3A 4K60A 1HAVB 1S6HA 4I8KA 1VJAU 3RM2H 1FIZA 1GJCB 1VITH 1PQ7A 2ASUB 1Z6EA 3DFLA 3H7TA 4ZKOU 1KYNA 1FY8E 4YT6H 1O3FA 3GICB 5DP3A 1MCTA 1YF4A 1F5LA 2CGAA 2VGCC 2BOHB 3E6PH 2P93A 1S0RA 1GGDC 3ATLA 2P3FH 1UCYK 2OD3B 4F49A 2BLQA 2C4FH 1G9IE 3MU5A 2A0QB 3M37A 4KGAA 1O2YA 2ZA5A 3QTOH 5JBTA 3ZZBA 4D9RA 4X2YA 4U32A 8ESTE 4E7RG 1MKWH 1C1UH 2BHGA 2ZHEH 2GD4B 3QGJA 2IOTA 1V2OT 4J2YB 1G3CA 1O2QA 4NGAH 1TX7A 4MLFB 1NFYA 1ESBA 5EODA 4X6OA 3ZZCA 1YP9A 1GCTB 1GBJA 2ZGJA 5L2ZH 1HUTH 2RA0A 1DLKB 1C5NH 2FESH 2Y7ZA 5T6DA 4YM9A 1GBCA 3MFJA 1EB1H 1VGCB 1TE0A 1LMWB 1P2KA 4Y8YA 3BIVH 3OU0A 1ZHMA 1GDNA 4NIWA 3NK8A 1MU8B 1YPLH 2VIDA 3PLBA 1TOMH 4CR5A 1OP8A 2ZPSA 1GJ6A 1RD3B 4K1TA 2KAIA 2WPMS 1A5GH 3TJVA 1O39A 1OS8A 1KLIH 2SNVA 1UTLM 3KQEA 2BTCE 3ZZ5A 1CT4E 1LVYA 1MCVA 2HLCA 1O37A 1YKTA 1ZRKA 2W26A 4OS2A 4KTCA 1GJAB 2FDAA 3ZVAA 4X8TH 2FLRH 2ZCLP 1KXEA 1OWIA 4MQAA 3JZ1B 1JRSA 5PTPA 3EA9A 4DIIH 4OS1A 2O8WA 4ZKSU 2GZ7A 3UR9A 1FY4A 4NZQA 4KTSA 3OY5U 1E38B 6GCHF 3RDZA 1BTHH 1MH0A 1SGFA 4D7GA 1PJPA 3PV5A 1YBWA 3AK5A 3RXBA 1XM1A 3EGKH 1NT1A 2ZTZA 4NFEA 3ATIA 1H9IE 1KXFA 1ZSKA 1HB0B 1TRYA 2F9BH 1C1RA 1HV7A 2EI8A 1C5RA 2Y5HA 1BHXB 4OS5A 5B6LA 2OINA 3KGPA 4DGJA 4MNWA 2AS9A 1KXAA 5A2MH 3TJNA 1DWBH 1O5DH 1WQVH 1YLCA 1XUGA 1MTVA 1F5KU 1DWDH 2FTMA 5SGAE 5A09A 1HAIH 3SBKA 2G00A 3ZZ4A 2R0KA 3SU3A 3T25A 1BIOA 1SQTA 4X1PU 4XBDA 1P3EA 3LH3A 1V2PT 5GDSH 1ZTLA 1EPTC 4IMQA 1TMBH 3PROA 1NC6A 4UFFH 1ETRH 2ZTXA 3BF6H 3GCHB 1K1PA 4SGAE 1GBEA 3KQDA 2JKHA 1HAGE 2F3CE 1BTYA 3RXJA 1PPZA 1YLDA 2VIOA 2ZHFH 2VH0A 2P3TB 4LK4A 1FXYA 1TRMA 3SUFA 5ESBA 5L6NH 3SNEA 5L30H 1M9UA 5E0JA 8GCHF 1PYTC 1EAXA 1ELVA 1MU6B 2C8ZB 2XYAA 1QL9A 5CMXH 2BB4A 2J92A 1BITA 2A4RA 1N6YA 1GWAA 4BNRA 4AB8A 1CQQA 2SGAA 1THSH 2O8MA 2QXHA 1H9HE 2RG3A 1O2OA 1HNEE 2QXIA 3IWMA 2OUAA 5T6FA 2QV1A 1SLUB 4X8VH 3A7TA 4ZROA 3ZZAA 3SI3H 4ABHA 1GJ4H 3GY7A 1W0ZU 1SL3A 4FUIA 2BY8X 3OY6U 3ZZ3A 1V2VT 1B7XB 2UUFB 2BDHA 1FY3A 4U2WA 1ZYOA 5F6MA 3SGBE 1SLXB 3AW1A 1AB9B 3P95A 3MI4A 3CS7A 1XUHA 1T8MA 1SFIA 3SNCA 4A1TA 4SGBE 1O3CA 5FX6A 3SUDA 5IDKA 1GPZA 3TGJE 3KEEA 2XC4A 2QGRA 1O3NA 4Y7BA 1O3IA 1LVOA 1DY9A 3U8OH 3PV2A 1YCPH 1O2VA 3MO9A 1E36B 5DP6A 1VCWA 1MTWA 1DM4B 2XC5A 1QB6A 2Y5FA 4Q80A 1YC0A 3M61U 1NROH 1HJAB 1QCPA 1KY9A 4BAKB 1MZAA 4JCNA 1WAYB 1C4V2 5DK1A 1F2SE 3MYWA 1FI8A 1BBRH 1A5HA 1SGDE 4NA8A 1C2GA 5T3HA 2HGTH 1MD8A 1O2UA 5DPAA 1O2GH 1SGYE 1BCUH 4GHQA 3VEQB 1LQEA 2C93B 1GJ9B 1P0SH 1Y3VA 2FOEA 4Q2KA 5EW2H 1DOJA 2HALA 4YLUA 3PV4A 1O2LA 4FU9A 1GVKB 4X2XA 2W7UA 1VITF 1AY6H 2A4OA 2ZG0H 5J4SA 1JBUH 3U1JB 1BOQA 4O03A 3LT3A 4NIXA 2QF3A 2TGTA 1F0RA 3VB5A 1G3BA 5AF9H 3PB1E 1O35A 3VPKA 1CSOE 3PO1B 3E3TA 2VIVA 5F8ZA 5BRRE 2VINA 4YOJA 1H8IH 2ZDNA 2BXUH 4GAWA 3BEIB 3UR6A 1GJ7B 8LPRA 1UVOA 1OSSA 3MH7A 3GY6A 1BMMH 2PKSB 2BDGA 1TX6A 2Z6BD 1XUIA 3B23B 2ZKSA 2HNTF 2XBWA 2HNTE 1C2EA 4I8GA 3DT0H 2DUCA 2ZFPH 2D2DA 4I7YH 3ITIA 2W3KA 1ZHRA 1O3PB 2CXVA 2J34A 2UWLA 1WV7H 1A0LA 2JETC 3CS0A 2BY9X 1AVGH 1NFWA 4DW2U 1JRTA 1QQ4A 4AYVB 3D49H 1C1OA 2FEQH 2ZI2H 1BDAA 2ZP0H 4Y7AA 1SVPA 2FIRH 2G4UA 4DY7B 1DY8A 1GVZA 2QYIA 3FZZA 4CREA 3TPIZ 3HK3B 1D3DB 1AVWA 1DUEA 4K8YA 3ZZDA 4XE4A 5DP9A 3K2UA 4DCDA 3GCTG 4JZDH 3LH1A 4O3UA 4ZXYH 2YNBA 2A2QH 1ZPBA 2BD2A 4O9VA 2OBQA 1HAHH 2WINI 2Y81A 3SJOA 5GCHG 4XOJA 1ELBA 1CT0E 3MNXA 1CHGA 3NPSA 4X1SU 1SR5C 4OS4A 8KME2 1OP2A 1IQIA 2A31A 3M35A 5F8XA 2CV3A 1O2XA 3UPEA 2WPLS 1SSXA 3GCOA 2AIPA 1QJ1B 1LVMA 4CR9A 5JBAS 1IAUA 1RTLA 1MKXK 1QRWA 3TJOA 5FPTA 2ZGHA 1ELTA 3UTUH 4Y8XA 2B0FA 3HK6B 1ZJDA 3A84A 1ZSJA 2WV4A 3NWUA 3RU4T 2A1DB 3ZZ7A 2BD9A 1Z1IA 1SGEE 7ESTE 2PTNA 4BAHB 1O5FH 1BTUA 1LTOA 1SLVB 3ZVGA 2PGBB 2ZDVH 4ABDA 4NWLA 4AX9H 3SN8A 1VCPA 3S9AA 3LGUA 3S69A 5AVDA 2FLBH 1OKXA 3OX7U 1O3HA 3P8NA 4E06H 2G5VA 1V2UT 1L1GA 1GBDA 1DSTA 1N6XA 2DE8A 3MU1A 3V13A 2V35A 1MTSA 4HZHA 1UTNA 3URDA 3T2NA 3PMJA 2CF8H 2BY5X 2GV7A 1GCTC 1BJVA 3VB6A 3SO3A 4BOHA 1VGCC 2R3YA 2ZFRH 3GY4A 3TK5A 2VIQA 2ZCHP 2FOCA 1ABIH 1ELGA 1D6RA 2BD5A 1SFQB 1NFUA 1T8NA 4AORA 2YOLA 1PPBH 4B76A 3BTGE 2WPJS 1O0DH 3SGAE 1K1JA 1XMNB 1AKSA 3JZ2B 3TGIE 2FO9A 2J9NA 5EQSA 2C8XB 1DVAH 2IJOB 4CH8B 7LPRA 2Z3DA 4AZ2B 2QAAA 4OS7A 3AW0A 2BD8A 3M7QA 2VBCA 3LDXH 1ARCA 3STIA 3T62A 1MKWK 1P10A 3SUEA 3SNAA 3Q3XA 4ABJA 1Z8RA 1O2SA 4K1EA 1LCYA 3OSYA 1C5LH 1HJ8A 5K7RA 1QTFA 3ODFA 1L4ZA 2BQWB 1NESE 3LPRA 1K21H 1IQNA 2BOKA 1W13U 3D62A 3A8DA 1H9LB 3M5LA 2WYGA 4INKA 1RXPA 1FAXA 3B9FH 1Y8TA 5C67A 1QBVH 2OC8A 5I25A 4FUBA 5E0GA 4XBBA 4A5TS 1AWHB 2ANMH 3VXFH 5A8ZA 1NS3A 5C2ZA 1CBWB 1HAZB 3SU2A 1AFEH 3BV9B 5A0CA 1DSUA 2OP9A 2STBE 2SGDE 1LKAA 2V3OH 3MH6A 3KF2A 4WMEA 3ENSB 1BBRE 4X1RU 3W94A 2UUJB 2B9LA 4GUXA 1LHGH 1WYKA 1DWEH 2VIPA 4MVNA 4M7GA 3EAJA 2QCYA 1FONA 1CGHA 1C1TA 1O2IA 3EQ0H 1QA7A 1O2PA 2ZO3H 4I32A 4E7NA 1HAOH 1DXWA 2ZF0H 2BY6X 1QY6A 1WTGH 3MU0A 5E2PA 3ESTA 2A5IA 1E35B 5T6GA 1BUIA 2LPRA 1PQ8A 3GCHC 1GHZA 1L0ZA 1P11E 2FOFA 1E37B 2AMQA 1GI1A 5CHAB 3PMHB 3V12A 3RMMH 1GHWH 2PV9B 1LVBA 2ANKH 4Y6DA 3BIUH 1P2NA 4GHTA 6LPRA 2J4IA 4FUJA 5FX5A 2PW8H 1ZHPA 1Q2WA 2O8UA 3A8CA 1RS0A 4KP0A 2H9HA 3H7OA 1KDQA 1SLWB 4IN1A 1AIXH 3SV6A 3LC5A 1P9SA 2ODYB 1T4VH 3TNSA 4B75A 2A2XH 3U9AH 2RDLA 2BQ6B 2V0BA 4CRBA 5DP8A 2FWWA 2ZFFH 3M5OA 1C5WB 3RXCA 2FTLE 2OTVA 3VB3A 3B8JA 4WXVA 1SGQE 5DJ7A 3RXKA 4TPYA 2AYWA 1W8BH 1PPCE 2CN0H 2A7JA 1OX1A 1W2KH 2H2ZA 1K22H 1AB9C 2RA3A 3TK9A 3F1SB 1D4PB 1EKBB 3SV7A 1XKBC 3L33A 1CT2E 3RXQA 1JIMA 3P17H 1C5OH 1ESTA 1NU9A 2TRMA 3NCLA 2F91A 2HWLB 1MZDA 3A83A 2ZQ1A 2FS9A 4D8NA 3MHWU 1K9OE 2GCHF 3PTBA 2BVSH 2O8TA 1TNJA 1LDTT 3RXEA 2EA3A 1HJAC 3MO6A 1BA8B 2B7DH 1O36A 2HOBA 3ZZ8A 2NU1E 3A7VA 2FX4A 2G55A 2TPIZ 4NWKA 4Y0YE 1A5IA 2AIQA 3LOXA 1BRCE 1FIWA 1K1LA 1G2MA 1D3TB 1AZZA 5ESTE 5EXNA 1C4U2 1DE7H 1D3QB 1O5GH 3K6YA 4FUGA 4X8UH 2A4GA 2Z9IA 4D76A 4JYVH 3AAUA 2FI5E 5TJXA 1TPPA 4B6FA 1W0YH 3ZYEA 1HYLA 4CHAB 1J16A 2Q6DA 1ETTH 3GOVB 3A80A 5FPYA 2A5KA 2ESTE 4DOQA 1GMHG 2YNAA 1DS2E 3MH5A 1XUFA 3BTKE 1UK4A 2HPQH 2ZHDA 4ABAA 3TNTA 1Y3YA 2W3IA 2BXTH 4IC5A 3V3MA 3WY8A 3MO3A 1PPHE 3E90B 1V3XA 1BJUA 2ZFSA 3UNSA 3O8RA 2F9OA 1H4WA 1GBAA 1L2EA 3PO1C 4TY6A 1GMDG 1Y59T 1V2ST 1Q3XA 2ZQ2A 1O2TA 1IOEA 4AFUA 2RCEA 2XCFA 3SGQE 2QN5T 4K2YA 4ABFA 1CA0B 3FP7E 3GYLB 3P92A 4R0IA 3NXPA 2PKSC 3SU6A 1QRXA 1EZQA 2BQ7B 3T28A 2ZU3A 3R3GB 1FAKH 3F68H 5JBBS 3SQHE 2H9TH 3Q00A 1P02A 1O34A 3HGNA 6ESTA 5IYTA 3F9HA 1C1PA 4WH6A 1A4WH 4MNYA 2A32A 1BTPA 2AGEX 3SOSA 4AB9A 1O38A 1TRNA 1P57B 2VWNA 2ULLA 2BZ6H 1EATA 1O3AA 4UFDH 2AEIH 1HXEH 1NTPA 2P16A 2VIWA 4Q7ZA 3Q76A 4Q7XA 3KCGH 4A1VA 1S85A 1TBQH 4Y10E 2ZGXH 1UJ1A 1S84A 4WJG2 2PUXB 3FP6E 4XBCA 4YT7H 2XTTB 1SBWA 1C5VA 1KTSB 1W11U 4YESB 3UNRA 3A88A 3GY3A 2G4TA 1NRRH 5GNDA 1C5TA 5EG4A 3MWIU 3UOPA 1OOKB 4UONA 1C2IA 3P6ZB 4LZ4B 2SFAA 5CE1A 2Z7FE 2QXGA 2STAE 2XWAA 3D23A 3M3TA 2BZAA 5I46H 2PGQB 1OP0A 1V2MT 1ZTKA 2XBYA 1TPOA 4GSOA 2OXSA 3LGIA 1GVLA 1AKSB 3KQCA 3SUGA 1C4Y2 1DX5M 1VZQH 3FAOA 2AGGX 4DJZB 1QQUA 5FHTA 1GJDB 1ZZZA 3DHKH 3LGYA 2H9EH 3RMOH 5GXPA 1NY22 3G01A 5EOKA 5FBEA 1SQOA 5LPEA 1TPAE 1GHBG 1HJ9A 2Q1JA 2GDEH 3SQEE 4U01A 1P09A 1CVWH 1EP5A 3RXSA 2ZDLA 2NU0E 1PYTD 4JZEH 1ANBA 1YYY1 5FCKA 3QWCH 1K1MA 5DKMA 4IC6A 4FVDA 3BEFB 1O3KA 3I77A 3Q3KA 2WUCA 3NKKA 1T4UH 1Y5BT 4GLYA 5EW1H 1XX9A 2A7HA 2EEKA 1BTWA 1FNIA 4CRCA 4YZUA 1V2TT 3TK6A 1C2LA 5HM2A 1F0TA 1J14A 1QRZA 2AERH 2TBSA 1GBIA 1ESAA 2FYQA 3GYMA 1SGCA 1WSSH 3U69H 2VH6A 1QBNA 5FBIA 1UO6A 1YPEH 3A82A 3RXLA 1K2I1 1C2KA 3T26A 2VWMA 1QR3E 1T32A 1ZLRA 1TAWA 1WOFA 2G8TA 4PROA 4GVUA 1O3MA 2O9QA 3BTWE 2R2WU 4OM9A 3A7XA 2QC2A 1V2QT 1GCDA 1HAYB 3MMGA 1THRH 2QF0A 1DWCH 5ETXA 1P2QA 1YPJH 4X2WA 1O2MA 1UHBA 4MTBA 1QB9A 1GMCG 2ZDKA 4B1TA 3BG4B 3K65B 3M36A 1HDTH 1SGTA 3EDXB 3SW2B 1V2WT 3DD2H 4BAOB 3RUOA 2FOMB 4J1YA 3D65E 5E8EH 3KHVA 1BTXA 3RXTA 1ABJH 1O2JA 1ZPZA 2R9PA 3PWCA 1LO6A 1IQLA 2F9NA 3FANA 1CGJE 2F83A 1L1NA 3UOUA 2OQ5A 1KDQB 1VCQA 1IQJA 1V2JT 4A92A 3FZDA 3M7TA 1DICA 2BD3A 3QGNB 5EXLA 1DANH 4CBNA 2GCTB 2ZIQH 2Y82A 2F4LA 4LZ1H 4MPXA 2A4QA 1UMAH 2OQUA 1O2KA 2R3UA 4U30A 1E0FD 2FPZA 4WY3A 1SB1H 1S6FA 2ODPA 1QNJA 2GMTB 3BEUA 4GPGA 4INHA 3UY9A 1Z6JH 2HRVA 4IMZA 1AZ8A 2GZ8A 1IQHA 4Y79A 4I33A 2WV9A 1TONA 4R8TB 5J4QA 1SGIB 2P8OB 2SGFE 3LIWA 1AMHA 1GI5A 2V3HH 1HRTH 2ZDAH 4FUDA 1QBOA 3M3VA 4MNXA 4D7FA 1KLTA 3SV8A 2PSYA 1O3GA 1BRUP 2WYJA 1CBWC 3GDSA 2W5EA 4TY7A 1RFNA 1TALA 2ALPA 5HM9A 4JZIA 1THPB 3EYDA 1IQGA 1P01A 1ANDA 1ZRBA 3F9FA 4WWYA 2BM2A 5AFYH 5EPYA 4MDSA 1GI8B 1WCZA 1TBRH 2KAIB 2FI3E 4AFZA 3RXRA 3UUZA 5EPNA 2GTBA 2UWOA 3H5CB 3ATMA 1BRBE 2B8OH 4NA7A 1GI9B 1TYNA 1FPHH 3BTME 3MNCA 5CHAC 1A1RA 2C90B 4Z6AH 3V0XA 5L2YH 4B2CA 3LGVA 1P2OA 4CH2B 3RXUA 1TOCB 1DT2A 2P95A 4AG2A 4HFPB 2ALVA 4ISOA 4X6NA 1AUTC 3HATH 1C1VH 1GDUA 1WBGB 3BSQA 1IHSH 1SG8B 4ZHLU 3I78A 1MQ6A 2VWOA 3QZRA 1N1LA 2AGIX 1FUJA 4A1XA 3RLYH 1ELFA 1H1BA 1QJ7B 1FDPA 1P2IA 1QURH 4MG3A 3SYJA 1WXRA 3A81A 1QA0A 3PLKA 1AI8H 1D6WA 1JIRA 1ETSH 3VFEA 2H5DA 4UFEH 1UVPA 1OWKA 1AGJA 3BN9A 1GL1A 3QDZB 4ZXXH 2F9VA 1NPMA 1TA2A 2B5TB 5BPEA 3UIRA 3RXOA 1A7SA 2GV6A 4CRFA 3W95A 2FX6A 3EE0B 1BRAA 1CHOF 1N8OB 1UTOA 2GDDA 4VGCB 1UCYE 2TGAA 4LXBH 2H1UA 2XRCA 3HKJB 2Y80A 1O33A 1C1QA 2C3SA 3BTFE 1MMJN 1W7XH 3RC5A 1UK3A 3OTPA 1ZR0A 1TABE 7KMEH 3SI4H 1BZXE 2FS8A 3P8OA 2VB0A 1L1JA 1RTKA 3UWIA 4B74A 2AFQB 3BTTE 2WPKS 3UQVA 3GCTF 1RGQA 2Y6TA 3GY2A 4B73A 3SV2H 7GCHG 3PMBB 2OBOA 2K1QA 4FU8A 2VJ1A 3QZQA 5LH8A 4BTUB 1J15A 5GCHF 4MPUA 4GCHG 4KELA 1RJXB 1Y3WA 1SOTA 1TB6H 1EZXC 1YM0A 4WMFA 5A8YA 5DP4A 4OGYA 2XBVA 4NSVA 3LJOA 2XXLA 1SQAA 2ZPQA 1C5YB 1QHRB 3TVJB 1BB0B 1Q31A 2CJIA 2Z9KA 4FXGH 1XVMA 1EOLA 1MD7A 4AYYB 4NG9H 3TLOA 2J95A 1CO7E 1GHAG 5LGOA 2BD7A 9ESTA 1MAXA 2SGEE 1O2NA 4JZ1A 2ZHQH 3A7ZA 3QTVH 4BANB 4CHAC 1OYTH 1YCPM 3PWBA 1AVXA 1SC8U 2ZHWH 3TU7H 5JBCS 3UWJH 2Z3CA 1SGRE 3LGWA 1EZSC 5JYIA 3RXPA 1EB2A 1KSNA 2ZTYA 3QUMP 1C2JA 1C5SA 1LPZB 1S5SA 1ELAA 2UUYA 4RSPA 4D9QA 1O31A 1NRPH 1C2DA 1RIWB 5GPIB 4ESTE 1SI5H 4E05H 1ELCA 1EUFA 2PWXA 2HNTC 2M5TA 1J9CH 1UK2A 1O32A 1O3BA 1P9UA 3GY5A 3ZYDA 1J8AA 6CHAB 1AHTH 2OCVB 3U98H 4ZH8A 1U6QA 1MBMA 3URCA 1TWXB 1A3BH 1CA0C 1SGFG 1A61H 2FYRA 3RC6A 1ZGIA 3O8CA 1MBQA 2OC1A 4DIHH 4ZMAH 1ZOMA 1TNKA 2QA9E 1O5EH 1C1NA 4FU7A 5B6OA 1XUKA 2PSXA 1BMLA 1EX3A 1O5AB 4WH8A 2FODA 2Z3EA 3E0NB 2WPHS 1L4DA 1YPHC 2GKVE 2SGQE 3NUMA 4FUCA 4HGCA 4H6TA 1WU1A 1AWFH 4JZFH 5DP7A 1OXGA 1PPGE 1JMOH 2Z9JA 5FXLA 3N7OA 1XVOA 4IS5A 3RC4A 1EQ9A 3ODDA 3RP2A 1DFPA 1ZPCA 1ZJKA 4UDWH 1GBMA 1JOUB 1W7GH 2PFEA 1UTPA 1LPKB 1F5RA 1BTZA 1ZMNA 3GDVA 4MNVA 1GBKA 2IJD1 5JB8S 1QFKH 3KQBA 5F8TA 1F92A 2ZEBA 4ISIH 4DURA 3BTDE 3A7WA 2BVXH 4NZLA 1UHBB 3Q3YA 2TGDA 2ZZUH 4BTIB 4CRGA 1YPKH 1TBZH 1P8VC 4X2VA 1GJBB 3S0NA 3R0FA 2NU2E 4ABIA 4Y0ZE 1TMUH 1CA8B 1GBHA 1QL7A 6GCHG 2C8WB 2BY7X 3MH4A 4A7IB 2PUQH 3E8LA 1ORFA 3RXIA 3C1KA 2D8WA 3SORA 3GCNA 3EA8A 1EPTA 1Z8JB 1F0SA 2Y5GA 3FFGA 4O3TA 1O3OA 1LPGB 1V2RT 4ABGA 3PM3A 2EI7A 2IN2A 3I29A 4ABEA 1SGNE 2BYAX 2QXJA 5FCRA 1V2NT 3SHCH 2ZC9H 1EJAA 3FVFB 3TJUA 5JPMH 3KL6A 2ANYA 1C2HA 5A0BA 1FN6A 3VGCB 4ZUHA 2FOAA 2R2MB 3RLWH 3SZEA 1FY1A 3A86A 2ANWA 1O30A 1TNLA 1NRSH 1XXFA 4ISHH 1EP6A 3QO6A 1OWEA 4UE7H 1V2LT 2CF9H 4NSYA 1AFQB 2ZGCA 5TCCA 3SNDA 1DITH 9LPRA 2A7CA 1SMFE 4WXIA 3T5FH 1ZSLA 2I6SA 5LPRA 4X1QU 1S0QA 1PFXC 1C5ZB 3LU9B 2A5AA 3RMLH 1NN6A 1Z71A 2VVCA 4FUEA 5JDUB 2ZU4A 1KLJH 2PKAA 3PTNA 1HLTH 3S9BA 1GJ5H 4UD9H 3C27B 8GCHG 4UFGH 3HGPA 2PHBA 1ELEE 5DGJA 1FPCH 1NRQH 1A0JA 3ATWA 5HMAA 1A3EH 3ZZ6A 1C2MA 4UEHH 1GBTA 4ZHAA 1WUNH 2BLWA 1HAPH 1KXBA 1Y5UT 1FV9A 3BG4C 2ZU2A 4TPIZ 2J38A 5A0AE 1C5XB 4Y11E 4RKJB 4ASHA 2AMPA 1YCPK 3UFAA 1FMGA 4WMDA 4AFSA 4QT8C 2WHXA 1FQ3A 4I31A 5K0HA
chains in the Genus database with same CATH superfamily
4FUHA 4Y71A 2G51A 2WPIS 1UVTH 1C2FA 1GI4A 3TIUA 3LGTA 1GBBA 1AN1E 3ZZ9A 1LHCH 1NM6A 1T31A 2XNIA 1BBRK 4ACAA 2QF4A 3DA9B 2GCTC 1GG6B 4WF8A 4JK5A 4X6PA 3QK1A 1QIXB 2J97A 2P3UB 1P06A 1TPSA 2P59A 2O8LA 4X8SH 1UCYH 3SHAH 1P03A 4FVBA 2GMTC 3A85A 2G5NA 2AMDA 3PRBA 4A6LA 4BTTB 1A46H 3SJ8A 1A0HB 1W10U 4X6MA 1GHVH 2PR3A 4DG4A 1MUEB 2ZU5A 3FKSD 3K6ZA 2P8OC 3PMAB 3A8BA 3BTQE 1PQAA 2XNDD 3RXDA 1K1IA 3MU4A 1UVSH 2WUBA 1P3CA 1ZTJA 1YPMH 1C1SA 4HG6A 3L6PA 2NU4E 3RXFA 3E1XB 1WDIA 2CHAB 3O8DA 4LOYH 3ZVCA 2D1JA 3PRDA 3RU4E 1W14U 1Z8GA 3S7KB 4YLQH 4BAMB 2C8YB 4B2AA 1HPGA 1NZQH 1UTJA 5AHGH 1MTNB 1MABB 1XUJA 3MNSA 1GI0A 5T1VA 3DFJA 3NRLA 3SJ9A 2TIOA 1DPOA 1PPEE 1YPGH 1Y5AT 3DSPA 2QY0B 2ZECA 3KYFA 3L3TA 3MNBA 1HAXB 2IPHA 5AFZH 1TQ0B 3AVZA 3V7TA 5KGOA 5HYOA 3S9CA 1GMHF 4TYDA 4ZAEA 5EQQA 1ZMLA 1KXDA 1VITG 3PLPA 2FOGA 3SU1A 1QL8A 2VGCB 3MTYA 3TITA 1K0HA 1GGDB 2BX3A 2WZQA 1DDJA 2BX4A 2UWPA 2Z9GA 2BD4A 1GMDF 2ZPRA 2LP6A 2BDAA 1GJ8B 4B6EA 4NCYA 4BXWA 3RXAA 4WVPE 4XDEA 1TMTH 2JH5D 1TNHA 3BTHE 2H6MA 4JMYA 1OYQA 4K5ZA 2JH6D 1E34B 1FX0B 5C3NA 3K9XB 4HTCH 3E0PB 1ANEA 1A2CH 3W1EA 5EGMA 1GI7B 2BDIA 1HIAA 5HIYA 2YMSC 4FUFA 3HPTB 1F0UA 2OC0A 1BMFD 3QN7A 1H8DH 4I8JA 4XSKU 1TIOA 1LHDH 1P12E 3ZVEA 1CGIE 1SKYE 3TH4H 3M5NA 1ACBE 1UTMA 4AG1A 1O2WA 2FMJA 2XW9A 2WV5A 1N8OC 4VGCC 1IQKA 3UQOA 1O3JA 3P70B 2QF5A 1AO5A 1MQ5A 4X1NU 1WTHD 1BMAA 3ZV9A 2BDBA 1HXFH 1C5QA 3A7YA 4I8HA 5EXMA 1ANCA 4ISLA 2Y7XA 1G3EA 3SU4A 1AE8H 2XWBI 1BT7A 2ZWLH 1O2HA 1AU8A 3U8RH 1S6LA 4BAQB 1OWJA 1P05A 2F9PA 1EJMA 4MPVA 4AN7A 1DLEA 3ZVFA 1P2MA 3OTJE 2EI6A 2ZNKH 1WQSA 2XCNA 3ZVDA 2VVUA 4Y76A 1DUAA 1HAVA 1Y3XA 2SNWA 1YGCH 5DG6A 4MPWA 1EXFA 4IW4E 2FXRA 2THFB 2GT7A 4YOIA 1TGNA 3Q77A 3H09A 1IQFA 5C5OA 1HCGA 1KIGH 4NIYA 1HGTH 1UTKA 1FZZA 4B71A 4O97A 1INCA 2FOBA 4CBOA 2G81E 5EQRA 3ATKA 1EZUC 1GL0E 2ZFTA 5C1XA 1ZGVA 2QIQA 1GHBF 1EASA 1GI2A 1TGBA 1DXPA 1IQEA 3HKIB 1HBTH 4RI0A 3ZV8A 4JYUH 1SGPE 2FOHA 4ZKNU 1TGSZ 4X0WU 5TCAA 3ELAH 3RXMA 4K8BA 2XBXA 5FAHA 1PQ5A 1Z1JA 2UUKB 3RM0H 1G37A 2OC7A 5CDFE 2P94A 3PYHA 2OK5A 4K69A 3STJA 1RIWC 3FN8A 3A87A 4TWWA 1CU1A 1G2LA 2GT8A 3A8AA 4KTUA 1GHXH 4I8LA 1BHXF 1FLEE 3F9EA 1O5CB 5DO4H 3TGKE 4H4FA 1EPTB 1HFDA 3BTEE 3GY8A 4DT7B 1NBMD 2VVVA 5C1UA 6CHAC 2L6OA 1CHOG 3U8TH 5C1YA 1W3CA 1TQ7B 1EAWA 1RRKA 1UTQA 2BDYA 2KFWA 4JYTA 3LC3A 1O2ZA 1AUJA 4DVAU 1K1OA 2AH4X 2I6QA 5E2OA 1T7CA 1AQ7A 1EAUA 2Z94A 1CE5A 2PTCE 1NFXA 4RKOB 1YPHE 1F7ZA 1XXDA 4NA9H 2TGPZ 3QLPH 5C0TA 2GX4A 1S82A 4THNH 1QB1A 2BLOA 1FY5A 1GMCF 2H5CA 4CRDA 2GVFA 2OLGA 2ZGBH 2ZCKP 3SU0A 3DUXH 1V2KT 3GISB 2V6NA 2PKAB 4I86A 1NO9H 3AAVA 5GIBA 2DE9A 2ZFQH 1TA6A 1OPHB 2JJ1D 2VNTA 4CRAA 4INLA 4H6SB 3M5MA 2F9UA 3LJJA 3RU4D 3GS9A 1IQMA 2FZZA 2GP9B 1OWDA 4DT4A 2CK3D 1LHFH 4OGXA 3SU5A 4ABBA 5DSFA 1OWHA 2PLXA 5HXFA 1TLDA 2VWLA 1IHTH 1C1MA 4H42U 5EU8A 2VU8E 1TFXA 3GDUA 1O3DA 1G30B 2Q6GA 1B0EA 3TH3H 1EOJA 4IN2A 1C9TA 4YTAA 3OYPA 4ISNA 5E0HA 1JWTA 1D9IA 3IITA 3SV9A 5GWZA 4ZHMU 1Y3UA 3EE7A 2G52A 3E91A 1G36A 3TH2H 3U1IB 4BXSA 1FN8A 1GI6A 3KIDU 1LHEH 1C5MD 1ARBA 1C1WH 4ZKRU 4YOGA 3UREA 5JB9S 3EA7A 2FP7B 5FPSA 1BQYA 1C5PA 2JH0D 4TWYA 4AGJA 3IG6B 4Z0KA 3LKWA 1P2JA 1XKAC 4F4OC 1ZMJA 3VGCC 2BMGB 1JXPA 1O2RA 2SGPE 4Y8ZA 2Q6FA 4K3JA 1EJNA 2EC9H 3VB7A 2J2UA 5HIZA 3BG8A 3AASA 1AD8H 3M3SA 3RXHA 3SNBA 1AFQC 3FP8E 1SHHB 1K28D 4YXWD 1O3LA 3E16B 3KN2A 4NIVA 3N7EA 1UW7A 4OS6A 3VXEH 5C20A 1GBFA 4IGDA 4F55A 2GGVB 3F9GA 5H4IB 1GDQA 1Z7KA 4AGKA 1TGTA 1C5UA 1ELDE 1P04A 2NWNA 1VR1H 4B2BA 5F53A 1T8LA 3CENA 4AC9A 3SZNA 4K1SA 1QJ6B 3S7HB 1G3DA 3P8FA 2XC0A 1S83A 5GJ4B 3RMNH 2A45B 1MTUA 4AFQA 5LPFA 3RXGA 2NU3E 1YWUA 1VJ9U 1E79D 5F03A 1O5BB 3A89A 1PPFE 2R0LA 1S81A 2FI4E 2KR7A 3UNQA 2BDCA 1MKXH 1K1NA 1X7AC 4HI3A 3VB4A 2ZU1A 1KTTB 2BVRH 5HGGA 5G4BA 1LQDB 1GHYH 2ZDMA 3KNXA 1TNGA 3NZIA 3T29A 1O3EA 3QX5H 2JETB 1LKBA 1EAIA 2Z9LA 3MOCA 4M9FA 2BLVA 3P8GA 1V6DA 1GG6C 5C5NA 1NU7B 5DP5A 1TX8A 1ID5H 3M7UA 1HIAB 3T27A 1G32B 1D3PB 1QZ8A 1SPJA 4RN6A 1AE5A 1RTFB 3F6UH 4NFFA 2GCHG 4Q7YA 2HPPH 3LONA 1FJSA 3MU8A 7GCHF 1UVUH 2ODQA 1SHYA 4JK6A 1T8OA 2GZ9A 4IBLH 1MAYA 1Z8IB 2HVXA 2ILNA 5ABWA 2W7SA 4GCHF 3O8BA 1TGCA 1SOZA 3F0PA 1BMNH 1NRNH 2CMYA 1KXCA 1C9PA 2D26C 3SJKA 3ZVBA 4KKDA 4XFQA 1B0FA 1J17T 2CHAC 1GBLA 3SJIA 4AOQA 2FM2A 1TNIA 1QGFA 1B5GH 4YO9A 2LNCA 3RXVA 5KECA 1MTNC 2J94A 1GHAF 5A8XA 1W12U 3CP7A 1GI3A 4K60A 1HAVB 1E1QD 1S6HA 2JIZD 4I8KA 1VJAU 3RM2H 1FIZA 1GJCB 1VITH 1PQ7A 2ASUB 1Z6EA 2V3MA 3DFLA 3H7TA 4ZKOU 1KYNA 1FY8E 4YT6H 1O3FA 3GICB 5DP3A 1MCTA 1YF4A 2HLDD 1F5LA 2CGAA 2VGCC 2BOHB 3E6PH 2P93A 1S0RA 1GGDC 3ATLA 2P3FH 1UCYK 2OD3B 4F49A 2BLQA 2C4FH 1G9IE 3MU5A 2A0QB 3M37A 4KGAA 1O2YA 2ZA5A 3QTOH 5JBTA 3ZZBA 4D9RA 4X2YA 4U32A 8ESTE 4E7RG 1MKWH 1C1UH 2BHGA 3WW7A 2ZHEH 1EFRD 2GD4B 3QGJA 2IOTA 1V2OT 4J2YB 3KYGA 1G3CA 1O2QA 4NGAH 1TX7A 4MLFB 1NFYA 1ESBA 5EODA 4X6OA 3ZZCA 1YP9A 1GCTB 1GBJA 2ZGJA 5L2ZH 1HUTH 2RA0A 1DLKB 1C5NH 2FESH 2Y7ZA 5T6DA 4YM9A 1GBCA 3MFJA 1EB1H 1VGCB 2WSSD 1TE0A 1LMWB 1P2KA 4Y8YA 3BIVH 3OU0A 1ZHMA 1GDNA 4NIWA 3NK8A 1MU8B 1YPLH 2VIDA 3PLBA 1TOMH 4CR5A 1OP8A 2ZPSA 1GJ6A 4ASUD 1RD3B 2K8IA 4K1TA 2KAIA 2WPMS 1A5GH 3TJVA 1O39A 1OS8A 3FOAA 1KLIH 2SNVA 1UTLM 3KQEA 2BTCE 3ZZ5A 1CT4E 1LVYA 1MCVA 2HLCA 1O37A 1YKTA 1ZRKA 2W26A 4OS2A 4KTCA 1GJAB 2IPQX 2FDAA 3ZVAA 4X8TH 2FLRH 2ZCLP 1KXEA 1OWIA 4MQAA 3JZ1B 1JRSA 2EQNA 5PTPA 3EA9A 4DIIH 3OEED 4OS1A 2O8WA 4ZKSU 2GZ7A 2RDEA 1FY4A 3UR9A 4NZQA 4KTSA 3OY5U 5EJZA 1E38B 6GCHF 3RDZA 1BTHH 1MH0A 1SGFA 4D7GA 1PJPA 3PV5A 1YBWA 3U28C 3RXBA 3AK5A 1XM1A 3EGKH 1NT1A 2ZTZA 4NFEA 3ATIA 1H9IE 1KXFA 1ZSKA 1HB0B 1TRYA 2F9BH 1C1RA 1HV7A 2EI8A 3N7DA 1C5RA 2Y5HA 1BHXB 4OS5A 5B6LA 2OINA 3KGPA 4DGJA 4MNWA 2AS9A 1KXAA 5A2MH 3TJNA 1DWBH 1O5DH 1WQVH 1YLCA 1XUGA 1MTVA 1F5KU 1DWDH 2FTMA 5SGAE 5A09A 1HAIH 3SBKA 2KCPA 2G00A 3ZZ4A 2R0KA 3SU3A 3T25A 1BIOA 1SQTA 4X1PU 4XBDA 1P3EA 3LH3A 1V2PT 5GDSH 1ZTLA 1EPTC 4IMQA 1KMHB 1TMBH 3PROA 1NC6A 4UFFH 1ETRH 2ZTXA 3BF6H 3GCHB 1K1PA 4SGAE 1GBEA 3KQDA 2JKHA 1HAGE 2F3CE 1BTYA 3RXJA 1PPZA 1YLDA 2VIOA 2ZHFH 2VH0A 2P3TB 4LK4A 1FXYA 1TRMA 3SUFA 5ESBA 5L6NH 3SNEA 5L30H 1M9UA 5E0JA 8GCHF 1PYTC 1EAXA 1ELVA 1MU6B 2C8ZB 2XYAA 1QL9A 5CMXH 2BB4A 2J92A 1BITA 2A4RA 1N6YA 1GWAA 4BNRA 4AB8A 1CQQA 2SGAA 4F48B 1THSH 2O8MA 2QXHA 1H9HE 2RG3A 1O2OA 1HNEE 2QXIA 3IWMA 2OUAA 5T6FA 2QV1A 1SLUB 4X8VH 3A7TA 4ZROA 3ZZAA 3SI3H 4ABHA 1GJ4H 3GY7A 4Q63A 1W0ZU 1YLNA 1SL3A 4FUIA 2BY8X 3OY6U 5C17A 3ZZ3A 1V2VT 1B7XB 2KCAA 2UUFB 2BDHA 1FY3A 4U2WA 1ZYOA 5F6MA 3SGBE 1SLXB 3AW1A 1AB9B 3P95A 3MI4A 3CS7A 1XUHA 1T8MA 1SFIA 3SNCA 4A1TA 4SGBE 1O3CA 5FX6A 3SUDA 5IDKA 1GPZA 4FOUC 3TGJE 3KEEA 2XC4A 2QGRA 1O3NA 4Y7BA 1O3IA 1LVOA 1DY9A 3U8OH 3PV2A 1YCPH 1O2VA 3MO9A 1E36B 5DP6A 1VCWA 1MTWA 1DM4B 2XC5A 1QB6A 2Y5FA 4Q80A 1YC0A 3M61U 4FETA 1NROH 1HJAB 1QCPA 1KY9A 4BAKB 1MZAA 4JCNA 1WAYB 1C4V2 5DK1A 1F2SE 2F43B 3MYWA 1FI8A 1BBRH 1A5HA 1SGDE 4NA8A 1C2GA 5T3HA 2HGTH 1MD8A 1O2UA 5DPAA 1O2GH 1SGYE 1BCUH 4GHQA 3VEQB 1LQEA 2C93B 1GJ9B 1P0SH 1Y3VA 2FOEA 4Q2KA 5EW2H 1DOJA 2HALA 4YLUA 3PV4A 1O2LA 2YMSD 4FU9A 1GVKB 4X2XA 2W7UA 1VITF 1AY6H 2A4OA 2ZG0H 5J4SA 1JBUH 3U1JB 1BOQA 4O03A 3LT3A 4NIXA 2QF3A 2TGTA 1F0RA 3VB5A 1G3BA 5AF9H 3PB1E 1O35A 3VPKA 1CSOE 3PO1B 2PP6A 3E3TA 2VIVA 5F8ZA 5BRRE 2VINA 4YOJA 1H8IH 2ZDNA 2BXUH 4GAWA 3BEIB 3UR6A 1GJ7B 3DSGA 8LPRA 1UVOA 4TSFD 1OSSA 3MH7A 3GY6A 1BMMH 2PKSB 2BDGA 1TX6A 2Z6BD 1XUIA 3B23B 2ZKSA 2HNTF 2XBWA 2HNTE 1C2EA 3UB0A 4I8GA 3DT0H 2J5UA 2DUCA 2ZFPH 2D2DA 4I7YH 3ITIA 2W3KA 1ZHRA 1O3PB 2CXVA 2J34A 2UWLA 1WV7H 1A0LA 5EIYA 2JETC 3CS0A 2BY9X 1AVGH 1NFWA 4DW2U 1JRTA 1QQ4A 4AYVB 3D49H 1C1OA 2FEQH 2ZI2H 1BDAA 2ZP0H 4Y7AA 1SVPA 2FIRH 2G4UA 4DY7B 1DY8A 1GVZA 2QYIA 3FZZA 4CREA 3TPIZ 3HK3B 1D3DB 1AVWA 1DUEA 4K8YA 3ZZDA 4XE4A 5DP9A 3K2UA 4DCDA 3GCTG 4JZDH 3LH1A 4O3UA 4ZXYH 2YNBA 2A2QH 1ZPBA 2BD2A 4O9VA 2OBQA 1HAHH 2WINI 2Y81A 3SJOA 5GCHG 4XOJA 1ELBA 1CT0E 3MNXA 1CHGA 3NPSA 4X1SU 1SR5C 4OS4A 8KME2 1OP2A 1IQIA 2A31A 3M35A 5F8XA 2CV3A 1O2XA 3UPEA 2WPLS 1SSXA 3GCOA 2AIPA 1QJ1B 1LVMA 4CR9A 5JBAS 1IAUA 5DN6D 1RTLA 1MKXK 1QRWA 3TJOA 5FPTA 2ZGHA 5EJ1A 1ELTA 3UTUH 4Y8XA 2B0FA 3HK6B 1ZJDA 3A84A 1ZSJA 2WV4A 3NWUA 3RU4T 2A1DB 3ZZ7A 2HVYB 2BD9A 1Z1IA 1SGEE 7ESTE 2PTNA 4BAHB 1O5FH 1BTUA 1LTOA 1SLVB 3ZVGA 2PGBB 2ZDVH 4ABDA 4NWLA 4AX9H 2AHME 3SN8A 1VCPA 3S9AA 3LGUA 3S69A 5AVDA 2FLBH 1OKXA 3OX7U 1O3HA 3P8NA 4E06H 2G5VA 1V2UT 1L1GA 1GBDA 1DSTA 1N6XA 2DE8A 3MU1A 3V13A 5FL7D 2V35A 3F0OA 4Z1MD 1MTSA 4HZHA 1UTNA 3URDA 3T2NA 3PMJA 2CF8H 2BY5X 2GV7A 1GCTC 2W6ID 1BJVA 3VB6A 3SO3A 4BOHA 1VGCC 2L74A 2R3YA 2ZFRH 3GY4A 2VIQA 3TK5A 2ZCHP 2FOCA 1ABIH 1ELGA 1D6RA 2BD5A 1SFQB 1NFUA 1COWD 1T8NA 4AORA 2YOLA 2JJ2D 1PPBH 4B76A 3BTGE 2WPJS 1O0DH 3SGAE 1K1JA 1XMNB 1AKSA 3JZ2B 3OEHD 3TGIE 2FO9A 2J9NA 5EQSA 2C8XB 1DVAH 2RFKC 2IJOB 4CH8B 7LPRA 2Z3DA 3F2GA 4AZ2B 2QAAA 4OS7A 3AW0A 2BD8A 3M7QA 2VBCA 3LDXH 1ARCA 3STIA 3T62A 1MKWK 1P10A 3SUEA 3SNAA 3Q3XA 4ABJA 1Z8RA 1O2SA 4K1EA 1LCYA 3OSYA 1C5LH 1HJ8A 5K7RA 1QTFA 5HKKD 3ODFA 1L4ZA 2BQWB 1NESE 3LPRA 5C0UA 1K21H 1IQNA 2BOKA 1W13U 3D62A 3A8DA 1H9LB 3M5LA 2WYGA 4INKA 1RXPA 1FAXA 3B9FH 1Y8TA 5C67A 1QBVH 2OC8A 5I25A 4FUBA 5E0GA 4ZCNA 4XBBA 4A5TS 1AWHB 2ANMH 3VXFH 5A8ZA 4XD7D 1NS3A 5C2ZA 1CBWB 1HAZB 3SU2A 1AFEH 3BV9B 5A0CA 1DSUA 2OP9A 2STBE 2SGDE 1LKAA 2V3OH 3MH6A 3KF2A 4WMEA 3ENSB 1BBRE 4X1RU 3W94A 2KX4A 2UUJB 2B9LA 4GUXA 1LHGH 1WYKA 1DWEH 2VIPA 4MVNA 4M7GA 3EAJA 2QCYA 1FONA 1CGHA 1C1TA 1O2IA 3EQ0H 1QA7A 1O2PA 2ZO3H 4I32A 4E7NA 1HAOH 1DXWA 2ZF0H 2BY6X 1QY6A 1WTGH 3MU0A 5E2PA 3ESTA 2A5IA 1E35B 5T6GA 1BUIA 2LPRA 1PQ8A 3GCHC 1GHZA 1L0ZA 1P11E 2FOFA 1E37B 2AMQA 1GI1A 5CHAB 3PMHB 3V12A 3RMMH 1GHWH 2PV9B 1LVBA 2ANKH 4Y6DA 3BIUH 1P2NA 4GHTA 6LPRA 2J4IA 4FUJA 5FX5A 2PW8H 1ZHPA 1Q2WA 2O8UA 3A8CA 1RS0A 4KP0A 2H9HA 3H7OA 1KDQA 1SLWB 4IN1A 1W0JD 1AIXH 3SV6A 3LC5A 1P9SA 2ODYB 1T4VH 3TNSA 4B75A 2A2XH 3U9AH 2RDLA 2BQ6B 2V0BA 4CRBA 5DP8A 2FWWA 2ZFFH 3M5OA 1C5WB 3RXCA 2FTLE 2OTVA 3VB3A 3B8JA 4WXVA 1SGQE 5DJ7A 3RXKA 4TPYA 2AYWA 1W8BH 1VKYA 1PPCE 2CN0H 2A7JA 5IK2D 1OX1A 1W2KH 2H2ZA 1K22H 1AB9C 2RA3A 3TK9A 3F1SB 1D4PB 2KCYA 1EKBB 3SV7A 1XKBC 3L33A 1CT2E 3RXQA 1JIMA 3P17H 1C5OH 1ESTA 1H8ED 1NU9A 2TRMA 3NCLA 2F91A 2HWLB 1MZDA 3A83A 2ZQ1A 2FS9A 4D8NA 3MHWU 1K9OE 2GCHF 3PTBA 3MQKC 2BVSH 2O8TA 1TNJA 1LDTT 2LELA 3RXEA 2EA3A 5KEDA 1HJAC 3MO6A 1BA8B 2B7DH 1O36A 2HOBA 3ZZ8A 2NU1E 3A7VA 2FX4A 2G55A 2TPIZ 4NWKA 4P02A 4Y0YE 1A5IA 2AIQA 3LOXA 1BRCE 1FIWA 1K1LA 1G2MA 1D3TB 1AZZA 5ESTE 5EXNA 1C4U2 1DE7H 1D3QB 1O5GH 3K6YA 4FUGA 4X8UH 2A4GA 2Z9IA 4D76A 4JYVH 3AAUA 2FI5E 5TJXA 1TPPA 4B6FA 1W0YH 3ZYEA 1HYLA 4CHAB 1J16A 2Q6DA 1ETTH 3GOVB 3A80A 5FPYA 2A5KA 2ESTE 4DOQA 1GMHG 2YNAA 2J98A 1DS2E 3MH5A 1XUFA 3BTKE 1UK4A 2KM0A 2HPQH 2ZHDA 4ABAA 3TNTA 1Y3YA 2W3IA 2BXTH 4IC5A 3V3MA 3WY8A 3MO3A 1PPHE 3E90B 1V3XA 1BJUA 2ZFSA 3UNSA 3O8RA 2F9OA 1H4WA 1GBAA 1L2EA 3PO1C 4TY6A 1GMDG 1Y59T 1V2ST 1Q3XA 4ACBA 2ZQ2A 1O2TA 1IOEA 4AFUA 2RCEA 2XCFA 3SGQE 1YY3A 3OAAD 4TT3D 2QN5T 4K2YA 4ABFA 1CA0B 3FP7E 3GYLB 3P92A 4R0IA 3VG8A 3NXPA 2PKSC 3SU6A 1QRXA 1EZQA 2BQ7B 3T28A 2ZU3A 3R3GB 1FAKH 3F68H 5JBBS 3SQHE 2H9TH 3Q00A 1P02A 1O34A 3HGNA 6ESTA 5IYTA 3F9HA 1C1PA 4WH6A 1A4WH 4MNYA 2A32A 2K0QA 1BTPA 2AGEX 3SOSA 4AB9A 1O38A 1TRNA 1P57B 2VWNA 2ULLA 2BZ6H 1EATA 1O3AA 2WPDD 4UFDH 2AEIH 1HXEH 1NTPA 2P16A 2VIWA 4Q7ZA 3Q76A 4Q7XA 3KCGH 4A1VA 1S85A 1TBQH 4Y10E 2ZGXH 1UJ1A 1S84A 4WJG2 2PUXB 3FP6E 4XBCA 4YT7H 2XTTB 1SBWA 1C5VA 1KTSB 1W11U 4YESB 3UNRA 3A88A 3GY3A 2G4TA 1NRRH 5GNDA 1C5TA 5EG4A 3MWIU 3UOPA 1OOKB 4UONA 1C2IA 3P6ZB 4LZ4B 2SFAA 5CE1A 2Z7FE 2QXGA 2STAE 2XWAA 3D23A 3M3TA 2BZAA 5I46H 2PGQB 1OP0A 1V2MT 1ZTKA 2XBYA 1TPOA 4GSOA 2OXSA 3LGIA 1GVLA 1AKSB 3KQCA 3SUGA 1C4Y2 1DX5M 1VZQH 3FAOA 2AGGX 4DJZB 1QQUA 5FHTA 1GJDB 1ZZZA 3DHKH 3LGYA 2H9EH 3RMOH 5GXPA 1NY22 3G01A 5EJLA 5EOKA 5FBEA 1SQOA 5LPEA 1TPAE 1GHBG 1HJ9A 2Q1JA 2GDEH 1OHHD 3SQEE 4U01A 1P09A 1CVWH 1EP5A 3RXSA 2ZDLA 2NU0E 1PYTD 4JZEH 1ANBA 1YYY1 5FCKA 3QWCH 1K1MA 5DKMA 4IC6A 4FVDA 3BEFB 1O3KA 3I77A 3Q3KA 2WUCA 3NKKA 1T4UH 1Y5BT 4GLYA 5EW1H 4P00A 1XX9A 2A7HA 2EEKA 1BTWA 1FNIA 4CRCA 4YZUA 1V2TT 3DSOA 1C2LA 5HM2A 3TK6A 1F0TA 1J14A 1QRZA 2AERH 2TBSA 1GBIA 1ESAA 2FYQA 3GYMA 1SGCA 1WSSH 3U69H 2VH6A 1QBNA 5FBIA 1UO6A 1YPEH 3A82A 3RXLA 1K2I1 1C2KA 3T26A 2VWMA 1QR3E 1T32A 1ZLRA 1TAWA 1WOFA 2G8TA 4PROA 4GVUA 1O3MA 2O9QA 3BTWE 2R2WU 4OM9A 3A7XA 2QC2A 1V2QT 1GCDA 1HAYB 3MMGA 1THRH 2QF0A 1DWCH 5ETXA 1P2QA 1YPJH 4X2WA 1O2MA 1UHBA 4MTBA 1QB9A 1GMCG 2ZDKA 4B1TA 3BG4B 3K65B 3M36A 1HDTH 1SGTA 1H8HD 3EDXB 3SW2B 1V2WT 3DD2H 4BAOB 3RUOA 2FOMB 4J1YA 3D65E 5E8EH 3KHVA 1BTXA 3RXTA 1ABJH 1O2JA 1ZPZA 3KQ5A 2R9PA 3PWCA 1LO6A 1IQLA 2F9NA 3FANA 1E1RD 1CGJE 2F83A 1L1NA 3UOUA 2OQ5A 1KDQB 1VCQA 1IQJA 1V2JT 4A92A 3FZDA 3M7TA 1DICA 2BD3A 3QGNB 5EXLA 1DANH 4CBNA 2GCTB 2ZIQH 2Y82A 2F4LA 4LZ1H 4MPXA 2A4QA 1UMAH 2OQUA 1O2KA 2R3UA 4U30A 1E0FD 2FPZA 4WY3A 1SB1H 1S6FA 2ODPA 1QNJA 2GMTB 3BEUA 4GPGA 4INHA 3UY9A 1Z6JH 2HRVA 4IMZA 1AZ8A 2GZ8A 3WWBA 1IQHA 4Y79A 4I33A 2WV9A 1TONA 4R8TB 5J4QA 1SGIB 2P8OB 2SGFE 3LIWA 1AMHA 1GI5A 2V3HH 1HRTH 2ZDAH 4FUDA 1QBOA 3M3VA 4MNXA 4D7FA 1KLTA 3SV8A 2PSYA 1O3GA 1BRUP 2WYJA 1CBWC 3GDSA 2W5EA 4TY7A 1RFNA 1TALA 2ALPA 5HM9A 4JZIA 1THPB 3EYDA 1IQGA 1SQRA 2W6JD 1P01A 1ANDA 1ZRBA 3F9FA 4WWYA 2BM2A 5AFYH 5EPYA 4MDSA 3ZIAD 1GI8B 2KCOA 1WCZA 1TBRH 2KAIB 2FI3E 4AFZA 3RXRA 3UUZA 5EPNA 2GTBA 2UWOA 3H5CB 3ATMA 1BRBE 2B8OH 4NA7A 1GI9B 1TYNA 1FPHH 3BTME 2GJGA 3MNCA 5CHAC 1A1RA 2C90B 4Z6AH 3V0XA 3OE7D 3DCLA 5L2YH 4B2CA 3LGVA 1P2OA 4CH2B 3RXUA 1TOCB 1DT2A 2P95A 4AG2A 4HFPB 2ALVA 4ISOA 4X6NA 1AUTC 3HATH 1C1VH 1GDUA 1WBGB 2EY4C 3BSQA 1IHSH 1SG8B 2J98B 4ZHLU 3I78A 1MQ6A 2VWOA 3QZRA 1N1LA 2AGIX 1FUJA 4A1XA 3RLYH 1ELFA 5C94A 1H1BA 1QJ7B 1FDPA 1P2IA 1QURH 4MG3A 3SYJA 1WXRA 3A81A 1QA0A 3PLKA 1AI8H 1D6WA 1JIRA 1ETSH 3VFEA 2H5DA 2YMSB 4UFEH 1UVPA 1OWKA 1AGJA 3BN9A 1GL1A 3QDZB 3N99A 2F9VA 4ZXXH 1NPMA 3FO8D 1TA2A 2B5TB 5BPEA 3UIRA 3RXOA 1A7SA 2GV6A 4CRFA 3W95A 2FX6A 3EE0B 1BRAA 1CHOF 1N8OB 1UTOA 2GDDA 4VGCB 1UCYE 2TGAA 4LXBH 2H1UA 2XRCA 3HKJB 4XRNA 2Y80A 1O33A 1C1QA 2C3SA 3BTFE 1MMJN 1W7XH 3RC5A 1UK3A 3OTPA 1ZR0A 1TABE 7KMEH 3SI4H 1BZXE 2FS8A 3P8OA 2VB0A 1L1JA 1RTKA 3UWIA 4B74A 2AFQB 3BTTE 2WPKS 3UQVA 3GCTF 1RGQA 2Y6TA 3GY2A 4B73A 3SV2H 7GCHG 3PMBB 2OBOA 1W0KD 2K1QA 4FU8A 2VJ1A 3QZQA 5LH8A 4BTUB 1J15A 4RT0A 5GCHF 4MPUA 4GCHG 4KELA 1RJXB 1Y3WA 1SOTA 1TB6H 1EZXC 1YM0A 4WMFA 5A8YA 5DP4A 4OGYA 2XBVA 4NSVA 3LJOA 2XXLA 1SQAA 2ZPQA 1C5YB 1QHRB 3TVJB 1BB0B 1Q31A 2CJIA 2JDID 2Z9KA 1XVMA 2M2AA 1EOLA 1MD7A 4FXGH 4AYYB 4NG9H 3TLOA 2J95A 1CO7E 1GHAG 5LGOA 2BD7A 9ESTA 1MAXA 2SGEE 1O2NA 4JZ1A 2ZHQH 3A7ZA 3QTVH 4BANB 4CHAC 1OYTH 1YCPM 3PWBA 1AVXA 1SC8U 2ZHWH 3TU7H 5JBCS 3UWJH 2Z3CA 1SGRE 3LGWA 1EZSC 3UAIC 5JYIA 3RXPA 1EB2A 1KSNA 2ZTYA 3QUMP 1C2JA 1C5SA 1LPZB 1S5SA 1ELAA 2UUYA 4RSPA 4D9QA 1O31A 1NRPH 1C2DA 1RIWB 5GPIB 4ESTE 1SI5H 4E05H 1ELCA 1EUFA 2PWXA 2HNTC 2M5TA 1J9CH 1UK2A 1O32A 1O3BA 1P9UA 3GY5A 3ZYDA 1J8AA 6CHAB 1AHTH 2OCVB 4Q4LA 3U98H 4ZH8A 1U6QA 1MBMA 3OFND 3URCA 1TWXB 1A3BH 1CA0C 5CHBA 1SGFG 1A61H 2FYRA 3RC6A 1ZGIA 3O8CA 1MBQA 2OC1A 4DIHH 4ZMAH 1ZOMA 1TNKA 2QA9E 1O5EH 1C1NA 4FU7A 5B6OA 1XUKA 2KZ4A 2PSXA 1BMLA 1EX3A 1O5AB 4WH8A 2FODA 2Z3EA 3E0NB 2WPHS 2XOKD 1L4DA 1YPHC 2GKVE 2SGQE 2V7QD 3NUMA 4FUCA 4HGCA 4H6TA 1WU1A 1AWFH 4JZFH 3F2FA 5DP7A 1OXGA 1PPGE 1JMOH 2Z9JA 5FXLA 3N7OA 1XVOA 4IS5A 3RC4A 1EQ9A 3ODDA 3RP2A 1DFPA 1ZPCA 1ZJKA 4UDWH 1GBMA 1JOUB 1W7GH 2PFEA 1UTPA 1LPKB 1F5RA 1BTZA 1ZMNA 3GDVA 2IJD1 1GBKA 4MNVA 5JB8S 1QFKH 3KQBA 5F8TA 1F92A 2ZEBA 4ISIH 4DURA 3BTDE 3A7WA 2BVXH 4NZLA 1UHBB 3Q3YA 2TGDA 2ZZUH 4BTIB 4CRGA 1YPKH 1TBZH 1P8VC 4X2VA 1GJBB 3S0NA 3R0FA 2NU2E 4ABIA 4Y0ZE 1TMUH 1CA8B 1GBHA 1QL7A 6GCHG 2C8WB 2BY7X 3MH4A 4A7IB 2PUQH 3E8LA 1ORFA 3RXIA 3C1KA 2D8WA 3SORA 3GCNA 3EA8A 1EPTA 1Z8JB 3CNRA 1F0SA 2Y5GA 3FFGA 4O3TA 1O3OA 1LPGB 1V2RT 4ABGA 3PM3A 2EI7A 2IN2A 3I29A 4ABEA 1SGNE 2BYAX 2QXJA 3WWFA 5FCRA 1V2NT 3SHCH 2ZC9H 1EJAA 3FVFB 3TJUA 5JPMH 3KL6A 2ANYA 1C2HA 5A0BA 1FN6A 3VGCB 4ZUHA 2FOAA 2R2MB 3RLWH 3SZEA 1FY1A 3A86A 2ANWA 1O30A 1TNLA 1NRSH 1XXFA 4ISHH 1EP6A 4RT1A 3QO6A 1OWEA 4UE7H 1V2LT 2CF9H 4NSYA 1AFQB 2ZGCA 5TCCA 3SNDA 1DITH 9LPRA 2A7CA 1SMFE 4WXIA 3T5FH 1ZSLA 2I6SA 5LPRA 4X1QU 1S0QA 1PFXC 1C5ZB 3LU9B 2A5AA 3RMLH 1NN6A 1Z71A 2VVCA 4FUEA 5JDUB 2ZU4A 1KLJH 2PKAA 3PTNA 1HLTH 3S9BA 2QE7D 1GJ5H 4UD9H 3C27B 8GCHG 4UFGH 3HGPA 2PHBA 1ELEE 5DGJA 1FPCH 1NRQH 1A0JA 3ATWA 5HMAA 1A3EH 3ZZ6A 1C2MA 3F3BA 4UEHH 1GBTA 4ZHAA 1WUNH 2BLWA 1HAPH 1KXBA 1Y5UT 1FV9A 3BG4C 2ZU2A 4TPIZ 2J38A 5A0AE 1C5XB 4Y11E 4RKJB 3F2HA 2AMPA 4ASHA 1YCPK 3UFAA 1FMGA 4WMDA 4AFSA 4QT8C 2WHXA 1NBME 1FQ3A 4I31A 5K0HA
chains in the Genus database with same CATH topology
4FUHA 4Y71A 2G51A 2WPIS 1UVTH 1C2FA 1GI4A 3TIUA 3LGTA 1GBBA 1AN1E 3ZZ9A 1LHCH 1NM6A 1T31A 2XNIA 1BBRK 2QF4A 3DA9B 2GCTC 1GG6B 4WF8A 4JK5A 4X6PA 3QK1A 1QIXB 2P3UB 1P06A 1TPSA 2P59A 2O8LA 4X8SH 1UCYH 3SHAH 1P03A 4FVBA 2GMTC 3A85A 2G5NA 2AMDA 3PRBA 4A6LA 4BTTB 1A46H 3SJ8A 1A0HB 1W10U 4X6MA 1GHVH 2PR3A 4DG4A 1MUEB 2ZU5A 3FKSD 3K6ZA 2P8OC 3PMAB 3A8BA 3BTQE 1PQAA 3RXDA 2XNDD 1K1IA 3MU4A 1UVSH 2WUBA 1P3CA 1ZTJA 1YPMH 1C1SA 3L6PA 2NU4E 3RXFA 3E1XB 2CHAB 3O8DA 4LOYH 3ZVCA 2D1JA 3PRDA 3RU4E 1W14U 1Z8GA 3S7KB 4YLQH 4BAMB 2C8YB 4B2AA 1HPGA 1NZQH 1UTJA 5AHGH 1MTNB 1MABB 1XUJA 3MNSA 1GI0A 5T1VA 3DFJA 3NRLA 3SJ9A 2TIOA 1DPOA 1PPEE 1YPGH 1Y5AT 3DSPA 2QY0B 2ZECA 3L3TA 3MNBA 1HAXB 2IPHA 5AFZH 1TQ0B 3AVZA 3V7TA 5HYOA 3S9CA 1GMHF 4TYDA 4ZAEA 5EQQA 1ZMLA 1KXDA 1VITG 3PLPA 2FOGA 3SU1A 1QL8A 2VGCB 3MTYA 3TITA 1GGDB 2BX3A 2WZQA 1DDJA 2BX4A 2UWPA 2Z9GA 2BD4A 1GMDF 2ZPRA 2BDAA 1GJ8B 4B6EA 4NCYA 4BXWA 3RXAA 4WVPE 4XDEA 1TMTH 2JH5D 1TNHA 3BTHE 2H6MA 4JMYA 1OYQA 4K5ZA 2JH6D 1E34B 1FX0B 5C3NA 3K9XB 4HTCH 3E0PB 1ANEA 1A2CH 3W1EA 5EGMA 1GI7B 2BDIA 1HIAA 2YMSC 4FUFA 3HPTB 1F0UA 2OC0A 1BMFD 3QN7A 1H8DH 4I8JA 4XSKU 1TIOA 1LHDH 1P12E 3ZVEA 1CGIE 3TH4H 1SKYE 3M5NA 1ACBE 1UTMA 4AG1A 1O2WA 2FMJA 2XW9A 2WV5A 1N8OC 4VGCC 1IQKA 3UQOA 1O3JA 3P70B 2QF5A 1AO5A 1MQ5A 4X1NU 1WTHD 1BMAA 3ZV9A 2BDBA 1HXFH 1C5QA 3A7YA 4I8HA 5EXMA 1ANCA 4ISLA 2Y7XA 1G3EA 3SU4A 1AE8H 2XWBI 1BT7A 2ZWLH 1O2HA 1AU8A 3U8RH 1S6LA 4BAQB 1OWJA 1P05A 2F9PA 1EJMA 4MPVA 4AN7A 1DLEA 3ZVFA 1P2MA 3OTJE 2EI6A 2ZNKH 1WQSA 2XCNA 3ZVDA 2VVUA 4Y76A 1DUAA 1HAVA 1Y3XA 2SNWA 1YGCH 5DG6A 4MPWA 1EXFA 4IW4E 2FXRA 2THFB 2GT7A 4YOIA 1TGNA 3Q77A 3H09A 1IQFA 5C5OA 1HCGA 1KIGH 4NIYA 1HGTH 1UTKA 1FZZA 4B71A 4O97A 1INCA 2FOBA 4CBOA 2G81E 5EQRA 3ATKA 1EZUC 1GL0E 2ZFTA 5C1XA 1ZGVA 2QIQA 1GHBF 1EASA 1GI2A 1TGBA 1DXPA 1IQEA 3HKIB 1HBTH 4RI0A 3ZV8A 4JYUH 1SGPE 2FOHA 4ZKNU 1TGSZ 4X0WU 5TCAA 3ELAH 3RXMA 4K8BA 2XBXA 5FAHA 1PQ5A 1Z1JA 2UUKB 3RM0H 1G37A 2OC7A 5CDFE 2P94A 3PYHA 2OK5A 4K69A 3STJA 1RIWC 3FN8A 3A87A 4TWWA 1CU1A 1G2LA 2GT8A 3A8AA 4KTUA 1GHXH 4I8LA 1BHXF 1FLEE 3F9EA 1O5CB 5DO4H 3TGKE 4H4FA 1EPTB 1HFDA 3BTEE 3GY8A 4DT7B 1NBMD 2VVVA 5C1UA 6CHAC 2L6OA 1CHOG 3U8TH 5C1YA 1W3CA 1TQ7B 1EAWA 1RRKA 1UTQA 2BDYA 2KFWA 4JYTA 3LC3A 1O2ZA 1AUJA 4DVAU 1K1OA 2AH4X 2I6QA 5E2OA 1T7CA 1AQ7A 1EAUA 2Z94A 1CE5A 2PTCE 1NFXA 4RKOB 1YPHE 1F7ZA 1XXDA 4NA9H 2TGPZ 3QLPH 5C0TA 2GX4A 1S82A 4THNH 1QB1A 2BLOA 1FY5A 1GMCF 2H5CA 4CRDA 2GVFA 2OLGA 2ZGBH 2ZCKP 3SU0A 3DUXH 1V2KT 3GISB 2V6NA 2PKAB 1NO9H 3AAVA 5GIBA 2DE9A 2ZFQH 1TA6A 1OPHB 2JJ1D 2VNTA 4CRAA 4INLA 4H6SB 3M5MA 2F9UA 3LJJA 3RU4D 3GS9A 1IQMA 2FZZA 2GP9B 1OWDA 4DT4A 2CK3D 1LHFH 4OGXA 3SU5A 4ABBA 5DSFA 1OWHA 2PLXA 5HXFA 1TLDA 2VWLA 1IHTH 1C1MA 4H42U 5EU8A 2VU8E 1TFXA 3GDUA 1O3DA 1G30B 2Q6GA 1B0EA 3TH3H 1EOJA 4IN2A 1C9TA 4YTAA 3OYPA 4ISNA 5E0HA 1JWTA 1D9IA 3IITA 3SV9A 5GWZA 4ZHMU 1Y3UA 2G52A 3E91A 1G36A 3TH2H 3U1IB 4BXSA 1FN8A 1GI6A 3KIDU 1LHEH 1C5MD 1ARBA 1C1WH 4ZKRU 4YOGA 3UREA 5JB9S 3EA7A 2FP7B 5FPSA 1BQYA 1C5PA 2JH0D 4TWYA 4AGJA 3IG6B 4Z0KA 3LKWA 1P2JA 1XKAC 4F4OC 1ZMJA 3VGCC 2BMGB 1JXPA 1O2RA 2SGPE 4Y8ZA 2Q6FA 4K3JA 1EJNA 2EC9H 3VB7A 2J2UA 3BG8A 3AASA 1AD8H 3M3SA 3RXHA 3SNBA 1AFQC 3FP8E 1SHHB 1K28D 4YXWD 1O3LA 3E16B 3KN2A 4NIVA 3N7EA 4OS6A 3VXEH 5C20A 1GBFA 4IGDA 4F55A 2GGVB 3F9GA 5H4IB 1GDQA 1Z7KA 4AGKA 1TGTA 1C5UA 1ELDE 1P04A 2NWNA 1VR1H 4B2BA 5F53A 1T8LA 3CENA 3SZNA 4K1SA 1QJ6B 3S7HB 1G3DA 3P8FA 2XC0A 1S83A 5GJ4B 3RMNH 2A45B 1MTUA 4AFQA 5LPFA 3RXGA 2NU3E 1VJ9U 1E79D 5F03A 1O5BB 3A89A 1PPFE 2R0LA 1S81A 2FI4E 2KR7A 3UNQA 2BDCA 1MKXH 1K1NA 1X7AC 4HI3A 3VB4A 2ZU1A 1KTTB 2BVRH 5HGGA 5G4BA 1LQDB 1GHYH 2ZDMA 3KNXA 1TNGA 3NZIA 3T29A 1O3EA 3QX5H 2JETB 1LKBA 1EAIA 2Z9LA 3MOCA 4M9FA 2BLVA 3P8GA 1V6DA 1GG6C 5C5NA 1NU7B 5DP5A 1TX8A 1ID5H 3M7UA 1HIAB 3T27A 1G32B 1D3PB 1SPJA 4RN6A 1AE5A 1RTFB 3F6UH 4NFFA 2GCHG 4Q7YA 2HPPH 3LONA 1FJSA 3MU8A 7GCHF 1UVUH 2ODQA 1SHYA 4JK6A 1T8OA 2GZ9A 4IBLH 1MAYA 1Z8IB 2HVXA 2ILNA 5ABWA 2W7SA 4GCHF 3O8BA 1TGCA 1SOZA 3F0PA 1BMNH 1NRNH 2CMYA 1KXCA 1C9PA 2D26C 3SJKA 3ZVBA 4KKDA 4XFQA 1B0FA 1J17T 2CHAC 1GBLA 3SJIA 4AOQA 2FM2A 1TNIA 1QGFA 1B5GH 4YO9A 2LNCA 3RXVA 1MTNC 2J94A 1GHAF 5A8XA 1W12U 3CP7A 1GI3A 4K60A 1HAVB 1S6HA 4I8KA 1E1QD 2JIZD 1VJAU 3RM2H 1FIZA 1GJCB 1VITH 1PQ7A 2ASUB 1Z6EA 3DFLA 3H7TA 4ZKOU 1KYNA 1FY8E 4YT6H 1O3FA 3GICB 5DP3A 1MCTA 1YF4A 2HLDD 1F5LA 2CGAA 2VGCC 2BOHB 3E6PH 2P93A 1S0RA 1GGDC 3ATLA 2P3FH 1UCYK 2OD3B 4F49A 2BLQA 2C4FH 1G9IE 3MU5A 2A0QB 3M37A 4KGAA 1O2YA 2ZA5A 3QTOH 5JBTA 3ZZBA 4D9RA 4X2YA 4U32A 8ESTE 4E7RG 1MKWH 1C1UH 2BHGA 3WW7A 2ZHEH 1EFRD 2GD4B 3QGJA 2IOTA 1V2OT 4J2YB 1G3CA 1O2QA 4NGAH 1TX7A 4MLFB 1NFYA 1ESBA 5EODA 4X6OA 3ZZCA 1YP9A 1GCTB 1GBJA 2ZGJA 5L2ZH 1HUTH 2RA0A 1DLKB 1C5NH 2FESH 2Y7ZA 5T6DA 4YM9A 1GBCA 3MFJA 1EB1H 1VGCB 2WSSD 1TE0A 1LMWB 1P2KA 4Y8YA 3BIVH 3OU0A 1ZHMA 1GDNA 4NIWA 3NK8A 1MU8B 1YPLH 2VIDA 3PLBA 1TOMH 4CR5A 1OP8A 2ZPSA 1GJ6A 4ASUD 1RD3B 2K8IA 4K1TA 2KAIA 2WPMS 1A5GH 3TJVA 1O39A 1OS8A 3FOAA 1KLIH 2SNVA 1UTLM 3KQEA 2BTCE 3ZZ5A 1CT4E 1LVYA 1MCVA 2HLCA 1O37A 1YKTA 1ZRKA 2W26A 4OS2A 4KTCA 1GJAB 2FDAA 3ZVAA 4X8TH 2FLRH 2ZCLP 1KXEA 1OWIA 4MQAA 3JZ1B 1JRSA 5PTPA 3EA9A 4DIIH 4OS1A 3OEED 2O8WA 4ZKSU 2GZ7A 3UR9A 1FY4A 4NZQA 4KTSA 3OY5U 1E38B 6GCHF 3RDZA 1BTHH 1MH0A 1SGFA 4D7GA 1PJPA 3PV5A 1YBWA 3AK5A 3RXBA 1XM1A 3EGKH 1NT1A 2ZTZA 4NFEA 3ATIA 1H9IE 1KXFA 1ZSKA 1HB0B 1TRYA 2F9BH 1C1RA 1HV7A 2EI8A 3N7DA 1C5RA 2Y5HA 1BHXB 4OS5A 5B6LA 2OINA 3KGPA 4DGJA 4MNWA 2AS9A 1KXAA 5A2MH 3TJNA 1DWBH 1O5DH 1WQVH 1YLCA 1XUGA 1MTVA 1F5KU 1DWDH 2FTMA 5SGAE 5A09A 1HAIH 3SBKA 2KCPA 2G00A 3ZZ4A 2R0KA 3SU3A 3T25A 1BIOA 1SQTA 4X1PU 4XBDA 1P3EA 3LH3A 1V2PT 5GDSH 1ZTLA 1EPTC 4IMQA 1KMHB 1TMBH 3PROA 1NC6A 4UFFH 1ETRH 2ZTXA 3BF6H 3GCHB 1K1PA 4SGAE 1GBEA 3KQDA 2JKHA 1HAGE 2F3CE 1BTYA 3RXJA 1PPZA 1YLDA 2VIOA 2ZHFH 2VH0A 2P3TB 4LK4A 1FXYA 1TRMA 3SUFA 5ESBA 5L6NH 3SNEA 5L30H 1M9UA 5E0JA 8GCHF 1PYTC 1EAXA 1ELVA 1MU6B 2C8ZB 2XYAA 1QL9A 5CMXH 2BB4A 2J92A 1BITA 2A4RA 1N6YA 1GWAA 4BNRA 4AB8A 1CQQA 2SGAA 1THSH 2O8MA 2QXHA 1H9HE 2RG3A 1O2OA 1HNEE 2QXIA 3IWMA 2OUAA 5T6FA 2QV1A 1SLUB 4X8VH 3A7TA 4ZROA 3ZZAA 3SI3H 4ABHA 1GJ4H 3GY7A 4Q63A 1W0ZU 1SL3A 4FUIA 2BY8X 3OY6U 5C17A 3ZZ3A 1V2VT 1B7XB 2UUFB 2KCAA 2BDHA 1FY3A 4U2WA 1ZYOA 5F6MA 3SGBE 1SLXB 3AW1A 1AB9B 3P95A 3MI4A 3CS7A 1XUHA 1T8MA 1SFIA 3SNCA 4A1TA 4SGBE 1O3CA 5FX6A 3SUDA 5IDKA 1GPZA 3TGJE 3KEEA 2XC4A 2QGRA 1O3NA 4Y7BA 1O3IA 1LVOA 1DY9A 3U8OH 3PV2A 1YCPH 1O2VA 3MO9A 1E36B 5DP6A 1VCWA 1MTWA 1DM4B 2XC5A 1QB6A 2Y5FA 4Q80A 1YC0A 3M61U 4FETA 1NROH 1HJAB 1QCPA 1KY9A 4BAKB 1MZAA 4JCNA 1WAYB 1C4V2 5DK1A 1F2SE 2F43B 3MYWA 1FI8A 1BBRH 1A5HA 1SGDE 4NA8A 1C2GA 5T3HA 2HGTH 1MD8A 1O2UA 5DPAA 1O2GH 1SGYE 1BCUH 4GHQA 3VEQB 1LQEA 2C93B 1GJ9B 1P0SH 1Y3VA 2FOEA 4Q2KA 5EW2H 1DOJA 2HALA 4YLUA 3PV4A 1O2LA 2YMSD 4FU9A 1GVKB 4X2XA 2W7UA 1VITF 1AY6H 2A4OA 2ZG0H 5J4SA 1JBUH 3U1JB 1BOQA 4O03A 3LT3A 4NIXA 2QF3A 2TGTA 1F0RA 3VB5A 1G3BA 5AF9H 3PB1E 1O35A 3VPKA 1CSOE 3PO1B 3E3TA 2VIVA 5F8ZA 5BRRE 2VINA 4YOJA 1H8IH 2ZDNA 2BXUH 4GAWA 3BEIB 3UR6A 1GJ7B 8LPRA 1UVOA 4TSFD 1OSSA 3MH7A 3GY6A 1BMMH 2PKSB 2BDGA 1TX6A 2Z6BD 1XUIA 3B23B 2ZKSA 2HNTF 2XBWA 2HNTE 1C2EA 3UB0A 4I8GA 3DT0H 2J5UA 2DUCA 2ZFPH 2D2DA 4I7YH 3ITIA 2W3KA 1ZHRA 1O3PB 2CXVA 2J34A 2UWLA 1WV7H 1A0LA 2JETC 3CS0A 2BY9X 1AVGH 1NFWA 4DW2U 1JRTA 1QQ4A 4AYVB 3D49H 1C1OA 2FEQH 2ZI2H 1BDAA 2ZP0H 4Y7AA 1SVPA 2FIRH 2G4UA 4DY7B 1DY8A 1GVZA 2QYIA 3FZZA 4CREA 3TPIZ 3HK3B 1D3DB 1AVWA 1DUEA 4K8YA 3ZZDA 4XE4A 5DP9A 3K2UA 4DCDA 3GCTG 4JZDH 3LH1A 4O3UA 4ZXYH 2YNBA 2A2QH 1ZPBA 2BD2A 4O9VA 2OBQA 1HAHH 2WINI 2Y81A 3SJOA 5GCHG 4XOJA 1ELBA 1CT0E 3MNXA 1CHGA 3NPSA 4X1SU 1SR5C 4OS4A 8KME2 1OP2A 1IQIA