2OBQA

Discovery of the hcv ns3/4a protease inhibitor sch503034. key steps in structure-based optimization
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
180
structure length
180
Chain Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Hepatitis C virus
publication title Discovery of the HCV NS3/4A protease inhibitor (1R,5S)-N-[3-amino-1-(cyclobutylmethyl)-2,3-dioxopropyl]-3- [2(S)-[[[(1,1-dimethylethyl)amino]carbonyl]amino]-3,3-dimethyl-1-oxobutyl]- 6,6-dimethyl-3-azabicyclo[3.1.0]hexan-2(S)-carboxamide (Sch 503034) II. Key steps in structure-based optimization.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 39
structure length 180
sequence length 180
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2obqA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2obqA01
3ODDA 1O2LA 1Y5UT 1SI5H 2ANWA 1AKSB 1G3EA 1NFXA 1C5LH 1GJCB 3URDA 4CBNA 5HYOA 1TMTH 1Z8RA 2PSYA 2NU2E 5EQSA 2GCHG 2EC9H 3ATIA 1HAXB 2WV5A 1AE5A 3F6UH 3NPSA 3RMLH 1QY6A 2ANMH 1YPLH 3SNCA 1QRXA 2OC0A 2XYAA 4X8SH 5E0HA 2XBYA 1DPOA 1V2JT 5TCCA 1XX9A 1BUIA 1XM1A 4KKDA 1CBWC 1NM6A 1V2TT 2C8WB 2BY8X 2W5EA 3BTKE 3PYHA 4ISHH 1IQMA 3QTOH 3TJVA 1GJDB 4BXWA 4I7YH 2M5TA 1SOTA 1ELFA 4D7FA 1EB2A 1SLXB 1O35A 1YP9A 3RP2A 2Y82A 1L1NA 5CHAB 3ZZ9A 2O8UA 3FFGA 4OS7A 1PJPA 3D62A 5DKMA 2BD9A 2XW9A 1ELVA 2PKAA 2JH5D 4KTCA 1A5GH 5EXNA 3NKKA 3LGVA 2NWNA 4X6PA 1OWDA 2FOAA 9ESTA 2Y80A 2Q6DA 4JZEH 2XCNA 5EPNA 2FOHA 1AQ7A 2P16A 1BRBE 2FX6A 1MKWH 1O5GH 2QY0B 2VVUA 5C3NA 1W0ZU 1P05A 4RSPA 3ZZDA 1C1OA 1SG8B 1PPGE 2BMGB 5GJ4B 1AIXH 1NY22 3TGJE 2ZDVH 1O3HA 1P11E 1TGTA 1TWXB 5ETXA 4GSOA 2V0BA 1Y5AT 2O8LA 3HKJB 3A7XA 4ISLA 3VB6A 1S83A 2ZFSA 1O3NA 2NU3E 3H7TA 1ANDA 2TGDA 3RU4T 2ZCHP 4JYTA 2FMJA 4IMQA 4ZAEA 3ODFA 1C1PA 1P01A 1UVOA 3P95A 3UR9A 1TGSZ 1QQUA 2ZU3A 1V2OT 1MH0A 5JB9S 1MZDA 2GMTC 1P3CA 1TONA 1QL8A 5GDSH 4X6MA 3KCGH 5FPSA 2BQWB 5FX5A 3FZDA 1P03A 1HAHH 4FUBA 1GBMA 2KAIB 4IS5A 4NIXA 3TK5A 1HDTH 1EJAA 1CHOG 3M3VA 1GMHG 5LH8A 1ZRKA 2FX4A 2ZFTA 1CBWB 2GD4B 1EKBB 2HVXA 1GI5A 1MKXH 4JMYA 2QAAA 3T26A 5B6LA 3ZZCA 3A88A 2AIPA 5K7RA 3E6PH 3SJIA 4D9QA 1HJ8A 3S9AA 1HXEH 5DK1A 1F5RA 1Z8JB 1Y59T 5FHTA 1NRRH 1GI2A 3RXPA 2BD7A 1ELEE 1LVYA 4ZXXH 3UREA 1T8NA 1LQDB 2ZGJA 1GDNA 1VJ9U 1L1GA 1ZGIA 1C1RA 1TGNA 4O9VA 2WUCA 3UIRA 4AZ2B 4TY6A 2GCHF 3CS0A 4WF8A 6CHAC 2NU4E 3BTQE 1AKSA 3KQEA 2OD3B 1AN1E 3ATWA 3EAJA 1BT7A 2PUQH 3LT3A 1FIZA 1BRCE 3MH7A 1WUNH 1N1LA 4LZ4B 1GCDA 1S84A 1AVXA 2LPRA 2RA3A 4K1SA 3AW1A 2ULLA 1EZUC 4FUFA 1D6WA 2ZPRA 1UK4A 1PYTD 1ZOMA 1C1SA 2SFAA 3CP7A 1O2IA 2ZDAH 1C1WH 2F9UA 1C5RA 2Q6FA 3OYPA 1SGQE 1DWCH 4OGYA 4JZIA 2GMTB 3UWIA 2PV9B 4A92A 2XCFA 3Q00A 3RXHA 1DSUA 2QXIA 4FUEA 2Y81A 1UCYH 2XWAA 3T29A 3A7WA 2FXRA 1UVPA 2GT8A 5J4QA 3A8BA 1DXPA 1A5HA 3TJUA 5HGGA 3ZVCA 1DX5M 2C90B 1FN6A 1C5SA 1IQEA 6GCHG 1KXAA 2ASUB 1HLTH 3MI4A 1UVSH 1VGCC 1EX3A 4B76A 1UO6A 2P95A 4YZUA 1WQVH 3UNSA 2BDCA 1DOJA 1FUJA 3A7TA 2GP9B 5EXMA 2OXSA 3RDZA 1O2HA 4FUDA 1O2TA 4GHTA 3HK6B 2DE8A 3Q3YA 1DY8A 1O3OA 1PQ8A 3RXKA 3D23A 3PB1E 2HALA 1O5DH 1WV7H 1CT4E 1RTLA 6CHAB 3BIUH 2FZZA 1F2SE 1W0YH 1VCQA 4X2XA 2B8OH 2A4RA 1FDPA 1RRKA 1UMAH 2F9NA 1W14U 2FOEA 3DUXH 5AFZH 1LTOA 1SGEE 5AF9H 2GV6A 3OSYA 3EGKH 3PTNA 1FPCH 1GMHF 1ANBA 1QCPA 3P70B 1XUIA 1WQSA 3EA7A 3RLWH 1QR3E 2XBXA 2KAIA 3SV7A 4YTAA 4YOGA 1G30B 3B23B 1GGDC 1ZZZA 1LVMA 2VNTA 3U69H 1OWEA 2OP9A 4DURA 5H4IB 4INKA 3LPRA 1O5CB 3PWBA 4NWLA 1V2NT 1GBCA 1P2JA 2SGAA 3K6ZA 1HNEE 2A7CA 4OS6A 3SNEA 1SPJA 3U8TH 1XXFA 2JKHA 2CHAC 5FCRA 8GCHG 4X8UH 1O3LA 1HB0B 1QB6A 1TRMA 4FU9A 4B74A 3RLYH 3SU0A 3EA8A 1QJ6B 1GBIA 5LPRA 2FPZA 3BSQA 3OTPA 1OYTH 3PMHB 2OLGA 1GBHA 1LCYA 4AB9A 3P8OA 3GY3A 2P8OB 3RXCA 1G3CA 1AVGH 1RD3B 1EOLA 4X2VA 2PSXA 1HAZB 3SU2A 4XE4A 4CR5A 2PHBA 2VH0A 2XBVA 1GI3A 1O5AB 2VIVA 2IJOB 1NT1A 1MBQA 1HBTH 1A2CH 3OTJE 1KLIH 3S9BA 4YOJA 1VGCB 1GHVH 1A46H 4Z6AH 2B5TB 1MU6B 1BTYA 1O2VA 3A8DA 1GL1A 3ZZ5A 1C2DA 1DVAH 4NSVA 1H9LB 3KHVA 3LH1A 3PV4A 1ESAA 3FANA 1HXFH 2GZ9A 1DWDH 2C4FH 3E0NB 1GJ6A 2PTNA 1LO6A 3GY7A 4JZDH 2BVSH 3FP8E 5DP9A 3PLKA 4IGDA 2HNTF 4YT6H 4WH6A 2G81E 3STIA 4U32A 2EEKA 2GX4A 1SGFA 2FOFA 3UPEA 3SZEA 1TNGA 2ZPSA 5EW1H 1Y3XA 4DW2U 4LZ1H 2FEQH 2CXVA 3MH6A 1O5BB 3SQEE 1ZPBA 2G5VA 5FBEA 1IQJA 1GJ7B 2F9PA 4H6TA 6GCHF 1ESTA 2VVVA 3HK3B 2AYWA 3QN7A 1O0DH 2FOMB 4WMDA 1GGDB 3UOPA 3M5NA 1C5QA 2HNTE 3LOXA 4KTSA 4INHA 2WPHS 1Y8TA 2A5IA 2VH6A 1NZQH 5EOKA 2ZHEH 2PFEA 1GBAA 2CHAB 4FVBA 1HAPH 2H9TH 4GVUA 1H4WA 4CBOA 4IBLH 4Y7AA 3D65E 3GCOA 2BXUH 2EI6A 1BTWA 3SZNA 2FI3E 3BTEE 1BBRK 1GMCG 3GY8A 3Q76A 1HRTH 2R3YA 3VB5A 1S5SA 4NZQA 1ARBA 5L6NH 1YGCH 4XSKU 1ZMNA 1F0RA 4CH2B 1EJMA 1C2MA 1O2PA 2IOTA 1C4V2 2EI8A 2WHXA 1BTUA 4I8HA 1XMNB 1P12E 2O8MA 2YOLA 1NO9H 2HGTH 2FYRA 1AGJA 3MH5A 3OX7U 3SUDA 1K21H 3HKIB 3ESTA 1T32A 5JBTA 2Y6TA 4E7NA 8GCHF 2ZDMA 1ZJKA 2ZIQH 1V6DA 2ODYB 1GJ5H 1BJUA 2Z3CA 1HJ9A 1ZJDA 4NG9H 1P2NA 5A0CA 5C1XA 3Q3XA 4A1TA 5C2ZA 3FAOA 3GCTG 3QWCH 1TMBH 1C2GA 3ZZ6A 3UOUA 3UWJH 1QBVH 4BTTB 1ZYOA 1G2LA 2ANYA 3PV5A 1SGYE 2AH4X 2ZGCA 2XXLA 3P6ZB 1GG6C 2ZCLP 1GJAB 4WMFA 3O8CA 2DUCA 5FPTA 1FV9A 3LONA 3PMJA 3RXTA 1O3FA 4RKJB 1BJVA 2FTLE 4DVAU 1FY3A 3LJJA 5F03A 5F6MA 2QA9E 1XKBC 3BTWE 2GDDA 3M7UA 2STBE 2FLBH 1IHTH 3BEFB 1TE0A 4X1QU 1LPZB 3MU4A 1GBTA 3ATMA 3RXEA 4THNH 4OS5A 1Z1JA 3JZ2B 2ZEBA 3A8CA 4MPUA 3WY8A 3MU8A 4GAWA 3FP7E 1QTFA 4ZKOU 1QJ1B 3PV2A 2C3SA 2J4IA 4BAMB 2QF0A 5EW2H 1O2NA 4JZ1A 2RA0A 1V2UT 4DJZB 1O3IA 1V2KT 1Z7KA 3SV9A 1CGJE 3S9CA 1EXFA 2A7JA 1FXYA 1BTHH 1Z6EA 1L4DA 3MU1A 1LQEA 2A5KA 2F9OA 1OWKA 5EODA 2Q6GA 2FLRH 1SFQB 4UFEH 4LK4A 4X0WU 1O2XA 2ZHDA 2ZQ1A 4MPXA 1TBRH 3ZV9A 3PLBA 1GI7B 4FUHA 3LU9B 3MNCA 2W26A 1GMCF 4X8TH 3A7ZA 1PFXC 1AE8H 2A2QH 2WUBA 1RJXB 1F0TA 1GHBG 2ZA5A 1DICA 1O3CA 1ELGA 3I77A 4XDEA 3S0NA 3DT0H 1WTHD 4K69A 4K8YA 2A4GA 3RMNH 2I6QA 3ZZ4A 2BD8A 2BDBA 1MQ5A 1GVKB 3BTME 1TMUH 1GG6B 1INCA 2BY6X 3KEEA 3ZV8A 3MO3A 3RU4D 4A1VA 3U98H 2GVFA 5A8XA 2FESH 2UUJB 2C93B 2WPJS 1PPZA 3ZZ8A 5L30H 5GCHG 1XUHA 3QGJA 3U9AH 4M7GA 3PWCA 1IQFA 1AB9C 3SO3A 1O3PB 1TGCA 1H9IE 1TNLA 2ZFQH 1FPHH 5EQRA 3DFJA 3UR6A 1MTNC 4D8NA 5HM2A 1P2QA 3TVJB 1EASA 1ZTLA 4O3UA 4ASHA 2I6SA 1YPJH 4CR9A 2CJIA 3M5OA 1OXGA 1O2WA 5F8ZA 3RXSA 4MTBA 1CGIE 1SLUB 5DP3A 3LJOA 5EU8A 1NRQH 1VCPA 3E8LA 1MD8A 3M7TA 2F83A 3GCTF 2FO9A 3BTTE 1DLKB 3SNAA 1VJAU 1GHAG 1BBRE 3EQ0H 4QT8C 1C1TA 5A8YA 1JIRA 5HMAA 2R2WU 5C1YA 1G3DA 3A89A 3SU1A 1T8MA 3HGPA 2ODPA 3RXLA 3BTGE 2H1UA 3GYMA 1AI8H 2OCVB 3SUEA 4ABAA 5A8ZA 1P09A 3N7OA 3GY5A 3MNSA 4FXGH 2QXHA 3UTUH 3A8AA 5T6DA 4TYDA 2PGQB 4UFFH 1AHTH 2OC7A 1MZAA 4OGXA 3ELAH 2F3CE 2A45B 2SGPE 2Z9GA 1JBUH 2IJD1 1C2EA 1FJSA 5E2PA 2FOGA 2AGGX 2D26C 1ARCA 1GJBB 1LKAA 1S6HA 3SN8A 3TNTA 2ZI2H 3SJKA 1YM0A 1EZQA 4FUCA 4MNWA 2ZU4A 1MU8B 4NFFA 4JZFH 1DSTA 2ZU5A 1GHXH 3LIWA 2XNIA 4BAQB 3UQOA 1TQ0B 2G51A 3MH4A 5EPYA 5BRRE 3TH4H 5C1UA 1O2GH 2W7SA 1YPMH 2H6MA 1NFUA 3UNQA 1BRUP 1UTKA 2H9EH 1E36B 2F91A 1V2LT 1BMLA 1OPHB 4MG3A 1AB9B 5LGOA 4Y6DA 3EYDA 3NUMA 3HPTB 5L2ZH 4U2WA 1MTNB 6LPRA 5GNDA 5FX6A 3AASA 9LPRA 3QZRA 1Z71A 4D7GA 1P2OA 1HUTH 1ELDE 3AVZA 1BTXA 3T5FH 3G01A 1WCZA 3ZZAA 3V0XA 1TABE 1ZMJA 2Z7FE 1QHRB 3AK5A 1N6XA 2AERH 3SW2B 3DD2H 3KNXA 2FI4E 4UFDH 1B0EA 1BMNH 1GHBF 3SU3A 3I78A 3SJOA 1BMMH 2Z9JA 4H42U 4DOQA 4NA7A 2BB4A 1Z8GA 3RXQA 1NFYA 4IN2A 4Y8YA 3P8FA 1KXDA 2B9LA 1O39A 5K0HA 4DIIH 4YESB 1CT0E 5GPIB 1AD8H 1WBGB 2XTTB 5DP6A 2JETC 4UEHH 1GI8B 1P8VC 1QIXB 1Z8IB 1P3EA 2VWNA 2WPLS 3C27B 2A31A 2WYGA 1P9UA 1O3EA 2ZDNA 1GMDG 5GCHF 2GGVB 2QYIA 2J38A 3IITA 1L2EA 4Y10E 2ZHWH 3LGTA 1FI8A 3QO6A 1H8IH 5JBBS 1TQ7B 4X1PU 4TWYA 1GJ9B 1OOKB 4NA8A 1ORFA 1D3QB 3FZZA 1O3DA 4Z0KA 3F68H 3UUZA 5FXLA 4IW4E 5DP5A 1BQYA 1J8AA 1C1NA 3GYLB 2OTVA 1O2SA 5E2OA 4AYYB 1K28D 3H09A 1HYLA 4JYVH 3SJ9A 7LPRA 1ESBA 1C9TA 3M61U 2SGFE 2BDYA 5JPMH 1CGHA 3T27A 1LHCH 3V7TA 1GHAF 1A3EH 4ABIA 1QBNA 1C5XB 4B6FA 3BIVH 1RFNA 4K5ZA 5G4BA 2UWPA 4ZKRU 1V2MT 1PYTC 4AN7A 1KXEA 2FTMA 1PPHE 4A7IB 1KXCA 1FZZA 3M5MA 2A5AA 1TA2A 1C5WB 3KQCA 2VIDA 1P2IA 3VFEA 3EDXB 2A4QA 2ZFPH 2SGDE 1GJ8B 1C9PA 1V3XA 1ZHMA 2R0LA 1JWTA 3SI3H 1YLDA 3T25A 4ABGA 4YLUA 2A1DB 2O9QA 1AWFH 2F9BH 1O3KA 3GY4A 4GPGA 1MQ6A 1JRSA 2C8YB 1GWAA 1AMHA 4CRAA 5J4SA 1BBRH 3L33A 2BY7X 2JETB 5AFYH 1THRH 1FAXA 1VR1H 1YF4A 4ZKNU 5GXPA 3RUOA 3O8RA 2Z9LA 1XUKA 4JK5A 3D49H 2BYAX 5EXLA 2BLWA 4E05H 1AUJA 1BA8B 1SLVB 3PMAB 1YPHC 3TNSA 1Z1IA 1Y3YA 1TNJA 3M36A 1T8OA 4Q7YA 1OWJA 4WJG2 1C5UA 3Q3KA 1GHZA 3TPIZ 2VWOA 1P04A 2BD4A 1MCTA 4X2YA 4PROA 2VIQA 5AVDA 4MVNA 4INLA 1BITA 2A2XH 3SGBE 3W94A 3RXJA 2ZCKP 2QV1A 2G55A 3BEUA 4ABJA 3EE0B 1EATA 1DDJA 2FYQA 1AZZA 2XC0A 2ZDKA 1CO7E 1O3AA 2A32A 3UNRA 1HAVB 3E1XB 1GBJA 1Q2WA 3RXIA 1SGNE 1UK3A 2IPHA 3HATH 2BOKA 1ID5H 1TX6A 3P8NA 1XUFA 1EUFA 4X1SU 4MNXA 4TWWA 5A0AE 1EJNA 3IWMA 1MD7A 5JB8S 4IN1A 1DXWA 4B73A 4IMZA 1E38B 1GMDF 3SU6A 4HGCA 1P2MA 5IYTA 1DS2E 1D3TB 3SHCH 4A1XA 1ACBE 3I29A 2GV7A 3KL6A 2AMPA 1TX7A 3P92A 4K2YA 2GZ7A 4JYUH 3RXMA 3M5LA 1TRNA 3KIDU 3A87A 4AOQA 3RC4A 1O3GA 1F92A 2EA3A 2CV3A 2WV4A 2Z6BD 1O2OA 2RCEA 3F9FA 1EB1H 1NN6A 1L0ZA 4Y79A 1RIWC 1NU9A 3ZVAA 3U1JB 4JCNA 1H8DH 1K1NA 1G9IE 1S0QA 4BAOB 1VITG 1EAWA 2RDLA 3DFLA 3UQVA 2OQ5A 2ZO3H 2VIWA 4CRCA 5SGAE 2OUAA 4ABFA 1SOZA 3TK6A 2ZC9H 4ABHA 1BHXB 1T31A 4WXIA 5B6OA 1UVUH 2QCYA 1K1OA 1YCPK 1S0RA 4NWKA 1NFWA 2BLVA 4AGJA 1XUJA 2C8ZB 4ZHMU 4CRFA 1O2JA 2VINA 3KGPA 2OQUA 1SGTA 3QDZB 2Z9IA 1XXDA 3LGIA 4YLQH 3TLOA 1V2QT 1C5YB 1NRNH 1NS3A 4XBDA 4Y8ZA 1UHBB 2FP7B 1QFKH 3R3GB 1SBWA 1LMWB 1TGBA 3PMBB 2W7UA 2V3OH 1PQ5A 3RXRA 4F49A 3SNDA 1C1QA 4XOJA 2FODA 2O8WA 3ENSB 3V12A 1UTPA 1AU8A 2AGIX 3MFJA 4FU8A 1GHYH 3RXOA 1ZLRA 2J9NA 4FU7A 1O32A 1HAOH 2ZG0H 2GDEH 3URCA 5DJ7A 1O2YA 4Y8XA 3SNBA 3A84A 3QTVH 5T3HA 2OBQA 2G5NA 2UWOA 4K1EA 1HAGE 1S6FA 3OY6U 2NU1E 5HXFA 3TJOA 5EGMA 2PUXB 2B7DH 1C4Y2 1BRAA 4Y0YE 1DUAA 1J9CH 1LPKB 2JH6D 3A86A 1EAUA 1XKAC 2H9HA 4AFSA 1QL7A 2UUFB 5EQQA 5ESTE 2SGQE 3H7OA 2AGEX 3ZVFA 1RIWB 1OX1A 1UTMA 3A83A 1FY8E 2BQ7B 3VXEH 1OYQA 4LOYH 1FAKH 1CE5A 3O8BA 3F9HA 1B5GH 1E35B 3NCLA 1G32B 1SGCA 4NIYA 1YLCA 1O3BA 1TPOA 1Y5BT 1HAVA 3LKWA 3LDXH 1GJ4H 1QA0A 3GY6A 2AS9A 1YPEH 1BMAA 2ZTXA 1C1VH 2BM2A 1LPGB 1KDQB 1T4VH 2V3HH 2ZFRH 1NROH 1BTZA 1SGFG 1JXPA 2FI5E 4BAKB 4ZH8A 4DY7B 2ZGBH 1G36A 3RM0H 1D6RA 1DWEH 1ANEA 3A7YA 4Q7XA 1RXPA 1K1IA 1RTKA 1ZTKA 4H6SB 4GHQA 1S81A 3V13A 1SGIB 4ZUHA 1ZMLA 1C2LA 1OWHA 1E34B 1OP0A 1TB6H 3LGYA 1ZR0A 1SLWB 2AMQA 3RMOH 2B0FA 1GCTC 2F9VA 3SORA 1VITF 4Y71A 2R0KA 2Z94A 4I8KA 1FLEE 2ZP0H 1TOMH 1WAYB 1GPZA 2Z3EA 3SOSA 1O2RA 2H5DA 1OP2A 1GBLA 1IAUA 1SR5C 1FY5A 1TLDA 3MWIU 1GBKA 1GVZA 1MTUA 3VPKA 1KTSB 1TX8A 4F4OC 1FMGA 5C5NA 3TGKE 3PM3A 1S82A 2BLQA 3RM2H 2YNAA 1ETSH 3LC5A 4X6OA 1TRYA 1C2JA 3NK8A 4MDSA 1GBBA 1RS0A 5AHGH 1LHGH 1C5TA 1MCVA 1O2UA 2JH0D 2ZDLA 3LGUA 2D1JA 1IOEA 2WZQA 2ILNA 2P3FH 1UHBA 4KTUA 1W11U 1QBOA 3FVFB 3OY5U 4HFPB 4M9FA 3CS7A 3MMGA 5L2YH 3A81A 4XBBA 5E0GA 1SQOA 4AG2A 3SUFA 3KF2A 4TPIZ 2VWLA 2WPIS 1ZPZA 1WYKA 1QB1A 3KQBA 4I31A 1FY1A 1C5OH 1W10U 1D3DB 2BDGA 2TBSA 1H9HE 1DANH 1MBMA 4E7RG 1XVOA 4FVDA 3E16B 4AB8A 1CVWH 1O37A 1SC8U 2UWLA 3BV9B 4RN6A 4X2WA 3LC3A 2HPPH 3MNBA 2RG3A 2XBWA 3MHWU 1QNJA 5FCKA 3SJ8A 1ZSLA 4Y76A 1O33A 1MAYA 4XBCA 2V35A 3A7VA 1Z6JH 3RXGA 4BANB 1DFPA 5T6GA 4AFQA 2P3UB 1X7AC 1L4ZA 1OP8A 3MO6A 1MTVA 1UVTH 1AFQC 1P9SA 1GCTB 4I8JA 4CHAC 1V2WT 5C5OA 1W12U 2TGAA 3MTYA 1ZHRA 3LGWA 5FBIA 3ZVBA 1B7XB 3A82A 5DGJA 1MTSA 3RXVA 4ZROA 1DUEA 1SSXA 3P17H 1J15A 1EZXC 2EI7A 3HGNA 1UCYE 1XVMA 3GY2A 2BDIA 1GI0A 1HFDA 3K9XB 4JK6A 2TIOA 1P0SH 1CHGA 3EA9A 1O38A 1ZSJA 3ZVGA 3SQHE 1MUEB 4ZMAH 1GBEA 3VXFH 2HOBA 3E0PB 2BXTH 1KDQA 1CU1A 3MYWA 1A3BH 1PPBH 3PROA 3U8OH 4E06H 1PPFE 3PO1C 2XC4A 1JIMA 1IQNA 1WTGH 2BX3A 4MQAA 1J17T 1SMFE 3T2NA 5EG4A 4A5TS 2R3UA 2GKVE 4OM9A 2PR3A 4I32A 1K1MA 3S7KB 3MOCA 5T1VA 1C5PA 2QIQA 5F8TA 2TGTA 4GCHG 4KP0A 1MMJN 1T8LA 1BTPA 3BEIB 2A4OA 2VJ1A 1GI4A 1KLJH 3GDVA 1A0HB 2WPMS 2ZGXH 4LXBH 1HAIH 5A0BA 2ZHQH 2P59A 3F9EA 1QGFA 2SNVA 3LH3A 1ZHPA 3M3SA 1SGDE 3ATKA 4CREA 5DP7A 3KQDA 4DT7B 1V2PT 1EQ9A 2BY5X 4ZHLU 3SV2H 1KXBA 1SQAA 4Y7BA 1K2I1 1TNKA 1NESE 1O5EH 2HWLB 2J92A 4K1TA 3QGNB 1AFQB 4DG4A 5ABWA 2K1QA 1EP6A 4CHAB 2ZWLH 5HM9A 1C2FA 1UTQA 4NCYA 2QGRA 3SI4H 1YCPM 2WPKS 1F0UA 4K8BA 1O31A 1YYY1 1C4U2 1LHDH 5A2MH 1DT2A 8KME2 3QLPH 3K2UA 1SHHB 2VVCA 1A4WH 1DWBH 1QRWA 3GCNA 1VITH 3PO1B 4OS1A 5TCAA 2PKSC 2ZPQA 5FPYA 4ABBA 4SGBE 1MAXA 6ESTA 4K3JA 3SV8A 1WU1A 5T6FA 1F5LA 1WOFA 1HPGA 4A6LA 1CA8B 2Y5GA 1A61H 1Y3WA 3VB4A 1C2IA 3BF6H 2P93A 5IDKA 1ELBA 2CN0H 1GBDA 3RXDA 3K65B 2J94A 5F8XA 2D2DA 3DA9B 2Y5HA 1EAXA 5CMXH 1NPMA 2AMDA 5TJXA 2D8WA 2ZZUH 2BTCE 1O5FH 2ZHFH 2PLXA 1EOJA 1BB0B 4O97A 2Z3DA 5E0JA 1XUGA 3T62A 2BOHB 1PPCE 2J95A 1RGQA 8LPRA 2BHGA 1JOUB 2YNBA 1SHYA 2ZTZA 1G2MA 3BG8A 3RXAA 2HPQH 2Q1JA 3B9FH 1BDAA 1N8OC 2IN2A 4KGAA 4AFUA 4BNRA 3TU7H 3BTHE 3IG6B 5I25A 5DP8A 3AW0A 1NU7B 1TPAE 3QX5H 2GZ8A 2ODQA 1HCGA 3ZYDA 2QF3A 2XRCA 2BZ6H 2Y7XA 3DHKH 2VU8E 1BHXF 3M3TA 1YCPH 4RI0A 1K1LA 2ZKSA 1A7SA 5C20A 3NXPA 3FP6E 3QUMP 4HTCH 4UE7H 4WVPE 1ELAA 1DITH 1DY9A 1LDTT 1EP5A 4TY7A 4MNVA 2G52A 4HZHA 3JZ1B 1U6QA 1V2ST 1EPTC 1NRPH 1IQGA 4YM9A 4UONA 4GCHF 4CRDA 1ETTH 1FIWA 1FY4A 2PWXA 1YPHE 5JBCS 1NRSH 3OU0A 1G37A 1GBFA 1QB9A 2FS8A 2HRVA 2W3KA 2ZU2A 2O8TA 1JRTA 3R0FA 5FAHA 1GHWH 4B2BA 1P02A 3A85A 1GI6A 2NU0E 2P8OC 3VB3A 4AG1A 1FQ3A 1T7CA 2PKSB 1C5ZB 1C1MA 1DM4B 3BG4C 1LVOA 4CH8B 4VGCC 1CA0C 4Q7ZA 2AEIH 1ZSKA 5DG6A 2ALVA 3KN2A 1MKWK 5LPFA 3RMMH 8ESTE 2W3IA 2CF8H 1PQAA 2GCTC 1YC0A 2G8TA 2XWBI 4R8TB 2P94A 2BVRH 3UY9A 1J14A 4J1YA 3SU5A 1ELCA 3NZIA 5DO4H 5JDUB 1CSOE 1SB1H 4FUIA 2WINI 1Y3VA 2CGAA 1MTWA 4H4FA 4ZKSU 4ABDA 4MPWA 1IHSH 3MU0A 1AWHB 1SGRE 2FWWA 2SNWA 1BIOA 2VIOA 1QJ7B 1N8OB 1A0JA 1O30A 1K22H 1Q3XA 7KMEH 2BLOA 1W3CA 1JMOH 2FOBA 1GDUA 2BDAA 2GT7A 4WXVA 1CHOF 3GDSA 1IQLA 5BPEA 1F7ZA 2TRMA 4I8LA 1F5KU 4FUGA 4AFZA 1OWIA 4GLYA 3L3TA 3SGAE 2TGPZ 4D76A 3SU4A 1UJ1A 3BN9A 3GICB 1MKXK 5DPAA 3SUGA 3TJNA 3CENA 1EPTB 3ATLA 1ETRH 1UTJA 3MNXA 3ZZ7A 1D4PB 3H5CB 1TPSA 2DE9A 3MO9A 1TBQH 1V2RT 3ZZ3A 1O3MA 1DE7H 5GIBA 2VGCC 3B8JA 3RXBA 1T4UH 1SQTA 1LHEH 2OINA 1OKXA 4I33A 2BD2A 2R9PA 2QXGA 1C5NH 1P57B 3C1KA 3ZZBA 3BG4B 4CRGA 1P2KA 4VGCB 1CA0B 3GCHC 3Q77A 3S7HB 3BTDE 5GWZA 1YKTA 1NC6A 4WWYA 2GTBA 3K6YA 2BDHA 3V3MA 2GCTB 2UUYA 1UTLM 1P10A 1AUTC 2V6NA 7ESTE 2R2MB 2ZGHA 4MPVA 2AIQA 4OS4A 3S69A 3U8RH 1ELTA 1FNIA 1QA7A 4NSYA 4WH8A 1O2ZA 1K1JA 1HJAC 1GI1A 2STAE 2ZTYA 3QZQA 3STJA 3QK1A 3GDUA 1A1RA 1GDQA 3RC6A 4X8VH 4ZXYH 4D9RA 3ZVEA 4DGJA 1EZSC 3VEQB 5JBAS 1HIAB 4BXSA 1UCYK 5A09A 1OS8A 2ZQ2A 1IQIA 2PTCE 3O8DA 4IC5A 1CQQA 2XC5A 2A7HA 2F4LA 3RC5A 1A5IA 1QL9A 2ALPA 3SBKA 1ZGVA 2THFB 3GISB 4X1RU 1C5MD 1VCWA 1HGTH 4HI3A 1LHFH 3GOVB 4RKOB 2Y7ZA 3PLPA 4X1NU 2FM2A 2VBCA 4B6EA 2VIPA 3PTBA 3BTFE 2FIRH 4NGAH 2AFQB 2H2ZA 1AY6H 4Y0ZE 1LKBA 4BAHB 2VGCB 4AYVB 3ZVDA 1HV7A 1QQ4A 3A80A 3TGIE 1VZQH 3ZYEA 3M7QA 1GL0E 2CMYA 1TFXA 1NTPA 1UK2A 1N6YA 5DP4A 1KSNA 1O3JA 4BOHA 2BQ6B 2J2UA 4NZLA 1UTOA 3GCHB 3VGCC 4YOIA 1TALA 4SGAE 1O2MA 2BZAA 2HNTC 2WYJA 4K60A 1GI9B 1ABJH 1W13U 3UFAA 2ESTE 7GCHG 1C2KA 4I8GA 4MNYA 4U01A 1C5VA 1BZXE 4UDWH 1TYNA 3E91A 2H5CA 2VB0A 2LNCA 2Y5FA 4GUXA 1S85A 2TPIZ 3TK9A 1G3BA 1B0FA 1W7XH 1ZRBA 4B71A 4B2CA 1TNHA 1W7GH 1KY9A 1D9IA 1W8BH 1HJAB 3TIUA 1BOQA 1WSSH 5PTPA 3AAUA 3SYJA 1QURH 2SGEE 1KYNA 2A0QB 1TIOA 2QXJA 3M37A 2OK5A 1E37B 1AO5A 1EPTA 5C67A 1Q31A 1EAIA 1P06A 1WXRA 3VB7A 4WY3A 4MLFB 4B75A 2OC1A 2FOCA 1KLTA 3ITIA 1DLEA 1SFIA 1THPB 2ZECA 4NIWA 4Q80A 4XFQA 4YT7H 2Z9KA 2G4TA 5JYIA 2PKAB 3P8GA 1OSSA 2J34A 4CRBA 1D3PB 4NFEA 3SV6A 1PPEE 2G00A 1K9OE 4NA9H 5CE1A 2HLCA 2BD5A 1ZPCA 1O34A 1YBWA 1C2HA 1Y3UA 1FONA 1LVBA 1ABIH 2FDAA 4OS2A 4Q2KA 1KXFA 4YO9A 1H1BA 3SGQE 1O36A 1TBZH 1V2VT 1F0SA 1UTNA 2ZFFH 1TNIA 1AFEH 2QN5T 3TH3H 4O3TA 4BTUB 3RXUA 1SL3A 3SHAH 3W95A 2WV9A 1KTTB 4DIHH 1YPGH 1K1PA 1AZ8A 1L1JA 2OC8A 4UFGH 2FS9A 1KIGH 3M35A 3VGCB 1THSH 1W2KH 1E0FD 4ISOA 1CT2E 4U30A 4BTIB 3L6PA 4AX9H 4X6NA 1IQHA 1TOCB 2P3TB 3F9GA 1O2QA 1YPKH 4B1TA 4B2AA 3NWUA 1GVLA 3U1IB 5ESBA 2BD3A 1BCUH 2VWMA 5E8EH 1HAYB 4TPYA 1QRZA 5CHAC 4ESTE 1HIAA 1IQKA 1A0LA 2BY9X 4R0IA 2C8XB 4KELA 1M9UA 4NIVA 3TITA 2ANKH 4WMEA 4AGKA 1C1UH 4AORA 4UD9H 2BVXH 2PW8H 1FN8A 2ZNKH 1SGPE 3RU4E 3AAVA 4Y11E 4DCDA 2UUKB 4J2YB 2ZF0H 1ANCA 2OBOA 4ISNA 2G4UA 3T28A 1TPPA 4IC6A 4ABEA 1TA6A 3RXFA 5LPEA 2PGBB 2BX4A 1AVWA 2ZU1A 3MU5A 4O03A 2QC2A 1PQ7A 1J16A 3F1SB 3TH2H 2CF9H 5I46H 4ZHAA 1RTFB 3E90B 1TAWA 1O2KA 4FUJA 7GCHF 4ISIH 1SVPA 3E3TA 1ZTJA
chains in the Genus database with same CATH superfamily
3ODDA 1O2LA 1Y5UT 1SI5H 2ANWA 1AKSB 1G3EA 1NFXA 1C5LH 1GJCB 3URDA 4CBNA 5HYOA 1TMTH 1Z8RA 2PSYA 2NU2E 5EQSA 2GCHG 2EC9H 3ATIA 1HAXB 2WV5A 5KECA 1AE5A 3F6UH 3NPSA 3RMLH 1QY6A 2ANMH 1YPLH 3SNCA 1QRXA 2OC0A 2XYAA 4F48B 4X8SH 5E0HA 2XBYA 1DPOA 1V2JT 5TCCA 1XX9A 1BUIA 1XM1A 4KKDA 1CBWC 1NM6A 1V2TT 2C8WB 2BY8X 2W5EA 3BTKE 3PYHA 4ISHH 4YXWD 1IQMA 3QTOH 3TJVA 1GJDB 1UW7A 4BXWA 4I7YH 2M5TA 1SOTA 1ELFA 4D7FA 1EFRD 1EB2A 1SLXB 1O35A 1YP9A 3RP2A 2Y82A 1L1NA 5CHAB 3ZZ9A 2O8UA 2KCPA 3FFGA 2KM0A 4OS7A 2QE7D 1PJPA 3D62A 5DKMA 2BD9A 2XW9A 1ELVA 2PKAA 2JH5D 4KTCA 1A5GH 2J5UA 5EXNA 3NKKA 3LGVA 2NWNA 4X6PA 1OWDA 2FOAA 9ESTA 2Y80A 2Q6DA 4JZEH 2XCNA 5EPNA 2FOHA 1AQ7A 2P16A 1BRBE 2FX6A 1MKWH 1O5GH 2QY0B 2VVUA 5C3NA 1W0ZU 1P05A 4RSPA 3ZZDA 1C1OA 1SG8B 1PPGE 2BMGB 5GJ4B 1AIXH 1NY22 3TGJE 2ZDVH 1O3HA 1P11E 1TGTA 1TWXB 5ETXA 4GSOA 2V0BA 1Y5AT 2O8LA 3HKJB 2YMSB 3A7XA 4ISLA 3VB6A 1S83A 2ZFSA 1O3NA 2NU3E 3H7TA 1ANDA 2TGDA 3RU4T 2ZCHP 4JYTA 2FMJA 4IMQA 4ZAEA 3ODFA 1C1PA 1P01A 1UVOA 3P95A 3UR9A 1TGSZ 1QQUA 2ZU3A 1V2OT 1MH0A 5JB9S 1MZDA 2GMTC 1P3CA 1TONA 1QL8A 2JIZD 5GDSH 4X6MA 3KCGH 5FPSA 2BQWB 5FX5A 3FZDA 1P03A 1HAHH 4FUBA 1GBMA 2KAIB 4IS5A 4NIXA 3TK5A 1HDTH 1EJAA 1CHOG 3M3VA 1GMHG 5LH8A 1ZRKA 2FX4A 2ZFTA 1CBWB 2GD4B 1EKBB 2HVXA 1GI5A 1MKXH 4JMYA 4P00A 2QAAA 1YY3A 3T26A 5B6LA 3ZZCA 3A88A 2AIPA 5K7RA 3F3BA 3E6PH 3SJIA 4D9QA 1HJ8A 3S9AA 1HXEH 5DK1A 1F5RA 1Z8JB 1Y59T 5FHTA 1NRRH 1GI2A 3RXPA 2BD7A 1ELEE 1LVYA 4ZXXH 3UREA 1T8NA 3DCLA 1LQDB 2ZGJA 1GDNA 1VJ9U 1L1GA 1ZGIA 1C1RA 1TGNA 4O9VA 2WUCA 3UIRA 4AZ2B 4TY6A 2GCHF 3CS0A 4WF8A 6CHAC 2NU4E 3BTQE 1AKSA 3KQEA 2OD3B 1AN1E 3ATWA 3EAJA 1BT7A 2PUQH 3LT3A 1FIZA 1BRCE 3MH7A 1WUNH 1N1LA 4LZ4B 1GCDA 1S84A 1AVXA 2LPRA 2RA3A 4K1SA 3AW1A 2ULLA 1EZUC 4FUFA 1D6WA 2ZPRA 1UK4A 1PYTD 1ZOMA 3OAAD 1C1SA 2SFAA 3CP7A 1O2IA 2ZDAH 1C1WH 2F9UA 1C5RA 2KX4A 2Q6FA 3OYPA 1SGQE 1DWCH 4OGYA 3N7EA 4JZIA 2GMTB 3UWIA 2PV9B 4A92A 2XCFA 3Q00A 3RXHA 1DSUA 2QXIA 4FUEA 2Y81A 1UCYH 2XWAA 3T29A 3A7WA 2FXRA 1UVPA 2GT8A 5J4QA 3A8BA 1DXPA 1A5HA 3TJUA 5HGGA 3ZVCA 1DX5M 2C90B 1FN6A 1C5SA 1IQEA 6GCHG 1KXAA 2ASUB 1HLTH 3DSOA 3MI4A 1UVSH 1VGCC 1EX3A 4B76A 1UO6A 2P95A 4YZUA 1QZ8A 1WQVH 3UNSA 2BDCA 1DOJA 1FUJA 3A7TA 2GP9B 5EXMA 2OXSA 3RDZA 1O2HA 4FUDA 1O2TA 4GHTA 3HK6B 2DE8A 3Q3YA 1DY8A 1O3OA 1PQ8A 3RXKA 4RT0A 3D23A 3PB1E 2HALA 1O5DH 1WV7H 1CT4E 1RTLA 6CHAB 3BIUH 2FZZA 1F2SE 1W0YH 3PRBA 1VCQA 4X2XA 2B8OH 2A4RA 1FDPA 1RRKA 1UMAH 2F9NA 1W14U 2FOEA 3DUXH 5AFZH 1LTOA 1SGEE 5AF9H 2GV6A 3OSYA 2J98B 3EGKH 3PTNA 1FPCH 1GMHF 1ANBA 1QCPA 3P70B 1XUIA 1WQSA 3EA7A 3RLWH 1QR3E 2XBXA 2KAIA 3SV7A 4YTAA 4YOGA 1G30B 3B23B 1GGDC 1ZZZA 1LVMA 2VNTA 3U69H 1OWEA 2OP9A 4DURA 4Q63A 4INKA 5H4IB 3LPRA 1O5CB 3PWBA 5KEDA 4NWLA 1V2NT 1GBCA 1P2JA 2SGAA 3K6ZA 1HNEE 2A7CA 4OS6A 3SNEA 1SPJA 3U8TH 1XXFA 2JKHA 2CHAC 5FCRA 8GCHG 4X8UH 1O3LA 1HB0B 1QB6A 1TRMA 4FU9A 4B74A 3RLYH 3SU0A 3EA8A 1QJ6B 1GBIA 3ZIAD 5LPRA 2FPZA 3BSQA 3OTPA 2JJ2D 1OYTH 3PMHB 2OLGA 1GBHA 1LCYA 4AB9A 3P8OA 3GY3A 2P8OB 3RXCA 1G3CA 1AVGH 1RD3B 1EOLA 4X2VA 2PSXA 1HAZB 3SU2A 4XE4A 4CR5A 2PHBA 2KZ4A 2VH0A 2XBVA 1GI3A 1O5AB 2VIVA 2IJOB 1NT1A 1MBQA 1HBTH 1A2CH 3OTJE 1KLIH 3S9BA 4YOJA 1VGCB 1GHVH 1A46H 4Z6AH 2B5TB 1MU6B 1BTYA 3KQ5A 1O2VA 3A8DA 1GL1A 3ZZ5A 1C2DA 1DVAH 4NSVA 1H9LB 3KHVA 3LH1A 3PV4A 1ESAA 5EJ1A 3FANA 1HXFH 2GZ9A 1DWDH 5C94A 2C4FH 3E0NB 1GJ6A 2PTNA 1LO6A 3GY7A 4JZDH 2BVSH 3FP8E 5DP9A 3PLKA 4IGDA 2HNTF 4YT6H 4WH6A 2G81E 3STIA 4U32A 2EEKA 2GX4A 1SGFA 2FOFA 3SZEA 3UPEA 1TNGA 2ZPSA 5EW1H 1Y3XA 4DW2U 4LZ1H 2FEQH 2CXVA 3MH6A 1O5BB 3SQEE 1ZPBA 2G5VA 5FBEA 1IQJA 1GJ7B 2F9PA 4H6TA 6GCHF 1ESTA 2VVVA 3HK3B 2AYWA 3QN7A 1O0DH 2FOMB 4WMDA 1GGDB 3UOPA 3M5NA 1C5QA 2HNTE 3LOXA 4KTSA 4INHA 2WPHS 1Y8TA 2A5IA 2VH6A 1NZQH 5EOKA 2ZHEH 2PFEA 1GBAA 2CHAB 4FVBA 1HAPH 2H9TH 4GVUA 1H4WA 1VKYA 4CBOA 4IBLH 4Y7AA 3D65E 3GCOA 2BXUH 2EI6A 2K8IA 1BTWA 3SZNA 2FI3E 3BTEE 1BBRK 1GMCG 3GY8A 3Q76A 2HVYB 1HRTH 2R3YA 3VB5A 1S5SA 4NZQA 1ARBA 2HLDD 5L6NH 1YGCH 4XSKU 1ZMNA 1F0RA 4CH2B 1EJMA 1C2MA 1O2PA 2IOTA 1C4V2 2EI8A 2WHXA 1BTUA 3F0PA 4I8HA 1XMNB 2QF4A 1P12E 2O8MA 2EY4C 2J98A 2YOLA 1NO9H 2HGTH 2FYRA 1AGJA 3MH5A 3WWBA 3OX7U 3SUDA 1K21H 3HKIB 3ESTA 1T32A 5JBTA 2Y6TA 4E7NA 8GCHF 2ZDMA 1ZJKA 2ZIQH 1V6DA 2ODYB 1GJ5H 1BJUA 3PRDA 2Z3CA 1HJ9A 1ZJDA 4NG9H 1P2NA 5A0CA 5C1XA 3Q3XA 4A1TA 5C2ZA 3FAOA 3GCTG 3QWCH 1TMBH 2RFKC 1C2GA 3ZZ6A 3UOUA 3UWJH 1QBVH 4BTTB 1ZYOA 1G2LA 2ANYA 3PV5A 1SGYE 2AH4X 2ZGCA 2XXLA 3P6ZB 1GG6C 2ZCLP 1GJAB 4WMFA 3O8CA 2DUCA 5FPTA 1FV9A 3LONA 4AC9A 3PMJA 3RXTA 1E1RD 1O3FA 4RKJB 1BJVA 2FTLE 4DVAU 1FY3A 3LJJA 5F03A 5F6MA 2QA9E 1XKBC 3BTWE 2GDDA 3M7UA 2STBE 2FLBH 1IHTH 3BEFB 1TE0A 4X1QU 1LPZB 3MU4A 3OFND 1GBTA 3ATMA 3RXEA 4THNH 4OS5A 1Z1JA 3NRLA 3JZ2B 2ZEBA 3A8CA 4MPUA 3WY8A 3MU8A 4GAWA 3FP7E 1QTFA 4ZKOU 1QJ1B 3PV2A 3VG8A 2C3SA 2J4IA 3CNRA 4BAMB 2QF0A 5EW2H 1O2NA 4JZ1A 2RA0A 4F55A 1V2UT 4DJZB 1O3IA 1V2KT 1Z7KA 3SV9A 1CGJE 3S9CA 1OHHD 1EXFA 3KYFA 2A7JA 1FXYA 1BTHH 1Z6EA 1L4DA 3MU1A 1LQEA 2A5KA 2F9OA 1OWKA 5EODA 2Q6GA 2FLRH 1SFQB 4UFEH 4LK4A 4X0WU 1O2XA 2ZHDA 2ZQ1A 4MPXA 1TBRH 3ZV9A 3PLBA 1GI7B 4FUHA 3LU9B 3MNCA 2W26A 1GMCF 4X8TH 5KGOA 3A7ZA 1PFXC 1AE8H 2A2QH 2WUBA 1RJXB 1F0TA 1GHBG 3W1EA 2ZA5A 1DICA 1O3CA 1ELGA 3I77A 4XDEA 2J97A 3S0NA 3DT0H 1WTHD 4K69A 4K8YA 2A4GA 3RMNH 2I6QA 3ZZ4A 2BD8A 2BDBA 1MQ5A 1GVKB 3BTME 1TMUH 1GG6B 1INCA 2BY6X 3KEEA 3ZV8A 3MO3A 3RU4D 4A1VA 3U98H 2GVFA 5A8XA 2FESH 2UUJB 2C93B 2WPJS 1PPZA 3ZZ8A 5L30H 5GCHG 1XUHA 3QGJA 3U9AH 4M7GA 3PWCA 1IQFA 1AB9C 3SO3A 1O3PB 1TGCA 1H9IE 1TNLA 2ZFQH 1FPHH 5EQRA 3DFJA 2WPDD 3UR6A 1MTNC 4D8NA 5HM2A 1P2QA 3TVJB 1EASA 2XOKD 1ZTLA 4O3UA 4ASHA 2I6SA 1YPJH 4CR9A 2CJIA 3M5OA 1OXGA 1O2WA 5F8ZA 3RXSA 4MTBA 1CGIE 1SLUB 5DP3A 2V3MA 3LJOA 5EU8A 1NRQH 1VCPA 3E8LA 1MD8A 3M7TA 2F83A 3GCTF 5C0UA 2FO9A 3BTTE 1DLKB 3SNAA 1VJAU 1GHAG 1BBRE 3EQ0H 4QT8C 1C1TA 5A8YA 1JIRA 5HMAA 2R2WU 5C1YA 1G3DA 3A89A 3SU1A 1T8MA 3HGPA 2ODPA 3RXLA 3BTGE 2H1UA 3GYMA 1AI8H 2OCVB 3SUEA 4ABAA 5A8ZA 1P09A 3N7OA 3GY5A 3MNSA 4FXGH 2QXHA 3UTUH 3A8AA 5T6DA 4TYDA 2PGQB 4UFFH 1AHTH 2OC7A 1MZAA 4OGXA 5F53A 3ELAH 2F3CE 2A45B 2SGPE 2Z9GA 1JBUH 2IJD1 1C2EA 1FJSA 5E2PA 2FOGA 2AGGX 2D26C 1ARCA 1GJBB 1LKAA 1S6HA 3SN8A 3TNTA 2ZI2H 3SJKA 1YM0A 1EZQA 4FUCA 3FOAA 4MNWA 2ZU4A 1MU8B 4NFFA 4JZFH 1DSTA 2ZU5A 1GHXH 3LIWA 2XNIA 4BAQB 3UQOA 1TQ0B 2G51A 3MH4A 5EPYA 5BRRE 3TH4H 5C1UA 1O2GH 2W7SA 1YPMH 2H6MA 1NFUA 3UNQA 1BRUP 1UTKA 2H9EH 3MQKC 1E36B 2F91A 1V2LT 1BMLA 1OPHB 4MG3A 1AB9B 5LGOA 4Y6DA 3EYDA 3FO8D 3NUMA 3HPTB 5L2ZH 4U2WA 1MTNB 5GNDA 6LPRA 5FX6A 3AASA 9LPRA 3QZRA 1Z71A 4D7GA 1P2OA 1HUTH 3OE7D 1ELDE 1H8HD 1BTXA 3AVZA 3T5FH 3G01A 1WCZA 3ZZAA 3V0XA 1TABE 1ZMJA 2Z7FE 1QHRB 3AK5A 1N6XA 2AERH 3SW2B 3DD2H 3KNXA 2FI4E 5CHBA 4UFDH 1B0EA 1BMNH 1GHBF 3SU3A 3I78A 3SJOA 1BMMH 2Z9JA 4H42U 4DOQA 4NA7A 2BB4A 1Z8GA 3RXQA 1NFYA 4IN2A 4Y8YA 3P8FA 1KXDA 4ASUD 4RT1A 2B9LA 1O39A 5K0HA 4DIIH 4YESB 1CT0E 2PP6A 5GPIB 1AD8H 1WBGB 2XTTB 5DP6A 2JETC 4UEHH 1GI8B 1P8VC 1QIXB 1Z8IB 1P3EA 2VWNA 2WPLS 3C27B 2A31A 2WYGA 1P9UA 1O3EA 2ZDNA 1GMDG 5GCHF 2GGVB 2QYIA 2J38A 3IITA 4TSFD 2L6OA 1L2EA 4Y10E 2ZHWH 3LGTA 1FI8A 3QO6A 1H8IH 5JBBS 1TQ7B 4X1PU 4TWYA 1GJ9B 1OOKB 4NA8A 1ORFA 1D3QB 3FZZA 1O3DA 4Z0KA 3F68H 3UUZA 5FXLA 4IW4E 5DP5A 1BQYA 1J8AA 1C1NA 3GYLB 2OTVA 1O2SA 5E2OA 4AYYB 1K28D 3H09A 1HYLA 4JYVH 3SJ9A 7LPRA 1ESBA 1C9TA 3M61U 2SGFE 2BDYA 5JPMH 1CGHA 3T27A 1LHCH 2LELA 3V7TA 1GHAF 1A3EH 4ABIA 1QBNA 1C5XB 4B6FA 3BIVH 3F2HA 1W0JD 3U28C 1RFNA 4K5ZA 5G4BA 2UWPA 4ZKRU 1V2MT 1PYTC 4AN7A 1WDIA 1KXEA 2FTMA 1PPHE 4A7IB 1KXCA 1FZZA 3M5MA 2A5AA 1TA2A 1C5WB 3KQCA 4FOUC 2VIDA 1P2IA 3VFEA 3EDXB 2A4QA 2ZFPH 2SGDE 1GJ8B 1C9PA 1V3XA 1ZHMA 2R0LA 1JWTA 3SI3H 1YLDA 3T25A 4ABGA 5DN6D 4YLUA 2A1DB 2O9QA 1AWFH 2F9BH 1O3KA 3GY4A 4GPGA 1MQ6A 1JRSA 2C8YB 1GWAA 1AMHA 4CRAA 5J4SA 1BBRH 3L33A 2BY7X 3UB0A 2JETB 5AFYH 1THRH 1BMFD 1FAXA 1VR1H 1YF4A 4ZKNU 5GXPA 3RUOA 3O8RA 2Z9LA 1SKYE 3F0OA 1XUKA 4JK5A 3D49H 2BYAX 5EXLA 2BLWA 4E05H 1AUJA 1BA8B 1SLVB 3PMAB 1YPHC 3TNSA 1Z1IA 1Y3YA 1TNJA 3M36A 1T8OA 4Q7YA 1OWJA 4WJG2 1C5UA 3Q3KA 1GHZA 3TPIZ 2VWOA 1P04A 2BD4A 1MCTA 4X2YA 4PROA 2VIQA 5AVDA 4MVNA 4INLA 1BITA 2A2XH 3SGBE 3W94A 3RXJA 2ZCKP 2QV1A 2G55A 3BEUA 4ABJA 3EE0B 1EATA 1DDJA 2FYQA 1AZZA 2XC0A 2ZDKA 1CO7E 1O3AA 2A32A 3UNRA 1HAVB 3E1XB 1GBJA 1Q2WA 3RXIA 1SGNE 1UK3A 2IPHA 3HATH 2BOKA 1ID5H 1TX6A 3P8NA 1XUFA 1EUFA 4X1SU 4MNXA 4TWWA 5A0AE 1EJNA 3IWMA 1MD7A 5JB8S 3UAIC 4IN1A 1DXWA 4B73A 4IMZA 1E38B 1GMDF 3SU6A 4HGCA 1P2MA 5IYTA 1DS2E 1D3TB 3SHCH 4A1XA 4XD7D 1ACBE 3I29A 2GV7A 3KL6A 2AMPA 1TX7A 3P92A 4K2YA 2GZ7A 4JYUH 3RXMA 3M5LA 1TRNA 3KIDU 3A87A 4AOQA 3RC4A 1O3GA 1F92A 2EA3A 2CV3A 2WV4A 2Z6BD 1O2OA 2RCEA 3F9FA 1EB1H 1NN6A 1L0ZA 4Y79A 1RIWC 1NU9A 3ZVAA 3U1JB 4JCNA 1H8DH 1K1NA 1G9IE 1S0QA 4BAOB 1VITG 1EAWA 2RDLA 3DFLA 3UQVA 2OQ5A 2ZO3H 2VIWA 4CRCA 5SGAE 2OUAA 4ABFA 1SOZA 3TK6A 2ZC9H 4ABHA 1BHXB 3EE7A 1T31A 4WXIA 5B6OA 1UVUH 2QCYA 1K1OA 1YCPK 1S0RA 4NWKA 1NFWA 2BLVA 4AGJA 1XUJA 2C8ZB 4ZHMU 4CRFA 1O2JA 2VINA 3KGPA 2OQUA 1SGTA 3QDZB 2Z9IA 1XXDA 3LGIA 4YLQH 3TLOA 1V2QT 1C5YB 1NRNH 1NS3A 4XBDA 4Y8ZA 1UHBB 3KYGA 2FP7B 1QFKH 3R3GB 1SBWA 1LMWB 1TGBA 3PMBB 2W7UA 2V3OH 1PQ5A 3RXRA 4F49A 3SNDA 1C1QA 4XOJA 2FODA 2O8WA 3ENSB 3FKSD 3V12A 1UTPA 1AU8A 2AGIX 3MFJA 4FU8A 1GHYH 3RXOA 1ZLRA 2J9NA 4FU7A 1O32A 1HAOH 2ZG0H 5C17A 2GDEH 3URCA 5DJ7A 1O2YA 4Y8XA 3SNBA 3A84A 3QTVH 5T3HA 2OBQA 2G5NA 2UWOA 4K1EA 1HAGE 1S6FA 3OY6U 2NU1E 5HXFA 3TJOA 5EGMA 2PUXB 2B7DH 1C4Y2 1BRAA 4Y0YE 1DUAA 1J9CH 1LPKB 2JH6D 3A86A 1EAUA 1XKAC 2H9HA 4I86A 4AFSA 3F2GA 1QL7A 2UUFB 5EQQA 5ESTE 2SGQE 3H7OA 2AGEX 3ZVFA 1RIWB 1OX1A 1UTMA 3A83A 1FY8E 2BQ7B 3VXEH 1OYQA 4LOYH 1FAKH 1CE5A 3O8BA 3F9HA 1B5GH 1E35B 3NCLA 1G32B 1SGCA 4NIYA 1YLCA 1O3BA 1TPOA 1Y5BT 1HAVA 3LKWA 3LDXH 1GJ4H 1QA0A 3GY6A 2AS9A 1YPEH 1BMAA 2ZTXA 1C1VH 2BM2A 1LPGB 1KDQB 1T4VH 2V3HH 2ZFRH 1NROH 1BTZA 1SGFG 1JXPA 2FI5E 4BAKB 4ZH8A 4DY7B 2ZGBH 1G36A 3RM0H 1D6RA 1DWEH 1ANEA 3A7YA 4Q7XA 1RXPA 1K1IA 1RTKA 1ZTKA 2XNDD 4H6SB 4GHQA 1S81A 3V13A 1SGIB 1NBME 4ZUHA 1H8ED 1ZMLA 1C2LA 1OWHA 1E34B 1OP0A 1TB6H 3LGYA 1ZR0A 1SLWB 2AMQA 3RMOH 2B0FA 1GCTC 2F9VA 3SORA 1VITF 4Y71A 2R0KA 2Z94A 4I8KA 1FLEE 2ZP0H 1TOMH 1WAYB 1FX0B 1GPZA 2Z3EA 3SOSA 1O2RA 2H5DA 1OP2A 1GBLA 1IAUA 1SR5C 1FY5A 1TLDA 3MWIU 1GBKA 1GVZA 1MTUA 2RDEA 3VPKA 1KTSB 1TX8A 4F4OC 1FMGA 5C5NA 3TGKE 3PM3A 1S82A 2BLQA 3RM2H 2YNAA 4ACBA 1ETSH 3LC5A 4X6OA 1TRYA 1C2JA 3NK8A 4MDSA 1GBBA 1RS0A 5AHGH 1LHGH 1C5TA 1MCVA 1O2UA 2JH0D 2ZDLA 3LGUA 2D1JA 4Q4LA 1IOEA 2WZQA 2QF5A 2ILNA 4DT4A 2P3FH 4ZCNA 1UHBA 4KTUA 1W11U 1QBOA 3FVFB 3OY5U 4HFPB 4M9FA 3CS7A 3MMGA 5L2YH 3A81A 4XBBA 5E0GA 1SQOA 4AG2A 3SUFA 3KF2A 4TPIZ 2VWLA 2WPIS 1ZPZA 1WYKA 1QB1A 3KQBA 4I31A 1FY1A 1C5OH 1W10U 1D3DB 2BDGA 2TBSA 1H9HE 3DSPA 1DANH 1MBMA 4E7RG 1XVOA 4FVDA 3E16B 4AB8A 4TT3D 1CVWH 1O37A 1SC8U 2UWLA 3BV9B 4RN6A 4X2WA 2YMSD 3LC3A 2HPPH 3MNBA 2RG3A 2XBWA 3MHWU 1QNJA 1KMHB 3SJ8A 1ZSLA 5FCKA 4Y76A 1O33A 1MAYA 4XBCA 2V35A 3A7VA 1Z6JH 3RXGA 4BANB 1DFPA 5T6GA 2KR7A 4AFQA 2P3UB 1X7AC 1L4ZA 1OP8A 3MO6A 1MTVA 1UVTH 1AFQC 4Z1MD 1P9SA 1GCTB 4I8JA 4CHAC 1V2WT 5C5OA 1W12U 2TGAA 3MTYA 1ZHRA 3LGWA 5FBIA 3ZVBA 1B7XB 3A82A 5DGJA 1MTSA 3RXVA 4ZROA 1DUEA 1SSXA 3P17H 1J15A 1EZXC 2EI7A 3HGNA 1UCYE 1XVMA 3GY2A 2BDIA 1GI0A 1HFDA 3K9XB 2W6JD 2TIOA 1P0SH 4JK6A 1CHGA 3EA9A 1O38A 1ZSJA 3ZVGA 3SQHE 1MUEB 4ZMAH 1GBEA 3VXFH 2HOBA 3E0PB 2BXTH 1KDQA 1CU1A 3MYWA 1A3BH 1PPBH 3PROA 3U8OH 4E06H 1PPFE 3PO1C 2XC4A 1JIMA 1IQNA 1WTGH 2BX3A 4MQAA 1J17T 1SMFE 3T2NA 5EG4A 4A5TS 2R3UA 2GKVE 4OM9A 2PR3A 4I32A 1K1MA 5T1VA 3MOCA 3S7KB 5CDFE 1C5PA 2QIQA 5F8TA 2TGTA 4GCHG 4KP0A 1MMJN 1T8LA 1BTPA 3BEIB 2A4OA 2VJ1A 1GI4A 1KLJH 2JDID 3GDVA 1A0HB 2WPMS 2ZGXH 4LXBH 1HAIH 5A0BA 2ZHQH 2P59A 3F9EA 1QGFA 2SNVA 3LH3A 1ZHPA 1COWD 3M3SA 1SGDE 3ATKA 3OEHD 4CREA 5DP7A 3KQDA 4DT7B 1V2PT 1EQ9A 2BY5X 4ZHLU 3SV2H 1KXBA 1SQAA 4Y7BA 1K2I1 1TNKA 1NESE 1O5EH 2HWLB 2J92A 4K1TA 3QGNB 1AFQB 4DG4A 5ABWA 2K1QA 1EP6A 4CHAB 2ZWLH 5HM9A 1C2FA 1UTQA 4NCYA 2QGRA 3SI4H 1YCPM 2WPKS 1F0UA 4K8BA 2KCOA 1O31A 1YYY1 1C4U2 1LHDH 5A2MH 1DT2A 8KME2 3QLPH 3K2UA 1SHHB 2VVCA 1A4WH 3N99A 3GS9A 1DWBH 5FL7D 1QRWA 3GCNA 1VITH 3PO1B 4OS1A 5TCAA 2PKSC 2ZPQA 5FPYA 4ABBA 4SGBE 1MAXA 6ESTA 4K3JA 3SV8A 1WU1A 5T6FA 1F5LA 1WOFA 1HPGA 4A6LA 1CA8B 2Y5GA 1A61H 1Y3WA 3VB4A 1C2IA 3BF6H 2P93A 5IDKA 1ELBA 2CN0H 1GBDA 3RXDA 3K65B 2J94A 5F8XA 2D2DA 3DA9B 2Y5HA 1EAXA 5CMXH 1NPMA 2AMDA 5TJXA 2D8WA 2ZZUH 2BTCE 2KCYA 1O5FH 2ZHFH 2PLXA 1EOJA 1BB0B 4O97A 2Z3DA 5E0JA 1XUGA 3T62A 2BOHB 1PPCE 2J95A 1RGQA 8LPRA 2JJ1D 2BHGA 1JOUB 3F2FA 2YNBA 1SHYA 2KCAA 5EJZA 2ZTZA 1G2MA 3BG8A 3RXAA 2HPQH 2Q1JA 3B9FH 1BDAA 1N8OC 2IN2A 4KGAA 4AFUA 2KFWA 4BNRA 3TU7H 3BTHE 3IG6B 5I25A 5DP8A 3AW0A 1NU7B 1TPAE 3QX5H 2GZ8A 2ODQA 1HCGA 3ZYDA 2QF3A 2XRCA 2BZ6H 2Y7XA 3DHKH 2VU8E 1BHXF 3M3TA 1YCPH 4RI0A 1W0KD 1K1LA 2ZKSA 1A7SA 5C20A 3NXPA 3WWFA 3FP6E 3QUMP 4HTCH 4UE7H 4WVPE 1ELAA 1DITH 1DY9A 1LDTT 1EP5A 4TY7A 4MNVA 2G52A 4HZHA 3JZ1B 1U6QA 1V2ST 1EPTC 1NRPH 2AHME 1IQGA 4YM9A 5EIYA 4UONA 4GCHF 4CRDA 1ETTH 1FIWA 1FY4A 2PWXA 1YPHE 5JBCS 1NRSH 3OU0A 1G37A 1GBFA 1QB9A 2FS8A 2HRVA 2W3KA 5HKKD 2ZU2A 2O8TA 1JRTA 3R0FA 5FAHA 1GHWH 4B2BA 1P02A 3A85A 1GI6A 2NU0E 2P8OC 3VB3A 4AG1A 1FQ3A 1T7CA 2PKSB 1C5ZB 1C1MA 1DM4B 3BG4C 1LVOA 4CH8B 4VGCC 1CA0C 4Q7ZA 2AEIH 1ZSKA 5DG6A 2ALVA 3KN2A 1MKWK 5LPFA 3RMMH 8ESTE 2W3IA 2CF8H 1PQAA 2GCTC 1YC0A 2G8TA 2XWBI 4R8TB 2P94A 2BVRH 3UY9A 1J14A 4J1YA 3SU5A 1ELCA 3DSGA 3NZIA 5EJLA 5DO4H 5JDUB 3OEED 4ACAA 1CSOE 1SB1H 1YLNA 4FUIA 2WINI 1Y3VA 2CGAA 1MTWA 4H4FA 5HIYA 4ZKSU 4ABDA 4MPWA 1IHSH 3MU0A 1AWHB 1SGRE 2FWWA 2SNWA 1BIOA 2VIOA 1QJ7B 1N8OB 1A0JA 1O30A 1K22H 1Q3XA 7KMEH 2BLOA 1W3CA 1JMOH 2FOBA 1GDUA 2BDAA 2GT7A 4WXVA 1CHOF 3GDSA 1IQLA 5BPEA 1F7ZA 2TRMA 4I8LA 1F5KU 4FUGA 4AFZA 1OWIA 4GLYA 2V7QD 3L3TA 3SGAE 2TGPZ 4D76A 3SU4A 1UJ1A 3BN9A 3GICB 1MKXK 5DPAA 3SUGA 3TJNA 3CENA 1EPTB 3ATLA 1ETRH 1UTJA 3MNXA 3ZZ7A 1D4PB 3H5CB 1TPSA 2M2AA 2DE9A 4HG6A 3MO9A 1TBQH 1V2RT 3ZZ3A 1O3MA 1DE7H 5GIBA 2VGCC 3B8JA 1E1QD 3RXBA 1T4UH 1SQTA 1LHEH 2OINA 1OKXA 4I33A 4FETA 2BD2A 2R9PA 2QXGA 1C5NH 1P57B 3C1KA 3ZZBA 3BG4B 4CRGA 1P2KA 4VGCB 1CA0B 3GCHC 3Q77A 3S7HB 3BTDE 5GWZA 5C0TA 1YKTA 1NC6A 4WWYA 2GTBA 3K6YA 2BDHA 3V3MA 2GCTB 2W6ID 2UUYA 1UTLM 1P10A 1AUTC 2V6NA 7ESTE 2R2MB 2ZGHA 4MPVA 2AIQA 4OS4A 3S69A 3U8RH 1ELTA 1FNIA 1QA7A 4NSYA 4WH8A 1O2ZA 1K1JA 1HJAC 1GI1A 2STAE 2ZTYA 3QZQA 3STJA 3QK1A 3GDUA 1A1RA 2IPQX 1GDQA 3RC6A 4X8VH 4ZXYH 4D9RA 3ZVEA 4DGJA 1EZSC 3VEQB 5JBAS 1HIAB 4BXSA 1UCYK 5A09A 1OS8A 2ZQ2A 1IQIA 2PTCE 3O8DA 4IC5A 1CQQA 2XC5A 1S6LA 2A7HA 2F4LA 2GJGA 3RC5A 1A5IA 1QL9A 2ALPA 3SBKA 1ZGVA 2THFB 4P02A 3GISB 4X1RU 1C5MD 1VCWA 1HGTH 4HI3A 1LHFH 3GOVB 4RKOB 2Y7ZA 3PLPA 4X1NU 2FM2A 2VBCA 4B6EA 2VIPA 3PTBA 3BTFE 2FIRH 4NGAH 1SQRA 2AFQB 2H2ZA 1AY6H 2K0QA 4Y0ZE 1LKBA 4BAHB 2VGCB 4AYVB 3ZVDA 1HV7A 1QQ4A 3A80A 3TGIE 1VZQH 4XRNA 3M7QA 1GL0E 3ZYEA 2CMYA 1TFXA 1NTPA 1UK2A 1N6YA 5DP4A 1KSNA 1O3JA 4BOHA 2BQ6B 2J2UA 4NZLA 1UTOA 3GCHB 3VGCC 4YOIA 1TALA 4SGAE 1O2MA 2BZAA 2HNTC 2WYJA 4K60A 1GI9B 1ABJH 1W13U 3UFAA 2ESTE 7GCHG 1C2KA 4I8GA 3N7DA 4MNYA 4U01A 1C5VA 1BZXE 4UDWH 1TYNA 3E91A 2H5CA 2VB0A 2L74A 3FN8A 2LNCA 2Y5FA 4GUXA 1S85A 2TPIZ 3TK9A 1G3BA 1B0FA 1W7XH 1ZRBA 4B71A 4B2CA 1TNHA 1W7GH 1KY9A 1D9IA 1W8BH 1HJAB 3TIUA 1BOQA 1WSSH 5PTPA 3AAUA 3SYJA 1QURH 2SGEE 1KYNA 2A0QB 1TIOA 2QXJA 3M37A 2OK5A 1E37B 1AO5A 1EPTA 5C67A 1Q31A 1EAIA 2EQNA 1P06A 1WXRA 3VB7A 4WY3A 4MLFB 4B75A 2OC1A 2FOCA 1MABB 1KLTA 3ITIA 1DLEA 1SFIA 1THPB 2ZECA 4NIWA 4Q80A 4XFQA 4YT7H 2Z9KA 2G4TA 5JYIA 2PKAB 3P8GA 5IK2D 1OSSA 2J34A 4CRBA 1D3PB 4NFEA 3SV6A 2LP6A 1PPEE 2G00A 1K9OE 4NA9H 5CE1A 2HLCA 2BD5A 1ZPCA 1O34A 1YBWA 1C2HA 1Y3UA 1FONA 1LVBA 1ABIH 2FDAA 4OS2A 4Q2KA 1KXFA 4YO9A 1H1BA 3SGQE 1O36A 1TBZH 1V2VT 1F0SA 1UTNA 2ZFFH 1TNIA 1AFEH 2QN5T 3TH3H 1NBMD 4O3TA 4BTUB 3RXUA 1SL3A 3SHAH 3W95A 2WSSD 2WV9A 1KTTB 4DIHH 1YPGH 1K1PA 1AZ8A 1L1JA 2OC8A 4UFGH 2FS9A 1KIGH 3M35A 3VGCB 1THSH 1W2KH 1E0FD 4ISOA 1CT2E 4U30A 4BTIB 3L6PA 4AX9H 4X6NA 1IQHA 1TOCB 2P3TB 3F9GA 1O2QA 1YPKH 4B1TA 4B2AA 3NWUA 1GVLA 3U1IB 5ESBA 2BD3A 1BCUH 1E79D 2VWMA 5E8EH 1HAYB 4TPYA 3WW7A 1QRZA 5CHAC 4ESTE 1HIAA 2F43B 1IQKA 1A0LA 2BY9X 4R0IA 2C8XB 4KELA 1M9UA 4NIVA 3TITA 2ANKH 4WMEA 4AGKA 1C1UH 4AORA 4UD9H 2BVXH 2PW8H 1FN8A 1YWUA 1SGPE 2ZNKH 3RU4E 3AAVA 4Y11E 4DCDA 2UUKB 4J2YB 2ZF0H 1ANCA 2OBOA 4ISNA 5HIZA 2G4UA 3T28A 1TPPA 4IC6A 2CK3D 4ABEA 1TA6A 5DSFA 3RXFA 5LPEA 2PGBB 2BX4A 1AVWA 1K0HA 2ZU1A 3MU5A 4O03A 2QC2A 1PQ7A 1J16A 3F1SB 3TH2H 2CF9H 5I46H 4ZHAA 1RTFB 3E90B 1TAWA 2YMSC 1O2KA 4FUJA 7GCHF 4ISIH 1SVPA 3E3TA 1ZTJA
chains in the Genus database with same CATH topology
3ODDA 1O2LA 1Y5UT 1SI5H 2ANWA 1AKSB 1G3EA 1NFXA 1C5LH 1GJCB 3URDA 4CBNA 5HYOA 1TMTH 1Z8RA 2PSYA 2NU2E 5EQSA 2GCHG 2EC9H 3ATIA 1HAXB 2WV5A 1AE5A 3F6UH 3NPSA 3RMLH 1QY6A 2ANMH 1YPLH 3SNCA 1QRXA 2OC0A 2XYAA 4X8SH 5E0HA 2XBYA 1DPOA 1V2JT 5TCCA 1XX9A 1BUIA 1XM1A 4KKDA 1CBWC 1NM6A 1V2TT 2C8WB 2BY8X 2W5EA 3BTKE 3PYHA 4ISHH 4YXWD 1IQMA 3QTOH 3TJVA 1GJDB 4BXWA 4I7YH 2M5TA 1SOTA 1ELFA 4D7FA 1EFRD 1EB2A 1SLXB 1O35A 1YP9A 3RP2A 2Y82A 1L1NA 5CHAB 3ZZ9A 2O8UA 2KCPA 3FFGA 2KM0A 4OS7A 2QE7D 1PJPA 3D62A 5DKMA 2BD9A 2XW9A 1ELVA 2PKAA 2JH5D 4KTCA 1A5GH 2J5UA 5EXNA 3NKKA 3LGVA 2NWNA 4X6PA 1OWDA 2FOAA 9ESTA 2Y80A 2Q6DA 4JZEH 2XCNA 5EPNA 2FOHA 1AQ7A 2P16A 1BRBE 2FX6A 1MKWH 1O5GH 2QY0B 2VVUA 5C3NA 1W0ZU 1P05A 4RSPA 3ZZDA 1C1OA 1SG8B 1PPGE 2BMGB 5GJ4B 1AIXH 1NY22 3TGJE 2ZDVH 1O3HA 1P11E 1TGTA 1TWXB 5ETXA 4GSOA 2V0BA 1Y5AT 2O8LA 3HKJB 2YMSB 3A7XA 4ISLA 3VB6A 1S83A 2ZFSA 1O3NA 2NU3E 3H7TA 1ANDA 2TGDA 3RU4T 2ZCHP 4JYTA 2FMJA 4IMQA 4ZAEA 3ODFA 1C1PA 1P01A 1UVOA 3P95A 3UR9A 1TGSZ 1QQUA 2ZU3A 1V2OT 1MH0A 5JB9S 1MZDA 2GMTC 1P3CA 1TONA 1QL8A 5GDSH 2JIZD 4X6MA 3KCGH 5FPSA 2BQWB 5FX5A 3FZDA 1P03A 1HAHH 4FUBA 1GBMA 2KAIB 4IS5A 4NIXA 3TK5A 1HDTH 1EJAA 1CHOG 3M3VA 1GMHG 5LH8A 1ZRKA 2FX4A 2ZFTA 1CBWB 2GD4B 1EKBB 2HVXA 1GI5A 1MKXH 4JMYA 2QAAA 3T26A 5B6LA 3ZZCA 3A88A 2AIPA 5K7RA 3F3BA 3E6PH 3SJIA 4D9QA 1HJ8A 3S9AA 1HXEH 5DK1A 1F5RA 1Z8JB 1Y59T 5FHTA 1NRRH 1GI2A 3RXPA 2BD7A 1ELEE 1LVYA 4ZXXH 3UREA 1T8NA 3DCLA 1LQDB 2ZGJA 1GDNA 1VJ9U 1L1GA 1ZGIA 1C1RA 1TGNA 4O9VA 2WUCA 3UIRA 4AZ2B 4TY6A 2GCHF 3CS0A 4WF8A 6CHAC 2NU4E 3BTQE 1AKSA 3KQEA 2OD3B 1AN1E 3ATWA 3EAJA 1BT7A 2PUQH 3LT3A 1FIZA 1BRCE 3MH7A 1WUNH 1N1LA 4LZ4B 1GCDA 1S84A 1AVXA 2LPRA 2RA3A 4K1SA 3AW1A 2ULLA 1EZUC 4FUFA 1D6WA 2ZPRA 1UK4A 1PYTD 1ZOMA 3OAAD 1C1SA 2SFAA 3CP7A 1O2IA 2ZDAH 1C1WH 2F9UA 1C5RA 2Q6FA 3OYPA 1SGQE 1DWCH 4OGYA 3N7EA 4JZIA 2GMTB 3UWIA 2PV9B 4A92A 2XCFA 3Q00A 3RXHA 1DSUA 2QXIA 4FUEA 2Y81A 1UCYH 2XWAA 3T29A 3A7WA 2FXRA 1UVPA 2GT8A 5J4QA 3A8BA 1DXPA 1A5HA 3TJUA 5HGGA 3ZVCA 1DX5M 2C90B 1FN6A 1C5SA 1IQEA 6GCHG 1KXAA 2ASUB 1HLTH 3DSOA 3MI4A 1UVSH 1VGCC 1EX3A 4B76A 1UO6A 2P95A 4YZUA 1WQVH 3UNSA 2BDCA 1DOJA 1FUJA 3A7TA 2GP9B 5EXMA 2OXSA 3RDZA 1O2HA 4FUDA 1O2TA 4GHTA 3HK6B 2DE8A 3Q3YA 1DY8A 1O3OA 1PQ8A 3RXKA 3D23A 3PB1E 2HALA 1O5DH 1WV7H 1CT4E 1RTLA 6CHAB 3BIUH 2FZZA 1F2SE 1W0YH 3PRBA 1VCQA 4X2XA 2B8OH 2A4RA 1FDPA 1RRKA 1UMAH 2F9NA 1W14U 2FOEA 3DUXH 5AFZH 1LTOA 1SGEE 5AF9H 2GV6A 3OSYA 3EGKH 3PTNA 1FPCH 1GMHF 1ANBA 1QCPA 3P70B 1XUIA 1WQSA 3EA7A 3RLWH 1QR3E 2XBXA 2KAIA 3SV7A 4YTAA 4YOGA 1G30B 3B23B 1GGDC 1ZZZA 1LVMA 2VNTA 3U69H 1OWEA 2OP9A 4DURA 5H4IB 4INKA 4Q63A 3LPRA 1O5CB 3PWBA 4NWLA 1V2NT 1GBCA 1P2JA 2SGAA 3K6ZA 1HNEE 2A7CA 4OS6A 3SNEA 1SPJA 3U8TH 1XXFA 2JKHA 2CHAC 5FCRA 8GCHG 4X8UH 1O3LA 1HB0B 1QB6A 1TRMA 4FU9A 4B74A 3RLYH 3SU0A 3EA8A 1QJ6B 1GBIA 3ZIAD 5LPRA 2FPZA 3BSQA 3OTPA 1OYTH 2JJ2D 3PMHB 2OLGA 1GBHA 1LCYA 4AB9A 3P8OA 3GY3A 2P8OB 3RXCA 1G3CA 1AVGH 1RD3B 1EOLA 4X2VA 2PSXA 1HAZB 3SU2A 4XE4A 4CR5A 2PHBA 2VH0A 2KZ4A 2XBVA 1GI3A 1O5AB 2VIVA 2IJOB 1NT1A 1MBQA 1HBTH 1A2CH 3OTJE 1KLIH 3S9BA 4YOJA 1VGCB 1GHVH 1A46H 4Z6AH 2B5TB 1MU6B 1BTYA 1O2VA 3A8DA 1GL1A 3ZZ5A 1C2DA 1DVAH 4NSVA 1H9LB 3KHVA 3LH1A 3PV4A 1ESAA 3FANA 1HXFH 2GZ9A 1DWDH 2C4FH 3E0NB 1GJ6A 2PTNA 1LO6A 3GY7A 4JZDH 2BVSH 3FP8E 5DP9A 3PLKA 4IGDA 2HNTF 4YT6H 4WH6A 2G81E 3STIA 4U32A 2EEKA 2GX4A 1SGFA 2FOFA 3UPEA 3SZEA 1TNGA 2ZPSA 5EW1H 1Y3XA 4DW2U 4LZ1H 2FEQH 2CXVA 3MH6A 1O5BB 3SQEE 1ZPBA 2G5VA 5FBEA 1IQJA 1GJ7B 2F9PA 4H6TA 6GCHF 1ESTA 2VVVA 3HK3B 2AYWA 3QN7A 1O0DH 2FOMB 4WMDA 1GGDB 3UOPA 3M5NA 1C5QA 2HNTE 3LOXA 4KTSA 4INHA 2WPHS 1Y8TA 2A5IA 2VH6A 1NZQH 5EOKA 2ZHEH 2PFEA 1GBAA 2CHAB 4FVBA 1HAPH 2H9TH 4GVUA 1H4WA 4CBOA 4IBLH 4Y7AA 3D65E 3GCOA 2BXUH 2EI6A 2K8IA 1BTWA 3SZNA 2FI3E 3BTEE 1BBRK 1GMCG 3GY8A 3Q76A 1HRTH 2R3YA 3VB5A 1S5SA 4NZQA 1ARBA 2HLDD 5L6NH 1YGCH 4XSKU 1ZMNA 1F0RA 4CH2B 1EJMA 1C2MA 1O2PA 2IOTA 1C4V2 2EI8A 2WHXA 1BTUA 3F0PA 4I8HA 1XMNB 2QF4A 1P12E 2O8MA 2YOLA 1NO9H 2HGTH 2FYRA 1AGJA 3MH5A 3WWBA 3OX7U 3SUDA 1K21H 3HKIB 3ESTA 1T32A 5JBTA 2Y6TA 4E7NA 8GCHF 2ZDMA 1ZJKA 2ZIQH 1V6DA 2ODYB 1GJ5H 1BJUA 3PRDA 2Z3CA 1HJ9A 1ZJDA 4NG9H 1P2NA 5A0CA 5C1XA 3Q3XA 4A1TA 5C2ZA 3FAOA 3GCTG 3QWCH 1TMBH 1C2GA 3ZZ6A 3UOUA 3UWJH 1QBVH 4BTTB 1ZYOA 1G2LA 2ANYA 3PV5A 1SGYE 2AH4X 2ZGCA 2XXLA 3P6ZB 1GG6C 2ZCLP 1GJAB 4WMFA 3O8CA 2DUCA 5FPTA 1FV9A 3LONA 3PMJA 3RXTA 1E1RD 1O3FA 4RKJB 1BJVA 2FTLE 4DVAU 1FY3A 3LJJA 5F03A 5F6MA 2QA9E 1XKBC 3BTWE 2GDDA 3M7UA 2STBE 2FLBH 1IHTH 3BEFB 1TE0A 4X1QU 1LPZB 3MU4A 3OFND 1GBTA 3ATMA 3RXEA 4THNH 4OS5A 1Z1JA 3NRLA 3JZ2B 2ZEBA 3A8CA 4MPUA 3WY8A 3MU8A 4GAWA 3FP7E 1QTFA 4ZKOU 1QJ1B 3PV2A 3VG8A 2C3SA 2J4IA 4BAMB 2QF0A 5EW2H 1O2NA 4JZ1A 2RA0A 4F55A 1V2UT 4DJZB 1O3IA 1V2KT 1Z7KA 3SV9A 1CGJE 3S9CA 1OHHD 1EXFA 2A7JA 1FXYA 1BTHH 1Z6EA 1L4DA 3MU1A 1LQEA 2A5KA 2F9OA 1OWKA 5EODA 2Q6GA 2FLRH 1SFQB 4UFEH 4LK4A 4X0WU 1O2XA 2ZHDA 2ZQ1A 4MPXA 1TBRH 3ZV9A 3PLBA 1GI7B 4FUHA 3LU9B 3MNCA 2W26A 1GMCF 4X8TH 3A7ZA 1PFXC 1AE8H 2A2QH 2WUBA 1RJXB 1F0TA 1GHBG 3W1EA 2ZA5A 1DICA 1O3CA 1ELGA 3I77A 4XDEA 3S0NA 3DT0H 1WTHD 4K69A 4K8YA 2A4GA 3RMNH 2I6QA 3ZZ4A 2BD8A 2BDBA 1MQ5A 1GVKB 3BTME 1TMUH 1GG6B 1INCA 2BY6X 3KEEA 3ZV8A 3MO3A 3RU4D 4A1VA 3U98H 2GVFA 5A8XA 2FESH 2UUJB 2C93B 2WPJS 1PPZA 3ZZ8A 5L30H 5GCHG 1XUHA 3QGJA 3U9AH 4M7GA 3PWCA 1IQFA 1AB9C 3SO3A 1O3PB 1TGCA 1H9IE 1TNLA 2ZFQH 1FPHH 5EQRA 3DFJA 2WPDD 3UR6A 1MTNC 4D8NA 5HM2A 1P2QA 3TVJB 1EASA 2XOKD 1ZTLA 4O3UA 4ASHA 2I6SA 1YPJH 4CR9A 2CJIA 3M5OA 1OXGA 1O2WA 5F8ZA 3RXSA 4MTBA 1CGIE 1SLUB 5DP3A 3LJOA 5EU8A 1NRQH 1VCPA 3E8LA 1MD8A 3M7TA 2F83A 3GCTF 5C0UA 2FO9A 3BTTE 1DLKB 3SNAA 1VJAU 1GHAG 1BBRE 3EQ0H 4QT8C 1C1TA 5A8YA 1JIRA 5HMAA 2R2WU 5C1YA 1G3DA 3A89A 3SU1A 1T8MA 3HGPA 2ODPA 3RXLA 3BTGE 2H1UA 3GYMA 1AI8H 2OCVB 3SUEA 4ABAA 5A8ZA 1P09A 3N7OA 3GY5A 3MNSA 4FXGH 2QXHA 3UTUH 3A8AA 5T6DA 4TYDA 2PGQB 4UFFH 1AHTH 2OC7A 1MZAA 4OGXA 5F53A 3ELAH 2F3CE 2A45B 2SGPE 2Z9GA 1JBUH 2IJD1 1C2EA 1FJSA 5E2PA 2FOGA 2AGGX 2D26C 1ARCA 1GJBB 1LKAA 1S6HA 3SN8A 3TNTA 2ZI2H 3SJKA 1YM0A 1EZQA 4FUCA 3FOAA 4MNWA 2ZU4A 1MU8B 4NFFA 4JZFH 1DSTA 2ZU5A 1GHXH 3LIWA 2XNIA 4BAQB 3UQOA 1TQ0B 2G51A 3MH4A 5EPYA 5BRRE 3TH4H 5C1UA 1O2GH 2W7SA 1YPMH 2H6MA 1NFUA 3UNQA 1BRUP 1UTKA 2H9EH 1E36B 2F91A 1V2LT 1BMLA 1OPHB 4MG3A 1AB9B 5LGOA 4Y6DA 3EYDA 3NUMA 3FO8D 3HPTB 5L2ZH 4U2WA 1MTNB 6LPRA 5GNDA 5FX6A 3AASA 9LPRA 3QZRA 1Z71A 4D7GA 1P2OA 1HUTH 3OE7D 1ELDE 3AVZA 1BTXA 1H8HD 3T5FH 3G01A 1WCZA 3ZZAA 3V0XA 1TABE 1ZMJA 2Z7FE 1QHRB 3AK5A 1N6XA 2AERH 3SW2B 3DD2H 3KNXA 2FI4E 5CHBA 4UFDH 1B0EA 1BMNH 1GHBF 3SU3A 3I78A 3SJOA 1BMMH 2Z9JA 4H42U 4DOQA 4NA7A 2BB4A 1Z8GA 3RXQA 1NFYA 4IN2A 4Y8YA 3P8FA 1KXDA 4ASUD 2B9LA 1O39A 5K0HA 4DIIH 4YESB 1CT0E 5GPIB 1AD8H 1WBGB 2XTTB 5DP6A 2JETC 4UEHH 1GI8B 1P8VC 1QIXB 1Z8IB 1P3EA 2VWNA 2WPLS 3C27B 2A31A 2WYGA 1P9UA 1O3EA 2ZDNA 1GMDG 5GCHF 2GGVB 2QYIA 2J38A 3IITA 4TSFD 2L6OA 1L2EA 4Y10E 2ZHWH 3LGTA 1FI8A 3QO6A 1H8IH 5JBBS 1TQ7B 4X1PU 4TWYA 1GJ9B 1OOKB 4NA8A 1ORFA 1D3QB 3FZZA 1O3DA 4Z0KA 3F68H 3UUZA 5FXLA 4IW4E 5DP5A 1BQYA 1J8AA 1C1NA 3GYLB 2OTVA 1O2SA 5E2OA 4AYYB 1K28D 3H09A 1HYLA 4JYVH 3SJ9A 7LPRA 1ESBA 1C9TA 3M61U 2SGFE 2BDYA 5JPMH 1CGHA 3T27A 1LHCH 3V7TA 2LELA 1GHAF 1A3EH 4ABIA 1QBNA 1C5XB 4B6FA 3BIVH 3F2HA 1W0JD 1RFNA 4K5ZA 5G4BA 2UWPA 4ZKRU 1V2MT 1PYTC 4AN7A 1KXEA 2FTMA 1PPHE 4A7IB 1KXCA 1FZZA 3M5MA 2A5AA 1TA2A 1C5WB 3KQCA 2VIDA 1P2IA 3VFEA 3EDXB 2A4QA 2ZFPH 2SGDE 1GJ8B 1C9PA 1V3XA 1ZHMA 2R0LA 1JWTA 3SI3H 1YLDA 3T25A 4ABGA 5DN6D 4YLUA 2A1DB 2O9QA 1AWFH 2F9BH 1O3KA 3GY4A 4GPGA 1MQ6A 1JRSA 2C8YB 1GWAA 1AMHA 4CRAA 5J4SA 1BBRH 3L33A 2BY7X 3UB0A 2JETB 5AFYH 1THRH 1BMFD 1FAXA 1VR1H 1YF4A 4ZKNU 5GXPA 3RUOA