4IMQA

Structural basis of substrate specificity and protease inhibition in norwalk virus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
183
structure length
173
Chain Sequence
GSAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like protease
publication title Structural basis of substrate specificity and protease inhibition in norwalk virus.
pubmed doi rcsb
source organism Norovirus hu/1968/us
total genus 41
structure length 173
sequence length 183
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4imqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4imqA01
4X1NU 1GI9B 1HFDA 2FODA 1A1RA 2VGCB 1FN8A 4AFQA 4JYTA 4DGJA 1BBRH 4ZKSU 2Y7ZA 4AG1A 1O2TA 1V2VT 1IOEA 1O3GA 1UK2A 1AWFH 3SNCA 4JZFH 2FMJA 5GWZA 2B9LA 1UTJA 4CR5A 4OGXA 3SUEA 4BAHB 4WY3A 1YCPK 1BRAA 1MD7A 2A0QB 1ZGIA 1O5DH 1H9HE 3ZYDA 3WY8A 1O2HA 3ATKA 3GISB 1V2KT 4FU9A 3ZVEA 3TH4H 1C1MA 2ZU4A 3AAUA 1DM4B 1SQOA 1S82A 1V2ST 6LPRA 3JZ1B 1TRNA 1J16A 2VIOA 5EG4A 4NSVA 1T4UH 4IS5A 1OWDA 1EOLA 2C4FH 4ESTE 1CGJE 2PR3A 5E2OA 5EXNA 5L2ZH 5GPIB 1V6DA 3QGJA 2FYRA 2QC2A 2HPPH 4U32A 1G30B 1SOZA 1O3DA 1AO5A 2XC4A 1BTZA 4AYYB 3W95A 1SOTA 1K2I1 1TMBH 1DS2E 3A89A 2ZCHP 3PM3A 1D9IA 2H5DA 1HYLA 4DT7B 4H4FA 1DLKB 2QXJA 1G32B 1XXFA 1DE7H 4X1RU 3RU4D 2Z9LA 4BXWA 4X6NA 4XFQA 5E0JA 1WOFA 2PW8H 1UO6A 2VINA 2C8YB 2GZ7A 1F0TA 1HB0B 1Z6JH 4PROA 1UVPA 2WYJA 1HNEE 4I8LA 2WV4A 1ABIH 1TOCB 2STAE 4TY6A 1LHGH 1DSTA 2VH6A 1NRRH 3A83A 6CHAC 1BTXA 1P2MA 1BTUA 2GGVB 2FTLE 1DXPA 2UUFB 2A7JA 1PPZA 2BDIA 2CMYA 4X8UH 1GI2A 3LT3A 1O31A 3QDZB 4CRBA 3S0NA 3BEUA 2VVUA 1BCUH 1TX7A 1GJ8B 1HAGE 2FWWA 1UVSH 3QX5H 1F92A 4FUCA 2V0BA 3RXIA 5JB9S 3ENSB 1TNIA 1OWJA 3D62A 4YESB 1TLDA 3ZZ4A 3ZVGA 1A0HB 4JK5A 4GSOA 1RXPA 4DW2U 1MU8B 4E7NA 1AVGH 1EAXA 1MH0A 3QO6A 2FOCA 2R3UA 1FZZA 1AFQC 1O3MA 1ZSLA 4I32A 1ZHPA 2H6MA 3MU1A 2F9BH 3GDVA 1LQDB 3T5FH 2FESH 2JETC 1Z7KA 1SL3A 1XXDA 1O3KA 3M7TA 5J4QA 1SSXA 1V2JT 1AFQB 1VCWA 1HBTH 3LU9B 4YLQH 1C5SA 2GVFA 2VWMA 4X6MA 1EB1H 1SGRE 3GDSA 3ATLA 2XBWA 2RG3A 3FZZA 2H5CA 4INHA 2BD2A 2BLOA 2D2DA 3RP2A 3FFGA 4DG4A 2OUAA 4A6LA 1ARBA 4HGCA 4B1TA 2STBE 2SNVA 1O37A 1GL0E 1P9SA 3U9AH 8ESTE 1VITF 1BA8B 4XSKU 3SW2B 2R3YA 3GY5A 3ZZCA 3GY7A 2A2XH 3Q77A 2Y81A 1UMAH 1C5UA 5DKMA 3SV2H 1TBQH 1V2UT 1ZPBA 2YNAA 3E3TA 3EQ0H 2O8MA 1BTWA 2IOTA 2PLXA 5EGMA 2BOHB 3LOXA 1ELCA 1FXYA 2NU1E 4YM9A 1GHBG 2FOEA 1V3XA 3TGJE 2PSYA 4WWYA 1K1NA 4B76A 1LTOA 5J4SA 5LGOA 4D7FA 1UTPA 2W7SA 1MUEB 4NG9H 1FV9A 4FUDA 4ABAA 4IC5A 4MPWA 4FUBA 1GJ4H 1TRMA 1GHVH 1GI5A 1Q2WA 6GCHF 1C2MA 2Q6FA 1P09A 1THRH 3SI4H 3LGWA 4D8NA 5T3HA 3UUZA 2PKSB 4CH8B 1UK3A 5F8ZA 2BQ7B 4CHAB 1K1IA 3ATWA 1VJAU 5E0GA 1GMCF 1UVOA 2ZCKP 4KTUA 4B74A 1TB6H 3TIUA 1LPZB 2PKAA 1BT7A 1CHOF 3FANA 1LHEH 1ZPCA 3A7YA 3LDXH 3ZVCA 1EB2A 1YBWA 1KY9A 6ESTA 5FPYA 4ZXYH 1LPGB 1XUHA 1YPJH 3P95A 1TGNA 4GUXA 1E35B 1O34A 3KL6A 2FS8A 2OXSA 3RXDA 3HK3B 1O3CA 2ZZUH 2SNWA 1GBEA 4FU7A 1H9IE 1NO9H 2ZHFH 2Z6BD 1EAIA 5BPEA 2F9VA 1QIXB 3FP8E 3ATIA 1Z71A 1JWTA 1ZMJA 4MNXA 1CGIE 3PMHB 4ABHA 1YM0A 2PKAB 3S9AA 2PHBA 1D3TB 3VB7A 4CRAA 1C4Y2 2BDCA 1SFIA 2R2MB 1SGQE 3A7XA 1TRYA 2UUYA 3QTOH 1LVYA 1NT1A 2IN2A 1W13U 2C90B 4ZKRU 3QTVH 3UPEA 2ANWA 3SN8A 2QF3A 1EJNA 4K8BA 1C5QA 4FUEA 3UOUA 2BVRH 3SUFA 3TH3H 1C9TA 2I6SA 4X6PA 9ESTA 1P12E 1ELEE 2AGGX 4UE7H 2ZU5A 5L6NH 1O2VA 2ZDKA 2ZA5A 1MD8A 1CA0C 3FZDA 4Y79A 2GDDA 5F8XA 1P3EA 4ISHH 2A7HA 2P95A 1GBCA 1GCTB 2OLGA 4ABDA 3TH2H 1QTFA 4NFFA 1JMOH 1K22H 2O9QA 2OBQA 3URDA 1CA0B 1P2OA 3SJ8A 3D65E 3TJVA 3NPSA 2AGEX 1AB9B 1FAXA 1S0RA 4NZQA 1V2TT 4GAWA 1DPOA 1O33A 3E1XB 5FPSA 1J9CH 3ODFA 5C2ZA 1GHZA 4ABBA 1LHFH 3KHVA 1YCPH 1GBTA 4FUJA 2R2WU 2QA9E 1HXEH 2HPQH 1GBMA 3V3MA 2R0KA 4O03A 3E90B 1RD3B 3MU0A 3SQHE 1V2MT 2H9HA 3RXBA 3LH3A 1KXCA 3TGIE 2ODYB 2BD4A 3M61U 1NRSH 1DUEA 4R8TB 3P6ZB 1V2PT 1AWHB 1GI0A 3KN2A 1CU1A 1G9IE 5EW2H 2HALA 4I8KA 1B7XB 3TNSA 3HPTB 3LGUA 3STIA 2ZHEH 4OGYA 2XTTB 3M5LA 2H1UA 1ZJDA 1O0DH 3A82A 4YZUA 3MNCA 5EPNA 2AERH 3FP7E 1THPB 3SU2A 1ACBE 1T4VH 2WPHS 1IQFA 3SHCH 1AKSB 1F2SE 1G37A 5T6DA 3SV9A 1UTKA 1A3EH 1TGBA 2CHAB 3DHKH 1GJBB 2XWAA 1ELBA 1EJAA 2BDBA 3U1IB 5DP3A 1Y8TA 2UUJB 3V12A 3KQEA 1YLDA 4VGCC 5JDUB 2BXTH 2CJIA 1LVOA 1HAIH 2ZTZA 2WYGA 2VIVA 1TNLA 4UFFH 2P59A 1DOJA 4A1TA 1XVOA 1MKXK 1BJUA 2HNTF 5SGAE 3BG4C 1SGNE 1OP0A 1WTHD 1NN6A 4IN1A 1KXFA 1AZ8A 2ZTYA 3M3TA 1HRTH 2JH6D 1UVTH 1EQ9A 2ZPSA 4FU8A 1NY22 2ZGCA 3BG4B 1QBOA 4ISIH 2TRMA 1DWEH 4ZUHA 3PWCA 3EAJA 2OD3B 2J92A 1XMNB 3K65B 3PMAB 1YPKH 1F0UA 1PPEE 4K69A 4DURA 3F9FA 2QCYA 3UNQA 1FIZA 5T6GA 4AFZA 2AMQA 2P3TB 1UTOA 4GVUA 3TK6A 3SBKA 1AMHA 3MMGA 5ABWA 2ZG0H 3F1SB 1O3EA 1C4U2 1TQ7B 3MI4A 1G3CA 4MTBA 1G3DA 1BMAA 1CBWC 1DWBH 4IBLH 1OYTH 4E06H 2WPLS 3GCOA 1C1TA 1FPHH 2GV6A 2W7UA 2FOAA 2GKVE 3GY8A 1DY8A 4NA7A 2BY6X 3ZZ7A 4B71A 3VB6A 3RXFA 4SGBE 3UOPA 1O2UA 1O2JA 2GDEH 4Z6AH 1SGPE 4SGAE 1O2WA 2FP7B 5GIBA 1HIAB 1OSSA 3BG8A 5LPRA 1P2IA 2OTVA 2G4TA 3A7VA 4ABIA 2OP9A 3O8RA 1BOQA 3IITA 4XOJA 4TWWA 1O3NA 1THSH 5JPMH 2ODPA 2SGDE 3D49H 2BD8A 4ZXXH 1GJ7B 2ZU3A 2EI7A 3B9FH 3ZZ9A 1GJ6A 1DWDH 3GY4A 2RCEA 4ZHLU 2EA3A 1L1GA 2HVXA 3PLPA 2AFQB 1FUJA 1HAXB 3M3VA 1PPCE 2ILNA 4Y11E 3VB3A 2GCHF 2F91A 1BMNH 4FUIA 5EQRA 2VIQA 1L0ZA 1RTKA 1HJAB 2J95A 3Q3KA 3VB4A 5C3NA 2ZGBH 2ZFSA 3NZIA 2A32A 2F83A 2H9TH 2UWPA 5EODA 1TWXB 1SLVB 2VVCA 2BD7A 3S9CA 3A7ZA 3ELAH 1ZLRA 4LZ4B 1CE5A 3Q3XA 2ZDNA 1D3DB 2ALVA 3T26A 2IJOB 1YCPM 4IN2A 1KDQB 3BTWE 3V0XA 5FXLA 3RXCA 3PB1E 4IMQA 1J15A 2V3OH 4AX9H 2Y6TA 3O8DA 4YOJA 1WTGH 5JBAS 4MPUA 1TALA 4X8TH 1KXAA 2VGCC 1MQ6A 3SUDA 1W3CA 2F9OA 3BTDE 4MG3A 1AI8H 3P8OA 1A7SA 1IQJA 1EX3A 4NIVA 1P3CA 2ANYA 3MH5A 4BAMB 3BTFE 1AVWA 1ELAA 2ANMH 4Y0ZE 1FIWA 1P06A 3EA9A 5AFZH 2ZPQA 3QK1A 2BDGA 3L3TA 1AD8H 2HNTE 4AN7A 2W3IA 2VIWA 2A5AA 4WMDA 4Q7ZA 2SGEE 3LIWA 1WCZA 2BY8X 3M3SA 3ESTA 1O2XA 2H2ZA 1Y3VA 1EZQA 4DCDA 5AF9H 2V3HH 5HM9A 7LPRA 1QFKH 5EPYA 2ZFPH 5C67A 1BRBE 1DXWA 1ZJKA 5L2YH 4D9QA 1LVMA 5DP5A 3KIDU 1ESAA 4YT6H 4JYVH 1TBZH 1C9PA 1NU9A 3U8OH 4K1SA 3M7UA 1A5IA 3RC6A 3D23A 1XM1A 1SGIB 4RN6A 1TPOA 1B0EA 2ZWLH 5A0BA 4AOQA 2XCNA 1DICA 2H9EH 1ZTJA 1O3AA 1QL8A 1SR5C 5G4BA 3S69A 1XUFA 2AIPA 4J2YB 3OX7U 1F0SA 4GCHG 2P8OB 1QBNA 2FOHA 4K1TA 4Y71A 2ZFTA 4Y7BA 4KKDA 1KYNA 2ZHWH 1QR3E 1CHGA 2DE9A 3HGNA 3G01A 4JZIA 4TPYA 2FI5E 2PGBB 1IQHA 1GHYH 2A4OA 1G2MA 1D4PB 3RM0H 4JZDH 4MDSA 3PTNA 3ZZ8A 3LGVA 4K3JA 4CRFA 2W5EA 1FJSA 1NFWA 2QV1A 4TWYA 3UY9A 1O3HA 3U8TH 4NSYA 1V2LT 3IWMA 1MQ5A 3U8RH 2BVSH 3RU4E 4I8JA 2Y80A 4OS2A 2ANKH 2ESTE 1EZXC 4FVBA 1VITG 1YPHE 1C1OA 1L2EA 2ZDLA 2ALPA 1RTFB 2ZGJA 1K1MA 1VCQA 2OC8A 3AASA 1VCPA 3BEFB 1Z8RA 4NIYA 4U01A 3A8CA 1OWKA 1C5VA 1E34B 2B5TB 1QRWA 2FOBA 3ZVBA 2QXHA 1TIOA 5E0HA 1A61H 4I8GA 1C2IA 2BD9A 3SNAA 2Y5FA 2G55A 5DP8A 1KLIH 3RXHA 1FAKH 1T8OA 4D7GA 1S0QA 3U69H 2HOBA 3L6PA 4XBBA 1O2QA 1GBDA 1KSNA 4Y76A 1TA6A 4K1EA 2HGTH 1K1PA 3RDZA 2ZQ1A 2QN5T 2JH0D 3SU5A 1SHHB 4F49A 1Y5UT 4OS7A 1BTYA 1PJPA 1C5WB 4NWLA 3T27A 1SVPA 1VR1H 3MNBA 1ELGA 2BQ6B 2FO9A 2QY0B 3F9GA 3FAOA 3QZRA 2F9UA 2A45B 1CHOG 5GDSH 3LONA 2KAIA 1FY1A 2BY7X 3RXMA 2P16A 4ZROA 2A4GA 1ETSH 2Y5GA 2FZZA 1L4ZA 1HXFH 2GCTC 4X6OA 1ELDE 3SJIA 3SOSA 2BM2A 2DE8A 1ZRKA 4YOIA 1HAPH 4Q7XA 2ZO3H 2CGAA 2ZCLP 1H1BA 1MKXH 4YTAA 1C2DA 3R0FA 2BD3A 2AMPA 1FY4A 1ANBA 2J9NA 2GCTB 1DWCH 1EAUA 3KGPA 3F6UH 4BANB 3DFJA 3SHAH 1RGQA 3LPRA 4UFGH 2NU2E 2WPMS 2ZP0H 1O38A 4HTCH 1GI1A 1XUJA 3K9XB 1MMJN 1O2RA 2BDAA 1O35A 2VVVA 1PPGE 3NXPA 4R0IA 4BTUB 1SPJA 1KLTA 4OS4A 1K9OE 1SLUB 3RXAA 4B2BA 4TYDA 4M7GA 1SGTA 1OXGA 3T25A 1ELFA 1C2EA 4GLYA 1T8MA 2J38A 2AH4X 2PKSC 1LKAA 2BZ6H 1AVXA 4CHAC 4XDEA 4F4OC 2Q1JA 2C8XB 2CN0H 3E0PB 2A4RA 1UCYE 1ZTLA 3UNSA 4K8YA 2ZPRA 1P05A 3TU7H 4BXSA 1ID5H 3RXUA 4WH6A 4RKJB 3SJKA 1HJ9A 1N6XA 2PV9B 3SV8A 3KCGH 1BHXB 3NCLA 1TPSA 4CBOA 3BSQA 4ABGA 1HDTH 1LVBA 1ZSKA 5DK1A 4CRCA 2BB4A 1O5AB 1MKWH 1SGFA 5I25A 1OP2A 3ZV9A 1DDJA 3DD2H 3FP6E 3RXVA 1CT2E 1P01A 2TBSA 1QB1A 4BAKB 3GICB 3IG6B 3MNXA 3RXKA 2ZFFH 3E16B 1GBAA 4Y6DA 1TOMH 1FN6A 2BLQA 1GGDB 1DY9A 1WSSH 1UTNA 1B0FA 1TPAE 1P57B 1TPPA 1Q31A 1WQVH 4YOGA 5TCAA 2RA3A 4BAQB 1HAYB 1LDTT 1AFEH 2YOLA 3QZQA 4Q80A 2UWLA 1O36A 2OC1A 2V6NA 2ZHQH 3TK9A 1O2PA 1AQ7A 3HKJB 1C5MD 5F03A 3TGKE 1BRUP 1RRKA 3A87A 1RTLA 1ANCA 4AB9A 1A2CH 2WUBA 1V2OT 4AORA 1S5SA 4NCYA 2BX4A 2GD4B 1NPMA 3ZVFA 2VIPA 1F5KU 1GBLA 1GMDF 1K1OA 3TJOA 4O3UA 1GCTC 1KTSB 2AGIX 1ANEA 1MZAA 1PYTC 3UWIA 4XE4A 1WBGB 3BTKE 1O3BA 2TGPZ 1NROH 2GV7A 4A1VA 5LPEA 2UWOA 4Q2KA 3H7TA 3BTQE 5A0CA 5DP6A 1AB9C 3MTYA 1D6RA 1WUNH 2BY9X 2J94A 1O2MA 3P17H 5FHTA 2CV3A 1KIGH 2QXIA 3MO6A 5GJ4B 2AMDA 2GZ9A 1KLJH 2Z7FE 1A3BH 3P70B 2Z3EA 4Y8XA 1C1QA 3Q3YA 3CS7A 4WMEA 2EC9H 2VH0A 3A8DA 2FOMB 1C5LH 1C5TA 5FAHA 1E38B 1H9LB 1TAWA 5JYIA 2VJ1A 5E2PA 2A5IA 2D1JA 2G81E 1Z6EA 3SU6A 1GJDB 3GY6A 2IPHA 4UFEH 2XC5A 3T29A 1UTQA 2WV5A 1NU7B 1LCYA 3KQCA 2XNIA 1P2KA 3GY3A 2BD5A 3U1JB 1S84A 2CF8H 1ZR0A 3OY6U 2EI8A 3OY5U 1NS3A 5A8XA 4KGAA 1QGFA 4I33A 1HV7A 5HYOA 1H4WA 4ZAEA 3RM2H 1XX9A 2I6QA 2ZC9H 1GJ5H 3AW0A 5PTPA 3MOCA 3KQDA 1K21H 4UFDH 4Y8ZA 2TPIZ 1GI4A 1WAYB 1GBIA 3GYMA 4B75A 1ARCA 1E36B 3B23B 1K1JA 2OQUA 3P8FA 2FYQA 5JB8S 1IQNA 2CHAC 4GHTA 3MH7A 1SGEE 1YC0A 4HZHA 1T8NA 3UR6A 1A5GH 2GP9B 1TYNA 3NK8A 2WPJS 1GHAF 1SGFG 2GMTB 2R0LA 2BQWB 2NU0E 2PUQH 1UCYK 1G3EA 5A2MH 3SU0A 1O3OA 3UREA 1C2KA 1GDNA 2XYAA 5EU8A 1BB0B 4ZH8A 3LGYA 3LKWA 3RLWH 1GBHA 1GHWH 4TY7A 2A1DB 3RXOA 4ABJA 1C1PA 1GI3A 3SV7A 7GCHF 1T31A 2PTCE 3I77A 8GCHF 1SGCA 4X2YA 4LK4A 4UD9H 4MPVA 1AIXH 4K2YA 2P3FH 4JYUH 3SNBA 3E6PH 5K0HA 1H8DH 1TGTA 2SGQE 3SUGA 5FX6A 1JRSA 5EQSA 1K1LA 1P9UA 5AFYH 2PUXB 4Q7YA 1BTHH 4JMYA 3M5NA 1S85A 2HWLB 1TGSZ 1YPGH 2GCHG 1AU8A 3E8LA 3ZZAA 4NA9H 1RFNA 1Q3XA 5ESBA 1MZDA 3UFAA 5CE1A 1XKAC 4H6SB 1PPFE 3QGNB 1FPCH 1VGCC 5LH8A 1RJXB 1NC6A 1SB1H 4WMFA 1BJVA 3MH6A 3I29A 4D9RA 3HK6B 4WVPE 2OCVB 1YP9A 1FQ3A 2JH5D 3VEQB 2ZDMA 1DX5M 1VGCB 1VJ9U 4I31A 3CP7A 1OWEA 4GHQA 1QJ6B 1RIWB 2ZFQH 1J14A 1GI8B 1UK4A 2ZGHA 4JCNA 1HAVA 4CBNA 2XBYA 1SG8B 3MYWA 3LJOA 1EOJA 1D3PB 4HI3A 1AZZA 1P10A 1O2OA 1EZUC 5A8YA 2FI3E 4YO9A 3RLYH 4NA8A 3TPIZ 1ZGVA 3SJ9A 1PPHE 5EXLA 2M5TA 1Y5AT 2ZDAH 1HAOH 1EPTA 4IGDA 3BTME 2B8OH 1VZQH 1O3LA 3BV9B 3M35A 2ASUB 3E0NB 4ISNA 1SC8U 3VGCB 1XUIA 1C2LA 1CA8B 2A31A 1SFQB 3QN7A 5HGGA 3C27B 3TVJB 1P2NA 2PGQB 1HJAC 3SJOA 3NKKA 1W14U 4CRGA 2VWOA 3DA9B 5HMAA 3V13A 3VXFH 1YYY1 4CH2B 1BDAA 4NFEA 4DIHH 1ELVA 1C2HA 3BF6H 1O2IA 1QRXA 1C1UH 4ISOA 3RXTA 1AN1E 3PV4A 1Z8GA 1TMUH 1HAHH 1ZRBA 1V2WT 3MHWU 5EW1H 1BQYA 2ZHDA 1UHBA 3A85A 2G00A 2WINI 4UEHH 2C93B 2FIRH 2GT7A 3GOVB 3BTHE 5AVDA 2JKHA 2FPZA 1IQIA 1GWAA 2D8WA 4U30A 1GJ9B 1OPHB 4ZKNU 2BLWA 1S83A 4E7RG 1A0LA 1TNGA 3ZZDA 5C1XA 1BRCE 4HFPB 1F7ZA 1KTTB 1MTWA 2FX6A 1TNHA 1TABE 3EA8A 5F6MA 1Z8IB 1E0FD 1S6FA 1ZMLA 3GCTF 1O3FA 1EP6A 1Y59T 3ZZ6A 1AUJA 1DSUA 1SLXB 1O3PB 1BUIA 1D6WA 1C5RA 4X2WA 4X2XA 3ATMA 3B8JA 4MNYA 4X8VH 2Q6GA 1OOKB 1V2QT 2ULLA 1MAYA 5IYTA 3URCA 1M9UA 3ZZ3A 4DOQA 1KXDA 1O2SA 1PQ5A 1TA2A 1MTSA 1ZHMA 5C5NA 3HKIB 1SLWB 1PQ7A 3C1KA 1DT2A 3BIUH 3MFJA 1T8LA 1JBUH 3EA7A 1GG6B 3O8CA 4AB8A 1N1LA 2ZNKH 2SGPE 3T28A 2Z94A 3PO1B 1LKBA 3M5OA 1G36A 1K28D 1QB9A 3RMMH 2F3CE 1C2FA 3PMBB 1W12U 2AS9A 5DPAA 5GCHF 3GYLB 3LJJA 2A2QH 4ABEA 2ODQA 1SBWA 1GBJA 1JOUB 4MNWA 4A7IB 1A0JA 2P8OC 1LHDH 1CSOE 4ISLA 5K7RA 4TPIZ 1O2GH 4H6TA 3A84A 3EE0B 1SGYE 3BTEE 1HJ8A 2ZDVH 3SORA 4MLFB 2C8ZB 4Y8YA 1NM6A 4FUHA 3DUXH 3KQBA 1TNKA 1UTMA 1GMHF 1O3JA 1ZZZA 1GJCB 1XUKA 3TITA 2FI4E 4CREA 1F5LA 4K5ZA 1KXBA 3MO3A 4NIXA 1DVAH 4WH8A 1GI7B 2GZ8A 4I8HA 1FDPA 1XKBC 4KELA 1IAUA 3VXEH 1BBRE 3RXRA 4B2AA 2G5NA 3UNRA 1TONA 2GX4A 8LPRA 1O32A 4X1QU 1J8AA 3H5CB 3JZ2B 1O5BB 2FLRH 1ZSJA 1LMWB 1W2KH 1O5EH 1Y5BT 5IDKA 4GPGA 1MU6B 1EKBB 1MCVA 1BTPA 3NUMA 1OP8A 5A09A 2THFB 3LC5A 2EI6A 2Z9IA 1GVLA 4Y0YE 2AYWA 2O8UA 5A8ZA 2Y7XA 1Z8JB 3ZZ5A 2VB0A 1PYTD 2AEIH 3BN9A 4FXGH 1QCPA 3I78A 4IMZA 2WPKS 5DP4A 1TX6A 3PLBA 1P8VC 5FBEA 1IQEA 1C5XB 4ZKOU 1OX1A 1TX8A 1YPEH 2LNCA 3F9EA 2O8WA 4NZLA 2ZQ2A 1O5FH 6CHAB 3RC4A 2Q6DA 3OYPA 3ZZBA 4QT8C 3UR9A 2XXLA 3M5MA 3MNSA 3RMOH 1XVMA 3PLKA 4AFUA 1PQAA 1C1WH 1INCA 4AYVB 3RXEA 1CT0E 3TJUA 2VIDA 3BIVH 3OSYA 5EQQA 6GCHG 3GCHC 1HCGA 2YNBA 2NWNA 2V35A 1QB6A 5JBCS 3TNTA 1E37B 2SGFE 5JBBS 1O5GH 1IHTH 1GMCG 2C3SA 1C1RA 3OU0A 1LHCH 1DFPA 1QQUA 1SGDE 3GCHB 4GCHF 3RXSA 1C5ZB 3QLPH 1H8IH 5FCRA 1QNJA 3SNEA 1IHSH 2TGAA 1UCYH 2C8WB 4A5TS 5DJ7A 4CRDA 3PROA 3PWBA 4RKOB 2PWXA 2W3KA 1D3QB 1NFXA 3W94A 2ZTXA 4O9VA 3MU8A 2WPIS 1CVWH 1SQAA 3KF2A 2FOGA 4WXIA 5FX5A 4AZ2B 5FCKA 2HRVA 1HLTH 1DLEA 2JETB 4NIWA 3CENA 1JIMA 2CF9H 3MU4A 4BTTB 1ABJH 5ETXA 3M37A 3RC5A 1MBQA 5F8TA 3F68H 4INKA 1P03A 3MO9A 4WF8A 1GJAB 1L4DA 1O5CB 1NFYA 3RUOA 1LO6A 4AFSA 3SU3A 1GI6A 1N6YA 1P02A 4AGKA 4YLUA 3ITIA 1CO7E 5DO4H 2KAIB 2AIQA 3PYHA 4NGAH 1TGCA 1BITA 2XC0A 1DUAA 1FNIA 3A80A 4E05H 3A8AA 1N8OC 2HNTC 5TJXA 1GDQA 3UWJH 1QBVH 2PFEA 2Z3DA 4I7YH 1EASA 1CQQA 1IQGA 5JBTA 3ZYEA 1NTPA 3A7TA 3GY2A 1N8OB 3OTJE 4ASHA 1GMDG 1EUFA 1MTNC 4K60A 3TJNA 2WUCA 5TCCA 1S81A 1ZTKA 2F9NA 1G3BA 2GT8A 4MNVA 7KMEH 2A5KA 3RMNH 2RA0A 3SGAE 1MTNB 4FVDA 1P2QA 4MQAA 1NESE 4XBDA 1NRNH 1QQ4A 3GDUA 3O8BA 5DP7A 3P92A 3MU5A 1W7GH 5AHGH 1HPGA 4A92A 4NWKA 3RXQA 2ZEBA 3Q00A 2B7DH 2ZI2H 1GGDC 1BZXE 3RMLH 3STJA 1YPMH 3SGQE 2QAAA 2BOKA 5B6OA 2BXUH 1ZOMA 4THNH 3TLOA 1MAXA 1QURH 1PFXC 5C20A 1BBRK 1QJ7B 1W10U 1ORFA 1VITH 2Y82A 2ZF0H 3T62A 5BRRE 2ZU1A 1ANDA 3M7QA 3P8GA 4FUFA 7ESTE 1TFXA 3MH4A 1GCDA 3P8NA 2BX3A 4DVAU 2QYIA 3KEEA 1OYQA 2RDLA 1P0SH 1QA0A 3SNDA 2Z9KA 3ODDA 1FMGA 2BMGB 2FS9A 1C2JA 1FONA 2BDHA 4UDWH 1C1SA 2GTBA 3SGBE 1F5RA 1GVKB 1A4WH 3VB5A 3LGTA 4O3TA 2Z3CA 1A5HA 2G8TA 3AVZA 1AE5A 1B5GH 5DP9A 1IQLA 1GHBF 2A7CA 1XUGA 2EEKA 1YPHC 2FM2A 4JZEH 2ZIQH 4X0WU 1ELTA 1P04A 3L33A 4LZ1H 2D26C 5C1UA 3UQOA 1CT4E 4D76A 4IW4E 2BLVA 4O97A 2F9PA 1X7AC 1ZYOA 3SU4A 2CXVA 5EOKA 1T7CA 1GHAG 1TMTH 1O3IA 1QY6A 1BIOA 4XBCA 2BY5X 1UJ1A 1W8BH 1JXPA 2SGAA 1LQEA 1GL1A 2ZECA 1LPKB 2VNTA 3LC3A 1C2GA 1YLCA 3K6YA 3TK5A 1YGCH 4INLA 3E91A 4AG2A 7GCHG 1GBKA 1BMLA 2QXGA 4Y7AA 3MWIU 1C5PA 8GCHG 1C5OH 1KXEA 2J2UA 2G52A 3DFLA 3DT0H 1GHXH 4BOHA 2QGRA 3N7OA 1NRPH 1NRQH 1W11U 5CHAC 1QL9A 4AGJA 1SQTA 3RXPA 2FOFA 1P11E 2XW9A 2J34A 2VWNA 1O39A 2B0FA 5CHAB 1Y3XA 2A4QA 1MBMA 1O2YA 1C5NH 1Y3YA 1O2KA 1GBFA 2NU3E 1YF4A 2UUKB 1FY3A 1TE0A 1IQKA 2FLBH 1YKTA 4RSPA 1AKSA 4KP0A 5CMXH 1UVUH 1MTUA 1ZMNA 1ESBA 3UQVA 5EXMA 4CR9A 1TNJA 4X8SH 9LPRA 1EJMA 1S6HA 2G51A 2ZU2A 1NFUA 3QWCH 2HLCA 2GMTC 5I46H 2O8TA 1HGTH 1W0ZU 5HXFA 4A1XA 1YPLH 1Y3UA 1O2LA 1HUTH 3K6ZA 1ZPZA 2XRCA 2PTNA 1EP5A 1DITH 1DANH 1O2NA 1FLEE 1WV7H 4KTCA 1HAZB 1WU1A 3VPKA 3A8BA 4BTIB 3T2NA 2QIQA 4DY7B 2XCFA 1FY5A 2LPRA 5HM2A 1QJ1B 1V2NT 2DUCA 3UTUH 1ZHRA 1Z1IA 3BTGE 2R9PA 1NZQH 2BDYA 3PMJA 2K1QA 3S7HB 4X2VA 1AE8H 5DG6A 5ESTE 8KME2 4JZ1A 2Z9GA 2OINA 4DIIH 2Z9JA 1FI8A 3UIRA 1W0YH 2P3UB 3SI3H 2BVXH 1OS8A 3ZVDA 2VWLA 3ZVAA 2SFAA 1WQSA 1JRTA 2P93A 3VFEA 4VGCB 1OWHA 3EYDA 1U6QA 5LPFA 1GBBA 5H4IB 1EZSC 2OC0A 3A7WA 3R3GB 3V7TA 3BTTE 1Z1JA 1BHXF 4JK6A 4MVNA 1BMMH 1RS0A 3SO3A 1QRZA 1RIWC 2W26A 4OS5A 2XWBI 2OC7A 3CS0A 1ESTA 3HATH 3S7KB 1AY6H 1HIAA 1SHYA 2BHGA 2FX4A 3BEIB 2XBVA 1V2RT 1GVZA 2OQ5A 4OS1A 2BZAA 3RU4T 5FPTA 4B73A 3S9BA 4B2CA 4J1YA 4BNRA 3KNXA 5DGJA 3GCTG 2FTMA 1WYKA 3ZV8A 4MPXA 2FEQH 5C1YA 2BYAX 3NWUA 3SV6A 3AAVA 1IQMA 4Y10E 3VGCC 4WXVA 1SI5H 3U98H 2BTCE 2VU8E 2ZKSA 3PTBA 3SQEE 2OBOA 1T32A 3H7OA 2TIOA 3RXJA 1QL7A 3GCNA 1CBWB 1TQ0B 1OWIA 1PPBH 4ZHAA 4OS6A 3EDXB 1ETRH 4WJG2 1MKWK 3SZNA 5E8EH 1JIRA 3M36A 3F9HA 4UONA 1A46H 3LGIA 5T6FA 1QHRB 3LH1A 2TGTA 3A88A 2FDAA 1ETTH 4IC6A 5FBIA 1HAVB 3K2UA 1L1JA 1FY8E 1EPTC 3RXGA 1P2JA 5GCHG 4ZHMU 1KDQA 1L1NA 2G4UA 1Y3WA 1MTVA 4BAOB 1C1VH 3HGPA 1F0RA 3A86A 2Y5HA 5C5OA 1C4V2 1SMFE 1EPTB 2PSXA 4Z0KA 2XBXA 4DJZB 3QUMP 1O30A 1AUTC 1TBRH 2P94A 1EAWA 4ABFA 5GXPA 2TGDA 1EATA 4FUGA 1GMHG 1MCTA 1UTLM 2G5VA 2FXRA 2O8LA 1EXFA 1W7XH 2NU4E 1GDUA 4ZMAH 4X1PU 5L30H 5A0AE 1CGHA 1UHBB 2QF0A 1QA7A 1G2LA 4YT7H 3EGKH 1C1NA 4KTSA 1GPZA 4LOYH 3RXLA 3AW1A 1GG6C 1AHTH 1OKXA 3FVFB 1AGJA 2ZGXH 2J4IA 3Q76A 3PO1C 1O2ZA 4X1SU 4H42U 1J17T 4LXBH 4U2WA 1C5YB 2ZFRH 1PQ8A 3SU1A 3A81A
chains in the Genus database with same CATH superfamily
4X1NU 1GI9B 1HFDA 2FODA 1A1RA 2VGCB 1FN8A 4AFQA 1BMFD 4JYTA 4DGJA 1BBRH 4ZKSU 2Y7ZA 4AG1A 1O2TA 1V2VT 1IOEA 1O3GA 1UK2A 1AWFH 3SNCA 4JZFH 2FMJA 5GWZA 2B9LA 1UTJA 4CR5A 4OGXA 3SUEA 3UAIC 4BAHB 4WY3A 1YCPK 1BRAA 1MD7A 2A0QB 1ZGIA 1O5DH 1H9HE 3SYJA 3ZYDA 3EE7A 3WY8A 1O2HA 3ATKA 3GISB 1UW7A 1V2KT 4FU9A 3ZVEA 3TH4H 1C1MA 2ZU4A 3AAUA 1DM4B 1SQOA 1S82A 1V2ST 6LPRA 3JZ1B 1TRNA 1J16A 2VIOA 5EG4A 4NSVA 1T4UH 4IS5A 5C94A 1OWDA 1EOLA 2C4FH 4ESTE 1CGJE 2PR3A 5E2OA 5EXNA 5L2ZH 5GPIB 1V6DA 3QGJA 2FYRA 2HLDD 2QC2A 2HPPH 4U32A 1G30B 1VKYA 1SOZA 1O3DA 1AO5A 2XC4A 1BTZA 4AYYB 3W95A 1SOTA 1K2I1 1TMBH 1DS2E 3A89A 2ZCHP 3PM3A 1D9IA 2H5DA 1HYLA 4DT7B 4H4FA 1DLKB 2QXJA 1G32B 1XXFA 1DE7H 4X1RU 3RU4D 2Z9LA 4BXWA 4X6NA 4XFQA 5E0JA 1WOFA 2PW8H 1UO6A 2VINA 2C8YB 1W0JD 2GZ7A 1F0TA 1HB0B 1Z6JH 4PROA 1UVPA 2WYJA 1HNEE 4I8LA 2WV4A 1ABIH 1TOCB 2STAE 4TY6A 1LHGH 1DSTA 2VH6A 1NRRH 3A83A 6CHAC 1BTXA 1P2MA 1BTUA 2GGVB 2FTLE 1DXPA 2UUFB 3PV2A 2A7JA 1PPZA 2BDIA 2CMYA 2J5UA 4X8UH 1GI2A 3LT3A 1O31A 3QDZB 4CRBA 3S0NA 3BEUA 2VVUA 1BCUH 1TX7A 1GJ8B 1HAGE 2FWWA 3OFND 1UVSH 3QX5H 1F92A 4FUCA 2V0BA 3RXIA 5JB9S 3ENSB 1TNIA 1OWJA 3D62A 4YESB 1TLDA 3ZZ4A 3ZVGA 1A0HB 4JK5A 4GSOA 1RXPA 4DW2U 1MU8B 2OK5A 4E7NA 1AVGH 1EAXA 1MH0A 3QO6A 2FOCA 2R3UA 1FZZA 3PRBA 1AFQC 1O3MA 1ZSLA 4I32A 1ZHPA 2L6OA 2H6MA 3MU1A 2F9BH 3GDVA 1LQDB 3T5FH 2FESH 2JETC 1Z7KA 1SL3A 1XXDA 1O3KA 3M7TA 5J4QA 1SSXA 3N7EA 1V2JT 4ACAA 1AFQB 1VCWA 1HBTH 3LU9B 4YLQH 1C5SA 2GVFA 2VWMA 4X6MA 3H09A 1EB1H 1SGRE 3GDSA 3ATLA 2XBWA 2RG3A 3FZZA 2H5CA 4INHA 2QF4A 2BD2A 2BLOA 2D2DA 3RP2A 3FFGA 4DG4A 2OUAA 4A6LA 1ARBA 4HGCA 4B1TA 2STBE 2SNVA 1O37A 1GL0E 3NRLA 1P9SA 3U9AH 8ESTE 1VITF 1BA8B 4XSKU 3SW2B 2R3YA 3GY5A 3ZZCA 3GY7A 2A2XH 3Q77A 2Y81A 1UMAH 1C5UA 5DKMA 3SV2H 1TBQH 3VG8A 1V2UT 1ZPBA 2YNAA 3E3TA 3EQ0H 2O8MA 1BTWA 2IOTA 2PLXA 5EGMA 2BOHB 3LOXA 1ELCA 1FXYA 2NU1E 4M9FA 4YM9A 1GHBG 2FOEA 1V3XA 3TGJE 2PSYA 4WWYA 1K1NA 4B76A 1LTOA 5J4SA 5LGOA 4D7FA 1UTPA 2W7SA 1MUEB 4NG9H 1FV9A 3PV5A 4FUDA 4ABAA 4IC5A 2YMSD 4MPWA 2AHME 4FUBA 1GJ4H 1TRMA 5HKKD 1GHVH 1GI5A 1Q2WA 6GCHF 1C2MA 2Q6FA 1P09A 1THRH 3SI4H 3LGWA 4D8NA 5T3HA 3FKSD 3UUZA 2PKSB 4CH8B 1UK3A 5F8ZA 2BQ7B 4CHAB 1K1IA 3ATWA 1VJAU 5E0GA 1GMCF 1UVOA 3F0OA 5C17A 2ZCKP 4KTUA 3ZIAD 1TB6H 4B74A 3TIUA 1LPZB 2PKAA 1BT7A 1CHOF 3FANA 1LHEH 1ZPCA 3A7YA 3LDXH 3ZVCA 1EB2A 1YBWA 1KY9A 6ESTA 5FPYA 4FOUC 4ZXYH 1LPGB 1XUHA 1YPJH 3P95A 1TGNA 4GUXA 1E35B 1O34A 3KL6A 2FS8A 2OXSA 3RXDA 3HK3B 1O3CA 2ZZUH 2SNWA 1GBEA 4FU7A 1H9IE 1NO9H 2ZHFH 2Z6BD 1EAIA 5BPEA 2F9VA 1QIXB 3FP8E 3ATIA 1Z71A 1JWTA 1ZMJA 4MNXA 1CGIE 3PMHB 4ABHA 1YM0A 2PKAB 3S9AA 2PHBA 1D3TB 3VB7A 4CRAA 1C4Y2 2BDCA 1SFIA 2R2MB 1SGQE 3A7XA 1TRYA 2UUYA 3QTOH 1LVYA 1NT1A 2IN2A 1W13U 2C90B 4ZKRU 3QTVH 3N7DA 3UPEA 2ANWA 2V7QD 3SN8A 2QF3A 5HIYA 3OAAD 1EJNA 4K8BA 1C5QA 4FUEA 3UOUA 2BVRH 3SUFA 3TH3H 1C9TA 2I6SA 4X6PA 9ESTA 1P12E 1ELEE 2AGGX 4UE7H 2ZU5A 5L6NH 1O2VA 2ZDKA 2ZA5A 1MD8A 1CA0C 3FZDA 4Y79A 2GDDA 5F8XA 1P3EA 4ISHH 3U28C 2A7HA 2P95A 1GBCA 1GCTB 2OLGA 4ABDA 4Q4LA 3TH2H 1QTFA 4NFFA 1JMOH 1K22H 2O9QA 2OBQA 3URDA 1CA0B 1P2OA 3SJ8A 3D65E 3TJVA 3NPSA 2AGEX 1AB9B 1FAXA 1S0RA 4NZQA 1V2TT 4GAWA 1DPOA 1O33A 3E1XB 5FPSA 1J9CH 3ODFA 5CHBA 5C2ZA 1GHZA 4ABBA 1LHFH 3KHVA 1YCPH 1GBTA 4FUJA 2R2WU 2QA9E 1HXEH 2HPQH 1GBMA 3V3MA 2R0KA 4O03A 3E90B 1RD3B 3GS9A 3MU0A 3SQHE 1V2MT 2H9HA 3RXBA 3LH3A 1KXCA 3TGIE 2ODYB 2BD4A 3M61U 1NRSH 1DUEA 4R8TB 3P6ZB 1V2PT 1AWHB 1GI0A 3KN2A 1CU1A 1G9IE 5EW2H 2HALA 4I8KA 1B7XB 3TNSA 3HPTB 3LGUA 3STIA 2ZHEH 4OGYA 2XTTB 5C0TA 3M5LA 2H1UA 1ZJDA 1O0DH 3A82A 4YZUA 3MNCA 5EPNA 2AERH 3FP7E 1THPB 3SU2A 1ACBE 1T4VH 2WPHS 1IQFA 3SHCH 1AKSB 1F2SE 1G37A 5T6DA 3SV9A 1UTKA 1A3EH 1TGBA 2CHAB 3DHKH 1GJBB 2XWAA 1ELBA 1EJAA 2BDBA 3U1IB 3WWBA 5DP3A 1Y8TA 4RI0A 2UUJB 3V12A 3KQEA 1YLDA 4VGCC 5JDUB 2BXTH 2CJIA 1MABB 1LVOA 1HAIH 2ZTZA 2WYGA 2VIVA 1TNLA 4UFFH 2P59A 1DOJA 4A1TA 1E1RD 1XVOA 1MKXK 1BJUA 2HNTF 5SGAE 3BG4C 1SGNE 1OP0A 1WTHD 1NN6A 4IN1A 1KXFA 1AZ8A 2ZTYA 3M3TA 1HRTH 2JH6D 3KQ5A 1UVTH 1EQ9A 2ZPSA 4FU8A 1NY22 2ZGCA 3BG4B 1QBOA 4ISIH 2TRMA 1DWEH 4ZUHA 3PWCA 3EAJA 2OD3B 2J92A 1XMNB 3K65B 3PMAB 1YPKH 1F0UA 1PPEE 4K69A 4FETA 4DURA 3F9FA 2QCYA 3UNQA 1FIZA 5T6GA 4AFZA 2AMQA 2P3TB 1UTOA 4GVUA 2KCYA 3TK6A 3SBKA 1AMHA 3MMGA 5ABWA 2ZG0H 3F1SB 1O3EA 1C4U2 1TQ7B 2K0QA 1G3CA 3MI4A 2KX4A 4MTBA 1G3DA 1BMAA 1CBWC 1DWBH 4IBLH 1OYTH 4E06H 2WPLS 3GCOA 1C1TA 1FPHH 2GV6A 2W7UA 2FOAA 2GKVE 3GY8A 1DY8A 4NA7A 2BY6X 3ZZ7A 4B71A 3VB6A 3RXFA 4SGBE 3UOPA 1O2UA 1O2JA 2GDEH 4Z6AH 1SGPE 4SGAE 1O2WA 2FP7B 5GIBA 1HIAB 1OSSA 3BG8A 5LPRA 1P2IA 2OTVA 2G4TA 3A7VA 4ABIA 2OP9A 3O8RA 1BOQA 3IITA 4XOJA 4TWWA 1O3NA 1THSH 5JPMH 2ODPA 2SGDE 3D49H 2BD8A 4ZXXH 4B6FA 1GJ7B 2ZU3A 2EI7A 3B9FH 3ZZ9A 4F55A 1GJ6A 1DWDH 3GY4A 2RCEA 4ZHLU 2EA3A 1L1GA 2HVXA 3PLPA 2AFQB 1FUJA 1HAXB 3M3VA 1PPCE 2ILNA 4Y11E 3VB3A 2GCHF 2F91A 2L74A 1BMNH 4FUIA 5EQRA 2VIQA 1L0ZA 1RTKA 1HJAB 2J95A 3Q3KA 3VB4A 5C3NA 2ZGBH 2ZFSA 3NZIA 2A32A 2F83A 2H9TH 2UWPA 5EODA 1TWXB 1SLVB 2VVCA 2BD7A 3S9CA 3A7ZA 3ELAH 1ZLRA 4LZ4B 1CE5A 3Q3XA 2ZDNA 1D3DB 2ALVA 3T26A 2IJOB 1YCPM 4IN2A 1KDQB 3BTWE 3V0XA 5FXLA 3RXCA 3PB1E 4IMQA 1J15A 2V3OH 4AX9H 2Y6TA 3O8DA 4YOJA 1WTGH 3KYFA 5JBAS 2WHXA 4MPUA 1TALA 4X8TH 1KXAA 2VGCC 1MQ6A 3SUDA 1W3CA 2F9OA 5IK2D 5EIYA 4OM9A 3BTDE 4MG3A 1AI8H 3P8OA 1A7SA 1IQJA 1EX3A 4NIVA 1P3CA 2ANYA 3MH5A 4BAMB 3BTFE 1AVWA 1ELAA 2XOKD 2ANMH 4Y0ZE 1FIWA 1P06A 3OTPA 3EA9A 5AFZH 2ZPQA 3QK1A 2BDGA 3L3TA 1AD8H 2HNTE 4AN7A 2W3IA 2VIWA 2A5AA 4WMDA 4DT4A 4Q7ZA 2SGEE 3LIWA 1WCZA 2BY8X 3M3SA 3ESTA 1O2XA 2H2ZA 2V3MA 1Y3VA 1EZQA 4DCDA 5AF9H 2V3HH 5HM9A 7LPRA 1QFKH 5EPYA 2ZFPH 5C67A 1BRBE 1QZ8A 2JDID 1DXWA 1ZJKA 5L2YH 4D9QA 1LVMA 5DP5A 3KIDU 1ESAA 4YT6H 4JYVH 1TBZH 1C9PA 1NU9A 3U8OH 4K1SA 3M7UA 1A5IA 3RC6A 3D23A 1H8HD 1XM1A 1SGIB 4RN6A 1TPOA 1B0EA 2ZWLH 5A0BA 4AOQA 2XCNA 1DICA 2H9EH 5EJ1A 1ZTJA 1O3AA 1QL8A 1SR5C 5G4BA 3S69A 1XUFA 2AIPA 3DSGA 4J2YB 3OX7U 1F0SA 4GCHG 2P8OB 1QBNA 2FOHA 4K1TA 4Y71A 2ZFTA 2WV9A 4Y7BA 4KKDA 1KYNA 2ZHWH 1QR3E 1CHGA 2DE9A 3HGNA 3G01A 4JZIA 4TPYA 2FI5E 2PGBB 1IQHA 1GHYH 2A4OA 5F53A 1G2MA 3OEHD 1D4PB 3RM0H 4JZDH 4MDSA 3PTNA 4B6EA 3ZZ8A 3LGVA 4K3JA 4CRFA 2W5EA 1FJSA 1NFWA 2QV1A 4TWYA 3UY9A 1O3HA 1S6LA 3U8TH 4NSYA 1V2LT 3IWMA 1MQ5A 3U8RH 2BVSH 3DCLA 3RU4E 4I8JA 2Y80A 4OS2A 4Z1MD 2ANKH 2ESTE 1EZXC 4FVBA 1VITG 1YPHE 1C1OA 1L2EA 2ZDLA 2ALPA 1RTFB 2ZGJA 1K1MA 1VCQA 2OC8A 3AASA 1VCPA 3BEFB 1Z8RA 4NIYA 4U01A 3A8CA 1OWKA 1C5VA 1E34B 2B5TB 1QRWA 2FOBA 3ZVBA 2QXHA 1TIOA 5E0HA 1A61H 4I8GA 1C2IA 2BD9A 3SNAA 2Y5FA 2G55A 5DP8A 1KLIH 3RXHA 1FAKH 1T8OA 4D7GA 1S0QA 3U69H 2HOBA 3L6PA 4XBBA 1O2QA 1GBDA 1KSNA 4Y76A 1TA6A 4K1EA 2HGTH 1NBMD 1K1PA 3RDZA 2ZQ1A 2QN5T 4XD7D 2JH0D 3SU5A 1SHHB 4F49A 2W6ID 1Y5UT 4OS7A 1BTYA 1PJPA 1C5WB 4NWLA 3T27A 1SVPA 1VR1H 3MNBA 1ELGA 2BQ6B 2FO9A 2QY0B 1FX0B 3F9GA 3FAOA 2F9UA 2A45B 3QZRA 1CHOG 3FN8A 5GDSH 3LONA 2KAIA 1FY1A 2BY7X 3RXMA 2P16A 4ZROA 2A4GA 1ETSH 2Y5GA 3MQKC 2FZZA 1L4ZA 1HXFH 2GCTC 4X6OA 1ELDE 3SJIA 3SOSA 2BM2A 2DE8A 1ZRKA 4YOIA 1HAPH 4Q7XA 2ZO3H 2CGAA 2ZCLP 1H1BA 1MKXH 4YTAA 1C2DA 3R0FA 2BD3A 2AMPA 1FY4A 1ANBA 2J9NA 2GCTB 1DWCH 1EAUA 3KGPA 3F6UH 4BANB 3DFJA 3SHAH 1RGQA 3LPRA 4UFGH 2NU2E 2WPMS 2ZP0H 1O38A 4HTCH 1GI1A 1XUJA 3K9XB 1MMJN 1O2RA 2BDAA 1O35A 2VVVA 1PPGE 3NXPA 4R0IA 2PP6A 4BTUB 1SPJA 1KLTA 4OS4A 1K9OE 1SLUB 3RXAA 4B2BA 4TYDA 4M7GA 1SGTA 1OXGA 3T25A 1ELFA 1C2EA 4GLYA 1T8MA 2J38A 2AH4X 2PKSC 1LKAA 2BZ6H 1AVXA 4CHAC 4XDEA 4F4OC 2Q1JA 1K0HA 2C8XB 2CN0H 3E0PB 2A4RA 1UCYE 1ZTLA 3UNSA 4K8YA 2ZPRA 1P05A 3OE7D 3TU7H 4BXSA 1ID5H 3RXUA 4WH6A 4RKJB 3SJKA 1HJ9A 1N6XA 2PV9B 3SV8A 3KCGH 1BHXB 3NCLA 1E79D 1TPSA 4CBOA 3BSQA 4ABGA 1HDTH 1LVBA 1ZSKA 5DK1A 4CRCA 2BB4A 1O5AB 1MKWH 1SGFA 5I25A 1OP2A 3ZV9A 1DDJA 3DD2H 3FP6E 3RXVA 1CT2E 1P01A 2TBSA 1QB1A 4BAKB 3GICB 3IG6B 3MNXA 3W1EA 3RXKA 2ZFFH 3E16B 1GBAA 4Y6DA 1TOMH 1FN6A 2BLQA 1GGDB 1DY9A 1WSSH 1UTNA 1B0FA 1TPAE 1P57B 1TPPA 1Q31A 1WQVH 4YOGA 5TCAA 2RA3A 4BAQB 1HAYB 1LDTT 1AFEH 2YOLA 3QZQA 4Q80A 2UWLA 4F48B 1OHHD 1O36A 2OC1A 2V6NA 2KCAA 2ZHQH 1O2PA 3TK9A 3WW7A 1AQ7A 3HKJB 1C5MD 5F03A 3TGKE 1BRUP 1RRKA 3A87A 1RTLA 1ANCA 4AB9A 1A2CH 2WUBA 1V2OT 3FO8D 1S5SA 4AORA 4NCYA 2BX4A 2GD4B 1NPMA 3ZVFA 2VIPA 1F5KU 1GBLA 1GMDF 1K1OA 3TJOA 4O3UA 1GCTC 1KTSB 2AGIX 1ANEA 1MZAA 1PYTC 3UWIA 4XE4A 1WBGB 3BTKE 1O3BA 2TGPZ 1NROH 2J98A 2GV7A 4A1VA 5LPEA 2UWOA 4Q2KA 3H7TA 3BTQE 5A0CA 5DP6A 1AB9C 3MTYA 1D6RA 1WUNH 2BY9X 2J94A 1O2MA 3CNRA 3P17H 5FHTA 2CV3A 1KIGH 2QXIA 3MO6A 5GJ4B 2AMDA 2GZ9A 1KLJH 2Z7FE 1A3BH 3P70B 2Z3EA 3DSOA 1C1QA 3Q3YA 4Y8XA 3CS7A 4WMEA 2EC9H 2VH0A 3A8DA 2FOMB 1C5LH 1C5TA 5FAHA 1E38B 1H9LB 1TAWA 5JYIA 2VJ1A 5E2PA 2A5IA 2D1JA 2G81E 1Z6EA 3SU6A 1GJDB 3GY6A 2IPHA 4UFEH 2XC5A 3T29A 2IPQX 5HIZA 1UTQA 2WV5A 1NU7B 1LCYA 3KQCA 2XNIA 1P2KA 3GY3A 2BD5A 3U1JB 2J98B 1S84A 2CF8H 1ZR0A 3OY6U 2EI8A 3OY5U 1NS3A 5A8XA 4KGAA 1QGFA 4I33A 1HV7A 5HYOA 1H4WA 4ZAEA 3RM2H 1XX9A 2I6QA 2ZC9H 1GJ5H 1WDIA 3AW0A 5PTPA 3MOCA 3KQDA 1K21H 4UFDH 4Y8ZA 2TPIZ 1GI4A 1WAYB 1GBIA 3GYMA 4B75A 1ARCA 1E36B 3B23B 1K1JA 2OQUA 3P8FA 2FYQA 5JB8S 1IQNA 2CHAC 4GHTA 3MH7A 1SGEE 1YC0A 4HZHA 1T8NA 3UR6A 1A5GH 2GP9B 1TYNA 3NK8A 2WPJS 1GHAF 1SGFG 2GMTB 2R0LA 2BQWB 2NU0E 2PUQH 1UCYK 1G3EA 5A2MH 3SU0A 1O3OA 3UREA 1C2KA 1GDNA 1YY3A 2XYAA 5EU8A 1BB0B 4ZH8A 3LGYA 3LKWA 3RLWH 1COWD 1GBHA 1GHWH 4TY7A 2A1DB 3RXOA 4ABJA 1C1PA 1GI3A 3SV7A 7GCHF 1T31A 2PTCE 3I77A 8GCHF 1SGCA 4X2YA 4LK4A 4UD9H 4MPVA 1AIXH 4K2YA 2P3FH 4JYUH 3SNBA 3E6PH 5K0HA 1H8DH 1TGTA 2SGQE 3SUGA 5FX6A 1JRSA 1YWUA 5EQSA 1K1LA 1P9UA 5AFYH 2PUXB 4Q7YA 1BTHH 4JMYA 3M5NA 1S85A 2HWLB 1W0KD 1TGSZ 1YPGH 2GCHG 1AU8A 3E8LA 3ZZAA 4NA9H 1RFNA 1Q3XA 2J97A 5ESBA 1MZDA 3UFAA 5CE1A 1XKAC 4H6SB 1PPFE 3QGNB 2IJD1 1FPCH 1VGCC 5LH8A 1RJXB 1NC6A 1SB1H 2YMSB 4WMFA 1BJVA 3MH6A 3I29A 4D9RA 3HK6B 4WVPE 2OCVB 1YP9A 1FQ3A 2JH5D 3VEQB 2ZDMA 1DX5M 1VGCB 1VJ9U 4I31A 3CP7A 1OWEA 4GHQA 1QJ6B 1RIWB 2ZFQH 1J14A 1GI8B 1UK4A 2ZGHA 4JCNA 1HAVA 4CBNA 2XBYA 1SG8B 3MYWA 2K8IA 3LJOA 1EOJA 1D3PB 4HI3A 1AZZA 1P10A 1O2OA 1EZUC 5A8YA 2FI3E 4YO9A 3RLYH 4NA8A 3TPIZ 1ZGVA 3SJ9A 1PPHE 5EXLA 2M5TA 1Y5AT 2ZDAH 2GJGA 1HAOH 1EPTA 4IGDA 3BTME 2B8OH 1VZQH 1O3LA 2QE7D 2EY4C 3BV9B 3M35A 2ASUB 3E0NB 4ISNA 1SC8U 3VGCB 2F4LA 1XUIA 1C2LA 1CA8B 2A31A 1SFQB 3QN7A 5HGGA 3C27B 3TVJB 1P2NA 2PGQB 1HJAC 3SJOA 3NKKA 1W14U 4CRGA 2VWOA 3DA9B 5HMAA 3V13A 2CK3D 3VXFH 1YYY1 4CH2B 1BDAA 4NFEA 4DIHH 1ELVA 1C2HA 3BF6H 1O2IA 1QRXA 1C1UH 4ISOA 3RXTA 1AN1E 3PV4A 1Z8GA 1TMUH 1HAHH 1ZRBA 1V2WT 3MHWU 5EW1H 1BQYA 2ZHDA 1UHBA 2EQNA 3A85A 2G00A 2WINI 4UEHH 2C93B 2FIRH 2GT7A 3GOVB 2M2AA 3DSPA 3BTHE 5AVDA 2JKHA 2FPZA 1IQIA 1GWAA 2D8WA 4U30A 1GJ9B 1OPHB 4ZKNU 2BLWA 1S83A 4E7RG 1A0LA 1TNGA 3ZZDA 5C1XA 1BRCE 4HFPB 1F7ZA 1KTTB 1MTWA 2FX6A 1TNHA 1TABE 3EA8A 5F6MA 1Z8IB 1E0FD 1S6FA 1ZMLA 3GCTF 1O3FA 4TT3D 1EP6A 1Y59T 3ZZ6A 1AUJA 1DSUA 1SLXB 1O3PB 1BUIA 1D6WA 1C5RA 4X2WA 4X2XA 3ATMA 3B8JA 4MNYA 4X8VH 2Q6GA 1OOKB 1V2QT 2ULLA 1MAYA 5IYTA 3URCA 1M9UA 4I86A 3ZZ3A 4DOQA 1KXDA 1O2SA 1PQ5A 1TA2A 1MTSA 1ZHMA 5C5NA 3HKIB 1SLWB 1PQ7A 5T1VA 3C1KA 1DT2A 3BIUH 5GNDA 3MFJA 1T8LA 1JBUH 3EA7A 1GG6B 1KMHB 3O8CA 4AB8A 1N1LA 2ZNKH 2SGPE 3T28A 2Z94A 3PO1B 1LKBA 3M5OA 1G36A 1K28D 1QB9A 3RMMH 2F3CE 4XRNA 1C2FA 3PMBB 1W12U 2AS9A 5DPAA 5GCHF 3GYLB 3LJJA 2A2QH 4ABEA 2ODQA 1SBWA 1GBJA 1JOUB 4MNWA 4A7IB 1A0JA 2P8OC 1LHDH 1CSOE 4ISLA 5K7RA 4TPIZ 1O2GH 4H6TA 3A84A 3EE0B 1SGYE 3BTEE 1HJ8A 2ZDVH 3SORA 4MLFB 2C8ZB 4Y8YA 1NM6A 4FUHA 3DUXH 3KQBA 1TNKA 1UTMA 1GMHF 1O3JA 1ZZZA 1GJCB 1XUKA 3TITA 2FI4E 4CREA 1F5LA 4K5ZA 1KXBA 3MO3A 4NIXA 1DVAH 4WH8A 1GI7B 1WXRA 2GZ8A 4I8HA 1FDPA 1XKBC 4KELA 1IAUA 3VXEH 1BBRE 3RXRA 4B2AA 2G5NA 3UNRA 5FL7D 1TONA 2GX4A 8LPRA 1O32A 4X1QU 1J8AA 3H5CB 3JZ2B 1SQRA 1O5BB 2FLRH 1ZSJA 1LMWB 1W2KH 1O5EH 1Y5BT 5IDKA 4GPGA 1MU6B 1EKBB 1MCVA 1BTPA 3NUMA 1OP8A 5A09A 2THFB 3KYGA 2EI6A 3LC5A 2Z9IA 1GVLA 4Y0YE 2AYWA 2O8UA 5A8ZA 2Y7XA 1Z8JB 3ZZ5A 2VB0A 1PYTD 2AEIH 3BN9A 4FXGH 1QCPA 3I78A 4IMZA 2WPKS 5DP4A 1TX6A 3PLBA 1P8VC 5KEDA 5FBEA 1IQEA 1C5XB 3N99A 4ZKOU 1OX1A 1TX8A 1YPEH 2LNCA 3F9EA 2O8WA 4NZLA 2VBCA 2ZQ2A 1O5FH 6CHAB 3RC4A 2Q6DA 3OYPA 3ZZBA 4QT8C 3UR9A 2XXLA 3M5MA 5B6LA 3MNSA 3RMOH 1XVMA 3PLKA 4AFUA 1PQAA 1C1WH 1INCA 5DN6D 4AYVB 3RXEA 1CT0E 3TJUA 2VIDA 3BIVH 3OSYA 5EQQA 6GCHG 3GCHC 1HCGA 2YNBA 2NWNA 2V35A 1QB6A 5JBCS 3TNTA 1E37B 2SGFE 5JBBS 1O5GH 1NBME 1IHTH 1GMCG 2C3SA 1C1RA 3OU0A 1LHCH 1DFPA 1QQUA 1SGDE 3GCHB 4GCHF 3RXSA 1C5ZB 3QLPH 1H8IH 3F2GA 5FCRA 1QNJA 3SNEA 1IHSH 2TGAA 1UCYH 2C8WB 4A5TS 5DJ7A 4CRDA 3PROA 3PWBA 4RKOB 2PWXA 2W3KA 1D3QB 1NFXA 3W94A 2ZTXA 4O9VA 3MU8A 2WPIS 1CVWH 1SQAA 3KF2A 2FOGA 4WXIA 5FX5A 4AZ2B 5FCKA 2HRVA 2JJ2D 4RT0A 1HLTH 3F0PA 1DLEA 2JETB 4NIWA 3CENA 4YXWD 1JIMA 2CF9H 3MU4A 4BTTB 1ABJH 5ETXA 3M37A 3RC5A 1MBQA 5F8TA 3F68H 4INKA 1P03A 3MO9A 4WF8A 1GJAB 1L4DA 1O5CB 2F43B 1NFYA 3RUOA 1LO6A 4AFSA 3SU3A 1GI6A 1N6YA 1P02A 4AGKA 4YLUA 3ITIA 1CO7E 5DO4H 3F2HA 2KAIB 2AIQA 3PYHA 4NGAH 1TGCA 1BITA 2XC0A 1DUAA 1FNIA 3A80A 4E05H 3A8AA 1N8OC 2HNTC 5TJXA 1GDQA 3UWJH 4ASUD 1QBVH 2PFEA 2Z3DA 4I7YH 1EASA 1CQQA 1IQGA 5JBTA 3ZYEA 1NTPA 2LELA 3A7TA 4P00A 3GY2A 1N8OB 3OTJE 4ASHA 1GMDG 1EUFA 5CDFE 1MTNC 4K60A 1SKYE 3TJNA 2WUCA 2WZQA 5TCCA 1S81A 1ZTKA 2F9NA 1G3BA 2GT8A 4MNVA 7KMEH 2A5KA 3RMNH 2RA0A 3SGAE 1MTNB 4FVDA 1P2QA 4MQAA 1NESE 4XBDA 1NRNH 1QQ4A 3GDUA 3O8BA 5DP7A 3P92A 3MU5A 1W7GH 5AHGH 1HPGA 4A92A 4NWKA 5EJZA 3RXQA 2ZEBA 3Q00A 2JJ1D 2B7DH 2ZI2H 1GGDC 1BZXE 3RMLH 3STJA 1YPMH 3SGQE 2QAAA 2BOKA 5B6OA 2BXUH 1ZOMA 4THNH 3TLOA 1MAXA 1QURH 4P02A 1PFXC 5C20A 1BBRK 1QJ7B 1W10U 1ORFA 1VITH 2Y82A 2ZF0H 3T62A 5BRRE 2ZU1A 1ANDA 3M7QA 3P8GA 4FUFA 7ESTE 1TFXA 3MH4A 1GCDA 3P8NA 2BX3A 4DVAU 2QYIA 3KEEA 1OYQA 2RDLA 1P0SH 1QA0A 3SNDA 2Z9KA 3ODDA 1FMGA 2BMGB 2FS9A 2WPDD 1C2JA 1FONA 2BDHA 4UDWH 1C1SA 2GTBA 3SGBE 1F5RA 3PRDA 1GVKB 1A4WH 5KGOA 3VB5A 3LGTA 4O3TA 2Z3CA 1A5HA 2G8TA 3AVZA 1AE5A 1B5GH 5DP9A 1EFRD 1IQLA 1GHBF 2A7CA 1XUGA 2EEKA 1YPHC 2FM2A 4JZEH 2ZIQH 4X0WU 1ELTA 1H8ED 1P04A 2KFWA 3L33A 4LZ1H 2D26C 5C1UA 3UQOA 1CT4E 4D76A 4IW4E 2BLVA 4O97A 2F9PA 1X7AC 1ZYOA 3SU4A 2CXVA 5EOKA 1T7CA 1GHAG 1TMTH 1O3IA 1QY6A 1BIOA 4XBCA 2BY5X 1UJ1A 1W8BH 1JXPA 2SGAA 1LQEA 2HVYB 1GL1A 2W6JD 2ZECA 1LPKB 2VNTA 3LC3A 1C2GA 1YLCA 5C0UA 3K6YA 3TK5A 1YGCH 4INLA 3E91A 4AG2A 7GCHG 1GBKA 1BMLA 2QXGA 4Y7AA 3MWIU 1C5PA 8GCHG 1C5OH 1KXEA 2J2UA 2G52A 3DFLA 3DT0H 3F2FA 1GHXH 4BOHA 2QGRA 3N7OA 1NRPH 1NRQH 1W11U 5CHAC 1QL9A 4AGJA 1SQTA 3RXPA 3WWFA 2FOFA 2KM0A 1P11E 2XW9A 2J34A 2VWNA 1O39A 2B0FA 2LP6A 5CHAB 1Y3XA 2A4QA 1MBMA 1O2YA 1C5NH 1Y3YA 1O2KA 1GBFA 2NU3E 1YF4A 2UUKB 1FY3A 1TE0A 1IQKA 2FLBH 1YKTA 4RSPA 1AKSA 4KP0A 5CMXH 1UVUH 1MTUA 1ZMNA 1ESBA 4AC9A 3UQVA 5EXMA 4CR9A 1TNJA 4X8SH 9LPRA 1EJMA 1S6HA 2G51A 5KECA 2ZU2A 1NFUA 3QWCH 2HLCA 2GMTC 5I46H 2O8TA 1HGTH 1W0ZU 5HXFA 4A1XA 1YPLH 4TSFD 1Y3UA 1O2LA 1HUTH 3K6ZA 3UB0A 1ZPZA 2XRCA 2PTNA 1EP5A 1DITH 1DANH 1O2NA 1FLEE 3FOAA 1WV7H 4KTCA 1HAZB 1WU1A 3VPKA 3A8BA 4BTIB 3T2NA 2XNDD 2QIQA 4DY7B 2XCFA 1FY5A 2LPRA 5HM2A 4ZCNA 1QJ1B 1V2NT 2DUCA 3UTUH 1ZHRA 1Z1IA 3BTGE 2R9PA 1NZQH 2BDYA 3PMJA 2K1QA 3S7HB 4X2VA 1AE8H 5DG6A 5ESTE 8KME2 4JZ1A 2Z9GA 2OINA 4DIIH 2Z9JA 1FI8A 3UIRA 1W0YH 2P3UB 3SI3H 2BVXH 1OS8A 3ZVDA 2VWLA 3ZVAA 2SFAA 2YMSC 1WQSA 1JRTA 2KZ4A 2P93A 3VFEA 4VGCB 1OWHA 3EYDA 3SZEA 1U6QA 2WSSD 5LPFA 1GBBA 5H4IB 1EZSC 2OC0A 3A7WA 3R3GB 3V7TA 3BTTE 1Z1JA 1BHXF 4JK6A 4MVNA 1BMMH 1RS0A 4RT1A 3SO3A 1QRZA 4Q63A 1RIWC 2W26A 4OS5A 2QF5A 2XWBI 4HG6A 2OC7A 3CS0A 1ESTA 3HATH 3S7KB 1AY6H 5EJLA 1HIAA 1SHYA 2BHGA 2FX4A 3BEIB 2XBVA 1V2RT 1GVZA 2OQ5A 4OS1A 2BZAA 3RU4T 5FPTA 4B73A 3S9BA 4B2CA 4J1YA 4BNRA 3KNXA 5DGJA 3GCTG 2FTMA 1WYKA 3ZV8A 4MPXA 2FEQH 5C1YA 2BYAX 3NWUA 3SV6A 3AAVA 1IQMA 4Y10E 3VGCC 4WXVA 1SI5H 3U98H 2BTCE 2VU8E 2ZKSA 3PTBA 3SQEE 2OBOA 1T32A 3H7OA 2TIOA 3RXJA 1QL7A 2RFKC 3GCNA 1CBWB 1TQ0B 1OWIA 1PPBH 4ZHAA 4OS6A 3EDXB 1ETRH 4WJG2 1MKWK 3SZNA 5E8EH 1JIRA 3M36A 3F9HA 4UONA 1A46H 3LGIA 5T6FA 1QHRB 3LH1A 2TGTA 1YLNA 3A88A 2FDAA 1ETTH 4IC6A 5FBIA 1E1QD 1HAVB 3K2UA 1L1JA 1FY8E 1EPTC 3RXGA 1P2JA 5GCHG 4ZHMU 1KDQA 1L1NA 2G4UA 1Y3WA 1MTVA 4BAOB 1C1VH 3HGPA 4ACBA 1F0RA 3A86A 2Y5HA 5C5OA 1C4V2 1SMFE 1EPTB 3OEED 2PSXA 2KR7A 4Z0KA 2XBXA 4DJZB 3QUMP 1O30A 1AUTC 1TBRH 2P94A 1EAWA 5DSFA 4ABFA 3AK5A 5GXPA 2TGDA 1EATA 4FUGA 1GMHG 2JIZD 1MCTA 1UTLM 2G5VA 2FXRA 2O8LA 1EXFA 1W7XH 2NU4E 1GDUA 4ZMAH 4X1PU 2RDEA 5A0AE 5L30H 1CGHA 1UHBB 2QF0A 2KCPA 1QA7A 1G2LA 4YT7H 3EGKH 1C1NA 4KTSA 1GPZA 4LOYH 3RXLA 3AW1A 1GG6C 1AHTH 1OKXA 3FVFB 1AGJA 2ZGXH 3F3BA 2J4IA 3Q76A 3PO1C 1O2ZA 4X1SU 4H42U 1J17T 4LXBH 4U2WA 1C5YB 2KCOA 2ZFRH 1PQ8A 3SU1A 3A81A
chains in the Genus database with same CATH topology
4X1NU 1GI9B 1HFDA 2FODA 1A1RA 2VGCB 1FN8A 4AFQA 4JYTA 4DGJA 1BBRH 4ZKSU 2Y7ZA 4AG1A 1O2TA 1V2VT 1IOEA 1O3GA 1UK2A 1AWFH 3SNCA 4JZFH 2FMJA 5GWZA 2B9LA 1UTJA 4CR5A 4OGXA 3SUEA 4BAHB 4WY3A 1YCPK 1BRAA 1MD7A 2A0QB 1ZGIA 1O5DH 1H9HE 3ZYDA 3WY8A 1O2HA 3ATKA 3GISB 1V2KT 4FU9A 3ZVEA 3TH4H 1C1MA 2ZU4A 3AAUA 1DM4B 1SQOA 1S82A 1V2ST 6LPRA 3JZ1B 1TRNA 1J16A 2VIOA 5EG4A 4NSVA 1T4UH 4IS5A 1OWDA 1EOLA 2C4FH 4ESTE 1CGJE 2PR3A 5E2OA 5EXNA 5L2ZH 5GPIB 1V6DA 3QGJA 2FYRA 2QC2A 2HPPH 4U32A 1G30B 1SOZA 1O3DA 1AO5A 2XC4A 1BTZA 4AYYB 3W95A 1SOTA 1K2I1 1TMBH 1DS2E 3A89A 2ZCHP 3PM3A 1D9IA 2H5DA 1HYLA 4DT7B 4H4FA 1DLKB 2QXJA 1G32B 1XXFA 1DE7H 4X1RU 3RU4D 2Z9LA 4BXWA 4X6NA 4XFQA 5E0JA 1WOFA 2PW8H 1UO6A 2VINA 2C8YB 2GZ7A 1F0TA 1HB0B 1Z6JH 4PROA 1UVPA 2WYJA 1HNEE 4I8LA 2WV4A 1ABIH 1TOCB 2STAE 4TY6A 1LHGH 1DSTA 2VH6A 1NRRH 3A83A 6CHAC 1BTXA 1P2MA 1BTUA 2GGVB 2FTLE 1DXPA 2UUFB 2A7JA 1PPZA 2BDIA 2CMYA 4X8UH 1GI2A 3LT3A 1O31A 3QDZB 4CRBA 3S0NA 3BEUA 2VVUA 1BCUH 1TX7A 1GJ8B 1HAGE 2FWWA 1UVSH 3QX5H 1F92A 4FUCA 2V0BA 3RXIA 5JB9S 3ENSB 1TNIA 1OWJA 3D62A 4YESB 1TLDA 3ZZ4A 3ZVGA 1A0HB 4JK5A 4GSOA 1RXPA 4DW2U 1MU8B 4E7NA 1AVGH 1EAXA 1MH0A 3QO6A 2FOCA 2R3UA 1FZZA 1AFQC 1O3MA 1ZSLA 4I32A 1ZHPA 2H6MA 3MU1A 2F9BH 3GDVA 1LQDB 3T5FH 2FESH 2JETC 1Z7KA 1SL3A 1XXDA 1O3KA 3M7TA 5J4QA 1SSXA 1V2JT 1AFQB 1VCWA 1HBTH 3LU9B 4YLQH 1C5SA 2GVFA 2VWMA 4X6MA 1EB1H 1SGRE 3GDSA 3ATLA 2XBWA 2RG3A 3FZZA 2H5CA 4INHA 2BD2A 2BLOA 2D2DA 3RP2A 3FFGA 4DG4A 2OUAA 4A6LA 1ARBA 4HGCA 4B1TA 2STBE 2SNVA 1O37A 1GL0E 1P9SA 3U9AH 8ESTE 1VITF 1BA8B 4XSKU 3SW2B 2R3YA 3GY5A 3ZZCA 3GY7A 2A2XH 3Q77A 2Y81A 1UMAH 1C5UA 5DKMA 3SV2H 1TBQH 1V2UT 1ZPBA 2YNAA 3E3TA 3EQ0H 2O8MA 1BTWA 2IOTA 2PLXA 5EGMA 2BOHB 3LOXA 1ELCA 1FXYA 2NU1E 4YM9A 1GHBG 2FOEA 1V3XA 3TGJE 2PSYA 4WWYA 1K1NA 4B76A 1LTOA 5J4SA 5LGOA 4D7FA 1UTPA 2W7SA 1MUEB 4NG9H 1FV9A 4FUDA 4ABAA 4IC5A 4MPWA 4FUBA 1GJ4H 1TRMA 1GHVH 1GI5A 1Q2WA 6GCHF 1C2MA 2Q6FA 1P09A 1THRH 3SI4H 3LGWA 4D8NA 5T3HA 3UUZA 2PKSB 4CH8B 1UK3A 5F8ZA 2BQ7B 4CHAB 1K1IA 3ATWA 1VJAU 5E0GA 1GMCF 1UVOA 2ZCKP 4KTUA 4B74A 1TB6H 3TIUA 1LPZB 2PKAA 1BT7A 1CHOF 3FANA 1LHEH 1ZPCA 3A7YA 3LDXH 3ZVCA 1EB2A 1YBWA 1KY9A 6ESTA 5FPYA 4ZXYH 1LPGB 1XUHA 1YPJH 3P95A 1TGNA 4GUXA 1E35B 1O34A 3KL6A 2FS8A 2OXSA 3RXDA 3HK3B 1O3CA 2ZZUH 2SNWA 1GBEA 4FU7A 1H9IE 1NO9H 2ZHFH 2Z6BD 1EAIA 5BPEA 2F9VA 1QIXB 3FP8E 3ATIA 1Z71A 1JWTA 1ZMJA 4MNXA 1CGIE 3PMHB 4ABHA 1YM0A 2PKAB 3S9AA 2PHBA 1D3TB 3VB7A 4CRAA 1C4Y2 2BDCA 1SFIA 2R2MB 1SGQE 3A7XA 1TRYA 2UUYA 3QTOH 1LVYA 1NT1A 2IN2A 1W13U 2C90B 4ZKRU 3QTVH 3UPEA 2ANWA 3SN8A 2QF3A 1EJNA 4K8BA 1C5QA 4FUEA 3UOUA 2BVRH 3SUFA 3TH3H 1C9TA 2I6SA 4X6PA 9ESTA 1P12E 1ELEE 2AGGX 4UE7H 2ZU5A 5L6NH 1O2VA 2ZDKA 2ZA5A 1MD8A 1CA0C 3FZDA 4Y79A 2GDDA 5F8XA 1P3EA 4ISHH 2A7HA 2P95A 1GBCA 1GCTB 2OLGA 4ABDA 3TH2H 1QTFA 4NFFA 1JMOH 1K22H 2O9QA 2OBQA 3URDA 1CA0B 1P2OA 3SJ8A 3D65E 3TJVA 3NPSA 2AGEX 1AB9B 1FAXA 1S0RA 4NZQA 1V2TT 4GAWA 1DPOA 1O33A 3E1XB 5FPSA 1J9CH 3ODFA 5C2ZA 1GHZA 4ABBA 1LHFH 3KHVA 1YCPH 1GBTA 4FUJA 2R2WU 2QA9E 1HXEH 2HPQH 1GBMA 3V3MA 2R0KA 4O03A 3E90B 1RD3B 3MU0A 3SQHE 1V2MT 2H9HA 3RXBA 3LH3A 1KXCA 3TGIE 2ODYB 2BD4A 3M61U 1NRSH 1DUEA 4R8TB 3P6ZB 1V2PT 1AWHB 1GI0A 3KN2A 1CU1A 1G9IE 5EW2H 2HALA 4I8KA 1B7XB 3TNSA 3HPTB 3LGUA 3STIA 2ZHEH 4OGYA 2XTTB 3M5LA 2H1UA 1ZJDA 1O0DH 3A82A 4YZUA 3MNCA 5EPNA 2AERH 3FP7E 1THPB 3SU2A 1ACBE 1T4VH 2WPHS 1IQFA 3SHCH 1AKSB 1F2SE 1G37A 5T6DA 3SV9A 1UTKA 1A3EH 1TGBA 2CHAB 3DHKH 1GJBB 2XWAA 1ELBA 1EJAA 2BDBA 3U1IB 5DP3A 1Y8TA 2UUJB 3V12A 3KQEA 1YLDA 4VGCC 5JDUB 2BXTH 2CJIA 1LVOA 1HAIH 2ZTZA 2WYGA 2VIVA 1TNLA 4UFFH 2P59A 1DOJA 4A1TA 1XVOA 1MKXK 1BJUA 2HNTF 5SGAE 3BG4C 1SGNE 1OP0A 1WTHD 1NN6A 4IN1A 1KXFA 1AZ8A 2ZTYA 3M3TA 1HRTH 2JH6D 1UVTH 1EQ9A 2ZPSA 4FU8A 1NY22 2ZGCA 3BG4B 1QBOA 4ISIH 2TRMA 1DWEH 4ZUHA 3PWCA 3EAJA 2OD3B 2J92A 1XMNB 3K65B 3PMAB 1YPKH 1F0UA 1PPEE 4K69A 4DURA 3F9FA 2QCYA 3UNQA 1FIZA 5T6GA 4AFZA 2AMQA 2P3TB 1UTOA 4GVUA 3TK6A 3SBKA 1AMHA 3MMGA 5ABWA 2ZG0H 3F1SB 1O3EA 1C4U2 1TQ7B 3MI4A 1G3CA 4MTBA 1G3DA 1BMAA 1CBWC 1DWBH 4IBLH 1OYTH 4E06H 2WPLS 3GCOA 1C1TA 1FPHH 2GV6A 2W7UA 2FOAA 2GKVE 3GY8A 1DY8A 4NA7A 2BY6X 3ZZ7A 4B71A 3VB6A 3RXFA 4SGBE 3UOPA 1O2UA 1O2JA 2GDEH 4Z6AH 1SGPE 4SGAE 1O2WA 2FP7B 5GIBA 1HIAB 1OSSA 3BG8A 5LPRA 1P2IA 2OTVA 2G4TA 3A7VA 4ABIA 2OP9A 3O8RA 1BOQA 3IITA 4XOJA 4TWWA 1O3NA 1THSH 5JPMH 2ODPA 2SGDE 3D49H 2BD8A 4ZXXH 1GJ7B 2ZU3A 2EI7A 3B9FH 3ZZ9A 1GJ6A 1DWDH 3GY4A 2RCEA 4ZHLU 2EA3A 1L1GA 2HVXA 3PLPA 2AFQB 1FUJA 1HAXB 3M3VA 1PPCE 2ILNA 4Y11E 3VB3A 2GCHF 2F91A 1BMNH 4FUIA 5EQRA 2VIQA 1L0ZA 1RTKA 1HJAB 2J95A 3Q3KA 3VB4A 5C3NA 2ZGBH 2ZFSA 3NZIA 2A32A 2F83A 2H9TH 2UWPA 5EODA 1TWXB 1SLVB 2VVCA 2BD7A 3S9CA 3A7ZA 3ELAH 1ZLRA 4LZ4B 1CE5A 3Q3XA 2ZDNA 1D3DB 2ALVA 3T26A 2IJOB 1YCPM 4IN2A 1KDQB 3BTWE 3V0XA 5FXLA 3RXCA 3PB1E 4IMQA 1J15A 2V3OH 4AX9H 2Y6TA 3O8DA 4YOJA 1WTGH 5JBAS 4MPUA 1TALA 4X8TH 1KXAA 2VGCC 1MQ6A 3SUDA 1W3CA 2F9OA 3BTDE 4MG3A 1AI8H 3P8OA 1A7SA 1IQJA 1EX3A 4NIVA 1P3CA 2ANYA 3MH5A 4BAMB 3BTFE 1AVWA 1ELAA 2ANMH 4Y0ZE 1FIWA 1P06A 3EA9A 5AFZH 2ZPQA 3QK1A 2BDGA 3L3TA 1AD8H 2HNTE 4AN7A 2W3IA 2VIWA 2A5AA 4WMDA 4Q7ZA 2SGEE 3LIWA 1WCZA 2BY8X 3M3SA 3ESTA 1O2XA 2H2ZA 1Y3VA 1EZQA 4DCDA 5AF9H 2V3HH 5HM9A 7LPRA 1QFKH 5EPYA 2ZFPH 5C67A 1BRBE 1DXWA 1ZJKA 5L2YH 4D9QA 1LVMA 5DP5A 3KIDU 1ESAA 4YT6H 4JYVH 1TBZH 1C9PA 1NU9A 3U8OH 4K1SA 3M7UA 1A5IA 3RC6A 3D23A 1XM1A 1SGIB 4RN6A 1TPOA 1B0EA 2ZWLH 5A0BA 4AOQA 2XCNA 1DICA 2H9EH 1ZTJA 1O3AA 1QL8A 1SR5C 5G4BA 3S69A 1XUFA 2AIPA 4J2YB 3OX7U 1F0SA 4GCHG 2P8OB 1QBNA 2FOHA 4K1TA 4Y71A 2ZFTA 4Y7BA 4KKDA 1KYNA 2ZHWH 1QR3E 1CHGA 2DE9A 3HGNA 3G01A 4JZIA 4TPYA 2FI5E 2PGBB 1IQHA 1GHYH 2A4OA 1G2MA 1D4PB 3RM0H 4JZDH 4MDSA 3PTNA 3ZZ8A 3LGVA 4K3JA 4CRFA 2W5EA 1FJSA 1NFWA 2QV1A 4TWYA 3UY9A 1O3HA 3U8TH 4NSYA 1V2LT 3IWMA 1MQ5A 3U8RH 2BVSH 3RU4E 4I8JA 2Y80A 4OS2A 2ANKH 2ESTE 1EZXC 4FVBA 1VITG 1YPHE 1C1OA 1L2EA 2ZDLA 2ALPA 1RTFB 2ZGJA 1K1MA 1VCQA 2OC8A 3AASA 1VCPA 3BEFB 1Z8RA 4NIYA 4U01A 3A8CA 1OWKA 1C5VA 1E34B 2B5TB 1QRWA 2FOBA 3ZVBA 2QXHA 1TIOA 5E0HA 1A61H 4I8GA 1C2IA 2BD9A 3SNAA 2Y5FA 2G55A 5DP8A 1KLIH 3RXHA 1FAKH 1T8OA 4D7GA 1S0QA 3U69H 2HOBA 3L6PA 4XBBA 1O2QA 1GBDA 1KSNA 4Y76A 1TA6A 4K1EA 2HGTH 1K1PA 3RDZA 2ZQ1A 2QN5T 2JH0D 3SU5A 1SHHB 4F49A 1Y5UT 4OS7A 1BTYA 1PJPA 1C5WB 4NWLA 3T27A 1SVPA 1VR1H 3MNBA 1ELGA 2BQ6B 2FO9A 2QY0B 3F9GA 3FAOA 3QZRA 2F9UA 2A45B 1CHOG 5GDSH 3LONA 2KAIA 1FY1A 2BY7X 3RXMA 2P16A 4ZROA 2A4GA 1ETSH 2Y5GA 2FZZA 1L4ZA 1HXFH 2GCTC 4X6OA 1ELDE 3SJIA 3SOSA 2BM2A 2DE8A 1ZRKA 4YOIA 1HAPH 4Q7XA 2ZO3H 2CGAA 2ZCLP 1H1BA 1MKXH 4YTAA 1C2DA 3R0FA 2BD3A 2AMPA 1FY4A 1ANBA 2J9NA 2GCTB 1DWCH 1EAUA 3KGPA 3F6UH 4BANB 3DFJA 3SHAH 1RGQA 3LPRA 4UFGH 2NU2E 2WPMS 2ZP0H 1O38A 4HTCH 1GI1A 1XUJA 3K9XB 1MMJN 1O2RA 2BDAA 1O35A 2VVVA 1PPGE 3NXPA 4R0IA 4BTUB 1SPJA 1KLTA 4OS4A 1K9OE 1SLUB 3RXAA 4B2BA 4TYDA 4M7GA 1SGTA 1OXGA 3T25A 1ELFA 1C2EA 4GLYA 1T8MA 2J38A 2AH4X 2PKSC 1LKAA 2BZ6H 1AVXA 4CHAC 4XDEA 4F4OC 2Q1JA 2C8XB 2CN0H 3E0PB 2A4RA 1UCYE 1ZTLA 3UNSA 4K8YA 2ZPRA 1P05A 3TU7H 4BXSA 1ID5H 3RXUA 4WH6A 4RKJB 3SJKA 1HJ9A 1N6XA 2PV9B 3SV8A 3KCGH 1BHXB 3NCLA 1TPSA 4CBOA 3BSQA 4ABGA 1HDTH 1LVBA 1ZSKA 5DK1A 4CRCA 2BB4A 1O5AB 1MKWH 1SGFA 5I25A 1OP2A 3ZV9A 1DDJA 3DD2H 3FP6E 3RXVA 1CT2E 1P01A 2TBSA 1QB1A 4BAKB 3GICB 3IG6B 3MNXA 3RXKA 2ZFFH 3E16B 1GBAA 4Y6DA 1TOMH 1FN6A 2BLQA 1GGDB 1DY9A 1WSSH 1UTNA 1B0FA 1TPAE 1P57B 1TPPA 1Q31A 1WQVH 4YOGA 5TCAA 2RA3A 4BAQB 1HAYB 1LDTT 1AFEH 2YOLA 3QZQA 4Q80A 2UWLA 1O36A 2OC1A 2V6NA 2ZHQH 3TK9A 1O2PA 1AQ7A 3HKJB 1C5MD 5F03A 3TGKE 1BRUP 1RRKA 3A87A 1RTLA 1ANCA 4AB9A 1A2CH 2WUBA 1V2OT 4AORA 1S5SA 4NCYA 2BX4A 2GD4B 1NPMA 3ZVFA 2VIPA 1F5KU 1GBLA 1GMDF 1K1OA 3TJOA 4O3UA 1GCTC 1KTSB 2AGIX 1ANEA 1MZAA 1PYTC 3UWIA 4XE4A 1WBGB 3BTKE 1O3BA 2TGPZ 1NROH 2GV7A 4A1VA 5LPEA 2UWOA 4Q2KA 3H7TA 3BTQE 5A0CA 5DP6A 1AB9C 3MTYA 1D6RA 1WUNH 2BY9X 2J94A 1O2MA 3P17H 5FHTA 2CV3A 1KIGH 2QXIA