2OBQA

Discovery of the hcv ns3/4a protease inhibitor sch503034. key steps in structure-based optimization
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
180
structure length
180
Chain Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatitis C virus
publication title Discovery of the HCV NS3/4A protease inhibitor (1R,5S)-N-[3-amino-1-(cyclobutylmethyl)-2,3-dioxopropyl]-3- [2(S)-[[[(1,1-dimethylethyl)amino]carbonyl]amino]-3,3-dimethyl-1-oxobutyl]- 6,6-dimethyl-3-azabicyclo[3.1.0]hexan-2(S)-carboxamide (Sch 503034) II. Key steps in structure-based optimization.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein
total genus 39
structure length 180
sequence length 180
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2obqA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2obqA01
4A5TS 2ZU4A 4ABDA 1GHBG 1NT1A 1F0TA 3SNBA 2ZO3H 1YKTA 2W7SA 5FCRA 1FAKH 4PROA 2QXJA 2BDHA 3ZZ8A 1ABIH 5FCKA 1QHRB 1H8DH 4IC5A 2Z3CA 2FM2A 2OQ5A 1OYTH 3TK9A 3UWJH 3A85A 3STIA 2GCTC 1UMAH 1HNEE 2WPMS 4JK5A 5GCHG 1HAYB 2R2WU 2WUCA 1S81A 2Y7XA 1MTNB 2H9EH 5LPRA 2WPJS 1JBUH 3UNRA 2G51A 1V2VT 3KCGH 1TIOA 3FP6E 3BEFB 2W7UA 4ABBA 2WYGA 1O2XA 1ID5H 3AVZA 1SBWA 3P95A 8KME2 1HGTH 1XVMA 1GVLA 1P11E 2BD2A 3A83A 2VIDA 1XUJA 3SI4H 2FEQH 3GCHC 1RTLA 3RLWH 2C8WB 3SU6A 1G3BA 7GCHF 2DUCA 3UNSA 1KXFA 1O5FH 2F91A 1QB9A 2VIWA 1E38B 4KP0A 1UTMA 5PTPA 1KXDA 4CHAC 4O97A 2ZHFH 2F9PA 4Y8YA 4FUIA 1AD8H 1SVPA 2O8UA 4CRBA 7KMEH 2AIPA 4ISOA 4NG9H 4B73A 4XFQA 1O2HA 1F0RA 1CA8B 2CV3A 3QN7A 2VH6A 1K9OE 5C67A 2H1UA 4U30A 3RXCA 3UR9A 1D6WA 4JCNA 2TGTA 2G55A 1AN1E 1L1JA 1O38A 3P70B 1XKAC 1YPJH 3VB7A 3M3SA 3MTYA 4GUXA 1D3QB 3U8TH 1IQLA 1G2MA 4FU9A 4UEHH 5EGMA 2H6MA 5FPYA 2D26C 3FFGA 3W95A 1QB6A 2GCHG 3SU2A 3ZZ9A 1CA0C 1G30B 2OXSA 4X2YA 2PR3A 4ABEA 3P6ZB 4Z0KA 3I78A 2PKSB 1V2ST 2WZQA 1NN6A 1TX7A 2GKVE 4MNXA 1ZHPA 1MKXH 3RXJA 1P02A 4FUCA 3CENA 1YBWA 1EJAA 1T4VH 1U6QA 1CU1A 1TQ7B 3ZV8A 1HAVB 1EAXA 1EKBB 1MCTA 3E91A 1UHBA 3LDXH 1P12E 3A82A 5FAHA 2J94A 2ODPA 1KTSB 1OWEA 3S9BA 1Y5UT 2FOEA 1C1RA 4J1YA 2GDDA 1P2NA 1THSH 3Q3KA 1C1WH 2VWMA 4NZLA 3A81A 4Q80A 1GI5A 3BIVH 2TGPZ 4DY7B 1HJ8A 1A46H 2FXRA 3TK6A 1QCPA 1V3XA 2AGEX 1PYTC 5ESBA 1DICA 1WSSH 4WF8A 3OY5U 1SLVB 4X6NA 4E7RG 3TGJE 1OP2A 4K3JA 3T26A 4FUGA 1K2I1 3GY5A 3CS7A 3ENSB 4XSKU 1C5OH 3SU0A 3GCHB 1C5UA 4NWKA 2M5TA 3KNXA 4NCYA 5DPAA 3A8BA 1PQ8A 4YM9A 3AASA 3QO6A 2HGTH 1KYNA 1FY4A 4DCDA 1UCYK 3H09A 2ZC9H 4OS5A 4GLYA 1ZHMA 1ZZZA 2W5EA 4JYTA 1KDQB 2PV9B 4NIXA 1TGSZ 3CP7A 2P3UB 1PPZA 2BLWA 2JH5D 4DJZB 1G37A 4BAQB 5L2YH 2AH4X 1J9CH 2H2ZA 2PUQH 1UTPA 1O2ZA 1LMWB 1WXRA 3ZZCA 4I8KA 2ZFSA 1P10A 2R0LA 3GCNA 4AG2A 1GI7B 3PMAB 4MDSA 8GCHF 2A5KA 4BOHA 3UY9A 3MNSA 1SGPE 1A2CH 4GHTA 1DOJA 2A4RA 1LPGB 1ZRBA 3NUMA 2ANWA 2FLRH 3D62A 4AYVB 1C4Y2 3HKIB 5T1VA 3BSQA 3SNCA 1SFQB 2AMQA 1DM4B 4K60A 4B6FA 1TPOA 1WCZA 1GJAB 4UD9H 3SUFA 4KTSA 3TJUA 2AFQB 4XBDA 1GVZA 1D6RA 1C5RA 1JRTA 2BD7A 1UJ1A 1HDTH 2QC2A 1C5SA 1DY9A 4ABHA 3NK8A 1YGCH 2BLVA 1E34B 4A92A 1ZSLA 4TWWA 3ZZBA 3QLPH 2JETC 2G8TA 4TYDA 2V0BA 5HGGA 2G52A 4I31A 4ZAEA 4F49A 3F9FA 3ATWA 3BTGE 2Z3DA 2UUJB 2ZHQH 3MWIU 2Z9IA 1Z8RA 3MOCA 1FLEE 1SGCA 3LJJA 3EA7A 1C5WB 3GY7A 4HGCA 4JZFH 2AGGX 1C1MA 3PMJA 1ELCA 2OBQA 2ZU2A 3RXFA 1E36B 5EW2H 1KY9A 4HZHA 2ZKSA 1DXPA 2Z3EA 1BHXF 1MKXK 2F3CE 1EATA 3M7QA 5A8YA 1KTTB 1BUIA 3EAJA 1UK3A 4ZH8A 4B2CA 1BT7A 4DIHH 1V2UT 1FZZA 3GY3A 2THFB 3SJ9A 1TMBH 4X8VH 4M9FA 2P8OC 1C5NH 1Y3YA 2STAE 1ABJH 1VITF 1WBGB 1GHYH 1QRXA 2OK5A 1BA8B 1ELFA 5EQSA 4MPUA 4DURA 1OYQA 1OSSA 1P9SA 3CS0A 3NZIA 1GHBF 1FIWA 3MH6A 5LPEA 2Y82A 1O30A 2ZIQH 3KQDA 2B5TB 2SGEE 4CH8B 2ILNA 3O8BA 2AEIH 1IHTH 1KIGH 1O2IA 1OWIA 4JMYA 5JBAS 4ISLA 5EXMA 5TCAA 1TGNA 4Y6DA 1C2KA 1HAXB 1P06A 5L6NH 3QUMP 4K1SA 5DP7A 1UCYE 1SOTA 1QA7A 4Q7ZA 1NRSH 2UUKB 3R3GB 4AGKA 1ZTJA 1FY1A 2VGCC 4A1XA 3UR6A 1XXDA 3GOVB 5DKMA 1O2WA 2OC8A 4TPYA 3A84A 5GCHF 1QQUA 2G4TA 2J9NA 3SU4A 4JYVH 2NU2E 3RLYH 4XE4A 3E16B 4CREA 1O3LA 3RXKA 3OSYA 1EPTB 1NM6A 4DVAU 1MTUA 2ASUB 5DP6A 3SJ8A 1C5MD 2A2XH 3PMHB 3RMNH 1XVOA 1C1UH 2BVXH 5K0HA 3RDZA 3BEIB 1FY3A 2PUXB 4IMQA 1QIXB 1AVXA 3RMMH 1TPPA 2WYJA 5K7RA 3L33A 2SNVA 1IQGA 5T6GA 5ESTE 4FUHA 1AKSA 4A1TA 2Y81A 3MFJA 1PPFE 3ESTA 2GVFA 3SBKA 1HJAB 2BDBA 2BYAX 2ZHEH 3MNXA 5CHAC 1WV7H 2Z94A 3QX5H 4X2VA 1ZLRA 5DGJA 4U2WA 1ZMLA 1OP8A 2HPPH 4LOYH 4Q2KA 4B74A 1MU6B 4KGAA 3RXQA 2VU8E 1O32A 2WV5A 1Y3WA 4XOJA 2ALPA 5EG4A 2GT8A 2GCHF 2F9BH 3HATH 3QDZB 1W11U 3LC3A 5A09A 4IMZA 3K6ZA 4B71A 1SGQE 1PQ5A 4RI0A 1NRNH 2BX3A 2H5DA 4XBCA 1B5GH 4UFDH 4F4OC 1QL7A 2BY9X 2FYRA 1ELEE 4LZ1H 4NGAH 1YCPM 4X1PU 3Q00A 5EW1H 1SFIA 4X1RU 4ZHMU 3I29A 2BD3A 1LPZB 1NU7B 1G9IE 1JRSA 4UDWH 3M7TA 2J2UA 2KAIB 1TOMH 2P95A 3RXUA 2BD8A 2IJOB 2K1QA 2BM2A 4A1VA 1O3AA 2ZF0H 4X1NU 1GMHG 3A7YA 1XM1A 2ZPSA 1HLTH 3TH2H 3BTKE 3ZZ3A 1NZQH 5F6MA 1ZOMA 2ZQ1A 3HK6B 5J4SA 1GJ8B 2F4LA 5DO4H 3P17H 2ZDAH 1BDAA 4BNRA 2PTCE 1C1SA 1VJAU 1O5BB 1JIRA 1ZSKA 4H4FA 4B1TA 3SYJA 1LCYA 4NWLA 2GDEH 3M5MA 1T8MA 3RP2A 1MD8A 4MG3A 5C2ZA 1TA2A 1T8NA 4UFGH 4RN6A 5A8XA 3SUGA 3FVFB 2C90B 3A88A 4RKOB 1DXWA 3BV9B 4K8YA 2J95A 1ORFA 1FXYA 1RTFB 3SU5A 1QURH 1THPB 3M3TA 2P16A 3PV2A 2YNBA 1UTQA 3U1JB 1UVPA 1UTLM 2WUBA 4NIVA 1ANCA 3TJOA 1BB0B 1AUJA 2Q6FA 1JIMA 1YPKH 2XBYA 1UVSH 3T62A 3M36A 3PTNA 3RXEA 1GHVH 5E0GA 5CMXH 2BVSH 2H9TH 3MU8A 5GJ4B 2ZPRA 1DDJA 3MI4A 1BJVA 1J8AA 1FN8A 1FI8A 3MU0A 1YPMH 1DPOA 3AW0A 4UFEH 1EOLA 1Y8TA 1GBJA 1N6XA 3SV6A 2ZDVH 4YOGA 2GMTB 1GDUA 1BRBE 1LHGH 4OS4A 4RKJB 2HLCA 1IQKA 1K1JA 1ELGA 2DE9A 1Q2WA 1N8OB 1SGYE 2VINA 1LVYA 3VEQB 1DUAA 1C5VA 3PYHA 1B0EA 1GI1A 2GX4A 3NWUA 2BX4A 2D8WA 3O8CA 4NIWA 5HM9A 3TPIZ 3UUZA 2BY6X 4GPGA 2NU0E 2XNIA 2ZG0H 1AE5A 1MAXA 2NU3E 1SI5H 2ZNKH 1GMDG 4NA7A 2AMDA 4X6MA 2B8OH 2R3YA 2TGAA 3TNTA 5T3HA 3GISB 2H9HA 1CSOE 1P03A 2FP7B 3GY4A 1TNIA 2XWAA 3SN8A 1W13U 1FPHH 3TITA 5AHGH 1Z71A 4THNH 5A2MH 1CT4E 1C5ZB 1QFKH 2JH0D 2Y5HA 2Q6GA 2BHGA 1BMNH 2AYWA 1C1OA 1HAIH 4UE7H 3F6UH 1F2SE 2C8YB 1Z7KA 4OS2A 2ZA5A 1A61H 1GBDA 1ZPZA 3RMOH 1VGCB 4ISHH 1XX9A 4KTUA 4DGJA 2HPQH 1MUEB 2FO9A 4WWYA 1Z8GA 3SGQE 1SHYA 1AIXH 1QL9A 2C8ZB 2A7HA 1SGNE 3E90B 3GDSA 1CBWC 1H9HE 1TYNA 2FWWA 3D23A 1QBNA 1X7AC 4BXWA 1VCWA 1C2GA 3NCLA 1CHOG 3E6PH 3LGYA 1ZMJA 2RA0A 4B75A 3RU4T 2EEKA 3E1XB 1SQTA 1P2IA 1GI6A 3SI3H 1EASA 1O2OA 1SOZA 1UTKA 2ODQA 4K1EA 3RXBA 1LQDB 2WPIS 4I32A 1SLUB 1O5AB 2Y5FA 2BXTH 1MKWH 2TPIZ 1YLCA 2BVRH 1THRH 3C27B 2BDIA 3PB1E 4KTCA 4YTAA 3SUDA 5EPYA 1OWJA 4NA9H 1KLJH 1N1LA 1ZTLA 1FN6A 3TH4H 2A45B 1FDPA 1P09A 5FBEA 1GMCG 1VR1H 4OGXA 3ATLA 4ZMAH 1OXGA 1BBRK 1FNIA 3BF6H 1TPAE 1MMJN 1TPSA 3SUEA 1HBTH 1LHCH 3A89A 1EZQA 1EZUC 1P2MA 1NRRH 1S6HA 2GP9B 4YT6H 1QBOA 2XW9A 4O9VA 4X8SH 1ESAA 5B6OA 5A0CA 1IQEA 1O2QA 1A0LA 2UWOA 5G4BA 1K1NA 1UHBB 4B76A 3ZZAA 3I77A 4BXSA 3GDUA 5E2PA 1P04A 4DIIH 1T8LA 1MAYA 3SZNA 1BTYA 3M3VA 4WVPE 6GCHG 1XKBC 4IW4E 1GHWH 1S83A 3VB6A 3A86A 1OWHA 3M7UA 1P3CA 1YPHC 3SHCH 4JZIA 1GPZA 1T32A 1QRZA 2G00A 2VNTA 1HIAA 1C2MA 3PWCA 4VGCC 1C9TA 1ELBA 1HXEH 3HGPA 2A5AA 3SV9A 1ARCA 3LC5A 5T6FA 3ZYEA 3ATIA 3L6PA 1BTXA 1P0SH 2Y80A 1UVOA 2FI4E 1RXPA 4E05H 2IJD1 3ZVDA 1YPLH 1FAXA 1O3DA 1TMTH 1OKXA 3FZDA 1C5LH 3HGNA 4CBNA 4AN7A 4LXBH 3UIRA 4INLA 4NIYA 1TBRH 2V3OH 4GCHF 2HVXA 4I8JA 4D9RA 2OUAA 2GCTB 2BTCE 2TRMA 4NSVA 1NRQH 4BAHB 1V2QT 4WMDA 2F9VA 5FX5A 1QNJA 1TGBA 1C2JA 5AFYH 1BTWA 3LKWA 2IPHA 1CBWB 3FP8E 1FMGA 2O9QA 1GJ4H 3H7TA 3QK1A 3E8LA 3A7XA 5B6LA 2BDCA 1SGRE 4JK6A 1TONA 4X8UH 4ASHA 1E37B 5T6DA 5FBIA 1J14A 1GCDA 4QT8C 2GT7A 1C4V2 2WPKS 4ZHLU 3A8DA 4AORA 1GG6C 2AERH 1J16A 1K28D 3ZV9A 2P3TB 1S6FA 1TGTA 3S69A 3BTFE 4X2XA 5ABWA 3UREA 3SNDA 1BMMH 1YCPH 1GMHF 1IQJA 3ZVBA 3OY6U 1C5TA 2OBOA 2FOMB 3W94A 4CHAB 3P8FA 2NU1E 4CBOA 1QL8A 5IDKA 3TJNA 1CT0E 1Y3XA 1G3DA 1XMNB 4INHA 3KQCA 3KN2A 4IBLH 1ZSJA 1CGIE 1F0UA 3GCTF 1HXFH 3LGIA 3UWIA 3KEEA 3SORA 3GCOA 4AFQA 1AFQC 4YOIA 1O2SA 1EJNA 1W10U 1UTNA 1V2JT 3SV2H 3AK5A 3HK3B 2QIQA 4ZKNU 1YLDA 1WYKA 1BBRE 4DG4A 4A7IB 1H8IH 1K1OA 1SQAA 5C5NA 2VJ1A 1ANBA 2FOCA 2ULLA 1CO7E 2PTNA 1SR5C 2ZU3A 3RXIA 2QCYA 4YLQH 3SZEA 2OQUA 3MHWU 2FDAA 4Y10E 2A32A 1MKWK 1P05A 2IOTA 5C3NA 1CA0B 1DSTA 3D49H 3S7KB 4BAKB 1ZJKA 1ZMNA 1K1IA 4X8TH 5EOKA 2VWNA 1EJMA 1B7XB 2PKAA 4VGCB 1BRAA 5F8TA 4J2YB 1HAHH 3STJA 3SU1A 3C1KA 3GY6A 5HYOA 1HYLA 2V3HH 1IQHA 2J92A 1O3JA 1O2RA 2RA3A 3MU1A 2ZQ2A 2QF3A 5GIBA 4KKDA 2ZECA 7LPRA 3K2UA 1GHAG 2ZTYA 1A3BH 1GCTC 1PQ7A 2BY7X 1C2DA 1ELTA 2QXHA 4JZDH 4CRFA 1EP6A 3QTOH 2FI3E 4ABGA 3EA9A 2A7CA 4R0IA 3TGKE 1LVOA 3AAVA 1TABE 1TNKA 1HJ9A 2EI6A 3IITA 2BD5A 1ZGIA 1ZPBA 2IN2A 2XC5A 3JZ1B 3UTUH 3A87A 4NFFA 3QWCH 1D3TB 2Q6DA 3MO3A 3EYDA 1AGJA 1PPHE 1GMDF 1O2VA 1RTKA 3RXVA 9ESTA 1MBMA 1AU8A 1TNJA 1H1BA 5DP3A 1GJ5H 3U8RH 5C5OA 1EAWA 1PPGE 5GDSH 1GBBA 1GG6B 3A7VA 3VXFH 2ZDMA 2XTTB 2HNTC 2DE8A 2VIQA 2CHAC 4FUDA 2A4OA 4Y11E 1ZGVA 2W3KA 3N7OA 5GNDA 3U1IB 3BTTE 5EPNA 1OPHB 2XBVA 2FS9A 1HRTH 1QBVH 1RIWC 1Z6JH 3V13A 5DP4A 1T31A 2CMYA 3SU3A 1C1NA 1TALA 5E0JA 1O3OA 3SJKA 2A31A 4X6OA 1C1PA 3WY8A 2A7JA 1T7CA 2RDLA 2XBXA 3PV4A 1O31A 5E8EH 2A0QB 2VWLA 1FY5A 3ATKA 3VGCC 1ANDA 2SFAA 2XYAA 1TMUH 2A2QH 1FPCH 1CHOF 4CR5A 4YLUA 2ZI2H 3PROA 4CR9A 1YCPK 1O2TA 4O3UA 3V0XA 4TY6A 2ZCKP 3A80A 2G5VA 2ZP0H 5JBBS 4UONA 4D76A 3K65B 2Z9GA 1GI0A 1AWFH 1IQMA 2B7DH 2QF0A 3TK5A 5I46H 2SGQE 1QJ6B 3U98H 1DITH 3ZVCA 2BQ6B 4BTUB 2ZEBA 1D9IA 2RCEA 1GMCF 4Y79A 1JXPA 2JETB 1DWBH 4H6SB 1GBMA 1L4ZA 2VVCA 3BG8A 3S9CA 3M5OA 2CJIA 3SQHE 5EXNA 1O3IA 4RSPA 4B2BA 1GI9B 1DSUA 1NU9A 3BN9A 3A8AA 2EI8A 4X1QU 3RM0H 1ELDE 4AOQA 1O2YA 4BAMB 4Y8ZA 3B23B 1XUGA 1H9LB 1UK4A 2CN0H 4FUBA 3BTQE 1MD7A 3BTHE 3LGVA 2HWLB 1EPTA 1GBCA 2Z9KA 1EB2A 4ZROA 1C2EA 3BG4C 6GCHF 1GBHA 4CRGA 2J38A 1DVAH 3ODDA 4MLFB 1SQOA 2P8OB 1YYY1 1TOCB 1L4DA 1O0DH 1HAGE 2UUFB 1BRCE 1MH0A 6LPRA 4Y76A 1O35A 1DLEA 4IN2A 2ANYA 3R0FA 1ELVA 1A4WH 1MCVA 2FTLE 1F0SA 1YPHE 4CRCA 1Z6EA 3BTME 4HI3A 1TNLA 1V2PT 3A7WA 1HUTH 1EZSC 2LNCA 5HMAA 1GBKA 1MZAA 3BTEE 3TH3H 1VITH 1KXCA 2YOLA 1RIWB 2R3UA 1ESBA 3PTBA 4NFEA 2WPHS 3F1SB 3KHVA 1O3PB 1YF4A 3MU4A 2O8LA 1GBIA 1L2EA 1IAUA 2VIVA 2VGCB 4X6PA 5HXFA 1O5EH 1WQSA 5A0AE 1SL3A 1GDQA 3F68H 1C9PA 2ZFQH 1LPKB 3AAUA 3MNCA 1KLIH 1TB6H 2WINI 1T8OA 1Z1IA 1ZRKA 1TNHA 2GV7A 4OM9A 3GY8A 1PJPA 2BZ6H 4E7NA 5DP9A 1K1PA 4I8GA 1CQQA 4B2AA 1A0HB 1NY22 2XBWA 1Z8JB 1L1NA 1O3KA 1G2LA 1FUJA 3GY2A 4AFUA 3LT3A 5JDUB 4FVBA 2OC1A 3MH4A 1O5GH 1MZDA 2UUYA 1UVTH 1FJSA 1SHHB 1GJBB 4K1TA 1RD3B 2WHXA 1C5YB 1P8VC 1SGEE 2XC4A 3DD2H 1UVUH 8GCHG 2ANKH 1EX3A 2QGRA 5CHAB 1TFXA 1A0JA 3TU7H 1GDNA 2VBCA 1G3CA 3VB5A 1DY8A 3PMBB 1WTGH 2QV1A 1C2HA 1C4U2 1GBLA 5DK1A 1TGCA 1TRMA 1O2NA 4YZUA 1EAIA 2QXGA 1HFDA 3TIUA 2OINA 6ESTA 1Y3UA 1AQ7A 2WV4A 2ZGXH 2BD4A 3BG4B 2ALVA 1GWAA 3SJOA 3SGAE 2GGVB 3PM3A 1KXEA 1VZQH 1S85A 1BTHH 1S0QA 2P3FH 2CXVA 1YPGH 1DS2E 4WXVA 1IHSH 1DUEA 3AW1A 1V2NT 2OP9A 3KL6A 3LGTA 1H4WA 3QGNB 1P2KA 1KLTA 1WTHD 1GL0E 2HOBA 3F9GA 4I33A 1SMFE 1SGFG 2QYIA 1SGFA 2JH6D 4I8LA 4ESTE 2H5CA 1G32B 1M9UA 1ZTKA 1W7GH 1NS3A 1V2LT 4AZ2B 1XUIA 4FU8A 5SGAE 3L3TA 2STBE 1C1VH 1GHAF 8LPRA 4D7GA 2OC0A 1O2GH 1MTWA 1AVWA 2VIOA 4BTIB 3G01A 2FODA 1C5PA 1A5HA 3SW2B 1QTFA 2BDGA 1AZZA 3MH7A 1ZHRA 2PKSC 2FLBH 4NSYA 3PLBA 2ESTE 1A3EH 1VITG 3RXLA 5C1UA 3UFAA 2NWNA 2FTMA 4D8NA 1OOKB 1V6DA 2ZU1A 3M35A 2AMPA 1DT2A 1W8BH 3DFLA 3MMGA 3FAOA 1FQ3A 1DLKB 1E0FD 3RXGA 1RS0A 1TX6A 4MNYA 1INCA 1A5IA 2B0FA 5A0BA 2SGAA 4BAOB 1C1QA 2F83A 5TCCA 3UOPA 2F9OA 5C1YA 2VVVA 1F92A 2WV9A 3VB4A 2Y6TA 2UWPA 3RXMA 2OLGA 1QY6A 2FS8A 1CE5A 2D2DA 1C2LA 1UCYH 1UTOA 4O03A 3VFEA 2AIQA 1BMAA 1SGDE 1AE8H 2PGBB 2ZDLA 4H42U 1P2QA 1MU8B 4K2YA 3VXEH 2BD9A 3ITIA 3MO6A 5C1XA 1GJ7B 3LGUA 4ABAA 1QGFA 2HNTE 3T5FH 1W14U 1JOUB 1S82A 1SLXB 3DUXH 3FP7E 4FU7A 3LH1A 3MU5A 1XUKA 2QY0B 4HTCH 5E0HA 2ZFFH 3V7TA 4TPIZ 3RU4D 2FX4A 1P01A 1NFXA 1EZXC 1O3HA 3V12A 5LGOA 1JWTA 1HCGA 3OU0A 4Y7AA 2XXLA 5EQQA 3SHAH 4DT7B 1O3FA 2G5NA 4ZKSU 1V2WT 3SNEA 1RRKA 2NU4E 3KF2A 2O8TA 3UOUA 1HIAB 1FV9A 1O2JA 2G81E 3GYLB 1F5KU 5EODA 8ESTE 1NC6A 2HALA 5JBTA 5FPSA 4WMEA 1TRNA 3ZZ7A 1SLWB 1LHDH 2P94A 4JZ1A 1TE0A 5CE1A 2XCNA 2ZFRH 2ZHDA 2PSXA 3S0NA 2F9UA 1W12U 1PFXC 2FPZA 1O33A 1T4UH 1K1MA 2ZGHA 2BDYA 2BOKA 5GPIB 1GJ6A 4I7YH 4Y71A 3TLOA 4H6TA 2BQWB 2P59A 1BZXE 3DFJA 4FXGH 5JB9S 5JB8S 1Z1JA 2I6SA 1QQ4A 3M5NA 2VH0A 4WMFA 4IN1A 3MO9A 2W26A 3EA8A 4XDEA 3SJIA 3Q77A 4BANB 3TVJB 2UWLA 3LONA 2ZDNA 2ANMH 4OGYA 1P57B 1GJDB 5LPFA 1B0FA 3DA9B 3BTDE 5L30H 1WUNH 4FUFA 3OTPA 1DFPA 3LGWA 2A4QA 3SO3A 4WH6A 2CF8H 1EAUA 3T2NA 1LVBA 5DG6A 1MTVA 1LKAA 1YPEH 3QTVH 2QXIA 1LVMA 4WY3A 1TBQH 2P93A 2Z7FE 1O2PA 1ZJDA 1Y59T 2J4IA 3IWMA 3V3MA 3Q76A 3Q3YA 3P92A 3RXSA 2CF9H 1D4PB 1YM0A 2R0KA 4ZKRU 3Q3XA 5FXLA 2OD3B 3RXDA 2EC9H 1PYTD 2B9LA 4ZXXH 1NFWA 1VCPA 6CHAC 1OWDA 2PWXA 2GZ7A 1O2KA 2GZ9A 2Q1JA 1HAZB 3LU9B 1P3EA 1NTPA 1O3MA 3P8GA 3T29A 4Y7BA 2C8XB 1AVGH 3QZRA 1TBZH 1NESE 4SGBE 1RFNA 4TY7A 1HAVA 1LKBA 1AB9C 4MPWA 1TQ0B 1G36A 4CH2B 2ODYB 3TJVA 4MTBA 5JYIA 4Y0YE 1NPMA 4DOQA 3H5CB 1TLDA 2EA3A 4X1SU 9LPRA 2HNTF 1QJ7B 3MH5A 3ODFA 1Z8IB 1DWDH 2PKAB 2Z6BD 3SNAA 1QR3E 3BTWE 4GAWA 1SGTA 4I8HA 5TJXA 1MQ5A 1GGDC 1GI3A 1Q3XA 1C1TA 3RM2H 2ZTZA 4TWYA 1AMHA 5EQRA 2TBSA 2XWBI 3IG6B 4IGDA 1ZYOA 2AS9A 1D3DB 1O5DH 3HKJB 1IQIA 3NKKA 3KIDU 1FY8E 5BPEA 1PQAA 4ZUHA 3S7HB 5DP5A 2R9PA 1ELAA 3RXRA 2ZTXA 3ELAH 3KQEA 4GHQA 2TIOA 4ABFA 2FMJA 1BTPA 2BZAA 4OS1A 1N6YA 1TRYA 2FIRH 3O8RA 3K9XB 1EQ9A 1LQEA 2PLXA 3VB3A 1EPTC 1FIZA 2Y7ZA 2VB0A 4Q7YA 3GICB 5A8ZA 2FX6A 5HM2A 2ZWLH 2OTVA 2QN5T 4GSOA 1O5CB 2W3IA 4GVUA 5F8XA 3FANA 1KDQA 1SC8U 1IQNA 1GBTA 1UK2A 4U01A 4YT7H 1V2KT 2A5IA 3A7TA 1A7SA 1P2JA 4SGAE 1GJCB 1DWEH 4YOJA 2C3SA 5IYTA 3ZZ6A 2FOBA 1XXFA 1NO9H 1W2KH 1LO6A 3GDVA 2Z9JA 5EU8A 1BTZA 1S0RA 1TA6A 1HJAC 1W0ZU 2XCFA 1Q31A 1V2TT 4BTTB 4Y0ZE 1K1LA 4D9QA 2ZGCA 2PHBA 3OTJE 1OS8A 4U32A 1WAYB 4OS6A 1QJ1B 5E2OA 4JZEH 1ACBE 3NXPA 4Y8XA 5I25A 4CRAA 2J34A 3M61U 1V2OT 6CHAB 1LHFH 1PPCE 4K69A 1TAWA 1FONA 3A7ZA 4M7GA 2SNWA 1GVKB 3BEUA 1W3CA 1Y3VA 2I6QA 4LZ4B 3DT0H 1O2MA 1KXBA 4MQAA 1GJ9B 1QB1A 3LH3A 2ZGJA 3PO1C 5EXLA 4D7FA 1S84A 3PV5A 1DANH 1AB9B 1W0YH 2BB4A 3URCA 4IC6A 2SGPE 5DP8A 1LTOA 3RXHA 1C5QA 2FOHA 2RG3A 1RJXB 4WXIA 1AFQB 3M5LA 1Y5BT 3MYWA 5AFZH 3UQOA 5ETXA 2GTBA 1BITA 1GGDB 2OCVB 4FUJA 2D1JA 1AKSB 1CGJE 1ZPCA 2V35A 3U9AH 3TGIE 4OS7A 2CGAA 2R2MB 1F5RA 1HB0B 4AG1A 3ATMA 5F03A 7GCHG 3LJOA 3B8JA 1K21H 1GBFA 1WU1A 5F8ZA 1SSXA 1YC0A 4ZXYH 5J4QA 1OWKA 1BIOA 2ZFPH 1C5XB 1O2LA 1V2RT 2XRCA 3ZZDA 3OYPA 1MTSA 3QGJA 3URDA 4AB8A 3JZ2B 2FOFA 1TNGA 2GD4B 4ZKOU 5FHTA 5L2ZH 4ISNA 5H4IB 3RC4A 3SOSA 3UQVA 4X2WA 1AUTC 2O8WA 1AFEH 1O3EA 1PPBH 1VCQA 3NPSA 3TNSA 1L1GA 2FESH 4DW2U 3A8CA 4WH8A 2BY5X 1SGIB 1O3NA 3E0PB 1RGQA 4NZQA 4WJG2 4FUEA 1GCTB 1UO6A 3ZVGA 2ZCHP 2G4UA 3DHKH 2BY8X 1HV7A 1GI8B 2TGDA 4AFSA 2PGQB 3RU4E 3T27A 2V6NA 3RUOA 3S9AA 1HPGA 4B6EA 5FPTA 3LPRA 2A1DB 1IQFA 1BMLA 1ARBA 1O3CA 2WPLS 3PLPA 1XUFA 4MVNA 1LDTT 3BIUH 3H7OA 3EDXB 3RXPA 4MNWA 4AFZA 1ETRH 1O39A 1AWHB 2AGIX 2PW8H 3SV7A 1O36A 2GMTC 3PWBA 2FI5E 4YESB 3ZVAA 1O2UA 1KSNA 4KELA 1N8OC 3O8DA 2XC0A 5GXPA 4AYYB 2O8MA 3K6YA 1DWCH 3PO1B 4CRDA 4GCHG 2ZU5A 2CHAB 1O37A 5C20A 3SGBE 3ZZ4A 1AI8H 4O3TA 5BRRE 1ZR0A 1CT2E 1NRPH 2ZDKA 1ETSH 2ZHWH 1IOEA 4Z6AH 4YO9A 3KGPA 4AX9H 4XBBA 3ZVFA 5AVDA 2F9NA 1VJ9U 3LIWA 5JBCS 3U69H 1HAOH 1O3GA 1EB1H 1MBQA 4ABIA 1JMOH 2GV6A 1ESTA 1WOFA 1A1RA 4AGJA 3RC5A 1J17T 1P9UA 4MPXA 3VGCB 1GBAA 1EXFA 4IS5A 1BTUA 3UPEA 5DJ7A 4X0WU 1NFYA 1TWXB 3RXOA 2GZ8A 2PFEA 3OX7U 1NFUA 1YP9A 4R8TB 1ANEA 1BRUP 1O3BA 7ESTE 2ZZUH 1D3PB 3GCTG 2FYQA 1AHTH 4JYUH 3P8OA 1CVWH 3E0NB 4MPVA 3MNBA 2BMGB 2C93B 3D65E 3KQBA 1VGCC 2ZGBH 1QRWA 3FZZA 1GL1A 1BQYA 2KAIA 2LPRA 1AO5A 1PPEE 3QZQA 2JKHA 4Q7XA 1F5LA 1MTNC 1BBRH 4LK4A 4FVDA 2QA9E 5AF9H 3EE0B 3RXTA 3ZZ5A 2FZZA 4MNVA 2ZFTA 1HAPH 4K8BA 3U8OH 1GI4A 1L0ZA 3SQEE 4INKA 1O34A 2BXUH 1EUFA 3HPTB 1Y5AT 2A4GA 2BDAA 3EGKH 4NA8A 1J15A 1QA0A 5LH8A 1DE7H 3ZYDA 2Z9LA 3P8NA 1C2IA 1CHGA 1GHXH 1SB1H 5FX6A 2C4FH 3F9EA 1AZ8A 1SPJA 1OP0A 2EI7A 1EP5A 1ETTH 5JPMH 1DX5M 4E06H 1TX8A 2BOHB 2SGDE 3M37A 3B9FH 1BJUA 1LHEH 3RMLH 5GWZA 1BHXB 4ZHAA 2BLQA 3UNQA 1UTJA 4ABJA 4HFPB 1AY6H 2HRVA 1BCUH 2BQ7B 1NROH 1KXAA 2VIPA 3RXAA 4K5ZA 2FOGA 1H9IE 1GBEA 3ZVEA 1MQ6A 4A6LA 3E3TA 1G3EA 1SG8B 2ZPQA 2OC7A 1C2FA 1GI2A 3F9HA 4ISIH 1V2MT 2SGFE 3RC6A 1W7XH 2BLOA 3EQ0H 3T28A 4UFFH 1GHZA 2FOAA 1XUHA 1A5GH 3GYMA 1CGHA 3LOXA 1E35B 4AB9A 2QAAA 2VWOA 3T25A 3VPKA 2ZCLP 1K22H 2YNAA 2Y5GA 1EOJA 1F7ZA 1P2OA 2VVUA 3PLKA 3SV8A 1BOQA 1S5SA 1WQVH 2PSYA 1OX1A
chains in the Genus database with same CATH superfamily
4A5TS 5C17A 2ZU4A 4ABDA 1GHBG 1NT1A 1F0TA 3SNBA 2ZO3H 1YKTA 2W7SA 5FCRA 1FAKH 4PROA 2QXJA 2BDHA 3ZZ8A 3F0OA 1ABIH 5FCKA 1QHRB 1H8DH 4IC5A 2Z3CA 2FM2A 2OQ5A 1OYTH 3TK9A 3UWJH 3A85A 4ZCNA 3STIA 2GCTC 1UMAH 1HNEE 2WPMS 1KMHB 4JK5A 5GCHG 1HAYB 2R2WU 2WUCA 1S81A 2Y7XA 1MTNB 2H9EH 5LPRA 2WPJS 1JBUH 3UNRA 2G51A 1V2VT 3KCGH 1TIOA 2JJ2D 3FP6E 5HIYA 3BEFB 2W7UA 4ABBA 2WYGA 1O2XA 1ID5H 3AVZA 1SBWA 3P95A 8KME2 1HGTH 1XVMA 1GVLA 1P11E 2BD2A 3A83A 2VIDA 1XUJA 3SI4H 2FEQH 3GCHC 1RTLA 3RLWH 2C8WB 3SU6A 1G3BA 7GCHF 2DUCA 3UNSA 1KXFA 1O5FH 2F91A 1QB9A 2VIWA 1E38B 3KYFA 4KP0A 1UTMA 5PTPA 1KXDA 4CHAC 4O97A 2ZHFH 2F9PA 4Y8YA 4FUIA 1AD8H 1SVPA 2O8UA 4CRBA 7KMEH 2AIPA 4ISOA 4NG9H 4B73A 5EJ1A 4XFQA 1O2HA 1F0RA 1CA8B 2CV3A 3QN7A 2VH6A 1K9OE 5C67A 2H1UA 4U30A 3RXCA 3UR9A 1D6WA 4JCNA 2TGTA 2G55A 1AN1E 1L1JA 1O38A 3P70B 5CHBA 1XKAC 1YPJH 2KX4A 3VB7A 3M3SA 3MTYA 4GUXA 1D3QB 3U8TH 1IQLA 1G2MA 4FU9A 4UEHH 5EGMA 2H6MA 5FPYA 2D26C 3FFGA 3W95A 1QB6A 2GCHG 1OHHD 1SQRA 3SU2A 3ZZ9A 1CA0C 1G30B 2OXSA 4X2YA 2PR3A 4ABEA 3P6ZB 4Z0KA 3I78A 2PKSB 1V2ST 2WZQA 1NN6A 1TX7A 2GKVE 4MNXA 1ZHPA 1MKXH 3RXJA 1P02A 4FUCA 3CENA 2EY4C 1YBWA 1EJAA 1T4VH 1U6QA 1CU1A 1TQ7B 3ZV8A 1HAVB 1EAXA 1EKBB 1MCTA 3E91A 1UHBA 3LDXH 1P12E 3A82A 5FAHA 2J94A 2ODPA 1KTSB 1OWEA 3S9BA 1NBME 1Y5UT 2FOEA 1C1RA 4J1YA 2GDDA 1P2NA 1THSH 3Q3KA 1C1WH 2VWMA 4NZLA 3A81A 4Q80A 1GI5A 4RT1A 3BIVH 2TGPZ 4DY7B 1HJ8A 1A46H 2FXRA 3TK6A 1QCPA 5C0TA 1V3XA 2AGEX 1PYTC 5ESBA 1DICA 1WSSH 4WF8A 3OY5U 1SLVB 4X6NA 4E7RG 3TGJE 1OP2A 4K3JA 2KFWA 3T26A 4FUGA 1K2I1 3GY5A 3CS7A 3ENSB 4XSKU 1C5OH 3SU0A 3GCHB 1C5UA 4NWKA 2M5TA 3KNXA 4NCYA 5DPAA 3A8BA 1PQ8A 4YM9A 3AASA 3QO6A 2HGTH 2V3MA 1KYNA 1FY4A 4DCDA 1UCYK 3H09A 2ZC9H 4OS5A 4GLYA 1ZHMA 1ZZZA 3FN8A 2W5EA 4JYTA 1KDQB 2PV9B 4NIXA 1TGSZ 3CP7A 2P3UB 1PPZA 2BLWA 2JH5D 4DJZB 1G37A 4BAQB 5L2YH 2AH4X 1J9CH 2H2ZA 2PUQH 1UTPA 1O2ZA 1LMWB 1WXRA 3ZZCA 4I8KA 2ZFSA 1P10A 2R0LA 3GCNA 4AG2A 1GI7B 3PMAB 4MDSA 8GCHF 2A5KA 4BOHA 3UY9A 3MNSA 1SGPE 1A2CH 4GHTA 2LELA 1DOJA 2A4RA 1LPGB 1ZRBA 3NUMA 2ANWA 2FLRH 3D62A 4AYVB 4F55A 1C4Y2 3HKIB 5T1VA 3BSQA 3SNCA 1SFQB 2AMQA 1DM4B 4K60A 4B6FA 1TPOA 1WCZA 1GJAB 4UD9H 3SUFA 4KTSA 3TJUA 2AFQB 3EE7A 4XBDA 1GVZA 1D6RA 2PP6A 1C5RA 1JRTA 2BD7A 1UJ1A 1HDTH 2JJ1D 2QC2A 1E79D 1C5SA 1DY9A 4ABHA 3NK8A 1YGCH 2BLVA 1E34B 4A92A 1ZSLA 3PRDA 3W1EA 3UB0A 4TWWA 3ZZBA 3QLPH 2JETC 2G8TA 4TYDA 4P02A 2V0BA 5HGGA 2G52A 4I31A 4ZAEA 4F49A 3F9FA 3ATWA 3BTGE 2Z3DA 2UUJB 2ZHQH 3MWIU 2Z9IA 1Z8RA 3MOCA 1FLEE 1SGCA 3LJJA 3EA7A 1C5WB 3GY7A 4HGCA 4JZFH 2AGGX 1C1MA 3PMJA 1ELCA 2OBQA 2ZU2A 3RXFA 1E36B 5EW2H 1WDIA 1KY9A 4HZHA 2ZKSA 1DXPA 2Z3EA 1BHXF 1MKXK 2F3CE 1EATA 3M7QA 5A8YA 1KTTB 1BUIA 3EAJA 1UK3A 4ZH8A 4B2CA 1BT7A 4DIHH 1V2UT 1FZZA 3GY3A 2THFB 3SJ9A 1TMBH 4M9FA 4X8VH 2P8OC 1C5NH 1Y3YA 2STAE 1ABJH 1VITF 1WBGB 1GHYH 1QRXA 3OFND 2OK5A 1BA8B 1ELFA 5EQSA 4MPUA 4DURA 1OYQA 1OSSA 1P9SA 3CS0A 3NZIA 1GHBF 2YMSD 1FIWA 3MH6A 5LPEA 3NRLA 2Y82A 1O30A 2ZIQH 3KQDA 2B5TB 2SGEE 4CH8B 2ILNA 3O8BA 2AEIH 1IHTH 1KIGH 1O2IA 1OWIA 4JMYA 5JBAS 4ISLA 5EXMA 2YMSC 5TCAA 1TGNA 4Y6DA 1C2KA 1HAXB 1P06A 5L6NH 3QUMP 4K1SA 5DP7A 1UCYE 1SOTA 1QA7A 4Q7ZA 1NRSH 2UUKB 3R3GB 4AGKA 1ZTJA 1FY1A 2VGCC 4A1XA 3UR6A 1XXDA 3GOVB 5DKMA 1O2WA 2OC8A 4TPYA 3A84A 5GCHF 1QQUA 2G4TA 2J9NA 3SU4A 4JYVH 2NU2E 3RLYH 4XE4A 4ASUD 3E16B 4CREA 1O3LA 3RXKA 3OSYA 1EPTB 1NM6A 4DVAU 1MTUA 2ASUB 5DP6A 3SJ8A 1C5MD 2A2XH 2L6OA 3PMHB 3RMNH 1XVOA 1C1UH 2BVXH 5K0HA 3RDZA 3BEIB 1FY3A 2PUXB 4IMQA 1QIXB 1AVXA 3RMMH 1TPPA 2WYJA 5K7RA 3L33A 2SNVA 1IQGA 5T6GA 5ESTE 4FUHA 1AKSA 4A1TA 2Y81A 3MFJA 1PPFE 3ESTA 3OEED 2GVFA 3SBKA 1HJAB 2BDBA 2BYAX 2ZHEH 3MNXA 5CHAC 1WV7H 2Z94A 3QX5H 4X2VA 1ZLRA 5DGJA 4U2WA 1ZMLA 1OP8A 2HPPH 4LOYH 4Q2KA 4B74A 4DT4A 1MU6B 4KGAA 3RXQA 2VU8E 1O32A 2WV5A 4FOUC 1Y3WA 4XOJA 2ALPA 5EG4A 2GT8A 2GCHF 2F9BH 3HATH 3QDZB 1W11U 3LC3A 5A09A 4IMZA 3K6ZA 4B71A 1SGQE 1PQ5A 4RI0A 1NRNH 2BX3A 2H5DA 4XBCA 1B5GH 4UFDH 4F4OC 1QL7A 2BY9X 2FYRA 1ELEE 4LZ1H 4NGAH 1YCPM 4X1PU 3Q00A 5EW1H 1SFIA 4X1RU 4ZHMU 3I29A 2BD3A 1LPZB 1NU7B 1G9IE 3VG8A 1JRSA 4UDWH 3M7TA 2J2UA 2KAIB 1TOMH 2P95A 3RXUA 2BD8A 2IJOB 2K1QA 2BM2A 4A1VA 1O3AA 2ZF0H 4X1NU 1GMHG 3A7YA 1XM1A 2ZPSA 1HLTH 3TH2H 3BTKE 3ZZ3A 1NZQH 5F6MA 1ZOMA 3OEHD 2ZQ1A 3HK6B 2F4LA 1GJ8B 5J4SA 5DO4H 3P17H 2ZDAH 1BDAA 4BNRA 2PTCE 1C1SA 1VJAU 1O5BB 1JIRA 1ZSKA 4H4FA 3SYJA 4B1TA 1LCYA 4NWLA 2GDEH 3M5MA 1T8MA 3RP2A 1MD8A 4MG3A 5C2ZA 1TA2A 1T8NA 4UFGH 4RN6A 5A8XA 3SUGA 3FVFB 2C90B 3A88A 4RKOB 1DXWA 3BV9B 4K8YA 2J95A 1ORFA 1FXYA 1RTFB 3SU5A 1QURH 1THPB 3M3TA 2HVYB 2P16A 3PV2A 2YNBA 1UTQA 3U1JB 1UVPA 1UTLM 2WUBA 4NIVA 1ANCA 3TJOA 1BB0B 1AUJA 2Q6FA 1JIMA 1YPKH 2XBYA 1UVSH 3T62A 3M36A 3PTNA 3RXEA 1GHVH 5E0GA 5CMXH 2BVSH 4Q63A 2H9TH 3MU8A 5GJ4B 2ZPRA 1DDJA 3MI4A 1BJVA 1J8AA 1FN8A 1FI8A 3MU0A 1YPMH 1DPOA 3AW0A 4UFEH 1EOLA 1Y8TA 1GBJA 1N6XA 3SV6A 2ZDVH 4YOGA 2GMTB 1GDUA 1BRBE 1LHGH 3KYGA 4OS4A 4RKJB 2HLCA 1IQKA 1K1JA 1ELGA 2DE9A 1Q2WA 1N8OB 1SGYE 2VINA 1LVYA 1MABB 3VEQB 1DUAA 1C5VA 3PYHA 1B0EA 1GI1A 2GX4A 3NWUA 2BX4A 2D8WA 3O8CA 4NIWA 3DSPA 3WWFA 2EQNA 5HM9A 3TPIZ 3UUZA 2BY6X 4GPGA 2NU0E 2XNIA 2ZG0H 1AE5A 1MAXA 2NU3E 1SI5H 2ZNKH 1GMDG 4NA7A 4YXWD 2AMDA 2IPQX 4X6MA 1E1QD 2B8OH 2R3YA 2TGAA 3TNTA 5T3HA 3GISB 2H9HA 1CSOE 1P03A 3WWBA 2FP7B 3GY4A 1TNIA 2XWAA 3SN8A 1W13U 1FPHH 2K0QA 5KGOA 3TITA 2WPDD 5AHGH 1Z71A 1COWD 4THNH 1K0HA 5A2MH 1CT4E 1C5ZB 1QFKH 2JH0D 2Y5HA 2WSSD 2Q6GA 2BHGA 1BMNH 2AYWA 1C1OA 1HAIH 4UE7H 3F6UH 1F2SE 2C8YB 1Z7KA 4OS2A 2ZA5A 1A61H 1GBDA 4I86A 1ZPZA 3RMOH 1VGCB 4ISHH 1XX9A 4KTUA 4DGJA 2RFKC 3U28C 2HPQH 1MUEB 2FO9A 4WWYA 1Z8GA 3SGQE 1SHYA 3FOAA 1AIXH 1QL9A 2C8ZB 2A7HA 1SGNE 3E90B 3GDSA 1CBWC 1H9HE 1TYNA 2FWWA 3D23A 1QBNA 1X7AC 4BXWA 1VCWA 1C2GA 3NCLA 1CHOG 3E6PH 3LGYA 1ZMJA 2RA0A 4B75A 3RU4T 2EEKA 3E1XB 1SQTA 1P2IA 1GI6A 3SI3H 1EASA 1O2OA 1SOZA 1UTKA 2ODQA 4K1EA 5FL7D 3RXBA 1LQDB 2WPIS 4I32A 1SLUB 1O5AB 2Y5FA 2BXTH 1MKWH 2TPIZ 1YLCA 2BVRH 1THRH 3C27B 2BDIA 3PB1E 4KTCA 4YTAA 3SUDA 5EPYA 1OWJA 4NA9H 1KLJH 1N1LA 1ZTLA 1FN6A 3TH4H 2A45B 1FDPA 1P09A 5FBEA 1GMCG 1VR1H 4OGXA 3ATLA 4ZMAH 1OXGA 1BBRK 1FNIA 3BF6H 1TPAE 1MMJN 1TPSA 3SUEA 1HBTH 1LHCH 3A89A 1EZQA 1EZUC 1P2MA 1NRRH 1S6HA 2GP9B 4YT6H 1QBOA 2XW9A 4O9VA 4X8SH 1ESAA 5B6OA 5A0CA 1IQEA 1O2QA 1A0LA 2UWOA 5G4BA 1K1NA 1UHBB 4B76A 3N7EA 3ZZAA 3I77A 4BXSA 3GDUA 5E2PA 1P04A 4DIIH 1T8LA 1MAYA 3SZNA 1BTYA 3M3VA 4WVPE 6GCHG 1XKBC 4IW4E 1GHWH 1S83A 3VB6A 3A86A 1OWHA 3M7UA 1P3CA 1YPHC 3SHCH 4JZIA 1GPZA 1T32A 1QRZA 2G00A 2VNTA 1HIAA 1C2MA 3PWCA 4VGCC 1C9TA 1ELBA 1HXEH 3HGPA 2A5AA 3SV9A 1ARCA 2QE7D 3LC5A 5T6FA 3ZYEA 3ATIA 3L6PA 1BTXA 1P0SH 2Y80A 1UVOA 2FI4E 2J5UA 1RXPA 4E05H 2IJD1 5C0UA 5CDFE 3ZVDA 1YPLH 1FAXA 1O3DA 1TMTH 1OKXA 3FZDA 1C5LH 3HGNA 4CBNA 4AN7A 4LXBH 3UIRA 4INLA 4NIYA 1TBRH 2V3OH 4GCHF 2HVXA 4I8JA 4D9RA 2OUAA 2GCTB 2BTCE 2TRMA 4NSVA 1NRQH 4BAHB 1V2QT 4WMDA 2F9VA 5FX5A 1QNJA 1TGBA 1C2JA 5AFYH 1BTWA 3LKWA 2IPHA 1CBWB 3FP8E 1FMGA 2O9QA 1GJ4H 2QF4A 3H7TA 3QK1A 3E8LA 3A7XA 5B6LA 2BDCA 2KCAA 1SGRE 4JK6A 1TONA 4X8UH 4ASHA 1E37B 5T6DA 5FBIA 1J14A 1GCDA 4QT8C 2GT7A 1C4V2 2WPKS 4P00A 4ZHLU 3A8DA 4AORA 3FKSD 1GG6C 2AERH 1J16A 1K28D 3ZV9A 2P3TB 1S6FA 1TGTA 3S69A 3BTFE 4X2XA 5ABWA 3UREA 3SNDA 1BMMH 2XOKD 1YCPH 1GMHF 1IQJA 3ZVBA 3OY6U 1C5TA 2OBOA 2FOMB 3W94A 4CHAB 3P8FA 2NU1E 4CBOA 4HG6A 1QL8A 5IDKA 3TJNA 1CT0E 1YY3A 1Y3XA 1G3DA 1XMNB 4INHA 3KQCA 3KN2A 4IBLH 1ZSJA 1CGIE 1F0UA 3GCTF 1HXFH 3LGIA 3UWIA 3KEEA 3SORA 3GCOA 4AFQA 1AFQC 4YOIA 1O2SA 1EJNA 1W10U 1UTNA 1V2JT 3SV2H 3AK5A 3F2HA 2QIQA 3HK3B 4ZKNU 1YLDA 1WYKA 1BBRE 4DG4A 4A7IB 1H8IH 1K1OA 1SQAA 5C5NA 2VJ1A 1ANBA 2FOCA 2ULLA 4XRNA 1CO7E 2PTNA 1SR5C 4XD7D 2ZU3A 3RXIA 2QCYA 4YLQH 3SZEA 2OQUA 3MHWU 2FDAA 4Y10E 2A32A 1MKWK 1P05A 2IOTA 5C3NA 1CA0B 1DSTA 3D49H 3S7KB 4BAKB 1ZJKA 1ZMNA 1K1IA 4X8TH 5EOKA 2VWNA 1EJMA 1W0KD 1B7XB 2PKAA 4VGCB 1BRAA 5F8TA 4ACAA 4J2YB 1HAHH 3STJA 3SU1A 3C1KA 5EJZA 3GY6A 5HYOA 1HYLA 2V3HH 1IQHA 2J92A 1O3JA 1O2RA 2RA3A 3MU1A 2ZQ2A 2QF3A 5GIBA 4KKDA 2ZECA 7LPRA 3F3BA 3K2UA 1GHAG 2ZTYA 1A3BH 1GCTC 1PQ7A 2BY7X 1C2DA 1ELTA 2QXHA 4JZDH 4CRFA 1EP6A 3QTOH 2FI3E 4ABGA 3EA9A 2A7CA 4R0IA 3TGKE 1LVOA 3AAVA 1TABE 1TNKA 1HJ9A 2EI6A 3IITA 2BD5A 1ZGIA 1ZPBA 2IN2A 2XC5A 3JZ1B 3UTUH 3A87A 4NFFA 3QWCH 1D3TB 2Q6DA 3MO3A 3EYDA 1AGJA 1PPHE 1GMDF 1O2VA 1RTKA 3RXVA 9ESTA 1MBMA 1AU8A 1TNJA 1H1BA 5DP3A 1GJ5H 3U8RH 5C5OA 1EAWA 1PPGE 5GDSH 1GBBA 1GG6B 3A7VA 3VXFH 2ZDMA 2XTTB 2HNTC 2DE8A 2VIQA 2CHAC 4FUDA 2A4OA 4Y11E 1ZGVA 2W3KA 3N7OA 5GNDA 3U1IB 3BTTE 5EPNA 1OPHB 2XBVA 2FS9A 1HRTH 1QBVH 1RIWC 1Z6JH 3V13A 5DP4A 1T31A 2CMYA 3SU3A 1C1NA 1TALA 5E0JA 1O3OA 3SJKA 2A31A 4X6OA 1C1PA 3WY8A 2A7JA 1T7CA 2RDLA 2XBXA 3PV4A 1O31A 2CK3D 5E8EH 2A0QB 2VWLA 1FY5A 3ATKA 3VGCC 1ANDA 5KECA 2SFAA 2XYAA 1TMUH 2A2QH 1FPCH 1CHOF 3CNRA 4CR5A 4YLUA 2ZI2H 3PROA 4CR9A 1YCPK 1O2TA 4O3UA 3V0XA 4TY6A 2ZCKP 3A80A 2G5VA 2ZP0H 5JBBS 4UONA 4D76A 3K65B 4TSFD 2Z9GA 1GI0A 1AWFH 1IQMA 2B7DH 2QF0A 3TK5A 5I46H 2SGQE 2JIZD 1QJ6B 2XNDD 3U98H 1DITH 3ZVCA 2BQ6B 2J98A 4BTUB 2ZEBA 1D9IA 2RCEA 1GMCF 4Y79A 1JXPA 2JETB 1DWBH 4H6SB 1GBMA 1L4ZA 2VVCA 3BG8A 3S9CA 3M5OA 2CJIA 3SQHE 5EXNA 1O3IA 4RSPA 4B2BA 1GI9B 1DSUA 1NU9A 3BN9A 3A8AA 2EI8A 4X1QU 3RM0H 1ELDE 4AOQA 1O2YA 4BAMB 4Y8ZA 3B23B 1XUGA 1W0JD 1H9LB 1UK4A 2CN0H 4FUBA 3BTQE 1MD7A 3BTHE 3LGVA 2HWLB 1EPTA 1GBCA 1FX0B 2Z9KA 1EB2A 4ZROA 1C2EA 3BG4C 2M2AA 3N99A 6GCHF 1GBHA 4CRGA 1QZ8A 2J38A 1DVAH 3ODDA 4MLFB 1SQOA 2P8OB 1YYY1 1TOCB 1L4DA 1O0DH 1HAGE 2UUFB 1BRCE 1MH0A 6LPRA 2RDEA 4Y76A 1O35A 1DLEA 4IN2A 2ANYA 3R0FA 1ELVA 3UAIC 5C94A 1A4WH 1MCVA 2FTLE 1F0SA 1YPHE 4CRCA 1Z6EA 3BTME 4HI3A 1TNLA 5EJLA 1V2PT 3A7WA 1HUTH 1EZSC 2LNCA 5HMAA 1GBKA 1MZAA 3BTEE 3TH3H 1VITH 1KXCA 2YOLA 1RIWB 2R3UA 1ESBA 2W6ID 2YMSB 3PTBA 4NFEA 2WPHS 3F1SB 3KHVA 1O3PB 1YF4A 3MU4A 2O8LA 1GBIA 1L2EA 1S6LA 1IAUA 2VIVA 2VGCB 4X6PA 5HXFA 1O5EH 1WQSA 5A0AE 1SL3A 1GDQA 3F68H 1C9PA 2ZFQH 1LPKB 3AAUA 3MNCA 1KLIH 4TT3D 1TB6H 2WINI 1T8OA 1Z1IA 1ZRKA 1TNHA 2GV7A 4OM9A 3GY8A 1PJPA 2BZ6H 4E7NA 5DP9A 1K1PA 4I8GA 1CQQA 4B2AA 1A0HB 1NY22 2XBWA 1Z8JB 1L1NA 4ACBA 1O3KA 1G2LA 1FUJA 3GY2A 4AFUA 3LT3A 5JDUB 4FVBA 2OC1A 2AHME 3MH4A 1O5GH 1MZDA 2UUYA 1UVTH 1FJSA 3MQKC 1SHHB 1E1RD 1GJBB 4K1TA 1RD3B 2WHXA 1C5YB 1P8VC 1SGEE 2XC4A 3DD2H 1UVUH 8GCHG 2ANKH 1UW7A 2KR7A 1EX3A 2QGRA 5CHAB 1TFXA 1A0JA 3TU7H 1GDNA 2VBCA 1G3CA 3VB5A 1DY8A 3PMBB 1WTGH 2QV1A 1C2HA 1C4U2 1GBLA 5DK1A 1TGCA 1TRMA 1O2NA 4YZUA 1EAIA 2QXGA 1HFDA 3TIUA 2OINA 6ESTA 1EFRD 1Y3UA 1AQ7A 2WV4A 2ZGXH 2BD4A 1VKYA 3BG4B 2ALVA 1GWAA 3SJOA 3SGAE 2GGVB 3PM3A 1KXEA 1VZQH 1S85A 1BTHH 1S0QA 2P3FH 2CXVA 1YPGH 1DS2E 4WXVA 1IHSH 1DUEA 3AW1A 1V2NT 2OP9A 3KL6A 3LGTA 1H4WA 3QGNB 1P2KA 1KLTA 1WTHD 1GL0E 2HOBA 2F43B 3F9GA 4I33A 1SMFE 3F0PA 1SGFG 2QYIA 1SGFA 2JH6D 4I8LA 4ESTE 2H5CA 1G32B 1M9UA 1ZTKA 1W7GH 1NS3A 1V2LT 4AZ2B 1XUIA 4FU8A 5SGAE 3L3TA 2STBE 1C1VH 1GHAF 8LPRA 4D7GA 2OC0A 1O2GH 1MTWA 1AVWA 2VIOA 4BTIB 3G01A 2FODA 2K8IA 1C5PA 1A5HA 3SW2B 1QTFA 2BDGA 1AZZA 3MH7A 1ZHRA 2PKSC 2FLBH 4NSYA 3PLBA 2ESTE 1A3EH 1VITG 3RXLA 5C1UA 3UFAA 2NWNA 2FTMA 4D8NA 1OOKB 4F48B 1V6DA 2ZU1A 3M35A 2AMPA 1DT2A 1W8BH 3DFLA 5KEDA 1YLNA 4RT0A 3MMGA 3FAOA 1FQ3A 1DLKB 1E0FD 3RXGA 1RS0A 1TX6A 4MNYA 1INCA 1A5IA 2B0FA 5A0BA 2SGAA 4BAOB 1C1QA 2F83A 5TCCA 2W6JD 3UOPA 2F9OA 5C1YA 2VVVA 1F92A 2WV9A 3VB4A 2Y6TA 2UWPA 3RXMA 2OLGA 1QY6A 2FS8A 1CE5A 2D2DA 1C2LA 1UCYH 1UTOA 4O03A 3VFEA 2AIQA 1BMAA 1SGDE 1AE8H 2PGBB 2ZDLA 4H42U 1P2QA 1MU8B 4K2YA 3VXEH 2BD9A 3ITIA 3MO6A 5C1XA 1GJ7B 3LGUA 4ABAA 1QGFA 2HNTE 3T5FH 2KCPA 1W14U 1JOUB 1S82A 1SLXB 3DUXH 3FP7E 4FU7A 3LH1A 3MU5A 1XUKA 2QY0B 4HTCH 5E0HA 2ZFFH 3V7TA 4TPIZ 3RU4D 2FX4A 1P01A 1NFXA 1EZXC 1O3HA 3V12A 5LGOA 1JWTA 1HCGA 3OU0A 4Y7AA 2XXLA 5EQQA 3SHAH 4DT7B 1O3FA 2G5NA 4ZKSU 1V2WT 3SNEA 3KQ5A 1RRKA 2NU4E 3KF2A 2O8TA 3UOUA 1HIAB 3PRBA 1FV9A 1O2JA 2G81E 3GYLB 1F5KU 5EODA 8ESTE 1NC6A 2HALA 5JBTA 5FPSA 1H8ED 4WMEA 1TRNA 3ZZ7A 1SLWB 1LHDH 2JDID 2P94A 4JZ1A 1TE0A 5CE1A 2XCNA 2ZFRH 2ZHDA 2PSXA 3S0NA 3OE7D 2F9UA 1W12U 1PFXC 2FPZA 1O33A 1T4UH 1K1MA 2ZGHA 2BDYA 2BOKA 5GPIB 1GJ6A 4I7YH 4Y71A 3TLOA 4H6TA 2BQWB 2P59A 1BZXE 3DFJA 4FXGH 5JB9S 5JB8S 1Z1JA 2I6SA 1QQ4A 3M5NA 2VH0A 5IK2D 4WMFA 4IN1A 3MO9A 2W26A 3EA8A 4XDEA 3SJIA 3Q77A 4BANB 3TVJB 2UWLA 3LONA 2ZDNA 2ANMH 4OGYA 1P57B 1GJDB 5LPFA 1B0FA 2HLDD 3DA9B 3BTDE 5L30H 1WUNH 3OTPA 4FUFA 1DFPA 3LGWA 2A4QA 3SO3A 1BMFD 4WH6A 2CF8H 1EAUA 3T2NA 1LVBA 5DG6A 1MTVA 1LKAA 1YPEH 3QTVH 2QXIA 1LVMA 4WY3A 1TBQH 2P93A 2Z7FE 1O2PA 1ZJDA 1Y59T 2J4IA 3IWMA 3V3MA 3Q76A 3Q3YA 3P92A 3RXSA 2CF9H 1D4PB 1YM0A 2R0KA 4ZKRU 3Q3XA 5FXLA 2OD3B 3RXDA 2EC9H 1PYTD 2B9LA 4ZXXH 1NFWA 1VCPA 6CHAC 1OWDA 2PWXA 2GZ7A 1O2KA 2GZ9A 2Q1JA 1HAZB 3LU9B 1P3EA 1NTPA 5HKKD 1O3MA 3P8GA 3T29A 4Y7BA 2C8XB 1AVGH 3QZRA 1TBZH 1NESE 4SGBE 1RFNA 2LP6A 4TY7A 1HAVA 1LKBA 1AB9C 4MPWA 1TQ0B 1G36A 4CH2B 2ODYB 3TJVA 3GS9A 4MTBA 5JYIA 4Y0YE 1NPMA 4DOQA 3H5CB 1TLDA 2EA3A 4X1SU 9LPRA 2HNTF 1QJ7B 3MH5A 3ODFA 1Z8IB 1DWDH 2PKAB 2Z6BD 3SNAA 1QR3E 3BTWE 4GAWA 1SGTA 4I8HA 5TJXA 1MQ5A 1GGDC 1GI3A 1Q3XA 1C1TA 3RM2H 2ZTZA 4TWYA 1AMHA 5EQRA 2TBSA 2XWBI 3IG6B 4IGDA 1ZYOA 2AS9A 1D3DB 1O5DH 3HKJB 1IQIA 3NKKA 3KIDU 1FY8E 3WW7A 5BPEA 1PQAA 4ZUHA 3S7HB 5DP5A 2R9PA 1ELAA 3RXRA 2ZTXA 3ELAH 3KQEA 4GHQA 2TIOA 4ABFA 2FMJA 3OAAD 1BTPA 2BZAA 4OS1A 1N6YA 1TRYA 2FIRH 3O8RA 3K9XB 1EQ9A 1LQEA 2PLXA 3VB3A 1EPTC 1FIZA 2Y7ZA 2VB0A 4Q7YA 3GICB 5A8ZA 2FX6A 5HM2A 2ZWLH 2OTVA 2QN5T 4GSOA 1O5CB 2W3IA 4GVUA 5F8XA 3FANA 1KDQA 1SC8U 1IQNA 1GBTA 1UK2A 4U01A 4YT7H 1V2KT 2A5IA 3A7TA 1A7SA 1P2JA 4SGAE 1GJCB 1DWEH 4YOJA 2C3SA 5IYTA 3ZZ6A 2FOBA 1XXFA 1NO9H 1W2KH 1LO6A 3GDVA 5DN6D 2Z9JA 5EU8A 1BTZA 1S0RA 2KCYA 1TA6A 1HJAC 1W0ZU 2XCFA 1Q31A 1V2TT 4BTTB 4Y0ZE 1K1LA 4D9QA 2ZGCA 2PHBA 3OTJE 1OS8A 4U32A 1WAYB 4OS6A 1QJ1B 5E2OA 4JZEH 1ACBE 3NXPA 4Y8XA 5I25A 4CRAA 2J34A 3M61U 1V2OT 6CHAB 1LHFH 1PPCE 4K69A 1TAWA 1FONA 3A7ZA 4M7GA 2SNWA 4Z1MD 1GVKB 3BEUA 1W3CA 1Y3VA 2I6QA 4LZ4B 3DT0H 1O2MA 1KXBA 4MQAA 1GJ9B 1QB1A 3LH3A 2ZGJA 3PO1C 5EXLA 4D7FA 1S84A 3PV5A 1DANH 1AB9B 1W0YH 2BB4A 2V7QD 3URCA 4IC6A 2SGPE 3DSOA 5DP8A 1LTOA 3RXHA 1C5QA 4Q4LA 2FOHA 2RG3A 1RJXB 4WXIA 1AFQB 2GJGA 3M5LA 1Y5BT 3MYWA 5AFZH 3UQOA 5ETXA 2GTBA 1BITA 1GGDB 2OCVB 4FUJA 2D1JA 1AKSB 1CGJE 1ZPCA 2J98B 2V35A 3U9AH 3TGIE 4OS7A 2CGAA 2R2MB 1F5RA 1HB0B 4AG1A 3ATMA 5F03A 7GCHG 3LJOA 3B8JA 1K21H 1GBFA 1WU1A 5F8ZA 1SSXA 1YC0A 4ZXYH 5J4QA 1OWKA 1BIOA 2ZFPH 1C5XB 1O2LA 1V2RT 5EIYA 2XRCA 3ZZDA 3OYPA 1MTSA 3QGJA 3URDA 1YWUA 4AB8A 3JZ2B 2FOFA 1TNGA 2GD4B 4ZKOU 5FHTA 5L2ZH 4ISNA 5H4IB 3RC4A 2KZ4A 3SOSA 3UQVA 4FETA 4X2WA 1AUTC 2O8WA 1AFEH 1O3EA 1PPBH 1VCQA 3NPSA 3TNSA 1L1GA 2FESH 4DW2U 3A8CA 4WH8A 2BY5X 1SGIB 1O3NA 3E0PB 1RGQA 4NZQA 4WJG2 4FUEA 1GCTB 1UO6A 3ZVGA 2ZCHP 2G4UA 3DHKH 2BY8X 1HV7A 1GI8B 2TGDA 4AFSA 2PGQB 3RU4E 3T27A 2V6NA 5F53A 3RUOA 3S9AA 1HPGA 5HIZA 4B6EA 5FPTA 3DCLA 3LPRA 2A1DB 1NBMD 1IQFA 1BMLA 3ZIAD 1ARBA 1O3CA 2WPLS 3PLPA 1XUFA 4MVNA 1LDTT 3BIUH 3H7OA 3EDXB 3RXPA 4MNWA 4AFZA 1ETRH 1O39A 1AWHB 2AGIX 2PW8H 3SV7A 1O36A 2GMTC 3PWBA 2FI5E 4YESB 1H8HD 3ZVAA 1O2UA 1KSNA 4KELA 1N8OC 3O8DA 2XC0A 5GXPA 4AYYB 2O8MA 3K6YA 1DWCH 3PO1B 4CRDA 4GCHG 2ZU5A 2CHAB 1O37A 5C20A 3SGBE 3ZZ4A 1AI8H 4O3TA 5BRRE 1ZR0A 1CT2E 1NRPH 2ZDKA 2L74A 1ETSH 2ZHWH 1IOEA 4Z6AH 4YO9A 3KGPA 4AX9H 4XBBA 3ZVFA 5AVDA 2F9NA 1VJ9U 3LIWA 5JBCS 3U69H 1HAOH 1O3GA 1EB1H 1MBQA 4ABIA 1JMOH 2GV6A 1ESTA 1WOFA 1A1RA 4AGJA 3RC5A 1J17T 1P9UA 4MPXA 3VGCB 1GBAA 1EXFA 4IS5A 1BTUA 3UPEA 5DJ7A 4X0WU 1NFYA 1TWXB 3RXOA 2GZ8A 2PFEA 3OX7U 1NFUA 1YP9A 4R8TB 1ANEA 1BRUP 1O3BA 2KM0A 2ZZUH 7ESTE 1D3PB 3GCTG 2FYQA 1AHTH 4JYUH 3P8OA 1CVWH 3E0NB 4MPVA 3MNBA 2BMGB 2C93B 3D65E 3KQBA 1VGCC 2ZGBH 1QRWA 3FZZA 1GL1A 1BQYA 2KAIA 2LPRA 1AO5A 3N7DA 1PPEE 3QZQA 2JKHA 4Q7XA 1F5LA 1MTNC 1BBRH 4LK4A 4FVDA 2QA9E 5AF9H 3EE0B 3RXTA 3ZZ5A 2FZZA 2KCOA 4MNVA 2ZFTA 1HAPH 4K8BA 3U8OH 1GI4A 1L0ZA 3SQEE 4INKA 1O34A 2BXUH 1EUFA 3HPTB 1Y5AT 2A4GA 2BDAA 3EGKH 4NA8A 1J15A 1QA0A 5LH8A 1DE7H 3ZYDA 2Z9LA 3P8NA 1C2IA 1CHGA 1GHXH 1SB1H 5FX6A 2C4FH 3F9EA 1AZ8A 1SPJA 1OP0A 2EI7A 1EP5A 5DSFA 1ETTH 3FO8D 5JPMH 1DX5M 4E06H 1TX8A 2BOHB 2SGDE 3M37A 3B9FH 1BJUA 1LHEH 3RMLH 5GWZA 1BHXB 4ZHAA 3F2GA 2BLQA 3UNQA 1UTJA 4ABJA 4HFPB 1AY6H 2HRVA 1BCUH 2BQ7B 1NROH 1KXAA 2VIPA 3RXAA 4K5ZA 2FOGA 3F2FA 1H9IE 1GBEA 3ZVEA 1MQ6A 4A6LA 3DSGA 3E3TA 1G3EA 1SG8B 2ZPQA 2OC7A 1C2FA 1GI2A 3F9HA 2J97A 4ISIH 1V2MT 2SGFE 3RC6A 1W7XH 2QF5A 2BLOA 3EQ0H 3T28A 4UFFH 4AC9A 1GHZA 2FOAA 1XUHA 1A5GH 3GYMA 1CGHA 3LOXA 1E35B 4AB9A 2QAAA 2VWOA 3T25A 3VPKA 2ZCLP 1K22H 2YNAA 2Y5GA 1EOJA 1F7ZA 1P2OA 2VVUA 3PLKA 3SV8A 1BOQA 1S5SA 1WQVH 2PSYA 1OX1A 1SKYE
chains in the Genus database with same CATH topology
4A5TS 5C17A 2ZU4A 4ABDA 1GHBG 1NT1A 1F0TA 3SNBA 2ZO3H 1YKTA 2W7SA 5FCRA 1FAKH 4PROA 2QXJA 2BDHA 3ZZ8A 3F0OA 1ABIH 5FCKA 1QHRB 1H8DH 4IC5A 2Z3CA 2FM2A 2OQ5A 1OYTH 3TK9A 3UWJH 3A85A 4ZCNA 3STIA 2GCTC 1UMAH 1HNEE 2WPMS 4JK5A 5GCHG 1KMHB 1HAYB 2R2WU 2WUCA 1S81A 2Y7XA 1MTNB 2H9EH 5LPRA 2WPJS 1JBUH 3UNRA 2G51A 1V2VT 3KCGH 1TIOA 2JJ2D 3FP6E 3BEFB 2W7UA 4ABBA 2WYGA 1O2XA 1ID5H 3AVZA 1SBWA 3P95A 8KME2 1HGTH 1XVMA 1GVLA 1P11E 2BD2A 3A83A 2VIDA 1XUJA 3SI4H 2FEQH 3GCHC 1RTLA 3RLWH 2C8WB 3SU6A 1G3BA 7GCHF 2DUCA 3UNSA 1KXFA 1O5FH 2F91A 1QB9A 2VIWA 1E38B 4KP0A 1UTMA 5PTPA 1KXDA 4CHAC 4O97A 2ZHFH 2F9PA 4Y8YA 4FUIA 1AD8H 1SVPA 2O8UA 4CRBA 7KMEH 2AIPA 4ISOA 4NG9H 4B73A 4XFQA 1O2HA 1F0RA 1CA8B 2CV3A 3QN7A 2VH6A 1K9OE 5C67A 2H1UA 4U30A 3RXCA 3UR9A 1D6WA 4JCNA 2TGTA 2G55A 1AN1E 1L1JA 1O38A 3P70B 5CHBA 1XKAC 1YPJH 3VB7A 3M3SA 3MTYA 4GUXA 1D3QB 3U8TH 1IQLA 1G2MA 4FU9A 4UEHH 5EGMA 2H6MA 5FPYA 2D26C 3FFGA 3W95A 1QB6A 2GCHG 1OHHD 3SU2A 3ZZ9A 1CA0C 1G30B 2OXSA 4X2YA 2PR3A 4ABEA 3P6ZB 4Z0KA 3I78A 2PKSB 1V2ST 2WZQA 1NN6A 1TX7A 2GKVE 4MNXA 1ZHPA 1MKXH 3RXJA 1P02A 4FUCA 3CENA 1YBWA 1EJAA 1T4VH 1U6QA 1CU1A 1TQ7B 3ZV8A 1HAVB 1EAXA 1EKBB 1MCTA 3E91A 1UHBA 3LDXH 1P12E 3A82A 5FAHA 2J94A 2ODPA 1KTSB 1OWEA 3S9BA 1NBME 1Y5UT 2FOEA 1C1RA 4J1YA 2GDDA 1P2NA 1THSH 3Q3KA 1C1WH 2VWMA 4NZLA 3A81A 4Q80A 1GI5A 3BIVH 2TGPZ 4DY7B 1HJ8A 1A46H 2FXRA 3TK6A 1QCPA 5C0TA 1V3XA 2AGEX 1PYTC 5ESBA 1DICA 1WSSH 4WF8A 3OY5U 1SLVB 4X6NA 4E7RG 3TGJE 1OP2A 4K3JA 3T26A 2KFWA 4FUGA 1K2I1 3GY5A 3CS7A 3ENSB 4XSKU 1C5OH 3SU0A 3GCHB 1C5UA 4NWKA 2M5TA 3KNXA 4NCYA 5DPAA 3A8BA 1PQ8A 4YM9A 3AASA 3QO6A 2HGTH 1KYNA 1FY4A 4DCDA 1UCYK 3H09A 2ZC9H 4OS5A 4GLYA 1ZHMA 1ZZZA 3FN8A 2W5EA 4JYTA 1KDQB 2PV9B 4NIXA 1TGSZ 3CP7A 2P3UB 1PPZA 2BLWA 2JH5D 4DJZB 1G37A 4BAQB 5L2YH 2AH4X 1J9CH 2H2ZA 2PUQH 1UTPA 1O2ZA 1LMWB 1WXRA 3ZZCA 4I8KA 2ZFSA 1P10A 2R0LA 3GCNA 4AG2A 1GI7B 3PMAB 4MDSA 8GCHF 2A5KA 4BOHA 3UY9A 3MNSA 1SGPE 1A2CH 4GHTA 2LELA 1DOJA 2A4RA 1LPGB 1ZRBA 3NUMA 2ANWA 2FLRH 3D62A 4AYVB 4F55A 1C4Y2 3HKIB 5T1VA 3BSQA 3SNCA 1SFQB 2AMQA 1DM4B 4K60A 4B6FA 1TPOA 1WCZA 1GJAB 4UD9H 3SUFA 4KTSA 3TJUA 2AFQB 4XBDA 1GVZA 1D6RA 1C5RA 1JRTA 2BD7A 1UJ1A 1HDTH 2QC2A 2JJ1D 1E79D 1C5SA 1DY9A 4ABHA 3NK8A 1YGCH 2BLVA 1E34B 4A92A 1ZSLA 3PRDA 3W1EA 3UB0A 4TWWA 3ZZBA 3QLPH 2JETC 2G8TA 4TYDA 2V0BA 5HGGA 2G52A 4I31A 4ZAEA 4F49A 3F9FA 3ATWA 3BTGE 2Z3DA 2UUJB 2ZHQH 3MWIU 2Z9IA 1Z8RA 3MOCA 1FLEE 1SGCA 3LJJA 3EA7A 1C5WB 3GY7A 4HGCA 4JZFH 2AGGX 1C1MA 3PMJA 1ELCA 2OBQA 2ZU2A 3RXFA 1E36B 5EW2H 1KY9A 4HZHA 2ZKSA 1DXPA 2Z3EA 1BHXF 1MKXK 2F3CE 1EATA 3M7QA 5A8YA 1KTTB 1BUIA 3EAJA 1UK3A 4ZH8A 4B2CA 1BT7A 4DIHH 1V2UT 1FZZA 3GY3A 2THFB 3SJ9A 1TMBH 4X8VH 4M9FA 2P8OC 1C5NH 1Y3YA 2STAE 1ABJH 1VITF 1WBGB 1GHYH 1QRXA 3OFND 2OK5A 1BA8B 1ELFA 5EQSA 4MPUA 4DURA 1OYQA 1OSSA 1P9SA 3CS0A 3NZIA 1GHBF 2YMSD 1FIWA 3MH6A 5LPEA 3NRLA 2Y82A 1O30A 2ZIQH 3KQDA 2B5TB 2SGEE 4CH8B 2ILNA 3O8BA 2AEIH 1IHTH 1KIGH 1O2IA 1OWIA 4JMYA 5JBAS 4ISLA 5EXMA 5TCAA 2YMSC 1TGNA 4Y6DA 1C2KA 1HAXB 1P06A 5L6NH 3QUMP 4K1SA 5DP7A 1UCYE 1SOTA 1QA7A 4Q7ZA 1NRSH 2UUKB 3R3GB 4AGKA 1ZTJA 1FY1A 2VGCC 4A1XA 3UR6A 1XXDA 3GOVB 5DKMA 1O2WA 2OC8A 4TPYA 3A84A 5GCHF 1QQUA 2G4TA 2J9NA 3SU4A 4JYVH 2NU2E 3RLYH 4XE4A 4ASUD 3E16B 4CREA 1O3LA 3RXKA 3OSYA 1EPTB 1NM6A 4DVAU 1MTUA 2ASUB 5DP6A 3SJ8A 1C5MD 2A2XH 3PMHB 2L6OA 3RMNH 1XVOA 1C1UH 2BVXH 5K0HA 3RDZA 3BEIB 1FY3A 2PUXB 4IMQA 1QIXB 1AVXA 3RMMH 1TPPA 2WYJA 5K7RA 3L33A 2SNVA 1IQGA 5T6GA 5ESTE 4FUHA 1AKSA 4A1TA 2Y81A 3MFJA 1PPFE 3ESTA 3OEED 2GVFA 3SBKA 1HJAB 2BDBA 2BYAX 2ZHEH 3MNXA 5CHAC 1WV7H 2Z94A 3QX5H 4X2VA 1ZLRA 5DGJA 4U2WA 1ZMLA 1OP8A 2HPPH 4LOYH 4Q2KA 4B74A 4DT4A 1MU6B 4KGAA 3RXQA 2VU8E 1O32A 2WV5A 1Y3WA 4XOJA 2ALPA 5EG4A 2GT8A 2GCHF 2F9BH 3HATH 3QDZB 1W11U 3LC3A 5A09A 4IMZA 3K6ZA 4B71A 1SGQE 1PQ5A 4RI0A 1NRNH 2BX3A 2H5DA 4XBCA 1B5GH 4UFDH 4F4OC 1QL7A 2BY9X 2FYRA 1ELEE 4LZ1H 4NGAH 1YCPM 4X1PU 3Q00A 5EW1H 1SFIA 4X1RU 4ZHMU 3I29A 2BD3A 1LPZB 1NU7B 1G9IE 3VG8A 1JRSA 4UDWH 3M7TA 2J2UA 2KAIB 1TOMH 2P95A 3RXUA 2BD8A 2IJOB 2K1QA 2BM2A 4A1VA 1O3AA 2ZF0H 4X1NU 1GMHG 3A7YA 1XM1A 2ZPSA 1HLTH 3TH2H 3BTKE 3ZZ3A 1NZQH 5F6MA 1ZOMA 3OEHD 2ZQ1A 3HK6B 5J4SA 1GJ8B 2F4LA 5DO4H 3P17H 2ZDAH 1BDAA 4BNRA 2PTCE 1C1SA 1VJAU 1O5BB 1JIRA 1ZSKA 4H4FA 4B1TA 3SYJA 1LCYA 4NWLA 2GDEH 3M5MA 1T8MA 3RP2A 1MD8A 4MG3A 5C2ZA 1TA2A 1T8NA 4UFGH 4RN6A 5A8XA 3SUGA 3FVFB 2C90B 3A88A 4RKOB 1DXWA 3BV9B 4K8YA 2J95A 1ORFA 1FXYA 1RTFB 3SU5A 1QURH 1THPB 3M3TA 2P16A 3PV2A 2YNBA 1UTQA 3U1JB 1UVPA 1UTLM 2WUBA 4NIVA 1ANCA 3TJOA 1BB0B 1AUJA 2Q6FA 1JIMA 1YPKH 2XBYA 1UVSH 3T62A 3M36A 3PTNA 3RXEA 1GHVH 5E0GA 5CMXH 2BVSH 4Q63A 2H9TH 3MU8A 5GJ4B 2ZPRA 1DDJA 3MI4A 1BJVA 1J8AA 1FN8A 1FI8A 3MU0A 1YPMH 1DPOA 3AW0A 4UFEH 1EOLA 1Y8TA 1GBJA 1N6XA 3SV6A 2ZDVH 4YOGA 2GMTB 1GDUA 1BRBE 1LHGH 4OS4A 4RKJB 2HLCA 1IQKA 1K1JA 1ELGA 2DE9A 1Q2WA 1N8OB 1SGYE 2VINA 1LVYA 1MABB 3VEQB 1DUAA 1C5VA 3PYHA 1B0EA 1GI1A 2GX4A 3NWUA 2BX4A 2D8WA 3O8CA 4NIWA 3DSPA 3WWFA 5HM9A 3TPIZ 3UUZA 2BY6X 4GPGA 2NU0E 2XNIA 2ZG0H 1AE5A 1MAXA 2NU3E 1SI5H 2ZNKH 1GMDG 4NA7A 4YXWD 2AMDA 4X6MA 2B8OH 1E1QD 2R3YA 2TGAA 3TNTA 5T3HA 3GISB 2H9HA 1CSOE 1P03A 3WWBA 2FP7B 3GY4A 1TNIA 2XWAA 3SN8A 1W13U 1FPHH 2K0QA 3TITA 2WPDD 5AHGH 1Z71A 1COWD 4THNH 5A2MH 1CT4E 1C5ZB 1QFKH 2JH0D 2Y5HA 2WSSD 2Q6GA 2BHGA 1BMNH 2AYWA 1C1OA 1HAIH 4UE7H 3F6UH 1F2SE 2C8YB 1Z7KA 4OS2A 2ZA5A 1A61H 1GBDA 1ZPZA 3RMOH 1VGCB 4ISHH 1XX9A 4KTUA 4DGJA 2HPQH 1MUEB 2FO9A 4WWYA 1Z8GA 3SGQE 1SHYA 3FOAA 1AIXH 1QL9A 2C8ZB 2A7HA 1SGNE 3E90B 3GDSA 1CBWC 1H9HE 1TYNA 2FWWA 3D23A 1QBNA 1X7AC 4BXWA 1VCWA 1C2GA 3NCLA 1CHOG 3E6PH 3LGYA 1ZMJA 2RA0A 4B75A 3RU4T 2EEKA 3E1XB 1SQTA 1P2IA 1GI6A 3SI3H 1EASA 1O2OA 1SOZA 1UTKA 2ODQA 4K1EA 5FL7D 3RXBA 1LQDB 2WPIS 4I32A 1SLUB 1O5AB 2Y5FA 2BXTH 1MKWH 2TPIZ 1YLCA 2BVRH 1THRH 3C27B 2BDIA 3PB1E 4KTCA 4YTAA 3SUDA 5EPYA 1OWJA 4NA9H 1KLJH 1N1LA 1ZTLA 1FN6A 3TH4H 2A45B 1FDPA 1P09A 5FBEA 1GMCG 1VR1H 4OGXA 3ATLA 4ZMAH 1OXGA 1BBRK 1FNIA 3BF6H 1TPAE 1MMJN 1TPSA 3SUEA 1HBTH 1LHCH 3A89A 1EZQA 1EZUC 1P2MA 1NRRH 1S6HA 2GP9B 4YT6H 1QBOA 2XW9A 4O9VA 4X8SH 1ESAA 5B6OA 5A0CA 1IQEA 1O2QA 1A0LA 2UWOA 5G4BA 1K1NA 1UHBB 4B76A 3N7EA 3ZZAA 3I77A 4BXSA 3GDUA 5E2PA 1P04A 4DIIH 1T8LA 1MAYA 3SZNA 1BTYA 3M3VA 4WVPE 6GCHG 1XKBC 4IW4E 1GHWH 1S83A 3VB6A 3A86A 1OWHA 3M7UA 1P3CA 1YPHC 3SHCH 4JZIA 1GPZA 1T32A 1QRZA 2G00A 2VNTA 1HIAA 1C2MA 3PWCA 4VGCC 1C9TA 1ELBA 1HXEH 3HGPA 2A5AA 3SV9A 1ARCA 2QE7D 3LC5A 5T6FA 3ZYEA 3ATIA 3L6PA 1BTXA 1P0SH 2Y80A 1UVOA 2FI4E 2J5UA 1RXPA 4E05H 2IJD1 5C0UA 5CDFE 3ZVDA 1YPLH 1FAXA 1O3DA 1TMTH 1OKXA 3FZDA 1C5LH 3HGNA 4CBNA 4AN7A 4LXBH 3UIRA 4INLA 4NIYA 1TBRH 2V3OH 4GCHF 2HVXA 4I8JA 4D9RA 2OUAA 2GCTB 2BTCE 2TRMA 4NSVA 1NRQH 4BAHB 1V2QT 4WMDA 2F9VA 5FX5A 1QNJA 1TGBA 1C2JA 5AFYH 1BTWA 3LKWA 2IPHA 1CBWB 3FP8E 1FMGA 2O9QA 1GJ4H 3H7TA 3QK1A 2QF4A 3E8LA 3A7XA 5B6LA 2BDCA 2KCAA 1SGRE 4JK6A 1TONA 4X8UH 4ASHA 1E37B 5T6DA 5FBIA 1J14A 1GCDA 4QT8C 2GT7A 1C4V2 2WPKS 4ZHLU 3A8DA 4AORA 3FKSD 1GG6C 2AERH 1J16A 1K28D 3ZV9A 2P3TB 1S6FA 1TGTA 3S69A 3BTFE 4X2XA 5ABWA 3UREA 3SNDA 1BMMH 2XOKD 1YCPH 1GMHF 1IQJA 3ZVBA 3OY6U 1C5TA 2OBOA 2FOMB 3W94A 4CHAB 3P8FA 2NU1E 4CBOA 1QL8A 5IDKA 3TJNA 1CT0E 1Y3XA 1G3DA 1XMNB 4INHA 3KQCA 3KN2A 4IBLH 1ZSJA 1CGIE 1F0UA 3GCTF 1HXFH 3LGIA 3UWIA 3KEEA 3SORA 3GCOA 4AFQA 1AFQC 4YOIA 1O2SA 1EJNA 1W10U 1UTNA 1V2JT 3SV2H 3AK5A 3HK3B 2QIQA 3F2HA 4ZKNU 1YLDA 1WYKA 1BBRE 4DG4A 4A7IB 1H8IH 1K1OA 1SQAA 5C5NA 2VJ1A 1ANBA 2FOCA 2ULLA 1CO7E 2PTNA 1SR5C 4XD7D 2ZU3A 3RXIA 2QCYA 4YLQH 3SZEA 2OQUA 3MHWU 2FDAA 4Y10E 2A32A 1MKWK 1P05A 2IOTA 5C3NA 1CA0B 1DSTA 3D49H 3S7KB 4BAKB 1ZJKA 1ZMNA 1K1IA 4X8TH 5EOKA 2VWNA 1EJMA 1W0KD 1B7XB 2PKAA 4VGCB 1BRAA 5F8TA 4J2YB