4IMQA

Structural basis of substrate specificity and protease inhibition in norwalk virus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
183
structure length
173
Chain Sequence
GSAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like protease
publication title Structural basis of substrate specificity and protease inhibition in norwalk virus.
pubmed doi rcsb
source organism Norovirus hu/1968/us
molecule tags Hydrolase/hydrolase inhibitor
total genus 41
structure length 173
sequence length 183
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4imqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4imqA01
3SQHE 1S82A 1PFXC 2VGCC 4ZKSU 1IQHA 4XE4A 1YLCA 2DUCA 1GBHA 1O2JA 2BLOA 4UFGH 4UDWH 4QT8C 7GCHF 1DM4B 5F8XA 1A5IA 3M7TA 5E2OA 2ZO3H 3SNCA 3RXKA 1H4WA 1NU9A 2BB4A 2BVSH 5F8ZA 3T5FH 1GI4A 2KAIB 4ABBA 1BHXB 5LPRA 4FVBA 5HYOA 2KAIA 1TOMH 3ESTA 2OTVA 4O3UA 4OS7A 5A8ZA 1C2HA 1L1GA 3U8OH 3EYDA 4FUIA 2HNTF 4AGKA 1HLTH 1EATA 3A82A 4B76A 4NA8A 1HJAB 2FOGA 2VU8E 4J2YB 3ZZDA 3GY6A 9ESTA 3PTNA 2JH0D 4GAWA 3BTGE 1ZGIA 1QBVH 1GJAB 2ANYA 2GCTC 1BTUA 2V3OH 1Z1JA 1BTPA 2OD3B 1BRAA 1F92A 1GI0A 2Z9LA 5K0HA 2ZPRA 2PSXA 1AUTC 1ZHPA 1PPCE 1GI7B 1Z8JB 1FUJA 2P94A 2F9VA 3TVJB 2HNTC 1YPEH 2THFB 3M37A 2ZU1A 1LVBA 1AB9C 2VWLA 1B7XB 5CHAC 4CH2B 4AB9A 1EASA 3BV9B 4RKJB 3SOSA 4IW4E 1EP5A 4FU9A 5DO4H 4TWYA 3V12A 1HPGA 4AFUA 1GMDG 2J95A 3SUDA 4I8JA 1A0HB 4DW2U 2F9BH 3ZVGA 1BTXA 1TMUH 1UO6A 3NWUA 5A2MH 1O5DH 1CA8B 1Q2WA 1T8MA 2NU0E 1SOTA 1HAYB 2R0KA 3RMOH 3UOPA 2CHAC 3M7QA 1EPTC 4BTUB 2FS8A 3VB7A 1OYQA 1V2WT 3PO1B 1PPBH 4Z0KA 1O3JA 1EAUA 1ZPCA 2BOHB 2A1DB 2CN0H 3IITA 3CS7A 4H6SB 4WWYA 3SUGA 1K9OE 3MO3A 1UK3A 3JZ1B 4JYVH 3RXEA 2V3HH 1CT4E 1L1NA 4B73A 1B5GH 1ZSJA 3LIWA 1QIXB 3B9FH 2ZCKP 1OP0A 1AWFH 5GPIB 1AKSB 5CMXH 1KDQB 1AHTH 2FS9A 3M3SA 4RN6A 1UTPA 3C27B 3ATMA 1E34B 3GOVB 1V2QT 2G8TA 1GHZA 1MZDA 2GZ7A 1FN8A 5AF9H 1HB0B 1YPJH 4BAHB 1GI2A 3DT0H 4UFEH 1SBWA 1GJ4H 1QY6A 2PFEA 6GCHG 4A1VA 1ID5H 3SJOA 2AGIX 2Y7XA 1GL1A 3ZZ9A 1UK2A 2Y80A 1WTHD 1ABIH 2GVFA 1WYKA 2J2UA 3FVFB 1BDAA 1J14A 1WBGB 5DP8A 3LU9B 4I32A 1WQSA 1DY8A 5FAHA 3ZYDA 2BY8X 3P8FA 1ZRKA 4LOYH 2D26C 3ZZ8A 4BTTB 2CGAA 1S84A 1XXDA 4IN2A 2FYRA 2A4QA 2NU3E 4I8KA 2A31A 2GT7A 3M5LA 9LPRA 1CHOF 1GHVH 5LPFA 1AZ8A 2TGAA 1V2RT 4CHAB 1XUKA 2QCYA 3FZZA 1ANEA 4Y10E 2FX4A 3A7WA 4AOQA 5L30H 1BA8B 3U1IB 2F9NA 2QV1A 4JYUH 3W94A 1VZQH 4FU7A 1FY8E 3DHKH 3RUOA 2VWOA 4R0IA 4A5TS 3SW2B 3PLBA 4JMYA 1GVLA 2HVXA 3OTJE 3GCHB 2ZDAH 1TGNA 1O30A 1SG8B 3E6PH 3SJ9A 2IN2A 3SQEE 4D8NA 2GMTB 1HAOH 1QB1A 2RA3A 4SGBE 5E0HA 3EQ0H 3U8RH 2AH4X 2FOFA 3VB6A 5A0CA 4FUFA 3HKJB 1C5VA 2BDAA 1E38B 1RIWC 1PJPA 2GDEH 1QFKH 4X8UH 3UPEA 2XCNA 1CE5A 1MTUA 3M5OA 1KIGH 4OS6A 1ELVA 2BDYA 4DT7B 1GBIA 4KELA 2NU4E 1CSOE 7KMEH 2WPMS 2FM2A 2H9HA 1FPHH 3RXJA 1TNIA 4LZ1H 1IHTH 2J34A 1O2WA 1O3EA 2PKAA 1V2UT 1OX1A 3SN8A 1MCTA 3RLYH 1FIWA 3KIDU 1ETSH 1O2MA 1QJ1B 4CBOA 1CHGA 1E0FD 2WV5A 3LONA 1DWEH 1HAGE 1O3LA 2A7JA 2OQUA 1MZAA 6CHAB 3KQEA 3K6YA 1D9IA 2ZCLP 5TJXA 2J9NA 1KXAA 5EW1H 3C1KA 2G5VA 1O3OA 3K9XB 5EQQA 1SLXB 1C1RA 2Z3EA 4WH6A 3SGAE 2Y6TA 3PLPA 4K1EA 4B71A 1YCPM 5J4SA 1CGIE 1O2GH 4A1XA 1LTOA 1E36B 1W8BH 1GBBA 1IQKA 3GCNA 2FWWA 3QGJA 5EPNA 5JPMH 1GHWH 3FFGA 3MOCA 4BOHA 3BTWE 3PYHA 3VEQB 3M3VA 3RU4T 1C2DA 5I25A 4NSYA 1RTKA 2H5CA 1DOJA 1G36A 1RD3B 1A3EH 1O2IA 1W7XH 1INCA 2ILNA 3GCTG 1TLDA 5DK1A 1AD8H 1TX6A 4UONA 1ANBA 1S81A 1OWKA 1O5FH 2Y5FA 1P2NA 1SGCA 3Q3KA 2STBE 4DCDA 2GTBA 1HUTH 3TGJE 1C2MA 4ZHAA 1C1UH 1O31A 1UJ1A 1BBRK 3RC5A 1NRPH 1P0SH 2R0LA 2EI6A 1GI9B 4FUDA 4K69A 4Y71A 3SV6A 2HOBA 5GCHG 4GLYA 3SORA 2P3FH 2UWPA 2XWAA 3GY4A 4X1PU 2ZPQA 3RXOA 3FP6E 4X8SH 1CA0C 2ZFSA 1TQ0B 2NU1E 4YZUA 2EEKA 4Q7YA 1BRBE 4JZEH 1S0RA 2GCTB 1YC0A 4FUCA 1AE5A 1ESAA 3SU5A 4BTIB 1H1BA 1L1JA 1JOUB 4I8GA 3LH1A 2H2ZA 5JB9S 1VITG 5FX6A 1BRCE 1D3TB 5DKMA 1AB9B 5CHAB 1GBEA 1Q31A 1BTHH 3E16B 2FOEA 1Y3XA 2ZF0H 1MKXK 2VB0A 2Z3DA 3MHWU 3KCGH 1V2OT 1P02A 2AMDA 1ZGVA 1QRZA 3EA9A 1UMAH 1DT2A 2PGBB 3T62A 3HGPA 2XXLA 2PKSC 1C1QA 3GDVA 1V2LT 3STJA 2BXTH 2ZECA 4K5ZA 1BBRH 5DP3A 2BQ7B 4JCNA 1O36A 1TPOA 3TIUA 2CHAB 1S83A 2GD4B 2VIOA 5A8XA 1GHAF 3SU2A 1SFQB 1EPTA 3F9EA 4FUHA 1HXEH 4E7RG 1UVTH 1B0FA 3KQCA 7GCHG 1TAWA 1TONA 2D1JA 3KN2A 3MYWA 3KEEA 3T25A 3TJNA 1ZZZA 1UVPA 1WQVH 2ZKSA 1HAHH 2W5EA 1N6XA 3RXIA 1YPGH 1MBMA 1AZZA 2C93B 3TITA 3RMLH 4AFQA 1O3DA 3A84A 3GDUA 3NCLA 2ALPA 3MNSA 3MO9A 2P3UB 1HJ9A 3SV8A 2HALA 2OC8A 3SJKA 4D9QA 4X2XA 1C5LH 2C3SA 1IQEA 1BCUH 3ZVBA 1YYY1 1TYNA 2VVUA 2BDHA 5G4BA 1G32B 4Y8ZA 3SUFA 3K65B 2ZNKH 1NS3A 4U32A 2XC0A 1SVPA 4NIWA 3SBKA 1AMHA 1T32A 3ZVCA 1TWXB 1W12U 1SR5C 1MKXH 1O5BB 2VH0A 4JZDH 1YF4A 1QB6A 1F0RA 1F5RA 1CO7E 3A7TA 1VR1H 3SNDA 1HAIH 4O3TA 1CU1A 2OUAA 3PWBA 1GG6C 3PROA 2ZU3A 2PW8H 1DX5M 4AORA 4M7GA 1S85A 3GY8A 3AVZA 2R2WU 2BY5X 4ZAEA 2BTCE 1YBWA 3SGBE 1FV9A 1W11U 4ZKOU 3RXGA 4OS1A 1OWJA 4WMEA 3SGQE 3BIUH 2AGEX 1GJ5H 2SFAA 4INKA 2TIOA 1ZSKA 4PROA 3UREA 4IN1A 1HIAA 1O3IA 1PQAA 2ZQ2A 3MNCA 2ZDNA 5DP6A 3STIA 1ARCA 2FTLE 2W26A 3DA9B 1TPAE 2ZGJA 1C5SA 1KLTA 5SGAE 1TALA 1ELEE 2Z6BD 4CREA 3P70B 2VIWA 5DJ7A 4FXGH 3RU4D 3Q00A 4MDSA 1C2EA 2OQ5A 1V2MT 1ZOMA 1C1VH 4X6OA 4Y8YA 4ESTE 4DGJA 1OKXA 1UHBB 3BSQA 1XX9A 1RIWB 1O3GA 1C1TA 1LHEH 3G01A 4GVUA 1EX3A 1LPGB 3UQOA 1LPZB 2J4IA 4K2YA 5ABWA 2DE8A 1FQ3A 1F2SE 1C5XB 1EJAA 2B8OH 1G2LA 4IGDA 1HV7A 4CRGA 3TJVA 1V2TT 4INHA 1Y3WA 3TH2H 5HXFA 4MNXA 3CS0A 1EZQA 2C90B 4B75A 5EU8A 5JDUB 1K1IA 5IYTA 2BDIA 1LHGH 4X2WA 2Z9JA 1JIRA 3A8CA 4CBNA 3QX5H 3UQVA 1K1PA 1LKBA 3UY9A 1LVOA 1O5CB 1UCYK 1T4UH 1THRH 3SU0A 1AWHB 1QTFA 3LH3A 1AFEH 3ZVFA 3ZVAA 1SOZA 1ORFA 1GCDA 4HTCH 2BHGA 1BTWA 1GI8B 1OP8A 3TU7H 2ZGHA 1VGCC 1DSUA 3QZRA 1CHOG 3ODDA 3MH4A 2P16A 1TNJA 4I31A 1MMJN 1DLEA 5DPAA 3I77A 2FOHA 1MTVA 2ZI2H 1KXFA 1O2PA 1OWEA 1EB1H 1HAPH 4OGYA 2Q6DA 2ZIQH 4OS2A 1OWIA 2GCHF 4O9VA 4Q7ZA 4Q80A 3V3MA 1A5HA 3U1JB 2WV4A 1H8IH 1XUHA 2PLXA 4YTAA 3HKIB 3RXPA 2XCFA 1F0TA 5AHGH 3UWJH 2ZHFH 1O2VA 1ZHMA 2AIQA 1F0SA 2B5TB 2K1QA 3P8NA 5LPEA 2WUCA 3BTEE 1WV7H 3A89A 1TA6A 2GT8A 2IJOB 1ESTA 1BITA 1TRMA 2VINA 3E90B 7LPRA 4XDEA 1BJVA 2ZQ1A 5AVDA 3BG8A 4DURA 4Y0YE 3ZZ3A 1OYTH 4Y6DA 5E2PA 4WXIA 2BLQA 1BTZA 3RM2H 1YPHC 1AFQC 1UCYH 1DLKB 2OC0A 5C1UA 1YM0A 4WMDA 4ISOA 1OWHA 2J94A 2GZ9A 2SGEE 2ZFPH 1F0UA 5A8YA 1CA0B 3KF2A 1GHBF 1QJ7B 1EAWA 4NCYA 1G3CA 3BEIB 2FPZA 5JB8S 1SLWB 1GBLA 5EXNA 5HM9A 8GCHF 5HMAA 2SNWA 2W7UA 4ABGA 1KYNA 2OXSA 5DP4A 2ZDMA 4U30A 4DVAU 1GJ8B 2V0BA 1P10A 1SGPE 1KLIH 1DS2E 5L6NH 3GY5A 4ZHMU 1AN1E 2TBSA 1DPOA 3RC6A 1K1OA 2QXHA 3ATKA 3RXAA 3NUMA 1IQNA 3QGNB 5H4IB 2P95A 1SFIA 2VWNA 2CV3A 4MPUA 2PKSB 2BX4A 3A8BA 4ABAA 2G51A 3F1SB 1SGFG 1BQYA 3Q3XA 2ZU2A 1TPPA 1WU1A 1ZTLA 1AKSA 4GSOA 1KDQA 1V2JT 4NIVA 3SHCH 5DP9A 2R3UA 4A7IB 1ZPZA 2A4RA 3A7YA 5EODA 1LPKB 2AFQB 4I8HA 3BTTE 3LGVA 1P2QA 5A0BA 2VVVA 2HWLB 1ANCA 2ZTYA 2BY6X 1WTGH 4E05H 1QL7A 2ZP0H 1JRSA 1PYTC 1NFWA 1IQFA 2Z94A 1MTSA 3VGCC 3VXFH 5GXPA 3MU8A 3ZZAA 1OP2A 1P2KA 1C5MD 1BJUA 2FIRH 5FPTA 1SMFE 2ASUB 3EGKH 2GP9B 3NZIA 2O8UA 1O3BA 5ESTE 1YCPK 2XYAA 1MTNC 1FJSA 4TY7A 3SU6A 1UTQA 2XBVA 2YNAA 3BTDE 2H9EH 1GVZA 1DICA 1W0ZU 4IMZA 4Q2KA 4D7GA 5C67A 4NFFA 1O2KA 5FX5A 5JBAS 2VIPA 1XUFA 1WAYB 3ATLA 1NRSH 4X0WU 2BD2A 1EKBB 5ESBA 2FI3E 1GVKB 3KHVA 3UR9A 4B2BA 2B9LA 3M3TA 2RA0A 4AG2A 2OC1A 2BVXH 4AFSA 1HRTH 3SO3A 1EOJA 1YP9A 2V6NA 1TBZH 2FTMA 3FP8E 2O8WA 1LHDH 1SL3A 1W0YH 1E35B 1J8AA 1C1WH 2XRCA 1GG6B 1EZUC 5E0JA 1DE7H 3TH3H 4DG4A 4XSKU 4HFPB 2AS9A 1VITH 2ANMH 4WH8A 1EB2A 4BAMB 6LPRA 3IWMA 1MTWA 1O2YA 3UTUH 1HFDA 3TGKE 1DXPA 5GJ4B 3GYMA 3U9AH 1C5RA 5B6OA 1TGTA 4MNYA 3BIVH 1AY6H 1EXFA 1YPLH 2AEIH 3LGIA 2FMJA 7ESTE 1AGJA 1FXYA 1MUEB 4ZXXH 3GISB 1FY4A 3VFEA 1AVWA 1O3KA 1KLJH 1C5YB 4Z6AH 1QRWA 2FDAA 2RG3A 1UVOA 2BMGB 4IC5A 1K1JA 1GBAA 2WYJA 3AAVA 3PMJA 1ETTH 1C1SA 1XM1A 1IAUA 4K1SA 2BDBA 1YCPH 5T6DA 5IDKA 3TPIZ 2FX6A 2O8LA 3ZV9A 1P09A 1G30B 2C8WB 5DGJA 1C5WB 8KME2 4X2YA 1GHAG 3PB1E 4DIIH 5AFZH 4R8TB 1GBCA 1D3DB 2ZDVH 3OU0A 2FI5E 2XBYA 1CT0E 2R2MB 5FBEA 3SZNA 4BNRA 4AB8A 3BN9A 4XOJA 1K28D 1PPZA 1V2NT 2C8YB 1SGEE 4X2VA 1C2JA 1AVXA 2GKVE 2ZG0H 3KL6A 1J15A 4TYDA 4OS5A 3ZYEA 3QTOH 3ZZBA 2FOMB 1XKAC 3I29A 3LT3A 3GY3A 2F9UA 3RXLA 2TRMA 3NPSA 1P57B 3TJOA 4NA7A 3UNRA 2HPQH 5F6MA 4GCHF 2VWMA 1WCZA 2PV9B 2PHBA 4UFFH 3TNSA 2J38A 3MU1A 4K8YA 1T4VH 4X1RU 2A32A 1P01A 1HNEE 2BY9X 2HLCA 1G2MA 1O2HA 1CGJE 1IQGA 2BZ6H 4OS4A 1H9LB 1K21H 5FCKA 1GHXH 2CXVA 1MBQA 1O2XA 3M61U 1D6RA 1TABE 3RLWH 3M5NA 1VGCB 1NFXA 3ZVEA 3L3TA 3MO6A 1PQ8A 2RDLA 1HGTH 1T8LA 3ITIA 2G55A 2A4OA 1V2PT 2NWNA 1OSSA 5EW2H 1ZTJA 3RXTA 3SV7A 2GV6A 1YPHE 4DOQA 4ZMAH 1NFUA 1XUGA 1A0JA 2Z9KA 1C5PA 1O35A 1IHSH 4IBLH 3RMNH 4BXWA 1P8VC 2G4TA 1CGHA 4ABFA 2PWXA 3F9FA 1LHCH 1WUNH 1SQAA 1QL8A 3M36A 1XKBC 1T8NA 3MU0A 1BMLA 3ENSB 1SSXA 1FMGA 1ANDA 3QN7A 5JBTA 4MVNA 4CRCA 3S7HB 2C8XB 1JMOH 1V2ST 3M5MA 3OY5U 4YM9A 1C5OH 1AFQB 3VB3A 4TPYA 4INLA 4Y76A 2XC5A 1UTKA 2XBXA 1W7GH 3EA7A 2P93A 2VNTA 4DY7B 2AGGX 1HJ8A 1EJNA 1QBOA 3P92A 1HBTH 3A8AA 4IC6A 2W3IA 2H5DA 5EXLA 4B1TA 2WPIS 3RXFA 3GDSA 4B2CA 2BZAA 3D62A 1GHYH 2CF8H 3PWCA 2PR3A 1YPKH 1O2UA 1BOQA 3U8TH 5GIBA 5LGOA 3M7UA 4YOGA 4X6NA 3RXUA 4K3JA 1Z71A 2VJ1A 5C1XA 4ASHA 3D23A 1E37B 1SI5H 1P2OA 2OP9A 1GDUA 1W3CA 2OINA 3RXCA 3ATIA 4GHQA 4Q7XA 2ESTE 1K22H 1A61H 1RGQA 1ELGA 1S5SA 3T26A 5J4QA 4NIXA 3U98H 2PGQB 3OSYA 2ZEBA 3B23B 2JETC 3DFLA 4TY6A 4ABJA 5LH8A 3ZVDA 3LGWA 1M9UA 4AX9H 5BPEA 5C5NA 2WPHS 1MAXA 2P59A 2GCHG 1C1NA 1T31A 1BMAA 1G3DA 1GMHF 1TE0A 2QAAA 2FOBA 4SGAE 4BAOB 4XBBA 3VGCB 1GBJA 3UUZA 3P95A 3NXPA 4ABEA 4CRDA 1HAZB 1PPFE 1D4PB 1L4DA 1DSTA 1MKWK 2UUJB 2GX4A 5L2ZH 3A8DA 2ZPSA 2BD9A 2WINI 1MTNB 1Y3YA 4CRFA 1LDTT 1O3AA 3DFJA 4D9RA 3V13A 1TQ7B 2VIDA 1A7SA 3T28A 1CBWC 1BBRE 1NROH 3SNBA 3RXDA 2F9OA 2BD5A 2ZC9H 3PLKA 1SQTA 2P8OC 4XBDA 3KNXA 1ZYOA 1RFNA 5BRRE 8LPRA 3LC3A 1KTTB 4ISNA 1FPCH 4KP0A 1SGYE 4Y7BA 1WOFA 2QN5T 1C5TA 2LNCA 1TX7A 2Y5GA 2EI8A 4FUGA 1QL9A 3A81A 3RXSA 1O2OA 5HM2A 4NWKA 1EZSC 3LOXA 1GHBG 3D49H 1N6YA 3SNEA 3S0NA 4UE7H 1HXFH 1O33A 3R3GB 8GCHG 3MWIU 1AQ7A 2ZFQH 1TBQH 4A1TA 3FAOA 1YLDA 1FAXA 2UWLA 4XBCA 3EAJA 1UTNA 1O3MA 1LO6A 1FAKH 4YOJA 2M5TA 1FY1A 3UR6A 4YT7H 3U69H 1C2LA 2ANKH 3GCOA 4KTCA 4TPIZ 2Y81A 3E0NB 1Z8IB 1EAXA 3R0FA 2Q6GA 1RRKA 2YOLA 4ZKNU 1O37A 1S6FA 1L4ZA 1FONA 1QCPA 2AIPA 4FUEA 1FNIA 3O8BA 4MG3A 4O03A 2VIQA 1UHBA 4X8TH 3AASA 1DY9A 1C5ZB 1KY9A 1P03A 1O2ZA 4BXSA 1ZJKA 3RXVA 5FXLA 2Y5HA 1MKWH 3FZDA 1V3XA 3MH5A 4HZHA 2FZZA 2QA9E 5JBBS 2A4GA 1SC8U 1PPHE 1HCGA 1T8OA 3O8CA 1O2NA 2A2QH 2P3TB 3BEUA 3MNBA 3PMBB 4XFQA 1C9PA 2CF9H 2FOAA 2BOKA 1NM6A 2YNBA 4FUJA 4BAQB 3BF6H 1DWCH 3RXRA 1Z6EA 3T29A 1VJAU 2OCVB 5ETXA 2TGTA 1SGNE 1BMMH 1CVWH 1NC6A 3H5CB 1JWTA 2A7HA 1XVOA 3E91A 1QHRB 5DP5A 1TGSZ 1FZZA 2BD4A 4YESB 2GDDA 1BB0B 1PYTD 2A7CA 5T6GA 2HRVA 1Z7KA 2BD7A 3RP2A 1OOKB 1TOCB 3LGTA 3V0XA 3VB4A 1SGDE 4X1SU 4ISHH 5K7RA 4Y79A 1SHYA 1C2GA 1P2MA 4H6TA 3F9HA 4NWLA 3SJIA 3BTFE 2SGAA 3GYLB 1TNGA 2PTNA 4VGCC 5T6FA 3BG4C 3ZZ4A 4TWWA 1Y3VA 1ACBE 2SGPE 4Y0ZE 2W7SA 1DUEA 4AYVB 2BDCA 1A4WH 3RDZA 4MTBA 1B0EA 1NY22 3S9AA 2Z7FE 1QGFA 2EA3A 2XNIA 1P05A 1NU7B 2WPKS 1VCPA 4JK5A 5FPSA 2FI4E 3MH6A 1H8DH 1AU8A 5DG6A 2ZFRH 1J9CH 1AUJA 2PTCE 4MPWA 1NFYA 3TH4H 1SGFA 4AZ2B 1GBTA 4HGCA 2VH6A 4WXVA 5EG4A 1GMCF 1Y3UA 2BD3A 5EGMA 1SQOA 1NT1A 1C4U2 2ZGXH 4MLFB 2B7DH 1JBUH 2BYAX 3UIRA 1ZMNA 2ZCHP 2EC9H 3TK5A 1S6HA 5EOKA 4FVDA 2F9PA 1RXPA 1ZHRA 4ZH8A 2G5NA 2I6QA 1KXBA 3T27A 3QDZB 1QQUA 3ZZ5A 1TGBA 4H42U 4YLUA 2BY7X 2F83A 1GL0E 1XXFA 5F03A 4NSVA 1ZLRA 1C5QA 3PMHB 1DDJA 2IPHA 3SI4H 2HGTH 3Q3YA 4BANB 1Q3XA 1EUFA 4Y7AA 3K2UA 1P04A 1MU6B 1GGDC 2FEQH 1YGCH 2H1UA 1UTLM 2ZTXA 1C4Y2 1JRTA 1AO5A 3A7ZA 2ZZUH 4JZFH 2Z9GA 5E0GA 1MCVA 4Y11E 1NESE 4WJG2 4U01A 1GBFA 2C4FH 3AW1A 1O5GH 2ODPA 3UNSA 5L2YH 1P06A 5FCRA 3TK6A 1OWDA 4KGAA 3F68H 3RXHA 5GWZA 2QXGA 4GCHG 3AAUA 4NG9H 2JH6D 3W95A 2ZHDA 1DVAH 1LCYA 1C9TA 4ZXYH 3ZV8A 4GHTA 2A5IA 1UTOA 2FYQA 2ZFTA 1UCYE 3NKKA 1S0QA 1CQQA 1MQ6A 1TPSA 1N1LA 3L33A 1QQ4A 4K8BA 1PQ5A 1T7CA 3URCA 3N7OA 1ZMJA 4ABHA 1TRNA 1NRRH 4OGXA 1O3PB 1LMWB 3NK8A 2FLRH 1A3BH 1HAVB 1K2I1 1UTMA 1C5UA 3OYPA 1HAVA 2JETB 2BXUH 1GJ6A 2O8MA 4X8VH 3KQBA 1G37A 1O5EH 2ZHWH 4IMQA 2ZWLH 1ESBA 1EOLA 1FI8A 3E0PB 1DFPA 5EQRA 3Q76A 1ABJH 1XUJA 5JYIA 1A2CH 2BM2A 3KGPA 1DWBH 1GJ9B 3GY7A 3EA8A 1P2JA 4B2AA 4A6LA 1MD7A 3RXMA 2W3KA 1KXEA 3WY8A 1RTFB 4FUBA 1FY3A 2J92A 1SGIB 2FP7B 2A5KA 4A92A 5C5OA 1KTSB 3QK1A 3QO6A 1DITH 4DIHH 1EAIA 1GI6A 2UUFB 1GI1A 2O9QA 3S9BA 2A0QB 1D3PB 5DP7A 1ELBA 3VXEH 3AW0A 1N8OC 3UOUA 2Z9IA 1CBWB 4UEHH 2XW9A 3VPKA 1H9IE 2I6SA 2SGDE 1NO9H 3S69A 2XWBI 4WVPE 4AYYB 1DXWA 2P8OB 1RTLA 1EQ9A 1ELDE 1GPZA 3RXBA 2G00A 2GZ8A 3BEFB 8ESTE 2F91A 1TNHA 1TX8A 2QYIA 2QC2A 4I7YH 1GCTC 4ISLA 1G3BA 4AFZA 1IQJA 1O2QA 1C5NH 1EP6A 5TCCA 4MPVA 1Y59T 1ZR0A 1BTYA 1GBMA 3MU5A 5TCAA 1HYLA 1BIOA 5FHTA 1P3CA 2ZHQH 1LQDB 1G9IE 3QLPH 2SGQE 3GY2A 3Q77A 1NRNH 2WYGA 1C2KA 1ZJDA 1VJ9U 1PPEE 3SV9A 2AMQA 4CH8B 2WPJS 2WPLS 1Y5UT 3ODFA 3QWCH 2NU2E 1O3FA 4ZROA 3ZZ7A 1ZRBA 3P8GA 4NFEA 1O5AB 1GMDF 1V6DA 4H4FA 4ZKRU 1F5LA 1OS8A 1C1MA 1FDPA 2PKAB 3RMMH 1BHXF 1K1NA 4KTUA 5C2ZA 2FOCA 4ABDA 1UTJA 3RC4A 4F4OC 3A86A 1O3HA 2FO9A 3SV2H 1ARBA 1IQMA 4GUXA 1EZXC 1Y5BT 1P11E 3ATWA 1CT2E 1D6WA 1VCWA 3I78A 2ULLA 3UWIA 2JKHA 1K1LA 2QXJA 4LK4A 2TGDA 1IQLA 4JZ1A 1Z1IA 3DD2H 5F8TA 1P12E 1A1RA 1GMHG 2PUQH 3E8LA 2BLWA 2F3CE 3TK9A 2TPIZ 4LXBH 1NPMA 1O3CA 3TJUA 1C4V2 3PMAB 1A46H 3B8JA 1QB9A 1YKTA 2AMPA 3O8RA 1HAXB 1QJ6B 1O34A 4ISIH 3HK6B 1GI3A 1SHHB 3PTBA 3SNAA 1P9UA 2EI7A 4GPGA 4O97A 1O2TA 1TMTH 2FXRA 3LGUA 3P6ZB 1BZXE 2CJIA 1AE8H 2VGCB 1Y5AT 1UK4A 4BAKB 1ETRH 4THNH 4MQAA 1BUIA 6GCHF 3QUMP 3SU1A 1HJAC 1DUAA 5EXMA 5HGGA 2AERH 1DWDH 4FU8A 1Z6JH 4I33A 1GJDB 2GV7A 1NTPA 1LKAA 3HPTB 4YT6H 4UD9H 3OX7U 4RKOB 2QXIA 1V2KT 2ZGCA 4KTSA 1A5GH 1W14U 4VGCB 3BG4B 4DJZB 2D8WA 3P8OA 1TGCA 3MMGA 4UFDH 1XMNB 3EE0B 1AI8H 1W13U 2D2DA 1QRXA 3BTHE 1TNKA 1U6QA 2BLVA 2Q1JA 4Y8XA 4RSPA 2PUXB 4JZIA 4HI3A 3URDA 1THPB 1O2SA 4KKDA 5C20A 2HNTE 2WUBA 3E3TA 1ELFA 1ELAA 3O8DA 5EQSA 3JZ2B 4I8LA 1O3NA 1VCQA 1SGTA 1FN6A 1P2IA 2FODA 2XC4A 1JXPA 1TB6H 1FIZA 1D3QB 1NZQH 3LDXH 4K1TA 3UNQA 2FESH 3BTKE 5FBIA 5GDSH 4K60A 2BVRH 1UVUH 1GDNA 1QR3E 1OPHB 1V2VT 2ODQA 3RU4E 4B74A 1YPMH 2FLBH 1KXDA 5A0AE 3LPRA 2ZTZA 5T3HA 3PV4A 2VVCA 2Y7ZA 2PSYA 1L0ZA 1TRYA 1BMNH 1H9HE 4X6PA 4J1YA 2R9PA 1MU8B 1OXGA 3PO1C 4X1NU 1GWAA 3SHAH 3ZZ6A 1W10U 1QA0A 5I46H 1TBRH 1MQ5A 1GGDB 1F7ZA 3P17H 5JBCS 3MI4A 1GBDA 2UWOA 2Z3CA 3A87A 2OC7A 5PTPA 1UVSH 6ESTA 2CMYA 1GI5A 2BDGA 4F49A 1C1OA 1PQ7A 1XUIA 4YO9A 4NZLA 3VB5A 1AVGH 4WMFA 1ZSLA 1C2FA 3LJOA 2TGPZ 4YOIA 3FANA 1SB1H 1AIXH 1TMBH 1DANH 2A5AA 1EPTB 5C1YA 2A2XH 2OLGA 3TLOA 2GGVB 4WY3A 4NA9H 3CP7A 3MNXA 1MAYA 2UUYA 1XVMA 3MFJA 1A0LA 2H9TH 3GICB 4D76A 4ABIA 3RXQA 2BX3A 2R3YA 1LQEA 2QGRA 1KSNA 1QA7A 2Q6FA 3QZQA 1IOEA 3HGNA 3L6PA 5FPYA 1O39A 2H6MA 1GDQA 3T2NA 1ELCA 1GJ7B 3M35A 2A45B 3LC5A 4LZ4B 2BQWB 1WSSH 2ZGBH 2BQ6B 1Z8RA 3EDXB 1O2RA 3ZZCA 4AG1A 2SNVA 2G4UA 3SJ8A 4D7FA 1ZMLA 1NN6A 1QBNA 1TA2A 2ALVA 2O8TA 4MNVA 3SI3H 4AGJA 3F9GA 3SU3A 5C3NA 3A88A 3HK3B 1TFXA 1TNLA 2ZDLA 2VIVA 1ZPBA 2BD8A 3D65E 3RM0H 4CHAC 2QIQA 3CENA 1GBKA 1X7AC 4IS5A 1J17T 1GMCG 2ZU5A 1F5KU 4AN7A 1SLVB 2RCEA 1THSH 2IOTA 2V35A 1GJCB 2ZFFH 2ZHEH 3GCTF 4E7NA 1LHFH 1ELTA 3QTVH 1IQIA 5CE1A 1SLUB 1SGRE 3S7KB 3S9CA 2HPPH 2ODYB 3GCHC 2DE9A 1G3EA 1O32A 3SU4A 3V7TA 3SUEA 2AYWA 3BTME 1HDTH 3UFAA 2OBQA 3BTQE 2GMTC 5A09A 1N8OB 1RS0A 4WF8A 2ZDKA 2SGFE 2OBOA 4E06H 1SGQE 3FP7E 4YLQH 1SPJA 4ZUHA 2ZU4A 1HIAB 1QURH 5GCHF 1TIOA 1KXCA 1LVYA 5EPYA 2ZA5A 1GCTB 3DUXH 4X6MA 2QY0B 2QF0A 1MH0A 2XTTB 3MU4A 4MNWA 3IG6B 1BRUP 1C2IA 1EJMA 1PPGE 1Z8GA 2Y82A 3MH7A 1L2EA 3A80A 4JK6A 3K6ZA 4CR9A 1Y8TA 2ANWA 5E8EH 1P9SA 4NZQA 3A85A 1C1PA 1O0DH 1QNJA 2STAE 2C8ZB 2UUKB 3KQDA 4U2WA 1W2KH 4CRAA 1VITF 3LKWA 1BT7A 3F6UH 1GJBB 1FLEE 3ELAH 3A83A 1NRQH 1RJXB 6CHAC 2G81E 3MTYA 5AFYH 3H7TA 3A7VA 1LVMA 3LGYA 2G52A 1ZTKA 3TNTA 4X1QU 4CRBA 2B0FA 3E1XB 1K1MA 4MPXA 4NIYA 4CR5A 2QF3A 1P3EA 3OY6U 3H7OA 3HATH 4JYTA 3PM3A 3A7XA 2XBWA 1MD8A 2LPRA 1JIMA 3TGIE 3LJJA 1O2LA 2JH5D 1FY5A 4ZHLU 4NGAH 1J16A 1O38A
chains in the Genus database with same CATH superfamily
3SQHE 1S82A 1PFXC 2VGCC 4ZKSU 1IQHA 4XE4A 1YLCA 2DUCA 3DSGA 1GBHA 1O2JA 2BLOA 4UFGH 4UDWH 4QT8C 7GCHF 1DM4B 5F8XA 1A5IA 3M7TA 5E2OA 2ZO3H 3SNCA 1MABB 3RXKA 1H4WA 1NU9A 2BB4A 2BVSH 5F8ZA 3T5FH 1GI4A 2KAIB 4RI0A 4ABBA 1BHXB 5LPRA 4FVBA 5HYOA 2KAIA 1TOMH 3ESTA 2OTVA 4O3UA 4OS7A 5A8ZA 1C2HA 1L1GA 3U8OH 3EYDA 4FUIA 2HNTF 4AGKA 1HLTH 1EATA 3A82A 4B76A 4NA8A 3DSPA 4Z1MD 1HJAB 2FOGA 2VU8E 4J2YB 3ZZDA 3GY6A 9ESTA 3PTNA 2JH0D 4GAWA 3BTGE 1ZGIA 1QBVH 1GJAB 2ANYA 2GCTC 1BTUA 2V3OH 1Z1JA 1BTPA 2OD3B 1BRAA 1F92A 1GI0A 2Z9LA 5K0HA 2ZPRA 2PSXA 1AUTC 1ZHPA 1PPCE 1GI7B 1Z8JB 1FUJA 2P94A 2F9VA 3TVJB 2HNTC 1YPEH 2THFB 3M37A 2ZU1A 1LVBA 1AB9C 2VWLA 1B7XB 5CHAC 4CH2B 4AB9A 1EASA 3BV9B 4RKJB 3SOSA 4IW4E 1EP5A 4FU9A 5DO4H 4TWYA 5HKKD 3V12A 1HPGA 4AFUA 1GMDG 2J95A 3SUDA 4I8JA 1A0HB 2J5UA 4DW2U 2F9BH 3ZVGA 1BTXA 1TMUH 1UO6A 3NWUA 5A2MH 1O5DH 1CA8B 1Q2WA 1T8MA 2NU0E 1SOTA 1HAYB 2R0KA 5FL7D 3RMOH 3UOPA 1WXRA 2CHAC 3M7QA 1EPTC 4BTUB 2FS8A 3VB7A 1OYQA 1V2WT 2PP6A 3PO1B 1PPBH 4Z0KA 1O3JA 1EAUA 1ZPCA 2BOHB 2A1DB 2CN0H 3IITA 3CS7A 4H6SB 4WWYA 3SUGA 1K9OE 3MO3A 1UK3A 3JZ1B 4JYVH 3RXEA 2V3HH 1CT4E 1L1NA 4B73A 1B5GH 1ZSJA 3OE7D 3LIWA 1QIXB 3B9FH 2V3MA 2ZCKP 1OP0A 1AWFH 5GPIB 1AKSB 5CMXH 1KDQB 1AHTH 2FS9A 3M3SA 4RN6A 1UTPA 3C27B 3ATMA 1E34B 3GOVB 1V2QT 2G8TA 1GHZA 1MZDA 2GZ7A 1FN8A 5AF9H 1HB0B 1YPJH 4BAHB 1GI2A 3DT0H 4UFEH 1SBWA 2JIZD 1GJ4H 1QY6A 2PFEA 6GCHG 4A1VA 1ID5H 3SJOA 2AGIX 2Y7XA 1GL1A 3ZZ9A 1UK2A 2Y80A 1WTHD 1ABIH 2GVFA 1WYKA 2J2UA 3FVFB 1BDAA 1J14A 1WBGB 5DP8A 2LP6A 3LU9B 4I32A 1WQSA 1DY8A 5FAHA 3ZYDA 3PV2A 2BY8X 3P8FA 1ZRKA 4LOYH 2D26C 3ZZ8A 4BTTB 2CGAA 1S84A 1XXDA 4B6FA 4IN2A 2FYRA 2A4QA 2NU3E 4I8KA 2A31A 2GT7A 3M5LA 9LPRA 1CHOF 1GHVH 5LPFA 1AZ8A 2TGAA 1V2RT 4CHAB 1XUKA 2QCYA 3FZZA 1ANEA 4Y10E 1BMFD 2FX4A 3A7WA 4AOQA 5L30H 1BA8B 3U1IB 3N99A 2F9NA 2QV1A 4JYUH 3W94A 1VZQH 4FU7A 1FY8E 3DHKH 3RUOA 2VWOA 4R0IA 4A5TS 3SW2B 1KMHB 3PLBA 4JMYA 1GVLA 2HVXA 3OTJE 3GCHB 2ZDAH 1TGNA 1O30A 1SG8B 3E6PH 3SJ9A 2IPQX 2IN2A 3SQEE 4D8NA 2GMTB 2L6OA 1HAOH 1QB1A 5EJLA 2RA3A 4SGBE 5E0HA 3EQ0H 3U8RH 2AH4X 2FOFA 3VB6A 5A0CA 4FUFA 3HKJB 1C5VA 2BDAA 1E38B 1RIWC 1PJPA 2GDEH 1QFKH 4X8UH 3UPEA 2XCNA 1CE5A 1MTUA 1OHHD 3M5OA 1KIGH 4OS6A 3SZEA 1ELVA 2BDYA 4DT7B 1GBIA 4KELA 2NU4E 1CSOE 7KMEH 2WPMS 2FM2A 2H9HA 1FPHH 3RXJA 1TNIA 4LZ1H 1IHTH 2J34A 1O2WA 1O3EA 2PKAA 1V2UT 1OX1A 3SN8A 1MCTA 3RLYH 1FIWA 3KIDU 1ETSH 1O2MA 1QJ1B 2YMSB 4CBOA 1CHGA 1E0FD 2WV5A 3LONA 1DWEH 1HAGE 1O3LA 2A7JA 2OQUA 4RT1A 1MZAA 6CHAB 3KQEA 3K6YA 1VKYA 1D9IA 2ZCLP 5TJXA 2J9NA 1KXAA 5EW1H 2W6ID 3C1KA 2G5VA 1O3OA 3K9XB 5EQQA 1SLXB 1C1RA 2Z3EA 4WH6A 4ASUD 3F2FA 3SGAE 2Y6TA 3PLPA 4K1EA 4B71A 1YCPM 5J4SA 1CGIE 1O2GH 4A1XA 1LTOA 1E36B 1W8BH 1GBBA 1IQKA 5DN6D 2HVYB 3GCNA 2FWWA 3QGJA 5EPNA 5JPMH 1GHWH 3FFGA 3MOCA 4BOHA 3BTWE 1W0KD 3PYHA 3VEQB 3M3VA 3RU4T 1C2DA 5I25A 3PRBA 4NSYA 1RTKA 2H5CA 1DOJA 1G36A 1RD3B 1A3EH 1O2IA 1W7XH 1INCA 2ILNA 3GCTG 1TLDA 5DK1A 1AD8H 1TX6A 4UONA 1ANBA 1S81A 1OWKA 1O5FH 2Y5FA 1P2NA 1SGCA 3Q3KA 2STBE 4DCDA 3WW7A 4OM9A 2GTBA 1HUTH 3TGJE 1EFRD 1C2MA 4ZHAA 1C1UH 1O31A 1UJ1A 1BBRK 3RC5A 1NRPH 1P0SH 2R0LA 2EI6A 1GI9B 4FUDA 4K69A 4Y71A 3SV6A 2HOBA 5GCHG 4GLYA 5T1VA 3SORA 2P3FH 2UWPA 2XWAA 3GY4A 4X1PU 3MQKC 2ZPQA 3RXOA 3FP6E 4X8SH 1CA0C 2ZFSA 1TQ0B 2NU1E 4YZUA 2EEKA 4Q7YA 1BRBE 4JZEH 1S0RA 2GCTB 1YC0A 4FUCA 1AE5A 1ESAA 3SU5A 4BTIB 1H1BA 1L1JA 1JOUB 4I8GA 3LH1A 2H2ZA 5JB9S 1VITG 3KYGA 5FX6A 1BRCE 1D3TB 5DKMA 3WWBA 1AB9B 5CHAB 1GBEA 1Q31A 1BTHH 3E16B 2FOEA 1Y3XA 2ZF0H 1MKXK 2VB0A 2Z3DA 3MHWU 3KCGH 1V2OT 1P02A 2AMDA 1ZGVA 1QRZA 3EA9A 1UMAH 1DT2A 2PGBB 3T62A 3HGPA 2XXLA 2PKSC 1C1QA 3GDVA 1V2LT 3STJA 2BXTH 2ZECA 2AHME 4K5ZA 1BBRH 5DP3A 2BQ7B 4JCNA 1O36A 1TPOA 3TIUA 2CHAB 1S83A 2GD4B 2VIOA 5A8XA 1GHAF 3SU2A 1SFQB 1EPTA 3F9EA 4FUHA 1HXEH 4E7RG 1UVTH 1B0FA 3KQCA 7GCHG 2J98B 1TAWA 1TONA 2D1JA 3KN2A 3MYWA 3KEEA 3T25A 3TJNA 1ZZZA 1UVPA 1WQVH 2ZKSA 1HAHH 2W5EA 1N6XA 3RXIA 1YPGH 1MBMA 1AZZA 1NBMD 2C93B 3TITA 3RMLH 4AFQA 1O3DA 3A84A 3GDUA 3NCLA 2ALPA 3MNSA 3MO9A 2P3UB 1HJ9A 3SV8A 2HALA 2OC8A 3SJKA 4D9QA 4X2XA 1C5LH 2C3SA 1IQEA 1BCUH 3ZVBA 1YYY1 1TYNA 2VVUA 2BDHA 5G4BA 1G32B 4Y8ZA 3SUFA 3K65B 2ZNKH 1NS3A 4U32A 2XC0A 1SVPA 4NIWA 3SBKA 1AMHA 1T32A 3ZVCA 1TWXB 1W12U 1SR5C 1MKXH 1O5BB 2VH0A 4JZDH 1E1RD 1YF4A 1E79D 1QB6A 1F0RA 1F5RA 1CO7E 3A7TA 1VR1H 3SNDA 1HAIH 2V7QD 3F0PA 1CU1A 2OUAA 4O3TA 3PWBA 1GG6C 3PROA 2ZU3A 2PW8H 1DX5M 4AORA 4M7GA 1S85A 3KQ5A 3GY8A 3AVZA 2R2WU 2BY5X 4ZAEA 2BTCE 1YBWA 5CDFE 3SGBE 1FV9A 1W11U 4ZKOU 3RXGA 4OS1A 1OWJA 4WMEA 3SGQE 3BIUH 2AGEX 1GJ5H 2SFAA 4INKA 2TIOA 1ZSKA 4PROA 3OEHD 5C17A 4B6EA 3UREA 4IN1A 1HIAA 2HLDD 1O3IA 1PQAA 2ZQ2A 3MNCA 2ZDNA 5DP6A 3STIA 1ARCA 2FTLE 2W26A 3DA9B 1TPAE 2ZGJA 1C5SA 1KLTA 5SGAE 1TALA 3SYJA 1ELEE 2Z6BD 4CREA 3P70B 2VIWA 5DJ7A 3UB0A 4FXGH 3RU4D 3Q00A 4MDSA 1C2EA 2OQ5A 1V2MT 1ZOMA 1C1VH 4X6OA 4Y8YA 4ESTE 5GNDA 1OKXA 4DGJA 1E1QD 1UHBB 3BSQA 1XX9A 1RIWB 1O3GA 1C1TA 1LHEH 1H8HD 3G01A 4GVUA 1EX3A 1LPGB 3UQOA 1LPZB 2J4IA 4K2YA 5ABWA 2DE8A 1FQ3A 1F2SE 1C5XB 1EJAA 2B8OH 1G2LA 4IGDA 1HV7A 4CRGA 3TJVA 1V2TT 4INHA 1Y3WA 3TH2H 5HXFA 4MNXA 3CS0A 1EZQA 2C90B 4B75A 5EU8A 5JDUB 1K1IA 5IYTA 2BDIA 4TT3D 1LHGH 4X2WA 2Z9JA 2J97A 1JIRA 3A8CA 4CBNA 3QX5H 3UQVA 1K1PA 1LKBA 3UY9A 1LVOA 1O5CB 1UCYK 1T4UH 1THRH 3SU0A 1AWHB 2QF4A 1QTFA 3LH3A 1AFEH 3ZVFA 3ZVAA 1SOZA 1ORFA 1GCDA 4HTCH 2BHGA 1BTWA 1GI8B 1OP8A 3TU7H 2ZGHA 1VGCC 1DSUA 3QZRA 1CHOG 3ODDA 3MH4A 2P16A 1TNJA 4I31A 1MMJN 1DLEA 5DPAA 3I77A 2FOHA 1MTVA 4TSFD 3WWFA 2ZI2H 1KXFA 1O2PA 1OWEA 1EB1H 1HAPH 4OGYA 2Q6DA 2ZIQH 4OS2A 1OWIA 2GCHF 4O9VA 2OK5A 4Q7ZA 4Q80A 3V3MA 1A5HA 3U1JB 2WV4A 1H8IH 1XUHA 2PLXA 4YTAA 3HKIB 3RXPA 2XCFA 1F0TA 5AHGH 3UWJH 2ZHFH 1O2VA 1ZHMA 2AIQA 3PV5A 1F0SA 2B5TB 2K1QA 3P8NA 5LPEA 2WUCA 3BTEE 1WV7H 3A89A 1TA6A 2IJD1 2GT8A 2IJOB 2KCYA 1ESTA 1BITA 1TRMA 2VINA 3E90B 7LPRA 4XDEA 1BJVA 2ZQ1A 5AVDA 3BG8A 4DURA 2RFKC 4Y0YE 3ZZ3A 1OYTH 4Y6DA 5E2PA 4WXIA 2BLQA 1BTZA 3N7DA 3RM2H 1YPHC 1AFQC 1UCYH 1DLKB 2OC0A 5C1UA 1YM0A 4WMDA 4ISOA 1OWHA 2J94A 2GZ9A 2SGEE 2ZFPH 1F0UA 5A8YA 1CA0B 3KF2A 2QE7D 1S6LA 1GHBF 1QJ7B 1EAWA 4NCYA 1G3CA 3BEIB 2FPZA 5JB8S 1SLWB 1GBLA 5EXNA 5HM9A 8GCHF 5HMAA 1SKYE 2SNWA 4F55A 2W7UA 4ABGA 1KYNA 2OXSA 5DP4A 2ZDMA 4U30A 4DVAU 1GJ8B 2V0BA 1P10A 1SGPE 1KLIH 1DS2E 5L6NH 3GY5A 4ZHMU 1AN1E 2TBSA 1DPOA 3RC6A 1K1OA 2QXHA 3ATKA 3RXAA 3NUMA 1IQNA 3QGNB 5H4IB 2KCOA 2P95A 1SFIA 2VWNA 2CV3A 4MPUA 2PKSB 2BX4A 3A8BA 4ABAA 5EIYA 2G51A 1YY3A 3F1SB 1SGFG 1UW7A 1BQYA 3Q3XA 2ZU2A 1TPPA 1WU1A 1ZTLA 1AKSA 4GSOA 1KDQA 1V2JT 4NIVA 3SHCH 5DP9A 2R3UA 4A7IB 1ZPZA 2A4RA 3A7YA 4HG6A 5EODA 3UAIC 1LPKB 2AFQB 4I8HA 3BTTE 3LGVA 2KX4A 1P2QA 5A0BA 2VVVA 2HWLB 1ANCA 2ZTYA 2BY6X 1WTGH 4E05H 1QL7A 2ZP0H 1JRSA 1PYTC 1NFWA 1IQFA 2Z94A 1MTSA 3VGCC 3VXFH 3FOAA 3MU8A 5GXPA 3ZZAA 1OP2A 1P2KA 1C5MD 1BJUA 2WHXA 2FIRH 5FPTA 1SMFE 2ASUB 3EGKH 4ACBA 2GP9B 3NZIA 2O8UA 1O3BA 5ESTE 1YCPK 3OTPA 2XYAA 1MTNC 1FJSA 4TY7A 3SU6A 1UTQA 2XBVA 2YNAA 3BTDE 2H9EH 1GVZA 1DICA 1W0ZU 4IMZA 4Q2KA 4D7GA 5C67A 4NFFA 1O2KA 5FX5A 5JBAS 2VIPA 1K0HA 1XUFA 1WAYB 3ATLA 1NRSH 4X0WU 2BD2A 1EKBB 5ESBA 2FI3E 1GVKB 3KHVA 3UR9A 4B2BA 2B9LA 3M3TA 2RA0A 4AG2A 2OC1A 2BVXH 4AFSA 1HRTH 3SO3A 1EOJA 1YP9A 2V6NA 1TBZH 2FTMA 3FP8E 2O8WA 1LHDH 1SL3A 1W0YH 1E35B 3U28C 1J8AA 1C1WH 2XRCA 1GG6B 1EZUC 5E0JA 1DE7H 3TH3H 4DG4A 4XSKU 5KGOA 4HFPB 2AS9A 1VITH 3F0OA 2ANMH 4WH8A 1EB2A 4BAMB 6LPRA 3IWMA 1MTWA 1O2YA 3UTUH 1HFDA 3TGKE 1DXPA 5GJ4B 3GYMA 3U9AH 1C5RA 5B6OA 1TGTA 4MNYA 3BIVH 1AY6H 1EXFA 1YPLH 2AEIH 3LGIA 2K0QA 2FMJA 7ESTE 1AGJA 1FXYA 1MUEB 4ZXXH 3GISB 1FY4A 3VFEA 1AVWA 1O3KA 1KLJH 1C5YB 4Z6AH 1QRWA 2FDAA 2RG3A 4XD7D 1UVOA 2BMGB 4IC5A 1K1JA 1GBAA 2WYJA 3AAVA 3PMJA 1ETTH 1C1SA 1XM1A 1IAUA 4K1SA 2BDBA 1YCPH 5T6DA 5IDKA 3TPIZ 2FX6A 3AK5A 2O8LA 3ZV9A 1YWUA 1P09A 1G30B 2C8WB 5DGJA 1C5WB 8KME2 4X2YA 1GHAG 4AC9A 3PB1E 4DIIH 5AFZH 4R8TB 1GBCA 1D3DB 2ZDVH 3OU0A 2FI5E 2XBYA 1CT0E 2R2MB 5FBEA 3SZNA 4BNRA 4AB8A 3BN9A 4XOJA 1K28D 1PPZA 1V2NT 2C8YB 1SGEE 4X2VA 1C2JA 1AVXA 5CHBA 2GKVE 2ZG0H 3KL6A 1J15A 4TYDA 4OS5A 3ZYEA 3QTOH 3ZZBA 2FOMB 1XKAC 3I29A 3LT3A 2F43B 2F9UA 3GY3A 3RXLA 2TRMA 3NPSA 1P57B 2LELA 3TJOA 4NA7A 3UNRA 2HPQH 5F6MA 4GCHF 2VWMA 1WCZA 3OAAD 2PV9B 2PHBA 4UFFH 3TNSA 2J38A 3MU1A 4K8YA 5KECA 1T4VH 4X1RU 2A32A 1P01A 1HNEE 2BY9X 2HLCA 1G2MA 2KZ4A 1O2HA 1CGJE 1IQGA 2BZ6H 4OS4A 1H9LB 2KCAA 1K21H 5FCKA 1GHXH 2CXVA 1MBQA 1O2XA 3M61U 1D6RA 1W0JD 1TABE 3RLWH 3M5NA 1VGCB 1NFXA 3ZVEA 3L3TA 5HIYA 3MO6A 1PQ8A 2RDLA 3F2GA 1HGTH 2F4LA 1T8LA 3ITIA 2G55A 2A4OA 1V2PT 2NWNA 1OSSA 5EW2H 1ZTJA 3RXTA 3SV7A 2GV6A 1YPHE 4DOQA 4ZMAH 1NFUA 1XUGA 1A0JA 2Z9KA 1C5PA 1O35A 1IHSH 4IBLH 3RMNH 4BXWA 1P8VC 2G4TA 1CGHA 4ABFA 2PWXA 3F9FA 1LHCH 2GJGA 1WUNH 1SQAA 1QL8A 3M36A 1XKBC 1T8NA 3MU0A 1BMLA 3ENSB 1SSXA 1FMGA 1ANDA 3QN7A 5JBTA 4MVNA 4CRCA 3S7HB 2C8XB 1JMOH 3OEED 1V2ST 3M5MA 3OY5U 4YM9A 1C5OH 1AFQB 3VB3A 4TPYA 4INLA 4Y76A 2XC5A 1UTKA 2XBXA 1W7GH 3EA7A 2YMSD 2P93A 2VNTA 4DY7B 2AGGX 1HJ8A 1EJNA 5EJZA 1QBOA 3P92A 1HBTH 3A8AA 4IC6A 2W3IA 2H5DA 5EXLA 4B1TA 2WPIS 3RXFA 3GDSA 4B2CA 2BZAA 3D62A 1GHYH 2CF8H 3PWCA 2PR3A 1YPKH 1O2UA 1BOQA 3U8TH 5GIBA 5LGOA 3M7UA 4YOGA 2WPDD 4X6NA 3RXUA 4K3JA 1Z71A 2VJ1A 5C1XA 4ASHA 3D23A 2J98A 1E37B 1SI5H 1P2OA 2JJ2D 3PRDA 2OP9A 1GDUA 1W3CA 2OINA 3RXCA 3ATIA 4GHQA 4Q7XA 4FETA 2ESTE 1K22H 1A61H 1RGQA 1ELGA 1S5SA 3T26A 5J4QA 4NIXA 3U98H 2PGQB 3OSYA 2ZEBA 3B23B 2JETC 3DFLA 4TY6A 4ABJA 5LH8A 3ZVDA 3LGWA 1M9UA 4AX9H 5BPEA 5C5NA 2WPHS 1MAXA 2P59A 2GCHG 1C1NA 1T31A 1BMAA 1G3DA 1GMHF 1TE0A 2QAAA 2FOBA 4SGAE 4BAOB 4XBBA 3VGCB 1GBJA 3UUZA 3ZIAD 3P95A 3NXPA 4ABEA 4CRDA 1HAZB 1PPFE 1D4PB 1L4DA 1DSTA 1MKWK 2UUJB 2GX4A 5L2ZH 3A8DA 2ZPSA 2BD9A 2WINI 1MTNB 1Y3YA 4CRFA 1LDTT 1O3AA 3DFJA 4D9RA 3V13A 1TQ7B 2KFWA 2VIDA 1A7SA 3T28A 1CBWC 1BBRE 1NROH 3SNBA 3RXDA 2F9OA 2BD5A 2ZC9H 3PLKA 1SQTA 2P8OC 4XBDA 3KNXA 1ZYOA 1RFNA 2CK3D 5BRRE 3LC3A 8LPRA 1KTTB 4ISNA 1FPCH 4KP0A 1SGYE 4Y7BA 1WOFA 2QN5T 1C5TA 2LNCA 1TX7A 2Y5GA 2EI8A 4FUGA 1QL9A 3A81A 3RXSA 1O2OA 5HM2A 2RDEA 4NWKA 1EZSC 3LOXA 1GHBG 3D49H 1N6YA 3SNEA 3S0NA 4UE7H 5DSFA 1HXFH 1O33A 3R3GB 8GCHG 3MWIU 1AQ7A 2ZFQH 1TBQH 4A1TA 3FAOA 1YLDA 1FAXA 2UWLA 4XBCA 3EAJA 1UTNA 1O3MA 1LO6A 1FAKH 4YOJA 2M5TA 1FY1A 3UR6A 4YT7H 3U69H 1C2LA 2ANKH 3GCOA 2WSSD 4KTCA 2Y81A 3E0NB 4TPIZ 1Z8IB 1EAXA 3R0FA 5F53A 1RRKA 2YOLA 4ZKNU 2Q6GA 1O37A 1S6FA 1L4ZA 1FONA 1QCPA 2AIPA 4FUEA 3FO8D 1FNIA 3O8BA 4MG3A 4O03A 2VIQA 1UHBA 4X8TH 3AASA 1DY9A 1C5ZB 1KY9A 1P03A 1O2ZA 4BXSA 1ZJKA 3RXVA 5FXLA 2Y5HA 1MKWH 3FZDA 1V3XA 3MH5A 4HZHA 2FZZA 2QA9E 5JBBS 2A4GA 1SC8U 3F3BA 1PPHE 1HCGA 1T8OA 3O8CA 1O2NA 2A2QH 2P3TB 3BEUA 3MNBA 3PMBB 4XFQA 1C9PA 4M9FA 2CF9H 2FOAA 2BOKA 1NM6A 2YNBA 4FUJA 4BAQB 3BF6H 1DWCH 3RXRA 1Z6EA 3T29A 1VJAU 2OCVB 5ETXA 2TGTA 1SGNE 1BMMH 1CVWH 1NC6A 3H5CB 1JWTA 2A7HA 1XVOA 3E91A 1QHRB 5DP5A 1TGSZ 4I86A 1FZZA 2BD4A 4YESB 2GDDA 1BB0B 1PYTD 2A7CA 5T6GA 2HRVA 3N7EA 1Z7KA 2BD7A 3CNRA 3RP2A 2KM0A 1COWD 1OOKB 1TOCB 3LGTA 3V0XA 3VB4A 1SGDE 4X1SU 4ISHH 5K7RA 4Y79A 1SHYA 1C2GA 1P2MA 4H6TA 3F9HA 4NWLA 3SJIA 3BTFE 2SGAA 3GYLB 1TNGA 2PTNA 3H09A 4VGCC 5T6FA 3BG4C 3ZZ4A 4TWWA 1Y3VA 1ACBE 2SGPE 4Y0ZE 2W7SA 1DUEA 4AYVB 2BDCA 1A4WH 3RDZA 4MTBA 1B0EA 1NY22 3S9AA 2Z7FE 1QGFA 2EA3A 2XNIA 1P05A 1NU7B 2WPKS 1VCPA 4JK5A 5FPSA 2FI4E 3MH6A 1H8DH 1AU8A 5DG6A 2ZFRH 1J9CH 1AUJA 2PTCE 4MPWA 1NFYA 3TH4H 1SGFA 4AZ2B 1GBTA 4HGCA 2VH6A 4WXVA 5EG4A 1GMCF 1Y3UA 2BD3A 5EGMA 1SQOA 1NT1A 1C4U2 2ZGXH 4MLFB 2B7DH 1JBUH 2BYAX 3UIRA 1ZMNA 2ZCHP 2EC9H 3TK5A 1S6HA 5EOKA 4FVDA 2F9PA 2M2AA 1RXPA 1ZHRA 4ZH8A 2G5NA 2I6QA 1KXBA 3T27A 3QDZB 1QQUA 3ZZ5A 1TGBA 4H42U 4YLUA 2BY7X 2F83A 1GL0E 1XXFA 4F48B 5F03A 4NSVA 1ZLRA 1C5QA 3PMHB 1DDJA 2IPHA 3SI4H 2HGTH 3Q3YA 4BANB 1Q3XA 1EUFA 4Y7AA 3K2UA 1P04A 1MU6B 1GGDC 2FEQH 1YGCH 2QF5A 2H1UA 1UTLM 2ZTXA 1C4Y2 1JRTA 1AO5A 3A7ZA 2ZZUH 5C94A 4JZFH 2Z9GA 5E0GA 1MCVA 4Y11E 1NESE 4WJG2 4U01A 1GBFA 2C4FH 4ACAA 3AW1A 1O5GH 2ODPA 3UNSA 5L2YH 1H8ED 1P06A 5FCRA 3TK6A 1OWDA 4KGAA 3F68H 3RXHA 5GWZA 2QXGA 4GCHG 3AAUA 4NG9H 2JH6D 3W95A 2ZHDA 1DVAH 1LCYA 1C9TA 4ZXYH 3ZV8A 4GHTA 2A5IA 1UTOA 2FYQA 2ZFTA 4Q63A 1UCYE 3NKKA 1S0QA 1CQQA 1MQ6A 1TPSA 1N1LA 3L33A 1QQ4A 4K8BA 1PQ5A 1T7CA 3URCA 3N7OA 1ZMJA 4ABHA 1TRNA 2W6JD 1NRRH 4OGXA 1O3PB 1LMWB 3NK8A 2FLRH 1A3BH 1HAVB 1FX0B 1K2I1 1UTMA 1C5UA 3OYPA 1HAVA 2JETB 2BXUH 1GJ6A 2O8MA 4X8VH 3KQBA 1G37A 1O5EH 2ZHWH 2L74A 4IMQA 2ZWLH 1ESBA 1EOLA 1FI8A 3E0PB 1DFPA 5EQRA 3Q76A 1ABJH 1XUJA 5JYIA 1A2CH 2BM2A 3OFND 3KGPA 1DWBH 2K8IA 1GJ9B 3GY7A 3EA8A 1P2JA 4B2AA 4A6LA 1MD7A 3RXMA 2W3KA 1KXEA 4ZCNA 3WY8A 1RTFB 4FUBA 1FY3A 2J92A 1SGIB 2FP7B 2A5KA 4P00A 4A92A 5C5OA 1KTSB 3QK1A 3QO6A 1DITH 4DIHH 1EAIA 1GI6A 2UUFB 1GI1A 2O9QA 3S9BA 2A0QB 1D3PB 5DP7A 1ELBA 3FKSD 3VXEH 3AW0A 1N8OC 3UOUA 2Z9IA 1CBWB 4UEHH 2XW9A 3VPKA 1H9IE 2I6SA 2SGDE 1NO9H 3S69A 2XWBI 4WVPE 4AYYB 1DXWA 2P8OB 1RTLA 1EQ9A 1ELDE 1GPZA 3RXBA 2G00A 2GZ8A 3BEFB 3KYFA 8ESTE 2F91A 1TNHA 1TX8A 2QYIA 2QC2A 4I7YH 1GCTC 4ISLA 1G3BA 4AFZA 1IQJA 1O2QA 1C5NH 1EP6A 5TCCA 2EQNA 4MPVA 1Y59T 1ZR0A 1BTYA 5C0TA 1GBMA 3MU5A 5TCAA 1HYLA 1BIOA 5FHTA 1P3CA 4XRNA 2ZHQH 1LQDB 1G9IE 2KR7A 3QLPH 2SGQE 3GY2A 3Q77A 1NRNH 2WYGA 1C2KA 1ZJDA 4Q4LA 1VJ9U 1PPEE 3SV9A 2AMQA 4CH8B 2WPJS 2WPLS 1Y5UT 3ODFA 3QWCH 2NU2E 1O3FA 4ZROA 3ZZ7A 1ZRBA 3P8GA 4NFEA 1O5AB 1GMDF 1V6DA 4H4FA 4ZKRU 1F5LA 1OS8A 1WDIA 1C1MA 1FDPA 2PKAB 3RMMH 1BHXF 1K1NA 4KTUA 5C2ZA 2FOCA 4ABDA 4DT4A 1UTJA 3RC4A 4F4OC 3A86A 1O3HA 2FO9A 3SV2H 1ARBA 1IQMA 4GUXA 1EZXC 1Y5BT 1P11E 3ATWA 1CT2E 1D6WA 1VCWA 3I78A 2ULLA 1SQRA 2JKHA 1K1LA 3UWIA 2QXJA 1NBME 2TGDA 4LK4A 1IQLA 4JZ1A 1Z1IA 3DD2H 5F8TA 1P12E 1A1RA 1GMHG 2PUQH 3E8LA 2BLWA 2F3CE 3TK9A 2TPIZ 4LXBH 1NPMA 1O3CA 3TJUA 1C4V2 3PMAB 1A46H 3B8JA 1QB9A 1YKTA 2AMPA 3O8RA 1HAXB 1QJ6B 2EY4C 1O34A 4ISIH 3HK6B 1GI3A 1SHHB 3PTBA 3SNAA 1P9UA 2EI7A 4GPGA 4O97A 1O2TA 1TMTH 2FXRA 3LGUA 3P6ZB 1BZXE 2CJIA 1AE8H 2VGCB 1Y5AT 1UK4A 4BAKB 1ETRH 4THNH 4MQAA 1BUIA 6GCHF 3QUMP 3SU1A 1HJAC 1DUAA 5EXMA 5HGGA 2AERH 1DWDH 4FU8A 1Z6JH 4I33A 1GJDB 2GV7A 1NTPA 1LKAA 3HPTB 4YT6H 4UD9H 3OX7U 1YLNA 4RKOB 2QXIA 1V2KT 2ZGCA 4KTSA 1A5GH 1W14U 4VGCB 3BG4B 4DJZB 2D8WA 3P8OA 1TGCA 3MMGA 4UFDH 1XMNB 3EE0B 1AI8H 1W13U 2D2DA 1QRXA 3BTHE 1TNKA 1U6QA 2KCPA 2BLVA 2Q1JA 4Y8XA 4RSPA 2PUXB 4JZIA 4HI3A 3URDA 1THPB 1O2SA 4KKDA 5C20A 2HNTE 2WUBA 1QZ8A 1ELFA 1ELAA 3E3TA 3O8DA 5EQSA 3JZ2B 4I8LA 1O3NA 1VCQA 1SGTA 4FOUC 1FN6A 1P2IA 2FODA 2XC4A 2WZQA 1JXPA 1TB6H 1FIZA 1D3QB 1NZQH 3LDXH 4K1TA 3UNQA 2FESH 3BTKE 5FBIA 5GDSH 4K60A 2BVRH 1UVUH 1GDNA 1QR3E 1OPHB 1V2VT 2ODQA 3RU4E 4B74A 1YPMH 2FLBH 1KXDA 5A0AE 3LPRA 2ZTZA 5T3HA 3PV4A 2VVCA 2Y7ZA 2PSYA 1L0ZA 1TRYA 1BMNH 5B6LA 1H9HE 4X6PA 4J1YA 2R9PA 1MU8B 1OXGA 3PO1C 4X1NU 1GWAA 3SHAH 3ZZ6A 1W10U 1QA0A 5I46H 1TBRH 1MQ5A 1GGDB 1F7ZA 3P17H 5JBCS 3MI4A 1GBDA 2UWOA 2Z3CA 3A87A 2OC7A 5PTPA 1UVSH 6ESTA 2CMYA 1GI5A 2BDGA 4F49A 1C1OA 1PQ7A 1XUIA 4YO9A 4NZLA 3VB5A 1AVGH 4WMFA 1ZSLA 1C2FA 3LJOA 2TGPZ 4YOIA 3FANA 1SB1H 1AIXH 1TMBH 1DANH 3FN8A 2A5AA 1EPTB 5C1YA 5EJ1A 2A2XH 2OLGA 3TLOA 4RT0A 2GGVB 4WY3A 4NA9H 3CP7A 3MNXA 1MAYA 2UUYA 1XVMA 3MFJA 1A0LA 2H9TH 3GICB 4D76A 4ABIA 3GS9A 3RXQA 2BX3A 2R3YA 1LQEA 2QGRA 1KSNA 1QA7A 2Q6FA 2VBCA 3QZQA 1IOEA 3HGNA 3L6PA 5FPYA 1O39A 2H6MA 1GDQA 3T2NA 1ELCA 1GJ7B 3M35A 2A45B 3LC5A 4LZ4B 2BQWB 1WSSH 2ZGBH 5IK2D 2BQ6B 1Z8RA 3EDXB 1O2RA 3ZZCA 4YXWD 4AG1A 2SNVA 2G4UA 3SJ8A 4D7FA 1ZMLA 1NN6A 1QBNA 1TA2A 2ALVA 2O8TA 4MNVA 3SI3H 4AGJA 3F9GA 3SU3A 5C3NA 3A88A 3HK3B 1TFXA 1TNLA 2ZDLA 2VIVA 1ZPBA 2BD8A 3D65E 3RM0H 4CHAC 2QIQA 3CENA 1GBKA 1X7AC 4IS5A 1J17T 1GMCG 2ZU5A 1F5KU 4AN7A 1SLVB 2RCEA 1THSH 2IOTA 2V35A 3DCLA 1GJCB 5HIZA 2ZFFH 2ZHEH 3GCTF 4E7NA 1LHFH 1ELTA 3QTVH 1IQIA 5CE1A 1SLUB 1SGRE 3S7KB 3NRLA 3S9CA 2HPPH 2ODYB 3GCHC 2DE9A 1G3EA 1O32A 3SU4A 3V7TA 3SUEA 2AYWA 3BTME 4P02A 1HDTH 3UFAA 2OBQA 3BTQE 2GMTC 5A09A 1N8OB 3W1EA 1RS0A 4WF8A 2ZDKA 2SGFE 2JDID 2OBOA 4E06H 1SGQE 3FP7E 4YLQH 1SPJA 4ZUHA 2ZU4A 1HIAB 2JJ1D 1QURH 5GCHF 1TIOA 1KXCA 2WV9A 1LVYA 5EPYA 2ZA5A 1GCTB 3DUXH 4X6MA 3VG8A 2QY0B 2QF0A 1MH0A 2XTTB 3MU4A 4MNWA 3IG6B 1BRUP 1C2IA 1EJMA 1PPGE 1Z8GA 2Y82A 3MH7A 1L2EA 3A80A 3DSOA 4JK6A 3K6ZA 5KEDA 4CR9A 1Y8TA 2ANWA 5E8EH 1P9SA 4NZQA 3A85A 1C1PA 1O0DH 1QNJA 2STAE 2C8ZB 2YMSC 2UUKB 3KQDA 4U2WA 1W2KH 4CRAA 1VITF 3LKWA 1BT7A 3F6UH 1GJBB 3F2HA 5C0UA 1FLEE 3ELAH 3A83A 1NRQH 1RJXB 6CHAC 2G81E 3MTYA 5AFYH 3H7TA 3A7VA 1LVMA 3LGYA 2G52A 1ZTKA 3TNTA 4X1QU 4CRBA 2B0FA 3E1XB 1K1MA 3EE7A 4MPXA 4NIYA 4CR5A 2QF3A 1P3EA 3OY6U 3H7OA 3HATH 4JYTA 3PM3A 3A7XA 2XNDD 2XBWA 1MD8A 2LPRA 1JIMA 3TGIE 3LJJA 1O2LA 2JH5D 1FY5A 4ZHLU 4NGAH 1J16A 1O38A 2XOKD
chains in the Genus database with same CATH topology
3SQHE 1S82A 1PFXC 2VGCC 4ZKSU 1IQHA 4XE4A 1YLCA 2DUCA 1GBHA 1O2JA 2BLOA 4UFGH 4UDWH 4QT8C 7GCHF 1DM4B 5F8XA 1A5IA 3M7TA 5E2OA 2ZO3H 3SNCA 3RXKA 1H4WA 1NU9A 2BB4A 2BVSH 5F8ZA 3T5FH 1GI4A 2KAIB 4ABBA 1BHXB 5LPRA 4FVBA 5HYOA 2KAIA 1TOMH 3ESTA 2OTVA 4O3UA 4OS7A 5A8ZA 1C2HA 1L1GA 3U8OH 3EYDA 4FUIA 2HNTF 4AGKA 1HLTH 1EATA 3A82A 4B76A 4NA8A 1HJAB 2FOGA 2VU8E 4J2YB 3ZZDA 3GY6A 9ESTA 3PTNA 2JH0D 4GAWA 3BTGE 1ZGIA 1QBVH 1GJAB 2ANYA 2GCTC 1BTUA 2V3OH 1Z1JA 1BTPA 2OD3B 1BRAA 1F92A 1GI0A 2Z9LA 5K0HA 2ZPRA 2PSXA 1AUTC 1ZHPA 1PPCE 1GI7B 1Z8JB 1FUJA 2P94A 2F9VA 3TVJB 2HNTC 1YPEH 2THFB 3M37A 2ZU1A 1LVBA 1AB9C 2VWLA 1B7XB 5CHAC 4CH2B 4AB9A 1EASA 3BV9B 4RKJB 3SOSA 4IW4E 1EP5A 4FU9A 5DO4H 4TWYA 3V12A 1HPGA 4AFUA 1GMDG 2J95A 3SUDA 4I8JA 1A0HB 4DW2U 2F9BH 3ZVGA 1BTXA 1TMUH 1UO6A 3NWUA 5A2MH 1O5DH 1CA8B 1Q2WA 1T8MA 2NU0E 1SOTA 1HAYB 2R0KA 3RMOH 3UOPA 2CHAC 3M7QA 1EPTC 4BTUB 2FS8A 3VB7A 1OYQA 1V2WT 3PO1B 1PPBH 4Z0KA 1O3JA 1EAUA 1ZPCA 2BOHB 2A1DB 2CN0H 3IITA 3CS7A 4H6SB 4WWYA 3SUGA 1K9OE 3MO3A 1UK3A 3JZ1B 4JYVH 3RXEA 2V3HH 1CT4E 1L1NA 4B73A 1B5GH 1ZSJA 3LIWA 1QIXB 3B9FH 2ZCKP 1OP0A 1AWFH 5GPIB 1AKSB 5CMXH 1KDQB 1AHTH 2FS9A 3M3SA 4RN6A 1UTPA 3C27B 3ATMA 1E34B 3GOVB 1V2QT 2G8TA 1GHZA 1MZDA 2GZ7A 1FN8A 5AF9H 1HB0B 1YPJH 4BAHB 1GI2A 3DT0H 4UFEH 1SBWA 1GJ4H 1QY6A 2PFEA 6GCHG 4A1VA 1ID5H 3SJOA 2AGIX 2Y7XA 1GL1A 3ZZ9A 1UK2A 2Y80A 1WTHD 1ABIH 2GVFA 1WYKA 2J2UA 3FVFB 1BDAA 1J14A 1WBGB 5DP8A 3LU9B 4I32A 1WQSA 1DY8A 5FAHA 3ZYDA 2BY8X 3P8FA 1ZRKA 4LOYH 2D26C 3ZZ8A 4BTTB 2CGAA 1S84A 1XXDA 4IN2A 2FYRA 2A4QA 2NU3E 4I8KA 2A31A 2GT7A 3M5LA 9LPRA 1CHOF 1GHVH 5LPFA 1AZ8A 2TGAA 1V2RT 4CHAB 1XUKA 2QCYA 3FZZA 1ANEA 4Y10E 2FX4A 3A7WA 4AOQA 5L30H 1BA8B 3U1IB 2F9NA 2QV1A 4JYUH 3W94A 1VZQH 4FU7A 1FY8E 3DHKH 3RUOA 2VWOA 4R0IA 4A5TS 3SW2B 3PLBA 4JMYA 1GVLA 2HVXA 3OTJE 3GCHB 2ZDAH 1TGNA 1O30A 1SG8B 3E6PH 3SJ9A 2IN2A 3SQEE 4D8NA 2GMTB 1HAOH 1QB1A 2RA3A 4SGBE 5E0HA 3EQ0H 3U8RH 2AH4X 2FOFA 3VB6A 5A0CA 4FUFA 3HKJB 1C5VA 2BDAA 1E38B 1RIWC 1PJPA 2GDEH 1QFKH 4X8UH 3UPEA 2XCNA 1CE5A 1MTUA 3M5OA 1KIGH 4OS6A 1ELVA 2BDYA 4DT7B 1GBIA 4KELA 2NU4E 1CSOE 7KMEH 2WPMS 2FM2A 2H9HA 1FPHH 3RXJA 1TNIA 4LZ1H 1IHTH 2J34A 1O2WA 1O3EA 2PKAA 1V2UT 1OX1A 3SN8A 1MCTA 3RLYH 1FIWA 3KIDU 1ETSH 1O2MA 1QJ1B 4CBOA 1CHGA 1E0FD 2WV5A 3LONA 1DWEH 1HAGE 1O3LA 2A7JA 2OQUA 1MZAA 6CHAB 3KQEA 3K6YA 1D9IA 2ZCLP 5TJXA 2J9NA 1KXAA 5EW1H 3C1KA 2G5VA 1O3OA 3K9XB 5EQQA 1SLXB 1C1RA 2Z3EA 4WH6A 3SGAE 2Y6TA 3PLPA 4K1EA 4B71A 1YCPM 5J4SA 1CGIE 1O2GH 4A1XA 1LTOA 1E36B 1W8BH 1GBBA 1IQKA 3GCNA 2FWWA 3QGJA 5EPNA 5JPMH 1GHWH 3FFGA 3MOCA 4BOHA 3BTWE 3PYHA 3VEQB 3M3VA 3RU4T 1C2DA 5I25A 4NSYA 1RTKA 2H5CA 1DOJA 1G36A 1RD3B 1A3EH 1O2IA 1W7XH 1INCA 2ILNA 3GCTG 1TLDA 5DK1A 1AD8H 1TX6A 4UONA 1ANBA 1S81A 1OWKA 1O5FH 2Y5FA 1P2NA 1SGCA 3Q3KA 2STBE 4DCDA 2GTBA 1HUTH 3TGJE 1C2MA 4ZHAA 1C1UH 1O31A 1UJ1A 1BBRK 3RC5A 1NRPH 1P0SH 2R0LA 2EI6A 1GI9B 4FUDA 4K69A 4Y71A 3SV6A 2HOBA 5GCHG 4GLYA 3SORA 2P3FH 2UWPA 2XWAA 3GY4A 4X1PU 2ZPQA 3RXOA 3FP6E 4X8SH 1CA0C 2ZFSA 1TQ0B 2NU1E 4YZUA 2EEKA 4Q7YA 1BRBE 4JZEH 1S0RA 2GCTB 1YC0A 4FUCA 1AE5A 1ESAA 3SU5A 4BTIB 1H1BA 1L1JA 1JOUB 4I8GA 3LH1A 2H2ZA 5JB9S 1VITG 5FX6A 1BRCE 1D3TB 5DKMA 1AB9B 5CHAB 1GBEA 1Q31A 1BTHH 3E16B 2FOEA 1Y3XA 2ZF0H 1MKXK 2VB0A 2Z3DA 3MHWU 3KCGH 1V2OT 1P02A 2AMDA 1ZGVA 1QRZA 3EA9A 1UMAH 1DT2A 2PGBB 3T62A 3HGPA 2XXLA 2PKSC 1C1QA 3GDVA 1V2LT 3STJA 2BXTH 2ZECA 4K5ZA 1BBRH 5DP3A 2BQ7B 4JCNA 1O36A 1TPOA 3TIUA 2CHAB 1S83A 2GD4B 2VIOA 5A8XA 1GHAF 3SU2A 1SFQB 1EPTA 3F9EA 4FUHA 1HXEH 4E7RG 1UVTH 1B0FA 3KQCA 7GCHG 1TAWA 1TONA 2D1JA 3KN2A 3MYWA 3KEEA 3T25A 3TJNA 1ZZZA 1UVPA 1WQVH 2ZKSA 1HAHH 2W5EA 1N6XA 3RXIA 1YPGH 1MBMA 1AZZA 2C93B 3TITA 3RMLH 4AFQA 1O3DA 3A84A 3GDUA 3NCLA 2ALPA 3MNSA 3MO9A 2P3UB 1HJ9A 3SV8A 2HALA 2OC8A 3SJKA 4D9QA 4X2XA 1C5LH 2C3SA 1IQEA 1BCUH 3ZVBA 1YYY1 1TYNA 2VVUA 2BDHA 5G4BA 1G32B 4Y8ZA 3SUFA 3K65B 2ZNKH 1NS3A 4U32A 2XC0A 1SVPA 4NIWA 3SBKA 1AMHA 1T32A 3ZVCA 1TWXB 1W12U 1SR5C 1MKXH 1O5BB 2VH0A 4JZDH 1YF4A 1QB6A 1F0RA 1F5RA 1CO7E 3A7TA 1VR1H 3SNDA 1HAIH 4O3TA 1CU1A 2OUAA 3PWBA 1GG6C 3PROA 2ZU3A 2PW8H 1DX5M 4AORA 4M7GA 1S85A 3GY8A 3AVZA 2R2WU 2BY5X 4ZAEA 2BTCE 1YBWA 3SGBE 1FV9A 1W11U 4ZKOU 3RXGA 4OS1A 1OWJA 4WMEA 3SGQE 3BIUH 2AGEX 1GJ5H 2SFAA 4INKA 2TIOA 1ZSKA 4PROA 3UREA 4IN1A 1HIAA 1O3IA 1PQAA 2ZQ2A 3MNCA 2ZDNA 5DP6A 3STIA 1ARCA 2FTLE 2W26A 3DA9B 1TPAE 2ZGJA 1C5SA 1KLTA 5SGAE 1TALA 1ELEE 2Z6BD 4CREA 3P70B 2VIWA 5DJ7A 4FXGH 3RU4D 3Q00A 4MDSA 1C2EA 2OQ5A 1V2MT 1ZOMA 1C1VH 4X6OA 4Y8YA 4ESTE 4DGJA 1OKXA 1UHBB 3BSQA 1XX9A 1RIWB 1O3GA 1C1TA 1LHEH 3G01A 4GVUA 1EX3A 1LPGB 3UQOA 1LPZB 2J4IA 4K2YA 5ABWA 2DE8A 1FQ3A 1F2SE 1C5XB 1EJAA 2B8OH 1G2LA 4IGDA 1HV7A 4CRGA 3TJVA 1V2TT 4INHA 1Y3WA 3TH2H 5HXFA 4MNXA 3CS0A 1EZQA 2C90B 4B75A 5EU8A 5JDUB 1K1IA 5IYTA 2BDIA 1LHGH 4X2WA 2Z9JA 1JIRA 3A8CA 4CBNA 3QX5H 3UQVA 1K1PA 1LKBA 3UY9A 1LVOA 1O5CB 1UCYK 1T4UH 1THRH 3SU0A 1AWHB 1QTFA 3LH3A 1AFEH 3ZVFA 3ZVAA 1SOZA 1ORFA 1GCDA 4HTCH 2BHGA 1BTWA 1GI8B 1OP8A 3TU7H 2ZGHA 1VGCC 1DSUA 3QZRA 1CHOG 3ODDA 3MH4A 2P16A 1TNJA 4I31A 1MMJN 1DLEA 5DPAA 3I77A 2FOHA 1MTVA 2ZI2H 1KXFA 1O2PA 1OWEA 1EB1H 1HAPH 4OGYA 2Q6DA 2ZIQH 4OS2A 1OWIA 2GCHF 4O9VA 4Q7ZA 4Q80A 3V3MA 1A5HA 3U1JB 2WV4A 1H8IH 1XUHA 2PLXA 4YTAA 3HKIB 3RXPA 2XCFA 1F0TA 5AHGH 3UWJH 2ZHFH 1O2VA 1ZHMA 2AIQA 1F0SA 2B5TB 2K1QA 3P8NA 5LPEA 2WUCA 3BTEE 1WV7H 3A89A 1TA6A 2GT8A 2IJOB 1ESTA 1BITA 1TRMA 2VINA 3E90B 7LPRA 4XDEA 1BJVA 2ZQ1A 5AVDA 3BG8A 4DURA 4Y0YE 3ZZ3A 1OYTH 4Y6DA 5E2PA 4WXIA 2BLQA 1BTZA 3RM2H 1YPHC 1AFQC 1UCYH 1DLKB 2OC0A 5C1UA 1YM0A 4WMDA 4ISOA 1OWHA 2J94A 2GZ9A 2SGEE 2ZFPH 1F0UA 5A8YA 1CA0B 3KF2A 1GHBF 1QJ7B 1EAWA 4NCYA 1G3CA 3BEIB 2FPZA 5JB8S 1SLWB 1GBLA 5EXNA 5HM9A 8GCHF 5HMAA 2SNWA 2W7UA 4ABGA 1KYNA 2OXSA 5DP4A 2ZDMA 4U30A 4DVAU 1GJ8B 2V0BA 1P10A 1SGPE 1KLIH 1DS2E 5L6NH 3GY5A 4ZHMU 1AN1E 2TBSA 1DPOA 3RC6A 1K1OA 2QXHA 3ATKA 3RXAA 3NUMA 1IQNA 3QGNB 5H4IB 2P95A 1SFIA 2VWNA 2CV3A 4MPUA 2PKSB 2BX4A 3A8BA 4ABAA 2G51A 3F1SB 1SGFG 1BQYA 3Q3XA 2ZU2A 1TPPA 1WU1A 1ZTLA 1AKSA 4GSOA 1KDQA 1V2JT 4NIVA 3SHCH 5DP9A 2R3UA 4A7IB 1ZPZA 2A4RA 3A7YA 5EODA 1LPKB 2AFQB 4I8HA 3BTTE 3LGVA 1P2QA 5A0BA 2VVVA 2HWLB 1ANCA 2ZTYA 2BY6X 1WTGH 4E05H 1QL7A 2ZP0H 1JRSA 1PYTC 1NFWA 1IQFA 2Z94A 1MTSA 3VGCC 3VXFH 5GXPA 3MU8A 3ZZAA 1OP2A 1P2KA 1C5MD 1BJUA 2FIRH 5FPTA 1SMFE 2ASUB 3EGKH 2GP9B 3NZIA 2O8UA 1O3BA 5ESTE 1YCPK 2XYAA 1MTNC 1FJSA 4TY7A 3SU6A 1UTQA 2XBVA 2YNAA 3BTDE 2H9EH 1GVZA 1DICA 1W0ZU 4IMZA 4Q2KA 4D7GA 5C67A 4NFFA 1O2KA 5FX5A 5JBAS 2VIPA 1XUFA 1WAYB 3ATLA 1NRSH 4X0WU 2BD2A 1EKBB 5ESBA 2FI3E 1GVKB 3KHVA 3UR9A 4B2BA 2B9LA 3M3TA 2RA0A 4AG2A 2OC1A 2BVXH 4AFSA 1HRTH 3SO3A 1EOJA 1YP9A 2V6NA 1TBZH 2FTMA 3FP8E 2O8WA 1LHDH 1SL3A 1W0YH 1E35B 1J8AA 1C1WH 2XRCA 1GG6B 1EZUC 5E0JA 1DE7H 3TH3H 4DG4A 4XSKU 4HFPB 2AS9A 1VITH 2ANMH 4WH8A 1EB2A 4BAMB 6LPRA 3IWMA 1MTWA 1O2YA 3UTUH 1HFDA 3TGKE 1DXPA 5GJ4B 3GYMA 3U9AH 1C5RA 5B6OA 1TGTA 4MNYA 3BIVH 1AY6H 1EXFA 1YPLH 2AEIH 3LGIA 2FMJA 7ESTE 1AGJA 1FXYA 1MUEB 4ZXXH 3GISB 1FY4A 3VFEA 1AVWA 1O3KA 1KLJH 1C5YB 4Z6AH 1QRWA 2FDAA 2RG3A 1UVOA 2BMGB 4IC5A 1K1JA 1GBAA 2WYJA 3AAVA 3PMJA 1ETTH 1C1SA 1XM1A 1IAUA 4K1SA 2BDBA 1YCPH 5T6DA 5IDKA 3TPIZ 2FX6A 2O8LA 3ZV9A 1P09A 1G30B 2C8WB 5DGJA 1C5WB 8KME2 4X2YA 1GHAG 3PB1E 4DIIH 5AFZH 4R8TB 1GBCA 1D3DB 2ZDVH 3OU0A 2FI5E 2XBYA 1CT0E 2R2MB 5FBEA 3SZNA 4BNRA 4AB8A 3BN9A 4XOJA 1K28D 1PPZA 1V2NT 2C8YB 1SGEE 4X2VA 1C2JA 1AVXA 2GKVE 2ZG0H 3KL6A 1J15A 4TYDA 4OS5A 3ZYEA 3QTOH 3ZZBA 2FOMB 1XKAC 3I29A 3LT3A 3GY3A 2F9UA 3RXLA 2TRMA 3NPSA 1P57B 3TJOA 4NA7A 3UNRA 2HPQH 5F6MA 4GCHF 2VWMA 1WCZA 2PV9B 2PHBA 4UFFH 3TNSA 2J38A 3MU1A 4K8YA 1T4VH 4X1RU 2A32A 1P01A 1HNEE 2BY9X 2HLCA 1G2MA 1O2HA 1CGJE 1IQGA 2BZ6H 4OS4A 1H9LB 1K21H 5FCKA 1GHXH 2CXVA 1MBQA 1O2XA 3M61U 1D6RA 1TABE 3RLWH 3M5NA 1VGCB 1NFXA 3ZVEA 3L3TA 3MO6A 1PQ8A 2RDLA 1HGTH 1T8LA 3ITIA 2G55A 2A4OA 1V2PT 2NWNA 1OSSA 5EW2H 1ZTJA 3RXTA