2OBQA

Discovery of the hcv ns3/4a protease inhibitor sch503034. key steps in structure-based optimization
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
180
structure length
180
Chain Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatitis C virus
publication title Discovery of the HCV NS3/4A protease inhibitor (1R,5S)-N-[3-amino-1-(cyclobutylmethyl)-2,3-dioxopropyl]-3- [2(S)-[[[(1,1-dimethylethyl)amino]carbonyl]amino]-3,3-dimethyl-1-oxobutyl]- 6,6-dimethyl-3-azabicyclo[3.1.0]hexan-2(S)-carboxamide (Sch 503034) II. Key steps in structure-based optimization.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein
total genus 39
structure length 180
sequence length 180
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2obqA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2obqA01
4ABDA 5T6DA 5JBAS 1P11E 1S84A 5DP7A 1YCPH 2ZFFH 1S6HA 2OC7A 1UVSH 1QBNA 2H9EH 3Q3KA 3SU3A 3P95A 3RXUA 8GCHG 1EATA 1JXPA 1W12U 2UWLA 3AW1A 5AFYH 1O3MA 4MVNA 3BTWE 4KGAA 3B9FH 3KQBA 1ARCA 4I7YH 1HBTH 1CHOF 5J4SA 1ZRBA 1TNLA 4AYYB 4X2YA 3LT3A 3Q3YA 3SHCH 1P2IA 1GJAB 1H1BA 3A87A 3GY8A 3MU0A 2JKHA 2PHBA 2Q6DA 2Z3EA 1UVTH 4FU8A 1MQ5A 1TAWA 2FXRA 4ABFA 1O33A 4TWYA 2ESTE 2FM2A 1O3NA 3MYWA 4LOYH 1GVLA 2WUBA 3A7XA 3UOPA 3QDZB 2JETB 4XBDA 3NZIA 3MU4A 1O5DH 1GL0E 3U1IB 1TB6H 2H5DA 1L4DA 4CRAA 1P12E 1MMJN 1P3EA 1HPGA 1AY6H 1C1OA 1DSUA 2ULLA 1SGRE 4K1SA 2GVFA 5G4BA 1ZHPA 1QB1A 3RXPA 2ZF0H 3EA8A 3ELAH 1TPAE 2Z9LA 2WYJA 4TWWA 4AFSA 1SGNE 2GMTC 1RTLA 1Z7KA 1O2LA 1ELCA 4UEHH 2Y7ZA 3GISB 1MU8B 1TX8A 1CO7E 2FOCA 1B7XB 1AU8A 1KSNA 1F5LA 1CGHA 1F0SA 1J8AA 5GXPA 5F03A 2G52A 2FIRH 4I8LA 1ZOMA 2V6NA 1ZTJA 2FS8A 4MPUA 2ZGXH 3M3TA 1MZDA 1SGIB 9ESTA 1KIGH 2SGAA 3Q76A 1S5SA 4CH2B 2BXTH 1YCPM 3MWIU 3T27A 3M3SA 1H9IE 1FQ3A 4Y8ZA 2GDEH 1LMWB 2C4FH 5L30H 1CBWB 1GI6A 1HAIH 5EQRA 1DANH 1AMHA 1O3KA 3RM0H 2PGQB 3BTME 2KAIA 3RMMH 1ORFA 1M9UA 1K22H 1C5QA 3V12A 2GDDA 5B6OA 2WYGA 2BDYA 1LHFH 1MBQA 1ZLRA 1SLUB 1CQQA 2Y5GA 1O3FA 1DXWA 1CHGA 2FDAA 1V2VT 1VGCB 4A92A 3TNTA 2W5EA 3SHAH 1UHBB 3SUDA 1TALA 1IQKA 3QWCH 4FVBA 2C3SA 1O2UA 1OOKB 2ZFTA 1YP9A 5A8XA 2XCNA 4YOJA 1IOEA 1XUHA 1TGCA 3P8GA 4RI0A 4AN7A 2VVCA 4ASHA 1O34A 1BTHH 3A84A 2GT8A 4SGAE 1IHTH 3Q00A 1W0ZU 1V2QT 5F8ZA 3CS7A 2PTCE 2GX4A 1YKTA 1PQ5A 3SNDA 2QN5T 1ABJH 1KXAA 1YPJH 4IMZA 2R9PA 4BXSA 2Y7XA 2VIVA 4H6TA 1BTXA 3SV2H 1TMBH 5DP6A 5GJ4B 1BMNH 1TWXB 4Y6DA 1T4VH 3VB3A 2TGAA 3GDUA 3E16B 1CHOG 2FOFA 4JZFH 1SLWB 1P01A 1BT7A 3KIDU 2PW8H 4QT8C 3RXHA 2PGBB 1IQEA 2O9QA 5CHAC 3I77A 2UUYA 3QGNB 5F8XA 3E6PH 3BTFE 3P70B 2SGEE 4X1QU 3V3MA 1K1PA 1O3GA 1F0UA 2AS9A 1O2SA 2VIWA 5E0GA 1BBRE 4E7NA 3HGPA 1Y59T 1UCYH 1F92A 4UONA 4KKDA 4YLUA 1FIWA 4O3UA 2BDIA 3ZZAA 2Z9GA 3A85A 1OX1A 2XBVA 4ZHLU 1J14A 1U6QA 4X2WA 3E91A 1P04A 3PWCA 1P2KA 4O97A 3RC6A 1O37A 2AH4X 1K2I1 5JBCS 1H9HE 7LPRA 4XFQA 1HXFH 4CHAB 2YNAA 1TGBA 3F9EA 1GJ6A 3C27B 1TBZH 3GY5A 1O2ZA 1ELDE 4OS4A 1OS8A 2Q6GA 1C2FA 1QNJA 3TGJE 2SGFE 3EQ0H 4NZQA 2QC2A 1INCA 1YBWA 4DCDA 1BRBE 1XUKA 1GI7B 1Y5AT 1C1WH 1O2OA 1P9SA 1TNJA 2F9OA 1DWDH 2FP7B 2A5AA 5EXLA 4X8SH 3SV6A 2WZQA 1YPHC 4A7IB 2BDCA 2RA3A 3RXGA 1FY5A 4ESTE 3GCOA 1PQ8A 2EC9H 3BN9A 2FEQH 3PMJA 2BD3A 1TGTA 2GD4B 3IITA 4K8YA 2GMTB 4CBNA 2P3UB 3T29A 4AB9A 4JMYA 1YGCH 2ODQA 3MH5A 3QK1A 2O8TA 2PUXB 1IQIA 1NFWA 1JIMA 2FYQA 2GP9B 1C1NA 2HRVA 1T4UH 3SN8A 4MNXA 2BLVA 3UWIA 2AGGX 4WMEA 1V2PT 1UTJA 3FZDA 5AFZH 4JK5A 1ZSJA 4TPIZ 4IC6A 4GHQA 4IW4E 3AASA 3RXDA 1EAWA 1C1MA 3AW0A 1A2CH 3EAJA 1ZHMA 3VGCB 5EQSA 3KCGH 3SU1A 3TJUA 1T8LA 3GCNA 2P94A 4DIIH 2NU0E 4NGAH 2BVRH 1TA6A 5F8TA 4PROA 1WOFA 1IQMA 6CHAC 1FJSA 1AKSA 2ZWLH 1FPCH 1ZTKA 2G55A 1FN6A 4X6PA 1VCQA 1LHCH 3QX5H 3SI3H 1HAZB 3HKIB 1W7XH 3E3TA 3ATIA 1HAVA 5C5NA 1ZSLA 1C2EA 2W7SA 1GBKA 1Q2WA 1O5GH 5EU8A 3GOVB 1JBUH 1C1RA 3SJIA 1TX6A 1SOZA 4ABAA 3LH1A 1TNKA 2STBE 3RXRA 2XBYA 3VB5A 4DURA 5FCRA 1HJ9A 3SJ8A 4BOHA 3FANA 2GCTC 3LONA 4OS2A 5FXLA 1GJ5H 1SGYE 3TH4H 3BTTE 3H5CB 3U9AH 2FOAA 1HAXB 2HGTH 2VWMA 1A7SA 1D3TB 1WSSH 1QRXA 1KLIH 1S6FA 5SGAE 1J17T 1SB1H 4INHA 4AZ2B 1LKBA 1O3IA 2V3OH 5LPFA 4YM9A 1OWJA 3F68H 4CRCA 3ENSB 1GI9B 5T6FA 1AZZA 1TOMH 5CHAB 3RXVA 2F9BH 1EJNA 2F3CE 1WTHD 3EYDA 3K9XB 2UWPA 2SGQE 1F5KU 2PSXA 1A0JA 2YNBA 3TGIE 1EKBB 1AD8H 1P2QA 1L0ZA 4E06H 2FLRH 1GI3A 3OU0A 1LVBA 2FI5E 2WV5A 3A88A 1OWDA 1YLDA 3LJJA 2WPLS 3KQEA 2ZDNA 5EPYA 2TGTA 1K1OA 1O2XA 1QQUA 3S0NA 3LU9B 2BD5A 2F9VA 1Z1IA 1D3PB 1O2VA 3W95A 2ZGHA 2W3KA 3ZVCA 1TRMA 1V2OT 2BY5X 1GJCB 1O2YA 2ODPA 2JETC 3PLPA 5FCKA 4H42U 5C5OA 2TIOA 5DP9A 1YPMH 4WXIA 2F9PA 3P17H 1QB6A 3SJOA 1O2RA 5DP4A 1HFDA 2TRMA 1EASA 4WXVA 1DUAA 3TITA 2OK5A 1HLTH 2HPQH 2RCEA 2BDBA 1C5OH 3TK5A 2I6SA 4JCNA 2Q1JA 1VCWA 4O9VA 3D65E 3GY7A 4HZHA 2HNTE 1C1SA 4WJG2 1O5BB 2FOBA 3MTYA 5IYTA 1V2JT 2H9TH 3AAUA 1DFPA 3KGPA 1EP5A 3PLBA 3U69H 1AUTC 1CGIE 1TGNA 1GBMA 1QBOA 4MPXA 1B0FA 1DE7H 3K6YA 2W3IA 1HUTH 2A32A 2ZHEH 5FPYA 1UTMA 3NKKA 2ZQ1A 4JYTA 1PQAA 4ABJA 1AVGH 4B6EA 4I31A 3RXQA 5E2PA 3KNXA 3BSQA 1FUJA 1O3EA 3T25A 1O2WA 3ZVBA 1QA7A 3K2UA 2B8OH 2GV6A 4U32A 3DFJA 1JRSA 4Q7YA 2BQWB 1JRTA 3G01A 1UCYE 1PPGE 4BXWA 3GCTF 3SQHE 2DUCA 4FUJA 1O3HA 1S82A 3GY3A 2A4GA 2XC5A 3SU5A 3E0NB 6CHAB 1SGEE 1Z8JB 3M7UA 3U8OH 3UR6A 2Y82A 3RLWH 4B2AA 2J92A 1HYLA 1BJUA 4GVUA 7KMEH 1AKSB 4NA7A 3M36A 1D3DB 4JZ1A 1BTUA 1BZXE 2ANYA 4RN6A 2H5CA 3ZZ6A 4FUBA 2Q6FA 1HAVB 2BY8X 4OS7A 1EZUC 2ZI2H 1MUEB 2Y5HA 4HI3A 3E0PB 4YZUA 1ESAA 1QA0A 3MO9A 1S81A 1YPEH 1LCYA 3PV2A 3A7WA 3EA9A 1ZPCA 1Z1JA 2XW9A 3ZZBA 4NFEA 4Y76A 1MTUA 4K1EA 2UUJB 1SI5H 1YCPK 3STIA 1GHZA 2GCTB 1LPGB 2OC0A 3STJA 4OM9A 3VB7A 1SLXB 5L2ZH 1P05A 3P8FA 3S7KB 2AIQA 1C2HA 4E7RG 1G3DA 3ESTA 1CSOE 1SFQB 2A7HA 1YLCA 3S69A 2XTTB 1EAXA 1VR1H 3E90B 3SBKA 1YM0A 1W11U 3S9AA 1UJ1A 1YF4A 1T31A 1O3OA 1OWKA 2J2UA 3ZVFA 1G2MA 1BQYA 3M5LA 4X8TH 4Q80A 5DK1A 1KLTA 2PTNA 4YESB 1QQ4A 1FZZA 1C9TA 3MU8A 1ANDA 1KTSB 3BV9B 2SNWA 2G5NA 3U1JB 4XBBA 2R2WU 1P2NA 1DT2A 1O2TA 2EEKA 1TPOA 1AFQC 3M37A 1IQJA 2B7DH 1AB9B 4O3TA 1E36B 2BTCE 4THNH 3TH2H 5A2MH 1P02A 4ISLA 1QL8A 3V13A 1SFIA 3RXKA 4TYDA 3Q3XA 4AFUA 1K9OE 3JZ1B 4Y7AA 4CHAC 1HAYB 1GI4A 2F9UA 1D6WA 2FOGA 5HM9A 1RTKA 3ZYDA 5CE1A 4XBCA 1Z8RA 1THRH 1DWEH 4GLYA 1S85A 2Y80A 3T2NA 1T8MA 1EOJA 2GV7A 1FXYA 1HAHH 1S83A 1SGDE 1SSXA 3UPEA 2FX6A 1CA8B 5EXNA 1ZR0A 2R3UA 2WINI 1HIAA 2BLQA 3TIUA 5GDSH 1GBJA 1V2RT 5F6MA 3SV8A 1V2ST 2FOEA 3UFAA 1PPCE 1XVOA 2QXGA 2VJ1A 3VFEA 2O8LA 3TLOA 3H7TA 5LGOA 2FMJA 5JPMH 3ZZ7A 2C8WB 5A0AE 3B23B 1O5AB 2NWNA 4WMFA 1SGQE 2WUCA 3O8DA 2FS9A 1EOLA 3GCTG 1OYTH 1UVPA 4MG3A 2F83A 4GSOA 3ODDA 1OP0A 1ESTA 1LTOA 2ZU5A 4ZH8A 3UTUH 2CGAA 5HXFA 1THSH 3MH4A 1L1JA 2WV4A 3DUXH 4X1SU 3SUGA 1C2KA 3GYLB 2G00A 3SGAE 5A8ZA 3NK8A 2Z9KA 1OWEA 3VGCC 2O8UA 1IQLA 1V2UT 2ZZUH 1OKXA 4NA8A 2W7UA 2O8WA 3PV4A 1MTNC 1QHRB 5HGGA 1IQGA 3SZEA 1H9LB 2TBSA 1Y8TA 3M7QA 4BAHB 2FLBH 2BLOA 3BIVH 1YPKH 1YC0A 2A4RA 3SGQE 2BOHB 1A61H 4DJZB 1V2MT 3SUFA 4YLQH 4AYVB 2EI7A 1TOCB 3SNAA 5LH8A 1SGFG 4TPYA 3ATMA 1FNIA 2OLGA 4NIVA 1C1PA 2PKSC 3MNSA 1GBFA 1TX7A 4KP0A 1MTVA 3SU4A 2Y81A 2SGDE 5K7RA 3S9CA 1NS3A 1GBTA 4NCYA 1EQ9A 2HLCA 3DT0H 1C9PA 1O2JA 2Z94A 2IJOB 1GWAA 4B6FA 5K0HA 1C5ZB 4CRBA 3OYPA 2HVXA 4Y7BA 1GMHF 5JYIA 4H4FA 4KTCA 4ABIA 2A7JA 3D49H 2ZDLA 2RA0A 1A4WH 2FWWA 2SNVA 1QURH 2UUFB 1SG8B 3PLKA 2ALPA 1XVMA 1TPSA 1MZAA 3KQCA 5C2ZA 1GBAA 1UTPA 1GBLA 1C5UA 2YOLA 4KTUA 1O3PB 1O5CB 1DLEA 2CJIA 5E2OA 1Y3WA 2ZIQH 4ISNA 1KTTB 2A2XH 3LGWA 1NRQH 1G36A 3DFLA 3SU6A 2GZ8A 4NIXA 4DOQA 1SGCA 3TU7H 1XXDA 1GJBB 1C5LH 1DITH 2ZA5A 4ZUHA 1DXPA 3QZQA 2LNCA 1Y5UT 3RMOH 2P95A 2AMDA 2EI8A 3DHKH 4AB8A 1XXFA 3U8TH 3LGVA 1OSSA 1O3AA 2G5VA 2ZDAH 2GZ9A 1AFQB 2C8XB 2ZTXA 5C1YA 4ZKRU 5EPNA 1UO6A 3GDSA 5ESTE 5HYOA 1WQVH 4NG9H 1O3DA 1G3BA 3GCHB 1XUGA 3SI4H 4K69A 4GPGA 1AGJA 4NA9H 3ZZ8A 1S0RA 2BYAX 1EXFA 1BTWA 3SJKA 2CXVA 1RTFB 1TFXA 4Q2KA 1BOQA 1K21H 3PMBB 2ZECA 4ABGA 1NPMA 3Q77A 2FO9A 1Y3XA 3RDZA 1QL9A 5EW2H 2V3HH 1K1NA 5A09A 1O5EH 1ELGA 2WHXA 1MTWA 5FBEA 1XUFA 4FUGA 1WCZA 1NFXA 4K60A 3MI4A 4DVAU 3EE0B 5GIBA 1NFUA 1XKAC 5JDUB 2D26C 1G32B 2XC0A 4RSPA 1AWFH 4MNWA 1GI5A 1HIAB 3F1SB 4FUIA 4I32A 1FPHH 1C5VA 1NU7B 2A2QH 4Y8YA 5B6LA 2G51A 1V3XA 2H6MA 3PMHB 5AHGH 4OGXA 3SU2A 1WTGH 2VBCA 1MH0A 3ZZ3A 3ZZCA 1GDUA 1H8IH 1O3BA 1FY3A 1VJ9U 1TABE 2ZU1A 5GCHF 1V2NT 1C5XB 2BY7X 4OS1A 4NSYA 1GGDB 1GCTC 1C2LA 1TMTH 2VH6A 1PYTD 2ZGJA 4MNYA 1ANCA 1GJ4H 1OWIA 3H09A 2HOBA 5PTPA 4X8UH 2BOKA 1SPJA 2ZCKP 1TNIA 4AX9H 1MBMA 1NFYA 1KLJH 1Z71A 2J9NA 1VITH 4ISOA 2JH0D 1MTNB 1O2NA 4CR9A 1TGSZ 1GMHG 3QZRA 1NRRH 1PPFE 3SOSA 2ZG0H 1GPZA 3TH3H 1HCGA 3A7ZA 3UIRA 2XWBI 3A82A 2J34A 4BANB 5T3HA 1PPEE 5FX6A 2GZ7A 3P6ZB 1LO6A 1RGQA 1NRNH 1PJPA 2KAIB 2V0BA 5EW1H 2PKSB 2XCFA 3K6ZA 4DG4A 1MAXA 1SOTA 3RMLH 2OXSA 4CRGA 4UDWH 2WPJS 1KDQA 2VVVA 4NWLA 1ZMJA 3SV9A 1EAIA 1BMMH 5EGMA 1NM6A 1P8VC 3RMNH 1MCTA 1PQ7A 4DGJA 2A7CA 1PPZA 4AORA 2FTLE 4D7GA 2VH0A 2XYAA 4MPVA 1DS2E 3E1XB 4X6NA 3URCA 2VVUA 2AFQB 4Z6AH 3RC4A 1OXGA 3IG6B 4X1RU 4ABHA 1FY1A 2A5KA 3EGKH 1SGFA 1W7GH 2OTVA 2XNIA 4LZ4B 1L2EA 4TY7A 1IQNA 2XRCA 1NC6A 2H9HA 4LXBH 1H4WA 4O03A 1AQ7A 4WY3A 2R3YA 3RLYH 5A8YA 2UWOA 2C93B 4GCHF 1GJ8B 2G4UA 1ELTA 3P92A 4FUEA 1O38A 2AMQA 4M7GA 1KXFA 3M35A 1NN6A 1C5SA 3BTEE 1C2IA 4K1TA 2PR3A 3C1KA 3W94A 3KL6A 1WUNH 2BX3A 1T7CA 1YPHE 4AG2A 2AYWA 1XM1A 1AB9C 5HMAA 1O2GH 1SGTA 2ZQ2A 3PTNA 1G3CA 2A5IA 3ODFA 2XBXA 1VJAU 1EZXC 1JWTA 4F4OC 1HAGE 1D4PB 1HNEE 2A4OA 2J38A 1EZQA 5EG4A 2ZEBA 4WF8A 1F2SE 2FPZA 2NU1E 2OCVB 1TLDA 4ZKSU 3F6UH 1XKBC 2R2MB 4MPWA 1SVPA 1A1RA 4GAWA 1S0QA 2ZU2A 1CT0E 2NU2E 1BMLA 5C1XA 1UVOA 3MHWU 4Y71A 2H1UA 1WBGB 3K65B 2BZ6H 1D9IA 3GDVA 1V2KT 5J4QA 2Z6BD 5ABWA 1SQOA 4CH8B 3BTHE 1BBRK 2Z9JA 3L3TA 1SQTA 5GCHG 1BB0B 5DP5A 1MKXH 1O2HA 1TNGA 1TQ7B 2FODA 4ZXXH 4TY6A 3FP7E 3UY9A 2PLXA 5DKMA 4FUDA 3RXIA 1C4V2 1P0SH 1ETTH 1ANBA 4Q7XA 3QGJA 2J95A 1GBDA 2CN0H 2ILNA 4JYUH 4ZKNU 1FAKH 1JOUB 1Z6JH 5EQQA 2ZU3A 1IHSH 3VXFH 3UNRA 2D1JA 1O30A 3HATH 2J4IA 3LGIA 5H4IB 5GWZA 4FUFA 2C8ZB 1G37A 3TK9A 1GBEA 4WH6A 1PPBH 3MNXA 3LC3A 1F5RA 4YO9A 1ZTLA 2BVSH 3LPRA 1DLKB 3A7TA 3R3GB 3BF6H 1O31A 2GTBA 1UTLM 2CHAB 1RFNA 3MH7A 3LH3A 7GCHF 1A46H 3UQOA 3A80A 3NCLA 4H6SB 1BJVA 3LKWA 3VB6A 2BQ7B 1QL7A 2QYIA 1GCTB 4UE7H 3VB4A 4E05H 1DY8A 1DWCH 1XX9A 1C1QA 4MTBA 4YOIA 2K1QA 4D9RA 3TK6A 1QRWA 1NZQH 4CRFA 1ELVA 3LJOA 3ITIA 2PKAA 1FV9A 3KF2A 2F9NA 4NWKA 1AIXH 1FY8E 4UFDH 4K2YA 5JB8S 4Y79A 3RXLA 4Y11E 3RXOA 1GBBA 3TGKE 2CV3A 1LPZB 1WXRA 5I46H 2VWLA 1C5NH 1QFKH 1UTNA 4INKA 4KTSA 1C4U2 5DG6A 1QCPA 3ZZ4A 3ZVAA 3ZVGA 4FU9A 3RXFA 1WU1A 3M5OA 2HNTF 2VWOA 3AAVA 1Z8IB 4CR5A 1EJMA 1DDJA 2ZO3H 4X2VA 2BM2A 3M61U 1NTPA 3PB1E 3BEIB 1FMGA 2QY0B 3GY6A 4GCHG 5ESBA 2CMYA 1E37B 1QTFA 1UVUH 4ZMAH 3LIWA 3A8BA 3SO3A 3F9FA 1TNHA 3FP6E 1C4Y2 1C5MD 4OGYA 3LC5A 1GHWH 3O8BA 4X1NU 4X0WU 2VB0A 4B75A 1ZMLA 2ZHDA 2Z3CA 1T8NA 1KDQB 1BCUH 1ZYOA 1TBQH 5CMXH 1GHBF 1MKWH 3SU0A 1AZ8A 3GICB 4YOGA 5FX5A 4IC5A 3M5MA 4LZ1H 1MD8A 1SC8U 4XE4A 3MMGA 1GMCF 4AFQA 2UUKB 3TJNA 4CREA 3UNSA 2QIQA 3HPTB 3WY8A 2JH5D 1BHXF 2SGPE 2XWAA 2XXLA 1BA8B 3T28A 3MNBA 5LPRA 1CA0B 3PTBA 1DWBH 3QO6A 2B0FA 4ZHMU 1KY9A 1J15A 4AGJA 4HFPB 2C8YB 1TRNA 2P93A 3A7YA 2QGRA 4IGDA 2ODYB 1V6DA 1LVYA 1DY9A 4VGCB 1N6XA 4ABEA 3UOUA 1C5TA 3MO6A 4BAMB 3GCHC 1WYKA 1ZGVA 1AI8H 2BQ6B 1ELBA 1P03A 2Z7FE 4GUXA 1AWHB 4XSKU 2RG3A 1C1UH 3PM3A 1FI8A 1FN8A 1C2MA 3LOXA 1LKAA 3A7VA 5DO4H 4A5TS 1EP6A 4AFZA 1A3BH 4JK6A 2JH6D 3ATKA 3FVFB 3A86A 3D62A 6GCHF 2XC4A 4I8GA 2OQUA 3RXTA 1OYQA 2THFB 1GL1A 3TNSA 5T6GA 1UTKA 1ZJKA 3PROA 4BAOB 1SLVB 1HJAC 1W10U 1O36A 3HKJB 1EZSC 3ZYEA 6LPRA 1GHXH 1F0TA 1SBWA 1L1NA 3RP2A 4U30A 2GKVE 7GCHG 5DP3A 3PWBA 3ZZ9A 1CU1A 2ZNKH 1W13U 1CGJE 2ZPQA 2BDAA 2TGPZ 1RD3B 2AIPA 4RKOB 1SHYA 1GHYH 1HV7A 2BDHA 1ZZZA 1LQDB 4GHTA 2P3TB 1W3CA 4OS5A 3TJVA 1TMUH 3SORA 1ZPBA 2FOMB 1GDNA 2HWLB 3I78A 4F49A 3RXSA 2AGIX 3TVJB 4A1XA 1BRCE 2BD2A 2P59A 2FESH 1DOJA 2IOTA 4I8JA 1GGDC 3M7TA 3A8CA 4X1PU 1ETRH 3H7OA 2VIQA 2M5TA 3RXMA 4I8HA 3UNQA 1MAYA 1ZGIA 3PO1B 1GBIA 3RXCA 1KXEA 2OP9A 1VITF 4B74A 3HGNA 1TQ0B 3FZZA 1C5RA 4WWYA 1O2QA 4NIWA 1C5PA 2ZFRH 1ESBA 4YT7H 1KXBA 1ETSH 3BG8A 2ZGCA 1NESE 2D8WA 2G81E 4I8KA 3MH6A 3MOCA 3LDXH 4BNRA 2BXUH 2RDLA 4B1TA 1NO9H 2QF3A 1E35B 3NXPA 1N1LA 1PFXC 3RU4D 1P9UA 2ZTZA 1Y3VA 3RXEA 3OX7U 1LHGH 1A5GH 2GGVB 1GHBG 3QTOH 3UQVA 1QJ1B 1TBRH 1GI1A 2FX4A 1AVWA 1CVWH 3GY2A 2PKAB 3ZZDA 5TCAA 3QLPH 4CRDA 3T5FH 7ESTE 4IN1A 3SYJA 2G4TA 1AE5A 1P10A 1BITA 1BIOA 1D6RA 2BVXH 3SUEA 2VU8E 1GMCG 3NPSA 3BTGE 3PV5A 1WAYB 2VIDA 8KME2 2ZCHP 3QN7A 1QJ7B 1W0YH 2BD4A 8ESTE 1TPPA 5ETXA 1V2TT 1UK3A 1V2LT 2A1DB 5L6NH 1CE5A 1HRTH 4IS5A 4ZROA 3BG4B 4K8BA 4J2YB 2ZKSA 1UCYK 5AF9H 3AVZA 3RU4E 2OD3B 1AE8H 1C2GA 1ZPZA 2OC1A 3PYHA 1P2JA 2Y6TA 2TGDA 1C1TA 1K1JA 1A0LA 4JZIA 3A8DA 1P57B 2WPHS 2IN2A 1G3EA 2OBOA 4AOQA 2BY6X 1AO5A 1B0EA 1AFEH 1GI8B 2ANWA 5AVDA 3RM2H 1YPLH 2ZDMA 6GCHG 4Y8XA 3UUZA 3OTPA 1GI0A 4J1YA 3MO3A 5JBTA 2NU4E 2DE9A 2ZFSA 1SGPE 3KHVA 2QCYA 2AGEX 3OY5U 4FVDA 3M3VA 2V35A 3ATWA 1Y3UA 2ZDVH 5A0CA 2P8OC 4JZEH 3SV7A 4BTTB 2FI4E 4WH8A 4UFGH 1GJ9B 2R0LA 3A8AA 5IDKA 1W14U 1PYTC 1YYY1 4M9FA 1O3JA 2H2ZA 2TPIZ 4K3JA 1P09A 1VCPA 1C1VH 1QY6A 3ZV8A 1H8DH 4B73A 1BTPA 2VGCC 2A31A 1SMFE 1NRPH 4INLA 5FBIA 4HTCH 1G9IE 3RU4T 5BRRE 5T1VA 2QAAA 1GHVH 5DGJA 2FYRA 3UWJH 2WPKS 2B5TB 1N8OC 5BPEA 1G2LA 1DX5M 3A89A 4B2CA 1BTZA 1FLEE 2ZPRA 1HJAB 1K1IA 2ZU4A 1SR5C 1N6YA 1T32A 5GPIB 4ZXYH 1AVXA 3D23A 4NZLA 3BTDE 1FIZA 4ZAEA 2F4LA 5LPEA 1RXPA 4BTIB 4Y0YE 1VITG 3T26A 3RXAA 4NIYA 1AHTH 2PV9B 2PWXA 4A6LA 1KXCA 4Y10E 1DVAH 3ZZ5A 1KXDA 2J94A 3RXJA 1GG6C 3MFJA 3FAOA 1LVMA 5JBBS 2A45B 1JMOH 2BD9A 4B2BA 1O2KA 1P2OA 2CHAC 2VWNA 1BDAA 2FI3E 1CT2E 4AGKA 3O8CA 5C67A 1WQSA 3U8RH 1GDQA 2BZAA 1GVKB 1MTSA 1ARBA 1Z8GA 4FU7A 4D9QA 1QBVH 3QUMP 2EA3A 6ESTA 2DE8A 1LDTT 1P06A 2FTMA 1ZSKA 4NSVA 1BMAA 1NROH 2ZHQH 1Y5BT 2OUAA 1F7ZA 5DP8A 1AUJA 3ZVEA 2ALVA 1E0FD 1O39A 3EDXB 2OQ5A 3CS0A 2STAE 2CF9H 2FOHA 1G30B 3A81A 4X6MA 1OP8A 1UK2A 4FUCA 2VIOA 3E8LA 3O8RA 2QV1A 3ZVDA 1GMDF 3GY4A 1Z6EA 2A0QB 3S9BA 1NRSH 1BUIA 2GCHF 1FY4A 4FXGH 3DA9B 5HM2A 2ZC9H 1EPTA 3MU1A 2BB4A 1B5GH 1IQFA 3BEFB 3FFGA 4LK4A 1EPTC 3NUMA 4SGBE 4D7FA 1EB2A 1LHDH 1FAXA 1GHAF 4B71A 5C3NA 2HNTC 2VIPA 3BTKE 4DY7B 3LGTA 3KEEA 1EX3A 1DPOA 1HB0B 1OWHA 1ZJDA 4WVPE 4YTAA 1XUIA 2BX4A 1QR3E 2Y5FA 2QXHA 1IQHA 1EJAA 3DD2H 3UR9A 2A4QA 2VINA 2OC8A 2ASUB 5FHTA 2WPIS 2AMPA 2BDGA 4MLFB 1JIRA 1NY22 5FPTA 4ZHAA 1GVZA 4R0IA 4DIHH 1IAUA 3P8OA 1LHEH 2ZGBH 1DICA 3A83A 3L6PA 2IJD1 1RIWC 3CP7A 1FDPA 1W2KH 3V0XA 1MU6B 3IWMA 3BIUH 1J16A 3V7TA 1K28D 1CA0C 3FP8E 2Z9IA 3MNCA 5EODA 2ZCLP 1UMAH 4FUHA 1QB9A 1MQ6A 2BD8A 3CENA 4JZDH 4K5ZA 5TCCA 1QIXB 1FONA 4VGCC 5I25A 1GJ7B 2PFEA 2PUQH 3M5NA 4UFFH 1TA2A 1E38B 1OPHB 1LPKB 1K1LA 5DJ7A 1THPB 3P8NA 5FPSA 2ZDKA 1TIOA 1MKXK 2ZTYA 4U2WA 4BAKB 3VXEH 1MD7A 5A0BA 1GBCA 3SGBE 2OBQA 2QXIA 2P8OB 1O2PA 3SZNA 4IN2A 1A3EH 4JYVH 3KN2A 1J9CH 2QA9E 1F0RA 1RS0A 5C20A 1K1MA 4RKJB 3L33A 2BD7A 1ZMNA 1ABIH 3HK3B 5EOKA 3LGYA 1C2DA 2D2DA 2EI6A 2NU3E 2VGCB 1NT1A 1A5HA 1D3QB 1DM4B 1ACBE 3ZV9A 1ELAA 4DW2U 1N8OB 1VZQH 3URDA 2ZPSA 1GJDB 1HAOH 1HAPH 1C2JA 2O8MA 4CBOA 3UREA 1QRZA 1PPHE 8GCHF 1HJ8A 1KYNA 4D76A 4ABBA 5L2YH 4UD9H 1L4ZA 1SQAA 4UFEH 2GT7A 1LQEA 2G8TA 4B76A 1C5WB 1ELEE 1GCDA 4DT7B 1XUJA 2ZHWH 3OSYA 2I6QA 4ISIH 2ZFQH 1ID5H 2XBWA 4YT6H 1GG6B 4MNVA 5E0JA 1UTOA 2IPHA 5GNDA 3VPKA 4Y0ZE 1T8OA 3OTJE 1GMDG 3SW2B 5EXMA 1BRAA 2HALA 1P2MA 3PO1C 2AERH 3GYMA 1YPGH 3F9HA 1O5FH 1X7AC 2HPPH 2GCHG 3TJOA 4OS6A 3VEQB 1L1GA 1V2WT 5E0HA 2SFAA 1BBRH 1QGFA 1XMNB 3N7OA 3AK5A 4MDSA 5JB9S 1O35A 3MU5A 1GHAG 1O2IA 3PMAB 1O2MA 3SNCA 4ZKOU 1C5YB 3R0FA 1GI2A 4XOJA 1BRUP 2QF0A 4BTUB 4D8NA 1ZRKA 2ZP0H 1ELFA 3RUOA 4BAQB 1NU9A 1O32A 5TJXA 4R8TB 2P3FH 5E8EH 1EAUA 1MCVA 1CBWC 1MKWK 2ANMH 4XDEA 2Z3DA 1WV7H 3EA7A 4Q7ZA 5FAHA 1BTYA 1Q3XA 1O0DH 2BMGB 4IMQA 3LGUA 1HXEH 3HK6B 4Z0KA 3JZ2B 8LPRA 1QJ6B 1UK4A 1DSTA 1UHBA 4A1TA 1A0HB 1O3CA 1EPTB 1VGCC 2ZHFH 1TRYA 1P3CA 1Y3YA 3BG4C 1TE0A 2BHGA 4MQAA 3BTQE 1UTQA 4A1VA 3OY6U 1TONA 1HGTH 1DUEA 2P16A 4WMDA 5C1UA 4AG1A 1RRKA 2WPMS 2ZFPH 3SJ9A 2LPRA 3SNEA 2FZZA 4X6OA 3QTVH 2WV9A 1AN1E 1OP2A 1ANEA 3B8JA 4I33A 1EB1H 2R0KA 4NFFA 3TPIZ 9LPRA 2CF8H 1O3LA 4X8VH 2C90B 2AEIH 1EUFA 1TYNA 4X2XA 2BLWA 2OINA 1RIWB 2F91A 1HDTH 2PSYA 1E34B 4U01A 3RC5A 2W26A 1SL3A 1ZHRA 4ISHH 4KELA 1CT4E 2QXJA 5DPAA 2BY9X 4IBLH 1SHHB 2ANKH 1Q31A 3F9GA 3KQDA 3I29A 1LVOA 3BEUA 1W8BH 3T62A 1A5IA 1GBHA 4HGCA 3SQEE 3NWUA 3ATLA 3U98H 1RJXB 1BHXB 2VNTA 3SNBA 3S7HB 2B9LA 3RXBA
chains in the Genus database with same CATH superfamily
4ABDA 5T6DA 5JBAS 1P11E 1S84A 5DP7A 1YCPH 2ZFFH 1S6HA 2OC7A 1UVSH 1QBNA 2H9EH 3Q3KA 3SU3A 2W6ID 3P95A 3RXUA 8GCHG 1EATA 1JXPA 1W12U 1EFRD 2UWLA 3AW1A 2QF5A 5AFYH 1O3MA 4MVNA 3BTWE 4KGAA 3B9FH 3KQBA 1ARCA 4I7YH 1HBTH 1CHOF 5J4SA 1ZRBA 1TNLA 4AYYB 4X2YA 3LT3A 3Q3YA 3SHCH 1P2IA 1GJAB 1H1BA 2EY4C 3A87A 3GY8A 3MU0A 2JKHA 2PHBA 2Q6DA 2Z3EA 1UVTH 4FU8A 1MQ5A 5HKKD 1TAWA 2FXRA 4ABFA 1O33A 4TWYA 2ESTE 2FM2A 1O3NA 3MYWA 4LOYH 1GVLA 2WUBA 3A7XA 3UOPA 3QDZB 2JETB 4XBDA 3NZIA 3MU4A 1W0KD 4XRNA 1O5DH 1GL0E 3U1IB 1TB6H 2H5DA 1L4DA 4CRAA 1P12E 1MMJN 1P3EA 1HPGA 1AY6H 1C1OA 1DSUA 2ULLA 1SGRE 2CK3D 4K1SA 3DSOA 2GVFA 5G4BA 1ZHPA 1QB1A 3RXPA 5DSFA 2ZF0H 3EA8A 3ELAH 1TPAE 2Z9LA 2WYJA 4TWWA 4AFSA 1SGNE 2GMTC 1RTLA 1Z7KA 1O2LA 1ELCA 4UEHH 2Y7ZA 3GISB 1MU8B 1TX8A 1CO7E 2FOCA 3MQKC 1B7XB 1AU8A 1KSNA 1F5LA 1CGHA 1F0SA 1J8AA 5GXPA 5F03A 2G52A 2FIRH 4I8LA 1ZOMA 2RFKC 2V6NA 1ZTJA 2FS8A 4MPUA 2AHME 2ZGXH 3M3TA 1MZDA 1SGIB 9ESTA 1KIGH 2SGAA 3Q76A 1S5SA 4CH2B 2BXTH 1YCPM 3MWIU 3T27A 3M3SA 1H9IE 1FQ3A 4Y8ZA 2GDEH 2XOKD 1LMWB 2C4FH 5L30H 1CBWB 1GI6A 1HAIH 5EQRA 1DANH 1AMHA 1O3KA 3RM0H 2PGQB 3BTME 2KAIA 3RMMH 1ORFA 1M9UA 3WWFA 1K22H 1C5QA 3V12A 2GDDA 5B6OA 2WYGA 2BDYA 1LHFH 1MBQA 1ZLRA 1SLUB 1CQQA 2Y5GA 1O3FA 1DXWA 1CHGA 2FDAA 1V2VT 1VGCB 4A92A 3TNTA 2W5EA 3SHAH 1UHBB 3SUDA 1TALA 1IQKA 3QWCH 4FVBA 2C3SA 1O2UA 1OOKB 2ZFTA 1YP9A 5A8XA 2XCNA 4YOJA 1IOEA 1XUHA 1TGCA 3P8GA 4RI0A 4AN7A 2VVCA 4FETA 4ASHA 1O34A 1BTHH 3A84A 2GT8A 4SGAE 1IHTH 3Q00A 1W0ZU 1V2QT 5F8ZA 3CS7A 2PTCE 2GX4A 1YKTA 1PQ5A 3SNDA 2QN5T 1ABJH 1KXAA 1YPJH 4IMZA 2R9PA 4BXSA 2Y7XA 2VIVA 4H6TA 1BTXA 3SV2H 1TMBH 5DP6A 5GJ4B 3OEHD 1BMNH 1TWXB 4Y6DA 1T4VH 3VB3A 2TGAA 3GDUA 3E16B 4F55A 1CHOG 2FOFA 4JZFH 1SLWB 1COWD 1P01A 1BT7A 3KIDU 2PW8H 1H8ED 4QT8C 2KM0A 3RXHA 2PGBB 1IQEA 2O9QA 5CHAC 3I77A 2UUYA 3QGNB 5F8XA 3E6PH 3BTFE 3P70B 2SGEE 3UAIC 4X1QU 3V3MA 1K1PA 3FKSD 1O3GA 1F0UA 2AS9A 1O2SA 2VIWA 5E0GA 1BBRE 4E7NA 3HGPA 1Y59T 1UCYH 1F92A 4UONA 4KKDA 4YLUA 1FIWA 4O3UA 2BDIA 3ZZAA 2Z9GA 3A85A 1OX1A 2XBVA 4ZHLU 1J14A 1U6QA 4X2WA 3E91A 1P04A 3PWCA 1P2KA 4O97A 3RC6A 1O37A 2AH4X 1K2I1 5JBCS 1H9HE 7LPRA 4XFQA 1HXFH 4CHAB 2YNAA 1TGBA 3F9EA 1GJ6A 3C27B 1TBZH 3GY5A 1O2ZA 1ELDE 4OS4A 1OS8A 2Q6GA 1C2FA 1QNJA 3TGJE 2SGFE 3EQ0H 4NZQA 2QC2A 1INCA 1YBWA 4DCDA 1BRBE 1XUKA 1GI7B 1Y5AT 1C1WH 1O2OA 1P9SA 1TNJA 4RT1A 2F9OA 1DWDH 2FP7B 2A5AA 5EXLA 4X8SH 3SV6A 2WZQA 1YPHC 4A7IB 2BDCA 2RA3A 3RXGA 4F48B 1FY5A 4ESTE 3GCOA 1PQ8A 2EC9H 3BN9A 2FEQH 3PMJA 2BD3A 1TGTA 2GD4B 3IITA 4K8YA 2GMTB 4CBNA 2P3UB 3T29A 4AB9A 4JMYA 1YGCH 2ODQA 3MH5A 3QK1A 2O8TA 2PUXB 1IQIA 1NFWA 1JIMA 2FYQA 2GP9B 1C1NA 2HRVA 1T4UH 3SN8A 4MNXA 2BLVA 3UWIA 2AGGX 4WMEA 1V2PT 1UTJA 3FZDA 5AFZH 4JK5A 1ZSJA 4TPIZ 4IC6A 4GHQA 4IW4E 3AASA 3RXDA 1EAWA 1C1MA 3AW0A 1A2CH 3EAJA 1ZHMA 3VGCB 5EQSA 3KCGH 3SU1A 3TJUA 1T8LA 3GCNA 2P94A 4DIIH 2NU0E 3F2FA 4NGAH 2BVRH 1TA6A 5F8TA 4PROA 1WOFA 1IQMA 6CHAC 1FJSA 1AKSA 2ZWLH 1FPCH 1ZTKA 2G55A 1FN6A 4X6PA 1VCQA 1LHCH 3QX5H 3SI3H 1HAZB 3HKIB 1W7XH 3E3TA 3ATIA 1HAVA 5C5NA 1ZSLA 1C2EA 2W7SA 1GBKA 1Q2WA 1O5GH 5EU8A 3GOVB 1JBUH 1C1RA 3SJIA 1TX6A 1SOZA 4ABAA 3LH1A 1TNKA 2STBE 3RXRA 2XBYA 3VB5A 4DURA 5FCRA 1HJ9A 3SJ8A 4AC9A 4BOHA 3FANA 2GCTC 3LONA 4OS2A 5FXLA 1GJ5H 1SGYE 2K0QA 3TH4H 5DN6D 3BTTE 3H5CB 3U9AH 2FOAA 1HAXB 2HGTH 2VWMA 1A7SA 1D3TB 1WSSH 1QRXA 1KLIH 1S6FA 5SGAE 1J17T 1SB1H 4INHA 2XNDD 4AZ2B 1LKBA 1O3IA 2V3OH 5LPFA 4YM9A 1OWJA 3F68H 4CRCA 3ENSB 1GI9B 5T6FA 1AZZA 1TOMH 5CHAB 3RXVA 2F9BH 1EJNA 2F3CE 1WTHD 3EYDA 3K9XB 2UWPA 2SGQE 1F5KU 2PSXA 1A0JA 2YNBA 3TGIE 1EKBB 1AD8H 1P2QA 1L0ZA 4E06H 2FLRH 1GI3A 3OU0A 4TT3D 1LVBA 2FI5E 2WV5A 3A88A 1OWDA 1YLDA 3LJJA 2WPLS 3KQEA 2ZDNA 5EPYA 2TGTA 1K1OA 1O2XA 1QQUA 3S0NA 3LU9B 2BD5A 2F9VA 3U28C 1Z1IA 1D3PB 1O2VA 3W95A 2ZGHA 2W3KA 3ZVCA 1TRMA 1V2OT 2BY5X 2KFWA 1GJCB 1O2YA 2LP6A 2JETC 2ODPA 1YWUA 3PLPA 5FCKA 4H42U 3VG8A 5C5OA 2TIOA 5DP9A 1E1QD 1YPMH 5EJ1A 4WXIA 2F9PA 3P17H 1QB6A 3SJOA 1O2RA 5DP4A 1HFDA 2TRMA 1NBMD 1EASA 4WXVA 1DUAA 2OK5A 3TITA 1HLTH 2HPQH 2RCEA 2BDBA 1C5OH 3TK5A 2I6SA 4JCNA 2Q1JA 2YMSD 1VCWA 4O9VA 3D65E 3GY7A 4HZHA 2HNTE 1C1SA 4WJG2 1O5BB 2FOBA 3MTYA 5IYTA 1V2JT 2H9TH 3AAUA 1DFPA 3KGPA 1EP5A 3PLBA 3U69H 1AUTC 1CGIE 1TGNA 1GBMA 1QBOA 4MPXA 1B0FA 1DE7H 3K6YA 2W3IA 3DSGA 1HUTH 2A32A 2ZHEH 5FPYA 3F0OA 1UTMA 2J98B 3PRBA 3NKKA 3FO8D 2ZQ1A 4JYTA 1PQAA 2J97A 4ABJA 1AVGH 4B6EA 4I31A 3RXQA 5E2PA 3KNXA 3BSQA 1FUJA 1O3EA 3T25A 1O2WA 2KCYA 3ZVBA 1QA7A 3K2UA 2B8OH 2GV6A 4U32A 2EQNA 3DFJA 1JRSA 4Q7YA 2BQWB 5HIZA 1JRTA 3G01A 1UCYE 1PPGE 4BXWA 3GCTF 3SQHE 2DUCA 4FUJA 1O3HA 1S82A 3GY3A 2A4GA 2XC5A 3SU5A 3E0NB 6CHAB 1SGEE 1Z8JB 3M7UA 3U8OH 3UR6A 2Y82A 3RLWH 4B2AA 2J92A 1HYLA 1BJUA 4GVUA 7KMEH 1AKSB 4NA7A 3M36A 1D3DB 4JZ1A 1BTUA 1BZXE 2ANYA 4RN6A 2H5CA 3ZZ6A 4FUBA 2Q6FA 1HAVB 2BY8X 4OS7A 1EZUC 2ZI2H 1MUEB 2Y5HA 4HI3A 3E0PB 3OAAD 4YZUA 2V3MA 1ESAA 1QA0A 3MO9A 1S81A 1YPEH 1LCYA 3PV2A 3A7WA 3EA9A 1ZPCA 1Z1JA 2XW9A 3ZZBA 4NFEA 4Y76A 1MTUA 4K1EA 2UUJB 1SI5H 1YCPK 3STIA 1GHZA 2GCTB 1LPGB 2OC0A 4OM9A 3STJA 3VB7A 2WSSD 1SLXB 5L2ZH 1P05A 3P8FA 3S7KB 2AIQA 1C2HA 4E7RG 1G3DA 2JDID 3ESTA 1CSOE 1SFQB 2A7HA 1YLCA 3S69A 2XTTB 1EAXA 1VR1H 3E90B 3SBKA 1YM0A 1W11U 3S9AA 1UJ1A 1YF4A 4YXWD 1T31A 1O3OA 1OWKA 2J2UA 3ZVFA 1G2MA 1BQYA 3DSPA 3M5LA 1UW7A 4X8TH 4Q80A 5DK1A 1KLTA 2PTNA 4YESB 1QQ4A 1FZZA 1C9TA 3MU8A 1ANDA 1KTSB 3BV9B 2SNWA 2G5NA 3U1JB 4XBBA 2R2WU 1P2NA 1DT2A 1O2TA 2EEKA 1TPOA 1AFQC 3M37A 1IQJA 2B7DH 1AB9B 4O3TA 1H8HD 3ZIAD 1E36B 2BTCE 4THNH 3TH2H 5A2MH 1P02A 4ISLA 1QL8A 3V13A 1SFIA 3RXKA 4TYDA 3Q3XA 4AFUA 1K9OE 3JZ1B 4Y7AA 4CHAC 1HAYB 3CNRA 1GI4A 2F9UA 1D6WA 2FOGA 5HM9A 1RTKA 3ZYDA 5CE1A 4XBCA 1Z8RA 1THRH 1DWEH 4GLYA 1S85A 2Y80A 3T2NA 4HG6A 1T8MA 1EOJA 2GV7A 1FXYA 1HAHH 1S83A 1SGDE 1SSXA 3UPEA 2FX6A 1CA8B 5EXNA 1ZR0A 2R3UA 2WINI 1HIAA 2BLQA 3TIUA 5GDSH 2KCPA 1GBJA 3N7DA 1V2RT 5F6MA 3SV8A 1V2ST 2FOEA 3UFAA 1PPCE 1XVOA 1K0HA 2QXGA 2VJ1A 3VFEA 2O8LA 3TLOA 3H7TA 5LGOA 2FMJA 5JPMH 3ZZ7A 2C8WB 5A0AE 3B23B 1O5AB 2NWNA 4WMFA 1SGQE 2WUCA 3O8DA 2FS9A 1EOLA 3GCTG 1OYTH 1UVPA 4MG3A 3FOAA 2F83A 4GSOA 3ODDA 1OP0A 1ESTA 1LTOA 2ZU5A 4ZH8A 3UTUH 2CGAA 5HXFA 1THSH 3MH4A 1L1JA 2WV4A 3DUXH 4X1SU 2QF4A 1C2KA 3GYLB 3SUGA 2G00A 3SGAE 5A8ZA 3NK8A 2Z9KA 1OWEA 3VGCC 2O8UA 1IQLA 1V2UT 2ZZUH 1OKXA 5EJLA 4NA8A 1SKYE 2W7UA 2O8WA 3PV4A 1MTNC 1QHRB 5HGGA 1IQGA 3SZEA 1H9LB 2TBSA 1Y8TA 3M7QA 4BAHB 2FLBH 2BLOA 3BIVH 1YPKH 1YC0A 2A4RA 3SGQE 2BOHB 1A61H 4DJZB 1V2MT 3SUFA 4YLQH 4AYVB 2EI7A 1TOCB 4Q63A 3SNAA 5LH8A 1SGFG 4TPYA 3ATMA 1FNIA 2OLGA 1VKYA 4NIVA 1C1PA 2PKSC 3MNSA 1GBFA 1TX7A 4KP0A 1MTVA 3SU4A 2Y81A 2SGDE 5K7RA 3S9CA 1NS3A 1GBTA 4NCYA 1EQ9A 2HLCA 3DT0H 1C9PA 1O2JA 2Z94A 2IJOB 1GWAA 4B6FA 5K0HA 1C5ZB 4CRBA 3OYPA 2HVXA 4Y7BA 1GMHF 5JYIA 4H4FA 4KTCA 4ABIA 3KYGA 2A7JA 3D49H 2ZDLA 2RA0A 1A4WH 2FWWA 2SNVA 1QURH 2UUFB 3F0PA 1SG8B 3PLKA 2ALPA 1XVMA 1TPSA 1MZAA 3KQCA 5C2ZA 1GBAA 1UTPA 1GBLA 1C5UA 2YOLA 4KTUA 3N7EA 1O3PB 1O5CB 1DLEA 2CJIA 5E2OA 1Y3WA 2ZIQH 4ISNA 1KTTB 2A2XH 3LGWA 1NRQH 1G36A 3DFLA 3SU6A 2GZ8A 4NIXA 4DOQA 1SGCA 3TU7H 1XXDA 1GJBB 1C5LH 1DITH 2ZA5A 4ZUHA 1DXPA 3QZQA 2LNCA 1Y5UT 3RMOH 2P95A 2AMDA 2EI8A 3DHKH 4AB8A 1XXFA 3U8TH 3LGVA 2HLDD 1OSSA 1O3AA 2G5VA 2ZDAH 2GZ9A 1AFQB 2C8XB 2ZTXA 1OHHD 5C1YA 4ZKRU 5EPNA 1UO6A 3GDSA 3WWBA 5ESTE 5HYOA 1WQVH 4NG9H 1O3DA 1G3BA 3GCHB 1XUGA 3SI4H 4K69A 4GPGA 1AGJA 4NA9H 3ZZ8A 1S0RA 2BYAX 1EXFA 1BTWA 3SJKA 2CXVA 1RTFB 1TFXA 4Q2KA 1BOQA 1K21H 3PMBB 2ZECA 4ABGA 1NPMA 3Q77A 2FO9A 1Y3XA 3RDZA 2F43B 1QL9A 5EW2H 2V3HH 1K1NA 5A09A 1O5EH 1ELGA 2WHXA 1MTWA 5FBEA 1XUFA 4FUGA 1WCZA 1NFXA 4K60A 3MI4A 4DVAU 3EE0B 5GIBA 1NFUA 1XKAC 5JDUB 2D26C 1G32B 2XC0A 4RSPA 1AWFH 4MNWA 1GI5A 1HIAB 3F1SB 4FUIA 4I32A 1FPHH 1C5VA 1NU7B 2A2QH 4Y8YA 5B6LA 2G51A 1V3XA 2H6MA 3PMHB 5AHGH 4OGXA 3SU2A 1WTGH 2VBCA 1MH0A 3ZZ3A 3ZZCA 1GDUA 1H8IH 1O3BA 1FY3A 1VJ9U 1TABE 2ZU1A 5GCHF 1V2NT 1C5XB 2BY7X 4OS1A 3OFND 4NSYA 1SQRA 1GGDB 1GCTC 1C2LA 1TMTH 1YY3A 2VH6A 1PYTD 2ZGJA 4MNYA 1ANCA 1GJ4H 1OWIA 3H09A 2HOBA 5PTPA 4X8UH 3DCLA 2BOKA 1SPJA 2ZCKP 1TNIA 5F53A 4AX9H 1MBMA 1NFYA 1KLJH 1Z71A 2J9NA 1VITH 4ISOA 2JH0D 2GJGA 1MTNB 3KQ5A 1O2NA 4CR9A 1TGSZ 1GMHG 3QZRA 1NRRH 1PPFE 3SOSA 2ZG0H 1GPZA 3TH3H 1HCGA 3A7ZA 3UIRA 2XWBI 3A82A 2J34A 4BANB 5T3HA 1KMHB 1PPEE 5FX6A 2GZ7A 4I86A 3P6ZB 1LO6A 1RGQA 1NRNH 1PJPA 2KAIB 2V0BA 5EW1H 2PKSB 5C94A 2XCFA 3K6ZA 4DG4A 1MAXA 1SOTA 3RMLH 2OXSA 4CRGA 4UDWH 2WPJS 1KDQA 2VVVA 4NWLA 1ZMJA 3SV9A 4Q4LA 1EAIA 1BMMH 5EGMA 1NM6A 1P8VC 3RMNH 1MCTA 1PQ7A 4DGJA 1S6LA 2A7CA 1PPZA 4AORA 2FTLE 4D7GA 2VH0A 2XYAA 4MPVA 1DS2E 1YLNA 3E1XB 4X6NA 2VVUA 2AFQB 3URCA 4Z6AH 3RC4A 1OXGA 3IG6B 4X1RU 4ABHA 1FY1A 2A5KA 3EGKH 5C0TA 1SGFA 1W7GH 2OTVA 2XNIA 4LZ4B 1L2EA 4TY7A 1IQNA 2XRCA 1NC6A 2H9HA 4LXBH 1H4WA 4O03A 1AQ7A 4WY3A 2R3YA 2QE7D 3RLYH 5A8YA 2UWOA 2C93B 4GCHF 1GJ8B 2G4UA 1ELTA 3P92A 4FUEA 1O38A 2AMQA 4M7GA 1KXFA 3M35A 1NN6A 1C5SA 3BTEE 1C2IA 4K1TA 2PR3A 3C1KA 3W94A 3KL6A 1WUNH 2BX3A 1T7CA 1YPHE 4AG2A 2AYWA 1XM1A 1AB9C 4ACBA 5HMAA 1O2GH 1SGTA 2ZQ2A 3PTNA 1G3CA 2A5IA 3ODFA 2XBXA 1VJAU 1EZXC 1JWTA 4F4OC 1HAGE 1D4PB 1HNEE 2J5UA 2J38A 1EZQA 2A4OA 2ZEBA 4WF8A 5EG4A 1F2SE 2FPZA 2NU1E 2OCVB 1TLDA 4ZKSU 3F6UH 2L74A 1XKBC 2R2MB 4MPWA 1SVPA 1A1RA 4GAWA 1S0QA 2ZU2A 1CT0E 2NU2E 1BMLA 5C1XA 1UVOA 3MHWU 4Y71A 2H1UA 1WBGB 3K65B 2BZ6H 1D9IA 3GDVA 1V2KT 5J4QA 2Z6BD 5ABWA 1SQOA 4CH8B 3BTHE 1BBRK 2Z9JA 3L3TA 1SQTA 5GCHG 3W1EA 1BB0B 5HIYA 5DP5A 1MKXH 1O2HA 1TNGA 1TQ7B 2FODA 4ZXXH 4TY6A 3FP7E 3UY9A 2PLXA 5DKMA 4FUDA 3RXIA 1C4V2 1P0SH 1ETTH 1ANBA 4Q7XA 3QGJA 2J95A 1GBDA 2CN0H 2ILNA 4JYUH 4ZKNU 1FAKH 1JOUB 1Z6JH 5EQQA 2ZU3A 1IHSH 3VXFH 3UNRA 2D1JA 1O30A 3HATH 2J4IA 3LGIA 5H4IB 5GWZA 4FUFA 2C8ZB 5FL7D 1G37A 3TK9A 1GBEA 4WH6A 1PPBH 3MNXA 3LC3A 1F5RA 5C17A 4YO9A 1ZTLA 2BVSH 3LPRA 1DLKB 3A7TA 3R3GB 3BF6H 2HVYB 1O31A 2GTBA 1UTLM 2CHAB 1RFNA 3MH7A 3LH3A 7GCHF 1A46H 3UQOA 3A80A 3NCLA 4H6SB 1BJVA 3LKWA 3VB6A 2BQ7B 1QL7A 2QYIA 1GCTB 4UE7H 3VB4A 4E05H 1DY8A 1DWCH 1XX9A 1C1QA 4MTBA 4YOIA 2K1QA 2M2AA 4D9RA 3TK6A 1QRWA 1NZQH 4CRFA 1ELVA 3F2HA 3LJOA 3ITIA 2PKAA 1FV9A 3KF2A 2F9NA 4NWKA 1AIXH 1FY8E 2JJ1D 4K2YA 4UFDH 4Y79A 5JB8S 3RXLA 4Y11E 3RXOA 1GBBA 3TGKE 2CV3A 1LPZB 1WXRA 5I46H 2VWLA 1C5NH 1QFKH 1UTNA 4INKA 4KTSA 1C4U2 5DG6A 1QCPA 3ZZ4A 3ZVAA 3ZVGA 4FU9A 3RXFA 1WU1A 3M5OA 3WW7A 4ASUD 2HNTF 2VWOA 3AAVA 1Z8IB 4CR5A 1EJMA 1DDJA 2ZO3H 4X2VA 2BM2A 3M61U 1NTPA 3PB1E 3BEIB 1FMGA 2QY0B 3GY6A 4GCHG 5ESBA 2CMYA 1E37B 1QTFA 1UVUH 4ZMAH 3LIWA 3A8BA 3SO3A 3F9FA 1TNHA 3FP6E 1C4Y2 1C5MD 4OGYA 3LC5A 1GHWH 3O8BA 4X1NU 4X0WU 2KX4A 2VB0A 1ZMLA 2ZHDA 4B75A 4XD7D 2Z3CA 1T8NA 1KDQB 3F3BA 1BCUH 1ZYOA 1TBQH 5CMXH 1GHBF 1MKWH 3SU0A 1AZ8A 3GICB 4YOGA 5FX5A 4DT4A 4IC5A 3M5MA 4LZ1H 1MD8A 1SC8U 4XE4A 3MMGA 1GMCF 4AFQA 2UUKB 3TJNA 4CREA 3UNSA 2QIQA 3FN8A 3HPTB 3WY8A 2JH5D 1BHXF 2SGPE 2XWAA 2XXLA 2KCOA 1BA8B 1BMFD 3T28A 3MNBA 5LPRA 4TSFD 2YMSB 1CA0B 3PTBA 1DWBH 3QO6A 2B0FA 4ZHMU 1KY9A 1J15A 4AGJA 4HFPB 2C8YB 1TRNA 2P93A 3A7YA 2QGRA 4IGDA 2ODYB 1V6DA 1LVYA 1DY9A 1FX0B 4VGCB 1N6XA 4ABEA 3UOUA 1C5TA 3MO6A 4BAMB 3GCHC 1WYKA 1ZGVA 1AI8H 2BQ6B 1ELBA 1P03A 2Z7FE 4GUXA 1AWHB 4XSKU 2RG3A 1C1UH 3PM3A 1FI8A 1FN8A 1C2MA 4ZCNA 3LOXA 1LKAA 3A7VA 5DO4H 4A5TS 1EP6A 4AFZA 1A3BH 4JK6A 2JH6D 3ATKA 3FVFB 3A86A 3D62A 6GCHF 2XC4A 4I8GA 2OQUA 3RXTA 1OYQA 2THFB 1GL1A 3TNSA 5T6GA 1UTKA 1ZJKA 3PROA 4BAOB 1SLVB 1HJAC 1W10U 1O36A 3HKJB 1EZSC 3ZYEA 3KYFA 3PRDA 6LPRA 1GHXH 1F0TA 1SBWA 1L1NA 3RP2A 4U30A 2GKVE 7GCHG 5DP3A 3PWBA 3ZZ9A 1CU1A 2ZNKH 1W13U 1CGJE 2ZPQA 2BDAA 2TGPZ 1RD3B 2AIPA 4RKOB 1SHYA 1GHYH 1HV7A 2BDHA 1ZZZA 1LQDB 4GHTA 2P3TB 1W3CA 5IK2D 4OS5A 3TJVA 1TMUH 3SORA 1ZPBA 2FOMB 1GDNA 2HWLB 3I78A 4F49A 3RXSA 2AGIX 3TVJB 4A1XA 1BRCE 3UB0A 2BD2A 2P59A 2FESH 1DOJA 2IOTA 4I8JA 1GGDC 3M7TA 3A8CA 4X1PU 1ETRH 3H7OA 2VIQA 2M5TA 3RXMA 4I8HA 3UNQA 1MAYA 1ZGIA 3PO1B 1GBIA 3RXCA 4P00A 1KXEA 2OP9A 1VITF 4B74A 3HGNA 1TQ0B 3FZZA 1C5RA 4WWYA 1O2QA 4NIWA 1C5PA 2ZFRH 1ESBA 4YT7H 1KXBA 1ETSH 3BG8A 2ZGCA 1NESE 2D8WA 5KEDA 2G81E 4I8KA 3MH6A 3MOCA 3LDXH 4BNRA 2BXUH 2RDLA 4B1TA 1NO9H 2QF3A 1E35B 3NXPA 1N1LA 1PFXC 3RU4D 5CHBA 1P9UA 2ZTZA 1Y3VA 3RXEA 3OX7U 1LHGH 1A5GH 2GGVB 1GHBG 3QTOH 3UQVA 1QJ1B 1TBRH 1GI1A 2FX4A 1AVWA 1CVWH 3EE7A 2PKAB 3GY2A 2KR7A 5TCAA 3ZZDA 3QLPH 4CRDA 3T5FH 7ESTE 4IN1A 3SYJA 2G4TA 1AE5A 1P10A 1BITA 1BIOA 1D6RA 2BVXH 3SUEA 2VU8E 1GMCG 3NPSA 3BTGE 3PV5A 1WAYB 2VIDA 8KME2 2ZCHP 3QN7A 1QJ7B 1W0YH 2BD4A 8ESTE 1TPPA 5ETXA 2WPDD 1V2TT 1UK3A 1V2LT 2A1DB 5L6NH 1CE5A 1HRTH 4IS5A 4ZROA 3BG4B 4K8BA 4J2YB 2ZKSA 1UCYK 5AF9H 3AVZA 3RU4E 2OD3B 1AE8H 1C2GA 1ZPZA 2OC1A 3PYHA 1P2JA 2Y6TA 2TGDA 1C1TA 1K1JA 1A0LA 4JZIA 3A8DA 1P57B 2WPHS 2IN2A 1G3EA 2OBOA 4AOQA 2BY6X 1AO5A 1B0EA 1AFEH 1GI8B 2ANWA 5AVDA 3RM2H 1YPLH 2ZDMA 6GCHG 4Y8XA 3UUZA 3OTPA 1GI0A 4J1YA 3MO3A 5JBTA 2NU4E 2DE9A 2ZFSA 1SGPE 3KHVA 2QCYA 2AGEX 3OY5U 4FVDA 3M3VA 2V35A 3ATWA 1Y3UA 2ZDVH 5A0CA 2L6OA 2P8OC 4JZEH 3SV7A 4BTTB 2FI4E 5CDFE 4WH8A 4UFGH 1GJ9B 2R0LA 3A8AA 5IDKA 1W14U 1PYTC 1YYY1 4M9FA 1O3JA 2H2ZA 2TPIZ 4K3JA 1P09A 1VCPA 1C1VH 1QY6A 3ZV8A 1H8DH 4B73A 1BTPA 2VGCC 2A31A 4ACAA 1SMFE 1NRPH 4INLA 5FBIA 4HTCH 1G9IE 3RU4T 5BRRE 5T1VA 2QAAA 1GHVH 5DGJA 2FYRA 4P02A 2WPKS 3UWJH 2B5TB 1N8OC 5BPEA 1G2LA 1DX5M 3A89A 4B2CA 1BTZA 1FLEE 2ZPRA 1HJAB 1K1IA 2ZU4A 1SR5C 1N6YA 1T32A 2JIZD 5GPIB 4ZXYH 1AVXA 3D23A 4NZLA 2F4LA 1FIZA 2JJ2D 3BTDE 4ZAEA 5LPEA 2LELA 1RXPA 4BTIB 4Y0YE 1VITG 3T26A 3RXAA 4NIYA 1AHTH 2PV9B 2PWXA 4A6LA 1KXCA 4Y10E 1DVAH 3ZZ5A 1KXDA 2J94A 3RXJA 1GG6C 3MFJA 3FAOA 1LVMA 5JBBS 2A45B 1JMOH 2BD9A 4B2BA 1O2KA 1P2OA 2CHAC 2VWNA 1BDAA 2FI3E 1CT2E 4AGKA 3O8CA 5C67A 1WQSA 3U8RH 2W6JD 1GDQA 3N99A 2BZAA 1GVKB 1MTSA 1ARBA 1Z8GA 4FU7A 4D9QA 1QBVH 3QUMP 2J98A 2EA3A 2DE8A 6ESTA 1LDTT 1P06A 2FTMA 1ZSKA 3NRLA 4NSVA 1BMAA 1NROH 2ZHQH 1Y5BT 2OUAA 1F7ZA 5DP8A 1AUJA 3ZVEA 2ALVA 1E0FD 1O39A 3EDXB 2OQ5A 3CS0A 2STAE 2CF9H 2FOHA 1G30B 3A81A 4FOUC 5C0UA 4X6MA 1OP8A 1UK2A 4FUCA 2VIOA 3E8LA 3O8RA 5EJZA 2KCAA 2QV1A 3ZVDA 1GMDF 3GY4A 1Z6EA 2A0QB 2IPQX 3S9BA 1NRSH 1BUIA 2GCHF 1FY4A 4FXGH 3DA9B 5HM2A 2ZC9H 1EPTA 3MU1A 2BB4A 1B5GH 1IQFA 3BEFB 3FFGA 4LK4A 1EPTC 3NUMA 1WDIA 4SGBE 4D7FA 1EB2A 1LHDH 1FAXA 1GHAF 4B71A 5C3NA 2HNTC 1E79D 2VIPA 3BTKE 4DY7B 3LGTA 3KEEA 1EX3A 1DPOA 1HB0B 1OWHA 1ZJDA 4WVPE 4YTAA 1XUIA 2BX4A 1QR3E 2Y5FA 2QXHA 1W0JD 4Z1MD 1IQHA 1EJAA 3DD2H 2V7QD 3UR9A 3OEED 2A4QA 2VINA 2OC8A 2ASUB 5FHTA 2WPIS 2AMPA 2BDGA 4MLFB 1JIRA 1NY22 5FPTA 4ZHAA 1GVZA 4R0IA 4DIHH 1IAUA 3P8OA 1LHEH 2IJD1 1DICA 2ZGBH 3A83A 3L6PA 1RIWC 1E1RD 3CP7A 1FDPA 1W2KH 3V0XA 1MU6B 3IWMA 3BIUH 1J16A 3V7TA 2YMSC 1K28D 1CA0C 3FP8E 2Z9IA 3MNCA 5EODA 2ZCLP 1UMAH 4FUHA 1QB9A 1MQ6A 2BD8A 3CENA 4JZDH 4K5ZA 5KECA 5TCCA 1QIXB 1FONA 4VGCC 5I25A 1GJ7B 2PFEA 2PUQH 3M5NA 4UFFH 1TA2A 1E38B 1OPHB 1LPKB 1K1LA 5DJ7A 1THPB 3P8NA 5FPSA 2ZDKA 1TIOA 1MKXK 2ZTYA 4U2WA 4BAKB 3VXEH 1MD7A 5A0BA 1GBCA 3SGBE 2OBQA 2QXIA 2P8OB 1O2PA 3SZNA 4IN2A 1A3EH 4JYVH 3KN2A 1J9CH 2QA9E 1F0RA 1RS0A 5C20A 1K1MA 4RKJB 3L33A 2BD7A 1ZMNA 1ABIH 3HK3B 5EOKA 3LGYA 1C2DA 3GS9A 2D2DA 2EI6A 2NU3E 2VGCB 1NT1A 1A5HA 1D3QB 1DM4B 1ACBE 3ZV9A 1ELAA 4DW2U 1N8OB 1VZQH 3URDA 2ZPSA 1GJDB 1HAOH 1HAPH 1C2JA 2O8MA 4CBOA 3UREA 1QRZA 1PPHE 8GCHF 1HJ8A 1KYNA 4D76A 4ABBA 5L2YH 4UD9H 1L4ZA 1SQAA 4RT0A 4UFEH 2GT7A 1LQEA 2G8TA 4B76A 1C5WB 1ELEE 1GCDA 4DT7B 1XUJA 2ZHWH 3OSYA 2I6QA 4ISIH 2ZFQH 1ID5H 2XBWA 4YT6H 1GG6B 4MNVA 5E0JA 1UTOA 2IPHA 5GNDA 3VPKA 4Y0ZE 1T8OA 3OTJE 1GMDG 3SW2B 5EXMA 1BRAA 2HALA 1P2MA 3PO1C 2AERH 3GYMA 1YPGH 3F9HA 1O5FH 1X7AC 2HPPH 2GCHG 3TJOA 4OS6A 3VEQB 1L1GA 1V2WT 5E0HA 2SFAA 1BBRH 1QGFA 1XMNB 3N7OA 3AK5A 4MDSA 5KGOA 5JB9S 1O35A 3MU5A 1GHAG 1O2IA 3PMAB 1O2MA 3SNCA 4ZKOU 1C5YB 3R0FA 1GI2A 1NBME 4XOJA 1BRUP 2QF0A 4BTUB 4D8NA 1ZRKA 2ZP0H 1ELFA 3OE7D 3RUOA 4BAQB 1NU9A 1O32A 5TJXA 4R8TB 2P3FH 5E8EH 1EAUA 1MCVA 5EIYA 1CBWC 1MKWK 2ANMH 4XDEA 2Z3DA 1WV7H 3EA7A 4Q7ZA 5FAHA 1BTYA 1Q3XA 1O0DH 2BMGB 4IMQA 3LGUA 1HXEH 3HK6B 4Z0KA 3JZ2B 8LPRA 1QJ6B 1UK4A 1DSTA 1UHBA 4A1TA 1A0HB 1O3CA 1EPTB 1VGCC 2K8IA 2ZHFH 1TRYA 1P3CA 1Y3YA 3BG4C 1TE0A 2BHGA 4MQAA 3BTQE 1UTQA 4A1VA 3OY6U 1TONA 1HGTH 1DUEA 2P16A 4WMDA 5C1UA 4AG1A 1RRKA 2WPMS 2ZFPH 3SJ9A 2LPRA 3SNEA 2FZZA 4X6OA 3QTVH 2PP6A 2WV9A 1AN1E 1OP2A 2RDEA 1ANEA 3B8JA 4I33A 1EB1H 2R0KA 1MABB 4NFFA 3TPIZ 9LPRA 2CF8H 1O3LA 4X8VH 2C90B 3F2GA 2AEIH 1EUFA 1TYNA 4X2XA 2BLWA 2OINA 1RIWB 2F91A 1HDTH 2PSYA 1E34B 4U01A 3RC5A 2W26A 1SL3A 1ZHRA 4ISHH 4KELA 1CT4E 2KZ4A 2QXJA 5DPAA 1QZ8A 2BY9X 4IBLH 1SHHB 2ANKH 1Q31A 3F9GA 3KQDA 3I29A 1LVOA 3BEUA 1W8BH 3T62A 1A5IA 1GBHA 4HGCA 3SQEE 3NWUA 3ATLA 3U98H 1RJXB 1BHXB 2VNTA 3SNBA 3S7HB 2B9LA 3RXBA
chains in the Genus database with same CATH topology
4ABDA 5T6DA 5JBAS 1P11E 1S84A 5DP7A 1YCPH 2ZFFH 1S6HA 2OC7A 1UVSH 1QBNA 2H9EH 3Q3KA 3SU3A 2W6ID 3P95A 3RXUA 8GCHG 1EATA 1JXPA 1W12U 1EFRD 2UWLA 3AW1A 2QF5A 5AFYH 1O3MA 4MVNA 3BTWE 4KGAA 3B9FH 3KQBA 1ARCA 4I7YH 1HBTH 1CHOF 5J4SA 1ZRBA 1TNLA 4AYYB 4X2YA 3LT3A 3Q3YA 3SHCH 1P2IA 1GJAB 1H1BA 3A87A 3GY8A 3MU0A 2JKHA 2PHBA 2Q6DA 2Z3EA 1UVTH 4FU8A 1MQ5A 5HKKD 1TAWA 2FXRA 4ABFA 1O33A 4TWYA 2ESTE 2FM2A 1O3NA 3MYWA 4LOYH 1GVLA 2WUBA 3A7XA 3UOPA 3QDZB 2JETB 4XBDA 3NZIA 3MU4A 1W0KD 1O5DH 1GL0E 3U1IB 1TB6H 2H5DA 1L4DA 4CRAA 1P12E 1MMJN 1P3EA 1HPGA 1AY6H 1C1OA 1DSUA 2ULLA 1SGRE 2CK3D 4K1SA 3DSOA 2GVFA 5G4BA 1ZHPA 1QB1A 3RXPA 5DSFA 2ZF0H 3EA8A 3ELAH 1TPAE 2Z9LA 2WYJA 4TWWA 4AFSA 1SGNE 2GMTC 1RTLA 1Z7KA 1O2LA 1ELCA 4UEHH 2Y7ZA 3GISB 1MU8B 1TX8A 1CO7E 2FOCA 1B7XB 1AU8A 1KSNA 1F5LA 1CGHA 1F0SA 1J8AA 5GXPA 5F03A 2G52A 2FIRH 4I8LA 1ZOMA 2V6NA 1ZTJA 2FS8A 4MPUA 2AHME 2ZGXH 3M3TA 1MZDA 1SGIB 9ESTA 1KIGH 2SGAA 3Q76A 1S5SA 4CH2B 2BXTH 1YCPM 3MWIU 3T27A 3M3SA 1H9IE 1FQ3A 4Y8ZA 2GDEH 2XOKD 1LMWB 2C4FH 5L30H 1CBWB 1GI6A 1HAIH 5EQRA 1DANH 1AMHA 1O3KA 3RM0H 2PGQB 3BTME 2KAIA 3RMMH 1ORFA 1M9UA 3WWFA 1K22H 1C5QA 3V12A 2GDDA 5B6OA 2WYGA 2BDYA 1LHFH 1MBQA 1ZLRA 1SLUB 1CQQA 2Y5GA 1O3FA 1DXWA 1CHGA 2FDAA 1V2VT 1VGCB 4A92A 3TNTA 2W5EA 3SHAH 1UHBB 3SUDA 1TALA 1IQKA 3QWCH 4FVBA 2C3SA 1O2UA 1OOKB 2ZFTA 1YP9A 5A8XA 2XCNA 4YOJA 1IOEA 1XUHA 1TGCA 3P8GA 4RI0A 4AN7A 2VVCA 4ASHA 4FETA 1O34A 1BTHH 3A84A 2GT8A 4SGAE 1IHTH 3Q00A 1W0ZU 1V2QT 5F8ZA 3CS7A 2PTCE 2GX4A 1YKTA 1PQ5A 3SNDA 2QN5T 1ABJH 1KXAA 1YPJH 4IMZA 2R9PA 4BXSA 2Y7XA 2VIVA 4H6TA 1BTXA 3SV2H 1TMBH 5DP6A 5GJ4B 3OEHD 1BMNH 1TWXB 4Y6DA 1T4VH 3VB3A 2TGAA 3GDUA 3E16B 4F55A 1CHOG 2FOFA 4JZFH 1SLWB 1COWD 1P01A 1BT7A 3KIDU 2PW8H 4QT8C 1H8ED 2KM0A 3RXHA 2PGBB 1IQEA 2O9QA 5CHAC 3I77A 2UUYA 3QGNB 5F8XA 3E6PH 3BTFE 3P70B 2SGEE 4X1QU 3V3MA 1K1PA 3FKSD 1O3GA 1F0UA 2AS9A 1O2SA 2VIWA 5E0GA 1BBRE 4E7NA 3HGPA 1Y59T 1UCYH 1F92A 4UONA 4KKDA 4YLUA 1FIWA 4O3UA 2BDIA 3ZZAA 2Z9GA 3A85A 1OX1A 2XBVA 4ZHLU 1J14A 1U6QA 4X2WA 3E91A 1P04A 3PWCA 1P2KA 4O97A 3RC6A 1O37A 2AH4X 1K2I1 5JBCS 1H9HE 7LPRA 4XFQA 1HXFH 4CHAB 2YNAA 1TGBA 3F9EA 1GJ6A 3C27B 1TBZH 3GY5A 1O2ZA 1ELDE 4OS4A 1OS8A 2Q6GA 1C2FA 1QNJA 3TGJE 2SGFE 3EQ0H 4NZQA 2QC2A 1INCA 1YBWA 4DCDA 1BRBE 1XUKA 1GI7B 1Y5AT 1C1WH 1O2OA 1P9SA 1TNJA 2F9OA 1DWDH 2FP7B 2A5AA 5EXLA 4X8SH 3SV6A 2WZQA 1YPHC 4A7IB 2BDCA 2RA3A 3RXGA 1FY5A 4ESTE 3GCOA 1PQ8A 2EC9H 3BN9A 2FEQH 3PMJA 2BD3A 1TGTA 2GD4B 3IITA 4K8YA 2GMTB 4CBNA 2P3UB 3T29A 4AB9A 4JMYA 1YGCH 2ODQA 3MH5A 3QK1A 2O8TA 2PUXB 1IQIA 1NFWA 1JIMA 2FYQA 2GP9B 1C1NA 2HRVA 1T4UH 3SN8A 4MNXA 2BLVA 3UWIA 2AGGX 4WMEA 1V2PT 1UTJA 3FZDA 5AFZH 4JK5A 1ZSJA 4TPIZ 4IC6A 4GHQA 4IW4E 3AASA 3RXDA 1EAWA 1C1MA 3AW0A 1A2CH 3EAJA 1ZHMA 3VGCB 5EQSA 3KCGH 3SU1A 3TJUA 1T8LA 3GCNA 2P94A 4DIIH 2NU0E 3F2FA 4NGAH 2BVRH 1TA6A 5F8TA 4PROA 1WOFA 1IQMA 6CHAC 1FJSA 1AKSA 2ZWLH 1FPCH 1ZTKA 2G55A 1FN6A 4X6PA 1VCQA 1LHCH 3QX5H 3SI3H 1HAZB 3HKIB 1W7XH 3E3TA 3ATIA 1HAVA 5C5NA 1ZSLA 1C2EA 2W7SA 1GBKA 1Q2WA 1O5GH 5EU8A 3GOVB 1JBUH 1C1RA 3SJIA 1TX6A 1SOZA 4ABAA 3LH1A 1TNKA 2STBE 3RXRA 2XBYA 3VB5A 4DURA 5FCRA 1HJ9A 3SJ8A 4BOHA 3FANA 2GCTC 3LONA 4OS2A 5FXLA 1GJ5H 1SGYE 2K0QA 3TH4H 5DN6D 3BTTE 3H5CB 3U9AH 2FOAA 1HAXB 2HGTH 2VWMA 1A7SA 1D3TB 1WSSH 1QRXA 1KLIH 1S6FA 5SGAE 1J17T 1SB1H 4INHA 2XNDD 4AZ2B 1LKBA 1O3IA 2V3OH 5LPFA 4YM9A 1OWJA 3F68H 4CRCA 3ENSB 1GI9B 5T6FA 1AZZA 1TOMH 5CHAB 3RXVA 2F9BH 1EJNA 2F3CE 1WTHD 3EYDA 3K9XB 2UWPA 2SGQE 1F5KU 2PSXA 1A0JA 2YNBA 3TGIE 1EKBB 1AD8H 1P2QA 1L0ZA 4E06H 2FLRH 1GI3A 3OU0A 4TT3D 1LVBA 2FI5E 2WV5A 3A88A 1OWDA 1YLDA 3LJJA 2WPLS 3KQEA 2ZDNA 5EPYA 2TGTA 1K1OA 1O2XA 1QQUA 3S0NA 3LU9B 2BD5A 2F9VA 1Z1IA 1D3PB 1O2VA 3W95A 2ZGHA 2W3KA 3ZVCA 1TRMA 1V2OT 2BY5X 2KFWA 1GJCB 1O2YA 2ODPA 2JETC 3PLPA 5FCKA 4H42U 3VG8A 5C5OA 2TIOA 5DP9A 1YPMH 1E1QD 4WXIA 2F9PA 3P17H 1QB6A 3SJOA 1O2RA 5DP4A 1HFDA 2TRMA 1NBMD 1EASA 4WXVA 1DUAA 3TITA 2OK5A 1HLTH 2HPQH 2RCEA 2BDBA 1C5OH 3TK5A 2I6SA 4JCNA 2Q1JA 2YMSD 1VCWA 4O9VA 3D65E 3GY7A 4HZHA 2HNTE 1C1SA 4WJG2 1O5BB 2FOBA 3MTYA 5IYTA 1V2JT 2H9TH 3AAUA 1DFPA 3KGPA 1EP5A 3PLBA 3U69H 1AUTC 1CGIE 1TGNA 1GBMA 1QBOA 4MPXA 1B0FA 1DE7H 3K6YA 2W3IA 1HUTH 2A32A 2ZHEH 5FPYA 3F0OA 1UTMA 3PRBA 3NKKA 3FO8D 2ZQ1A 4JYTA 1PQAA 4ABJA 1AVGH 4B6EA 4I31A 3RXQA 5E2PA 3KNXA 3BSQA 1FUJA 1O3EA 3T25A 1O2WA 2KCYA 3ZVBA 1QA7A 3K2UA 2B8OH 2GV6A 4U32A 3DFJA 1JRSA 4Q7YA 2BQWB 1JRTA 3G01A 1UCYE 1PPGE 4BXWA 3GCTF 3SQHE 2DUCA 4FUJA 1O3HA 1S82A 3GY3A 2A4GA 2XC5A 3SU5A 3E0NB 6CHAB 1SGEE 1Z8JB 3M7UA 3U8OH 3UR6A 2Y82A 3RLWH 4B2AA 2J92A 1HYLA 1BJUA 4GVUA 7KMEH 1AKSB 4NA7A 3M36A 1D3DB 4JZ1A 1BTUA 1BZXE 2ANYA 4RN6A 2H5CA 3ZZ6A 4FUBA 2Q6FA 1HAVB 2BY8X 4OS7A 1EZUC 2ZI2H 1MUEB 2Y5HA 4HI3A 3E0PB 3OAAD 4YZUA 1ESAA 1QA0A 3MO9A 1S81A 1YPEH 1LCYA 3PV2A 3A7WA 3EA9A 1ZPCA 1Z1JA 2XW9A 3ZZBA 4NFEA 4Y76A 1MTUA 4K1EA 2UUJB 1SI5H 1YCPK 3STIA 1GHZA 2GCTB 1LPGB 2OC0A 3STJA 4OM9A 3VB7A 2WSSD 1SLXB 5L2ZH 1P05A 3P8FA 3S7KB 2AIQA 1C2HA 4E7RG 1G3DA 2JDID 3ESTA 1CSOE 1SFQB 2A7HA 1YLCA 3S69A 2XTTB 1EAXA 1VR1H 3E90B 3SBKA 1YM0A 1W11U 3S9AA 1UJ1A 1YF4A 4YXWD 1T31A 1O3OA 1OWKA 2J2UA 3ZVFA 1G2MA 1BQYA 3M5LA 3DSPA 4X8TH 4Q80A 5DK1A 1KLTA 2PTNA 4YESB 1QQ4A 1FZZA 1C9TA 3MU8A 1ANDA 1KTSB 3BV9B 2SNWA 2G5NA 3U1JB 4XBBA 2R2WU 1P2NA 1DT2A 1O2TA 2EEKA 1TPOA 1AFQC 3M37A 1IQJA 2B7DH 1AB9B 4O3TA 1H8HD 3ZIAD 1E36B 2BTCE 4THNH 3TH2H 5A2MH 1P02A 4ISLA 1QL8A 3V13A 1SFIA 3RXKA 4TYDA 3Q3XA 4AFUA 1K9OE 3JZ1B 4Y7AA 4CHAC 1HAYB 1GI4A 2F9UA 1D6WA 2FOGA 5HM9A 1RTKA 3ZYDA 5CE1A 4XBCA 1Z8RA 1THRH 1DWEH 4GLYA 1S85A 2Y80A 3T2NA 1T8MA 1EOJA 2GV7A 1FXYA 1HAHH 1S83A 1SGDE 1SSXA 3UPEA 2FX6A 1CA8B 5EXNA 1ZR0A 2R3UA 2WINI 1HIAA 2BLQA 3TIUA 5GDSH 2KCPA 1GBJA 3N7DA 1V2RT 5F6MA 3SV8A 1V2ST 2FOEA 3UFAA 1PPCE 1XVOA 2QXGA 2VJ1A 3VFEA 2O8LA 3TLOA 3H7TA 5LGOA 2FMJA 5JPMH 3ZZ7A 2C8WB 5A0AE 3B23B 1O5AB 2NWNA 4WMFA 1SGQE 2WUCA 3O8DA 2FS9A 1EOLA 3GCTG 1OYTH 1UVPA 4MG3A 3FOAA 2F83A 4GSOA 3ODDA 1OP0A 1ESTA 1LTOA 2ZU5A 4ZH8A 3UTUH 2CGAA 5HXFA 1THSH 3MH4A 1L1JA 2WV4A 3DUXH 4X1SU 3SUGA 1C2KA 3GYLB 2QF4A 2G00A 3SGAE 5A8ZA 3NK8A 2Z9KA 1OWEA 3VGCC 2O8UA 1IQLA 1V2UT 2ZZUH 1OKXA 4NA8A 1SKYE 2W7UA 2O8WA 3PV4A 1MTNC 1QHRB 5HGGA 1IQGA 3SZEA 1H9LB 2TBSA 1Y8TA 3M7QA 4BAHB 2FLBH 2BLOA 3BIVH 1YPKH 1YC0A 2A4RA 3SGQE 2BOHB 1A61H 4DJZB 1V2MT 3SUFA 4YLQH 4AYVB 2EI7A 1TOCB 4Q63A 3SNAA 5LH8A 1SGFG 4TPYA 3ATMA 1FNIA 2OLGA 4NIVA 1C1PA 2PKSC 3MNSA 1GBFA 1TX7A 4KP0A 1MTVA 3SU4A 2Y81A 2SGDE 5K7RA 3S9CA 1NS3A 1GBTA 4NCYA 1EQ9A 2HLCA 3DT0H 1C9PA 1O2JA 2Z94A 2IJOB 1GWAA 4B6FA 5K0HA 1C5ZB 4CRBA 3OYPA 2HVXA 4Y7BA 1GMHF 5JYIA 4H4FA 4KTCA 4ABIA 2A7JA 3D49H 2ZDLA 2RA0A 1A4WH 2FWWA 2SNVA 1QURH 2UUFB 3F0PA 1SG8B 3PLKA 2ALPA 1XVMA 1TPSA 1MZAA 3KQCA 5C2ZA 1GBAA 1UTPA 1GBLA 1C5UA 2YOLA 4KTUA 3N7EA 1O3PB 1O5CB 1DLEA 2CJIA 5E2OA 1Y3WA 2ZIQH 4ISNA 1KTTB 2A2XH 3LGWA 1NRQH 1G36A 3DFLA 3SU6A 2GZ8A 4NIXA 4DOQA 1SGCA 3TU7H 1XXDA 1GJBB 1C5LH 1DITH 2ZA5A 4ZUHA 1DXPA 3QZQA 2LNCA 1Y5UT 3RMOH 2P95A 2AMDA 2EI8A 3DHKH 4AB8A 1XXFA 3U8TH 3LGVA 2HLDD 1OSSA 1O3AA 2G5VA 2ZDAH 2GZ9A 1AFQB 2C8XB 2ZTXA 5C1YA 1OHHD 4ZKRU 5EPNA 1UO6A 3GDSA 3WWBA 5ESTE 5HYOA 1WQVH 4NG9H 1O3DA 1G3BA 3GCHB 1XUGA 3SI4H 4K69A 4GPGA 1AGJA 4NA9H 3ZZ8A 1S0RA 2BYAX 1EXFA 1BTWA 3SJKA 2CXVA 1RTFB 1TFXA 4Q2KA 1BOQA 1K21H 3PMBB 2ZECA 4ABGA 1NPMA 3Q77A 2FO9A 1Y3XA 3RDZA 2F43B 1QL9A 5EW2H 2V3HH 1K1NA 5A09A 1O5EH 1ELGA 2WHXA 1MTWA 5FBEA 1XUFA 4FUGA 1WCZA 1NFXA 4K60A 3MI4A 4DVAU 3EE0B 5GIBA 1NFUA 1XKAC 5JDUB 2D26C 1G32B 2XC0A 4RSPA 1AWFH 4MNWA 1GI5A 1HIAB 3F1SB 4FUIA 4I32A 1FPHH 1C5VA 1NU7B 2A2QH 4Y8YA 5B6LA 2G51A 1V3XA 2H6MA 3PMHB 5AHGH 4OGXA 3SU2A 1WTGH 2VBCA 1MH0A 3ZZ3A 3ZZCA 1GDUA 1H8IH 1O3BA 1FY3A 1VJ9U 1TABE