2OUAA

Crystal structure of nocardiopsis protease (napase)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
188
structure length
188
Chain Sequence
ADIIGGLAYTMGGRCSVGFAATNASGQPGFVTAGHCGSVGTQVSIGNGRGVFERSVFPGNDAAFVRGTSNFTLTNLVSRYNSGGYATVSGSSTAPIGSQVCRSGSTTGWYCGTIQARNQTVSYPQGTVHSLTRTSVCAEPGDSGGSFISGTQAQGVTSGGSGNCRTGGTTFYQEVNPMLNSWNLRLRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine protease
publication title Structural and mechanistic exploration of Acid resistance: kinetic stability facilitates evolution of extremophilic behavior
pubmed doi rcsb
total genus 47
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ouaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ouaA01
1IOEA 2Z9IA 1Y5UT 2A32A 4A92A 2QXIA 5T3HA 5LPRA 1CA8B 4MG3A 2NU0E 2P59A 3Q3KA 1GHYH 1AQ7A 3SBKA 1C5NH 1OS8A 1UVOA 3RC6A 2ZHEH 2FESH 3RU4D 4KKDA 5EOKA 3GYMA 5LPEA 4I8GA 4IC5A 4DY7B 1QRXA 1C1WH 1DDJA 5DKMA 1G3CA 1V2UT 5C20A 5C5OA 3UWIA 2J2UA 4X6PA 4Z6AH 1AB9B 2VH0A 1TGCA 3LGUA 4WWYA 2WPMS 4WXIA 3P6ZB 1F0TA 1AE5A 4HTCH 4UE7H 3S9AA 2UUYA 4AZ2B 5I46H 1O2MA 2BMGB 3EA9A 3TJOA 2ZU5A 3A85A 1PPZA 1DXPA 2XC5A 2G00A 4X2WA 1Z71A 1C5PA 1MBQA 4Y71A 1FNIA 2PW8H 2J9NA 2Z9GA 5L2ZH 1P05A 1V2KT 1GBDA 2WPJS 4DOQA 5DP3A 5E0HA 3SV7A 1Z7KA 1NFWA 1ANBA 1TPAE 3SQEE 3TU7H 4ZH8A 2CGAA 1GI9B 1PYTD 1BBRK 1C1QA 1EAUA 2DE9A 1O3GA 1CHOG 2XBYA 3HKJB 3D62A 1PPHE 3W95A 1ANCA 1SFIA 2V3HH 1AI8H 4BTIB 2VJ1A 2BDAA 2UWOA 3ESTA 3A87A 1W8BH 4CH8B 3ODFA 4UFGH 1LPGB 2A7HA 3A7YA 3M7QA 1GDNA 4ZKRU 5FAHA 3LGVA 2G8TA 4ASHA 2EI8A 1HAPH 4AG2A 1YGCH 1GBKA 3E0PB 2Y6TA 1WQSA 1SGRE 3E1XB 2Z9JA 2ZDMA 1TX6A 3PM3A 5A09A 1LHGH 1C2HA 2PSXA 1O3NA 3TIUA 1GI6A 3QZRA 1DY9A 3EAJA 1NROH 2EA3A 1WAYB 2PKSB 1LQEA 3OY5U 5DP4A 5T6GA 2ZZUH 1K1MA 4Z0KA 1SGIB 2ZHDA 5G4BA 1Y3YA 4NFFA 3BTFE 3TK5A 1GHVH 3UR9A 1Y3VA 2BOHB 2PLXA 4FUCA 1N8OB 3TGJE 1CGJE 1V2RT 2BVXH 1D4PB 1DLEA 3VXEH 5JBCS 2A4GA 4IGDA 1OPHB 2Q6DA 1GBBA 2BDBA 1NS3A 3UY9A 2A7CA 1LKAA 2GV7A 4MPXA 2BD5A 4X1SU 5CMXH 2BM2A 4AB8A 1A2CH 4ZHMU 1J14A 3RXGA 1AVWA 2ANMH 4FUHA 1IQIA 4H6SB 2ZHWH 2QF0A 1PPFE 1E38B 1TA6A 1DE7H 1BA8B 2P3TB 3TLOA 3EE0B 2P8OC 2ZU3A 2QY0B 3QTOH 5F8XA 2XC4A 3P70B 3ZVFA 3KGPA 3RLWH 2A1DB 1YBWA 1SBWA 1TX7A 4Y7BA 1JRTA 5DPAA 5C67A 1QGFA 2SGAA 1HAVA 1TQ7B 5A0CA 2V6NA 1FIZA 1GI1A 1LDTT 4ABFA 1UTOA 2ZDKA 1GI3A 1AO5A 1VITG 2P94A 3ZVGA 1VJ9U 3HATH 3MU4A 8ESTE 1QRZA 1OWDA 1C5LH 2FOBA 2VWMA 3A8DA 1T8NA 3SGAE 5GPIB 2ZFSA 1DSTA 1A5GH 4UFDH 3ZZ4A 4A1VA 3V0XA 3KQBA 1HAGE 1L0ZA 1FMGA 1ZPZA 1TONA 4ZUHA 2QAAA 2UUJB 1K21H 2TPIZ 1EZQA 3H7TA 4JCNA 1H8DH 2BLWA 2KAIA 2O8MA 3T28A 3E0NB 1A4WH 1IQHA 3RXEA 2W5EA 4K1EA 1HXFH 1AUJA 3U9AH 2QA9E 5HYOA 3U1JB 3B8JA 1P0SH 1MU8B 1ABIH 2ZHFH 3ZVAA 1MTUA 1YC0A 2ZDLA 1DY8A 2VWNA 1EJMA 1GJBB 4BXWA 1ARBA 1ZHRA 4K60A 2ZFPH 2ZECA 2GMTC 4E06H 1VR1H 1PJPA 3C1KA 3PWCA 4AFZA 3SU2A 3A7WA 3MO6A 1CA0C 1EXFA 2FWWA 2GX4A 3SHAH 1KDQA 4OS6A 1MQ6A 1HB0B 1GMCG 1AIXH 2F9NA 1DUAA 5LPFA 2FDAA 4DVAU 1O3OA 2P93A 4IN2A 4X8UH 1FJSA 2W26A 1WBGB 1MQ5A 1BUIA 1NU7B 3LT3A 2HNTC 3MO3A 2OD3B 3SV6A 3WY8A 2BLOA 2HNTE 1OX1A 3M36A 2OTVA 1O2UA 3BG4B 1SGDE 4XDEA 2VB0A 1VCQA 1C5YB 1EKBB 5L2YH 4GHQA 2QXJA 2Y82A 1DM4B 3V7TA 4OS1A 3ZZ7A 4O3UA 3SOSA 4Y7AA 4A7IB 3VB3A 1ZTKA 1HXEH 2AIQA 1O3MA 1TPPA 1BCUH 1PQ8A 2GZ7A 2YNBA 4X6NA 1WOFA 1TGNA 3RXUA 1LO6A 2C8ZB 3TGKE 1GI5A 3S0NA 1O3CA 1S6HA 4INKA 4GVUA 3T26A 5ESBA 4YZUA 2D2DA 3RUOA 4JZIA 2ZIQH 1YCPM 1BT7A 1L4ZA 1ZOMA 2EI6A 1P2NA 1C2FA 1GBFA 2Z3DA 4XFQA 1BRAA 2CHAC 1DWCH 3FP7E 1JMOH 1Y3XA 4F49A 1TYNA 4U2WA 1JRSA 5C2ZA 1HIAB 1O37A 3LU9B 1KXBA 1NFUA 2Z3EA 3RXDA 1QJ6B 2ZQ1A 5CHAC 2O8TA 3A84A 3GCNA 2TGAA 3RDZA 2G51A 1KXCA 2A0QB 3AW0A 3DFLA 4AFSA 2YOLA 3MH7A 1RTFB 2PV9B 5EXLA 1T4VH 1WSSH 3O8CA 1O36A 1U6QA 1QL9A 4DT7B 4DIIH 1ESBA 4OGXA 1H9HE 1OWEA 1AWHB 1G36A 1Y59T 2VINA 5FCRA 1HCGA 4ZXXH 2Y5FA 1GMDG 1HYLA 1SG8B 1MAYA 3NWUA 3BTKE 3M3VA 3TNSA 1WTHD 5FX6A 4VGCC 4GSOA 3MH4A 4U30A 2Y80A 1BTXA 3F6UH 3T2NA 1P57B 3V12A 2QIQA 2UUFB 1TOCB 4B76A 1W11U 2O8WA 2FOCA 1RTKA 4E7RG 2XRCA 1O2GH 4CBOA 2Z94A 1ZSLA 2UWLA 1RIWB 1O2NA 5EXMA 4B2BA 2NU3E 2TGDA 5BRRE 1O33A 4JZEH 2HPQH 5GDSH 1FUJA 4Y11E 1GJDB 2FIRH 3BIUH 2SNWA 3URCA 3E8LA 1GJ7B 4GLYA 4GCHF 1TRYA 1IQKA 2FYRA 2VU8E 1ARCA 1QBOA 1X7AC 1O2TA 2LPRA 1QY6A 1C4U2 2BQWB 1AFEH 2PKAB 4AB9A 5E2OA 1JXPA 2XBXA 2ODYB 1RTLA 5GCHF 1OYTH 1ZGVA 3RXTA 6ESTA 4RN6A 1DICA 1AN1E 5AVDA 2ASUB 1TWXB 3L3TA 2AMQA 5TCAA 4FUEA 1O0DH 1FPHH 3M7UA 3MH6A 1OP8A 5EXNA 2GZ9A 1GVKB 3MI4A 2VVCA 1DUEA 1FDPA 4OS2A 3TPIZ 1DVAH 2FX4A 3SU0A 1LMWB 3VGCB 3VXFH 5JB8S 1D3TB 3LKWA 1BMLA 3GYLB 2RCEA 2FOHA 1C1OA 5HM2A 3ZZAA 2PHBA 4I8LA 3EYDA 1P2MA 3AAVA 1GJ4H 3SNCA 1HAZB 4CR9A 3ITIA 2R0LA 2PFEA 4NGAH 3AAUA 4XBDA 1FPCH 1K1IA 3T62A 4Q2KA 3RMOH 1FN8A 1Q3XA 3U98H 2VH6A 1SGCA 1CGHA 5JDUB 2ZGJA 1B7XB 4TY7A 1EATA 1BITA 1GCTB 1V2QT 3KL6A 3MHWU 5E8EH 1P12E 3VB7A 3HK3B 1P09A 1E37B 2F9OA 2WYJA 5GXPA 2XNIA 1C5SA 3VEQB 1HGTH 4MQAA 1C1PA 1LVYA 1K1NA 4R8TB 1ZLRA 2TRMA 3RXJA 4AFUA 5GWZA 1OWHA 2WINI 5F03A 3GY7A 3FP6E 3K2UA 5GIBA 2PWXA 4WF8A 2BLVA 1P06A 1O3AA 1L1GA 2H2ZA 1UHBA 2SGDE 4KTSA 3LH3A 3ZV8A 2OLGA 3SU1A 1BBRE 3MWIU 4LZ4B 3TH2H 3BTDE 1DWBH 4X8TH 1YP9A 1N8OC 1NRRH 1QTFA 2A4QA 5B6OA 1ZHPA 1HJ9A 3RU4T 3ZVCA 1O5FH 2FX6A 1XUFA 2B0FA 3Q3XA 3SUEA 2PGBB 3RXAA 2RA0A 1MKWH 3H5CB 4ABDA 1FLEE 2OC7A 1TGBA 4Y8ZA 3BIVH 4AGKA 4XE4A 1HRTH 1VZQH 2F9BH 2BY7X 1W7XH 1SGPE 1H8IH 1EJNA 1ELEE 4IN1A 4CH2B 3TJUA 4B2CA 1PPCE 1EP6A 1C5OH 1MBMA 1A5IA 3CS0A 1EAXA 3I77A 1O5BB 3SUGA 5CHAB 1LHDH 4KTUA 4MNXA 1F5KU 5LGOA 1TRNA 1HNEE 5T6FA 2HWLB 2WPHS 1UJ1A 1GJ9B 3LGIA 2FPZA 4BAMB 1G3BA 3A82A 3CP7A 2ZKSA 1NZQH 2XWBI 1Y8TA 4Y79A 1O2VA 1ESTA 1HPGA 2ALPA 1MKXH 4GAWA 5FPYA 2FTMA 3A7TA 2BVSH 1TMUH 5EU8A 4UFFH 3RXSA 2FOFA 1AHTH 1DWDH 2BDIA 3E90B 1P3CA 1O32A 1W14U 2BB4A 1SHHB 2WPIS 1RJXB 1UTJA 4BAOB 4ABGA 5DP9A 6GCHF 1NC6A 3GCOA 4O03A 3QZQA 1KLJH 3B9FH 2TBSA 1C4V2 4X1QU 2TGPZ 1ETSH 1XKBC 1HAXB 2ZP0H 7GCHG 2ESTE 3HKIB 5DG6A 2G5NA 3SJ8A 1AZZA 1ZJKA 1MUEB 4ISHH 1UTNA 5FBIA 3UIRA 2VNTA 3UNRA 4BTUB 4I31A 1ELFA 2ZO3H 3ZYDA 3GCTG 1Z8GA 3RXKA 3F68H 1QHRB 1C4Y2 2AGIX 2V3OH 1FZZA 1AFQB 3LH1A 4JYTA 2XBWA 5C5NA 1Y5BT 2ZI2H 1K22H 1ZZZA 1GDQA 1E34B 4JK5A 4HFPB 1HFDA 1EOJA 2WUCA 3SU5A 1RXPA 3UOPA 2HALA 1GL1A 1QB1A 3TITA 2HPPH 1VCPA 1TQ0B 4RSPA 1O30A 2ALVA 4B73A 3UR6A 2M5TA 2QXGA 1ELAA 3BV9B 4YOGA 4BTTB 3KF2A 3UFAA 3N7OA 1BRCE 1JWTA 2GCHG 2NWNA 2ZU4A 4WJG2 3ZZ8A 1RS0A 1SGYE 1VJAU 2AGGX 1GI2A 1MTSA 2EEKA 3PWBA 2G81E 2DUCA 1Y3UA 1S0QA 3BG4C 2BXTH 1W7GH 2FZZA 2P3UB 1G3DA 3PYHA 3M7TA 1CHOF 1GBJA 5JBAS 2H1UA 2C90B 4WY3A 5JB9S 3PLKA 4I7YH 1GBLA 3E3TA 2RDLA 5ABWA 3UTUH 2WV4A 1C5ZB 2CMYA 1W0YH 3QN7A 4X6OA 3U8TH 1CT4E 4WMEA 1KSNA 2OUAA 4D76A 4LZ1H 1DWEH 3RM2H 2BX3A 1J17T 2WYGA 1C2GA 3STJA 7LPRA 3TH3H 3SO3A 2F91A 1CBWB 5FXLA 3NXPA 4WMDA 2H9EH 5JYIA 1IAUA 3PV4A 3QDZB 2IN2A 4OS4A 2FI5E 1SOTA 5E0GA 1SGQE 4HI3A 3LOXA 3MNXA 1DFPA 1G37A 2H6MA 3KN2A 2SFAA 1C5XB 1GMHG 6CHAB 2GZ8A 4TPYA 4MNVA 1FONA 4NCYA 1NRPH 1P3EA 2A4OA 3SJOA 2ZU1A 2C3SA 2BQ6B 3RMMH 7KMEH 3S7KB 1GWAA 1O2IA 2BQ7B 4ZXYH 5ETXA 4KTCA 1UVTH 1BIOA 1SLXB 2F9VA 4MPUA 4DG4A 4MLFB 4O3TA 1O2HA 1O3FA 1ZPBA 2GDDA 4K69A 1V2PT 2F9PA 2WPKS 1YPGH 4KP0A 3QLPH 2BDGA 2QYIA 3ZZ6A 2Z3CA 1LKBA 3GY3A 1V3XA 1S85A 3GY5A 1TBZH 1T4UH 1QURH 5A2MH 1FY3A 3RXCA 3ZZDA 1UVSH 1T7CA 2EC9H 1F2SE 1IQMA 1BJUA 1RIWC 3MYWA 2BLQA 2BY8X 3LGTA 3S69A 1G9IE 4ESTE 1Y5AT 1J9CH 1ACBE 1GDUA 1LHCH 1LHEH 2A4RA 3SI3H 2JH5D 1VITF 5DP8A 1V2WT 4FUBA 1SL3A 3I29A 1CHGA 1ZHMA 2Z9LA 3W94A 5C3NA 3UQVA 3M35A 5K0HA 4TYDA 4ABAA 1T8OA 2BVRH 3K6YA 2FP7B 3IITA 1B0EA 1P11E 2ZPRA 1SFQB 1SC8U 1QR3E 1W3CA 1S5SA 3NPSA 3MOCA 3VFEA 1N6XA 1SMFE 1UTMA 2AFQB 1UMAH 3BEFB 1DT2A 1T8LA 2VIPA 3V3MA 2OCVB 3G01A 1BMMH 1XUIA 2FTLE 4UD9H 3SU3A 7ESTE 2BYAX 4CRBA 5HXFA 4ZKSU 1UVUH 4K8YA 1BBRH 3TJVA 3ZVBA 3QTVH 1C1VH 1O2XA 2FOMB 2ZPQA 2ANWA 3RXBA 3AASA 1O3JA 3T29A 1AMHA 2OINA 1P2OA 1D9IA 3O8RA 2ZTZA 3QUMP 4GUXA 1OOKB 3VGCC 1Z6JH 2PUXB 3F9GA 4TPIZ 1ZMJA 4IC6A 4NWKA 4PROA 3BTQE 4KGAA 1AGJA 1FV9A 3A80A 1P2KA 4X8SH 2HLCA 4JYUH 1NESE 2H9TH 3QK1A 3GCHC 4ABJA 2CF9H 2PTCE 1VCWA 1QBVH 1K1LA 4DW2U 1GL0E 3BF6H 1T32A 1V2JT 4QT8C 1ELTA 4MVNA 1TE0A 1GCTC 1D6RA 1BTHH 1QIXB 5EODA 1K1PA 3ODDA 1YM0A 3PMBB 1GMCF 2IJOB 3B23B 2BOKA 5DP5A 3AVZA 3KQCA 3NK8A 1B5GH 1ELGA 3P92A 1C1UH 2ZHQH 3RM0H 1A3EH 1EQ9A 3ATLA 2FS9A 2R0KA 1GHZA 3I78A 3LC5A 1AKSB 4FUDA 3GDSA 3PROA 1C1TA 3O8BA 3LGWA 3DA9B 3GY8A 2QXHA 5DP7A 3SUDA 1GHAG 3EDXB 3HGPA 1QB9A 1TIOA 1JIMA 3EA7A 3QX5H 4XOJA 1LCYA 1GI7B 2YNAA 3A89A 3BTHE 3SW2B 3AW1A 1DPOA 1SQAA 1MTWA 3GISB 1ELVA 1L1JA 3HK6B 4MPWA 1G3EA 3ZVEA 2Z7FE 5AHGH 2XW9A 2C8XB 1GHXH 4OS5A 1KXDA 5IDKA 3MH5A 2G55A 1MZAA 2Y5HA 4K1SA 1EPTB 1O2QA 1Q31A 4YM9A 2P16A 1GJ5H 2H5DA 1V2OT 3BTEE 1FY1A 4X8VH 1O39A 4RKJB 2ZCLP 3SGBE 2DE8A 1C2MA 1EZUC 1P9SA 2ZFRH 1AUTC 1C1RA 4DCDA 3RXHA 1EB1H 1YPHC 2VIQA 1KXFA 2ANKH 2ZDAH 3GY6A 2Z6BD 1YPHE 3K9XB 1JIRA 4FUJA 3GY4A 2VIVA 4NIVA 1IQJA 2I6SA 1SI5H 1ZYOA 3GOVB 4WH6A 3SJIA 1GMDF 2P3FH 4D9QA 1ZGIA 1O2SA 1XM1A 3TK6A 1MZDA 1H4WA 4UONA 3IG6B 4NWLA 1BDAA 4D8NA 2CV3A 5FPTA 2V0BA 2VGCC 1C1SA 1XVOA 1QQUA 2AERH 1G30B 4DURA 2JH0D 2Y7ZA 2ULLA 1YCPK 1O2ZA 3EGKH 3GDVA 1ANDA 3QWCH 1VGCB 4ABEA 1MTNB 2O8LA 1UCYK 5L6NH 1BTZA 1K1OA 4B75A 1C9TA 4AYVB 1BZXE 2A2XH 1TAWA 4K2YA 1H9IE 4Q7XA 5T6DA 1PPBH 4D7FA 1WCZA 4NIYA 1O34A 1TPOA 1F92A 1MMJN 3A8AA 1WTGH 2NU2E 3BEUA 3MO9A 1P2QA 1AFQC 1TLDA 1ETTH 2XC0A 3PO1B 3ENSB 4AGJA 1PQ7A 3BTWE 1SVPA 3PB1E 1HJ8A 4YO9A 4R0IA 2B9LA 5EPYA 3LJOA 1SGTA 2P95A 5EG4A 4IS5A 1TNHA 3ELAH 4Y8YA 5DK1A 1BHXB 5FHTA 2SGFE 1G2MA 3RU4E 3LGYA 1IQGA 1BHXF 1MTVA 1YPLH 1IQNA 1C5WB 3MTYA 4B71A 2ZWLH 4FUGA 1XVMA 2QC2A 1RFNA 4FVDA 1D6WA 3SUFA 1CQQA 1OP0A 1SLUB 3LDXH 1ESAA 1QCPA 4HGCA 3GCHB 1V2LT 1D3PB 1O5EH 3MMGA 2CJIA 5EW1H 2Z9KA 1HAYB 4I8JA 3RXOA 1F5LA 1UVPA 2ZQ2A 1UTPA 3BN9A 2AEIH 1MCVA 1C2KA 1G32B 1ZTLA 1O3HA 2ODPA 3ATKA 4ISNA 4Y0YE 4XSKU 1LQDB 4ISOA 1L2EA 5E0JA 2GTBA 1THSH 3P8FA 4I8HA 1KTSB 1HIAA 3P95A 3O8DA 4AG1A 4J2YB 3A88A 4SGAE 4SGBE 3LC3A 2FI3E 1PYTC 1FAKH 2ZTYA 3DHKH 3E6PH 1ELCA 3FZZA 1TNIA 2AYWA 5J4QA 3K6ZA 1IHTH 1FQ3A 1XUHA 8LPRA 1E36B 1EASA 4FUFA 3LJJA 1KXEA 1FAXA 3ZZBA 1CBWC 1LTOA 1P04A 3UNSA 3SORA 3SZNA 1YF4A 1TABE 4TWYA 1O2RA 3SNEA 1QA0A 1QBNA 2FS8A 1YPEH 2J34A 5EQSA 2GP9B 2V35A 1O3KA 3DUXH 1GJ8B 4DJZB 1DITH 1Z8RA 4UDWH 1A3BH 1ELDE 2JH6D 3IWMA 6CHAC 2AIPA 3V13A 3SU4A 1QJ1B 2UUKB 1ZSJA 2FXRA 2ZF0H 3NZIA 1TNJA 3K65B 3PMJA 3SJ9A 4CRFA 2LNCA 3GY2A 1HJAB 2VVUA 3KEEA 2ZGCA 1J8AA 1GCDA 1TB6H 4INHA 2W7SA 1S6FA 2D26C 3NUMA 2G4UA 4U01A 4AORA 1TALA 2QGRA 3RXVA 4E05H 2PSYA 2RG3A 1TNLA 1Y3WA 4NZLA 1C2EA 1EP5A 1CSOE 4WVPE 1J16A 3Q3YA 3D49H 1SGEE 4BOHA 2R3YA 4NA7A 4B74A 1C1MA 2BD3A 2XTTB 5FBEA 2CF8H 2OBQA 4K3JA 4LXBH 1CE5A 1QA7A 2PKAA 2OP9A 2ODQA 1EAWA 2IPHA 2JETB 5TJXA 1EB2A 2ZNKH 2FOEA 3FP8E 1SOZA 1F0SA 3SU6A 1YLDA 2ANYA 3H7OA 5EGMA 4LK4A 1FY5A 3P8GA 3SNAA 5F8TA 2B8OH 2ZGBH 4CRDA 3SV2H 1KYNA 1ZMNA 3A7VA 3RXPA 1SHYA 1TOMH 2ZFQH 2OQUA 2VGCB 3UNQA 4FU9A 1DXWA 5FPSA 8GCHG 1GHWH 4OS7A 3PTNA 4NG9H 1GVLA 4ABHA 5H4IB 4E7NA 1KTTB 2UWPA 7GCHF 3JZ1B 1O2WA 2QF3A 2J4IA 1T8MA 4YLUA 3RMNH 2ZEBA 3DFJA 1ZRKA 5HM9A 3ZYEA 1UK4A 1KLTA 1V6DA 3VB6A 1NO9H 3RP2A 1O2KA 1CT2E 4IMZA 2Y81A 4NZQA 1C5QA 2QCYA 3GCTF 5DGJA 2XBVA 1O2JA 1WUNH 1V2ST 2ZU2A 3SV8A 4ZROA 1TMTH 2OC8A 1TBQH 2BD2A 2AH4X 2JKHA 1AD8H 4OGYA 2TIOA 1A7SA 3M5OA 1ETRH 1C2LA 2R2WU 2BD4A 1LVBA 2ZC9H 2A5AA 1O2YA 1GBAA 1JOUB 4CRCA 2GCTB 3KCGH 3ZZ3A 1ZTJA 3JZ2B 4K1TA 1HDTH 3S7HB 3GDUA 4F4OC 5DO4H 1P9UA 4H42U 1ZJDA 1HAIH 2BXUH 5EW2H 1S81A 5A0AE 1PPEE 1HAVB 1KY9A 1DS2E 2G4TA 1UTQA 2W3KA 4NA8A 5C1UA 2ZGXH 2G52A 3RC5A 4MNYA 1O3LA 3VB4A 1LVMA 2BZAA 3P8OA 2PTNA 1YYY1 3ATWA 2J95A 1J15A 2Q6FA 1GPZA 1YLCA 2GCHF 3UUZA 1A1RA 1OSSA 8KME2 4CHAB 4M7GA 6LPRA 2C8WB 2O9QA 1O5CB 3ATIA 4CR5A 2WUBA 4D9RA 3EA8A 1F0UA 2STBE 4ZKNU 3TH4H 4B1TA 1BB0B 1SGFA 2RA3A 1GJAB 4X6MA 1YKTA 5A8XA 4YLQH 1A0JA 2G5VA 1EZSC 1UTKA 2GV6A 3BTME 2KAIB 1M9UA 5A8YA 3A7ZA 3NKKA 2ZDNA 2AMDA 4BAKB 1EAIA 1NT1A 2HVXA 1IQLA 4AN7A 3PMHB 5DJ7A 3S9CA 4B2AA 1YPMH 4DIHH 1AY6H 1FI8A 1N1LA 4NIWA 3ZV9A 4AOQA 2ZFFH 1W12U 2OQ5A 1PQAA 1NRSH 1EPTC 2FEQH 1W0ZU 3KQEA 1Z8IB 1HLTH 1BRBE 3QO6A 4IBLH 4A1XA 5JBTA 1L4DA 4GPGA 1O35A 3OTJE 3VB5A 2ZFTA 2OXSA 1KDQB 2K1QA 1GMHF 3RXMA 1GG6C 3TGIE 2ZTXA 4FVBA 1W13U 1Z6EA 4MNWA 2AMPA 2BDHA 1QFKH 1SQTA 4FU7A 1AVXA 4A5TS 5LH8A 4AFQA 2PGQB 1MD7A 1SPJA 1O3EA 1HBTH 1DANH 1GGDB 1UK3A 1QNJA 4GHTA 1SQOA 1GVZA 2OC1A 2I6QA 1OWIA 4NFEA 3UPEA 1NFXA 2HOBA 2Q6GA 3SGQE 3SQHE 5K7RA 1CGIE 4INLA 4U32A 4CBNA 1XXDA 3R3GB 1F5RA 1CVWH 4CREA 1SLVB 3A86A 3HPTB 1XX9A 1PPGE 1QL7A 3KHVA 2BY6X 1FY8E 4BAQB 5A0BA 1TX8A 4MTBA 1GBHA 4X0WU 1TA2A 3CS7A 1C2JA 1IHSH 1VGCC 2NU4E 1MTNC 4ABIA 1V2TT 1C1NA 2FI4E 2FLRH 3DT0H 4A1TA 1CU1A 1OYQA 1BOQA 1QB6A 1RD3B 1MU6B 2Q1JA 2GVFA 2QN5T 4NSYA 3LIWA 3PO1C 1GJ6A 1Q2WA 2HGTH 1IQFA 4DGJA 2FM2A 4RKOB 3RXFA 1HAOH 1L1NA 1RGQA 1P10A 4HZHA 4X2XA 1P2IA 1D3DB 3L33A 4YTAA 1XUKA 3BSQA 2C4FH 1ID5H 1MAXA 3PLBA 3TK9A 3DD2H 1UCYE 5A8ZA 3KNXA 1GI8B 1ZPCA 1O3PB 1K9OE 3OU0A 1DX5M 3SNDA 2ZGHA 2TGTA 3A8BA 1LPZB 1EOLA 1TFXA 1TRMA 4JZDH 3T25A 1O2LA 2FLBH 1NPMA 3E91A 1KIGH 1DSUA 1W2KH 4AX9H 3UWJH 2A31A 3PLPA 1OXGA 3D23A 4NIXA 4O97A 2BD8A 4YOJA 4Y6DA 2WPLS 3M61U 1AE8H 3S9BA 2HRVA 1CT0E 3M3SA 1MD8A 1GBMA 1EZXC 2SGPE 1B0FA 4BXSA 9ESTA 1AWFH 2BD9A 1YPJH 2OC0A 1OKXA 2FYQA 1EUFA 1A0HB 3P17H 4X2VA 1DOJA 1SB1H 1Z1IA 4Q7YA 1XXFA 3RMLH 1VITH 2D1JA 2THFB 1K28D 3RC4A 1CO7E 1C2DA 3Q00A 1TGSZ 3RXLA 1HV7A 2F9UA 3SN8A 3VPKA 4IMQA 1GHAF 2XYAA 5L30H 1TMBH 2D8WA 3OYPA 1KLIH 1C5UA 1LPKB 1KXAA 2BDYA 1IQEA 1O5DH 3U69H 1C9PA 3GICB 1WV7H 5AFYH 3STIA 2BD7A 1HJAC 1MCTA 5EQQA 4CRAA 3LPRA 1BMNH 3LONA 1NM6A 1NY22 2B7DH 2W7UA 2A2QH 5C1YA 1TNKA 4Y0ZE 1ELBA 2GGVB 4Y76A 2SGEE 4LOYH 1NTPA 4THNH 5JPMH 1TBRH 2O8UA 3SNBA 5F6MA 3MU0A 4ZKOU 2VIDA 1O3IA 3ZVDA 1OWJA 4YT6H 3TJNA 3RLYH 4Q80A 2AGEX 4WXVA 1GG6B 4JZ1A 2Y5GA 1ZR0A 3MNCA 4K5ZA 1XUJA 3T27A 1P8VC 1A46H 2JETC 4Q7ZA 1E35B 3A83A 2VVVA 1Z8JB 3ZZ9A 4FU8A 2ZPSA 1K1JA 2STAE 2IOTA 1LHFH 5AF9H 5CE1A 1UHBB 4NA9H 1C5MD 4CRGA 1O3DA 1BTPA 2Y7XA 1P01A 1FIWA 1S82A 1O38A 2R9PA 4JK6A 1QL8A 2SNVA 2C93B 5HMAA 1F7ZA 1MH0A 1S84A 2SGQE 3A8CA 3HGNA 4K8BA 1SLWB 4FXGH 2VIWA 2XXLA 1O31A 2ZCKP 4TWWA 1V2MT 3U1IB 1C2IA 1BQYA 1H9LB 4I32A 2GD4B 2P8OB 1MKWK 2BDCA 4ZHLU 5E2PA 5HGGA 4UFEH 2CN0H 2B5TB 3KQDA 1JBUH 2J92A 1NFYA 2BY9X 3RXIA 1OWKA 3NCLA 1H1BA 4WMFA 1TNGA 1BTYA 2F3CE 3QGNB 3UOUA 1DLKB 2GCTC 3FANA 3A7XA 2ZCHP 1AU8A 4XBCA 5FCKA 3OY6U 4GCHG 3MNSA 1NU9A 4JYVH 4WH8A 2GKVE 1BRUP 1AKSA 5ESTE 4JMYA 1WYKA 5FX5A 4A6LA 5PTPA 2BHGA 1AB9C 1OP2A 5TCCA 5GCHG 3F9EA 4BNRA 1UO6A 3R0FA 5EQRA 4I8KA 1C5TA 4X1RU 5AFZH 3QGJA 4YT7H 1ANEA 2GDEH 4X1NU 5F8ZA 3RXQA 1MKXK 1A5HA 2BZ6H 1GI0A 1K2I1 4XBBA 3T5FH 4CHAC 4D7GA 3TNTA 3M5NA 2XCFA 2GT7A 3M5LA 3M3TA 3FAOA 4H4FA 3RXRA 2PR3A 4ISIH 2VIOA 4YOIA 2BY5X 1XUGA 1EX3A 4O9VA 2R2MB 1EPTA 2GMTB 2FODA 9LPRA 4BAHB 4NSVA 4ZMAH 1E0FD 4BANB 1BTWA 1A61H 3FVFB 1THRH 1GBEA 1O2PA 2NU1E 3F9HA 5C1XA 1P02A 4ZHAA 1CA0B 1BJVA 2A7JA 3KIDU 1P03A 2R3UA 1F0RA 1AZ8A 1S83A 1RRKA 1ZRBA 3BEIB 2VWLA 1XKAC 2A45B 3SHCH 1SR5C 2BTCE 1O5AB 1AVGH 3Q77A 3OSYA 5GJ4B 2ILNA 2FOGA 5IYTA 2W3IA 4X1PU 1LVOA 1UK2A 4Y10E 2FO9A 2H9HA 1HUTH 2HNTF 1BMAA 2ZDVH 5DP6A 3F9FA 1O5GH 2QV1A 3FFGA 1W10U 4FUIA 1ZSKA 2PKSC 3ZZCA 5J4SA 4ISLA 1WU1A 3A81A 4H6TA 2XWAA 1FN6A 1YCPH 4X2YA 4Y8XA 5BPEA 1NRNH 3MU5A 1C5RA 2ZG0H 1YPKH 1GGDC 1GJCB 5EPNA 1SSXA 1UCYH 1QQ4A 1BTUA 1TGTA 1TPSA 3TVJB 3E16B 2VWOA 2EI7A 2XCNA 1QRWA 3C27B 1ABJH 2WV5A 2GT8A 1FY4A 1T31A 2OBOA 3UREA 1GHBG 3U8OH 1A0LA 1G2LA 1PFXC 1GHBF 2BX4A 5JBBS 2CHAB 3BTGE 1FXYA 1NRQH 1SGFG 4YESB 3ZZ5A 1NN6A 2FMJA 1PQ5A 4KELA 4IW4E 3MFJA 1GBIA 4AYYB 3U8RH 1ORFA 5I25A 1GI4A 2AS9A 3D65E 3M37A 2A5KA 3CENA 3PMAB 3L6PA 1V2NT 3UQOA 1SGNE 1Z1JA 3FZDA 1P2JA 3SJKA 2J38A 2CXVA 1S0RA 1HAHH 1O2OA 1N6YA 1GBCA 3F1SB 4TY6A 3SV9A 3BTTE 4UEHH 4MPVA 3URDA 1O3BA 3PTBA 3P8NA 2J94A 1V2VT 3MU8A 1WQVH 3M5MA 1ZMLA 1GBTA 1D3QB 4ZAEA 8GCHF 3BG8A 2PUQH 1XMNB 5SGAE 2F83A 2ZA5A 3Q76A 3EQ0H 2FOAA 2A5IA 2H5CA 3OX7U 4VGCB 3MNBA 1QJ7B 1C5VA 3MU1A 1THPB 1INCA 4JZFH 4J1YA 6GCHG 4MDSA 3ATMA 1UTLM 2C8YB 3SI4H 4ABBA 1EJAA 4I33A
chains in the Genus database with same CATH superfamily
1IOEA 2Z9IA 1Y5UT 2A32A 4A92A 2QXIA 5T3HA 5LPRA 1CA8B 4MG3A 2NU0E 2P59A 3Q3KA 1GHYH 1AQ7A 2KX4A 3SBKA 1C5NH 1OS8A 3DSPA 1UVOA 3RC6A 2ZHEH 2FESH 3RU4D 4KKDA 1EFRD 5EOKA 3GYMA 5LPEA 4I8GA 4IC5A 4DY7B 1QRXA 1C1WH 1DDJA 5DKMA 1G3CA 1V2UT 5C20A 5C5OA 3UWIA 2J2UA 4X6PA 4Z6AH 1AB9B 2VH0A 1TGCA 3LGUA 4WWYA 2WPMS 4WXIA 3P6ZB 2HVYB 1F0TA 1AE5A 4HTCH 4UE7H 3S9AA 2UUYA 4AZ2B 5I46H 1O2MA 2BMGB 1NBMD 3EA9A 3TJOA 2ZU5A 3A85A 1PPZA 1DXPA 2XC5A 2G00A 4X2WA 1Z71A 1C5PA 1MBQA 4Y71A 1FNIA 4XD7D 2PW8H 2J9NA 1H8HD 2Z9GA 5L2ZH 1P05A 2CK3D 1V2KT 1UW7A 1GBDA 2WPJS 4DOQA 1BMFD 5DP3A 5E0HA 3SV7A 1Z7KA 1NFWA 1ANBA 3NRLA 1TPAE 3SQEE 3TU7H 4ZH8A 2CGAA 1GI9B 1PYTD 1BBRK 1C1QA 1EAUA 2DE9A 1O3GA 1CHOG 2IPQX 2XBYA 3HKJB 3D62A 1PPHE 3W95A 1ANCA 1SFIA 2V3HH 1AI8H 4BTIB 2VJ1A 2BDAA 2UWOA 3ESTA 3A87A 1W8BH 4CH8B 3ODFA 4UFGH 5KECA 1LPGB 2A7HA 3A7YA 3M7QA 1GDNA 4ZKRU 5FAHA 3LGVA 2G8TA 4ASHA 2EI8A 1HAPH 4AG2A 1YGCH 1GBKA 3E0PB 2Y6TA 1WQSA 4OM9A 1SGRE 3E1XB 2Z9JA 2ZDMA 1TX6A 3PM3A 5A09A 1LHGH 1C2HA 2PSXA 1O3NA 3TIUA 1GI6A 3QZRA 1DY9A 3EAJA 1NROH 2EA3A 1WAYB 2PKSB 1LQEA 3OY5U 5DP4A 2XOKD 5T6GA 2ZZUH 1K1MA 4Z0KA 1SGIB 2ZHDA 5G4BA 1Y3YA 4NFFA 3BTFE 3TK5A 1GHVH 3UR9A 1Y3VA 2BOHB 2PLXA 4FUCA 1N8OB 3TGJE 1CGJE 1V2RT 2BVXH 1D4PB 1DLEA 3VXEH 2IJD1 5JBCS 2A4GA 4IGDA 1OPHB 2Q6DA 1GBBA 2BDBA 1NS3A 3UY9A 2A7CA 1LKAA 2GV7A 2KCOA 4MPXA 2BD5A 4X1SU 5CMXH 2BM2A 4AB8A 1A2CH 4ZHMU 1J14A 1K0HA 3RXGA 1AVWA 2ANMH 4FUHA 1IQIA 4YXWD 4H6SB 2ZHWH 2QF0A 1PPFE 1E38B 1TA6A 1DE7H 1BA8B 2P3TB 3TLOA 3OE7D 3EE0B 2P8OC 2ZU3A 2QY0B 3QTOH 5F8XA 2XC4A 3P70B 3ZVFA 3KGPA 3RLWH 2JDID 2A1DB 1YBWA 1SBWA 1TX7A 4Y7BA 1JRTA 5DPAA 5C67A 1QGFA 2SGAA 1HAVA 1TQ7B 1SQRA 5A0CA 2V6NA 1FIZA 1GI1A 1LDTT 4ABFA 1UTOA 2ZDKA 1GI3A 1AO5A 3N7DA 1VITG 2P94A 3ZVGA 1VJ9U 3HATH 3MU4A 8ESTE 1QRZA 1OWDA 1C5LH 2FOBA 2VWMA 3A8DA 1T8NA 3SGAE 5GPIB 2ZFSA 1DSTA 1A5GH 4UFDH 5C0TA 2KCAA 3ZZ4A 4A1VA 2VBCA 5GNDA 3V0XA 3KQBA 1HAGE 1L0ZA 1FMGA 1ZPZA 1TONA 4ZUHA 5DN6D 2QAAA 2UUJB 1K21H 2TPIZ 1EZQA 3H7TA 4JCNA 2EQNA 1H8DH 4ZCNA 2BLWA 2KAIA 2O8MA 3EE7A 3T28A 3E0NB 1A4WH 1IQHA 3RXEA 2W5EA 4K1EA 1HXFH 1AUJA 3U9AH 2QA9E 5HYOA 3U1JB 4F48B 3B8JA 1P0SH 1MU8B 1ABIH 2ZHFH 3ZVAA 1MTUA 1YC0A 2ZDLA 1DY8A 2VWNA 1EJMA 1GJBB 4BXWA 1ARBA 1ZHRA 4K60A 2ZFPH 2ZECA 2GMTC 4E06H 1VR1H 1PJPA 3C1KA 3PWCA 4AFZA 2HLDD 3SU2A 3A7WA 3AK5A 3MO6A 1CA0C 1EXFA 2FWWA 2GX4A 3SHAH 3OTPA 2XNDD 4P02A 1KDQA 4OS6A 1MQ6A 1HB0B 1GMCG 1AIXH 3F3BA 2F9NA 1DUAA 5LPFA 2FDAA 4DVAU 1O3OA 2P93A 4IN2A 4X8UH 1FJSA 2W26A 1WBGB 1MQ5A 1BUIA 1NU7B 3LT3A 2HNTC 3MO3A 2OD3B 3SV6A 3WY8A 2BLOA 2HNTE 1OX1A 3M36A 2OTVA 1O2UA 3BG4B 1SGDE 4XDEA 2VB0A 1VCQA 2WSSD 1C5YB 1EKBB 5L2YH 4GHQA 2QXJA 2Y82A 1DM4B 3V7TA 4OS1A 3ZZ7A 2LELA 4O3UA 3SOSA 4Y7AA 4ACAA 4A7IB 3VB3A 1ZTKA 1HXEH 2AIQA 1O3MA 1TPPA 1BCUH 1PQ8A 2GZ7A 2YNBA 4X6NA 1WOFA 1TGNA 3RXUA 1LO6A 2C8ZB 3SYJA 3TGKE 1GI5A 3S0NA 5IK2D 1O3CA 5FL7D 1S6HA 4INKA 4GVUA 3T26A 5ESBA 4YZUA 2D2DA 3RUOA 4JZIA 2ZIQH 1YCPM 1BT7A 1L4ZA 1ZOMA 2EI6A 1P2NA 1C2FA 1GBFA 2Z3DA 4XFQA 1BRAA 2CHAC 1DWCH 3FP7E 1JMOH 1Y3XA 4F49A 1TYNA 4U2WA 4B6FA 1JRSA 5C2ZA 1HIAB 3OEED 1O37A 3LU9B 1KXBA 1NFUA 2Z3EA 3RXDA 1QJ6B 2ZQ1A 5CHAC 2O8TA 3A84A 4AC9A 3GCNA 2TGAA 3RDZA 2G51A 1KXCA 2A0QB 3AW0A 3DFLA 4AFSA 2YOLA 3MH7A 1RTFB 2PV9B 5EXLA 1T4VH 1WSSH 3O8CA 1O36A 1U6QA 1QL9A 4DT7B 4DIIH 1ESBA 4OGXA 1H9HE 1OWEA 1AWHB 1G36A 1Y59T 2VINA 3PV5A 1HCGA 5FCRA 4ZXXH 2Y5FA 1GMDG 1HYLA 1SG8B 1MAYA 3NWUA 3BTKE 3M3VA 3TNSA 1WTHD 5FX6A 4VGCC 4GSOA 3MH4A 4U30A 2Y80A 1BTXA 3F6UH 3T2NA 1P57B 3V12A 2QIQA 2UUFB 1TOCB 4B76A 3W1EA 1W11U 2O8WA 2FOCA 3SZEA 1RTKA 2GJGA 4E7RG 2XRCA 1O2GH 3OFND 4CBOA 2Z94A 1ZSLA 2UWLA 1RIWB 1O2NA 5EXMA 4B2BA 2NU3E 2TGDA 5BRRE 3WWBA 1O33A 4JZEH 2HPQH 5GDSH 1FUJA 2M2AA 4Y11E 1GJDB 2FIRH 3BIUH 2SNWA 3URCA 3E8LA 1GJ7B 4GLYA 4GCHF 1TRYA 1IQKA 2FYRA 2VU8E 1ARCA 1QBOA 1X7AC 1O2TA 2LPRA 1QY6A 1C4U2 2BQWB 1AFEH 2PKAB 4AB9A 3U28C 5E2OA 1JXPA 2XBXA 2ODYB 1RTLA 5GCHF 1OYTH 1ZGVA 3RXTA 6ESTA 4RN6A 1DICA 1AN1E 5AVDA 2ASUB 1TWXB 3L3TA 2AMQA 5TCAA 4FUEA 1O0DH 1FPHH 3M7UA 3MH6A 1OP8A 5EXNA 2GZ9A 1GVKB 3MI4A 2VVCA 1DUEA 1FDPA 4OS2A 3TPIZ 1DVAH 2FX4A 3SU0A 1LMWB 3VGCB 3VXFH 5JB8S 1D3TB 4XRNA 3LKWA 1BMLA 3GYLB 2RCEA 2FOHA 1C1OA 5HM2A 3ZZAA 2PHBA 4I8LA 3EYDA 1P2MA 3AAVA 1GJ4H 3SNCA 1HAZB 4CR9A 3ITIA 2R0LA 2PFEA 4NGAH 3AAUA 4XBDA 1FPCH 1K1IA 3T62A 4Q2KA 4RT0A 3RMOH 1FN8A 1Q3XA 1SKYE 3U98H 2VH6A 1SGCA 1CGHA 5JDUB 2ZGJA 1B7XB 4TY7A 1EATA 1BITA 1GCTB 1V2QT 3KL6A 3MHWU 5E8EH 1P12E 3VB7A 3HK3B 1P09A 1E37B 2F9OA 2WYJA 3FKSD 5GXPA 2XNIA 1C5SA 3VEQB 1HGTH 4MQAA 1C1PA 1LVYA 2J5UA 1K1NA 4R8TB 1ZLRA 2TRMA 3RXJA 3N99A 4AFUA 5GWZA 1OWHA 2WINI 5F03A 3GY7A 3FP6E 3K2UA 5GIBA 2PWXA 4WF8A 2BLVA 1P06A 1O3AA 1L1GA 2H2ZA 1UHBA 2SGDE 4KTSA 3LH3A 3ZV8A 2W6JD 2OLGA 3F2HA 3SU1A 1BBRE 3MWIU 4LZ4B 3TH2H 3BTDE 1DWBH 4X8TH 1YP9A 2KR7A 1N8OC 1NRRH 1QTFA 2A4QA 5B6OA 1ZHPA 1HJ9A 3RU4T 3ZVCA 1O5FH 2FX6A 1XUFA 2B0FA 2WV9A 3Q3XA 3SUEA 2PGBB 3RXAA 2RA0A 1MKWH 3H5CB 4ABDA 1FLEE 2OC7A 1TGBA 4Y8ZA 3BIVH 4AGKA 4XE4A 1HRTH 1VZQH 2F9BH 2BY7X 1W7XH 1SGPE 2OK5A 1H8IH 1EJNA 1ELEE 4IN1A 4CH2B 3TJUA 4B2CA 1PPCE 1EP6A 1C5OH 1MBMA 1A5IA 3CS0A 1EAXA 3I77A 1O5BB 3SUGA 5CHAB 1LHDH 4KTUA 4MNXA 1F5KU 3KYGA 5LGOA 1TRNA 1HNEE 5T6FA 2HWLB 2WPHS 1UJ1A 1GJ9B 3LGIA 2FPZA 4BAMB 1G3BA 3A82A 3CP7A 2ZKSA 3OEHD 1NZQH 1YY3A 2XWBI 1Y8TA 4Y79A 1O2VA 1ESTA 1HPGA 2ALPA 1MKXH 3DSGA 4GAWA 5FPYA 2FTMA 3A7TA 2BVSH 1TMUH 5EU8A 4UFFH 3RXSA 2FOFA 4FETA 1AHTH 1DWDH 2BDIA 3E90B 1P3CA 1O32A 1W14U 2BB4A 1SHHB 2WPIS 1RJXB 1UTJA 2J98B 4BAOB 4ABGA 5DP9A 6GCHF 1NC6A 3GCOA 4O03A 4M9FA 3QZQA 1KLJH 3B9FH 2TBSA 1C4V2 4X1QU 2TGPZ 1ETSH 1XKBC 1HAXB 2ZP0H 7GCHG 2ESTE 3HKIB 5KEDA 5DG6A 2G5NA 3SJ8A 1AZZA 1ZJKA 1MUEB 4ISHH 1UTNA 5FBIA 3UIRA 2VNTA 3UNRA 4BTUB 4I31A 1ELFA 2ZO3H 3ZYDA 3GCTG 1Z8GA 3RXKA 3F68H 1QHRB 1C4Y2 2AGIX 2V3OH 1FZZA 1AFQB 3LH1A 4JYTA 1KMHB 2XBWA 2JJ2D 5C5NA 1Y5BT 2ZI2H 1K22H 1ZZZA 1GDQA 1QZ8A 1E34B 4JK5A 4HFPB 1HFDA 1EOJA 2WUCA 3SU5A 1RXPA 3UOPA 4F55A 2HALA 1GL1A 1QB1A 3TITA 2HPPH 1VCPA 1TQ0B 4RSPA 1O30A 2ALVA 4B73A 3UR6A 5C17A 2M5TA 2QXGA 1ELAA 3BV9B 4YOGA 4BTTB 3KF2A 3UFAA 3N7OA 1BRCE 1JWTA 2GCHG 2NWNA 2ZU4A 4WJG2 3ZZ8A 1RS0A 1SGYE 1VJAU 2AGGX 1GI2A 1MTSA 2EEKA 3PWBA 2G81E 2DUCA 1Y3UA 1S0QA 3BG4C 2BXTH 1W7GH 2FZZA 2P3UB 1G3DA 3PYHA 3M7TA 1CHOF 1GBJA 4HG6A 3WW7A 5JBAS 2H1UA 2C90B 4WY3A 5JB9S 3PLKA 4I7YH 1GBLA 3E3TA 2RDLA 5ABWA 3UTUH 2WV4A 1C5ZB 2CMYA 1W0YH 3QN7A 4X6OA 3U8TH 1CT4E 4WMEA 1KSNA 2OUAA 4D76A 4LZ1H 1DWEH 3RM2H 2BX3A 1J17T 2WYGA 1C2GA 3STJA 7LPRA 3TH3H 3SO3A 2F91A 1CBWB 1FX0B 5FXLA 3NXPA 4WMDA 2H9EH 5JYIA 1IAUA 1E1RD 3PV4A 3QDZB 4FOUC 2IN2A 4OS4A 2FI5E 1SOTA 5E0GA 1SGQE 4HI3A 3LOXA 3MNXA 1DFPA 1G37A 2H6MA 3KN2A 2SFAA 1C5XB 1GMHG 6CHAB 2GZ8A 4TPYA 4MNVA 1FONA 4NCYA 1NRPH 2W6ID 3ZIAD 1P3EA 2A4OA 3SJOA 2ZU1A 2C3SA 2BQ6B 3RMMH 7KMEH 3S7KB 1GWAA 1O2IA 2BQ7B 4ZXYH 5ETXA 4KTCA 1UVTH 1BIOA 1SLXB 2F9VA 4MPUA 4DG4A 2RFKC 4MLFB 4O3TA 2GDDA 1O2HA 1O3FA 1ZPBA 5CDFE 3N7EA 4K69A 1V2PT 2F9PA 2WPKS 1YPGH 4KP0A 3QLPH 2BDGA 2QYIA 3ZZ6A 2Z3CA 1LKBA 3GY3A 1V3XA 1S85A 3GY5A 1TBZH 1T4UH 1QURH 5A2MH 1FY3A 3RXCA 3CNRA 3ZZDA 1UVSH 1T7CA 2EC9H 1F2SE 1E1QD 1IQMA 1BJUA 1RIWC 3MYWA 2BLQA 2BY8X 3LGTA 3S69A 1G9IE 4ESTE 1Y5AT 1J9CH 1ACBE 1GDUA 1LHCH 1LHEH 2A4RA 3SI3H 2JH5D 1VITF 5DP8A 1V2WT 4FUBA 1SL3A 5HIZA 3I29A 1CHGA 1ZHMA 2Z9LA 3W94A 5C3NA 3UQVA 3M35A 5K0HA 4TYDA 4ABAA 1T8OA 2BVRH 3K6YA 2FP7B 3IITA 1B0EA 3H09A 1P11E 2ZPRA 1SFQB 1SC8U 1QR3E 1W3CA 1S5SA 3NPSA 3MOCA 3VFEA 1N6XA 1SMFE 1UTMA 2AFQB 1UMAH 3BEFB 1DT2A 1T8LA 2VIPA 3V3MA 2OCVB 3G01A 1BMMH 1XUIA 2FTLE 4UD9H 3SU3A 7ESTE 2BYAX 4CRBA 5HXFA 4ZKSU 1S6LA 1UVUH 4K8YA 1BBRH 3TJVA 3ZVBA 3QTVH 1C1VH 1O2XA 2FOMB 2ZPQA 2ANWA 3RXBA 3AASA 1O3JA 3T29A 1AMHA 2OINA 1P2OA 1D9IA 3O8RA 2ZTZA 3QUMP 4GUXA 1OOKB 3VGCC 1Z6JH 2PUXB 3F9GA 4TPIZ 1ZMJA 4IC6A 4NWKA 4PROA 3BTQE 4KGAA 1AGJA 1FV9A 3A80A 1P2KA 4X8SH 2HLCA 4JYUH 1NESE 2H9TH 3QK1A 3GCHC 4ABJA 2CF9H 2PTCE 1VCWA 1QBVH 1K1LA 2LP6A 3KYFA 4DW2U 1GL0E 3BF6H 1T32A 1V2JT 4QT8C 1ELTA 4MVNA 1TE0A 1GCTC 1D6RA 1BTHH 1QIXB 5EODA 1K1PA 3ODDA 1YM0A 3PMBB 1GMCF 2IJOB 2KFWA 3B23B 2BOKA 5DP5A 3AVZA 3KQCA 3NK8A 1B5GH 1ELGA 3P92A 1C1UH 2ZHQH 3RM0H 1A3EH 1EQ9A 3ATLA 2FS9A 2R0KA 1GHZA 3I78A 3LC5A 1AKSB 4FUDA 3GDSA 3PROA 1C1TA 3O8BA 3LGWA 3DA9B 3GY8A 2QXHA 5DP7A 3SUDA 1GHAG 3EDXB 3HGPA 1QB9A 1TIOA 1JIMA 3EA7A 3QX5H 4XOJA 1LCYA 1GI7B 2YNAA 3A89A 3BTHE 3SW2B 3AW1A 1DPOA 1SQAA 1MTWA 3GISB 1ELVA 1L1JA 3HK6B 4MPWA 1G3EA 3ZVEA 2Z7FE 5AHGH 2XW9A 2C8XB 5EJZA 1GHXH 2KCPA 4OS5A 1KXDA 5IDKA 3MH5A 2G55A 1MZAA 2Y5HA 4K1SA 1EPTB 1O2QA 1Q31A 4YM9A 2P16A 1GJ5H 2H5DA 1V2OT 3BTEE 1FY1A 4X8VH 1O39A 4RKJB 2ZCLP 3WWFA 3SGBE 2DE8A 1C2MA 1EZUC 1P9SA 2ZFRH 1AUTC 1C1RA 4DCDA 3GS9A 3PRDA 3RXHA 1EB1H 1YPHC 2VIQA 1KXFA 2ANKH 2ZDAH 3GY6A 2Z6BD 1YPHE 3K9XB 1JIRA 4FUJA 2F43B 3GY4A 2VIVA 4NIVA 1IQJA 2I6SA 1SI5H 1ZYOA 3GOVB 4WH6A 3SJIA 1GMDF 2P3FH 4D9QA 1ZGIA 1O2SA 1XM1A 3TK6A 1MZDA 1H4WA 4UONA 3IG6B 4NWLA 1BDAA 1YLNA 4D8NA 2CV3A 5FPTA 2V0BA 5CHBA 2VGCC 1C1SA 1XVOA 1QQUA 2AERH 1G30B 4DURA 2JH0D 2Y7ZA 2ULLA 1YCPK 1O2ZA 3EGKH 3GDVA 1ANDA 3QWCH 1VGCB 4ABEA 4B6EA 1MTNB 2O8LA 3UAIC 1UCYK 5L6NH 1BTZA 1K1OA 4B75A 1C9TA 4AYVB 1BZXE 2A2XH 1TAWA 4K2YA 1H9IE 3KQ5A 4Q7XA 5T6DA 1PPBH 4D7FA 1WCZA 4NIYA 1O34A 1TPOA 1F92A 1MMJN 3A8AA 1WTGH 2NU2E 3BEUA 3MO9A 1P2QA 1AFQC 1TLDA 1ETTH 2XC0A 3PO1B 3ENSB 4AGJA 1PQ7A 3BTWE 1SVPA 2YMSB 3PB1E 1HJ8A 4YO9A 4R0IA 2B9LA 5EPYA 3LJOA 1SGTA 2P95A 5EG4A 4IS5A 1H8ED 1TNHA 3ELAH 4Y8YA 5DK1A 1BHXB 5FHTA 2SGFE 1G2MA 3RU4E 3LGYA 1IQGA 1BHXF 4TT3D 1MTVA 1YPLH 1IQNA 1C5WB 3MTYA 4B71A 2ZWLH 4FUGA 1XVMA 2QC2A 1RFNA 4FVDA 1D6WA 3SUFA 1CQQA 2KM0A 1OP0A 1SLUB 3LDXH 1ESAA 1QCPA 4HGCA 3GCHB 1V2LT 1D3PB 1O5EH 3MMGA 2CJIA 5EW1H 2Z9KA 1HAYB 4I8JA 3RXOA 1F5LA 1UVPA 2ZQ2A 1UTPA 3BN9A 2AEIH 1MCVA 1C2KA 1G32B 1ZTLA 1O3HA 2ODPA 3ATKA 4ISNA 4Y0YE 4XSKU 1LQDB 4ISOA 1L2EA 5E0JA 2GTBA 1THSH 3P8FA 4I8HA 1KTSB 1HIAA 3P95A 3O8DA 4AG1A 4J2YB 3A88A 4SGAE 4SGBE 3LC3A 2FI3E 1PYTC 1FAKH 2ZTYA 3DHKH 3E6PH 1ELCA 3FZZA 1TNIA 2AYWA 5J4QA 3K6ZA 1IHTH 1FQ3A 1XUHA 8LPRA 1E36B 1EASA 4FUFA 1WDIA 1KXEA 3LJJA 1FAXA 3ZZBA 1CBWC 1LTOA 1P04A 3UNSA 3SORA 3PRBA 3SZNA 1YF4A 1TABE 4TWYA 1O2RA 3SNEA 1QA0A 1QBNA 2FS8A 1YPEH 2J34A 5EQSA 2GP9B 2V35A 1O3KA 3DUXH 1GJ8B 4DJZB 1DITH 1Z8RA 4UDWH 1A3BH 1ELDE 2JH6D 3IWMA 6CHAC 2AIPA 3V13A 3SU4A 1QJ1B 2UUKB 1ZSJA 2FXRA 2ZF0H 3NZIA 1TNJA 3K65B 3PMJA 4RI0A 3SJ9A 4CRFA 2LNCA 3GY2A 1HJAB 2VVUA 3KEEA 2ZGCA 1J8AA 1GCDA 1TB6H 4INHA 2W7SA 1S6FA 2D26C 3NUMA 2G4UA 4U01A 4AORA 3MQKC 1TALA 3FO8D 2QGRA 2RDEA 3RXVA 4E05H 2PSYA 2RG3A 1TNLA 3DCLA 1Y3WA 4NZLA 1C2EA 1EP5A 1CSOE 4WVPE 1J16A 3Q3YA 3D49H 1SGEE 4BOHA 2R3YA 4NA7A 4B74A 1C1MA 2BD3A 2XTTB 5FBEA 2CF8H 2OBQA 4K3JA 2J97A 4ASUD 4LXBH 1CE5A 1QA7A 2PKAA 2OP9A 2ODQA 1EAWA 2IPHA 2JETB 5TJXA 1EB2A 2ZNKH 2FOEA 3FP8E 1SOZA 1F0SA 3SU6A 1YLDA 2ANYA 3H7OA 5EGMA 4LK4A 1FY5A 3P8GA 3SNAA 5F8TA 2B8OH 2ZGBH 4CRDA 3SV2H 1KYNA 1ZMNA 3A7VA 3RXPA 1SHYA 1TOMH 2ZFQH 2OQUA 2VGCB 3UNQA 4FU9A 1DXWA 5FPSA 8GCHG 1GHWH 4OS7A 3PTNA 4NG9H 1GVLA 4ABHA 5H4IB 4E7NA 1KTTB 2UWPA 7GCHF 3JZ1B 1O2WA 2QF3A 2J4IA 1T8MA 4YLUA 3RMNH 2ZEBA 3DFJA 1ZRKA 5HM9A 3ZYEA 3DSOA 1UK4A 1KLTA 1V6DA 3VB6A 1NO9H 4P00A 3RP2A 1O2KA 1CT2E 4IMZA 2Y81A 4NZQA 4I86A 1C5QA 2QCYA 3GCTF 5DGJA 2XBVA 1O2JA 2JJ1D 1WUNH 1V2ST 2ZU2A 3SV8A 4ZROA 1TMTH 2OC8A 1TBQH 2BD2A 2AH4X 2JKHA 1AD8H 4OGYA 2TIOA 1A7SA 3M5OA 1ETRH 1C2LA 2R2WU 2BD4A 1LVBA 2ZC9H 2A5AA 1O2YA 1GBAA 1JOUB 4CRCA 2GCTB 3KCGH 3ZZ3A 1ZTJA 3JZ2B 4K1TA 3VG8A 1HDTH 3S7HB 3GDUA 4F4OC 5DO4H 1P9UA 4H42U 1ZJDA 1HAIH 2BXUH 5EW2H 1S81A 5A0AE 1PPEE 2WHXA 1HAVB 1KY9A 1DS2E 2G4TA 1UTQA 2W3KA 4NA8A 5C1UA 2ZGXH 2G52A 3RC5A 4MNYA 1O3LA 3VB4A 1LVMA 2BZAA 3P8OA 2PTNA 1YYY1 3ATWA 2PP6A 2J95A 1J15A 2Q6FA 1GPZA 1YLCA 2GCHF 3UUZA 1A1RA 1OSSA 8KME2 4CHAB 4M7GA 6LPRA 2C8WB 2O9QA 1O5CB 3ATIA 4CR5A 2WUBA 4D9RA 3EA8A 1F0UA 2STBE 4ZKNU 3TH4H 4B1TA 1BB0B 1SGFA 2RA3A 1GJAB 2L74A 4X6MA 1YKTA 5A8XA 1W0KD 4YLQH 1A0JA 2G5VA 1EZSC 1UTKA 5C0UA 2GV6A 3BTME 2KAIB 1M9UA 5A8YA 3A7ZA 3NKKA 2ZDNA 2AMDA 4BAKB 1EAIA 1NT1A 2HVXA 1IQLA 4AN7A 3PMHB 5DJ7A 3S9CA 4B2AA 1YPMH 4DIHH 1AY6H 1FI8A 1N1LA 4NIWA 3ZV9A 4AOQA 2ZFFH 1W12U 1E79D 1PQAA 2OQ5A 1NRSH 1EPTC 2FEQH 1W0ZU 3KQEA 1Z8IB 1HLTH 1BRBE 3QO6A 5EIYA 4IBLH 5EJ1A 4A1XA 5JBTA 1L4DA 4GPGA 1O35A 3OTJE 3VB5A 2ZFTA 2OXSA 1KDQB 2K1QA 1GMHF 3RXMA 1GG6C 2J98A 3TGIE 2ZTXA 4FVBA 1W13U 1Z6EA 4MNWA 2AMPA 2BDHA 1QFKH 1SQTA 4FU7A 1AVXA 4A5TS 5LH8A 4AFQA 2PGQB 1MD7A 1SPJA 1O3EA 1HBTH 1DANH 1GGDB 1UK3A 1QNJA 2QE7D 4GHTA 1SQOA 1GVZA 2L6OA 2OC1A 2I6QA 1OWIA 4NFEA 3UPEA 1NFXA 2HOBA 2KCYA 2Q6GA 3SGQE 3SQHE 5K7RA 1CGIE 4INLA 4U32A 4CBNA 1XXDA 3R3GB 1F5RA 1CVWH 4CREA 1SLVB 2EY4C 3A86A 3HPTB 1XX9A 1PPGE 1QL7A 3KHVA 3OAAD 2BY6X 1COWD 1FY8E 4BAQB 5A0BA 1TX8A 4MTBA 1GBHA 4X0WU 2K8IA 1TA2A 3CS7A 1C2JA 1IHSH 1VGCC 2NU4E 1MTNC 4ABIA 1V2TT 1C1NA 2FI4E 2FLRH 3UB0A 3DT0H 4A1TA 1CU1A 1OYQA 1BOQA 1QB6A 1RD3B 1MU6B 2Q1JA 2GVFA 2QN5T 4NSYA 3LIWA 3PO1C 1GJ6A 1Q2WA 2YMSC 2HGTH 1IQFA 4DGJA 2FM2A 4RKOB 3RXFA 4RT1A 1HAOH 3F0OA 5HKKD 1L1NA 1RGQA 5B6LA 1P10A 4HZHA 4X2XA 1P2IA 1D3DB 3L33A 4YTAA 1XUKA 3BSQA 2C4FH 1ID5H 1MAXA 3PLBA 3TK9A 3DD2H 1UCYE 5A8ZA 3KNXA 1GI8B 1ZPCA 1O3PB 1K9OE 3OU0A 1DX5M 2K0QA 3SNDA 2ZGHA 2TGTA 3A8BA 1LPZB 1EOLA 1TFXA 1TRMA 4JZDH 3T25A 1O2LA 2FLBH 1NPMA 3PV2A 3E91A 1KIGH 1DSUA 1W2KH 4AX9H 3UWJH 2A31A 3PLPA 5HIYA 1OXGA 3D23A 4NIXA 4O97A 2BD8A 4YOJA 4Y6DA 2WPLS 3M61U 1AE8H 3S9BA 2QF5A 2HRVA 1CT0E 3M3SA 1MD8A 1GBMA 1EZXC 2SGPE 1B0FA 4BXSA 9ESTA 1AWFH 2BD9A 1YPJH 2OC0A 2JIZD 1OKXA 2FYQA 1EUFA 1A0HB 3P17H 4X2VA 1DOJA 1SB1H 1Z1IA 4Q7YA 1XXFA 3RMLH 1VITH 2D1JA 2THFB 1K28D 3RC4A 1CO7E 1C2DA 3Q00A 1TGSZ 3RXLA 1HV7A 2F9UA 3SN8A 3VPKA 4IMQA 1GHAF 2XYAA 5L30H 1TMBH 2D8WA 3OYPA 1KLIH 1C5UA 1LPKB 5DSFA 1KXAA 2BDYA 4TSFD 1IQEA 1W0JD 1O5DH 3U69H 1C9PA 3GICB 1WV7H 5AFYH 3STIA 2BD7A 1HJAC 1MCTA 5EQQA 4CRAA 3LPRA 1BMNH 3LONA 1NM6A 1NY22 2B7DH 2W7UA 2A2QH 5C1YA 1TNKA 4Y0ZE 1ELBA 2GGVB 4Y76A 3FN8A 2SGEE 4LOYH 1NTPA 4THNH 5JPMH 1TBRH 2O8UA 3SNBA 5F6MA 3MU0A 4ZKOU 2VIDA 1O3IA 3ZVDA 1OWJA 3F2FA 4YT6H 3TJNA 3RLYH 4Q80A 2AGEX 4WXVA 1GG6B 4JZ1A 2Y5GA 1ZR0A 3MNCA 4K5ZA 1XUJA 3T27A 1P8VC 1A46H 2JETC 4Q7ZA 1E35B 3A83A 2VVVA 1Z8JB 3ZZ9A 4FU8A 2ZPSA 5F53A 1K1JA 2STAE 2IOTA 5T1VA 1LHFH 5AF9H 5CE1A 1UHBB 4NA9H 1C5MD 4CRGA 1O3DA 1BTPA 2Y7XA 1P01A 1FIWA 1S82A 1O38A 2R9PA 4JK6A 1QL8A 2SNVA 2C93B 5HMAA 1F7ZA 1MH0A 1S84A 2SGQE 2WPDD 3A8CA 3HGNA 4K8BA 1SLWB 4FXGH 2VIWA 2AHME 1O31A 2XXLA 2ZCKP 1V2MT 4TWWA 3U1IB 1C2IA 1BQYA 1H9LB 4I32A 2GD4B 2P8OB 1MKWK 2BDCA 4ZHLU 4Q4LA 5E2PA 5HGGA 4UFEH 2CN0H 2B5TB 2YMSD 3KQDA 1JBUH 2J92A 1NFYA 1WXRA 2BY9X 3RXIA 1OWKA 3NCLA 1H1BA 4WMFA 1TNGA 1BTYA 2F3CE 3QGNB 3UOUA 1DLKB 2WZQA 2GCTC 3FANA 3A7XA 2ZCHP 1AU8A 4XBCA 4ACBA 5FCKA 1VKYA 1MABB 3OY6U 4GCHG 3MNSA 1NU9A 4JYVH 4WH8A 1YWUA 2GKVE 1BRUP 1AKSA 5ESTE 4JMYA 1WYKA 5FX5A 4A6LA 5PTPA 2BHGA 1AB9C 1OP2A 5TCCA 5GCHG 3F9EA 4BNRA 4Z1MD 1UO6A 3R0FA 5C94A 5EQRA 4I8KA 1C5TA 4X1RU 5AFZH 3QGJA 4YT7H 1ANEA 2GDEH 2V3MA 4X1NU 5F8ZA 3RXQA 1MKXK 1A5HA 2BZ6H 1GI0A 1K2I1 4XBBA 3T5FH 4CHAC 4D7GA 3TNTA 3M5NA 2XCFA 1NBME 2GT7A 3M5LA 3M3TA 3FAOA 4H4FA 3RXRA 2PR3A 4ISIH 2VIOA 4YOIA 2BY5X 1XUGA 1EX3A 4O9VA 2R2MB 1EPTA 2GMTB 2FODA 9LPRA 4BAHB 4NSVA 4ZMAH 1E0FD 4BANB 1BTWA 1A61H 3F2GA 3FVFB 1THRH 1GBEA 1O2PA 2F4LA 2NU1E 3F9HA 5C1XA 1P02A 4ZHAA 1CA0B 1BJVA 2A7JA 3KIDU 1P03A 2R3UA 5KGOA 1F0RA 1AZ8A 1S83A 1RRKA 1ZRBA 3BEIB 2VWLA 1XKAC 2A45B 3SHCH 1SR5C 2BTCE 1O5AB 1AVGH 3Q77A 3OSYA 5GJ4B 2ILNA 2FOGA 5IYTA 2W3IA 4X1PU 1LVOA 1UK2A 4Y10E 2FO9A 2H9HA 1HUTH 2HNTF 1BMAA 2ZDVH 5DP6A 3F9FA 1O5GH 2QV1A 3FFGA 1W10U 4FUIA 1ZSKA 2PKSC 3ZZCA 5J4SA 4ISLA 1WU1A 3A81A 4H6TA 2XWAA 1FN6A 1YCPH 4Q63A 4X2YA 4Y8XA 5BPEA 1NRNH 3MU5A 1C5RA 2ZG0H 1YPKH 1GGDC 1GJCB 5EPNA 1SSXA 1UCYH 1QQ4A 1BTUA 1TGTA 1TPSA 3TVJB 3E16B 2VWOA 2EI7A 2XCNA 1QRWA 2KZ4A 3C27B 1ABJH 2WV5A 2GT8A 1FY4A 1T31A 2OBOA 3UREA 1GHBG 3U8OH 1A0LA 1G2LA 1PFXC 1GHBF 2BX4A 5JBBS 2CHAB 3BTGE 1FXYA 1NRQH 1SGFG 2QF4A 3F0PA 1NN6A 4YESB 3ZZ5A 2FMJA 1PQ5A 4KELA 4IW4E 3MFJA 1GBIA 4AYYB 3U8RH 1ORFA 5I25A 1GI4A 2AS9A 3D65E 3M37A 2A5KA 3CENA 3PMAB 2V7QD 3L6PA 1V2NT 3UQOA 1SGNE 1Z1JA 3FZDA 3FOAA 1P2JA 5EJLA 3SJKA 2J38A 2CXVA 1S0RA 1HAHH 1O2OA 1N6YA 1GBCA 4DT4A 3F1SB 4TY6A 3SV9A 3BTTE 1OHHD 4UEHH 4MPVA 3URDA 1O3BA 3PTBA 3P8NA 2J94A 1V2VT 3MU8A 1WQVH 3M5MA 1ZMLA 1GBTA 1D3QB 4ZAEA 8GCHF 3BG8A 2PUQH 1XMNB 5SGAE 2F83A 2ZA5A 3Q76A 3EQ0H 2FOAA 2A5IA 2H5CA 3OX7U 4VGCB 3MNBA 1QJ7B 1C5VA 3MU1A 1THPB 1INCA 4JZFH 4J1YA 6GCHG 4MDSA 3ATMA 1UTLM 2C8YB 3SI4H 4ABBA 1EJAA 4I33A
chains in the Genus database with same CATH topology
1IOEA 2Z9IA 1Y5UT 2A32A 4A92A 2QXIA 5T3HA 5LPRA 1CA8B 4MG3A 2NU0E 2P59A 3Q3KA 1GHYH 1AQ7A 3SBKA 1C5NH 1OS8A 1UVOA 3RC6A 2ZHEH 2FESH 3RU4D 4KKDA 5EOKA 3GYMA 5LPEA 4I8GA 4IC5A 4DY7B 1QRXA 1C1WH 1DDJA 5DKMA 1G3CA 1V2UT 5C20A 5C5OA 3UWIA 2J2UA 4X6PA 4Z6AH 1AB9B 2VH0A 1TGCA 3LGUA 4WWYA 2WPMS 4WXIA 3P6ZB 1F0TA 1AE5A 4HTCH 4UE7H 3S9AA 2UUYA 4AZ2B 5I46H 1O2MA 2BMGB 3EA9A 3TJOA 2ZU5A 3A85A 1PPZA 1DXPA 2XC5A 2G00A 4X2WA 1Z71A 1C5PA 1MBQA 4Y71A 1FNIA 2PW8H 2J9NA 2Z9GA 5L2ZH 1P05A 1V2KT 1GBDA 2WPJS 4DOQA 5DP3A 5E0HA 3SV7A 1Z7KA 1NFWA 1ANBA 1TPAE 3SQEE 3TU7H 4ZH8A 2CGAA 1GI9B 1PYTD 1BBRK 1C1QA 1EAUA 2DE9A 1O3GA 1CHOG 2XBYA 3HKJB 3D62A 1PPHE 3W95A 1ANCA 1SFIA 2V3HH 1AI8H 4BTIB 2VJ1A 2BDAA 2UWOA 3ESTA 3A87A 1W8BH 4CH8B 3ODFA 4UFGH 1LPGB 2A7HA 3A7YA 3M7QA 1GDNA 4ZKRU 5FAHA 3LGVA 2G8TA 4ASHA 2EI8A 1HAPH 4AG2A 1YGCH 1GBKA 3E0PB 2Y6TA 1WQSA 1SGRE 3E1XB 2Z9JA 2ZDMA 1TX6A 3PM3A 5A09A 1LHGH 1C2HA 2PSXA 1O3NA 3TIUA 1GI6A 3QZRA 1DY9A 3EAJA 1NROH 2EA3A 1WAYB 2PKSB 1LQEA 3OY5U 5DP4A 5T6GA 2ZZUH 1K1MA 4Z0KA 1SGIB 2ZHDA 5G4BA 1Y3YA 4NFFA 3BTFE 3TK5A 1GHVH 3UR9A 1Y3VA 2BOHB 2PLXA 4FUCA 1N8OB 3TGJE 1CGJE 1V2RT 2BVXH 1D4PB 1DLEA 3VXEH 5JBCS 2A4GA 4IGDA 1OPHB 2Q6DA 1GBBA 2BDBA 1NS3A 3UY9A 2A7CA 1LKAA 2GV7A 4MPXA 2BD5A 4X1SU 5CMXH 2BM2A 4AB8A 1A2CH 4ZHMU 1J14A 3RXGA 1AVWA 2ANMH 4FUHA 1IQIA 4H6SB 2ZHWH 2QF0A 1PPFE 1E38B 1TA6A 1DE7H 1BA8B 2P3TB 3TLOA 3EE0B 2P8OC 2ZU3A 2QY0B 3QTOH 5F8XA 2XC4A 3P70B 3ZVFA 3KGPA 3RLWH 2A1DB 1YBWA 1SBWA 1TX7A 4Y7BA 1JRTA 5DPAA 5C67A 1QGFA 2SGAA 1HAVA 1TQ7B 5A0CA 2V6NA 1FIZA 1GI1A 1LDTT 4ABFA 1UTOA 2ZDKA 1GI3A 1AO5A 1VITG 2P94A 3ZVGA 1VJ9U 3HATH 3MU4A 8ESTE 1QRZA 1OWDA 1C5LH 2FOBA 2VWMA 3A8DA 1T8NA 3SGAE 5GPIB 2ZFSA 1DSTA 1A5GH 4UFDH 3ZZ4A 4A1VA 3V0XA 3KQBA 1HAGE 1L0ZA 1FMGA 1ZPZA 1TONA 4ZUHA 2QAAA 2UUJB 1K21H 2TPIZ 1EZQA 3H7TA 4JCNA 1H8DH 2BLWA 2KAIA 2O8MA 3T28A 3E0NB 1A4WH 1IQHA 3RXEA 2W5EA 4K1EA 1HXFH 1AUJA 3U9AH 2QA9E 5HYOA 3U1JB 3B8JA 1P0SH 1MU8B 1ABIH 2ZHFH 3ZVAA 1MTUA 1YC0A 2ZDLA 1DY8A 2VWNA 1EJMA 1GJBB 4BXWA 1ARBA 1ZHRA 4K60A 2ZFPH 2ZECA 2GMTC 4E06H 1VR1H 1PJPA 3C1KA 3PWCA 4AFZA 3SU2A 3A7WA 3MO6A 1CA0C 1EXFA 2FWWA 2GX4A 3SHAH 1KDQA 4OS6A 1MQ6A 1HB0B 1GMCG 1AIXH 2F9NA 1DUAA 5LPFA 2FDAA 4DVAU 1O3OA 2P93A 4IN2A 4X8UH 1FJSA 2W26A 1WBGB 1MQ5A 1BUIA 1NU7B 3LT3A 2HNTC 3MO3A 2OD3B 3SV6A 3WY8A 2BLOA 2HNTE 1OX1A 3M36A 2OTVA 1O2UA 3BG4B 1SGDE 4XDEA 2VB0A 1VCQA 1C5YB 1EKBB 5L2YH 4GHQA 2QXJA 2Y82A 1DM4B 3V7TA 4OS1A 3ZZ7A 4O3UA 3SOSA 4Y7AA 4A7IB 3VB3A 1ZTKA 1HXEH 2AIQA 1O3MA 1TPPA 1BCUH 1PQ8A 2GZ7A 2YNBA 4X6NA 1WOFA 1TGNA 3RXUA 1LO6A 2C8ZB 3TGKE 1GI5A 3S0NA 1O3CA 1S6HA 4INKA 4GVUA 3T26A 5ESBA 4YZUA 2D2DA 3RUOA 4JZIA 2ZIQH 1YCPM 1BT7A 1L4ZA 1ZOMA 2EI6A 1P2NA 1C2FA 1GBFA 2Z3DA 4XFQA 1BRAA 2CHAC 1DWCH 3FP7E 1JMOH 1Y3XA 4F49A 1TYNA 4U2WA 1JRSA 5C2ZA 1HIAB 1O37A 3LU9B 1KXBA 1NFUA 2Z3EA 3RXDA 1QJ6B 2ZQ1A 5CHAC 2O8TA 3A84A 3GCNA 2TGAA 3RDZA 2G51A 1KXCA 2A0QB 3AW0A 3DFLA 4AFSA 2YOLA 3MH7A 1RTFB 2PV9B 5EXLA 1T4VH 1WSSH 3O8CA 1O36A 1U6QA 1QL9A 4DT7B 4DIIH 1ESBA 4OGXA 1H9HE 1OWEA 1AWHB 1G36A 1Y59T 2VINA 5FCRA 1HCGA 4ZXXH 2Y5FA 1GMDG 1HYLA 1SG8B 1MAYA 3NWUA 3BTKE 3M3VA 3TNSA 1WTHD 5FX6A 4VGCC 4GSOA 3MH4A 4U30A 2Y80A 1BTXA 3F6UH 3T2NA 1P57B 3V12A 2QIQA 2UUFB 1TOCB 4B76A 1W11U 2O8WA 2FOCA 1RTKA 4E7RG 2XRCA 1O2GH 4CBOA 2Z94A 1ZSLA 2UWLA 1RIWB 1O2NA 5EXMA 4B2BA 2NU3E 2TGDA 5BRRE 1O33A 4JZEH 2HPQH 5GDSH 1FUJA 4Y11E 1GJDB 2FIRH 3BIUH 2SNWA 3URCA 3E8LA 1GJ7B 4GLYA 4GCHF 1TRYA 1IQKA 2FYRA 2VU8E 1ARCA 1QBOA 1X7AC 1O2TA 2LPRA 1QY6A 1C4U2 2BQWB 1AFEH 2PKAB 4AB9A 5E2OA 1JXPA 2XBXA 2ODYB 1RTLA 5GCHF 1OYTH 1ZGVA 3RXTA 6ESTA 4RN6A 1DICA 1AN1E 5AVDA 2ASUB 1TWXB 3L3TA 2AMQA 5TCAA 4FUEA 1O0DH 1FPHH 3M7UA 3MH6A 1OP8A 5EXNA 2GZ9A 1GVKB 3MI4A 2VVCA 1DUEA 1FDPA 4OS2A 3TPIZ 1DVAH 2FX4A 3SU0A 1LMWB 3VGCB 3VXFH 5JB8S 1D3TB 3LKWA 1BMLA 3GYLB 2RCEA 2FOHA 1C1OA 5HM2A 3ZZAA 2PHBA 4I8LA 3EYDA 1P2MA 3AAVA 1GJ4H 3SNCA 1HAZB 4CR9A 3ITIA 2R0LA 2PFEA 4NGAH 3AAUA 4XBDA 1FPCH 1K1IA 3T62A 4Q2KA 3RMOH 1FN8A 1Q3XA 3U98H 2VH6A 1SGCA 1CGHA 5JDUB 2ZGJA 1B7XB 4TY7A 1EATA 1BITA 1GCTB 1V2QT 3KL6A 3MHWU 5E8EH 1P12E 3VB7A 3HK3B 1P09A 1E37B 2F9OA 2WYJA 5GXPA 2XNIA 1C5SA 3VEQB 1HGTH 4MQAA 1C1PA 1LVYA 1K1NA 4R8TB 1ZLRA 2TRMA 3RXJA 4AFUA 5GWZA 1OWHA 2WINI 5F03A 3GY7A 3FP6E 3K2UA 5GIBA 2PWXA 4WF8A 2BLVA 1P06A 1O3AA 1L1GA 2H2ZA 1UHBA 2SGDE 4KTSA 3LH3A 3ZV8A 2OLGA 3SU1A 1BBRE 3MWIU 4LZ4B 3TH2H 3BTDE 1DWBH 4X8TH 1YP9A 1N8OC 1NRRH 1QTFA 2A4QA 5B6OA 1ZHPA 1HJ9A 3RU4T 3ZVCA 1O5FH 2FX6A 1XUFA 2B0FA 3Q3XA 3SUEA 2PGBB 3RXAA 2RA0A 1MKWH 3H5CB 4ABDA 1FLEE 2OC7A 1TGBA 4Y8ZA 3BIVH 4AGKA 4XE4A 1HRTH 1VZQH 2F9BH 2BY7X 1W7XH 1SGPE 1H8IH 1EJNA 1ELEE 4IN1A 4CH2B 3TJUA 4B2CA 1PPCE 1EP6A 1C5OH 1MBMA 1A5IA 3CS0A 1EAXA 3I77A 1O5BB 3SUGA 5CHAB 1LHDH 4KTUA 4MNXA 1F5KU 5LGOA 1TRNA 1HNEE 5T6FA 2HWLB 2WPHS 1UJ1A 1GJ9B 3LGIA 2FPZA 4BAMB 1G3BA 3A82A 3CP7A 2ZKSA 1NZQH 2XWBI 1Y8TA 4Y79A 1O2VA 1ESTA 1HPGA 2ALPA 1MKXH 4GAWA 5FPYA 2FTMA 3A7TA 2BVSH 1TMUH 5EU8A 4UFFH 3RXSA 2FOFA 1AHTH 1DWDH 2BDIA 3E90B 1P3CA 1O32A 1W14U 2BB4A 1SHHB 2WPIS 1RJXB 1UTJA 4BAOB 4ABGA 5DP9A 6GCHF 1NC6A 3GCOA 4O03A 3QZQA 1KLJH 3B9FH 2TBSA 1C4V2 4X1QU 2TGPZ 1ETSH 1XKBC 1HAXB 2ZP0H 7GCHG 2ESTE 3HKIB 5DG6A 2G5NA 3SJ8A 1AZZA 1ZJKA 1MUEB 4ISHH 1UTNA 5FBIA 3UIRA 2VNTA 3UNRA 4BTUB 4I31A 1ELFA 2ZO3H 3ZYDA 3GCTG 1Z8GA 3RXKA 3F68H 1QHRB 1C4Y2 2AGIX 2V3OH 1FZZA 1AFQB 3LH1A 4JYTA 2XBWA 5C5NA 1Y5BT 2ZI2H 1K22H 1ZZZA 1GDQA 1E34B 4JK5A 4HFPB 1HFDA 1EOJA 2WUCA 3SU5A 1RXPA 3UOPA 2HALA 1GL1A 1QB1A 3TITA 2HPPH 1VCPA 1TQ0B 4RSPA 1O30A 2ALVA 4B73A 3UR6A 2M5TA 2QXGA 1ELAA 3BV9B 4YOGA 4BTTB 3KF2A 3UFAA 3N7OA 1BRCE 1JWTA 2GCHG 2NWNA 2ZU4A 4WJG2 3ZZ8A 1RS0A 1SGYE 1VJAU 2AGGX 1GI2A 1MTSA 2EEKA 3PWBA 2G81E 2DUCA 1Y3UA 1S0QA 3BG4C 2BXTH 1W7GH 2FZZA 2P3UB 1G3DA 3PYHA 3M7TA 1CHOF 1GBJA 5JBAS 2H1UA 2C90B 4WY3A 5JB9S 3PLKA 4I7YH 1GBLA 3E3TA 2RDLA 5ABWA 3UTUH 2WV4A 1C5ZB 2CMYA 1W0YH 3QN7A 4X6OA 3U8TH 1CT4E 4WMEA 1KSNA 2OUAA 4D76A 4LZ1H 1DWEH 3RM2H 2BX3A 1J17T 2WYGA 1C2GA 3STJA 7LPRA 3TH3H 3SO3A 2F91A 1CBWB 5FXLA 3NXPA 4WMDA 2H9EH 5JYIA 1IAUA 3PV4A 3QDZB 2IN2A 4OS4A 2FI5E 1SOTA 5E0GA 1SGQE 4HI3A 3LOXA 3MNXA 1DFPA 1G37A 2H6MA 3KN2A 2SFAA 1C5XB 1GMHG 6CHAB 2GZ8A 4TPYA 4MNVA 1FONA 4NCYA 1NRPH 1P3EA 2A4OA 3SJOA 2ZU1A 2C3SA 2BQ6B 3RMMH 7KMEH 3S7KB 1GWAA 1O2IA 2BQ7B 4ZXYH 5ETXA 4KTCA 1UVTH 1BIOA 1SLXB 2F9VA 4MPUA 4DG4A 4MLFB 4O3TA 1O2HA 1O3FA 1ZPBA 2GDDA 4K69A 1V2PT 2F9PA 2WPKS 1YPGH 4KP0A 3QLPH 2BDGA 2QYIA 3ZZ6A 2Z3CA 1LKBA 3GY3A 1V3XA 1S85A 3GY5A 1TBZH 1T4UH 1QURH 5A2MH 1FY3A 3RXCA 3ZZDA 1UVSH 1T7CA 2EC9H 1F2SE 1IQMA 1BJUA 1RIWC 3MYWA 2BLQA 2BY8X 3LGTA 3S69A 1G9IE 4ESTE 1Y5AT 1J9CH 1ACBE 1GDUA 1LHCH 1LHEH 2A4RA 3SI3H 2JH5D 1VITF 5DP8A 1V2WT 4FUBA 1SL3A 3I29A 1CHGA 1ZHMA 2Z9LA 3W94A 5C3NA 3UQVA 3M35A 5K0HA 4TYDA 4ABAA 1T8OA 2BVRH 3K6YA 2FP7B 3IITA 1B0EA 1P11E 2ZPRA 1SFQB 1SC8U 1QR3E 1W3CA 1S5SA 3NPSA 3MOCA 3VFEA 1N6XA 1SMFE 1UTMA 2AFQB 1UMAH 3BEFB 1DT2A 1T8LA 2VIPA 3V3MA 2OCVB 3G01A 1BMMH 1XUIA 2FTLE 4UD9H 3SU3A 7ESTE 2BYAX 4CRBA 5HXFA 4ZKSU 1UVUH 4K8YA 1BBRH 3TJVA 3ZVBA 3QTVH 1C1VH 1O2XA 2FOMB 2ZPQA 2ANWA 3RXBA 3AASA 1O3JA 3T29A 1AMHA 2OINA 1P2OA 1D9IA 3O8RA 2ZTZA 3QUMP 4GUXA 1OOKB 3VGCC 1Z6JH 2PUXB 3F9GA 4TPIZ 1ZMJA 4IC6A 4NWKA 4PROA 3BTQE 4KGAA 1AGJA 1FV9A 3A80A 1P2KA 4X8SH 2HLCA 4JYUH 1NESE 2H9TH 3QK1A 3GCHC 4ABJA 2CF9H 2PTCE 1VCWA 1QBVH 1K1LA 4DW2U 1GL0E 3BF6H 1T32A 1V2JT 4QT8C 1ELTA 4MVNA 1TE0A 1GCTC 1D6RA 1BTHH 1QIXB 5EODA 1K1PA 3ODDA 1YM0A 3PMBB 1GMCF 2IJOB 3B23B 2BOKA 5DP5A 3AVZA 3KQCA 3NK8A 1B5GH 1ELGA 3P92A 1C1UH 2ZHQH 3RM0H 1A3EH 1EQ9A 3ATLA 2FS9A 2R0KA 1GHZA 3I78A 3LC5A 1AKSB 4FUDA 3GDSA 3PROA 1C1TA 3O8BA 3LGWA 3DA9B 3GY8A 2QXHA 5DP7A 3SUDA 1GHAG 3EDXB 3HGPA 1QB9A 1TIOA 1JIMA 3EA7A 3QX5H 4XOJA 1LCYA 1GI7B 2YNAA 3A89A 3BTHE 3SW2B 3AW1A 1DPOA 1SQAA 1MTWA 3GISB 1ELVA 1L1JA 3HK6B 4MPWA 1G3EA 3ZVEA 2Z7FE 5AHGH 2XW9A 2C8XB