4IMQA

Structural basis of substrate specificity and protease inhibition in norwalk virus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
183
structure length
173
Chain Sequence
GSAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like protease
publication title Structural basis of substrate specificity and protease inhibition in norwalk virus.
pubmed doi rcsb
source organism Norovirus hu/1968/us
molecule tags Hydrolase/hydrolase inhibitor
total genus 41
structure length 173
sequence length 183
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4imqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4imqA01
4WVPE 3VB6A 2TGAA 3LT3A 3LC5A 3HPTB 4X1RU 1AB9B 5EG4A 2W5EA 5EOKA 1Y3WA 1GI9B 1XVMA 4AFZA 3VXFH 3SJ8A 2IOTA 2NU2E 4ZROA 3U8TH 1LDTT 1TGCA 2WPMS 3SOSA 2Y7ZA 1BHXF 1SOZA 3I77A 4Y7BA 3TU7H 1XVOA 1W0ZU 1HAVB 1IHSH 3KNXA 4BAOB 4BAQB 2AMQA 2BVSH 2QYIA 4NZQA 4BTUB 2HPQH 1W8BH 3GCHB 4MNWA 3DA9B 3KEEA 1P03A 2B5TB 2WINI 3A8CA 4ZH8A 1T4VH 3RXLA 4H6SB 1D6RA 4YOIA 5PTPA 5B6OA 4YT6H 3EQ0H 1O37A 2P93A 4D7FA 1O3EA 2HALA 1K2I1 1SGCA 1BBRH 3ZVGA 1AN1E 2C8ZB 5FX6A 1GJ8B 1C2FA 3GDVA 1C1QA 2SGDE 3A81A 3D65E 1V2WT 4JZIA 3TITA 1C2GA 3GISB 5GPIB 1AWFH 4XBDA 1NFWA 1BIOA 2PFEA 2PGQB 4LK4A 2ZQ1A 1EPTC 3BTWE 4MG3A 3OSYA 2XBVA 2RA3A 1ELBA 2WYJA 1FN8A 2B0FA 1VITF 4ABFA 1NN6A 1O36A 1TNKA 1V2UT 1HRTH 1HXEH 2SGAA 1QA7A 2BDYA 5FPSA 1O2HA 3GY2A 1NC6A 4KKDA 1G30B 1YGCH 4IBLH 4NWKA 2C8YB 2BDCA 8ESTE 7GCHG 5IDKA 2ZU5A 1VZQH 1XUKA 3D23A 3SUEA 4ASHA 1BRUP 3A7WA 2RCEA 3RXJA 3Q3KA 1WYKA 2WPJS 2Z3EA 3P6ZB 1SSXA 1EZSC 3MO6A 3SNEA 1O2OA 4A1XA 1GJ7B 1YP9A 3GOVB 1H9IE 3T25A 1SFQB 2FOAA 1C1RA 1C4U2 2QXJA 4AYYB 5C3NA 1THSH 3RMNH 2ZDMA 4OS6A 1BRAA 1BB0B 1GMCG 4AX9H 4CRDA 3UUZA 4ESTE 2BDIA 5LPEA 4AORA 2F9UA 2G4TA 4CHAB 1GBIA 4OS4A 3ELAH 2F83A 5LPFA 1GBFA 2BY8X 3A7YA 2WPLS 3D49H 2ZEBA 4IC5A 1BMMH 1JMOH 1KDQB 2HLCA 4OGXA 1GWAA 4B2CA 2TRMA 1TAWA 1IQIA 1ZMNA 1NT1A 1C9TA 6CHAB 4QT8C 2VGCB 1LMWB 2VB0A 3KN2A 2SNWA 1TB6H 4OS5A 1KLIH 2ZTYA 1P0SH 1TIOA 2FIRH 2QV1A 1TQ7B 2V3HH 2UWOA 2Q6DA 2PKSB 4BXSA 1LCYA 1HXFH 2ZCHP 1CQQA 1RGQA 1GDUA 1GJCB 1H1BA 3QUMP 2WPKS 4WXIA 1C2KA 4K1SA 4ABBA 4Y0ZE 2ILNA 1VJAU 3HK3B 3BF6H 1H8IH 4A1TA 1CGIE 1SHHB 1GHAG 1GCTC 1O5EH 1P10A 3LH3A 2XCNA 1BT7A 4X1NU 5DO4H 3BG8A 3T2NA 1TPOA 3TH3H 1A5IA 4B73A 2FI4E 3SGQE 1DVAH 1C5ZB 3QTVH 2Y81A 1QURH 4CBOA 3SNCA 4Y8ZA 1SG8B 2ZECA 4NFEA 2KAIA 3GCNA 4X2YA 3M7TA 3B23B 1QHRB 2CHAB 3SO3A 1PJPA 1DLEA 2NU1E 4E7NA 1O38A 3MH6A 3SV9A 2FO9A 3T26A 3O8BA 4E06H 3URDA 2ZNKH 4A92A 1A4WH 2EEKA 4FUDA 3SU6A 1MTNC 1UTNA 3BSQA 1BTZA 3Q00A 3SU2A 3PMBB 1V2RT 4JMYA 3SV8A 3EE0B 3UQOA 2A32A 4H4FA 5BPEA 4D7GA 1C2IA 1XUIA 4RN6A 2QF0A 1G2LA 2J38A 3V12A 1AZZA 3RXMA 1GMHG 4DIIH 7ESTE 3LC3A 2FOMB 2ZDKA 3E91A 4TYDA 1HUTH 3SU3A 1S5SA 3SNDA 2JETC 4RKOB 4UFGH 4D9QA 4TPYA 1FONA 3ZZ8A 5LH8A 3GICB 3PMJA 5T6GA 1P2MA 2RA0A 3SV7A 1UK4A 1HJAB 1H4WA 1YPJH 4UFDH 1Y3UA 3EA7A 4NCYA 1S82A 3B8JA 5CHAC 3RU4T 5AFYH 4E7RG 1OP0A 1RXPA 1SBWA 1HDTH 1XXDA 3AAUA 5AFZH 5F8TA 3RU4D 5E2PA 1S0QA 1C2EA 4KGAA 1W11U 2EC9H 1QGFA 1ZMLA 1IQEA 1B0FA 2A0QB 5T6DA 4A5TS 4UE7H 3PMAB 2ASUB 1GBMA 5ESBA 2PV9B 4HZHA 1MZAA 1O3FA 1A61H 2OC8A 3ZVDA 1TABE 2Q6GA 2P59A 1PYTD 1O3KA 2GDEH 1D3PB 3UNSA 5GJ4B 3A84A 3GCTG 4Z6AH 1HAIH 3LGWA 5H4IB 2VVUA 2H5CA 2XTTB 1KXCA 3HKJB 3H5CB 5TCAA 3S9BA 1HPGA 1P2IA 4GAWA 1NRNH 1N8OC 2SNVA 2ZFPH 1CGJE 3KGPA 3A7XA 1UTMA 2BD2A 1WAYB 4YOJA 1MQ6A 4FU7A 4WF8A 1Y3YA 1TGNA 3ATIA 3ZZBA 1ZJDA 1WCZA 2B7DH 3MOCA 3UOPA 1FJSA 3MO3A 1Z8GA 3STIA 3D62A 4FUCA 3MU1A 1MCTA 3N7OA 2FEQH 3DD2H 1DXWA 1QJ6B 1O5AB 4B2AA 3U8OH 1TPSA 3FP6E 3KQDA 3BG4C 4NIYA 3A82A 1T8LA 5J4SA 1MQ5A 3GDUA 2ZFTA 1DX5M 4AN7A 2AEIH 3U9AH 3AASA 2BD9A 3M5NA 2ZTZA 3SNBA 1BDAA 1E34B 3A8DA 1RIWB 1UTPA 2ZHWH 3MU4A 1T7CA 3ZZ5A 1CSOE 3TNSA 1LQEA 1MD7A 4I32A 1F0RA 3QK1A 5ABWA 3IITA 2BZ6H 4MDSA 1EAXA 1OWDA 3G01A 1IOEA 2GT8A 1G9IE 3UWJH 4AFQA 5FAHA 2R0LA 3MI4A 1O3BA 2WUCA 1QRWA 1IAUA 1HJ9A 3RMLH 3BTHE 2R0KA 1LQDB 1W2KH 1Y5AT 3E16B 2FMJA 1Y59T 3UTUH 3SBKA 3FZZA 1GG6B 4ISHH 1O2RA 5C20A 1C5VA 3A7TA 1TRMA 2FP7B 4DCDA 2G52A 3ZVEA 4HFPB 4Q7YA 1O2XA 1T32A 2XWBI 1S81A 2OUAA 1YPLH 1XMNB 2ZQ2A 1TE0A 1Y5BT 2A2QH 2PR3A 4IS5A 1BTXA 4GSOA 3VXEH 2ZDVH 3TGJE 4X6OA 2H1UA 1CGHA 5C5NA 2QXHA 3M7QA 4Y10E 2TGDA 1KLTA 2QF3A 4U01A 1O2YA 1IQMA 1DS2E 5C1XA 1AMHA 1P12E 1AHTH 1EATA 1P2JA 2YOLA 6LPRA 5F8ZA 1VGCC 1PFXC 4JK6A 5L30H 3SQHE 1GBDA 1ZLRA 5L2ZH 5C1YA 1FI8A 1C1SA 4JZEH 1BA8B 2ZPRA 1AI8H 1P2OA 1TNIA 1VCQA 2G51A 7LPRA 3CS0A 2EI6A 2A7CA 1A0HB 1SGDE 3RXGA 1HAYB 3KIDU 5HYOA 4KTUA 1G32B 1V6DA 2ZFRH 1YPMH 3GCOA 2H9HA 5EXMA 1EPTB 3SHCH 3Q77A 1OOKB 2VIOA 5A8ZA 1G3BA 2ANYA 1KIGH 3RXIA 1KXAA 1H8DH 3RMOH 3SW2B 3PYHA 1XX9A 1SLUB 3LGTA 1WQSA 2P3FH 1GBEA 1GJ9B 2W7SA 3VPKA 3BTQE 2BZAA 2O9QA 1XKAC 1C1MA 1QCPA 6GCHG 2Y6TA 2P3UB 3RXEA 1OP8A 1GJ4H 1P01A 3O8DA 4LZ4B 1ZRBA 3LJJA 3RDZA 2ZGBH 3A83A 5L2YH 5JBAS 1AVWA 4FU8A 1ZR0A 2OINA 4I33A 5I46H 2ALVA 3PLPA 2AGIX 1QNJA 3GY3A 1OWJA 2V35A 1TWXB 4BOHA 2ZWLH 3LGYA 1HIAB 2BHGA 2ZIQH 2EI7A 3LIWA 3S69A 4YLUA 2A5KA 2G5VA 1V2TT 3SUGA 1VCPA 2FOBA 3TPIZ 3VGCB 1EZUC 1GBJA 2NU0E 3UY9A 2WPIS 3OX7U 3U1JB 2F3CE 2AMPA 4Q7ZA 1EB1H 1FMGA 1Q2WA 4Y8XA 4U2WA 7GCHF 2ZHEH 1LHDH 1ANEA 1F5KU 1HYLA 2H6MA 2F91A 2GMTC 1NRRH 4AFSA 1AQ7A 4HGCA 2ESTE 1LKAA 4CRCA 2FLBH 5A0BA 2VNTA 1UVTH 2ZGXH 3A89A 1A1RA 1CE5A 1ZJKA 1YLCA 2WV5A 1DANH 5EQQA 4HI3A 5T6FA 3L3TA 4Y11E 1J9CH 1GI7B 1EXFA 5EXNA 1P11E 4SGAE 3LH1A 4DT7B 5K7RA 2PHBA 2SGFE 1LHEH 2V0BA 2GZ8A 2R3UA 1C1OA 1QIXB 1GI6A 3A87A 1W14U 2BD5A 1W7XH 4XOJA 2BVXH 2C8WB 4UDWH 1YCPH 1TBQH 2G55A 1B5GH 3RP2A 1F5RA 3EGKH 5A8XA 4WJG2 4Y79A 2XC0A 2Y5HA 4F49A 2ZHFH 2TPIZ 1BHXB 1BITA 3H7TA 4SGBE 4YM9A 1ESTA 1UJ1A 1SLXB 1ELVA 2TBSA 1DDJA 2GX4A 1UHBB 1QB6A 4UONA 4U30A 1DPOA 2FESH 3LOXA 3DUXH 2FDAA 2PKAB 1MKWK 2A2XH 3P92A 1A3EH 1XUGA 2VU8E 1YBWA 3P8NA 1UVPA 1GHBG 2GV6A 5ETXA 1GDNA 1EAUA 3GY8A 1GI8B 3ZVAA 4D8NA 4AGJA 3CS7A 1AKSB 1ELEE 1CHOF 1C1VH 1PPHE 2GCHG 3BTDE 1YCPM 4I8JA 1INCA 2TGTA 3M35A 2ZGJA 3PO1B 3MNBA 3T28A 1KLJH 4X6MA 1X7AC 1F92A 4ISIH 4WMFA 3L33A 1V2NT 3F1SB 1V2PT 3MU5A 1L1GA 1SFIA 1PQ7A 4B71A 1ZTJA 3K6ZA 3OY5U 1P09A 2G4UA 2Z6BD 1ZRKA 3ATMA 1SGTA 4H6TA 1MCVA 4IMZA 1PQAA 1LHFH 2JETB 2BXTH 2SFAA 2XC5A 1HAPH 4X6NA 5DGJA 1P57B 1BZXE 3BTTE 5JBTA 1JOUB 2J34A 1YYY1 1O3LA 3PM3A 3SHAH 1K1NA 1QB9A 1HAZB 4MPVA 5CHAB 3SORA 3MWIU 4J2YB 4CBNA 1E38B 2G00A 3AVZA 1UCYE 2STBE 5FX5A 4NWLA 1QL9A 2A7HA 2O8MA 1P3EA 3AAVA 3TJVA 1XUFA 2Y5FA 4INKA 4A1VA 1GI0A 2PSXA 4MTBA 1AD8H 3BEUA 2AMDA 1GL1A 1DY9A 1K1LA 2FS9A 5TJXA 1UK2A 5FHTA 2GVFA 2VH0A 3E90B 1ELDE 1O2SA 4ISNA 3QWCH 3SU4A 1SGQE 2ZDNA 1TGSZ 1EB2A 3U1IB 4JYTA 1O2PA 3OYPA 3O8RA 2W7UA 1A46H 2A5IA 4K5ZA 3RXVA 1VCWA 5EODA 3RC4A 4B75A 4A7IB 1Y3XA 4K8BA 5AHGH 3PWBA 2Q1JA 2P94A 1SR5C 3V7TA 1CT2E 1SQAA 2ALPA 2GV7A 5EU8A 2VJ1A 2AERH 3AW1A 4XDEA 2G81E 3OU0A 2O8TA 1ORFA 1GDQA 1EPTA 2TIOA 2BB4A 3ZZ9A 1HB0B 2Z3DA 1O3IA 4ZHAA 1Z8JB 1WUNH 2GCTB 2WUBA 1SC8U 2FWWA 4ZKNU 3SV2H 4ZXXH 3T5FH 1ZPBA 3GCTF 1CBWC 1ZSJA 4Y71A 1ZSKA 1RTKA 1FV9A 1G3CA 2ZCLP 1UTLM 1P8VC 1C2MA 1BJUA 1NRQH 1GI3A 1TPPA 1P9SA 3JZ1B 2BVRH 2CF8H 1QR3E 2CXVA 2GT7A 1O3NA 3BG4B 3FP7E 3OTJE 3NWUA 4CH8B 8LPRA 2OXSA 1QBVH 2WPHS 4Y76A 1K1IA 4OS2A 1O2VA 3IG6B 3ODDA 1VITH 4TY6A 4NGAH 2FTLE 1QA0A 3MYWA 1BUIA 4LOYH 2C90B 1HIAA 2AH4X 1RTLA 1PQ8A 1AUTC 2HOBA 4R0IA 3PTBA 3UQVA 4XFQA 4BTIB 1NESE 1FUJA 5EPNA 1ELGA 2UUFB 1RTFB 1K1OA 1DUEA 2HGTH 3T27A 1Y8TA 4JZ1A 5E8EH 8GCHG 1GL0E 1S0RA 3TGIE 2AFQB 5J4QA 2GGVB 5FBIA 5TCCA 4GHQA 3WY8A 3VEQB 1FQ3A 2BD8A 2H2ZA 4ABJA 4BAMB 4AGKA 5DP9A 5A8YA 5C67A 3SJOA 2OCVB 3QDZB 3Q76A 1FAKH 4YZUA 3A80A 3GCHC 1FN6A 4YO9A 1P3CA 4M7GA 1YLDA 1CVWH 4ZHLU 4DY7B 1C5MD 3M3VA 4O3UA 2QA9E 3SJIA 5DP6A 2J95A 3ZZ3A 1A0JA 3SZNA 1TA6A 4WH8A 2SGPE 1DSUA 1BBRE 1NPMA 1ESBA 1BMLA 1ANCA 3MMGA 2P8OC 3TK9A 3TH4H 1OWHA 4DURA 1GJAB 2W3KA 1ZTKA 4I8KA 1S6HA 1FPCH 2I6QA 1NY22 5HXFA 3PB1E 1EX3A 1ETTH 1O2GH 4VGCC 4KTSA 4MPUA 1E37B 2FTMA 2J92A 1AE8H 1Y3VA 1NTPA 1G37A 1V2QT 3T29A 1TGBA 1UHBA 1JWTA 1BTYA 1HAVA 3P8GA 5FBEA 1Z71A 1YM0A 1GCDA 4MPWA 3TVJB 3VB5A 1PPCE 1TX8A 3NXPA 1F2SE 1V2LT 3BEFB 2R9PA 3QX5H 2PKAA 2BD7A 2V3OH 4NG9H 2ZP0H 5GDSH 1W0YH 5GCHF 3GY7A 2SGEE 3NZIA 2Q6FA 3LKWA 2QN5T 2BLQA 1S84A 3TIUA 3U8RH 1P06A 5EQSA 4ZHMU 5A2MH 2IPHA 1AKSA 4FUJA 1FDPA 4IMQA 2J2UA 1HAHH 1WBGB 3E3TA 3SU5A 4AB9A 1UMAH 1HJ8A 4NA8A 2OC1A 3LGIA 1TMTH 2ZC9H 5HM9A 3EA9A 3A85A 4DOQA 2OC0A 3H7OA 1QTFA 1O34A 1C2LA 4MLFB 1RRKA 2HNTF 3MU8A 4TWYA 1EJAA 2D26C 1SL3A 1E35B 5JBCS 3K2UA 1WTGH 2NU4E 3FAOA 1TA2A 1NFUA 1EZQA 3FVFB 1TGTA 4IGDA 1Z1JA 3GYLB 3L6PA 5E0HA 2BDAA 2GD4B 2QAAA 2ZHQH 6GCHF 1GJ5H 3VB7A 1OPHB 3F6UH 1QQUA 2VGCC 3UR6A 1J16A 3B9FH 2A4GA 1AFQC 2CMYA 3RXRA 1LKBA 1A7SA 2FI3E 1DWDH 1O3PB 1G3DA 2J4IA 4X6PA 2BXUH 3TK5A 3ZV8A 3TJNA 2DE8A 4WY3A 2PW8H 4DVAU 1D3TB 1J8AA 2F9OA 3F9GA 1O3HA 2AIQA 4INLA 1AY6H 3RM2H 3GYMA 2VIPA 2VIDA 4ZXYH 2IN2A 2FZZA 4K60A 1Z6JH 1WQVH 4ABEA 2QCYA 1TFXA 4HTCH 4CH2B 3LONA 1O5BB 3S0NA 3P70B 4BTTB 3NK8A 2VWMA 1L2EA 1WV7H 1Y5UT 1V2OT 2C3SA 4AZ2B 1AWHB 1H9HE 3DHKH 2ZDAH 1GHYH 1QL8A 3P17H 4THNH 2BYAX 1ARCA 1DLKB 1GBTA 4YOGA 1ZOMA 1FNIA 1FPHH 2BD3A 4BNRA 3FP8E 3MH4A 1KDQA 3ZYDA 3A8AA 3KQCA 1ANBA 1OWEA 4ABGA 1NFXA 2B8OH 2UWLA 3MNSA 5BRRE 2PTNA 2A5AA 1O3AA 1WU1A 1QFKH 1HCGA 2WYGA 1QY6A 2NU3E 1EAWA 1Z1IA 4CRAA 1TLDA 2AGEX 4BAHB 1GHVH 1O2QA 2UWPA 5GIBA 2LNCA 4K1EA 3BTGE 3MU0A 1TQ0B 3DFJA 5DP5A 1O5GH 2P3TB 1IHTH 4Y6DA 1FY5A 4X8SH 1B0EA 2FLRH 1ARBA 1ABJH 2Z9KA 1OSSA 3RXTA 3KF2A 1M9UA 1EASA 3SI3H 1FZZA 1O2IA 4RSPA 2BX3A 4CR9A 1F0SA 3RUOA 1UCYK 2FXRA 2VINA 3VB4A 1GGDC 2UUJB 1SVPA 1ZTLA 2PLXA 1OYTH 3V0XA 1CA0C 3RU4E 1FAXA 1ZGVA 1VJ9U 1O2MA 1O3CA 2A1DB 4TY7A 3ZZCA 3UNRA 4O97A 1AU8A 1THPB 1W10U 1V2MT 1P2KA 1FIZA 1YPHC 2HWLB 2AIPA 2XC4A 3ATLA 2J94A 1P02A 2BD4A 4DJZB 1D9IA 1IQGA 1GHBF 1OYQA 1BJVA 1P04A 2M5TA 2FOCA 1O2UA 1OXGA 2GCHF 2UUYA 2NWNA 1IQKA 3VB3A 2W3IA 1JBUH 1GBBA 1FY8E 4MQAA 4UFFH 2HNTC 5JYIA 1MBMA 4KELA 3QN7A 1UCYH 2FX4A 1C1PA 2FPZA 5FPYA 3RXPA 2BOHB 1O0DH 1DT2A 4GUXA 3KHVA 4I8GA 3E1XB 5LPRA 1K9OE 3EA8A 2BY6X 9ESTA 3TGKE 4O03A 2ZGCA 3MNXA 1C9PA 1C5QA 3HK6B 2FI5E 2K1QA 1GMDG 3DT0H 1PPBH 4B74A 5E2OA 5L6NH 1O2NA 2H9EH 4I8HA 3VFEA 1JIRA 1P2NA 1K1MA 2FOHA 3MH5A 4KP0A 4K3JA 1N1LA 4MNYA 1T4UH 4GHTA 1CU1A 2GDDA 1ZYOA 1EQ9A 1QQ4A 1XKBC 4WWYA 4FUGA 4AFUA 2JKHA 2Z9JA 4YLQH 1L4ZA 3KQBA 3P95A 1CHGA 4GVUA 1SQTA 1BMAA 3C1KA 2BQ6B 3RXAA 3E0PB 3S7KB 3SGBE 5T3HA 3MNCA 4OGYA 1FY4A 1GJ6A 4WXVA 1O32A 1QB1A 4RKJB 1L0ZA 1MTWA 2F9BH 3E8LA 3HGNA 1XUJA 2XW9A 1GMCF 5GXPA 2JH5D 2H5DA 3ENSB 2G8TA 1C4V2 2OLGA 1LHCH 1D3QB 2EI8A 2VIQA 1G36A 1Z8IB 1RIWC 3ATWA 2ZDLA 4CREA 1DICA 1O5FH 3F9FA 5FCKA 5G4BA 3O8CA 1MU8B 1CBWB 2XBXA 3FZDA 1T8NA 2ZF0H 2XBWA 2CF9H 3Q3YA 4R8TB 2XWAA 3SJKA 5EW2H 3SUFA 3K6YA 1OKXA 2QIQA 1TX6A 2XNIA 3V13A 1GCTB 1KYNA 1A3BH 1P05A 2RG3A 1KXFA 1TNJA 1OX1A 1D4PB 1DY8A 1D3DB 1DE7H 4K1TA 5IYTA 2ANKH 1BBRK 3RXOA 1K21H 1ESAA 2C93B 3UIRA 4XBCA 2ZG0H 3PLKA 1ZHPA 1BMNH 5EGMA 3CP7A 5DK1A 1BCUH 1O3OA 1J14A 2A7JA 4AG2A 1LHGH 1O2TA 1E36B 4JCNA 1YPHE 1TALA 4UEHH 4ZAEA 5JB9S 1T8MA 1GHXH 1GHAF 4B1TA 1B7XB 2ZFFH 1SMFE 1O35A 1UTOA 4ABIA 4ZKSU 2Z9LA 4WMDA 3TK6A 3RXKA 1U6QA 3LGVA 1MTNB 1EOJA 2HNTE 1NRPH 1P9UA 2A31A 1KTSB 1AFEH 3MH7A 1SGYE 3P8FA 4X1PU 1TOCB 4J1YA 4GPGA 2GP9B 5HMAA 3STJA 2FS8A 4LZ1H 1C5LH 1GBCA 2ZCKP 4ABHA 5E0GA 8GCHF 1C5RA 1IQJA 2ODQA 2R2WU 3FFGA 2OBOA 1RJXB 1TNGA 3M36A 4FUBA 4XE4A 1C5NH 3W94A 1MU6B 1V2KT 1UK3A 1OP2A 2VVVA 1MKWH 1A5HA 4NIXA 1S83A 4X8UH 2P8OB 1DWBH 1T31A 5SGAE 1GBHA 3EDXB 3PWCA 3SGAE 3BIUH 4AG1A 2STAE 1PPZA 1TONA 2A4OA 4FUHA 4CRFA 2R3YA 3RXUA 1GI5A 3TH2H 1O2WA 2PTCE 4VGCB 2CV3A 1SGPE 1AVGH 1AVXA 5CE1A 1ELFA 1EP6A 1GMHF 3RM0H 5JB8S 5FCRA 2Y82A 1HAGE 2D1JA 3M3SA 1MAXA 1QRXA 5C2ZA 1TPAE 4INHA 1DWCH 2BTCE 1P2QA 2BLOA 1C1TA 1GJDB 1NU7B 4ABAA 1O31A 3SU1A 1NU9A 1C1NA 1TMBH 3ZZDA 1XXFA 2VWLA 1VR1H 2PGBB 2ZO3H 5GWZA 1UTKA 1ZPZA 2BM2A 4XBBA 4GCHG 2DUCA 1MTSA 2QC2A 1O2LA 3DFLA 3EAJA 3VGCC 1WOFA 1N8OB 1TBRH 4FVBA 1GBLA 1W13U 1H9LB 1C5YB 1RFNA 2Z7FE 2WV4A 1Q31A 5HGGA 3SQEE 1EJMA 3A88A 2ZGHA 1EOLA 2VWOA 2Y80A 1S85A 3QTOH 3RMMH 3RXFA 2ZFSA 4JYVH 5AVDA 3CENA 1AZ8A 3ZYEA 5C1UA 2XCFA 3SV6A 2ZHDA 3PLBA 1BTPA 1SB1H 4UFEH 1SHYA 1J17T 4BXWA 1HBTH 2ZTXA 2F9PA 3K9XB 3SI4H 3RXHA 2XBYA 1ELAA 4Z0KA 3RC5A 4DGJA 1ZHRA 4WH6A 1CT0E 1QRZA 2ANMH 1G2MA 2LPRA 1AFQB 1FIWA 1O3MA 2FOFA 4X1QU 1C1WH 3HGPA 1SGIB 3NPSA 1UO6A 2ZA5A 1NRSH 3MO9A 4MNXA 4NSYA 1K22H 4I31A 4FUIA 1TOMH 5AF9H 3W95A 5ESTE 1F5LA 1SPJA 2FYQA 5HM2A 1AB9C 1MZDA 3MFJA 4XSKU 1MTUA 4O3TA 2JH6D 3U98H 3PROA 1C2HA 1L1JA 3RLYH 1PPFE 1Z8RA 4DIHH 2QGRA 4NA9H 4B76A 2P16A 1F0UA 4FU9A 1BOQA 1CHOG 1O3GA 3ZZ7A 5JDUB 3ATKA 1BTWA 3RXDA 1GVZA 4OS7A 1GI1A 4X8VH 1NO9H 3ITIA 2OQUA 3BV9B 1XM1A 3RXCA 1L1NA 4X2VA 4O9VA 1AO5A 3MTYA 1NZQH 3LU9B 1GHWH 4IC6A 4WMEA 5FPTA 1KXBA 1GPZA 2A45B 2R2MB 1VITG 3GY4A 1KXEA 1AE5A 1T8OA 3LJOA 4MVNA 3UPEA 1AGJA 1KSNA 4NIVA 3R3GB 1LTOA 4MNVA 2CJIA 3UR9A 2GTBA 4GLYA 2ZU4A 1EAIA 2GKVE 1TBZH 5K0HA 1IQLA 3ODFA 1KTTB 3PO1C 4JZFH 2PUXB 3KQEA 1O33A 3UOUA 2QXGA 2VIWA 1C2JA 2Z94A 1ID5H 4JYUH 3QGNB 3SN8A 4LXBH 1O2JA 4CRGA 4BAKB 2D8WA 4Y8YA 1PQ5A 1Z7KA 1O2KA 2DE9A 1VGCB 2OTVA 2THFB 1V2VT 2ZPQA 4X2WA 5DPAA 2Y5GA 2J9NA 1GGDB 4K8YA 2JH0D 3ZZ6A 5EXLA 3RXSA 1SLVB 1W7GH 1MTVA 3R0FA 1C2DA 1CA0B 1SGFG 2ZFQH 1O5CB 1DWEH 1ZPCA 1C4Y2 2W26A 2UUKB 1DITH 3GY6A 3RXQA 2ZI2H 1MUEB 1DXPA 3AW0A 1UTJA 1AUJA 2SGQE 3S7HB 1HGTH 1KY9A 2ZZUH 8KME2 1EUFA 1HLTH 3SUDA 2BY7X 3KL6A 2BQWB 4Q7XA 2OC7A 4U32A 5A0AE 2A4RA 1EKBB 2OD3B 4X0WU 2ZKSA 1RD3B 4NIWA 5F03A 2G5NA 1TX7A 2F9VA 2ODYB 1C5SA 1ABIH 2XYAA 4ABDA 4ZMAH 2ZU2A 1DOJA 1OWIA 1O39A 1F0TA 3NCLA 1HV7A 1YC0A 2VH6A 3GY5A 4FVDA 3UNQA 2ANWA 3A8BA 1ELTA 4ZKOU 1EJNA 1ZSLA 3PTNA 4CHAC 4ZUHA 3I78A 3NKKA 3M7UA 3BTKE 1O3JA 4TWWA 5F8XA 3NUMA 2QXIA 1PYTC 3E0NB 2ZPSA 3KCGH 3IWMA 3ZVBA 1UVOA 2ODPA 4NSVA 1IQFA 1HAXB 1ZZZA 5DJ7A 2C4FH 2PUQH 4Q2KA 1SGNE 4I7YH 6CHAC 3I29A 4NFFA 3JZ2B 4FUEA 1TNLA 1ZGIA 3BEIB 2GCTC 3RLWH 2YNAA 2PKSC 2BOKA 3QGJA 1EZXC 2I6SA 1V3XA 4UD9H 2VVCA 2GMTB 3LDXH 3PV4A 4D9RA 3SJ9A 3TNTA 1BRBE 1LVMA 1W12U 1SGFA 1GMDF 1MH0A 1A2CH 1SGRE 4JK5A 1FY3A 2BDBA 5DP8A 4MPXA 1A5GH 4D76A 2C8XB 1QJ1B 1SGEE 1WSSH 4NZLA 2FYRA 2F9NA 2Z9GA 1L4DA 2QY0B 3A86A 1RS0A 2TGPZ 1HNEE 1ETRH 4PROA 3LGUA 2FX6A 3RC6A 2V6NA 4KTCA 4K2YA 1A0LA 3FANA 2CN0H 1NROH 4ISLA 2CHAC 1V2JT 3LPRA 6ESTA 1ACBE 1SLWB 4I8LA 2PWXA 1TYNA 1O5DH 1YPGH 4YESB 1DM4B 1C1UH 1GI2A 1ELCA 4TPIZ 1ZHMA 3V3MA 3F9EA 1LVBA 3BTFE 3QO6A 5DP4A 4DW2U 1JIMA 4ZKRU 3M3TA 1HFDA 2ULLA 3UFAA 4AYVB 2IJOB 2B9LA 3F9HA 4JZDH 2YNBA 3S9AA 2BDGA 2BLVA 5EPYA 3TJOA 1TRNA 1MBQA 4H42U 1N6YA 4IW4E 5DKMA 1BTUA 2XRCA 4E05H 2HRVA 2OP9A 3ZZAA 1NS3A 1N6XA 1SOTA 1DUAA 5GCHG 3HKIB 1C5XB 1K1PA 4BANB 1MAYA 3UWIA 1BRCE 1C5TA 3T62A 3EYDA 1MKXK 3OY6U 1C5PA 5DP3A 1AIXH 1HJAC 5LGOA 2VIVA 5DG6A 1F7ZA 1GJBB 1MD8A 1LVOA 2BX4A 3ZV9A 1QJ7B 3K65B 4YT7H 1LVYA 3ZVFA 1K28D 2CGAA 3M37A 1C5UA 4FUFA 3SNAA 1GVLA 1UVUH 1TNHA 3U69H 9LPRA 1DFPA 1LPGB 3HATH 1ETSH 1TRYA 2FM2A 5I25A 1V2ST 4YTAA 1LO6A 3QLPH 1QBOA 3S9CA 3M61U 3ZZ4A 1E0FD 4NA7A 5F6MA 1Q3XA 1UVSH 2ZU1A 5A0CA 2Z3CA 5EW1H 1D6WA 3QZQA 2H9TH 1CA8B 2OBQA 3BTME 1JRSA 3BN9A 2BY9X 1GBAA 1GI4A 2BDHA 2D2DA 2EA3A 3A7ZA 1GBKA 2P95A 1O2ZA 1MKXH 3TJUA 2FOGA 4AB8A 4CRBA 1NM6A 2XXLA 3M5LA 1LPZB 2GZ7A 1JRTA 1YPKH 1QBNA 1ZMJA 1KXDA 2O8LA 5E0JA 5FXLA 4X2XA 2FODA 5CMXH 1BQYA 4IN2A 5JPMH 1C5OH 2BY5X 1YKTA 3TLOA 4IN1A 1SQOA 2GZ9A 4DG4A 3SU0A 3UREA 1FXYA 2VWNA 1XUHA 3E6PH 3P8OA 1UTQA 2O8UA 1NFYA 4X1SU 3ZVCA 1BTHH 4Y7AA 1C5WB 3C27B 1CT4E 1YCPK 2Y7XA 2KAIB 1SI5H 1O3DA 1Z6EA 3RXBA 3Q3XA 1GHZA 2HVXA 1YF4A 1IQNA 4OS1A 3A7VA 5JBBS 1O30A 1PPEE 4ISOA 4K69A 1QL7A 5A09A 1W3CA 4CR5A 4AOQA 1J15A 1PPGE 2AGGX 7KMEH 2BMGB 1IQHA 1HAOH 4Y0YE 1OS8A 1OWKA 2AYWA 1G3EA 4A6LA 4F4OC 3PMHB 5DP7A 3M5OA 3URCA 4GCHF 1GVKB 1S6FA 5EQRA 3GDSA 1FLEE 3BIVH 1CO7E 2Z9IA 3MHWU 2FOEA 4FXGH 4Q80A 2OQ5A 3BTEE 4X8TH 5C5OA 1THRH 2A4QA 1YPEH 1MMJN 1K1JA 1JXPA 2BLWA 1TMUH 1EP5A 2BQ7B 2O8WA 3M5MA 2ZU3A 2AS9A 2HPPH 1ANDA 2PSYA 4B2BA 3ESTA 2RDLA 3QZRA 3F68H 1GG6C 1LPKB 1WTHD 1DSTA 1FY1A
chains in the Genus database with same CATH superfamily
4WVPE 3VB6A 2TGAA 3LT3A 3LC5A 3HPTB 4X1RU 1AB9B 5EG4A 2W5EA 5EOKA 1Y3WA 1GI9B 1XVMA 4AFZA 3VXFH 3SJ8A 2IOTA 2NU2E 4ZROA 3U8TH 1LDTT 1TGCA 2WPMS 3SOSA 2Y7ZA 1BHXF 1SOZA 3I77A 4Y7BA 3TU7H 1XVOA 1W0ZU 1HAVB 1IHSH 3KNXA 4BAOB 4BAQB 3FN8A 2AMQA 2BVSH 2QYIA 4NZQA 4BTUB 2HPQH 1W8BH 3GCHB 4MNWA 3DA9B 3KEEA 1P03A 2B5TB 2WINI 3A8CA 4ZH8A 1T4VH 3RXLA 2L74A 1D6RA 4H6SB 4YOIA 5PTPA 4YT6H 5B6OA 3EQ0H 1O37A 2P93A 4D7FA 1KMHB 1O3EA 2HALA 1K2I1 1SGCA 1BBRH 3ZVGA 1AN1E 2C8ZB 3SYJA 5FX6A 1GJ8B 1C2FA 3GDVA 1C1QA 2SGDE 3A81A 3D65E 1V2WT 4JZIA 3TITA 1C2GA 3GISB 5GPIB 1AWFH 4XBDA 1NFWA 1BIOA 2PFEA 2PGQB 4LK4A 2ZQ1A 1EPTC 3BTWE 4MG3A 3OSYA 2XBVA 2RA3A 1ELBA 2WYJA 1FN8A 2B0FA 1VITF 4ABFA 1NN6A 1O36A 1TNKA 1V2UT 1HRTH 1HXEH 2F43B 1QA7A 2SGAA 2BDYA 5FPSA 1O2HA 3GY2A 1NC6A 4KKDA 1G30B 1YGCH 4IBLH 4NWKA 2C8YB 2BDCA 8ESTE 7GCHG 5IDKA 2ZU5A 1VZQH 1XUKA 3D23A 3SUEA 4ASHA 1BRUP 2J97A 3A7WA 2RCEA 3RXJA 3Q3KA 1WYKA 2KZ4A 1FX0B 2WPJS 2Z3EA 3P6ZB 1SSXA 1EZSC 3MO6A 3SNEA 1O2OA 4A1XA 1GJ7B 1YP9A 3GOVB 1H9IE 3T25A 1SFQB 2FOAA 1C1RA 1C4U2 2QXJA 4AYYB 5C3NA 1THSH 3CNRA 3RMNH 2ZDMA 4OS6A 1BRAA 1BB0B 1GMCG 4AX9H 2K8IA 4CRDA 3UUZA 4ESTE 2BDIA 5LPEA 4AORA 2F9UA 2G4TA 3UB0A 4CHAB 1GBIA 4OS4A 3ELAH 2F83A 5LPFA 1GBFA 2BY8X 3A7YA 2WPLS 3D49H 2ZEBA 4IC5A 1BMMH 1JMOH 5C0UA 1KDQB 2HLCA 4OGXA 1GWAA 4ACAA 4B2CA 2TRMA 1TAWA 1IQIA 1ZMNA 1NT1A 1C9TA 6CHAB 4QT8C 2VGCB 1LMWB 2VB0A 3KN2A 2SNWA 1TB6H 4OS5A 1KLIH 2ZTYA 1P0SH 1TIOA 2FIRH 2QV1A 1TQ7B 2V3HH 2UWOA 2Q6DA 2PKSB 4BXSA 1LCYA 1HXFH 2ZCHP 1CQQA 1RGQA 1GDUA 1GJCB 1H1BA 3QUMP 2WPKS 4WXIA 1C2KA 4K1SA 4ABBA 4Y0ZE 2ILNA 1VJAU 3HK3B 3BF6H 1H8IH 1S6LA 4A1TA 1CGIE 1SHHB 1GHAG 1GCTC 1O5EH 1P10A 3LH3A 1K0HA 2XCNA 1BT7A 4X1NU 5DO4H 3BG8A 3T2NA 1TPOA 3TH3H 1A5IA 4B73A 2FI4E 3SGQE 1DVAH 1C5ZB 3QTVH 2Y81A 3DSGA 1QURH 2WV9A 4CBOA 3SNCA 4Y8ZA 1SG8B 2ZECA 4NFEA 2KAIA 3GCNA 4X2YA 3M7TA 3B23B 1QHRB 2CHAB 2WSSD 3SO3A 1PJPA 1DLEA 2NU1E 4E7NA 1O38A 3MH6A 3SV9A 2FO9A 3T26A 3O8BA 4E06H 3SZEA 5CDFE 3URDA 2ZNKH 4A92A 1A4WH 2EEKA 4FUDA 3SU6A 1MTNC 1UTNA 3BSQA 1BTZA 3Q00A 3SU2A 2PP6A 3PMBB 1V2RT 4JMYA 3SV8A 3EE0B 2LP6A 3DCLA 3UQOA 2A32A 4H4FA 5BPEA 4D7GA 1C2IA 1XUIA 4RN6A 2QF0A 1G2LA 2J38A 3V12A 1AZZA 3RXMA 1GMHG 4DIIH 7ESTE 3LC3A 2FOMB 3VG8A 2ZDKA 3F0OA 3E91A 1OHHD 4TYDA 1HUTH 3OE7D 3SU3A 1S5SA 3SNDA 2JETC 4RKOB 4UFGH 4D9QA 4TPYA 1FONA 1W0KD 3ZZ8A 5LH8A 3GICB 3PMJA 5T6GA 1P2MA 2RA0A 3SV7A 1UK4A 1HJAB 1H4WA 1YPJH 4UFDH 1Y3UA 3EA7A 4NCYA 1S82A 3B8JA 5CHAC 3RU4T 5AFYH 4E7RG 1OP0A 3DSOA 1RXPA 1SBWA 1HDTH 1XXDA 3AAUA 5AFZH 5F8TA 3RU4D 5E2PA 1S0QA 1C2EA 4KGAA 1W11U 2EC9H 1QGFA 1ZMLA 1IQEA 1B0FA 5EJZA 2A0QB 5T6DA 4A5TS 4UE7H 3PMAB 2ASUB 2JDID 1GBMA 5ESBA 2PV9B 4HZHA 1MZAA 1O3FA 1A61H 2OC8A 3ZVDA 1TABE 2Q6GA 2P59A 1PYTD 1O3KA 2GDEH 1D3PB 3UNSA 5GJ4B 3A84A 3GCTG 4Z6AH 1HAIH 3LGWA 5H4IB 2VVUA 2H5CA 2XTTB 1KXCA 3HKJB 3H5CB 5TCAA 3S9BA 1HPGA 1P2IA 4GAWA 1NRNH 1N8OC 2SNVA 2ZFPH 1CGJE 3KGPA 3A7XA 1UTMA 2BD2A 1WAYB 4YOJA 1MQ6A 4FU7A 2F4LA 4WF8A 1Y3YA 1TGNA 3ATIA 3ZZBA 1ZJDA 1WCZA 2B7DH 3MOCA 1BMFD 3UOPA 1FJSA 3MO3A 1Z8GA 3STIA 3D62A 4FUCA 3MU1A 1MCTA 3N7OA 2FEQH 3DD2H 1DXWA 1QJ6B 1O5AB 4DT4A 4B2AA 3U8OH 1TPSA 3FP6E 3KQDA 3BG4C 4NIYA 3A82A 1T8LA 5J4SA 1MQ5A 3GDUA 2ZFTA 1DX5M 4AN7A 2AEIH 2J98A 3U9AH 3AASA 2BD9A 3M5NA 2ZTZA 3SNBA 1BDAA 1E34B 3A8DA 1RIWB 1UTPA 2ZHWH 3MU4A 1T7CA 3ZZ5A 1CSOE 4AC9A 3H09A 3TNSA 1LQEA 1MD7A 4I32A 1F0RA 3QK1A 5ABWA 3IITA 2BZ6H 4MDSA 1EAXA 1OWDA 3G01A 1IOEA 2GT8A 1G9IE 3UWJH 4AFQA 5FAHA 2R0LA 3MI4A 1O3BA 2WUCA 1QRWA 1IAUA 1HJ9A 3RMLH 3BTHE 2R0KA 1LQDB 1W2KH 1Y5AT 3E16B 2FMJA 3F3BA 1Y59T 3UTUH 3SBKA 3FZZA 1GG6B 4ISHH 1O2RA 5C20A 1C5VA 3A7TA 1TRMA 2FP7B 4DCDA 2G52A 3ZVEA 1SKYE 4HFPB 4Q7YA 1O2XA 1T32A 2XWBI 1S81A 2OUAA 1YPLH 1XMNB 2ZQ2A 1TE0A 1Y5BT 2A2QH 2PR3A 4IS5A 1BTXA 4GSOA 3VXEH 2ZDVH 3TGJE 4X6OA 2H1UA 1CGHA 5C5NA 2QXHA 3M7QA 4Q4LA 4Y10E 2TGDA 1KLTA 2QF3A 4U01A 1O2YA 1IQMA 1DS2E 5C1XA 1AMHA 1P12E 1AHTH 1EATA 1P2JA 2YOLA 6LPRA 5F8ZA 1VGCC 1PFXC 4JK6A 5L30H 3SQHE 1GBDA 1ZLRA 5L2ZH 5C1YA 5GNDA 1FI8A 1C1SA 4JZEH 1BA8B 2ZPRA 1AI8H 1P2OA 1TNIA 1VCQA 2G51A 7LPRA 3CS0A 2EI6A 2A7CA 2L6OA 1A0HB 1SGDE 3RXGA 1HAYB 3KIDU 5HYOA 4KTUA 1G32B 1V6DA 2ZFRH 1YPMH 3GCOA 3DSPA 2H9HA 3N7DA 5EXMA 1EPTB 3SHCH 3Q77A 1OOKB 2VIOA 5A8ZA 1G3BA 2ANYA 1KIGH 3RXIA 1KXAA 1H8DH 3RMOH 3SW2B 3PYHA 2AHME 1XX9A 1SLUB 3LGTA 1WQSA 2P3FH 1GBEA 1GJ9B 2W7SA 3VPKA 3BTQE 2BZAA 2O9QA 1XKAC 1C1MA 1QCPA 6GCHG 2Y6TA 2P3UB 3RXEA 1OP8A 1GJ4H 1P01A 5CHBA 3O8DA 4LZ4B 1ZRBA 3LJJA 5KECA 3RDZA 2ZGBH 3A83A 5L2YH 5JBAS 1AVWA 4FU8A 1ZR0A 2OINA 4I33A 5I46H 2ALVA 3PLPA 2AGIX 1QNJA 3GY3A 1OWJA 2V35A 1TWXB 4BOHA 2ZWLH 3OEHD 3LGYA 1HIAB 2BHGA 2ZIQH 2EI7A 3LIWA 3S69A 4YLUA 2A5KA 2G5VA 1V2TT 3SUGA 1VCPA 2FOBA 4B6FA 3TPIZ 3VGCB 1EZUC 1GBJA 2NU0E 3UY9A 2WPIS 1H8HD 3OX7U 3U1JB 2F3CE 2AMPA 4Q7ZA 1EB1H 1FMGA 1Q2WA 4Y8XA 4U2WA 7GCHF 2ZHEH 1LHDH 1ANEA 1F5KU 1HYLA 2H6MA 2F91A 2GMTC 1NRRH 4AFSA 1AQ7A 4HGCA 2ESTE 1LKAA 4CRCA 2FLBH 5A0BA 2VNTA 1UVTH 2ZGXH 3A89A 1A1RA 1CE5A 1ZJKA 1YLCA 2WV5A 1DANH 5EQQA 4HI3A 5T6FA 3L3TA 1WDIA 4Y11E 5DN6D 1J9CH 1GI7B 1EXFA 5EXNA 1P11E 2K0QA 4SGAE 3LH1A 4DT7B 5K7RA 2PHBA 2SGFE 1LHEH 2V0BA 2GZ8A 2R3UA 1C1OA 2LELA 1QIXB 1GI6A 3A87A 1W14U 2BD5A 1W7XH 4XOJA 2BVXH 2C8WB 4UDWH 1YCPH 2JIZD 1TBQH 2G55A 1B5GH 3RP2A 1F5RA 3EGKH 5A8XA 4WJG2 4Y79A 2XC0A 2Y5HA 4F49A 2ZHFH 2TPIZ 1BHXB 1BITA 3H7TA 4SGBE 4YM9A 1ESTA 1UJ1A 1SLXB 1ELVA 2TBSA 5C17A 1DDJA 2GX4A 1UHBB 1QB6A 4UONA 4U30A 1DPOA 2FESH 3LOXA 3DUXH 5C0TA 2FDAA 2PKAB 1MKWK 2A2XH 3P92A 3W1EA 1A3EH 1XUGA 2VU8E 5EJLA 1YBWA 3P8NA 1UVPA 1GHBG 2GV6A 5ETXA 1GDNA 1EAUA 3GY8A 1GI8B 3ZVAA 4D8NA 4AGJA 3CS7A 1AKSB 1ELEE 5KGOA 1CHOF 1C1VH 1PPHE 2GCHG 3BTDE 1YCPM 4I8JA 1INCA 2TGTA 3M35A 2ZGJA 3PO1B 3MNBA 3T28A 1KLJH 4X6MA 1X7AC 1F92A 4ISIH 4WMFA 1E79D 3L33A 1V2NT 3F1SB 1V2PT 1YY3A 3MU5A 3GS9A 1L1GA 2WPDD 1SFIA 1PQ7A 4B71A 1ZTJA 3K6ZA 3F2FA 4B6EA 3OY5U 1P09A 2G4UA 2Z6BD 1ZRKA 3ATMA 1SGTA 4H6TA 1MCVA 4IMZA 1PQAA 1LHFH 2JETB 3PV5A 2BXTH 2SFAA 4FOUC 2XC5A 1HAPH 4X6NA 5DGJA 1P57B 1BZXE 3BTTE 3WWBA 5JBTA 1JOUB 2J34A 1YYY1 1O3LA 3OEED 3PM3A 3FKSD 3SHAH 1K1NA 1QB9A 1HAZB 4MPVA 5CHAB 3SORA 3MWIU 4J2YB 4CBNA 1E38B 2G00A 3AVZA 1UCYE 2STBE 5FX5A 4NWLA 1QL9A 4Z1MD 2A7HA 2O8MA 1P3EA 3AAVA 3TJVA 1XUFA 2Y5FA 4INKA 4A1VA 1GI0A 2PSXA 4MTBA 1AD8H 3BEUA 2AMDA 1GL1A 1DY9A 1K1LA 2FS9A 5TJXA 1UK2A 5FHTA 2GVFA 2VH0A 3E90B 1ELDE 1O2SA 4ISNA 3QWCH 2GJGA 3SU4A 1SGQE 2ZDNA 1TGSZ 1EB2A 3U1IB 4JYTA 1O2PA 3OYPA 3O8RA 2W7UA 1A46H 2A5IA 4K5ZA 3RXVA 1VCWA 5EODA 3RC4A 4B75A 4A7IB 1Y3XA 4K8BA 5AHGH 3PWBA 3FOAA 2Q1JA 2P94A 1SR5C 3V7TA 1CT2E 1SQAA 2ALPA 2GV7A 5EU8A 2VJ1A 2AERH 3AW1A 4XDEA 2G81E 3OU0A 1ORFA 1GDQA 2O8TA 1EPTA 2TIOA 2BB4A 3ZZ9A 1HB0B 2Z3DA 1O3IA 4ZHAA 1Z8JB 1WUNH 2GCTB 2WUBA 1SC8U 2FWWA 4ZKNU 3SV2H 4ZXXH 3T5FH 1ZPBA 3GCTF 1CBWC 1ZSJA 4Y71A 1ZSKA 1RTKA 1FV9A 1G3CA 2ZCLP 1UTLM 1P8VC 1C2MA 1BJUA 1NRQH 1GI3A 1TPPA 1P9SA 3JZ1B 2BVRH 2CF8H 1QR3E 2CXVA 2GT7A 1O3NA 3BG4B 3FP7E 3OTJE 3NWUA 4CH8B 8LPRA 2OXSA 1QBVH 2WPHS 4Y76A 1K1IA 4OS2A 1O2VA 3IG6B 3ODDA 1VITH 4TY6A 4NGAH 2FTLE 1QA0A 3MYWA 1BUIA 4LOYH 2C90B 1HIAA 2AH4X 3ZIAD 1RTLA 1PQ8A 1AUTC 2HOBA 4R0IA 3PTBA 3UQVA 2JJ2D 4XFQA 4BTIB 3WW7A 1NESE 1FUJA 5EPNA 1ELGA 2UUFB 1RTFB 1K1OA 1DUEA 2HGTH 3T27A 4F48B 1Y8TA 4OM9A 4JZ1A 5E8EH 8GCHG 1GL0E 1S0RA 3TGIE 2AFQB 3ATLA 3WWFA 5J4QA 2GGVB 5FBIA 5TCCA 4GHQA 3WY8A 3VEQB 1FQ3A 2BD8A 2H2ZA 4ABJA 4BAMB 4AGKA 5DP9A 3NRLA 5A8YA 5C67A 3SJOA 2OCVB 3QDZB 3Q76A 1FAKH 4YZUA 3A80A 3GCHC 1FN6A 4YO9A 1P3CA 4M7GA 1YLDA 1CVWH 4ZHLU 4DY7B 1C5MD 3M3VA 4O3UA 2QA9E 3SJIA 5DP6A 2J95A 3ZZ3A 1A0JA 3SZNA 1TA6A 4WH8A 4FETA 2SGPE 1DSUA 1BBRE 1NPMA 5EIYA 1ESBA 1BMLA 1ANCA 3MMGA 2P8OC 3TK9A 3TH4H 1OWHA 4DURA 1GJAB 2W3KA 1ZTKA 4I8KA 1S6HA 3FO8D 1FPCH 2I6QA 1NY22 5HXFA 3PB1E 1EX3A 1ETTH 1O2GH 4VGCC 4KTSA 4MPUA 1E37B 2FTMA 2J92A 1AE8H 1EFRD 1Y3VA 1NTPA 1G37A 1V2QT 2V7QD 3T29A 1TGBA 1UHBA 3UAIC 1JWTA 1BTYA 1HAVA 3P8GA 5FBEA 1Z71A 1YM0A 1GCDA 4MPWA 3TVJB 3VB5A 1PPCE 1TX8A 3NXPA 1F2SE 1V2LT 3BEFB 2R9PA 3QX5H 2PKAA 2BD7A 2V3OH 3KQ5A 4NG9H 2ZP0H 5GDSH 1W0YH 5GCHF 3GY7A 2SGEE 3F0PA 2Q6FA 3NZIA 3LKWA 2QN5T 2BLQA 1S84A 3TIUA 3U8RH 1P06A 5EQSA 4ZHMU 5A2MH 2IPHA 1AKSA 5HKKD 4FUJA 1FDPA 4IMQA 2J2UA 1HAHH 1WBGB 3E3TA 3SU5A 4AB9A 1UMAH 1HJ8A 4NA8A 2OC1A 3LGIA 4I86A 1TMTH 2ZC9H 5HM9A 3EA9A 3A85A 4DOQA 2KCYA 2OC0A 3H7OA 1QTFA 1O34A 1C2LA 4MLFB 1RRKA 2HNTF 1VKYA 3MU8A 4TWYA 1EJAA 2D26C 1SL3A 1E35B 5JBCS 3K2UA 1WTGH 2V3MA 2NU4E 3FAOA 1TA2A 1NFUA 1EZQA 3FVFB 1TGTA 4IGDA 1Z1JA 3GYLB 3L6PA 5E0HA 2BDAA 2GD4B 2QAAA 2ZHQH 6GCHF 1GJ5H 3VB7A 1OPHB 3F6UH 1QQUA 2VGCC 3UR6A 1J16A 4ZCNA 3B9FH 2A4GA 2IPQX 1AFQC 2CMYA 3RXRA 1LKBA 1A7SA 2FI3E 1DWDH 1O3PB 1G3DA 2J4IA 4X6PA 2BXUH 3TK5A 3ZV8A 3TJNA 2DE8A 4WY3A 2PW8H 4DVAU 1NBME 1D3TB 1J8AA 2F9OA 3F9GA 2YMSB 1O3HA 2AIQA 4INLA 1AY6H 3RM2H 3GYMA 2VIPA 3F2HA 2VIDA 4ZXYH 2IN2A 2FZZA 4K60A 1Z6JH 1WQVH 4ABEA 2HLDD 4M9FA 2QCYA 1TFXA 4HTCH 4CH2B 3LONA 1O5BB 3S0NA 3P70B 4BTTB 3NK8A 2VWMA 1L2EA 1WV7H 1Y5UT 1V2OT 2C3SA 4AZ2B 1AWHB 1H9HE 3DHKH 2ZDAH 1GHYH 1QL8A 3P17H 4P02A 4THNH 5C94A 2BYAX 1ARCA 1DLKB 1GBTA 4YOGA 1ZOMA 1FNIA 1FPHH 2BD3A 4BNRA 3FP8E 3MH4A 1KDQA 3ZYDA 3A8AA 3KQCA 1ANBA 1OWEA 2KR7A 4ABGA 1NFXA 2B8OH 2UWLA 3MNSA 5BRRE 2PTNA 2A5AA 1O3AA 1WU1A 1QFKH 1HCGA 2WYGA 1QY6A 2NU3E 1EAWA 1Z1IA 4CRAA 1TLDA 2AGEX 4BAHB 1GHVH 3N7EA 1O2QA 2UWPA 5GIBA 4YXWD 2LNCA 4K1EA 3BTGE 3MU0A 3U28C 1TQ0B 3DFJA 5DP5A 1O5GH 2P3TB 1IHTH 4Y6DA 1FY5A 4X8SH 1B0EA 2FLRH 1ARBA 1ABJH 2Z9KA 1OSSA 3RXTA 3KF2A 1M9UA 1EASA 3SI3H 1FZZA 1O2IA 4RSPA 2BX3A 4CR9A 1F0SA 3RUOA 1UCYK 2FXRA 2VINA 3VB4A 1UW7A 1GGDC 2UUJB 1SVPA 1ZTLA 2PLXA 1OYTH 3V0XA 1CA0C 3RU4E 4HG6A 1FAXA 1ZGVA 1VJ9U 1O2MA 1O3CA 2A1DB 4TY7A 3ZZCA 3UNRA 4O97A 1E1QD 1AU8A 1THPB 1W10U 1V2MT 1P2KA 1FIZA 1YPHC 2HWLB 2AIPA 2VBCA 2XC4A 2J94A 1P02A 2BD4A 2M2AA 3PV2A 4DJZB 1D9IA 1IQGA 1GHBF 4P00A 1OYQA 1BJVA 1P04A 2M5TA 2FOCA 1O2UA 1OXGA 2GCHF 2UUYA 2NWNA 1IQKA 3VB3A 2W3IA 1JBUH 1GBBA 2KCOA 1FY8E 4MQAA 4UFFH 2HNTC 5JYIA 1MBMA 4KELA 3QN7A 1UCYH 2FX4A 1C1PA 2FPZA 5FPYA 3RXPA 2BOHB 1O0DH 1DT2A 4GUXA 3KHVA 4I8GA 3E1XB 5LPRA 1K9OE 3EA8A 2BY6X 9ESTA 3KYGA 5B6LA 3TGKE 4O03A 2ZGCA 3MNXA 1C9PA 1C5QA 3HK6B 2FI5E 2K1QA 1GMDG 3DT0H 1PPBH 4B74A 5E2OA 5L6NH 1O2NA 2H9EH 4I8HA 3VFEA 1JIRA 1COWD 1K1MA 1P2NA 2FOHA 3MH5A 4KP0A 4K3JA 1N1LA 4MNYA 1T4UH 4GHTA 1CU1A 2GDDA 1ZYOA 1EQ9A 1QQ4A 2YMSD 1XKBC 4WWYA 4FUGA 4AFUA 2JKHA 2OK5A 2Z9JA 4YLQH 1L4ZA 3KQBA 3P95A 1CHGA 4GVUA 1SQTA 1BMAA 3C1KA 2BQ6B 3RXAA 3E0PB 1SQRA 3S7KB 3SGBE 5T3HA 1WXRA 3MNCA 4OGYA 1FY4A 1GJ6A 4WXVA 1O32A 1QB1A 4RKJB 1L0ZA 1MTWA 2F9BH 3E8LA 3HGNA 1XUJA 2XW9A 2J5UA 1GMCF 5GXPA 2JH5D 2H5DA 3ENSB 2G8TA 1C4V2 2OLGA 1LHCH 2XOKD 1D3QB 2EI8A 2VIQA 1G36A 1Z8IB 1RIWC 3ATWA 2ZDLA 4CREA 1DICA 1O5FH 2RDEA 2KM0A 3F9FA 3KYFA 5FCKA 5G4BA 3O8CA 1MU8B 1CBWB 2XBXA 3FZDA 1T8NA 2ZF0H 2XBWA 2CF9H 3Q3YA 4R8TB 2XWAA 3SJKA 5EW2H 3SUFA 3K6YA 1OKXA 2QIQA 1TX6A 2XNIA 3V13A 1GCTB 1KYNA 1A3BH 1P05A 2RG3A 1KXFA 1TNJA 1OX1A 1D4PB 1DY8A 1D3DB 1DE7H 4K1TA 5IYTA 2ANKH 2KFWA 1BBRK 3RXOA 1K21H 1ESAA 2C93B 3UIRA 4XBCA 2ZG0H 3OTPA 1ZHPA 1BMNH 3PLKA 5EGMA 3CP7A 5DK1A 1BCUH 1O3OA 1J14A 2A7JA 4AG2A 1LHGH 1O2TA 1E36B 4JCNA 1YPHE 1TALA 4UEHH 4ZAEA 5JB9S 1T8MA 1GHXH 1GHAF 4B1TA 1B7XB 2ZFFH 1SMFE 1O35A 1UTOA 4ABIA 4ZKSU 2Z9LA 4WMDA 3TK6A 3RXKA 1U6QA 3LGVA 1MTNB 4TT3D 1EOJA 2HNTE 1NRPH 1P9UA 2A31A 1KTSB 1AFEH 3MH7A 1SGYE 3P8FA 2KCPA 4X1PU 1TOCB 3MQKC 4J1YA 4GPGA 2GP9B 5HMAA 3STJA 2FS8A 4LZ1H 1C5LH 1GBCA 2ZCKP 4ABHA 5E0GA 8GCHF 1C5RA 1IQJA 2ODQA 2R2WU 3FFGA 2OBOA 1RJXB 1TNGA 3M36A 4FUBA 4XE4A 1C5NH 3W94A 1MU6B 1V2KT 1UK3A 1OP2A 2VVVA 1MKWH 1A5HA 4NIXA 1S83A 4X8UH 2P8OB 3OFND 1DWBH 1T31A 5SGAE 1GBHA 3EDXB 3PWCA 3SGAE 3BIUH 4AG1A 2STAE 1PPZA 1TONA 2A4OA 4FUHA 4CRFA 2R3YA 3RXUA 1GI5A 3N99A 3TH2H 1O2WA 2PTCE 4VGCB 2CV3A 1SGPE 1AVGH 1AVXA 5CE1A 1ELFA 1EP6A 1GMHF 3RM0H 5JB8S 5FCRA 2Y82A 1HAGE 2D1JA 4XD7D 3M3SA 1MAXA 1QRXA 5C2ZA 1TPAE 4INHA 2J98B 1DWCH 2BTCE 1P2QA 2BLOA 1C1TA 1GJDB 1NU7B 4ABAA 2KX4A 1O31A 3SU1A 1NU9A 1C1NA 1TMBH 4RT0A 3ZZDA 1XXFA 2WZQA 2VWLA 1VR1H 2PGBB 2ZO3H 5GWZA 1UTKA 1ZPZA 2BM2A 4XBBA 4GCHG 2DUCA 1MTSA 2QC2A 1O2LA 3DFLA 3EAJA 3VGCC 1WOFA 5DSFA 1N8OB 1TBRH 4FVBA 1GBLA 1W13U 1H9LB 1C5YB 1RFNA 2Z7FE 2WV4A 1Q31A 5HGGA 3SQEE 1EJMA 3A88A 2ZGHA 1EOLA 2VWOA 2Y80A 1S85A 3QTOH 3RMMH 1H8ED 2ZFSA 3RXFA 4JYVH 5AVDA 3CENA 1AZ8A 3ZYEA 5C1UA 2XCFA 3SV6A 2ZHDA 3PLBA 1BTPA 1SB1H 4UFEH 1SHYA 1J17T 4BXWA 1HBTH 2ZTXA 2F9PA 3K9XB 3SI4H 3RXHA 2XBYA 1ELAA 4Z0KA 3RC5A 4DGJA 1ZHRA 4WH6A 1CT0E 1QRZA 2ANMH 1G2MA 2LPRA 5FL7D 1AFQB 1MABB 1FIWA 1O3MA 2FOFA 4X1QU 1C1WH 3HGPA 1SGIB 3NPSA 1UO6A 2ZA5A 1NRSH 3MO9A 5HIZA 4MNXA 4NSYA 1K22H 2JJ1D 4I31A 4FUIA 1TOMH 5AF9H 3W95A 5ESTE 1F5LA 1SPJA 2FYQA 5HM2A 1AB9C 1MZDA 3MFJA 4XSKU 1MTUA 4O3TA 2JH6D 3U98H 4Q63A 3PROA 1C2HA 1L1JA 3EE7A 3RLYH 1PPFE 1Z8RA 4DIHH 2QGRA 4NA9H 4B76A 1F0UA 2P16A 4FU9A 1BOQA 1CHOG 1O3GA 3ZZ7A 5JDUB 4ASUD 1NBMD 3ATKA 1BTWA 3RXDA 1GVZA 4OS7A 1GI1A 4X8VH 1NO9H 3ITIA 2OQUA 3BV9B 1XM1A 3RXCA 1L1NA 4X2VA 4O9VA 1AO5A 3MTYA 1NZQH 3LU9B 1GHWH 4IC6A 4WMEA 5FPTA 1KXBA 1GPZA 2A45B 2R2MB 1VITG 3GY4A 1KXEA 1AE5A 1T8OA 3LJOA 4MVNA 3UPEA 1AGJA 1KSNA 4NIVA 3R3GB 1LTOA 4MNVA 2CJIA 3UR9A 2GTBA 4GLYA 2ZU4A 1EAIA 2GKVE 1TBZH 5K0HA 1IQLA 3ODFA 1KTTB 3PO1C 4JZFH 2PUXB 3KQEA 1O33A 3UOUA 2QXGA 2VIWA 1C2JA 2Z94A 1ID5H 4JYUH 3QGNB 3SN8A 4LXBH 1O2JA 4CRGA 4BAKB 2D8WA 4Y8YA 1PQ5A 1Z7KA 1O2KA 2DE9A 1VGCB 2OTVA 2THFB 2EQNA 1V2VT 2ZPQA 2HVYB 4X2WA 5DPAA 2Y5GA 5KEDA 5F53A 2J9NA 1GGDB 4K8YA 2JH0D 3ZZ6A 5EXLA 3RXSA 1SLVB 1W7GH 1MTVA 3R0FA 4RT1A 1C2DA 1CA0B 1SGFG 2ZFQH 1O5CB 2CK3D 1DWEH 1ZPCA 5EJ1A 1C4Y2 2W26A 2UUKB 1DITH 3GY6A 3RXQA 2ZI2H 1MUEB 1DXPA 3AW0A 1UTJA 1AUJA 2SGQE 3S7HB 1HGTH 1KY9A 2ZZUH 8KME2 1EUFA 1HLTH 3SUDA 2BY7X 3KL6A 2BQWB 4Q7XA 2OC7A 4U32A 5A0AE 2A4RA 1EKBB 2OD3B 4X0WU 2ZKSA 1RD3B 4NIWA 5F03A 2G5NA 1TX7A 2QE7D 2F9VA 2ODYB 1C5SA 1ABIH 2XYAA 4ABDA 4ZMAH 2ZU2A 1DOJA 1OWIA 1O39A 1F0TA 3NCLA 1HV7A 1YC0A 2VH6A 3GY5A 4FVDA 3UNQA 2ANWA 2EY4C 3A8BA 1ELTA 4ZKOU 1EJNA 1ZSLA 3PTNA 4CHAC 4ZUHA 3I78A 3NKKA 3M7UA 3BTKE 5T1VA 1O3JA 4TWWA 5F8XA 3NUMA 2QXIA 1PYTC 3E0NB 2ZPSA 3KCGH 3IWMA 3ZVBA 3AK5A 1UVOA 2ODPA 3PRBA 4NSVA 1IQFA 1HAXB 1ZZZA 5DJ7A 2C4FH 2PUQH 4Q2KA 1SGNE 4I7YH 6CHAC 3I29A 4NFFA 3JZ2B 4FUEA 1TNLA 1ZGIA 3BEIB 2GCTC 3RLWH 2YNAA 2PKSC 2BOKA 3QGJA 1EZXC 2I6SA 1V3XA 4UD9H 2VVCA 2GMTB 3LDXH 3PV4A 4D9RA 3SJ9A 2W6JD 3TNTA 1BRBE 1LVMA 1W12U 1SGFA 1GMDF 1MH0A 1A2CH 1SGRE 4JK5A 1FY3A 2BDBA 5DP8A 4MPXA 3PRDA 1A5GH 4D76A 2C8XB 1QJ1B 1SGEE 1WSSH 4NZLA 1E1RD 1QZ8A 1YLNA 2FYRA 2F9NA 2Z9GA 1L4DA 2QY0B 3A86A 1RS0A 2TGPZ 2W6ID 1HNEE 1ETRH 4PROA 3LGUA 2FX6A 3RC6A 2V6NA 4KTCA 4K2YA 1A0LA 3FANA 4RI0A 4XRNA 2CN0H 1NROH 4ISLA 2CHAC 1V2JT 3LPRA 6ESTA 2WHXA 3F2GA 1ACBE 1SLWB 4I8LA 2PWXA 1TYNA 1O5DH 1YPGH 4YESB 1DM4B 1C1UH 1GI2A 1ELCA 4TPIZ 1ZHMA 3V3MA 3F9EA 1LVBA 3BTFE 3QO6A 5DP4A 4DW2U 1JIMA 4ZKRU 3M3TA 1HFDA 2ULLA 3UFAA 4AYVB 2IJOB 2B9LA 3F9HA 4JZDH 2YNBA 3S9AA 2BDGA 2BLVA 5EPYA 3TJOA 1TRNA 1MBQA 4H42U 1N6YA 4IW4E 5DKMA 1BTUA 2RFKC 2XRCA 4E05H 2HRVA 2OP9A 3ZZAA 1NS3A 1N6XA 1SOTA 1DUAA 5GCHG 3HKIB 1C5XB 1K1PA 4BANB 1MAYA 3UWIA 1BRCE 1C5TA 3T62A 3EYDA 1MKXK 3OY6U 1C5PA 5DP3A 1AIXH 1HJAC 5LGOA 2VIVA 5DG6A 1F7ZA 1GJBB 1MD8A 1LVOA 2BX4A 3ZV9A 1QJ7B 3K65B 4YT7H 1LVYA 3ZVFA 1K28D 2CGAA 3M37A 1C5UA 4FUFA 3SNAA 1GVLA 1UVUH 1TNHA 3U69H 9LPRA 1DFPA 1LPGB 3HATH 1ETSH 1TRYA 2FM2A 5I25A 4ACBA 1V2ST 4YTAA 1LO6A 3QLPH 1QBOA 3S9CA 3M61U 3ZZ4A 1E0FD 4NA7A 5F6MA 1Q3XA 1UVSH 2ZU1A 5A0CA 2QF4A 2Z3CA 5EW1H 1D6WA 3QZQA 2H9TH 1CA8B 2OBQA 3BTME 2KCAA 1JRSA 3BN9A 2BY9X 2QF5A 1GBAA 1GI4A 2BDHA 2D2DA 2EA3A 3A7ZA 1GBKA 2P95A 1O2ZA 1MKXH 3TJUA 2FOGA 4AB8A 4CRBA 2IJD1 1NM6A 2XXLA 3M5LA 1LPZB 2GZ7A 1JRTA 1YPKH 1QBNA 1ZMJA 1KXDA 2O8LA 5E0JA 5FXLA 4X2XA 2FODA 5CMXH 1BQYA 4IN2A 5JPMH 1C5OH 2BY5X 1YKTA 3TLOA 4IN1A 1SQOA 2GZ9A 4DG4A 3SU0A 3UREA 1FXYA 2VWNA 1XUHA 1YWUA 3E6PH 3P8OA 1UTQA 2O8UA 1NFYA 4X1SU 3ZVCA 1BTHH 4Y7AA 1C5WB 3C27B 1CT4E 1YCPK 2Y7XA 2KAIB 1SI5H 1O3DA 1Z6EA 3RXBA 3Q3XA 1GHZA 2HVXA 1YF4A 1IQNA 4OS1A 3A7VA 5JBBS 1O30A 1PPEE 4ISOA 4K69A 1QL7A 5A09A 1W3CA 5IK2D 1W0JD 4CR5A 4AOQA 1J15A 1PPGE 2AGGX 7KMEH 2BMGB 2YMSC 1IQHA 1HAOH 4Y0YE 1OS8A 1OWKA 2AYWA 1G3EA 4A6LA 4F4OC 3PMHB 5DP7A 3M5OA 3URCA 4GCHF 1GVKB 1S6FA 5HIYA 5EQRA 3GDSA 1FLEE 3BIVH 4TSFD 2XNDD 1CO7E 2Z9IA 3MHWU 2FOEA 4FXGH 4Q80A 2OQ5A 3BTEE 4X8TH 5C5OA 1THRH 2A4QA 1YPEH 1MMJN 1K1JA 1JXPA 2BLWA 1TMUH 1EP5A 2BQ7B 2O8WA 3OAAD 3M5MA 2ZU3A 4F55A 2AS9A 2HPPH 1ANDA 2PSYA 4B2BA 3ESTA 2RDLA 3QZRA 3F68H 1GG6C 1LPKB 1WTHD 1DSTA 1FY1A
chains in the Genus database with same CATH topology
4WVPE 3VB6A 2TGAA 3LT3A 3LC5A 3HPTB 4X1RU 1AB9B 5EG4A 2W5EA 5EOKA 1Y3WA 1GI9B 1XVMA 4AFZA 3VXFH 3SJ8A 2IOTA 2NU2E 4ZROA 3U8TH 1LDTT 1TGCA 2WPMS 3SOSA 2Y7ZA 1BHXF 1SOZA 3I77A 4Y7BA 3TU7H 1XVOA 1W0ZU 1HAVB 1IHSH 3KNXA 4BAOB 4BAQB 2AMQA 2BVSH 2QYIA 4NZQA 4BTUB 2HPQH 1W8BH 3GCHB 4MNWA 3DA9B 3KEEA 1P03A 2B5TB 2WINI 3A8CA 4ZH8A 1T4VH 3RXLA 4H6SB 1D6RA 4YOIA 5PTPA 5B6OA 4YT6H 3EQ0H 1O37A 2P93A 4D7FA 1O3EA 2HALA 1K2I1 1SGCA 1BBRH 3ZVGA 1AN1E 2C8ZB 5FX6A 1GJ8B 1C2FA 3GDVA 1C1QA 2SGDE 3A81A 3D65E 1V2WT 4JZIA 3TITA 1C2GA 3GISB 5GPIB 1AWFH 4XBDA 1NFWA 1BIOA 2PFEA 2PGQB 4LK4A 2ZQ1A 1EPTC 3BTWE 4MG3A 3OSYA 2XBVA 2RA3A 1ELBA 2WYJA 1FN8A 2B0FA 1VITF 4ABFA 1NN6A 1O36A 1TNKA 1V2UT 1HRTH 1HXEH 2SGAA 1QA7A 2BDYA 5FPSA 1O2HA 3GY2A 1NC6A 4KKDA 1G30B 1YGCH 4IBLH 4NWKA 2C8YB 2BDCA 8ESTE 7GCHG 5IDKA 2ZU5A 1VZQH 1XUKA 3D23A 3SUEA 4ASHA 1BRUP 3A7WA 2RCEA 3RXJA 3Q3KA 1WYKA 2WPJS 2Z3EA 3P6ZB 1SSXA 1EZSC 3MO6A 3SNEA 1O2OA 4A1XA 1GJ7B 1YP9A 3GOVB 1H9IE 3T25A 1SFQB 2FOAA 1C1RA 1C4U2 2QXJA 4AYYB 5C3NA 1THSH 3RMNH 2ZDMA 4OS6A 1BRAA 1BB0B 1GMCG 4AX9H 4CRDA 3UUZA 4ESTE 2BDIA 5LPEA 4AORA 2F9UA 2G4TA 4CHAB 1GBIA 4OS4A 3ELAH 2F83A 5LPFA 1GBFA 2BY8X 3A7YA 2WPLS 3D49H 2ZEBA 4IC5A 1BMMH 1JMOH 1KDQB 2HLCA 4OGXA 1GWAA 4B2CA 2TRMA 1TAWA 1IQIA 1ZMNA 1NT1A 1C9TA 6CHAB 4QT8C 2VGCB 1LMWB 2VB0A 3KN2A 2SNWA 1TB6H 4OS5A 1KLIH 2ZTYA 1P0SH 1TIOA 2FIRH 2QV1A 1TQ7B 2V3HH 2UWOA 2Q6DA 2PKSB 4BXSA 1LCYA 1HXFH 2ZCHP 1CQQA 1RGQA 1GDUA 1GJCB 1H1BA 3QUMP 2WPKS 4WXIA 1C2KA 4K1SA 4ABBA 4Y0ZE 2ILNA 1VJAU 3HK3B 3BF6H 1H8IH 4A1TA 1CGIE 1SHHB 1GHAG 1GCTC 1O5EH 1P10A 3LH3A 2XCNA 1BT7A 4X1NU 5DO4H 3BG8A 3T2NA 1TPOA 3TH3H 1A5IA 4B73A 2FI4E 3SGQE 1DVAH 1C5ZB 3QTVH 2Y81A 1QURH 4CBOA 3SNCA 4Y8ZA 1SG8B 2ZECA 4NFEA 2KAIA 3GCNA 4X2YA 3M7TA 3B23B 1QHRB 2CHAB 3SO3A 1PJPA 1DLEA 2NU1E 4E7NA 1O38A 3MH6A 3SV9A 2FO9A 3T26A 3O8BA 4E06H 3URDA 2ZNKH 4A92A 1A4WH 2EEKA 4FUDA 3SU6A 1MTNC 1UTNA 3BSQA 1BTZA 3Q00A 3SU2A 3PMBB 1V2RT 4JMYA 3SV8A 3EE0B 3UQOA 2A32A 4H4FA 5BPEA 4D7GA 1C2IA 1XUIA 4RN6A 2QF0A 1G2LA 2J38A 3V12A 1AZZA 3RXMA 1GMHG 4DIIH 7ESTE 3LC3A 2FOMB 2ZDKA 3E91A 4TYDA 1HUTH 3SU3A 1S5SA 3SNDA 2JETC 4RKOB 4UFGH 4D9QA 4TPYA 1FONA 3ZZ8A 5LH8A 3GICB 3PMJA 5T6GA 1P2MA 2RA0A 3SV7A 1UK4A 1HJAB 1H4WA 1YPJH 4UFDH 1Y3UA 3EA7A 4NCYA 1S82A 3B8JA 5CHAC 3RU4T 5AFYH 4E7RG 1OP0A 1RXPA 1SBWA 1HDTH 1XXDA 3AAUA 5AFZH 5F8TA 3RU4D 5E2PA 1S0QA 1C2EA 4KGAA 1W11U 2EC9H 1QGFA 1ZMLA 1IQEA 1B0FA 2A0QB 5T6DA 4A5TS 4UE7H 3PMAB 2ASUB 1GBMA 5ESBA 2PV9B 4HZHA 1MZAA 1O3FA 1A61H 2OC8A 3ZVDA 1TABE 2Q6GA 2P59A 1PYTD 1O3KA 2GDEH 1D3PB 3UNSA 5GJ4B 3A84A 3GCTG 4Z6AH 1HAIH 3LGWA 5H4IB 2VVUA 2H5CA 2XTTB 1KXCA 3HKJB 3H5CB 5TCAA 3S9BA 1HPGA 1P2IA 4GAWA 1NRNH 1N8OC 2SNVA 2ZFPH 1CGJE 3KGPA 3A7XA 1UTMA 2BD2A 1WAYB 4YOJA 1MQ6A 4FU7A 4WF8A 1Y3YA 1TGNA 3ATIA 3ZZBA 1ZJDA 1WCZA 2B7DH 3MOCA 3UOPA 1FJSA 3MO3A 1Z8GA 3STIA 3D62A 4FUCA 3MU1A 1MCTA 3N7OA 2FEQH 3DD2H 1DXWA 1QJ6B 1O5AB 4B2AA 3U8OH 1TPSA 3FP6E 3KQDA 3BG4C 4NIYA 3A82A 1T8LA 5J4SA 1MQ5A 3GDUA 2ZFTA 1DX5M 4AN7A 2AEIH 3U9AH 3AASA 2BD9A 3M5NA 2ZTZA 3SNBA 1BDAA 1E34B 3A8DA 1RIWB 1UTPA 2ZHWH 3MU4A 1T7CA 3ZZ5A 1CSOE 3TNSA 1LQEA 1MD7A 4I32A 1F0RA 3QK1A 5ABWA 3IITA 2BZ6H 4MDSA 1EAXA 1OWDA 3G01A 1IOEA 2GT8A 1G9IE 3UWJH 4AFQA 5FAHA 2R0LA 3MI4A 1O3BA 2WUCA 1QRWA 1IAUA 1HJ9A 3RMLH 3BTHE 2R0KA 1LQDB 1W2KH 1Y5AT 3E16B 2FMJA 1Y59T 3UTUH 3SBKA 3FZZA 1GG6B 4ISHH 1O2RA 5C20A 1C5VA 3A7TA 1TRMA 2FP7B 4DCDA 2G52A 3ZVEA 4HFPB 4Q7YA 1O2XA 1T32A 2XWBI 1S81A 2OUAA 1YPLH 1XMNB 2ZQ2A 1TE0A 1Y5BT 2A2QH 2PR3A 4IS5A 1BTXA 4GSOA 3VXEH 2ZDVH 3TGJE 4X6OA 2H1UA 1CGHA 5C5NA 2QXHA 3M7QA 4Y10E 2TGDA 1KLTA 2QF3A 4U01A 1O2YA 1IQMA 1DS2E 5C1XA 1AMHA 1P12E 1AHTH 1EATA 1P2JA 2YOLA 6LPRA 5F8ZA 1VGCC 1PFXC 4JK6A 5L30H 3SQHE 1GBDA 1ZLRA 5L2ZH 5C1YA 1FI8A 1C1SA 4JZEH 1BA8B 2ZPRA 1AI8H 1P2OA 1TNIA 1VCQA 2G51A 7LPRA 3CS0A 2EI6A 2A7CA 1A0HB 1SGDE 3RXGA 1HAYB 3KIDU 5HYOA 4KTUA 1G32B 1V6DA 2ZFRH 1YPMH 3GCOA 2H9HA 5EXMA 1EPTB 3SHCH 3Q77A 1OOKB 2VIOA 5A8ZA 1G3BA 2ANYA 1KIGH 3RXIA 1KXAA 1H8DH 3RMOH 3SW2B 3PYHA 1XX9A 1SLUB 3LGTA 1WQSA 2P3FH 1GBEA 1GJ9B 2W7SA 3VPKA 3BTQE 2BZAA 2O9QA 1XKAC 1C1MA 1QCPA 6GCHG 2Y6TA 2P3UB 3RXEA 1OP8A 1GJ4H 1P01A 3O8DA 4LZ4B 1ZRBA 3LJJA 3RDZA 2ZGBH 3A83A 5L2YH 5JBAS 1AVWA 4FU8A 1ZR0A 2OINA 4I33A 5I46H 2ALVA 3PLPA 2AGIX 1QNJA 3GY3A 1OWJA 2V35A 1TWXB 4BOHA 2ZWLH 3LGYA 1HIAB 2BHGA 2ZIQH 2EI7A 3LIWA 3S69A 4YLUA 2A5KA 2G5VA 1V2TT 3SUGA 1VCPA 2FOBA 3TPIZ 3VGCB 1EZUC 1GBJA 2NU0E 3UY9A 2WPIS 3OX7U 3U1JB 2F3CE 2AMPA 4Q7ZA 1EB1H 1FMGA 1Q2WA 4Y8XA 4U2WA 7GCHF 2ZHEH 1LHDH 1ANEA 1F5KU 1HYLA 2H6MA 2F91A 2GMTC 1NRRH 4AFSA 1AQ7A 4HGCA 2ESTE 1LKAA 4CRCA 2FLBH 5A0BA 2VNTA 1UVTH 2ZGXH 3A89A 1A1RA 1CE5A 1ZJKA 1YLCA 2WV5A 1DANH 5EQQA 4HI3A 5T6FA 3L3TA 4Y11E 1J9CH 1GI7B 1EXFA 5EXNA 1P11E 4SGAE 3LH1A 4DT7B 5K7RA 2PHBA 2SGFE 1LHEH 2V0BA 2GZ8A 2R3UA 1C1OA 1QIXB 1GI6A 3A87A 1W14U 2BD5A 1W7XH 4XOJA 2BVXH 2C8WB 4UDWH 1YCPH 1TBQH 2G55A 1B5GH 3RP2A 1F5RA 3EGKH 5A8XA 4WJG2 4Y79A 2XC0A 2Y5HA 4F49A 2ZHFH 2TPIZ 1BHXB 1BITA 3H7TA 4SGBE 4YM9A 1ESTA 1UJ1A 1SLXB 1ELVA 2TBSA 1DDJA 2GX4A 1UHBB 1QB6A 4UONA 4U30A 1DPOA 2FESH 3LOXA 3DUXH 2FDAA 2PKAB 1MKWK 2A2XH 3P92A 1A3EH 1XUGA 2VU8E 1YBWA 3P8NA 1UVPA 1GHBG 2GV6A 5ETXA 1GDNA 1EAUA 3GY8A 1GI8B 3ZVAA 4D8NA 4AGJA 3CS7A 1AKSB 1ELEE 1CHOF 1C1VH 1PPHE 2GCHG 3BTDE 1YCPM 4I8JA 1INCA 2TGTA 3M35A 2ZGJA 3PO1B 3MNBA 3T28A 1KLJH 4X6MA 1X7AC 1F92A 4ISIH 4WMFA 3L33A 1V2NT 3F1SB 1V2PT 3MU5A 1L1GA 1SFIA 1PQ7A 4B71A 1ZTJA 3K6ZA 3OY5U 1P09A 2G4UA 2Z6BD 1ZRKA 3ATMA 1SGTA 4H6TA 1MCVA 4IMZA 1PQAA 1LHFH 2JETB 2BXTH 2SFAA 2XC5A 1HAPH 4X6NA 5DGJA 1P57B 1BZXE 3BTTE 5JBTA 1JOUB 2J34A 1YYY1 1O3LA 3PM3A 3SHAH 1K1NA 1QB9A 1HAZB 4MPVA 5CHAB 3SORA 3MWIU 4J2YB 4CBNA 1E38B 2G00A 3AVZA 1UCYE 2STBE 5FX5A 4NWLA 1QL9A 2A7HA 2O8MA 1P3EA 3AAVA 3TJVA 1XUFA 2Y5FA 4INKA 4A1VA 1GI0A 2PSXA 4MTBA 1AD8H 3BEUA 2AMDA 1GL1A 1DY9A 1K1LA 2FS9A 5TJXA 1UK2A 5FHTA 2GVFA 2VH0A 3E90B 1ELDE 1O2SA 4ISNA 3QWCH 3SU4A 1SGQE 2ZDNA 1TGSZ 1EB2A 3U1IB 4JYTA 1O2PA 3OYPA 3O8RA 2W7UA 1A46H 2A5IA 4K5ZA 3RXVA 1VCWA 5EODA 3RC4A 4B75A 4A7IB 1Y3XA 4K8BA 5AHGH 3PWBA 2Q1JA 2P94A 1SR5C 3V7TA 1CT2E 1SQAA 2ALPA 2GV7A 5EU8A 2VJ1A 2AERH 3AW1A 4XDEA 2G81E 3OU0A 2O8TA 1ORFA 1GDQA 1EPTA 2TIOA 2BB4A 3ZZ9A 1HB0B 2Z3DA 1O3IA 4ZHAA 1Z8JB 1WUNH 2GCTB 2WUBA 1SC8U 2FWWA 4ZKNU 3SV2H 4ZXXH 3T5FH 1ZPBA 3GCTF 1CBWC 1ZSJA 4Y71A 1ZSKA 1RTKA 1FV9A 1G3CA 2ZCLP 1UTLM 1P8VC 1C2MA 1BJUA 1NRQH 1GI3A 1TPPA 1P9SA 3JZ1B 2BVRH 2CF8H 1QR3E 2CXVA 2GT7A 1O3NA 3BG4B 3FP7E 3OTJE 3NWUA 4CH8B 8LPRA 2OXSA 1QBVH 2WPHS 4Y76A 1K1IA 4OS2A 1O2VA 3IG6B 3ODDA 1VITH 4TY6A 4NGAH 2FTLE 1QA0A 3MYWA 1BUIA 4LOYH 2C90B 1HIAA 2AH4X 1RTLA 1PQ8A 1AUTC 2HOBA 4R0IA 3PTBA 3UQVA 4XFQA 4BTIB 1NESE 1FUJA 5EPNA 1ELGA 2UUFB 1RTFB 1K1OA 1DUEA 2HGTH 3T27A 1Y8TA 4JZ1A 5E8EH 8GCHG 1GL0E 1S0RA 3TGIE 2AFQB 5J4QA 2GGVB 5FBIA 5TCCA 4GHQA 3WY8A 3VEQB 1FQ3A 2BD8A 2H2ZA 4ABJA 4BAMB 4AGKA 5DP9A 5A8YA 5C67A 3SJOA 2OCVB 3QDZB 3Q76A 1FAKH 4YZUA 3A80A 3GCHC 1FN6A 4YO9A 1P3CA 4M7GA 1YLDA 1CVWH 4ZHLU 4DY7B 1C5MD 3M3VA 4O3UA 2QA9E 3SJIA 5DP6A 2J95A 3ZZ3A 1A0JA 3SZNA 1TA6A 4WH8A 2SGPE 1DSUA 1BBRE 1NPMA 1ESBA 1BMLA 1ANCA 3MMGA 2P8OC 3TK9A 3TH4H 1OWHA 4DURA 1GJAB 2W3KA 1ZTKA 4I8KA 1S6HA 1FPCH 2I6QA 1NY22 5HXFA 3PB1E 1EX3A 1ETTH 1O2GH 4VGCC 4KTSA 4MPUA 1E37B 2FTMA 2J92A 1AE8H 1Y3VA 1NTPA 1G37A 1V2QT 3T29A 1TGBA 1UHBA 1JWTA 1BTYA 1HAVA 3P8GA 5FBEA 1Z71A 1YM0A 1GCDA 4MPWA 3TVJB 3VB5A 1PPCE 1TX8A 3NXPA 1F2SE 1V2LT 3BEFB 2R9PA 3QX5H 2PKAA 2BD7A 2V3OH 4NG9H 2ZP0H 5GDSH 1W0YH 5GCHF 3GY7A 2SGEE 3NZIA 2Q6FA 3LKWA 2QN5T 2BLQA 1S84A 3TIUA 3U8RH 1P06A 5EQSA 4ZHMU 5A2MH 2IPHA 1AKSA 4FUJA 1FDPA 4IMQA 2J2UA 1HAHH 1WBGB 3E3TA 3SU5A 4AB9A 1UMAH 1HJ8A 4NA8A 2OC1A 3LGIA 1TMTH 2ZC9H 5HM9A 3EA9A 3A85A 4DOQA 2OC0A 3H7OA 1QTFA 1O34A 1C2LA 4MLFB 1RRKA 2HNTF 3MU8A 4TWYA 1EJAA 2D26C 1SL3A 1E35B 5JBCS 3K2UA 1WTGH 2NU4E 3FAOA 1TA2A 1NFUA 1EZQA 3FVFB 1TGTA