2F9VA

Hcv ns3 protease domain with ns4a peptide and a ketoamide inhibitor with p1 and p2 cyclopropylalannines
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
183
structure length
183
Chain Sequence
b'MGAPITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS3 protease/helicase
publication title Depeptidization efforts on P3-P2 a-ketoamide inhibitors of HCV NS3-4A serine protease: Effect on HCV replicon activity.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein
total genus 43
structure length 183
sequence length 183
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2f9vA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2f9vA01
2OC0A 3FZDA 3MH5A 1YLDA 2BD3A 2YOLA 3BEFB 3LJOA 3Q00A 5JBTA 2BDIA 1MU6B 3RXVA 3BTDE 1YKTA 1VJAU 1GJCB 3MH7A 1YLCA 4MNVA 4X1SU 1C2JA 1EZQA 1TPPA 1WQSA 2ZCLP 3Q3KA 4AFZA 4X2XA 4DURA 1O2IA 3GY5A 3EA7A 1O3EA 1OOKB 1JMOH 1DLEA 1HAHH 4F4OC 3V12A 1SI5H 1KTSB 1TMTH 1YP9A 1UTJA 2V3HH 1HAVA 1ZGIA 2Y6TA 2BDCA 1C1TA 2ANKH 1O2OA 5ABWA 1QQUA 3NXPA 3TNTA 1EAWA 5DP5A 4ISIH 1C2HA 5AHGH 3TIUA 4XDEA 3PV5A 3OY5U 3TJNA 1UCYH 5DP7A 4LXBH 1FPCH 4AG1A 3VPKA 1VCPA 2WYJA 1TIOA 1Z8IB 5BRRE 1MKWH 4WWYA 1MKXH 2HNTE 2UUJB 1HLTH 1WTHD 1W13U 1RS0A 1IQKA 3PB1E 2BHGA 5HM9A 5A0BA 2VIOA 1DY8A 4AOQA 3PROA 1LHEH 1O2YA 1RTFB 5A09A 2HPPH 1DSUA 3F9HA 3PMAB 3EYDA 1EATA 1F92A 3GCNA 2R3YA 1KDQA 3URDA 1UTQA 1P2NA 2BX4A 4ZUHA 3NPSA 2R2WU 1MH0A 2UWLA 2GGVB 1K1LA 4X6MA 1GI3A 5FPSA 2FYRA 2UUKB 4Y0ZE 1K1MA 2A1DB 2A7JA 3VB7A 3SGAE 1FNIA 2P16A 2BM2A 1GL1A 1OYQA 1C1PA 4X8VH 1Y5BT 4A7IB 1C5OH 1Y3UA 3P17H 2PTCE 3OX7U 1LMWB 3OTJE 1ZYOA 4E7NA 1BTYA 3KIDU 3RP2A 3RXFA 1BBRE 3KNXA 3HGPA 2GDDA 2WPLS 4UD9H 1HJAB 3ATWA 4CR5A 4BTIB 2A7CA 2AS9A 1O3BA 1N8OB 1THSH 1NC6A 2ZG0H 3E0PB 2K1QA 2RCEA 1GHYH 1BA8B 5EXLA 1PYTD 1C2LA 3RXQA 3T29A 1L4ZA 2YNBA 4ABEA 1AFQC 4FUJA 4CHAB 1HAYB 1NRNH 1MBMA 1BQYA 3A7XA 3ZVCA 1VITG 3ZYDA 2BD5A 2ZHQH 3FAOA 2I6SA 8GCHG 1P2JA 9LPRA 1SGFA 1NZQH 3F1SB 5C3NA 2PUQH 3SV8A 1O2MA 4K1EA 6CHAC 2NWNA 3RMMH 4B1TA 4I8KA 3EA9A 1CHOG 2Y7XA 1C5UA 1K2I1 3E8LA 1S5SA 3F6UH 1BRBE 1NT1A 1SGEE 2GZ9A 3SZNA 1SB1H 2D26C 4B6EA 4GCHG 1ELFA 2EI8A 4GSOA 2FX6A 5EG4A 1GI7B 3RC5A 1C1UH 1SC8U 2XC5A 4D9RA 2SGEE 1V2RT 3RLWH 2VH0A 1ZSJA 2FTLE 2B9LA 1P2OA 4AYVB 4ABDA 4FUFA 1C1WH 2BTCE 1KXBA 1DSTA 3A7VA 1BJVA 3K6ZA 1O3NA 4OS4A 2BY6X 5I25A 2J38A 2Y81A 1BIOA 1OP2A 2BOHB 9ESTA 4I7YH 3P8FA 1AZ8A 1LPZB 1UJ1A 2ZIQH 3NK8A 3P8GA 3A7ZA 1DWCH 1QGFA 1ESTA 1A2CH 2D2DA 3KL6A 1TNJA 4O3UA 3TVJB 2J94A 3B23B 3UR6A 2CV3A 4Y8YA 4ABFA 5DK1A 4JYTA 3QTVH 3RMLH 2P3FH 3RXSA 1XXDA 4LOYH 1PQAA 2GKVE 1QRZA 2XC4A 1HAXB 4FUHA 4GVUA 2VIDA 1YPEH 5CE1A 3PLKA 1S83A 2A32A 4NCYA 3TGIE 3NUMA 4WVPE 3LDXH 3ATKA 1QB6A 1V2JT 2ZTZA 3UWJH 1K21H 1KLJH 1G3DA 2XBXA 3RU4D 1OP0A 1PQ5A 1A61H 1SSXA 1YF4A 1GJ4H 1V3XA 2BDYA 2GTBA 3TGJE 1OSSA 1P8VC 4YT6H 3RXDA 1UVPA 3U9AH 3SW2B 4WMEA 2STAE 1HUTH 2C8XB 2SGPE 3BG4C 4NIVA 1MQ5A 1PYTC 2BD9A 2FMJA 3GYLB 4YOIA 4ZKNU 3V3MA 1GJ9B 1HBTH 1SQAA 1BHXF 2WV4A 4NIWA 4OS2A 1UHBB 3F9GA 4BAKB 2WUBA 3U1IB 2FLRH 3RM0H 5EPYA 4I8JA 3BSQA 1HPGA 2G55A 2H5CA 2NU1E 3FP7E 1CHGA 5T1VA 4CBOA 3MU0A 2NU4E 4CRFA 2GVFA 3SU1A 4NWLA 1YBWA 4DW2U 1C5MD 1TX7A 5PTPA 2TPIZ 2HWLB 4ZROA 4Y76A 1ZPZA 1FONA 4X1QU 1C5LH 1DE7H 2Z3CA 2ZDAH 3EDXB 1PPBH 1THRH 4ASHA 4CRDA 1TWXB 1CA8B 2F3CE 4J1YA 3U8OH 1EQ9A 2B8OH 2RA3A 3LGVA 2VJ1A 3VB6A 1RTKA 4X2WA 1P3EA 1V2PT 1D3TB 1SGNE 2R9PA 3ESTA 1GBEA 5LPFA 1MTVA 1O2PA 1VGCB 4NSVA 4BANB 3GDVA 4X0WU 2ZFTA 2HNTC 1HAGE 1GHWH 2ZFQH 3P6ZB 1VITF 3STJA 1BBRH 4MDSA 4BAQB 4NFFA 1NESE 1NY22 3S9AA 5A0AE 8GCHF 2ZU5A 1WYKA 2R0KA 1C2DA 1HV7A 5A0CA 2GV7A 5FPTA 5HMAA 1SBWA 1BHXB 3A83A 1HCGA 3JZ2B 1DXPA 1NU9A 3SJKA 3TH2H 4AB9A 2ZCKP 1OWEA 1TRNA 2EA3A 3NZIA 4MQAA 2FOHA 1CHOF 1SOTA 4IBLH 1SQOA 1MUEB 3A8CA 2BLVA 4GCHF 1BTPA 3ZZ5A 1GHAG 1ANEA 4Q7XA 2FOMB 2HNTF 2SGFE 4H4FA 1V2OT 1SG8B 1UCYK 1KYNA 1GI1A 1QRXA 3SYJA 3AAVA 2F91A 4NG9H 3MH6A 2BDBA 2QY0B 4SGAE 3EGKH 3VB5A 1MU8B 1J16A 4IMZA 1MKWK 1MKXK 1O2SA 4WH8A 1MMJN 3MNXA 3Q3XA 1OWJA 1C2EA 4DGJA 1NFYA 4ISHH 1AB9C 1HRTH 1TOMH 1DFPA 2F9UA 1QJ1B 1PPFE 1HAIH 2Q1JA 2FOEA 1FIWA 4M7GA 1CBWB 2BB4A 1W0ZU 1G37A 1V2WT 2GD4B 1SOZA 1QL7A 3SZEA 1UMAH 3DFJA 2F83A 1O32A 3LPRA 2ZHWH 1EPTC 1DOJA 2BY5X 1DDJA 3LC3A 2AMPA 1L1GA 1TQ7B 2FDAA 1QQ4A 5C5NA 3GY3A 1EUFA 1T32A 2WV5A 1JXPA 1TFXA 2PKSC 4KP0A 2F9PA 5I46H 2HOBA 2ZWLH 5AFYH 1BOQA 1TBZH 1ETRH 1A4WH 2P95A 1Y3YA 1GJDB 4AORA 2G52A 2VBCA 1AKSB 3RXPA 4YLQH 4YLUA 3QLPH 1TYNA 1ZJDA 1C5XB 2J92A 1C5NH 2H9TH 2PUXB 4AFUA 3Q76A 2Z3DA 5T3HA 1PPCE 1V2LT 1WSSH 2C8YB 4K8BA 3SORA 1C5ZB 1A5HA 2A0QB 1H1BA 3A7YA 2HPQH 3ZZ4A 1F0UA 3IG6B 3KQCA 1UHBA 2QV1A 1OXGA 1QRWA 3TK6A 1P2MA 3MI4A 1CGHA 4Z0KA 4ZHLU 2ZF0H 1P2KA 1G3BA 1ARCA 1DICA 4NFEA 2TGDA 2F4LA 3GCTG 1A46H 5EQQA 1E37B 1OWHA 3BTFE 3PMJA 1HDTH 2M5TA 3QGJA 2FOFA 4HTCH 2IPHA 5LGOA 2OK5A 1GL0E 4K8YA 3ZVAA 1GMDF 3FVFB 1ANDA 1O3LA 2CHAB 4UFGH 5AF9H 1AB9B 1TABE 3SU4A 1AVGH 1T31A 4ZHMU 3TJUA 4R0IA 3STIA 4M9FA 2SGAA 1P0SH 4GUXA 4LK4A 2JH0D 3ODDA 4RN6A 5IYTA 1YPHC 1ZLRA 2OINA 3ELAH 1DWBH 1D6RA 2GCHF 1DT2A 1C2KA 1EPTB 1P2IA 4VGCB 2WHXA 1WAYB 1A1RA 2BY8X 2UWPA 2ILNA 4E7RG 1LVBA 1LO6A 1CU1A 1SQTA 1AIXH 1O3KA 1FLEE 1SLXB 4U2WA 1X7AC 1AGJA 3RXAA 4AYYB 4ABHA 1HAPH 1B7XB 2ZI2H 1EKBB 4OS5A 3T5FH 3D23A 1LPGB 4YO9A 1HYLA 2QXJA 4A6LA 1BB0B 1ELAA 1NFUA 3VXFH 1SFQB 1YC0A 5CHAC 1UO6A 4OS1A 1HIAB 1EJNA 1UVTH 4B2BA 1GHAF 1P9SA 1O2KA 1EJAA 3VEQB 4Y79A 4TY6A 5FBIA 1LHDH 3ZZ9A 1GHVH 3OSYA 4X8SH 1DM4B 3KF2A 1TNGA 4GHQA 2J34A 2QXIA 1AVWA 3QZQA 4UFFH 1O2ZA 1LKAA 2QCYA 4OS6A 3AW0A 4U30A 3PMHB 4FUCA 1UVUH 2ANYA 3BTTE 1YYY1 3UFAA 7KMEH 3OTPA 1GBDA 1IQIA 3T62A 4JZDH 1MTWA 1AHTH 1OPHB 1SGPE 1P57B 4FU9A 1P04A 1SVPA 4K69A 1ZTLA 4JZIA 4YZUA 3LJJA 1IQGA 3RXRA 4A1VA 1S81A 3U8RH 1AU8A 1FZZA 1IQJA 3MO9A 2KAIB 2ZFFH 1THPB 1E34B 3M7QA 4UDWH 1CGJE 3L6PA 2BLQA 3VGCC 1G3EA 1TPAE 1W12U 5IDKA 1LQDB 1QB9A 3GOVB 2FODA 1T4VH 1KXDA 1TGTA 1Z6JH 2VWLA 1O5DH 1ETSH 1BRCE 1AE8H 1O3CA 1UTNA 2VGCC 1WTGH 3M7UA 2RA0A 4Y8XA 2G5VA 1Y5UT 3UUZA 1O2XA 2ZU1A 2ZPQA 1O3GA 1QFKH 1EZUC 3QTOH 1FUJA 2G81E 3RM2H 1LHCH 1O2RA 4ABGA 3Q77A 3KQDA 2O9QA 1NU7B 1ZR0A 3MNBA 1V6DA 3V13A 1C5PA 1N1LA 1AQ7A 2ZC9H 1C2IA 1YGCH 1BBRK 3PV2A 1WU1A 4Y7BA 3GY8A 3NWUA 4ZHAA 3SGBE 1DUEA 2SFAA 3ZV9A 1RD3B 2Z9KA 5A2MH 2TGPZ 2BDGA 2HALA 1QCPA 3GCTF 3KQEA 1AO5A 5E2OA 5K7RA 1Y3VA 3C1KA 3CS0A 3TITA 1GJ6A 1RIWB 1FY8E 4NGAH 4NA9H 3ZVDA 4I33A 4LZ1H 1VR1H 1H4WA 1BUIA 4D7FA 1TRYA 5FPYA 3UNRA 1T8LA 1ELGA 1GCTC 2OC8A 2OQ5A 1O3JA 3EA8A 4TWWA 4AX9H 2GMTB 2FWWA 3ZZ7A 3T27A 3M3VA 4Y7AA 4OS7A 1YCPM 2OXSA 3TNSA 4JZ1A 2DE8A 2HLCA 2ZU4A 4HI3A 3S7HB 1O5CB 4D76A 5E0JA 1FMGA 1BZXE 4FVBA 5E0GA 2ZECA 5JB9S 1NRPH 1DXWA 2QXGA 1KXEA 1LKBA 3RLYH 3SNDA 4SGBE 1KY9A 2H9HA 3LKWA 2FOBA 3RXOA 3RU4E 5AFZH 4ZH8A 5JPMH 1SGIB 2G00A 4JMYA 2ZGHA 5EPNA 5F6MA 4NIXA 3O8CA 5T6FA 1MZAA 5FBEA 4DY7B 2HGTH 2OLGA 4ISOA 5F8ZA 5FXLA 1HIAA 2BLOA 3SU5A 5DO4H 4B6FA 2J95A 4NZQA 3U98H 1FDPA 1GBBA 2FS9A 2CMYA 3QZRA 3RMNH 3AASA 1TA6A 3M5LA 3QGNB 5A8XA 5L2YH 1C1OA 4UE7H 3A82A 1UK2A 3RC4A 1C4U2 4IC5A 4D9QA 4TWYA 4B75A 1L1JA 1TBRH 1UTPA 4AB8A 5DKMA 1XUFA 2A4RA 1O2WA 2WYGA 4TYDA 2VWOA 3QX5H 2Y80A 1H9LB 4MVNA 4I8LA 1A5GH 1C5SA 3P70B 1C1QA 4E05H 1J8AA 3SNCA 5JBCS 3ZZCA 4K3JA 4HZHA 2FXRA 1NM6A 4KELA 3E1XB 2C90B 2C93B 4D8NA 3UNSA 1SHYA 2QYIA 3ZYEA 1E38B 3G01A 1GWAA 3RXUA 2Q6FA 5GDSH 3U8TH 1C2FA 1C5RA 3L3TA 2WINI 5JYIA 1OWIA 1ZHRA 2KAIA 2VH6A 3PMBB 5J4QA 2O8WA 4OGXA 2ANMH 5EQSA 5CMXH 4TY7A 3SHAH 3FANA 3GCOA 1F5LA 3UY9A 1VCQA 4NSYA 1XKAC 1WV7H 1FAKH 3ENSB 2A2XH 2A5KA 1OP8A 1ORFA 1SPJA 1Z71A 3LGTA 3SI4H 2G5NA 5EXMA 2JH6D 1TRMA 1XMNB 3A86A 4GHTA 2AMQA 2ZCHP 3SN8A 1O5EH 2C4FH 3SJ8A 3UWIA 2BQWB 2BY9X 2FLBH 3ZZAA 2EI7A 3LGUA 4I32A 3U69H 3FZZA 1C1VH 1NPMA 1GBHA 1HFDA 1ARBA 2XTTB 1O39A 3KQBA 1HXFH 2XBYA 3HGNA 1VITH 3GCHC 2AFQB 3EQ0H 3SNAA 1YPHE 3UPEA 1BRAA 2NU3E 1TA2A 3A8DA 1AFQB 3ZZ3A 1FY3A 1JRSA 4K5ZA 2B5TB 2PR3A 2I6QA 4BAOB 4UONA 1IQHA 1O3FA 2BDHA 3MYWA 5E0HA 1EP5A 1EX3A 2FO9A 2FPZA 1Z8GA 2CJIA 1C9PA 3PM3A 6CHAB 3SU2A 1ZRBA 4B76A 1GMHG 1T8OA 2ZQ1A 1ABIH 3PWCA 4YESB 5DP6A 4AFQA 1SLWB 1NRQH 5H4IB 1N6XA 4WF8A 1SGQE 4Q80A 3UQOA 3W95A 1GHBG 4ZXXH 3A87A 1D3QB 1XUGA 2RDLA 1HAOH 1WXRA 2LNCA 2ZU2A 1K1NA 2F9OA 2P3TB 1TGBA 1YPGH 2EC9H 3CENA 1HAZB 2JKHA 3QDZB 3SOSA 2W5EA 4FUEA 1V2MT 1K1OA 2GT7A 4O03A 2D1JA 1CT0E 4KGAA 2Z9JA 3ATMA 1EOLA 1TX6A 1XVMA 5T6DA 3TGKE 1GJ7B 2IOTA 3KEEA 1GI6A 1NN6A 1A0JA 1BTXA 2QF3A 1PJPA 3MO3A 4XOJA 3S7KB 1HJ8A 2EI6A 1EOJA 4CH8B 3IWMA 1BMMH 3S9BA 2PLXA 1TALA 4NA8A 4WMFA 3LH1A 5DP8A 1SGFG 1TMUH 1HJ9A 2ZTYA 1E0FD 3PLBA 2ZA5A 2OQUA 1D4PB 4A1XA 2FI5E 5TCCA 1O2TA 5C2ZA 5L2ZH 1EJMA 4TPYA 3B9FH 4A92A 1KIGH 4O97A 1W0YH 1UK4A 4D7GA 3D65E 1D3DB 5FAHA 2BD8A 3PTNA 1QA7A 2P3UB 3SNEA 4IW4E 1CT4E 4U01A 3SV6A 3AAUA 2Y5FA 1DANH 3ZVGA 1DITH 2Z9IA 1GI8B 1NROH 4UFEH 3UOPA 5C20A 3SV2H 4UFDH 3BG4B 1FXYA 5GXPA 3EAJA 2P93A 3P8NA 3RXBA 1LCYA 2BY7X 3CP7A 2ZGJA 3QUMP 2Y7ZA 2SNWA 2UUFB 1A5IA 2C3SA 4INKA 2A5IA 2TIOA 2XWBI 2ZZUH 2WPIS 1V2TT 1AFEH 2CN0H 1O2QA 2WPMS 4K2YA 3E6PH 2QGRA 4AFSA 4B2CA 3JZ1B 4AG2A 4A5TS 4JZFH 3MOCA 1GI0A 2ZTXA 1G3CA 1QR3E 3E91A 1NFWA 1NS3A 2A31A 1IOEA 1AVXA 2A4OA 1P05A 4FVDA 4HGCA 4GPGA 2ZKSA 3E0NB 3BG8A 5FX5A 3RMOH 1O0DH 1M9UA 1P01A 1B5GH 3ZZ6A 3M7TA 4MNYA 3LGYA 1T8NA 1UK3A 1J17T 1XM1A 3MFJA 1PQ8A 1T8MA 2A5AA 1PFXC 1O3AA 1GJAB 3AVZA 3LU9B 2WZQA 1G2MA 6GCHG 3TK9A 2QIQA 4FXGH 1EAXA 3VFEA 4ABAA 1JIRA 2ZNKH 3PO1C 1MQ6A 1EZXC 4KTSA 1DUAA 1GBMA 4A1TA 4DT7B 1DPOA 1ELDE 4X8TH 2JETC 5EOKA 1V2KT 3AW1A 1QB1A 7ESTE 4KTUA 2GZ8A 2AERH 4U32A 4X1PU 2GCTC 2BQ7B 4O3TA 4XBDA 3DT0H 1LHFH 1MTNC 1C5QA 2ASUB 4DG4A 1FY5A 4ZKOU 1IHTH 1TPSA 4JYVH 3DFLA 1A3BH 2QC2A 1XX9A 2XCFA 1O31A 1Z7KA 4FU8A 4E06H 4MNXA 1GBIA 2BOKA 1C2GA 3GISB 3HKIB 4KKDA 4CREA 1GPZA 1FY4A 5F8TA 3RXEA 1BMAA 2NU0E 1GHBF 3LH3A 4WMDA 2THFB 4ZKRU 1O3DA 5GJ4B 1MZDA 2CF8H 3A88A 3QO6A 4RSPA 4DJZB 5L30H 1UTMA 1O3HA 2RG3A 3M3TA 4H6SB 1RFNA 2Z9GA 2H1UA 4MPXA 1GBTA 1TNIA 2LPRA 1K22H 3RXKA 4B73A 4DVAU 1S84A 5E2PA 1Q2WA 1O2JA 3I29A 3M36A 3T25A 2GDEH 1WOFA 3V0XA 4BAHB 1GDUA 5HXFA 3FFGA 2W7UA 1GG6C 1ANBA 4MPWA 3M35A 4AGJA 2V0BA 1ZSKA 3SGQE 2STBE 1ELEE 1V2UT 3OU0A 1QJ6B 1GJ8B 2CF9H 3D49H 1SGYE 1Z1JA 3A85A 2R0LA 1P06A 2WUCA 2PKSB 4H42U 5C1XA 4YOJA 1LHGH 2ZEBA 1MD7A 1O3IA 1ANCA 1O2UA 1O33A 2H9EH 3TH3H 1C4V2 1K9OE 3K2UA 4X1NU 4BXWA 3PO1B 1AMHA 1KXFA 3SU6A 2BD7A 2JETB 1ZRKA 1F5KU 3GICB 3QK1A 4FUIA 1ZHMA 2ZHFH 3SHCH 5GWZA 1V2ST 3SUEA 4GLYA 1O3MA 4WH6A 4MTBA 2ZDVH 1C9TA 7GCHG 1BJUA 3MWIU 1GJBB 1D9IA 1GMCG 2W26A 1ZOMA 3FP6E 1TPOA 1QHRB 2Y5GA 1L4DA 1QJ7B 1MTNB 5BPEA 4CBNA 1GGDC 1K28D 3PTBA 5JDUB 1TAWA 3LIWA 3RXHA 1ZJKA 1VZQH 5F03A 5C67A 1EB1H 1GI4A 3T26A 2BMGB 2PSYA 1KLIH 4XBBA 1SGRE 4YM9A 4DIHH 3SUDA 3PWBA 3TPIZ 1QBNA 2Z94A 2XRCA 2JH5D 4MLFB 1E35B 3W94A 4ESTE 2ULLA 1FI8A 3S9CA 1Z8RA 2FX4A 1K1PA 4WXVA 4XFQA 1IQFA 3MU8A 4PROA 2G4UA 5EQRA 4CH2B 3SU0A 3SQHE 1V2QT 1C1RA 5GCHG 1XUIA 3BF6H 2J9NA 3UNQA 3DA9B 5EODA 5FX6A 1SGDE 5L6NH 2Q6GA 1ZPCA 2AYWA 2ZDKA 1MCVA 1F0TA 2ZGXH 3HPTB 1AUJA 1CSOE 2GV6A 2FOGA 3K6YA 4THNH 1AKSA 2VIQA 3MNCA 2VIWA 1C2MA 4NWKA 1OWDA 2SGQE 1IQLA 2FOCA 5EW1H 1AD8H 3AK5A 2VU8E 3SJIA 1GG6B 6GCHF 2OTVA 3H7OA 1CO7E 1LVMA 3HK6B 1B0FA 4Y71A 2WPJS 2AGIX 1UTOA 5E8EH 5A8ZA 2QAAA 1Y59T 1EB2A 2IJOB 3ZZBA 3U1JB 3SNBA 1ELVA 1FV9A 1O36A 1XKBC 4AZ2B 2BXTH 2ZDMA 5G4BA 3DD2H 5C5OA 2VVVA 1W10U 4X6OA 1HJAC 2A45B 5TCAA 1G30B 1N8OC 3R0FA 8ESTE 4Q7ZA 1O37A 4JK6A 4AN7A 2AMDA 5HYOA 2BVSH 2Z7FE 4CRBA 2P94A 1O2NA 1ELCA 1EZSC 2FESH 1ETTH 4CHAC 1ELBA 4RKOB 5ESBA 1UVOA 1Y5AT 4H6TA 2D8WA 1IQMA 5CHAB 1HGTH 2AGEX 1BMNH 1G2LA 3SV9A 3TJVA 3MU5A 1NO9H 1QNJA 2PHBA 3VXEH 1W7XH 3M37A 2HVXA 2H5DA 1O38A 3BN9A 2J4IA 1GGDB 2G51A 3GY7A 3SJOA 3SUFA 1XVOA 3BEIB 2AIQA 2VIVA 1WCZA 1QL9A 3LT3A 1MBQA 3ZVFA 2Z9LA 3Q3YA 2XBWA 1UTKA 3E16B 2BVXH 3TK5A 3H5CB 1TNKA 1LQEA 1U6QA 1WBGB 3M61U 5C1UA 1CT2E 2VWNA 4RI0A 1RGQA 1NRSH 2V35A 4K60A 4DIIH 3PV4A 3CS7A 1CGIE 4FU7A 2FP7B 1BRUP 1EPTA 1GDNA 1V2VT 1QBVH 1ABJH 1YCPH 1O5FH 1YPMH 2O8LA 1EASA 4CRCA 2GP9B 4O9VA 3BTHE 4IGDA 2R2MB 2ZFPH 4ISNA 2FEQH 1TNLA 1C1NA 1S85A 4ZXYH 2ALVA 1YPKH 3GY4A 4XSKU 5FCKA 1MTSA 3I77A 1FAXA 5LPRA 2F9VA 1ZGVA 1NRRH 1GVKB 3BIUH 3M5OA 2WPKS 2GT8A 2DE9A 4Y0YE 3VGCB 1GVLA 3RXIA 3VB4A 4X8UH 3RXMA 1SFIA 4B2AA 2ZDNA 2P8OC 1G36A 1JRTA 2H2ZA 1P03A 1L2EA 4BOHA 1E36B 1H8DH 1O30A 2VGCB 3LONA 4ISLA 1TOCB 2PWXA 1TGCA 2PW8H 7GCHF 2ZU3A 3R3GB 1VCWA 3UIRA 1ZTJA 2FM2A 2FI3E 1GMCF 2ZGCA 1O3OA 5A8YA 2PSXA 1GI2A 1C5VA 3NCLA 5JBBS 1A3EH 2BZAA 1AN1E 4DOQA 3EE0B 5JBAS 3ZZDA 2QN5T 1WQVH 1MAXA 2NU2E 1SL3A 3MHWU 3MMGA 5DP3A 1BDAA 4GAWA 5HM2A 1CVWH 4YT7H 3KGPA 2PGBB 2VIPA 4X2YA 3RXLA 4IS5A 2IJD1 1C5TA 1P02A 1SHHB 1B0EA 2ZDLA 1DS2E 1W7GH 1XXFA 2H6MA 4BXSA 3A84A 1PPZA 1EP6A 1PPHE 2O8TA 2XYAA 3MU1A 1Y3WA 1GBFA 1P11E 3PYHA 1TQ0B 5GCHF 2FIRH 1AWFH 3GDSA 1J15A 2GZ7A 1XUHA 3ZVBA 1N6YA 3MO6A 1GCTB 1OS8A 1ZHPA 1O5AB 4MPUA 3F9FA 4WJG2 3KCGH 3OY6U 1UTLM 3SI3H 1EAIA 1O2LA 5EU8A 4J2YB 4FUDA 4I8HA 1DX5M 1FN6A 3A8BA 1CQQA 3BV9B 5B6OA 5DGJA 2ANWA 2F9NA 2UWOA 5EW2H 1GDQA 3TU7H 2CGAA 3H7TA 1JIMA 5FCRA 2BQ6B 1IHSH 1EAUA 1OYTH 1QL8A 5F8XA 3UQVA 1W2KH 1H9IE 1A7SA 3S0NA 3IITA 2AGGX 2OUAA 4MNWA 2R3UA 3RU4T 5C1YA 4MG3A 1VGCC 1GBKA 4RKJB 1V2NT 3BTME 3A7WA 4ABIA 3L33A 2G8TA 1P3CA 1GI9B 2P8OB 4XBCA 2FI4E 2CXVA 7LPRA 1MCTA 1PPEE 3LGIA 3RUOA 3F9EA 2J2UA 2SNVA 2ZPSA 1O2HA 4LZ4B 5B6LA 1W11U 1FQ3A 1FIZA 5GIBA 3BTWE 4MPVA 1RRKA 1DVAH 3ZVEA 1QY6A 1G9IE 3TH4H 1HNEE 4XE4A 3BTGE 3UR9A 2XC0A 1F2SE 5HGGA 1DWDH 3K65B 1SR5C 4ABJA 3O8RA 4DCDA 1AE5A 3ODFA 1CE5A 1C1MA 1K1IA 2A2QH 3SV7A 3A8AA 1KXAA 3K9XB 4K1TA 4QT8C 4X2VA 3RXTA 1IAUA 2VWMA 3QWCH 4X6NA 2ZHEH 2Y5HA 2XWAA 3GDUA 1FJSA 3N7OA 1AZZA 1H8IH 1GHXH 2W7SA 4OM9A 2VNTA 3D62A 3ITIA 2EEKA 1F0SA 3MH4A 2VVUA 4Z6AH 1IQNA 2ZQ2A 2W3IA 2A7HA 1UVSH 1AWHB 1LVYA 2OD3B 1CBWC 1G32B 3RC6A 3P92A 1ZMLA 4I31A 2ZO3H 4NA7A 3SUGA 1ZSLA 2DUCA 3O8BA 3O8DA 2Z6BD 2TBSA 1BITA 1YPLH 1CA0C 5DJ7A 1P9UA 1W8BH 8LPRA 5JB8S 1KTTB 1TONA 1GMDG 1GBCA 1O2GH 1Q3XA 1TE0A 4INLA 6LPRA 1OKXA 3BTEE 1S0QA 3T2NA 3TJOA 3RXCA 1JWTA 3T28A 4FUBA 3A81A 4JZEH 4JCNA 4B74A 3RDZA 1O5GH 1J14A 2ZPRA 1SGCA 3QN7A 1FN8A 2C8ZB 3SBKA 3E3TA 2GCHG 3GCHB 2XXLA 2OBOA 3SQEE 5FHTA 3DHKH 3WY8A 1EXFA 1A0LA 1GVZA 5EXNA 4NIYA 5EGMA 4IC6A 1GJ5H 4IN1A 2OCVB 2BYAX 3SO3A 4NZLA 3A7TA 5TJXA 1F5RA 2ESTE 2GX4A 3FP8E 3B8JA 3E90B 3BEUA 1S82A 4CRAA 1O34A 2PKAB 1GBJA 1H9HE 1BMLA 1TNHA 4BNRA 4IN2A 1GCDA 1TX8A 2P59A 1QIXB 2BX3A 4TPIZ 1LTOA 1SGTA 3RXGA 4X1RU 2QA9E 5AVDA 3LGWA 3UREA 2Y82A 2XCNA 2TGTA 2CHAC 3V7TA 1SLVB 3BIVH 3LOXA 3HATH 1C1SA 4CR9A 2FS8A 1YCPK 1P09A 1Y3XA 3LC5A 1ZPBA 4YOGA 5T6GA 3RXJA 2BZ6H 4INHA 2AH4X 4I8GA 4HFPB 4Y8ZA 1ACBE 2FZZA 3M3SA 3NKKA 1GBAA 2C8WB 1ZTKA 1CA0B 4VGCC 1PPGE 1MD8A 3P8OA 2BD4A 2AIPA 2ODYB 4Y10E 1QTFA 5J4SA 3H09A 3HKJB 1XUKA 1BTZA 4CRGA 2O8MA 2XW9A 4FUGA 3ATIA 1TBQH 4Y11E 1FPHH 2ZGBH 1C5YB 1Z1IA 1NFXA 1O3PB 1O5BB 5DP4A 1S6FA 4ZAEA 4ZKSU 2SGDE 1LDTT 3M5MA 1YM0A 5LPEA 1C5WB 3SU3A 1UCYE 2BDAA 1GMHF 3GY6A 3A80A 2PGQB 5DG6A 1TGNA 2BXUH 3UOUA 1TMBH 1RJXB 1LVOA 1XUJA 2WPHS 2B7DH 1BTUA 1P10A 1GHZA 2AEIH 1GBLA 1WUNH 2ODPA 1AI8H 1HAVB 1Y8TA 2ZFSA 4AGKA 1LPKB 1AUTC 1ZZZA 1W14U 1Z6EA 2XBVA 1MTUA 3BTQE 4ZMAH 1KSNA 2OP9A 2VB0A 2PTNA 2ZFRH 3KN2A 1D6WA 1T7CA 5ETXA 1YPJH 1P2QA 2BVRH 2ZP0H 2A4GA 3PLPA 4Q7YA 1C4Y2 4Q2KA 2UUYA 4KTCA 3HK3B 3GY2A 1BT7A 3URCA 8KME2 1INCA 2QXHA 2QF0A 1DY9A 1K1JA 4OGYA 1TGSZ 3TLOA 4F49A 1MAYA 5DP9A 1NTPA 1ZMJA 2Z3EA 1F0RA 1HB0B 2VINA 3VB3A 5ESTE 4YTAA 3BTKE 4K1SA 4WY3A 3ZZ8A 1T4UH 2V3OH 5K0HA 1FY1A 1JBUH 1OWKA 2TGAA 2ALPA 1KDQB 3MNSA 2OC7A 3F68H 6ESTA 1BCUH 1Z8JB 2PV9B 1BTHH 5GPIB 3P95A 1D3PB 4X6PA 3S69A 4IMQA 2BD2A 3SJ9A 2TRMA 2IN2A 2WV9A 2W3KA 2XNIA 4JYUH 2OBQA 3UTUH 3ATLA 1AY6H 1O2VA 2PFEA 1F7ZA 1RTLA 1TB6H 4B71A 1ELTA 2FTMA 2GCTB 1KLTA 2YNAA 2PKAA 3M5NA 2HRVA 2OC1A 1QURH 2ODQA 1S6HA 2G4TA 4BTTB 1W3CA 4WXIA 1QBOA 3DUXH 3OYPA 1ZMNA 2B0FA 1Q31A 3MTYA 5LH8A 1SMFE 3C27B 2FOAA 3KHVA 2F9BH 4Y6DA 1L1NA 4UEHH 1VJ9U 1SLUB 1DLKB 1P12E 1QA0A 2O8UA 1IQEA 1RIWC 1RXPA 2Q6DA 1DWEH 2FYQA 2ZHDA 2V6NA 4ABBA 1BTWA 3I78A 1J9CH 3MU4A 1O35A 3GYMA 4BAMB 1L0ZA 3A89A 2BLWA 5SGAE 2VVCA 3ZV8A 4JK5A 1ESBA 1ID5H 1OX1A 1S0RA 2GMTC 1KXCA 1A0HB 1GI5A 1PQ7A 1HXEH 5GNDA 1ESAA 1TLDA 5DPAA 4BTUB 4R8TB 1JOUB 2A4QA
chains in the Genus database with same CATH superfamily
2OC0A 3FZDA 3MH5A 1YLDA 2BD3A 2YOLA 3BEFB 3LJOA 3Q00A 5JBTA 2KCPA 2BDIA 1MU6B 3RXVA 3BTDE 1YKTA 1VJAU 1KMHB 3KYGA 1GJCB 3MH7A 1YLCA 4MNVA 4X1SU 1C2JA 1EZQA 1TPPA 1WQSA 2ZCLP 3Q3KA 4AFZA 4X2XA 4DURA 1O2IA 3GY5A 3EA7A 4RT0A 1O3EA 1OOKB 1JMOH 1DLEA 1HAHH 4F4OC 3V12A 1SI5H 1KTSB 1TMTH 2KCYA 1BMFD 1YP9A 1UTJA 2V3HH 1HAVA 1ZGIA 2Y6TA 2BDCA 1C1TA 2ANKH 1O2OA 5ABWA 1QQUA 3NXPA 3TNTA 1EAWA 5DP5A 4ISIH 1C2HA 5AHGH 3TIUA 3PV5A 4XDEA 3OY5U 1UW7A 1UCYH 5DP7A 4LXBH 4XRNA 3TJNA 1FPCH 4AG1A 3VPKA 1VCPA 2WYJA 1TIOA 3GS9A 1Z8IB 5BRRE 1MKWH 4WWYA 1MKXH 2HNTE 2UUJB 1HLTH 1WTHD 1W13U 1RS0A 1IQKA 3PB1E 2BHGA 5HM9A 5A0BA 2VIOA 1DY8A 4AOQA 3PROA 1LHEH 1O2YA 1RTFB 5A09A 2HPPH 1DSUA 3F9HA 3PMAB 3EYDA 1EATA 1F92A 3GCNA 2R3YA 1KDQA 3URDA 1UTQA 1P2NA 2BX4A 4ZUHA 3NPSA 2R2WU 3F2HA 1MH0A 2UWLA 2GGVB 1K1LA 4X6MA 1GI3A 5FPSA 2FYRA 2UUKB 4Y0ZE 1K1MA 2A1DB 2A7JA 3VB7A 3SGAE 1FNIA 2BM2A 2P16A 1GL1A 1OYQA 1C1PA 4X8VH 1Y5BT 4A7IB 1C5OH 1Y3UA 2V7QD 3P17H 2PTCE 3OX7U 1LMWB 3OTJE 1ZYOA 4E7NA 1BTYA 3KIDU 3RP2A 3RXFA 1BBRE 3KNXA 3HGPA 2GDDA 2WPLS 4UD9H 1HJAB 3ATWA 4CR5A 4BTIB 2A7CA 2AS9A 1O3BA 1N8OB 1THSH 1NC6A 2ZG0H 3E0PB 2K1QA 2RCEA 1GHYH 1BA8B 5EXLA 1PYTD 1C2LA 3RXQA 3T29A 1L4ZA 2YNBA 4ABEA 1AFQC 4FUJA 4CHAB 1HAYB 1NRNH 1MBMA 1BQYA 3A7XA 3ZVCA 1VITG 3ZYDA 2BD5A 2ZHQH 3FAOA 2I6SA 8GCHG 1P2JA 9LPRA 5IK2D 1SGFA 1NZQH 3F1SB 5C3NA 2PUQH 3SV8A 1O2MA 4K1EA 6CHAC 2NWNA 3RMMH 4B1TA 4I8KA 3EA9A 1CHOG 2Y7XA 2HVYB 1C5UA 1K2I1 3E8LA 1S5SA 3F6UH 1BRBE 1NT1A 1SGEE 2GZ9A 3SZNA 1SB1H 2D26C 4B6EA 4GCHG 1ELFA 2EI8A 4GSOA 2FX6A 5EG4A 1GI7B 3RC5A 1C1UH 1SC8U 2XC5A 4D9RA 2SGEE 1V2RT 3RLWH 2VH0A 1ZSJA 2FTLE 2B9LA 1P2OA 4AYVB 4ABDA 4FUFA 1C1WH 2BTCE 1KXBA 1DSTA 3A7VA 2JIZD 1BJVA 3K6ZA 1O3NA 4OS4A 2BY6X 5I25A 2J38A 2Y81A 1BIOA 1OP2A 2BOHB 9ESTA 4I7YH 3WWFA 3P8FA 1AZ8A 1LPZB 1UJ1A 2ZIQH 3NK8A 3P8GA 3A7ZA 1DWCH 1QGFA 1ESTA 1A2CH 2D2DA 3KL6A 1TNJA 4O3UA 3TVJB 2J94A 2K0QA 3B23B 1OHHD 3UR6A 4Z1MD 2CV3A 4Y8YA 4ABFA 5DK1A 4JYTA 3QTVH 3RMLH 1K0HA 2P3FH 3RXSA 1XXDA 4LOYH 1PQAA 2GKVE 1QRZA 2K8IA 1HAXB 2XC4A 2XOKD 4FUHA 4GVUA 2VIDA 1YPEH 5CE1A 3PLKA 1S83A 2A32A 4NCYA 3TGIE 3NUMA 4WVPE 3LDXH 3ATKA 1QB6A 1V2JT 2ZTZA 3UWJH 1K21H 1KLJH 1G3DA 2XBXA 3RU4D 1OP0A 1PQ5A 1A61H 1SSXA 1YF4A 1GJ4H 1V3XA 2BDYA 2GTBA 3TGJE 1OSSA 1P8VC 4YT6H 3RXDA 1UVPA 3U9AH 3SW2B 4WMEA 2STAE 1HUTH 2C8XB 2SGPE 3BG4C 4NIVA 1MQ5A 1PYTC 2BD9A 2FMJA 3GYLB 4YOIA 4ZKNU 3V3MA 1GJ9B 1HBTH 1SQAA 1BHXF 2WV4A 4NIWA 4OS2A 1UHBB 3F9GA 4BAKB 2WUBA 3U1IB 2FLRH 3RM0H 5EPYA 4I8JA 3BSQA 1HPGA 2G55A 2H5CA 2NU1E 3FP7E 1CHGA 5T1VA 4CBOA 3MU0A 2NU4E 4CRFA 2W6ID 2GVFA 3SU1A 4NWLA 1YBWA 4DW2U 1C5MD 1TX7A 5PTPA 2TPIZ 2HWLB 4ZROA 4Y76A 3U28C 1ZPZA 1FONA 4X1QU 1C5LH 1DE7H 2Z3CA 2ZDAH 3EDXB 1PPBH 1THRH 4ASHA 4CRDA 1TWXB 1CA8B 2F3CE 4J1YA 3N7DA 1EQ9A 3U8OH 2B8OH 2RA3A 3LGVA 2VJ1A 3VB6A 1RTKA 4X2WA 1P3EA 1V2PT 1D3TB 1SGNE 2R9PA 3ESTA 1GBEA 5LPFA 1MTVA 1O2PA 1VGCB 4NSVA 4BANB 3GDVA 4X0WU 2ZFTA 5AF9H 2HNTC 1HAGE 1GHWH 2ZFQH 3P6ZB 1VITF 3STJA 1BBRH 4MDSA 4BAQB 4NFFA 1NESE 1NY22 3S9AA 5A0AE 8GCHF 2ZU5A 1WYKA 2R0KA 1C2DA 1HV7A 5A0CA 2GV7A 5FPTA 5HMAA 1SBWA 1BHXB 3A83A 1HCGA 3JZ2B 5CHBA 1DXPA 1NU9A 3SJKA 3TH2H 4AB9A 2ZCKP 1NBMD 1OWEA 1TRNA 2EA3A 3NZIA 4MQAA 2FOHA 1CHOF 1SOTA 4IBLH 1SQOA 1MUEB 3A8CA 2BLVA 4GCHF 2KR7A 1BTPA 3ZZ5A 1GHAG 1ANEA 4Q7XA 2CK3D 1QZ8A 2FOMB 2HNTF 2SGFE 4H4FA 1V2OT 1SG8B 1UCYK 5KEDA 1KYNA 1GI1A 1QRXA 3SYJA 3AAVA 2F91A 4NG9H 3MH6A 2BDBA 4ACBA 2QY0B 4SGAE 3EGKH 3VB5A 1MU8B 1J16A 4IMZA 1MKWK 1MKXK 1O2SA 4WH8A 2WPDD 1MMJN 3MNXA 3Q3XA 1OWJA 1C2EA 4DGJA 1NFYA 4ISHH 1AB9C 1HRTH 1TOMH 1DFPA 2F9UA 1QJ1B 1PPFE 1HAIH 2Q1JA 2FOEA 1FIWA 4M7GA 1CBWB 2BB4A 1W0ZU 1G37A 1V2WT 2GD4B 1SOZA 1QL7A 3SZEA 1UMAH 3DFJA 2F83A 1O32A 3LPRA 2ZHWH 1EPTC 1DOJA 2BY5X 1DDJA 3LC3A 2AMPA 1L1GA 1TQ7B 2FDAA 1QQ4A 5C5NA 3GY3A 1EUFA 1T32A 2WV5A 1JXPA 1TFXA 2PKSC 4KP0A 2F9PA 2LELA 5I46H 2HOBA 2ZWLH 5AFYH 1BOQA 1TBZH 1ETRH 1A4WH 2P95A 1Y3YA 1GJDB 4AORA 2G52A 2VBCA 1AKSB 3RXPA 1W0JD 4YLQH 4YLUA 3QLPH 1TYNA 1ZJDA 1C5XB 2J92A 1C5NH 2H9TH 2PUXB 4AFUA 3Q76A 2Z3DA 5T3HA 1PPCE 1V2LT 1WSSH 1E79D 2C8YB 4K8BA 3SORA 1C5ZB 1A5HA 2A0QB 1H1BA 3A7YA 2J98B 2HPQH 3ZZ4A 1F0UA 3IG6B 3KQCA 1UHBA 2QV1A 1OXGA 4TT3D 1QRWA 3TK6A 1P2MA 3MI4A 1CGHA 4Z0KA 2QF5A 4ZHLU 2ZF0H 1P2KA 1G3BA 1ARCA 1DICA 4NFEA 2TGDA 2F4LA 3GCTG 1A46H 5EQQA 1E37B 1OWHA 3BTFE 3PMJA 1HDTH 2M5TA 3QGJA 2FOFA 3EE7A 4HTCH 2IPHA 5LGOA 4ZCNA 2OK5A 4Q4LA 1GL0E 4K8YA 3ZVAA 1GMDF 3FVFB 1ANDA 1O3LA 2CHAB 2QF4A 4UFGH 5KGOA 1AB9B 1TABE 3SU4A 1AVGH 1T31A 4ZHMU 3TJUA 4R0IA 3STIA 4M9FA 2SGAA 1P0SH 4GUXA 4LK4A 2JH0D 3ODDA 4RN6A 5IYTA 1YPHC 1ZLRA 2OINA 3ELAH 1DWBH 1D6RA 2GCHF 3FOAA 1DT2A 1C2KA 1EPTB 1P2IA 4VGCB 2WHXA 1WAYB 1A1RA 2BY8X 2UWPA 2ILNA 4E7RG 1LVBA 1LO6A 1CU1A 1SQTA 1AIXH 1O3KA 1FLEE 1SLXB 4U2WA 1X7AC 1AGJA 3RXAA 4AYYB 4ABHA 1HAPH 1B7XB 2ZI2H 1EKBB 4OS5A 3T5FH 3D23A 1LPGB 4YO9A 1HYLA 2QXJA 4A6LA 1BB0B 1ELAA 1NFUA 3VXFH 1SFQB 1YC0A 5CHAC 1UO6A 4OS1A 1HIAB 1EJNA 1UVTH 4B2BA 1GHAF 1P9SA 5HIZA 1O2KA 1EJAA 3VEQB 2PP6A 4Y79A 4TY6A 5FBIA 1LHDH 3KQ5A 1GHVH 3OSYA 4X8SH 1DM4B 3KF2A 1TNGA 4GHQA 3ZZ9A 2J34A 2QXIA 3OEED 1AVWA 3QZQA 4UFFH 1O2ZA 1LKAA 3WWBA 2QCYA 4OS6A 3AW0A 4U30A 3PMHB 5FL7D 4FUCA 1UVUH 2ANYA 3BTTE 4Q63A 1YYY1 3UFAA 7KMEH 3OTPA 1GBDA 1IQIA 3T62A 4JZDH 1MTWA 1AHTH 1OPHB 1SGPE 1P57B 4FU9A 1P04A 1SVPA 4K69A 4AC9A 1ZTLA 4JZIA 4YZUA 3LJJA 1IQGA 3RXRA 4A1VA 1S81A 3U8RH 1AU8A 1FZZA 1IQJA 3MO9A 2KAIB 2ZFFH 1THPB 1E34B 3M7QA 4UDWH 1CGJE 3L6PA 2BLQA 4F48B 3VGCC 1G3EA 1TPAE 1W12U 5IDKA 1LQDB 1QB9A 3GOVB 2FODA 1T4VH 3DSOA 1KXDA 1TGTA 1Z6JH 2VWLA 1O5DH 1ETSH 1BRCE 1AE8H 1O3CA 1UTNA 2VGCC 1WTGH 3M7UA 2RA0A 4Y8XA 2G5VA 1Y5UT 3UUZA 2J98A 1O2XA 2ZU1A 2ZPQA 1O3GA 1QFKH 1EZUC 1SKYE 3QTOH 1FUJA 2G81E 3RM2H 1LHCH 1O2RA 4ABGA 4FOUC 3Q77A 3KQDA 5KECA 2O9QA 1NU7B 1ZR0A 3MNBA 1V6DA 3V13A 1C5PA 1N1LA 1AQ7A 2ZC9H 1C2IA 1YGCH 1BBRK 3PV2A 1WU1A 4Y7BA 3GY8A 3NWUA 4ZHAA 3SGBE 1DUEA 2SFAA 3ZV9A 1RD3B 2Z9KA 5A2MH 5C17A 2TGPZ 2BDGA 2HALA 1QCPA 3GCTF 3KQEA 1AO5A 5E2OA 5K7RA 1Y3VA 3C1KA 3CS0A 3TITA 1GJ6A 1RIWB 1FY8E 4NGAH 4NA9H 3ZVDA 4I33A 4LZ1H 1VR1H 1H4WA 1BUIA 4D7FA 1TRYA 5FPYA 3UNRA 1T8LA 1ELGA 3VG8A 1GCTC 2OC8A 2OQ5A 1O3JA 3EA8A 4TWWA 4AX9H 2GMTB 2FWWA 3ZZ7A 3T27A 4HG6A 3M3VA 4Y7AA 4OS7A 1YCPM 2OXSA 3TNSA 4JZ1A 3DSGA 2DE8A 1S6LA 3UB0A 4P00A 2HLCA 2ZU4A 4HI3A 3S7HB 1O5CB 4D76A 5E0JA 1FMGA 5HIYA 1BZXE 4FVBA 5E0GA 2ZECA 5JB9S 1NRPH 1DXWA 2QXGA 1KXEA 1LKBA 3RLYH 3SNDA 4SGBE 1KY9A 2H9HA 3LKWA 2FOBA 3RXOA 3RU4E 5AFZH 4ZH8A 5JPMH 1SGIB 5EJLA 2G00A 4JMYA 2ZGHA 5EPNA 5F6MA 2HLDD 4NIXA 3O8CA 5T6FA 1MZAA 1WDIA 5FBEA 4DY7B 2HGTH 2OLGA 4ISOA 5F8ZA 5FXLA 1HIAA 2BLOA 3SU5A 5DO4H 4B6FA 2J95A 4NZQA 3U98H 1FDPA 1GBBA 2FS9A 2CMYA 3QZRA 3N99A 3RMNH 3AASA 1TA6A 3M5LA 3QGNB 5A8XA 5L2YH 1C1OA 4UE7H 3A82A 1UK2A 3RC4A 1C4U2 4IC5A 4D9QA 4TWYA 4B75A 1L1JA 1TBRH 1UTPA 4AB8A 2JJ1D 5DKMA 1XUFA 2A4RA 1O2WA 2WYGA 4TYDA 2WSSD 2VWOA 3QX5H 2Y80A 1H9LB 4MVNA 4I8LA 1A5GH 1C5SA 3P70B 1C1QA 4E05H 1J8AA 3SNCA 5JBCS 3ZZCA 4K3JA 4HZHA 2FXRA 1NM6A 4KELA 3E1XB 2C90B 2C93B 4D8NA 3UNSA 1SHYA 3OAAD 2QYIA 3ZYEA 1E38B 3G01A 1GWAA 3RXUA 1H8ED 2Q6FA 5GDSH 3U8TH 1C2FA 1C5RA 3L3TA 2WINI 5JYIA 1OWIA 1ZHRA 2KAIA 2VH6A 3PMBB 5J4QA 2O8WA 4OGXA 2ANMH 5EQSA 5CMXH 4TY7A 3SHAH 3FANA 3GCOA 1F5LA 3UY9A 1H8HD 1VCQA 4NSYA 2GJGA 1XKAC 1WV7H 1FAKH 3ENSB 2A2XH 2A5KA 4P02A 1OP8A 1ORFA 1SPJA 1Z71A 3LGTA 3SI4H 2G5NA 5EXMA 2JH6D 1TRMA 1XMNB 3A86A 1NBME 4GHTA 2AMQA 3CNRA 2ZCHP 3SN8A 1O5EH 2C4FH 3SJ8A 3UWIA 2BQWB 2BY9X 2FLBH 3ZZAA 2EI7A 3LGUA 4I32A 3U69H 3FZZA 1C1VH 1NPMA 1GBHA 3DCLA 1HFDA 1ARBA 2XTTB 1O39A 3KQBA 1HXFH 2XBYA 3HGNA 1VITH 3GCHC 2AFQB 3EQ0H 3SNAA 1YPHE 2YMSD 3UPEA 1BRAA 2NU3E 1TA2A 3A8DA 1AFQB 3ZZ3A 1FY3A 1JRSA 4K5ZA 2B5TB 2PR3A 2I6QA 4BAOB 4UONA 1IQHA 1O3FA 2BDHA 3MYWA 5E0HA 1EP5A 3F2GA 1EX3A 2FO9A 2FPZA 1Z8GA 2CJIA 1C9PA 3PM3A 6CHAB 3SU2A 1ZRBA 3F3BA 4B76A 1GMHG 1T8OA 2ZQ1A 1ABIH 3PWCA 2EQNA 4YESB 5DP6A 4AFQA 1SLWB 1NRQH 2W6JD 5H4IB 1N6XA 4WF8A 1SGQE 4Q80A 3UQOA 3W95A 1GHBG 4ZXXH 3A87A 1D3QB 5F53A 5C0TA 1XUGA 2RDLA 1HAOH 1WXRA 2LNCA 2ZU2A 1K1NA 2F9OA 2P3TB 1TGBA 1YPGH 2EC9H 3CENA 1HAZB 2JKHA 4XD7D 5C0UA 3QDZB 3SOSA 2W5EA 4FUEA 1V2MT 1K1OA 2GT7A 4O03A 2D1JA 1CT0E 4KGAA 2Z9JA 3ATMA 1EOLA 1TX6A 1XVMA 5T6DA 3TGKE 4YXWD 1GJ7B 2IOTA 3KEEA 1GI6A 1NN6A 1A0JA 1BTXA 2QF3A 1PJPA 3MO3A 4XOJA 3S7KB 1HJ8A 2EI6A 1EOJA 4CH8B 3IWMA 5DN6D 3PRBA 1BMMH 3S9BA 2PLXA 1TALA 4NA8A 4WMFA 3LH1A 5DP8A 1SGFG 1TMUH 1HJ9A 2ZTYA 1E0FD 3PLBA 2ZA5A 2KZ4A 2OQUA 1D4PB 4A1XA 2FI5E 5TCCA 1O2TA 5C2ZA 5L2ZH 1EJMA 4TPYA 3B9FH 4A92A 1KIGH 4O97A 1FX0B 1W0YH 1UK4A 4D7GA 3D65E 1D3DB 5FAHA 2BD8A 3PTNA 1YLNA 1QA7A 2P3UB 3SNEA 4IW4E 1CT4E 4U01A 3SV6A 3NRLA 3AAUA 2Y5FA 1DANH 3ZVGA 1DITH 2Z9IA 1GI8B 1NROH 4UFEH 3UOPA 5C20A 3SV2H 4UFDH 3BG4B 1FXYA 5GXPA 2YMSC 3EAJA 2P93A 3P8NA 3RXBA 1LCYA 1E1RD 2BY7X 3CP7A 2ZGJA 3QUMP 2Y7ZA 2SNWA 2UUFB 1A5IA 2C3SA 4INKA 2A5IA 2TIOA 2XWBI 2ZZUH 2WPIS 1V2TT 1AFEH 2CN0H 1O2QA 2WPMS 4K2YA 3E6PH 2QGRA 4AFSA 4B2CA 3JZ1B 4AG2A 4A5TS 4JZFH 3MOCA 1GI0A 2ZTXA 1G3CA 1QR3E 3E91A 1NFWA 1NS3A 2A31A 1IOEA 1AVXA 2A4OA 1P05A 4FVDA 4HGCA 4GPGA 2ZKSA 3E0NB 3BG8A 5FX5A 3RMOH 1O0DH 1M9UA 1P01A 1B5GH 3ZZ6A 3M7TA 2KX4A 4MNYA 3LGYA 1T8NA 1UK3A 1J17T 1XM1A 3MFJA 1PQ8A 1T8MA 2A5AA 1PFXC 1O3AA 1GJAB 1SQRA 3AVZA 1COWD 3LU9B 2WZQA 1G2MA 6GCHG 3TK9A 2QIQA 4FXGH 1EAXA 3VFEA 4ABAA 1JIRA 2ZNKH 3PO1C 1MQ6A 1EZXC 4KTSA 1DUAA 1GBMA 4A1TA 4DT7B 1DPOA 1ELDE 4X8TH 2JETC 5EOKA 1V2KT 3AW1A 1QB1A 7ESTE 4KTUA 2GZ8A 2AERH 4U32A 4X1PU 2GCTC 2BQ7B 4O3TA 4XBDA 3DT0H 1LHFH 1MTNC 1C5QA 2ASUB 4DG4A 1FY5A 4ZKOU 1IHTH 1TPSA 4JYVH 3DFLA 1A3BH 2QC2A 1XX9A 2XCFA 1O31A 1Z7KA 4FU8A 5EJZA 3MQKC 4E06H 4MNXA 1GBIA 2BOKA 1C2GA 3GISB 3HKIB 4KKDA 4CREA 1GPZA 2RFKC 1FY4A 2KFWA 5F8TA 3RXEA 1BMAA 2NU0E 1GHBF 3LH3A 4WMDA 2THFB 4ZKRU 1O3DA 5GJ4B 1MZDA 2J5UA 2CF8H 3A88A 3QO6A 4RSPA 4DJZB 5L30H 1UTMA 1O3HA 2RG3A 3M3TA 4H6SB 1RFNA 2Z9GA 2H1UA 4MPXA 1GBTA 1TNIA 2LPRA 1K22H 3RXKA 4B73A 4DVAU 1S84A 5E2PA 1Q2WA 1O2JA 3I29A 3M36A 3T25A 2GDEH 1WOFA 3V0XA 4BAHB 1GDUA 5HXFA 3FFGA 2W7UA 1GG6C 1ANBA 4MPWA 3M35A 4AGJA 2V0BA 1ZSKA 3SGQE 2STBE 1ELEE 1V2UT 3OU0A 1QJ6B 1GJ8B 2CF9H 3D49H 1SGYE 1Z1JA 3A85A 2R0LA 1P06A 2WUCA 2PKSB 4H42U 5C1XA 4YOJA 1LHGH 2ZEBA 1MD7A 1O3IA 1ANCA 1O2UA 1O33A 2H9EH 3TH3H 1C4V2 1K9OE 3K2UA 3OE7D 4X1NU 4BXWA 3PO1B 1AMHA 1KXFA 3SU6A 2BD7A 2JETB 1ZRKA 1F5KU 3GICB 3QK1A 4FUIA 1ZHMA 2ZHFH 3SHCH 5GWZA 1V2ST 3SUEA 4GLYA 1O3MA 4WH6A 4MTBA 2ZDVH 1C9TA 7GCHG 1BJUA 3MWIU 1GJBB 1D9IA 1GMCG 2W26A 1ZOMA 3FP6E 1TPOA 1QHRB 2Y5GA 1L4DA 1QJ7B 1MTNB 5BPEA 4CBNA 1GGDC 1K28D 3PTBA 5JDUB 1TAWA 3LIWA 3RXHA 1ZJKA 1VZQH 5F03A 5C67A 5DSFA 1EB1H 1GI4A 3T26A 2BMGB 2PSYA 1KLIH 4XBBA 1SGRE 4YM9A 4DIHH 3SUDA 3PWBA 3TPIZ 1QBNA 2Z94A 2XRCA 2JH5D 4MLFB 1E35B 3W94A 4ESTE 2ULLA 1FI8A 3S9CA 1Z8RA 2FX4A 1K1PA 4WXVA 4XFQA 1IQFA 3MU8A 4PROA 2G4UA 5EQRA 4CH2B 3SU0A 3SQHE 1V2QT 1C1RA 5GCHG 1XUIA 3BF6H 2J9NA 3UNQA 4TSFD 3DA9B 5EODA 5FX6A 1SGDE 5L6NH 2Q6GA 1ZPCA 2AYWA 2ZDKA 1MCVA 1F0TA 2ZGXH 3HPTB 1AUJA 1CSOE 2GV6A 2FOGA 3K6YA 4THNH 1AKSA 2VIQA 3MNCA 2VIWA 1C2MA 4NWKA 1OWDA 2SGQE 1IQLA 2FOCA 5EW1H 1AD8H 3AK5A 2VU8E 3SJIA 1GG6B 6GCHF 5EIYA 2OTVA 3H7OA 1CO7E 1LVMA 3HK6B 1B0FA 4Y71A 2WPJS 3DSPA 2AGIX 1UTOA 2JDID 5E8EH 5A8ZA 2QAAA 1Y59T 1EB2A 2IJOB 3ZZBA 3U1JB 3SNBA 1ELVA 1FV9A 1O36A 1XKBC 4AZ2B 2BXTH 2ZDMA 5G4BA 3DD2H 5C5OA 2VVVA 1W10U 4X6OA 1HJAC 3PRDA 2A45B 5TCAA 1G30B 5C94A 1N8OC 3R0FA 2QE7D 4Q7ZA 8ESTE 1O37A 4JK6A 4AN7A 2AMDA 5HYOA 2BVSH 2Z7FE 4CRBA 1O2NA 1ELCA 2P94A 1EZSC 2FESH 1ETTH 4CHAC 1ELBA 4RKOB 5ESBA 1UVOA 1Y5AT 4H6TA 2D8WA 1IQMA 5CHAB 1HGTH 2AGEX 1BMNH 1G2LA 1YY3A 3W1EA 3TJVA 3SV9A 3MU5A 1NO9H 1QNJA 2PHBA 3VXEH 1W7XH 3M37A 2HVXA 2H5DA 1O38A 3BN9A 2J4IA 1GGDB 2G51A 3GY7A 3SJOA 3SUFA 1XVOA 3BEIB 2AIQA 2VIVA 1WCZA 1QL9A 3LT3A 1MBQA 3ZVFA 2Z9LA 3Q3YA 2XBWA 1UTKA 3E16B 2BVXH 3TK5A 3H5CB 1TNKA 1LQEA 1U6QA 1WBGB 3M61U 5C1UA 1CT2E 2VWNA 4RI0A 1RGQA 1NRSH 2V35A 4K60A 4DIIH 3PV4A 4DT4A 3CS7A 1CGIE 4FU7A 2FP7B 1BRUP 1EPTA 1GDNA 1V2VT 1QBVH 1ABJH 2F43B 1YCPH 1O5FH 1YPMH 2O8LA 1EASA 4CRCA 2GP9B 4O9VA 3BTHE 4IGDA 2R2MB 2ZFPH 4ISNA 2FEQH 1TNLA 1C1NA 1S85A 4ZXYH 2ALVA 1YPKH 3GY4A 4XSKU 4FETA 5FCKA 1MTSA 3I77A 1FAXA 5LPRA 2F9VA 1ZGVA 1NRRH 1GVKB 3BIUH 3M5OA 2WPKS 2GT8A 2DE9A 4Y0YE 2RDEA 1GVLA 3VGCB 3RXIA 5EJ1A 3VB4A 3F0OA 4X8UH 3RXMA 1SFIA 4B2AA 2ZDNA 2P8OC 1G36A 1JRTA 2H2ZA 1P03A 1L2EA 4BOHA 1E36B 1H8DH 1O30A 4F55A 2VGCB 3LONA 4ISLA 1TOCB 2PWXA 1TGCA 2PW8H 7GCHF 2ZU3A 3R3GB 1VCWA 3UIRA 1ZTJA 2FM2A 2FI3E 1GMCF 2ZGCA 1O3OA 5A8YA 2PSXA 1GI2A 1C5VA 3NCLA 5JBBS 1A3EH 2M2AA 2BZAA 1AN1E 4DOQA 3EE0B 5JBAS 3ZZDA 2QN5T 1WQVH 1MAXA 2NU2E 1SL3A 1YWUA 3MHWU 3MMGA 5DP3A 1BDAA 4GAWA 5HM2A 1CVWH 4YT7H 3KGPA 2PGBB 2VIPA 4X2YA 3RXLA 4IS5A 2IJD1 1C5TA 1P02A 1SHHB 1B0EA 2ZDLA 1DS2E 1W7GH 1XXFA 2H6MA 4BXSA 3A84A 1PPZA 1EP6A 3KYFA 1PPHE 2O8TA 2XYAA 3OEHD 3MU1A 1Y3WA 1GBFA 1P11E 3PYHA 1TQ0B 5GCHF 2FIRH 1AWFH 3GDSA 1J15A 2GZ7A 1XUHA 3ZIAD 3ZVBA 1N6YA 3MO6A 1GCTB 1OS8A 1ZHPA 1O5AB 4MPUA 3F9FA 4WJG2 3KCGH 3OY6U 1UTLM 2KM0A 3FO8D 5CDFE 3SI3H 1EAIA 1O2LA 5EU8A 4J2YB 4FUDA 4I8HA 1DX5M 1FN6A 3A8BA 1CQQA 3BV9B 5B6OA 5DGJA 2ANWA 2F9NA 2UWOA 5EW2H 1GDQA 3TU7H 2CGAA 3H7TA 1JIMA 5FCRA 2BQ6B 1IHSH 1EAUA 1OYTH 1QL8A 5F8XA 3UQVA 1W2KH 1H9IE 1A7SA 3S0NA 3IITA 2AGGX 2OUAA 4MNWA 2R3UA 3RU4T 5C1YA 4MG3A 1VGCC 1GBKA 4RKJB 1V2NT 3BTME 3A7WA 4ABIA 3L33A 2G8TA 1P3CA 1GI9B 2P8OB 4XBCA 2FI4E 2CXVA 7LPRA 1MCTA 1PPEE 3LGIA 3RUOA 3F9EA 2J2UA 2SNVA 2ZPSA 1O2HA 5B6LA 4LZ4B 1W11U 1FQ3A 1FIZA 5GIBA 3BTWE 4MPVA 1RRKA 1DVAH 3ZVEA 1QY6A 1G9IE 3TH4H 4ASUD 1HNEE 1W0KD 4XE4A 3BTGE 3UR9A 2LP6A 2XC0A 1F2SE 1VKYA 1DWDH 3K65B 5HGGA 1SR5C 4ABJA 3O8RA 4DCDA 1AE5A 3ODFA 1CE5A 1C1MA 1K1IA 2A2QH 3SV7A 2IPQX 3A8AA 1KXAA 3UAIC 3K9XB 4K1TA 4QT8C 4X2VA 3RXTA 1IAUA 2VWMA 3QWCH 4X6NA 2ZHEH 2Y5HA 2XWAA 3GDUA 4ACAA 1FJSA 3N7OA 1AZZA 1H8IH 1GHXH 2W7SA 4OM9A 2VNTA 3D62A 3ITIA 2EEKA 1F0SA 3MH4A 2VVUA 4Z6AH 1IQNA 2ZQ2A 2W3IA 2A7HA 1UVSH 1AWHB 1LVYA 2OD3B 1CBWC 1G32B 3RC6A 3P92A 1ZMLA 4I31A 2ZO3H 4NA7A 3SUGA 1ZSLA 2DUCA 3O8BA 3O8DA 2Z6BD 2TBSA 1BITA 1YPLH 1CA0C 5DJ7A 1P9UA 1W8BH 8LPRA 5JB8S 1KTTB 1TONA 1GMDG 1GBCA 1O2GH 1Q3XA 1TE0A 4INLA 6LPRA 1OKXA 3BTEE 1S0QA 3T2NA 3TJOA 3RXCA 1JWTA 3T28A 4FUBA 3A81A 4JZEH 2L6OA 4JCNA 4B74A 3RDZA 1O5GH 1J14A 2ZPRA 1SGCA 3QN7A 1FN8A 2C8ZB 3SBKA 3E3TA 2GCHG 3GCHB 2XXLA 1EFRD 2OBOA 3SQEE 5FHTA 3DHKH 3FKSD 3WY8A 1EXFA 1A0LA 1GVZA 5EXNA 4NIYA 2AHME 5EGMA 4IC6A 1GJ5H 4IN1A 2OCVB 2BYAX 3SO3A 4NZLA 3A7TA 5TJXA 1F5RA 2ESTE 2GX4A 3FP8E 3B8JA 3E90B 3BEUA 1S82A 4CRAA 1O34A 2PKAB 1GBJA 1H9HE 1BMLA 1TNHA 4BNRA 4IN2A 1GCDA 1TX8A 2P59A 1QIXB 2BX3A 2EY4C 4TPIZ 1LTOA 1SGTA 3RXGA 4X1RU 2QA9E 5AVDA 3LGWA 3UREA 2Y82A 2XCNA 2V3MA 2TGTA 2CHAC 3V7TA 1SLVB 3BIVH 3LOXA 3HATH 1C1SA 4CR9A 2FS8A 1YCPK 1P09A 1Y3XA 3LC5A 1ZPBA 4YOGA 5T6GA 3RXJA 2BZ6H 4INHA 2AH4X 4I8GA 4HFPB 4Y8ZA 1ACBE 2FZZA 3M3SA 3NKKA 1GBAA 2C8WB 1ZTKA 1CA0B 4VGCC 1PPGE 1MD8A 3P8OA 2BD4A 2AIPA 2ODYB 4Y10E 1QTFA 5J4SA 3H09A 3HKJB 1XUKA 1BTZA 4CRGA 2O8MA 2XW9A 4FUGA 3ATIA 1TBQH 4Y11E 1FPHH 2ZGBH 1C5YB 1Z1IA 1NFXA 2KCOA 1O3PB 1O5BB 5DP4A 1S6FA 3FN8A 4ZAEA 4ZKSU 2SGDE 1LDTT 3M5MA 1YM0A 5LPEA 1C5WB 3SU3A 1UCYE 2BDAA 1GMHF 3GY6A 3A80A 2PGQB 5DG6A 1TGNA 2BXUH 3UOUA 5HKKD 1TMBH 1RJXB 1LVOA 1XUJA 2WPHS 2B7DH 1BTUA 1P10A 1GHZA 2AEIH 1GBLA 1WUNH 2ODPA 1AI8H 1HAVB 1Y8TA 2ZFSA 4AGKA 1LPKB 1AUTC 1ZZZA 1W14U 1Z6EA 2XBVA 1MTUA 3BTQE 4ZMAH 1KSNA 2OP9A 3F0PA 2VB0A 2YMSB 2PTNA 2ZFRH 3KN2A 1D6WA 1T7CA 5ETXA 1E1QD 1YPJH 1P2QA 2BVRH 2ZP0H 2A4GA 3PLPA 4Q7YA 1C4Y2 4Q2KA 2UUYA 4KTCA 3HK3B 3GY2A 1BT7A 3URCA 8KME2 1INCA 2QXHA 2QF0A 1DY9A 1K1JA 4OGYA 1TGSZ 3TLOA 4F49A 1MAYA 5DP9A 1NTPA 1ZMJA 2Z3EA 1F0RA 1HB0B 2VINA 3VB3A 5ESTE 4YTAA 4RT1A 3F2FA 3BTKE 4K1SA 4WY3A 3ZZ8A 1T4UH 2V3OH 5K0HA 1FY1A 1JBUH 1OWKA 2J97A 2TGAA 2ALPA 1KDQB 3MNSA 2OC7A 4I86A 3F68H 6ESTA 1BCUH 1Z8JB 2PV9B 1BTHH 5GPIB 2KCAA 1D3PB 3P95A 4X6PA 3S69A 4IMQA 3N7EA 2BD2A 3SJ9A 2TRMA 2IN2A 2WV9A 2W3KA 2XNIA 3OFND 4JYUH 2OBQA 3UTUH 3ATLA 1AY6H 1O2VA 2PFEA 1MABB 1F7ZA 1RTLA 1TB6H 4B71A 1ELTA 2FTMA 2GCTB 1KLTA 2YNAA 2PKAA 3M5NA 2HRVA 2OC1A 1QURH 2ODQA 1S6HA 2G4TA 4BTTB 1W3CA 4WXIA 1QBOA 3DUXH 3OYPA 1ZMNA 2B0FA 1Q31A 3MTYA 5LH8A 1SMFE 3C27B 2FOAA 3KHVA 2F9BH 4Y6DA 1L1NA 2JJ2D 4UEHH 1VJ9U 1SLUB 1DLKB 1P12E 1QA0A 2O8UA 1IQEA 1RIWC 1RXPA 2Q6DA 1DWEH 2FYQA 2ZHDA 2V6NA 4ABBA 1BTWA 3I78A 2XNDD 1J9CH 3MU4A 3WW7A 1O35A 3GYMA 4BAMB 1L0ZA 3A89A 2BLWA 5SGAE 2VVCA 3ZV8A 4JK5A 1ESBA 1ID5H 1OX1A 1S0RA 2GMTC 1KXCA 1A0HB 1GI5A 1PQ7A 1HXEH 2L74A 5GNDA 1ESAA 1TLDA 5DPAA 4BTUB 4R8TB 1JOUB 2A4QA
chains in the Genus database with same CATH topology
2OC0A 3FZDA 3MH5A 1YLDA 2BD3A 2YOLA 3BEFB 3LJOA 3Q00A 5JBTA 2KCPA 2BDIA 1MU6B 3RXVA 3BTDE 1YKTA 1VJAU 1KMHB 1GJCB 3MH7A 1YLCA 4MNVA 4X1SU 1C2JA 1EZQA 1TPPA 1WQSA 2ZCLP 3Q3KA 4AFZA 4X2XA 4DURA 1O2IA 3GY5A 3EA7A 1O3EA 1OOKB 1JMOH 1DLEA 1HAHH 4F4OC 3V12A 1SI5H 1KTSB 1TMTH 2KCYA 1BMFD 1YP9A 1UTJA 2V3HH 1HAVA 1ZGIA 2Y6TA 2BDCA 1C1TA 2ANKH 1O2OA 5ABWA 1QQUA 3NXPA 3TNTA 1EAWA 5DP5A 4ISIH 1C2HA 5AHGH 3TIUA 4XDEA 3PV5A 3OY5U 3TJNA 1UCYH 5DP7A 4LXBH 1FPCH 4AG1A 3VPKA 1VCPA 2WYJA 1TIOA 3GS9A 1Z8IB 5BRRE 1MKWH 4WWYA 1MKXH 2HNTE 2UUJB 1HLTH 1WTHD 1W13U 1RS0A 1IQKA 3PB1E 2BHGA 5HM9A 5A0BA 2VIOA 1DY8A 4AOQA 3PROA 1LHEH 1O2YA 1RTFB 5A09A 2HPPH 1DSUA 3F9HA 3PMAB 3EYDA 1EATA 1F92A 3GCNA 2R3YA 1KDQA 3URDA 1UTQA 1P2NA 2BX4A 4ZUHA 3NPSA 2R2WU 3F2HA 1MH0A 2UWLA 2GGVB 1K1LA 4X6MA 1GI3A 5FPSA 2FYRA 2UUKB 4Y0ZE 1K1MA 2A1DB 2A7JA 3VB7A 3SGAE 1FNIA 2P16A 2BM2A 1GL1A 1OYQA 1C1PA 4X8VH 1Y5BT 4A7IB 1C5OH 1Y3UA 2V7QD 3P17H 2PTCE 3OX7U 1LMWB 3OTJE 1ZYOA 4E7NA 1BTYA 3KIDU 3RP2A 3RXFA 1BBRE 3KNXA 3HGPA 2GDDA 2WPLS 4UD9H 1HJAB 3ATWA 4CR5A 4BTIB 2A7CA 2AS9A 1O3BA 1N8OB 1THSH 1NC6A 2ZG0H 3E0PB 2K1QA 2RCEA 1GHYH 1BA8B 5EXLA 1PYTD 1C2LA 3RXQA 3T29A 1L4ZA 2YNBA 4ABEA 1AFQC 4FUJA 4CHAB 1HAYB 1NRNH 1MBMA 1BQYA 3A7XA 3ZVCA 1VITG 3ZYDA 2BD5A 2ZHQH 3FAOA 2I6SA 8GCHG 1P2JA 9LPRA 5IK2D 1SGFA 1NZQH 3F1SB 5C3NA 2PUQH 3SV8A 1O2MA 4K1EA 6CHAC 2NWNA 3RMMH 4B1TA 4I8KA 3EA9A 1CHOG 2Y7XA 1C5UA 1K2I1 3E8LA 1S5SA 3F6UH 1BRBE 1NT1A 1SGEE 2GZ9A 3SZNA 1SB1H 2D26C 4B6EA 4GCHG 1ELFA 2EI8A 4GSOA 2FX6A 5EG4A 1GI7B 3RC5A 1C1UH 1SC8U 2XC5A 4D9RA 2SGEE 1V2RT 3RLWH 2VH0A 1ZSJA 2FTLE 2B9LA 1P2OA 4AYVB 4ABDA 4FUFA 1C1WH 2BTCE 1KXBA 1DSTA 3A7VA 2JIZD 1BJVA 3K6ZA 1O3NA 4OS4A 2BY6X 5I25A 2J38A 2Y81A 1BIOA 1OP2A 2BOHB 9ESTA 4I7YH 3WWFA 3P8FA 1AZ8A 1LPZB 1UJ1A 2ZIQH 3NK8A 3P8GA 3A7ZA 1DWCH 1QGFA 1ESTA 1A2CH 2D2DA 3KL6A 1TNJA 4O3UA 3TVJB 2J94A 2K0QA 3B23B 3UR6A 1OHHD 4Z1MD 2CV3A 4Y8YA 4ABFA 5DK1A 4JYTA 3QTVH 3RMLH 2P3FH 3RXSA 1XXDA 4LOYH 1PQAA 2GKVE 1QRZA 2XC4A 1HAXB 4FUHA 4GVUA 2K8IA 2XOKD 2VIDA 1YPEH 5CE1A 3PLKA 1S83A 2A32A 4NCYA 3TGIE 3NUMA 4WVPE 3LDXH 3ATKA 1QB6A 1V2JT 2ZTZA 3UWJH 1K21H 1KLJH 1G3DA 2XBXA 3RU4D 1OP0A 1PQ5A 1A61H 1SSXA 1YF4A 1GJ4H 1V3XA 2BDYA 2GTBA 3TGJE 1OSSA 1P8VC 4YT6H 3RXDA 1UVPA 3U9AH 3SW2B 4WMEA 2STAE 1HUTH 2C8XB 2SGPE 3BG4C 4NIVA 1MQ5A 1PYTC 2BD9A 2FMJA 3GYLB 4YOIA 4ZKNU 3V3MA 1GJ9B 1HBTH 1SQAA 1BHXF 2WV4A 4NIWA 4OS2A 1UHBB 3F9GA 4BAKB 2WUBA 3U1IB 2FLRH 3RM0H 5EPYA 4I8JA 3BSQA 1HPGA 2G55A 2H5CA 2NU1E 3FP7E 1CHGA 5T1VA 4CBOA 3MU0A 2NU4E 4CRFA 2W6ID 2GVFA 3SU1A 4NWLA 1YBWA 4DW2U 1C5MD 1TX7A 5PTPA 2TPIZ 2HWLB 4ZROA 4Y76A 1ZPZA 1FONA 4X1QU 1C5LH 1DE7H 2Z3CA 2ZDAH 3EDXB 1PPBH 1THRH 4ASHA 4CRDA 1TWXB 1CA8B 2F3CE 4J1YA 3U8OH 1EQ9A 3N7DA 2B8OH 2RA3A 3LGVA 2VJ1A 3VB6A 1RTKA 4X2WA 1P3EA 1V2PT 1D3TB 1SGNE 2R9PA 3ESTA 1GBEA 5LPFA 1MTVA 1O2PA 1VGCB 4NSVA 4BANB 3GDVA 4X0WU 2ZFTA 2HNTC 1HAGE 1GHWH 2ZFQH 3P6ZB 1VITF 3STJA 1BBRH 4MDSA 4BAQB 4NFFA 1NESE 1NY22 3S9AA 5A0AE 8GCHF 2ZU5A 1WYKA 2R0KA 1C2DA 1HV7A 5A0CA 2GV7A 5FPTA 5HMAA 1SBWA 1BHXB 3A83A 1HCGA 3JZ2B 5CHBA 1DXPA 1NU9A 3SJKA 3TH2H 4AB9A 2ZCKP 1NBMD 1OWEA 1TRNA 2EA3A 3NZIA 4MQAA 2FOHA 1CHOF 1SOTA 4IBLH 1SQOA 1MUEB 3A8CA 2BLVA 4GCHF 2KR7A 1BTPA 3ZZ5A 1GHAG 1ANEA 4Q7XA 2CK3D 2FOMB 2HNTF 2SGFE 4H4FA 1V2OT 1SG8B 1UCYK 1KYNA 1GI1A 1QRXA 3SYJA 3AAVA 2F91A 4NG9H 3MH6A 2BDBA 2QY0B 4SGAE 3EGKH 3VB5A 1MU8B 1J16A 4IMZA 1MKWK 1MKXK 1O2SA 4WH8A 2WPDD 1MMJN 3MNXA 3Q3XA 1OWJA 1C2EA 4DGJA 1NFYA 4ISHH 1AB9C 1HRTH 1TOMH 1DFPA 2F9UA 1QJ1B 1PPFE 1HAIH 2Q1JA 2FOEA 1FIWA 4M7GA 1CBWB 2BB4A 1W0ZU 1G37A 1V2WT 2GD4B 1SOZA 1QL7A 3SZEA 1UMAH 3DFJA 2F83A 1O32A 3LPRA 2ZHWH 1EPTC 1DOJA 2BY5X 1DDJA 3LC3A 2AMPA 1L1GA 1TQ7B 2FDAA 1QQ4A 5C5NA 3GY3A 1EUFA 1T32A 2WV5A 1JXPA 1TFXA 2PKSC 4KP0A 2F9PA 2LELA 5I46H 2HOBA 2ZWLH 5AFYH 1BOQA 1TBZH 1ETRH 1A4WH 2P95A 1Y3YA 1GJDB 4AORA 2G52A 2VBCA 1AKSB 3RXPA 1W0JD 4YLQH 4YLUA 3QLPH 1TYNA 1ZJDA 1C5XB 2J92A 1C5NH 2H9TH 2PUXB 4AFUA 3Q76A 2Z3DA 5T3HA 1PPCE 1V2LT 1WSSH 1E79D 2C8YB 4K8BA 3SORA 1C5ZB 1A5HA 2A0QB 1H1BA 3A7YA 2HPQH 3ZZ4A 1F0UA 3IG6B 3KQCA 1UHBA 2QV1A 1OXGA 4TT3D 1QRWA 3TK6A 1P2MA 3MI4A 1CGHA 4Z0KA 2QF5A 4ZHLU 2ZF0H 1P2KA 1G3BA 1ARCA 1DICA 4NFEA 2TGDA 2F4LA 3GCTG 1A46H 5EQQA 1E37B 1OWHA 3BTFE 3PMJA 1HDTH 2M5TA 3QGJA 2FOFA 4HTCH 2IPHA 5LGOA 4ZCNA 2OK5A 4Q4LA 1GL0E 4K8YA 3ZVAA 1GMDF 3FVFB 1ANDA 1O3LA 2CHAB 4UFGH 5AF9H 2QF4A 1AB9B 1TABE 3SU4A 1AVGH 1T31A 4ZHMU 3TJUA 4R0IA 3STIA 4M9FA 2SGAA 1P0SH 4GUXA 4LK4A 2JH0D 3ODDA 4RN6A 5IYTA 1YPHC 1ZLRA 2OINA 3ELAH 1DWBH 1D6RA 2GCHF 3FOAA 1DT2A 1C2KA 1EPTB 1P2IA 4VGCB 2WHXA 1WAYB 1A1RA 2BY8X 2UWPA 2ILNA 4E7RG 1LVBA 1LO6A 1CU1A 1SQTA 1AIXH 1O3KA 1FLEE 1SLXB 4U2WA 1X7AC 1AGJA 3RXAA 4AYYB 4ABHA 1HAPH 1B7XB 2ZI2H 1EKBB 4OS5A 3T5FH 3D23A 1LPGB 4YO9A 1HYLA 2QXJA 4A6LA 1BB0B 1ELAA 1NFUA 3VXFH 1SFQB 1YC0A 5CHAC 1UO6A 4OS1A 1HIAB 1EJNA 1UVTH 4B2BA 1GHAF 1P9SA 1O2KA 1EJAA 3VEQB 4Y79A 4TY6A 5FBIA 1LHDH 3ZZ9A 1GHVH 3OSYA 4X8SH 1DM4B 3KF2A 1TNGA 4GHQA 2J34A 2QXIA 3OEED 1AVWA 3QZQA 4UFFH 1O2ZA 1LKAA 3WWBA 2QCYA 4OS6A 3AW0A 4U30A 3PMHB 5FL7D 4FUCA 1UVUH 2ANYA 3BTTE 4Q63A 1YYY1 3UFAA 7KMEH 3OTPA 1GBDA 1IQIA 3T62A 4JZDH 1MTWA 1AHTH 1OPHB 1SGPE 1P57B 4FU9A 1P04A 1SVPA 4K69A 1ZTLA 4JZIA 4YZUA 3LJJA 1IQGA 3RXRA 4A1VA 1S81A 3U8RH 1AU8A 1FZZA 1IQJA 3MO9A 2KAIB 2ZFFH 1THPB 1E34B 3M7QA 4UDWH 1CGJE 3L6PA 2BLQA 3VGCC 1G3EA 1TPAE 1W12U 5IDKA 1LQDB 1QB9A 3GOVB 2FODA 1T4VH 3DSOA 1KXDA 1TGTA 1Z6JH 2VWLA 1O5DH 1ETSH 1BRCE 1AE8H 1O3CA 1UTNA 2VGCC 1WTGH 3M7UA 2RA0A 4Y8XA 2G5VA 1Y5UT 3UUZA 1O2XA 2ZU1A 2ZPQA 1O3GA 1QFKH 1EZUC 1SKYE 3QTOH 1FUJA 2G81E 3RM2H 1LHCH 1O2RA 4ABGA 3Q77A 3KQDA 2O9QA 1NU7B 1ZR0A 3MNBA 1V6DA 3V13A 1C5PA 1N1LA 1AQ7A 2ZC9H 1C2IA 1YGCH 1BBRK 3PV2A 1WU1A 4Y7BA 3GY8A 3NWUA 4ZHAA 3SGBE 1DUEA 2SFAA 3ZV9A 1RD3B 2Z9KA 5A2MH 5C17A 2TGPZ 2BDGA 2HALA 1QCPA 3GCTF 3KQEA 1AO5A 5E2OA 5K7RA 1Y3VA 3C1KA 3CS0A 3TITA 1GJ6A 1RIWB 1FY8E 4NGAH 4NA9H 3ZVDA 4I33A 4LZ1H 1VR1H 1H4WA 1BUIA 4D7FA 1TRYA 5FPYA 3UNRA 1T8LA 1ELGA 3VG8A 1GCTC 2OC8A 2OQ5A 1O3JA 3EA8A 4TWWA 4AX9H 2GMTB 2FWWA 3ZZ7A 3T27A 3M3VA 4Y7AA 4OS7A 1YCPM 2OXSA 3TNSA 4JZ1A 2DE8A 1S6LA 3UB0A 2HLCA 2ZU4A 4HI3A 3S7HB 1O5CB 4D76A 5E0JA 1FMGA 1BZXE 4FVBA 5E0GA 2ZECA 5JB9S 1NRPH 1DXWA 2QXGA 1KXEA 1LKBA 3RLYH 3SNDA 4SGBE 1KY9A 2H9HA 3LKWA 2FOBA 3RXOA 3RU4E 5AFZH 4ZH8A 5JPMH 1SGIB 2G00A 4JMYA 2ZGHA 5EPNA 5F6MA 2HLDD 4NIXA 3O8CA 5T6FA 1MZAA 5FBEA 4DY7B 2HGTH 2OLGA 4ISOA 5F8ZA 5FXLA 1HIAA 2BLOA 3SU5A 5DO4H 4B6FA 2J95A 4NZQA 3U98H 1FDPA 1GBBA 2FS9A 2CMYA 3QZRA 3N99A 3RMNH 3AASA 1TA6A 3M5LA 3QGNB 5A8XA 5L2YH 1C1OA 4UE7H 3A82A 1UK2A 3RC4A 1C4U2 4IC5A 4D9QA 4TWYA 4B75A 1L1JA 1TBRH 1UTPA 4AB8A 2JJ1D 5DKMA 1XUFA 2A4RA 1O2WA 2WYGA 4TYDA 2WSSD 2VWOA 3QX5H 2Y80A 1H9LB 4MVNA 4I8LA 1A5GH 1C5SA 3P70B 1C1QA 4E05H 1J8AA 3SNCA 5JBCS 3ZZCA 4K3JA 4HZHA 2FXRA 1NM6A 4KELA 3E1XB 2C90B 2C93B 4D8NA 3UNSA 1SHYA 3OAAD 2QYIA 3ZYEA 1E38B 3G01A 1GWAA 3RXUA 1H8ED 2Q6FA 5GDSH 3U8TH 1C2FA 1C5RA 3L3TA 2WINI 5JYIA 1OWIA 1ZHRA 2KAIA 2VH6A 3PMBB 5J4QA 2O8WA 4OGXA 2ANMH 5EQSA 5CMXH 4TY7A 3SHAH 3FANA 3GCOA 1F5LA 3UY9A 1VCQA 4NSYA 1H8HD 1XKAC 1WV7H 1FAKH 3ENSB 2A2XH 2A5KA 1OP8A 1ORFA 1SPJA 1Z71A 3LGTA 3SI4H 2G5NA 5EXMA 2JH6D 1TRMA 1XMNB 3A86A 1NBME 4GHTA 2AMQA 2ZCHP 3SN8A 1O5EH 2C4FH 3SJ8A 3UWIA 2BQWB 2BY9X 2FLBH 3ZZAA 2EI7A 3LGUA 4I32A 3U69H 3FZZA 1C1VH 1NPMA 1GBHA 3DCLA 1HFDA 1ARBA 2XTTB 1O39A 3KQBA 1HXFH 2XBYA 3HGNA 1VITH 3GCHC 2AFQB 3EQ0H 3SNAA 1YPHE 2YMSD 3UPEA 1BRAA 2NU3E 1TA2A 3A8DA 1AFQB 3ZZ3A 1FY3A 1JRSA 4K5ZA 2B5TB 2PR3A 2I6QA 4BAOB 4UONA 1IQHA 1O3FA 2BDHA 3MYWA 5E0HA 1EP5A 3F2GA 1EX3A 2FO9A 2FPZA 1Z8GA 2CJIA 1C9PA 3PM3A 6CHAB 3SU2A 1ZRBA 3F3BA 4B76A 1GMHG 1T8OA 2ZQ1A