3BTME

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
222
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btmE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btmE02
3VB4A 4AG2A 2FOFA 2EA3A 4VGCC 2HLCA 4CBNA 3A84A 4GSOA 1O5GH 1NU9A 3U1JB 2SNWA 1SG8B 2F9PA 5C20A 3HATH 4NFFA 1K1OA 4THNH 4NSYA 2QAAA 3S9BA 1AVWA 4ABAA 2J9NA 3U1IB 1F0TA 2D2DA 4MNWA 5JB8S 1O5BB 4CR9A 3ZVGA 1HAVA 1VR1H 2ZG0H 1FN8A 3UNQA 3A7YA 3QGNB 1THSH 4NWLA 1EKBB 1GMCG 1GHAG 2HRVA 2ZQ1A 1ETSH 5IYTA 1BOQA 1DUEA 3EA7A 1K1LA 2V3HH 4DIHH 1TLDA 1D3TB 3ZYEA 3URCA 2TGTA 1G3EA 5JPMH 1QB9A 1V2TT 2ALVA 4MPUA 3GDUA 3U98H 1D4PB 4FUJA 3URDA 4X8SH 3ZZ6A 4MNYA 2NU3E 1UO6A 3PO1C 1G9IE 1O3GA 2C3SA 3KF2A 2I6SA 1ZHMA 1V6DA 4FUBA 1GBAA 2C90B 3T62A 2F9OA 4ZKOU 2ZNKH 1QA7A 4Y11E 3TIUA 2P3UB 2QXIA 2ZDNA 2PKAB 1VCQA 4CHAC 1GHXH 1SMFE 1GBIA 1EAXA 2QA9E 4ISOA 1IQLA 1O2SA 1GG6C 5GXPA 1E35B 4O3TA 1GHVH 1JXPA 3GY5A 3AAVA 1SFQB 4WF8A 2PGQB 3GCTF 2BD9A 1P2OA 3A8CA 5FCRA 4WH6A 2W3KA 3P6ZB 1GDNA 3AW1A 3M35A 4X1NU 4NIWA 1GI1A 2BZAA 2A32A 3A7ZA 2BVRH 2J95A 3JZ1B 2D26C 4A1XA 2XTTB 1SGPE 1QJ7B 1S6HA 4OS6A 3MU4A 3MU0A 1AFEH 1RRKA 4ZAEA 1A3BH 4HFPB 1A7SA 1ELVA 5AF9H 3OYPA 4HGCA 1EJNA 3RXEA 2H5DA 2P95A 2Q6DA 3LU9B 4MTBA 1CHOG 4INKA 1JWTA 3UIRA 2FOMB 1KTTB 2GT7A 3SI4H 3FP8E 1AE5A 2ZHFH 4YOGA 2GMTC 4X1RU 1VJAU 1V2JT 2BLWA 1GGDB 4F49A 4I8HA 1QIXB 1RFNA 3ZZ8A 2BLQA 1BJVA 1QB1A 1DICA 1PPCE 4ABGA 4UFGH 1P05A 1OXGA 3PYHA 1LCYA 3BV9B 5SGAE 1MKWK 5T3HA 4K1TA 1K28D 2CHAB 4K5ZA 1NM6A 2IN2A 3SV9A 3OY5U 1AU8A 1KXDA 1O2YA 1UVSH 2GCHG 3A86A 3BTWE 3K9XB 3MH7A 4X2XA 3MWIU 1G36A 3BIUH 1O0DH 1O30A 1Z1IA 1MQ5A 3DT0H 4ZXXH 2OC1A 2VINA 1BHXF 3P17H 1QL8A 1EOLA 1S5SA 4NG9H 3TK9A 3LJJA 2FOGA 4X6PA 4DCDA 1TRNA 6GCHG 1RD3B 3RXFA 3SUFA 1HAIH 1TX7A 4X0WU 3O8RA 1HAZB 2ZCHP 2ZDAH 2BD4A 4YTAA 2OUAA 2VVUA 4OS4A 4BOHA 2YOLA 1UCYE 2Q6FA 1KLIH 1IQJA 1YPHE 2FX4A 3W94A 2BVSH 1GJBB 5T6FA 1MTNB 2WPHS 1O3DA 4AZ2B 1QJ1B 1XVMA 1O2LA 5HM9A 1TONA 1WTGH 4FU8A 3HK3B 3TK6A 1MTSA 1UTQA 1XUGA 3VXEH 1OWKA 3G01A 3I77A 1SHHB 2A4QA 1KDQA 3LGIA 2PSXA 3ZVDA 3QGJA 3F9HA 1J15A 1BBRE 4I8JA 1TNJA 3T29A 1ZGVA 1HLTH 1ZSJA 4YLUA 2FLRH 1YP9A 4DY7B 3O8DA 2ZI2H 1H4WA 4DJZB 1C1TA 3BEFB 3L33A 1NRRH 1GI0A 3SQHE 1P03A 1F2SE 1O5DH 1FY8E 4FUHA 4GHQA 5C3NA 3VXFH 2D1JA 1NTPA 1O3OA 1N8OC 4AB8A 1CA0C 1GCTC 2ZA5A 4NA7A 2O8WA 1ELGA 1C5QA 2F9UA 1BTYA 5F6MA 4E7RG 3E16B 1UVUH 1P02A 5E0HA 4WMFA 1EJAA 1DWEH 2O8TA 2PR3A 1ELDE 1TGCA 2FESH 2ZTXA 3TGJE 4WJG2 3T5FH 3VGCC 3MNXA 1OOKB 2WINI 4UFEH 2C8XB 3LPRA 4OS1A 4UD9H 4AOQA 2SGFE 1WAYB 4ABBA 1L0ZA 3STIA 1OS8A 1YC0A 4RKJB 1W11U 2OD3B 3D65E 1ZGIA 2RCEA 4B75A 1GDQA 4JYVH 1KXBA 2A7HA 3RXAA 4X6MA 3LKWA 3U8RH 2WV4A 1P06A 4U2WA 1EB2A 1Y5BT 3STJA 1S81A 3UQOA 1T31A 1EAWA 3QX5H 2EI8A 1CE5A 1O3AA 3MMGA 2H2ZA 3DFLA 1GHBG 1T32A 2UUFB 1NT1A 4ZKRU 4WMDA 2TGAA 1TE0A 1W8BH 2CMYA 4WVPE 2JH6D 1V2QT 4SGAE 1B0FA 1HDTH 3A83A 5FPTA 5CHAC 4Z6AH 5LPRA 1F92A 3TNSA 2F9VA 5EU8A 1DOJA 1F0SA 3V7TA 4KKDA 1D9IA 1UCYH 1FLEE 4NA9H 3RP2A 2TGDA 3UFAA 4X1QU 1S0QA 1TX6A 4IMZA 4K69A 5FHTA 2VIVA 2FYQA 2WYJA 3ODDA 1Z6EA 1DY9A 2VB0A 3PTNA 5F8XA 2FX6A 5LH8A 1BITA 1GHYH 5EXLA 1Y3XA 1OPHB 2GV7A 2WUCA 2W26A 2A7JA 1UK2A 4HTCH 1GMDG 1J9CH 2ZCLP 5ESBA 1J16A 1BQYA 2AEIH 2OLGA 4KP0A 1FY1A 1AGJA 1HJ8A 1C4V2 1A61H 2EC9H 1VITG 1QA0A 4JZIA 1T4UH 1V2NT 2GVFA 2KAIA 1GHWH 3SU4A 1GI5A 4LZ4B 1ZRKA 2BY6X 2ZU4A 4FUEA 2ZEBA 4JK5A 3PMAB 4CR5A 3S9AA 3T26A 4D7FA 3GCHB 1GI3A 2FOHA 3A8DA 3PMHB 1BCUH 3C1KA 2VNTA 4D9QA 1VGCB 1A5IA 1IQMA 3P8GA 1GBCA 2G4UA 1CHGA 2OP9A 2WV5A 3TJNA 1NFUA 1K1NA 1BTPA 1KY9A 4CH2B 1CBWB 1L4DA 4Y71A 4CBOA 1BRAA 1KXAA 1BMAA 1AFQC 1BUIA 1OYQA 1QRXA 1V2UT 2ZGJA 3ZVCA 1ELBA 4SGBE 4TY7A 3SN8A 2JETB 1GJ6A 5J4SA 3SNBA 2GCHF 4AX9H 3M5NA 3QO6A 3MH6A 1NRQH 4IC5A 3KQBA 2ZFFH 1L2EA 3SNCA 1SGTA 1SLVB 1OKXA 3UPEA 4NIXA 3MNCA 4I31A 1ORFA 2BD5A 3M3SA 4WWYA 1BJUA 4MPXA 2P8OC 2HALA 5AVDA 2BDBA 1ELFA 3BG4C 2FP7B 2H1UA 3E90B 3TJVA 1ZHPA 3UNRA 1GJDB 1G2LA 3A85A 4A5TS 3RXGA 2THFB 1O2XA 8KME2 1LVBA 1TBQH 1MCVA 2J34A 1AY6H 1A3EH 3PB1E 5ESTE 1MZAA 4ABHA 1O5AB 4XFQA 3B23B 1DXPA 3SU0A 3I78A 1FAXA 1SGEE 3ELAH 1LHFH 3TH2H 2Q6GA 1O32A 3E8LA 3LGTA 4YOJA 5DP3A 4B2AA 2WPKS 1HAPH 4RSPA 1BB0B 2ESTE 3D23A 4IW4E 1UK3A 3NWUA 4GLYA 1UHBA 3M7UA 2VWLA 3M3TA 2G55A 3EQ0H 1N6XA 3F9GA 3GY3A 2ZHWH 3ZZ4A 3ODFA 1H9HE 1W2KH 4FXGH 7GCHF 4BXSA 1O3FA 4JK6A 4YT6H 2ILNA 2ULLA 3A7VA 4AFSA 1H8IH 1RIWC 5DPAA 2OBQA 2FXRA 1SBWA 4TWWA 4CRGA 2Z3CA 1C9TA 4NCYA 3BTDE 1K2I1 4X1PU 1DLKB 4INHA 2AFQB 2OTVA 1EPTB 3VB7A 1TABE 1AI8H 1TWXB 1TNHA 1IQFA 1O3PB 1XXDA 3M5LA 4O03A 1PPBH 3MU8A 2SGPE 3LDXH 2XWAA 3ZZCA 1SLUB 1AVGH 1IQIA 1SGYE 2VWNA 4IS5A 1W7XH 1QURH 2B7DH 3Q77A 5CE1A 1GJAB 1KXEA 1T8LA 2K1QA 3ZZ7A 2VGCB 1A1RA 2V35A 2NU4E 1H1BA 1YPGH 3P8NA 1U6QA 1D3QB 3LC5A 1C2MA 1HV7A 1JRSA 1IQNA 5B6OA 2RG3A 6CHAB 2Z7FE 4I8GA 1BRCE 1UTKA 1K1JA 2ODQA 4GCHF 1XKAC 1V2PT 2ASUB 1BZXE 1P2KA 3S0NA 2FOEA 5FCKA 3A81A 3SV7A 1O39A 3RXHA 1F5RA 1GJ7B 1PPHE 3A89A 2VWMA 4O97A 1EATA 1XMNB 1AB9B 2TIOA 1GHBF 4Y8XA 1PPZA 4Y6DA 1P11E 3KNXA 1Y3UA 1SQOA 2UWPA 4NWKA 3RXKA 3V0XA 4ABDA 2WPJS 1EZUC 2Y80A 1O2OA 4DT7B 1E36B 2NU2E 4YO9A 1WQVH 1TB6H 3RM2H 1BTZA 1O3BA 3AW0A 5DK1A 2G8TA 4O3UA 3ATWA 5ETXA 2GP9B 1E0FD 1LMWB 4BTTB 5EW1H 1YPJH 3GOVB 1HNEE 2FM2A 4NZLA 5IDKA 2P16A 1TQ0B 3GY6A 1N1LA 1MU6B 1C5SA 1O2NA 2FS8A 1MKWH 3TH3H 1A0JA 1HPGA 4ASHA 1RTLA 8GCHG 2HGTH 5T6DA 1YBWA 3QTOH 4ZROA 3SJOA 3LONA 2ZGCA 3VPKA 2Q1JA 1NRSH 3DHKH 1FXYA 3RMNH 2R0LA 3SHCH 2OCVB 1PPEE 5H4IB 3RC5A 3SNEA 2VIPA 2QYIA 1GJ9B 3KL6A 5C1UA 2DUCA 5C5NA 3ZVBA 1P09A 1DITH 2ZU2A 2Z9JA 3PLPA 2PKSB 2ZECA 1XKBC 2H9TH 3TJUA 3M61U 4R0IA 2A0QB 4QT8C 5A8ZA 3EA8A 2Z94A 3P8OA 2FZZA 3N7OA 1O3IA 1C2KA 2UWOA 3OSYA 5LPFA 2BHGA 1K1MA 2CN0H 1EXFA 4Q7ZA 1V2RT 2R3UA 4Y0ZE 5DJ7A 1BTUA 1WU1A 1O2RA 1DSUA 3IG6B 2BB4A 3LJOA 2XBYA 1PQ8A 3TU7H 2UUYA 3D62A 5T6GA 1WYKA 4FUDA 3RXLA 4ABIA 1QCPA 4DVAU 2Z3EA 3S7HB 1C5NH 2B0FA 1LQDB 2Y81A 3GICB 4TPIZ 5DP4A 3GY2A 1EOJA 2HNTC 1BMMH 3UOPA 1NN6A 1UJ1A 2BZ6H 3SJ8A 4A92A 3E91A 3BTGE 1HJAC 4LOYH 1O3CA 2HWLB 2Y5FA 1O31A 1SC8U 1DE7H 3V3MA 2EEKA 2F9BH 5L2YH 2C8ZB 3Q76A 1XVOA 2G00A 3LH3A 3TVJB 1FUJA 1GJCB 1MCTA 3MI4A 1ESTA 1C1WH 2BLOA 1B0EA 1JMOH 5A0BA 2TGPZ 3SUEA 4FU7A 2AMDA 4AB9A 2BVXH 3PWBA 3LOXA 2XC4A 1BTHH 5JDUB 2VVVA 3RU4E 1XXFA 1O2IA 2ZGXH 5FBIA 3W95A 1TYNA 1KYNA 4NFEA 1SGIB 5E2OA 1L4ZA 4LZ1H 1O2GH 9ESTA 3BTQE 2AMQA 5A8XA 1MTVA 1D6WA 1HRTH 1CO7E 2SGDE 2TRMA 1AVXA 2F3CE 1GI2A 1FQ3A 4I33A 3BTTE 1DWCH 2CV3A 1XUJA 2W7UA 1P9UA 1ZPBA 1ZLRA 4WMEA 1UTNA 3ATKA 1KSNA 4DG4A 2A7CA 5E8EH 1W7GH 1O3HA 3SUGA 1P57B 3M3VA 3OY6U 4D9RA 4ZHMU 8ESTE 1MU8B 5L30H 1BA8B 2ZDLA 1YM0A 1OWHA 1GI4A 2ZFSA 4CRBA 4K8BA 4IBLH 4Y76A 3RXUA 4U30A 1ETTH 1ID5H 1TBZH 4FVBA 1C2FA 3H7TA 3SW2B 2FODA 1AIXH 1NC6A 5E0GA 1ARCA 2BX4A 4A6LA 4CRCA 2A4OA 3RC4A 5LPEA 1TOCB 1GVZA 3V12A 2A31A 1FI8A 1UTOA 1ZZZA 1QL9A 1TA6A 4HZHA 1AE8H 2BDGA 1ZMJA 3E6PH 4B71A 1CBWC 2G52A 3FFGA 4B2CA 2FTMA 4UONA 2PKAA 1JOUB 3SU3A 2PUQH 3JZ2B 2FDAA 4D8NA 1NS3A 4AFZA 3TJOA 2J94A 1GL0E 1FY3A 3ZV9A 3PLBA 1O2JA 4FUIA 1B5GH 1LKAA 3DFJA 1BTWA 1ZPZA 2J38A 3LC3A 1KXFA 1O2HA 1YYY1 2G4TA 4INLA 1VCWA 3RXQA 3M7QA 5GDSH 5FPSA 5FPYA 2GV6A 4WH8A 4Q7XA 3CP7A 1RXPA 1SGCA 5GWZA 1ZSLA 2A4RA 1GBEA 1FIWA 2IOTA 1QR3E 1Q2WA 1KIGH 1OP0A 4JZEH 4VGCB 1SGNE 1C1PA 4YZUA 5K7RA 2ZFTA 1WQSA 4WY3A 3T28A 2FWWA 2WUBA 2YNAA 3A88A 3RXPA 1C1QA 2BOHB 2XW9A 1C9PA 1EX3A 1PQ7A 2ZU5A 4TWYA 4B1TA 1GPZA 3S7KB 1O3KA 8GCHF 3OX7U 1GBLA 2AIPA 1HXEH 4R8TB 3PTBA 3EGKH 1ZOMA 4X2VA 1HBTH 1EP6A 1GBDA 2BY7X 1JIMA 4ZMAH 1YCPH 1FDPA 4MQAA 3K65B 3SNAA 1ZTJA 3PMJA 2KAIB 1P2MA 4BAHB 3TLOA 1GI6A 3F9FA 3KQCA 1TPPA 1O3JA 4K1SA 1P2NA 3RXOA 3QN7A 2JH0D 3S9CA 5C2ZA 5E0JA 5EODA 1NFXA 4UE7H 3KHVA 4BANB 1GMCF 1GHAF 4IGDA 5TCAA 3MO6A 3PO1B 3BEIB 1Z7KA 1Z8JB 3E1XB 2FOAA 3FP7E 5C5OA 3TGIE 3SHAH 1PYTD 5DP9A 3MNSA 1GI9B 1QBVH 4CRFA 1AWFH 1L1JA 1QBOA 2Z6BD 1N6YA 5GCHG 2ZPRA 2QGRA 4CHAB 1XUFA 5I25A 4Q7YA 3P92A 2Y5HA 1BT7A 2P59A 1C1MA 1IHSH 4BAOB 2IJOB 3UY9A 6ESTA 2PTCE 3UWIA 1DM4B 3MOCA 5DP5A 2W7SA 2ZGBH 4XE4A 2HNTF 2ZIQH 1SHYA 4UFDH 1ZMNA 3H5CB 1QY6A 4KTUA 3ZVAA 1IOEA 1ABJH 1AMHA 4B76A 7ESTE 1GI8B 1SQTA 1GMHG 5AHGH 2ANKH 4I7YH 2ODPA 5EQQA 1AUJA 1O3LA 1LPZB 3MNBA 3PM3A 3QK1A 4F4OC 1YF4A 2JKHA 3LIWA 5DP8A 2FEQH 3RU4T 1Y3VA 1Z8IB 3OTJE 1SB1H 1KLJH 1SL3A 4MVNA 2QXJA 2ZDMA 2VH6A 2GMTB 4TYDA 2VIQA 5EPNA 1C5PA 3ATIA 1UVPA 1F7ZA 1O36A 4OGXA 1H8DH 3IITA 1AKSA 1C5ZB 3MTYA 1G3CA 1IQHA 2PV9B 1LPGB 2ANWA 1HYLA 1TA2A 1NO9H 1FPCH 1UHBB 1CA8B 1ELTA 3QZRA 1HAGE 4ZXYH 4ZHAA 4WXIA 3SU2A 2BQWB 1CHOF 3A87A 3P70B 2ZC9H 5GPIB 4NIYA 1QRWA 3ZYDA 1WBGB 1VZQH 2WPIS 2BLVA 4B73A 1BRBE 4FUFA 1TNLA 2Z9GA 3KEEA 3TPIZ 1WSSH 1GVKB 4Y10E 2RDLA 3ZZAA 1TRYA 1HFDA 2GZ9A 2C93B 1C4Y2 1ANEA 1SLXB 2SGQE 2FLBH 3VB5A 2FMJA 2AMPA 3VFEA 1YLCA 4Y8ZA 4NZQA 2BY8X 1YCPK 5DGJA 3UTUH 1KTSB 1D3DB 1C1SA 2VVCA 1QJ6B 1J17T 4FUGA 3AAUA 1NESE 1GVLA 7LPRA 2XC5A 3QZQA 1TPOA 3HGPA 3BG8A 5EG4A 4LK4A 1EP5A 3EE0B 3NZIA 4J2YB 1ANBA 1B7XB 1TMTH 1AWHB 2V6NA 1PQAA 2LNCA 4MG3A 4AG1A 1P12E 3HPTB 4MPVA 2ZQ2A 3F1SB 9LPRA 1RTKA 6GCHF 1V2WT 4K2YA 1TMUH 1ZJDA 3ENSB 3ZV8A 4NA8A 1HIAB 1Y8TA 2ZHQH 4AORA 3UQVA 1EQ9A 1SOZA 1HUTH 1S82A 5EQRA 1SVPA 1BRUP 3GCTG 1J14A 3PMBB 2PFEA 3ZZDA 1LVYA 5JBAS 2SFAA 3BTHE 1P2IA 2H5CA 1G3BA 1OX1A 1LPKB 4HI3A 1P3EA 3FANA 3LH1A 4WXVA 4OGYA 3T25A 3RMOH 1BDAA 1V2OT 4X8UH 5DG6A 1A0LA 1W12U 5C1YA 1W10U 4ISLA 1ZRBA 1SGQE 1C1VH 2J2UA 2ZDKA 3MH5A 2BD8A 1N8OB 1CA0B 1GCTB 1ZR0A 5FX5A 1FONA 4ZUHA 2BDIA 1ZHRA 3RXSA 5DP7A 1SQAA 1Z1JA 3QWCH 4JMYA 3ITIA 3SJIA 3U9AH 2VIOA 2HPQH 4MPWA 2P93A 3SBKA 3SI3H 1OSSA 5EGMA 4DIIH 2FYRA 1GI7B 1YPKH 3VGCB 1RGQA 4OS7A 3V13A 2B5TB 4ISHH 4ZH8A 3B8JA 2Z9KA 1C4U2 2UWLA 3I29A 4JYTA 1A46H 3NK8A 4CRAA 4O9VA 2D8WA 1BIOA 4U01A 1CU1A 2A45B 2VIDA 4ABJA 1ZTLA 2GTBA 3SZNA 4IN1A 1HAVB 1ELCA 1GGDC 1IQKA 1ELAA 1PPGE 2GD4B 1O2KA 2ZWLH 2G51A 4AN7A 1DDJA 1SPJA 2Z3DA 3E0NB 1P0SH 3F9EA 2GDDA 5G4BA 1BBRK 1FY4A 1C5MD 2ZZUH 5HM2A 2PW8H 4DURA 3PWCA 1MD8A 4AYVB 2CHAC 3GYMA 3QDZB 1WCZA 3PLKA 3SJ9A 3TH4H 1F5LA 1GBFA 2XBXA 1LTOA 2PTNA 1A4WH 5CHAB 2O9QA 5F03A 3RLYH 2QXGA 1P2JA 4E05H 4TY6A 4AGKA 2R9PA 2ZPSA 3SV2H 1EAIA 5JB9S 2FI3E 4CH8B 1QHRB 2O8MA 1CGHA 4J1YA 3M36A 4BTUB 3ZZ9A 2ZHEH 3KCGH 4ABFA 3IWMA 1CQQA 4I8KA 3A8AA 5EXNA 3EA9A 1F0RA 1ARBA 4MLFB 5GIBA 2AERH 1MAXA 1TPSA 2SNVA 2BYAX 3DUXH 2STBE 1TFXA 2ANMH 1DX5M 5A2MH 3A7XA 1P3CA 1Y3YA 3RXIA 1JIRA 5FXLA 3GY7A 1TNGA 2C8YB 1NY22 1SI5H 1FNIA 1EJMA 3M37A 2BOKA 1TNKA 2QC2A 4AFQA 3UNSA 1WUNH 4NGAH 3O8BA 1C5XB 1C2DA 1T4VH 1MTNC 1Z8GA 1W3CA 3SNDA 2ZKSA 1BMLA 1LHGH 1UTMA 2ZP0H 4XBBA 5FX6A 2BXUH 4FU9A 1GMDF 3T2NA 1O2UA 4I8LA 2UUJB 4RN6A 4H6SB 1O2WA 1YPHC 3BTFE 1AO5A 4B74A 3OU0A 1FY5A 5TJXA 1DS2E 5AFZH 1EPTA 2NU0E 4ISIH 1D3PB 3R0FA 1X7AC 1O3NA 1TGSZ 1VITF 1CGIE 2BDYA 3RC6A 2AYWA 1ANCA 1O5EH 4M7GA 3RU4D 1VJ9U 1C5LH 5DO4H 1ZYOA 1C5OH 1C5YB 1EZSC 1TALA 1S0RA 2XXLA 1K1PA 1DLEA 3R3GB 3RMLH 1O5FH 1GBBA 2CF8H 2JH5D 4U32A 2BX3A 3L6PA 3T27A 3NXPA 3SGAE 3MYWA 2G5NA 1C2HA 1AFQB 1MD7A 2HVXA 3BTKE 1TRMA 5CMXH 1ZPCA 3MU5A 4TPYA 3RXCA 3MO9A 3Q3YA 2FS9A 3U8OH 1FZZA 2ZTYA 4DGJA 2H6MA 3HK6B 1DWBH 3ZZ5A 2OQUA 4Y7AA 1O33A 3MO3A 1S83A 4UFFH 2EI6A 1O3EA 1VCPA 2P8OB 1GDUA 3BG4B 2WYGA 3F6UH 3PV4A 1Z71A 1CSOE 3GY4A 1C1NA 3SV8A 2C8WB 1WTHD 3M5MA 1MQ6A 2OC0A 4GUXA 5I46H 1QTFA 5L6NH 1YCPM 3FVFB 4KTSA 1G32B 1AD8H 3RDZA 2GCTB 3TK5A 5HYOA 4K60A 5K0HA 2GDEH 1Y3WA 2P3FH 5HMAA 1GWAA 1P10A 1QBNA 2BXTH 2BDCA 3RM0H 1C5RA 1S85A 3EDXB 4KTCA 4BTIB 1FV9A 2AGIX 1YGCH 3QLPH 1UTJA 4DW2U 1F5KU 1K1IA 1O35A 2I6QA 5JBCS 2VU8E 3UR9A 5EXMA 3EAJA 4AGJA 1A2CH 1Y5UT 3A82A 1VITH 4FUCA 4KELA 5F8TA 4YM9A 2R2WU 3LGVA 3RXJA 3TGKE 1O37A 5TCCA 2OBOA 1C2JA 1RIWB 2A2QH 2ZGHA 1EAUA 1MKXK 1K21H 1AZ8A 2XYAA 1KDQB 2ZU3A 3RUOA 3SORA 1UVTH 1CT2E 2ALPA 1THPB 2AGEX 4H4FA 3ZVFA 3ATLA 3E3TA 3GDVA 3EYDA 1F0UA 1UK4A 2BD3A 4UEHH 1KLTA 2Y6TA 1ESAA 4Q80A 1LQEA 4XBCA 2RA3A 4Y79A 5F8ZA 3SJKA 2F91A 1NFYA 5PTPA 3TITA 1G2MA 2OINA 2NU1E 1SGDE 2Z9LA 4BXWA 1LHEH 3RXRA 1MUEB 1CGJE 4Y7BA 2M5TA 1BHXB 1O2QA 4YOIA 1E37B 4IMQA 3SGQE 1TOMH 2A1DB 2QF3A 3D49H 2P3TB 4MNVA 2XBWA 1DPOA 2STAE 3GISB 1AHTH 2FIRH 1C1RA 3GCHC 3BF6H 1O2MA 1ZJKA 4CRDA 1Y5AT 3SOSA 2QCYA 1MMJN 1P8VC 1G37A 1VGCC 1MZDA 4X2WA 1OYTH 2FI5E 3Q3XA 5A0CA 5JYIA 3GDSA 4K8YA 3MFJA 3CS0A 5JBBS 1OWDA 3CS7A 1RS0A 1WOFA 1P01A 3L3TA 4GVUA 1PYTC 1TPAE 4UDWH 4FVDA 4MNXA 1XX9A 6LPRA 3GCOA 1ESBA 2QF0A 1AN1E 1CT4E 1E34B 2ZF0H 1GHZA 3RXBA 5C67A 1LO6A 1QB6A 1QNJA 3QTVH 3UREA 1AUTC 1TIOA 1EUFA 3NPSA 4Z0KA 2JETC 3SV6A 1FJSA 5EOKA 5ABWA 2V0BA 1INCA 2LPRA 2PHBA 3LGYA 3HGNA 2GZ8A 3NKKA 1O3MA 4D7GA 1UMAH 1RTFB 1ZSKA 2B9LA 1HCGA 3U8TH 3DD2H 3GYLB 4XBDA 2WPMS 1C5UA 1O5CB 1QL7A 3B9FH 3MH4A 4ZHLU 2Y5GA 2XC0A 4ESTE 2ZDVH 3RXDA 4XOJA 3HKIB 1C1UH 1BMNH 1DUAA 4H42U 1Y59T 1V2MT 5EPYA 3SQEE 4IN2A 4X8VH 1DSTA 5FAHA 1C2EA 1YKTA 5DKMA 3SGBE 2CGAA 3GY8A 3GCNA 1V2LT 7GCHG 1GBKA 1YPMH 2W5EA 1O2PA 3K6YA 4Y0YE 1MBMA 1C2GA 1SGFG 4X6NA 4ZKSU 5GJ4B 4X6OA 1MTUA 2EI7A 1MTWA 4BNRA 1V2ST 3SU6A 5J4QA 1ANDA 4Y8YA 1TBRH 1AKSB 2UUKB 2ZCKP 3BSQA 3KIDU 3KGPA 2FI4E 5DP6A 3RMMH 4DOQA 2BD2A 3LT3A 1SFIA 3MU1A 2HNTE 1EASA 1TGTA 1OP8A 1NZQH 1H9IE 1YPEH 4D76A 4JYUH 1FPHH 1DY8A 7KMEH 2YNBA 1EPTC 3FAOA 1CVWH 3TNTA 1QGFA 4XDEA 1UTLM 2OXSA 2Y7ZA 2XCFA 4BAMB 1HJAB 1G3DA 2HOBA 1HAXB 3Q00A 1GJ5H 3QUMP 4GCHG 2A4GA 3MHWU 1O38A 1SOTA 2GGVB 2VGCC 3VB6A 2QIQA 1UVOA 3HKJB 1QRZA 1ACBE 4YLQH 1GG6B 1IAUA 1H9LB 1O2VA 2AH4X 1LDTT 5AFYH 2BDHA 2A5IA 2G5VA 1GBJA 2SGAA 6CHAC 3SU1A 1SR5C 4ABEA 2A5KA 4X2YA 2V3OH 1OP2A 1ETRH 1Z6JH 3P95A 1ZTKA 1FIZA 4YESB 4AFUA 2BY5X 1P04A 1BTXA 2Y82A 3K6ZA 1AB9C 2C4FH 2P94A 3AVZA 1YPLH 1MH0A 3BN9A 2R2MB 4JZDH 1K22H 1NFWA 2PUXB 1Z8RA 1G30B 3E0PB 1QFKH 3A80A 2R3YA 1GJ4H 2GX4A 3SU5A 2A2XH 2ZFRH 4B2BA 3PROA 1NU7B 3FZZA 1W0YH 2QY0B 3RXMA 1UTPA 2FO9A 2G81E 1S84A 2TPIZ 2AGGX 3DA9B 1TAWA 2H9EH 1OWEA 1BBRH 5A0AE 1DANH 1HXFH 1T8OA 4X8TH 1GCDA 2QXHA 3C27B 2PGBB 1KXCA 2BY9X 3WY8A 4NIVA 1GBMA 4YT7H 3RLWH 2F9NA 1XUHA 1PPFE 1O34A 3KQDA 1T8MA 2W3IA 2ZHDA 1FAKH 1NROH 2DE8A 1JBUH 2PKSC 3A7TA 2BQ7B 1HGTH 2R0KA 1P2QA 1TMBH 4PROA 3RXTA 4MDSA 2HPPH 3KQEA 1LHDH 1EB1H 2VH0A 3U69H 3BIVH 1L1NA 1FMGA 2ZU1A 1QQUA 2OC8A 1M9UA 1T8NA 2IPHA 3FZDA 1E38B 2PSYA 5EQSA 1C5VA 1LVMA 2RA0A 2Z9IA 1PFXC 4IC6A 1IQGA 2BDAA 1S6FA 1TGBA 4JZFH 1Q3XA 2B8OH 1DT2A 1IHTH 3SUDA 1C2IA 5BPEA 4Q2KA 1A0HB 2QN5T 2H9HA 1GBTA 1W13U 3UUZA 1C2LA 1TX8A 2XWBI 3A7WA 1CT0E 4JCNA 1C5WB 2AIQA 3H7OA 2NWNA 2QV1A 3BTME 3NCLA 4ZKNU 4X1SU 3VB3A 5A8YA 2GCTC 2DE9A 1XUKA 1HJ9A 3Q3KA 3ZVEA 2F83A 2SGEE 3BEUA 3K2UA 2ZFQH 3M5OA 1C1OA 1SLWB 3UOUA 2BM2A 3VEQB 2CF9H 4OS2A 2XBVA 2CXVA 1NRPH 1V2KT 4A7IB 5L2ZH 4K1EA 5HXFA 5E2PA 4H6TA 1TQ7B 2PWXA 2XCNA 3ZZBA 3CENA 5HGGA 1QQ4A 2O8LA 1UCYK 1P9SA 3M7TA 1JRTA 1ZMLA 1C5TA 1GBHA 2BMGB 1YLDA 1A5GH 1EZXC 1DXWA 1WV7H 1ELEE 2VIWA 2GZ7A 3AASA 2GT8A 2OC7A 4OS5A 1OWIA 4K3JA 4ISNA 4A1TA 2WPLS 4LXBH 2FPZA 1SSXA 3ESTA 5EW2H 2ZPQA 5C1XA 2BQ6B 2ZFPH 2PLXA 1W0ZU 1Q31A 1EZQA 4RKOB 2GKVE 4E7NA 4BAQB 2AS9A 4GHTA 1TNIA 2BD7A 3ATMA 4JZ1A 1ABIH 2ODYB 1L1GA 2ZTZA 1V3XA 1O2TA 5LGOA 2ANYA 3S69A 2J92A 2VWOA 1NPMA 2OQ5A 3P8FA 1T7CA 1DWDH 3FP6E 4NSVA 1J8AA 5A09A 1SGRE 1K9OE 1HB0B 2XNIA 1PQ5A 3LGWA 4CREA 3BTEE 1DFPA 1V2VT 3A8BA 3O8CA 2FOCA 4XSKU 1GJ8B 5GCHF 2FTLE 8LPRA 1HIAA 1MKXH 2XRCA 1D6RA 4AYYB 4GAWA 1A5HA 4A1VA 2BTCE 1MAYA 3NUMA 3RXVA 1FN6A 1RJXB 1AZZA 3UWJH 1XUIA 2TBSA 1O2ZA 1DVAH 1SGFA 5JBTA 3LGUA 1HAOH 3KN2A 2O8UA 1TGNA 1AQ7A 1MBQA 1HAHH 5FBEA 2VJ1A 1GMHF 1PJPA 1W14U 1NRNH 1GL1A 1LKBA 2A5AA 2Y7XA 4BAKB 1LVOA 4GPGA 1OWJA 4I32A 5BRRE 3SO3A 3ZZ3A 4E06H 2FOBA 1XM1A 2ZO3H 1THRH 4KGAA 2J4IA 2CJIA 1LHCH 3UR6A 1HAYB 3F68H 1IQEA
chains in the Genus database with same CATH superfamily
4P00A 3VB4A 4AG2A 2FOFA 2EA3A 4VGCC 2HLCA 4CBNA 3A84A 4GSOA 1O5GH 1NU9A 3U1JB 2SNWA 1SG8B 2F9PA 1VKYA 5C20A 3HATH 4NFFA 1K1OA 4THNH 5HIZA 4NSYA 2QAAA 3S9BA 1AVWA 4ABAA 2J9NA 3U1IB 1F0TA 2D2DA 4MNWA 5JB8S 1O5BB 4CR9A 3PRBA 3ZVGA 1HAVA 1VR1H 2ZG0H 2KR7A 1FN8A 3UNQA 3A7YA 3QGNB 1THSH 4NWLA 1EKBB 1GMCG 1GHAG 2HRVA 2ZQ1A 1ETSH 5IYTA 1BOQA 1DUEA 3EA7A 1K1LA 2JJ2D 2V3HH 3GS9A 4DIHH 1OHHD 1TLDA 1D3TB 3ZYEA 3URCA 2TGTA 1G3EA 5JPMH 2GJGA 1QB9A 3OTPA 1V2TT 2ALVA 4MPUA 3GDUA 2F4LA 1D4PB 4FUJA 3U98H 3URDA 3ZIAD 4X8SH 3ZZ6A 4MNYA 2NU3E 1UO6A 3PO1C 1G9IE 1O3GA 2C3SA 3KF2A 2I6SA 1ZHMA 1V6DA 4FUBA 1GBAA 2C90B 3T62A 2F9OA 4ZKOU 2ZNKH 1QA7A 4Y11E 3TIUA 2P3UB 2QXIA 2ZDNA 2PKAB 1VCQA 4CHAC 1GHXH 1SMFE 1GBIA 1EAXA 2QA9E 4ISOA 4Q63A 1IQLA 1O2SA 1GG6C 5GXPA 1E35B 2LP6A 2WZQA 4O3TA 1GHVH 1JXPA 3GY5A 3AAVA 1SFQB 4WF8A 2PGQB 3GCTF 2BD9A 1P2OA 3A8CA 5FCRA 4WH6A 2W3KA 3P6ZB 1GDNA 3AW1A 3M35A 4X1NU 4NIWA 1GI1A 2BZAA 2A32A 3A7ZA 2BVRH 2J95A 3JZ1B 2D26C 4A1XA 2XTTB 1SGPE 1QJ7B 1S6HA 4OS6A 3MU4A 3MU0A 2YMSC 1AFEH 1RRKA 4ZAEA 1A3BH 1COWD 4HFPB 1A7SA 1ELVA 5AF9H 2JDID 3OYPA 4HGCA 1EJNA 3RXEA 2H5DA 2P95A 2Q6DA 3LU9B 4MTBA 1CHOG 4INKA 1JWTA 3UIRA 2FOMB 1KTTB 2GT7A 3SI4H 3FP8E 1AE5A 2ZHFH 4YOGA 2GMTC 4X1RU 1VJAU 1V2JT 2BLWA 1GGDB 4F49A 1W0JD 4I8HA 1QIXB 1RFNA 3ZZ8A 2BLQA 1BJVA 1QB1A 1DICA 1NBMD 1PPCE 4ABGA 4UFGH 1P05A 1OXGA 3PYHA 4B6EA 1LCYA 3BV9B 5SGAE 1MKWK 5T3HA 4K1TA 1K28D 1E79D 2VBCA 2CHAB 4K5ZA 1NM6A 2IN2A 3SV9A 3OY5U 1AU8A 1KXDA 1O2YA 1UVSH 2GCHG 3A86A 3BTWE 3K9XB 3MH7A 4X2XA 3MWIU 1G36A 3BIUH 1O0DH 1O30A 1Z1IA 1MQ5A 3DT0H 4ZXXH 4XRNA 2OC1A 2VINA 1BHXF 3P17H 1QL8A 1EOLA 1S5SA 3CNRA 4NG9H 3TK9A 3LJJA 2FOGA 4X6PA 4DCDA 1TRNA 6GCHG 1RD3B 3RXFA 3SUFA 1HAIH 1TX7A 4X0WU 3O8RA 1HAZB 2ZCHP 2ZDAH 2BD4A 4YTAA 2OUAA 2VVUA 4OS4A 4BOHA 2YOLA 1UCYE 2Q6FA 1KLIH 1IQJA 1YPHE 2FX4A 3W94A 2BVSH 1GJBB 5T6FA 1MTNB 2WPHS 1O3DA 3F2HA 1QJ1B 1XVMA 1O2LA 4AZ2B 5HM9A 1TONA 1WTGH 4FU8A 3HK3B 3TK6A 1MTSA 1UTQA 1XUGA 3VXEH 1OWKA 3G01A 3I77A 1SHHB 2A4QA 1KDQA 3LGIA 2PSXA 3ZVDA 3QGJA 3F9HA 1J15A 3NRLA 1BBRE 4I8JA 1TNJA 3T29A 1ZGVA 1HLTH 1ZSJA 4YLUA 2FLRH 1YP9A 4DY7B 3O8DA 2ZI2H 1FX0B 1H4WA 4DJZB 1C1TA 3BEFB 3L33A 1NRRH 1GI0A 3SQHE 1P03A 1F2SE 1O5DH 1FY8E 4FUHA 4GHQA 5C3NA 3VXFH 2D1JA 1NTPA 1O3OA 1N8OC 4AB8A 1CA0C 1GCTC 2ZA5A 4NA7A 2O8WA 1ELGA 1C5QA 2F9UA 1BTYA 5F6MA 4E7RG 3E16B 1UVUH 1P02A 5E0HA 2CK3D 4WMFA 1EJAA 1DWEH 2O8TA 2PR3A 3KQ5A 1ELDE 1TGCA 2FESH 2ZTXA 3TGJE 4WJG2 3T5FH 3VGCC 3MNXA 1W0KD 2AHME 1OOKB 2WINI 4UFEH 2C8XB 3LPRA 4OS1A 4UD9H 4AOQA 2SGFE 1WAYB 4ABBA 1L0ZA 3STIA 1OS8A 1YC0A 4RKJB 1W11U 2OD3B 3D65E 1ZGIA 2RCEA 4B75A 1GDQA 4JYVH 1KXBA 2A7HA 3RXAA 4X6MA 3LKWA 3U8RH 2WV4A 1K0HA 1P06A 4U2WA 1EB2A 3W1EA 1Y5BT 3STJA 1S81A 3UQOA 1T31A 1EAWA 3QX5H 2EI8A 1CE5A 1O3AA 3MMGA 2H2ZA 3DFLA 1GHBG 1T32A 2UUFB 1NT1A 4ZKRU 4WMDA 3WWFA 2TGAA 1TE0A 1W8BH 2CMYA 5EIYA 4WVPE 2JH6D 1V2QT 4SGAE 1B0FA 1HDTH 3A83A 5FPTA 5CHAC 4Z6AH 5LPRA 1F92A 3TNSA 2F9VA 5EU8A 4OM9A 1DOJA 1F0SA 3V7TA 4KKDA 1D9IA 1UCYH 1FLEE 4NA9H 3RP2A 2TGDA 3UFAA 4X1QU 1S0QA 1TX6A 4IMZA 4K69A 5FHTA 2VIVA 2FYQA 2WYJA 3ODDA 1Z6EA 1DY9A 2VB0A 3PTNA 5F8XA 5IK2D 2FX6A 5LH8A 1BITA 1GHYH 5EXLA 1Y3XA 1OPHB 2GV7A 2WUCA 2W26A 2A7JA 1UK2A 4HTCH 1GMDG 4I86A 1J9CH 2ZCLP 5ESBA 1J16A 3AK5A 1BQYA 2AEIH 2OLGA 4KP0A 1FY1A 1AGJA 1HJ8A 1C4V2 1A61H 2EC9H 1VITG 1QA0A 4JZIA 1T4UH 1V2NT 2GVFA 2KAIA 1GHWH 3SU4A 1GI5A 4LZ4B 1ZRKA 2BY6X 2ZU4A 4FUEA 2ZEBA 2M2AA 4JK5A 3PMAB 4CR5A 3S9AA 3T26A 4D7FA 3GCHB 1GI3A 2FOHA 3A8DA 3PMHB 1BCUH 3C1KA 5B6LA 2VNTA 4D9QA 1VGCB 1A5IA 1IQMA 3P8GA 1GBCA 2G4UA 1CHGA 2OP9A 2WV5A 3TJNA 1NFUA 1K1NA 1BTPA 2J98A 1KY9A 4CH2B 1CBWB 1L4DA 4Y71A 4CBOA 1BRAA 1KXAA 1BMAA 1AFQC 1WDIA 1BUIA 1OYQA 2KX4A 1QRXA 1V2UT 2ZGJA 3ZVCA 1ELBA 4SGBE 4TY7A 3WW7A 3SN8A 2JETB 1GJ6A 5J4SA 3SNBA 2GCHF 4AX9H 3M5NA 3QO6A 3MH6A 1NRQH 4IC5A 3KQBA 2ZFFH 1L2EA 3SNCA 1SGTA 1SLVB 1OKXA 3UPEA 4NIXA 3MNCA 4I31A 1ORFA 2BD5A 3M3SA 4WWYA 1BJUA 4MPXA 2P8OC 2HALA 5AVDA 2BDBA 1ELFA 3BG4C 5CHBA 2FP7B 2H1UA 3E90B 5C94A 3TJVA 1ZHPA 3UNRA 1GJDB 1G2LA 3A85A 4A5TS 3RXGA 2THFB 1O2XA 8KME2 1LVBA 1TBQH 1MCVA 2J34A 1AY6H 1A3EH 3PB1E 5ESTE 1MZAA 4ABHA 1O5AB 4XFQA 3B23B 1DXPA 3SU0A 3I78A 1FAXA 1SGEE 3ELAH 1LHFH 3U28C 3TH2H 2Q6GA 1O32A 3E8LA 3LGTA 4YOJA 5DP3A 4B2AA 2WPKS 1HAPH 4RSPA 1BB0B 2ESTE 3D23A 4IW4E 1UK3A 3NWUA 4GLYA 1UHBA 3M7UA 2VWLA 3M3TA 2G55A 3EQ0H 1N6XA 3F9GA 3GY3A 2KCAA 2ZHWH 3ZZ4A 3ODFA 1H9HE 1W2KH 4FXGH 7GCHF 4BXSA 1O3FA 4JK6A 4YT6H 2ILNA 2ULLA 3A7VA 4AFSA 1H8IH 1RIWC 5DPAA 2OBQA 2FXRA 1SBWA 4M9FA 4TWWA 4CRGA 2Z3CA 1C9TA 4NCYA 3BTDE 1K2I1 4X1PU 1DLKB 4INHA 2AFQB 5GNDA 2OTVA 1EPTB 3VB7A 1TABE 1AI8H 1TWXB 1TNHA 1IQFA 1O3PB 1XXDA 3M5LA 4O03A 1PPBH 4FETA 3MU8A 1E1QD 2SGPE 3LDXH 2XWAA 3ZZCA 1SLUB 1AVGH 1IQIA 1SGYE 2VWNA 4IS5A 1W7XH 1QURH 2B7DH 3Q77A 5CE1A 1GJAB 1KXEA 1T8LA 2K1QA 3ZZ7A 2VGCB 1A1RA 2V35A 2NU4E 1H1BA 1YPGH 3P8NA 1U6QA 1D3QB 3LC5A 1C2MA 1HV7A 1JRSA 1IQNA 5B6OA 2RG3A 6CHAB 2Z7FE 4I8GA 1BRCE 1UTKA 1K1JA 2ODQA 4GCHF 1XKAC 1V2PT 2ASUB 1BZXE 1P2KA 3S0NA 2FOEA 5FCKA 3A81A 3KYFA 1O39A 3SV7A 3OAAD 3RXHA 1F5RA 1GJ7B 1PPHE 3A89A 2VWMA 4O97A 1EATA 1XMNB 1AB9B 2TIOA 1GHBF 2KCPA 4Y8XA 1PPZA 4Y6DA 1P11E 3KNXA 1Y3UA 1SQOA 2UWPA 4NWKA 3RXKA 3V0XA 4ABDA 2WPJS 5EJ1A 1EZUC 2Y80A 1O2OA 1WXRA 4DT7B 1E36B 2NU2E 4YO9A 1WQVH 3FKSD 1TB6H 3RM2H 1BTZA 1O3BA 3AW0A 5DK1A 2G8TA 4O3UA 3ATWA 5ETXA 2GP9B 1E0FD 1LMWB 4BTTB 5EW1H 1YPJH 3GOVB 1HNEE 2FM2A 4NZLA 5IDKA 2P16A 1TQ0B 3GY6A 1N1LA 1MU6B 1C5SA 1O2NA 2FS8A 4ACBA 1MKWH 3TH3H 1A0JA 1HPGA 4ASHA 1RTLA 8GCHG 2HGTH 5T6DA 1YBWA 3QTOH 1YLNA 4ZROA 3SJOA 3LONA 2ZGCA 3VPKA 2Q1JA 1NRSH 3DHKH 1FXYA 3RMNH 2R0LA 3SHCH 2OCVB 1PPEE 5H4IB 3RC5A 3SNEA 2VIPA 2QYIA 1GJ9B 3KL6A 5C1UA 5C0UA 2DUCA 5C5NA 3ZVBA 1P09A 1DITH 2ZU2A 2Z9JA 3PLPA 2PKSB 2ZECA 1XKBC 2H9TH 3TJUA 3M61U 4R0IA 2A0QB 4QT8C 5A8ZA 3EA8A 2Z94A 3P8OA 2FZZA 3N7OA 1O3IA 1C2KA 2UWOA 3OSYA 5CDFE 5LPFA 2BHGA 1K1MA 2CN0H 1EXFA 4Q7ZA 1V2RT 2R3UA 4Y0ZE 5DJ7A 1BTUA 1WU1A 1O2RA 1DSUA 3IG6B 2BB4A 3LJOA 2XOKD 2XBYA 1PQ8A 3TU7H 2UUYA 3D62A 3FOAA 5T6GA 1WYKA 4FUDA 3RXLA 4ABIA 1QCPA 4DVAU 2Z3EA 3S7HB 3F0PA 1C5NH 2B0FA 1LQDB 2Y81A 3GICB 4TPIZ 5DP4A 3GY2A 1EOJA 2HNTC 1BMMH 3UOPA 1NN6A 1UJ1A 2BZ6H 3SJ8A 4A92A 3E91A 3BTGE 1HJAC 4LOYH 1O3CA 2HWLB 2Y5FA 1O31A 1SC8U 1DE7H 3V3MA 2EEKA 2F9BH 5L2YH 2C8ZB 3Q76A 1XVOA 2G00A 3LH3A 3TVJB 1FUJA 1GJCB 1MCTA 3MI4A 1ESTA 1C1WH 2BLOA 1B0EA 1JMOH 5A0BA 2TGPZ 3SUEA 4FU7A 2AMDA 4AB9A 2OK5A 2BVXH 3PWBA 2EY4C 3LOXA 2XC4A 1BTHH 5JDUB 2VVVA 3RU4E 1XXFA 1O2IA 2ZGXH 5FBIA 3W95A 1TYNA 1KYNA 4NFEA 1SGIB 5E2OA 1L4ZA 4LZ1H 1O2GH 2K0QA 9ESTA 3BTQE 2AMQA 5A8XA 2V7QD 1MTVA 1D6WA 2IJD1 4RT1A 1HRTH 1CO7E 2SGDE 2TRMA 3H09A 1AVXA 2F3CE 1GI2A 1FQ3A 4I33A 3BTTE 1DWCH 2CV3A 1XUJA 2W7UA 1P9UA 1ZPBA 1ZLRA 4WMEA 1UTNA 3ATKA 1KSNA 4DG4A 2A7CA 5E8EH 1W7GH 1O3HA 3SUGA 1P57B 3M3VA 3OY6U 4D9RA 4ZHMU 1SQRA 8ESTE 1MU8B 5L30H 1BA8B 2ZDLA 1YM0A 1OWHA 1GI4A 2ZFSA 4CRBA 4K8BA 4IBLH 4Y76A 3RXUA 4U30A 1ETTH 2KM0A 1ID5H 1TBZH 4FVBA 1C2FA 3H7TA 3SW2B 2FODA 1AIXH 1NC6A 5E0GA 1ARCA 2BX4A 4A6LA 4CRCA 2A4OA 3RC4A 5LPEA 1TOCB 1GVZA 3V12A 2A31A 1FI8A 1UTOA 1ZZZA 1QL9A 1TA6A 4HZHA 1AE8H 2BDGA 1ZMJA 3E6PH 4B71A 1CBWC 2G52A 3FFGA 4B2CA 2FTMA 4UONA 2PKAA 1JOUB 3SU3A 2PUQH 3JZ2B 2FDAA 4D8NA 1NS3A 4AFZA 3TJOA 2J94A 1GL0E 1FY3A 3ZV9A 5C17A 3PLBA 1O2JA 4FUIA 1B5GH 1LKAA 3DFJA 1BTWA 1ZPZA 2RFKC 2J38A 3LC3A 1KXFA 1O2HA 1YYY1 2G4TA 4INLA 1VCWA 3RXQA 3M7QA 5GDSH 5FPSA 5FPYA 2GV6A 4WH8A 4Q7XA 3CP7A 1RXPA 1SGCA 5GWZA 1ZSLA 2A4RA 1GBEA 1FIWA 2L74A 2IOTA 1QR3E 1Q2WA 1KIGH 1OP0A 4JZEH 4VGCB 1SGNE 1C1PA 4Z1MD 4YZUA 5K7RA 2ZFTA 1WQSA 4WY3A 3T28A 2FWWA 2WUBA 2YNAA 3A88A 3RXPA 1C1QA 2BOHB 4DT4A 5KGOA 2XW9A 1C9PA 1EX3A 1PQ7A 2ZU5A 4TWYA 3OEED 4B1TA 1GPZA 3S7KB 1O3KA 8GCHF 3OX7U 1GBLA 2AIPA 1HXEH 4R8TB 3PTBA 3EGKH 1ZOMA 4X2VA 1HBTH 1EP6A 1GBDA 2BY7X 1JIMA 4ZMAH 1YCPH 1FDPA 4MQAA 3K65B 4F48B 3SNAA 1ZTJA 5EJLA 3PMJA 2KAIB 1P2MA 3DSPA 4BAHB 3TLOA 1GI6A 3F9FA 2JIZD 3KQCA 1TPPA 1O3JA 4K1SA 1P2NA 3RXOA 3QN7A 2JH0D 4FOUC 3S9CA 5C2ZA 5E0JA 5EODA 1NFXA 4UE7H 3KHVA 4BANB 1GMCF 1GHAF 4IGDA 5TCAA 3MO6A 3PO1B 3BEIB 1Z7KA 1Z8JB 3E1XB 2FOAA 3FP7E 5C5OA 3TGIE 3SHAH 1PYTD 5DP9A 3MNSA 1GI9B 1QBVH 4CRFA 2QE7D 1AWFH 1L1JA 1QBOA 2Z6BD 1N6YA 5GCHG 2ZPRA 2QGRA 4CHAB 1XUFA 5I25A 4Q7YA 3P92A 2Y5HA 1BT7A 2P59A 1C1MA 1IHSH 4BAOB 2IJOB 3UY9A 6ESTA 2PTCE 3UWIA 1DM4B 3MOCA 5DP5A 2W7SA 2ZGBH 4XE4A 2HNTF 2ZIQH 1SHYA 4UFDH 1ZMNA 3H5CB 1QY6A 4KTUA 3ZVAA 1IOEA 1ABJH 1AMHA 4B76A 7ESTE 1GI8B 1SQTA 1GMHG 5AHGH 2ANKH 4I7YH 2ODPA 5EQQA 1AUJA 1O3LA 1LPZB 2YMSB 3MNBA 3PM3A 3QK1A 5KECA 4F4OC 1YF4A 2JKHA 3LIWA 5DP8A 2FEQH 3RU4T 1Y3VA 4YXWD 1Z8IB 3OTJE 4TT3D 1SB1H 1KLJH 1SL3A 4MVNA 2QXJA 2ZDMA 2VH6A 2GMTB 4TYDA 2VIQA 5EPNA 1MABB 1SKYE 1C5PA 3ATIA 1UVPA 1F7ZA 1O36A 4OGXA 1H8DH 3IITA 1AKSA 1C5ZB 3MTYA 1G3CA 3WWBA 1IQHA 2PV9B 1LPGB 2ANWA 1HYLA 1TA2A 1NO9H 1FPCH 2HVYB 1UHBB 1CA8B 1ELTA 3QZRA 1HAGE 3F2GA 4ZXYH 4ZHAA 4WXIA 3SU2A 2BQWB 1CHOF 3A87A 3P70B 2ZC9H 5GPIB 4NIYA 1QRWA 3ZYDA 1WBGB 1VZQH 2WPIS 2BLVA 4B73A 1BRBE 4FUFA 1TNLA 2Z9GA 3KEEA 3TPIZ 1WSSH 1GVKB 4Y10E 2RDLA 3ZZAA 1TRYA 1HFDA 2GZ9A 2C93B 1C4Y2 1ANEA 1SLXB 2SGQE 2FLBH 3VB5A 2FMJA 2AMPA 3VFEA 1YLCA 1QZ8A 4Y8ZA 4NZQA 2BY8X 1YCPK 5DGJA 3UTUH 1KTSB 1D3DB 1C1SA 2VVCA 1QJ6B 1J17T 4FUGA 3AAUA 1NESE 1GVLA 7LPRA 2XC5A 3QZQA 1TPOA 3HGPA 3BG8A 5EG4A 4LK4A 1EP5A 3EE0B 3NZIA 4J2YB 1ANBA 1B7XB 1TMTH 1AWHB 2V6NA 1PQAA 2LNCA 4MG3A 4AG1A 1P12E 3HPTB 4MPVA 2ZQ2A 3F1SB 9LPRA 1RTKA 6GCHF 1V2WT 4K2YA 1TMUH 1ZJDA 3ENSB 3ZV8A 1E1RD 4NA8A 1HIAB 1Y8TA 5FL7D 2ZHQH 2WV9A 4AORA 3UQVA 1EQ9A 1SOZA 1HUTH 1S82A 5EQRA 1SVPA 1BRUP 3GCTG 1J14A 3PMBB 2PFEA 3ZZDA 1LVYA 5JBAS 2SFAA 3BTHE 1P2IA 2H5CA 1G3BA 1OX1A 1LPKB 3OE7D 2HLDD 3KYGA 4HI3A 1P3EA 3FANA 3LH1A 4WXVA 4OGYA 3T25A 3RMOH 1BDAA 1V2OT 4X8UH 5DG6A 1A0LA 1W12U 5C1YA 1W10U 4ISLA 1ZRBA 1SGQE 1C1VH 2J2UA 2ZDKA 3MH5A 2BD8A 1N8OB 1CA0B 1GCTB 1ZR0A 5FX5A 1FONA 4ZUHA 2BDIA 1ZHRA 3RXSA 5DP7A 1SQAA 1Z1JA 2KCOA 3QWCH 4JMYA 3ITIA 3SJIA 3U9AH 2VIOA 2HPQH 4MPWA 2P93A 3SBKA 3SI3H 1OSSA 5EGMA 4DIIH 2FYRA 1GI7B 1YPKH 3VGCB 2J5UA 1RGQA 4OS7A 3V13A 2B5TB 4ISHH 4ZH8A 3B8JA 2Z9KA 1C4U2 2UWLA 3I29A 4JYTA 1A46H 3NK8A 4CRAA 4O9VA 2D8WA 1BIOA 4U01A 1CU1A 2A45B 2VIDA 4ABJA 1ZTLA 3F3BA 2GTBA 3SZNA 4IN1A 1HAVB 1ELCA 2PP6A 1GGDC 1IQKA 1ELAA 1PPGE 5HIYA 2GD4B 1O2KA 2ZWLH 2G51A 4AN7A 1DDJA 1SPJA 2Z3DA 3E0NB 1P0SH 3F9EA 3N99A 2GDDA 5G4BA 1BBRK 1FY4A 1C5MD 2ZZUH 5HM2A 2PW8H 4DURA 3PWCA 1MD8A 4AYVB 2CHAC 3GYMA 3QDZB 1WCZA 3PLKA 3SJ9A 3TH4H 1F5LA 1GBFA 2XBXA 1LTOA 3PV5A 2PTNA 1A4WH 5CHAB 2O9QA 5F03A 3RLYH 2QXGA 1P2JA 4E05H 4TY6A 4AGKA 2R9PA 2ZPSA 3SV2H 1EAIA 5JB9S 2FI3E 4CH8B 1QHRB 2O8MA 1CGHA 4J1YA 2QF4A 3M36A 4BTUB 3ZZ9A 2ZHEH 3KCGH 4ABFA 3IWMA 1CQQA 4I8KA 3A8AA 5EXNA 3EA9A 4XD7D 2WHXA 1F0RA 1ARBA 4MLFB 5GIBA 2AERH 1MAXA 1TPSA 2SNVA 2BYAX 3DUXH 2STBE 1TFXA 2ANMH 1DX5M 5A2MH 3A7XA 1P3CA 1Y3YA 3RXIA 1JIRA 5FXLA 3GY7A 1TNGA 2C8YB 1NY22 1SI5H 1FNIA 1EJMA 3M37A 2BOKA 1TNKA 2QC2A 4AFQA 3UNSA 1WUNH 4NGAH 3O8BA 1C5XB 1C2DA 1T4VH 1MTNC 1Z8GA 1W3CA 3SNDA 2ZKSA 1BMLA 1LHGH 1UTMA 2ZP0H 4XBBA 5FX6A 2BXUH 4FU9A 1H8ED 1GMDF 3T2NA 1O2UA 4I8LA 2UUJB 4RN6A 4H6SB 1O2WA 1YPHC 3BTFE 1AO5A 4B74A 3OU0A 1FY5A 2EQNA 3F0OA 5TJXA 1DS2E 5AFZH 1EPTA 2NU0E 2LELA 4ISIH 1D3PB 3R0FA 1X7AC 1O3NA 1TGSZ 1VITF 1CGIE 2BDYA 3RC6A 2AYWA 1ANCA 1O5EH 4M7GA 3RU4D 1VJ9U 1C5LH 5DO4H 1ZYOA 1C5OH 1C5YB 1EZSC 1TALA 1S0RA 2XXLA 1K1PA 1DLEA 3R3GB 3RMLH 1O5FH 1GBBA 2CF8H 2JH5D 2K8IA 4U32A 2BX3A 3L6PA 3T27A 3NXPA 3SGAE 3MYWA 2G5NA 1C2HA 1AFQB 1MD7A 2HVXA 3BTKE 3EE7A 1TRMA 5CMXH 1ZPCA 3MU5A 4TPYA 3RXCA 3MO9A 3Q3YA 3FN8A 2FS9A 3U8OH 1FZZA 2L6OA 2ZTYA 4DGJA 3PV2A 2H6MA 3HK6B 1DWBH 3ZZ5A 2OQUA 4Y7AA 1O33A 3MO3A 1S83A 4UFFH 2EI6A 1O3EA 1VCPA 2P8OB 1GDUA 3BG4B 2WYGA 3F6UH 3PV4A 1Z71A 1CSOE 3GY4A 4ACAA 1C1NA 3SV8A 2C8WB 1WTHD 3M5MA 1MQ6A 2OC0A 4GUXA 5I46H 1QTFA 5L6NH 1YCPM 3FVFB 4KTSA 1G32B 1AD8H 3FO8D 2GCTB 3RDZA 3TK5A 4K60A 5HYOA 5K0HA 2GDEH 1Y3WA 2P3FH 5HMAA 5KEDA 1GWAA 1P10A 1QBNA 2BXTH 2BDCA 3RM0H 1C5RA 1S85A 3EDXB 4KTCA 4BTIB 1FV9A 3UAIC 2AGIX 1YGCH 3DSOA 3QLPH 1UTJA 4DW2U 1F5KU 1K1IA 1O35A 2I6QA 3UB0A 2VU8E 5JBCS 3UR9A 5EXMA 3EAJA 4AGJA 1A2CH 1Y5UT 3A82A 1VITH 4FUCA 4KELA 5F8TA 4YM9A 2R2WU 3LGVA 3RXJA 3TGKE 1O37A 5TCCA 2OBOA 1C2JA 1RIWB 2A2QH 2ZGHA 3OFND 1EAUA 1MKXK 1K21H 1AZ8A 2XYAA 1KDQB 1KMHB 2ZU3A 3RUOA 3SORA 1UVTH 1CT2E 2ALPA 1THPB 2AGEX 4H4FA 3ZVFA 3ATLA 3E3TA 3GDVA 3EYDA 1F0UA 1UK4A 2BD3A 4UEHH 1KLTA 2Y6TA 1ESAA 4Q80A 1LQEA 4XBCA 2RA3A 4Y79A 5F8ZA 3SJKA 2F91A 1NFYA 5PTPA 3TITA 1G2MA 2OINA 2NU1E 1SGDE 2Z9LA 4BXWA 1LHEH 3RXRA 1MUEB 1CGJE 2F43B 4Y7BA 2M5TA 1BHXB 2WSSD 1O2QA 4YOIA 1E37B 4IMQA 3SGQE 1TOMH 2A1DB 2QF3A 3D49H 2P3TB 4MNVA 5DN6D 2XBWA 1DPOA 2STAE 3GISB 1AHTH 2FIRH 1C1RA 3GCHC 3BF6H 1O2MA 1ZJKA 4CRDA 5T1VA 1Y5AT 3SOSA 2QCYA 1BMFD 1MMJN 1P8VC 1G37A 1VGCC 1MZDA 4X2WA 1OYTH 2FI5E 3Q3XA 5A0CA 5JYIA 3GDSA 4K8YA 3MFJA 3CS0A 5JBBS 1OWDA 3CS7A 1RS0A 1WOFA 1P01A 3L3TA 4GVUA 1PYTC 1TPAE 4UDWH 2XNDD 4FVDA 4MNXA 1XX9A 6LPRA 3GCOA 1ESBA 2QF0A 1AN1E 1CT4E 1E34B 2ZF0H 1GHZA 3RXBA 5C67A 1LO6A 1QB6A 1QNJA 3QTVH 3UREA 1AUTC 1TIOA 1EUFA 3NPSA 4Z0KA 2JETC 3SV6A 1FJSA 5EOKA 5ABWA 2V0BA 1INCA 2LPRA 2PHBA 3LGYA 3HGNA 2GZ8A 3NKKA 1O3MA 4D7GA 1UMAH 1RTFB 1ZSKA 2B9LA 1HCGA 3U8TH 3DD2H 3GYLB 4XBDA 2WPMS 1C5UA 1S6LA 1O5CB 1QL7A 3B9FH 3MH4A 4ZHLU 2Y5GA 2XC0A 4ESTE 2ZDVH 3RXDA 4XOJA 3HKIB 1C1UH 1BMNH 1DUAA 4H42U 1Y59T 1V2MT 5EPYA 3SQEE 4IN2A 4X8VH 1DSTA 5FAHA 1C2EA 1YKTA 5DKMA 3SGBE 2CGAA 1NBME 2YMSD 3GY8A 3GCNA 1V2LT 7GCHG 1GBKA 1YPMH 2W5EA 1O2PA 3K6YA 4Y0YE 1MBMA 1C2GA 1SGFG 4X6NA 4ZKSU 5GJ4B 4X6OA 1MTUA 3N7DA 2EI7A 1MTWA 4BNRA 1V2ST 3SU6A 5J4QA 1ANDA 4Y8YA 1TBRH 1AKSB 2UUKB 2ZCKP 3BSQA 3KIDU 3KGPA 2FI4E 5DP6A 3RMMH 4DOQA 2BD2A 3LT3A 1SFIA 3MU1A 2HNTE 1EASA 1TGTA 1OP8A 1NZQH 1H9IE 1YPEH 4D76A 4JYUH 1FPHH 1DY8A 7KMEH 2YNBA 4P02A 2V3MA 1EPTC 3FAOA 1CVWH 3TNTA 1QGFA 4XDEA 1UTLM 2OXSA 2Y7ZA 2XCFA 2J98B 4BAMB 1HJAB 1G3DA 2HOBA 2WPDD 1HAXB 3Q00A 1GJ5H 3QUMP 4GCHG 2A4GA 3MHWU 1O38A 1SOTA 2GGVB 2VGCC 3VB6A 2QIQA 1UVOA 3HKJB 1QRZA 1ACBE 4YLQH 1GG6B 1IAUA 1H9LB 1H8HD 1O2VA 2AH4X 1LDTT 5AFYH 2BDHA 2A5IA 2G5VA 1GBJA 2SGAA 6CHAC 3SU1A 1SR5C 4ABEA 2A5KA 2QF5A 4X2YA 2V3OH 1OP2A 1ETRH 1Z6JH 3P95A 1ZTKA 1FIZA 4YESB 4AFUA 2BY5X 1P04A 1BTXA 2Y82A 3K6ZA 1AB9C 2C4FH 2P94A 3AVZA 3SZEA 1YPLH 1MH0A 3BN9A 2R2MB 4JZDH 1K22H 4AC9A 5EJZA 3VG8A 1NFWA 2PUXB 1Z8RA 1G30B 3E0PB 1QFKH 3A80A 1UW7A 2R3YA 1GJ4H 2GX4A 3SU5A 2A2XH 2ZFRH 4B2BA 3PROA 1NU7B 3FZZA 1W0YH 2QY0B 3RXMA 1UTPA 2FO9A 1EFRD 2G81E 1S84A 2IPQX 2TPIZ 2AGGX 3DA9B 1TAWA 2H9EH 1OWEA 1BBRH 5C0TA 5A0AE 1DANH 1HXFH 1T8OA 4X8TH 1GCDA 2QXHA 2W6ID 3C27B 2PGBB 1KXCA 2BY9X 3WY8A 4NIVA 1GBMA 4YT7H 3RLWH 2F9NA 1XUHA 1PPFE 4ASUD 1O34A 3KQDA 1YWUA 1T8MA 2W3IA 2ZHDA 1FAKH 1NROH 2DE8A 1JBUH 2PKSC 3A7TA 2BQ7B 1HGTH 2R0KA 1P2QA 1TMBH 4PROA 3RXTA 4MDSA 2HPPH 3KQEA 1LHDH 1EB1H 2VH0A 2RDEA 3U69H 3BIVH 1L1NA 1FMGA 2ZU1A 1QQUA 2OC8A 1M9UA 1T8NA 2IPHA 3FZDA 1E38B 2PSYA 3SYJA 5EQSA 1C5VA 1LVMA 2RA0A 2Z9IA 3DCLA 1PFXC 4IC6A 2KCYA 1IQGA 2BDAA 1S6FA 2KZ4A 1TGBA 4JZFH 1Q3XA 2B8OH 2W6JD 1DT2A 1IHTH 2J97A 3SUDA 1C2IA 3N7EA 5BPEA 1YY3A 4Q2KA 1A0HB 2QN5T 2JJ1D 2H9HA 1GBTA 1W13U 3UUZA 1C2LA 1TX8A 2XWBI 3A7WA 1CT0E 4JCNA 1C5WB 2AIQA 3H7OA 2NWNA 2QV1A 3BTME 3NCLA 4ZKNU 4X1SU 3VB3A 5A8YA 2GCTC 2DE9A 1XUKA 4HG6A 3PRDA 1HJ9A 2KFWA 3Q3KA 3ZVEA 2F83A 2SGEE 4RI0A 3BEUA 3K2UA 2ZFQH 3M5OA 1C1OA 1SLWB 3UOUA 2BM2A 3VEQB 2CF9H 4OS2A 2XBVA 2CXVA 1NRPH 1V2KT 4A7IB 5L2ZH 4K1EA 4F55A 5HXFA 5E2PA 4H6TA 1TQ7B 2PWXA 2XCNA 5DSFA 3ZZBA 3CENA 5HGGA 1QQ4A 2O8LA 1UCYK 1P9SA 3M7TA 1JRTA 1ZMLA 1C5TA 1GBHA 2BMGB 1YLDA 1A5GH 1EZXC 1DXWA 1WV7H 1ELEE 2VIWA 2GZ7A 3AASA 2GT8A 2OC7A 4OS5A 1OWIA 4K3JA 4ISNA 4TSFD 4A1TA 2WPLS 4LXBH 2FPZA 1SSXA 3ESTA 5F53A 5EW2H 2ZPQA 5C1XA 2BQ6B 2ZFPH 2PLXA 1W0ZU 1Q31A 1EZQA 4RKOB 2GKVE 4E7NA 4ZCNA 4BAQB 2AS9A 4GHTA 1TNIA 2BD7A 3ATMA 4JZ1A 1ABIH 2ODYB 1L1GA 2ZTZA 1V3XA 3F2FA 1O2TA 5LGOA 2ANYA 3S69A 2J92A 2VWOA 1NPMA 2OQ5A 3P8FA 1T7CA 1DWDH 3FP6E 4NSVA 1J8AA 5A09A 1SGRE 4B6FA 1K9OE 1HB0B 2XNIA 1PQ5A 3LGWA 4CREA 3BTEE 1DFPA 3OEHD 1V2VT 3A8BA 3O8CA 2FOCA 4XSKU 1GJ8B 5GCHF 2FTLE 8LPRA 1HIAA 1MKXH 2XRCA 1D6RA 3DSGA 4AYYB 4GAWA 1A5HA 4A1VA 2BTCE 1MAYA 3NUMA 3RXVA 1FN6A 1RJXB 1AZZA 3UWJH 1XUIA 2TBSA 1O2ZA 1DVAH 1SGFA 5JBTA 3LGUA 1HAOH 4Q4LA 4RT0A 3KN2A 2O8UA 3MQKC 1TGNA 1AQ7A 1MBQA 1HAHH 5FBEA 2VJ1A 1GMHF 1PJPA 1W14U 1NRNH 1GL1A 1LKBA 2A5AA 2Y7XA 4BAKB 1LVOA 4GPGA 1OWJA 4I32A 5BRRE 3SO3A 3ZZ3A 4E06H 2FOBA 1XM1A 2ZO3H 5HKKD 1THRH 4KGAA 2J4IA 2CJIA 1LHCH 3UR6A 1HAYB 3F68H 1IQEA
chains in the Genus database with same CATH topology
3VB4A 4AG2A 2FOFA 2EA3A 4VGCC 2HLCA 4CBNA 3A84A 4GSOA 1O5GH 1NU9A 3U1JB 2SNWA 1SG8B 2F9PA 5C20A 3HATH 4NFFA 1K1OA 4THNH 4NSYA 2QAAA 3S9BA 1AVWA 4ABAA 2J9NA 3U1IB 1F0TA 2D2DA 4MNWA 5JB8S 1O5BB 4CR9A 3ZVGA 1HAVA 1VR1H 2ZG0H 1FN8A 3UNQA 3A7YA 3QGNB 1THSH 4NWLA 1EKBB 1GMCG 1GHAG 2HRVA 2ZQ1A 1ETSH 5IYTA 1BOQA 1DUEA 3EA7A 1K1LA 2V3HH 4DIHH 1TLDA 1D3TB 3ZYEA 3URCA 2TGTA 1G3EA 5JPMH 1QB9A 1V2TT 2ALVA 4MPUA 3GDUA 3U98H 1D4PB 4FUJA 3URDA 4X8SH 3ZZ6A 4MNYA 2NU3E 1UO6A 3PO1C 1G9IE 1O3GA 2C3SA 3KF2A 2I6SA 1ZHMA 1V6DA 4FUBA 1GBAA 2C90B 3T62A 2F9OA 4ZKOU 2ZNKH 1QA7A 4Y11E 3TIUA 2P3UB 2QXIA 2ZDNA 2PKAB 1VCQA 4CHAC 1GHXH 1SMFE 1GBIA 1EAXA 2QA9E 4ISOA 1IQLA 1O2SA 1GG6C 5GXPA 1E35B 4O3TA 1GHVH 1JXPA 3GY5A 3AAVA 1SFQB 4WF8A 2PGQB 3GCTF 2BD9A 1P2OA 3A8CA 5FCRA 4WH6A 2W3KA 3P6ZB 1GDNA 3AW1A 3M35A 4X1NU 4NIWA 1GI1A 2BZAA 2A32A 3A7ZA 2BVRH 2J95A 3JZ1B 2D26C 4A1XA 2XTTB 1SGPE 1QJ7B 1S6HA 4OS6A 3MU4A 3MU0A 1AFEH 1RRKA 4ZAEA 1A3BH 4HFPB 1A7SA 1ELVA 5AF9H 3OYPA 4HGCA 1EJNA 3RXEA 2H5DA 2P95A 2Q6DA 3LU9B 4MTBA 1CHOG 4INKA 1JWTA 3UIRA 2FOMB 1KTTB 2GT7A 3SI4H 3FP8E 1AE5A 2ZHFH 4YOGA 2GMTC 4X1RU 1VJAU 1V2JT 2BLWA 1GGDB 4F49A 4I8HA 1QIXB 1RFNA 3ZZ8A 2BLQA 1BJVA 1QB1A 1DICA 1PPCE 4ABGA 4UFGH 1P05A 1OXGA 3PYHA 1LCYA 3BV9B 5SGAE 1MKWK 5T3HA 4K1TA 1K28D 2CHAB 4K5ZA 1NM6A 2IN2A 3SV9A 3OY5U 1AU8A 1KXDA 1O2YA 1UVSH 2GCHG 3A86A 3BTWE 3K9XB 3MH7A 4X2XA 3MWIU 1G36A 3BIUH 1O0DH 1O30A 1Z1IA 1MQ5A 3DT0H 4ZXXH 2OC1A 2VINA 1BHXF 3P17H 1QL8A 1EOLA 1S5SA 4NG9H 3TK9A 3LJJA 2FOGA 4X6PA 4DCDA 1TRNA 6GCHG 1RD3B 3RXFA 3SUFA 1HAIH 1TX7A 4X0WU 3O8RA 1HAZB 2ZCHP 2ZDAH 2BD4A 4YTAA 2OUAA 2VVUA 4OS4A 4BOHA 2YOLA 1UCYE 2Q6FA 1KLIH 1IQJA 1YPHE 2FX4A 3W94A 2BVSH 1GJBB 5T6FA 1MTNB 2WPHS 1O3DA 4AZ2B 1QJ1B 1XVMA 1O2LA 5HM9A 1TONA 1WTGH 4FU8A 3HK3B 3TK6A 1MTSA 1UTQA 1XUGA 3VXEH 1OWKA 3G01A 3I77A 1SHHB 2A4QA 1KDQA 3LGIA 2PSXA 3ZVDA 3QGJA 3F9HA 1J15A 1BBRE 4I8JA 1TNJA 3T29A 1ZGVA 1HLTH 1ZSJA 4YLUA 2FLRH 1YP9A 4DY7B 3O8DA 2ZI2H 1H4WA 4DJZB 1C1TA 3BEFB 3L33A 1NRRH 1GI0A 3SQHE 1P03A 1F2SE 1O5DH 1FY8E 4FUHA 4GHQA 5C3NA 3VXFH 2D1JA 1NTPA 1O3OA 1N8OC 4AB8A 1CA0C 1GCTC 2ZA5A 4NA7A 2O8WA 1ELGA 1C5QA 2F9UA 1BTYA 5F6MA 4E7RG 3E16B 1UVUH 1P02A 5E0HA 4WMFA 1EJAA 1DWEH 2O8TA 2PR3A 1ELDE 1TGCA 2FESH 2ZTXA 3TGJE 4WJG2 3T5FH 3VGCC 3MNXA 1OOKB 2WINI 4UFEH 2C8XB 3LPRA 4OS1A 4UD9H 4AOQA 2SGFE 1WAYB 4ABBA 1L0ZA 3STIA 1OS8A 1YC0A 4RKJB 1W11U 2OD3B 3D65E 1ZGIA 2RCEA 4B75A 1GDQA 4JYVH 1KXBA 2A7HA 3RXAA 4X6MA 3LKWA 3U8RH 2WV4A 1P06A 4U2WA 1EB2A 1Y5BT 3STJA 1S81A 3UQOA 1T31A 1EAWA 3QX5H 2EI8A 1CE5A 1O3AA 3MMGA 2H2ZA 3DFLA 1GHBG 1T32A 2UUFB 1NT1A 4ZKRU 4WMDA 2TGAA 1TE0A 1W8BH 2CMYA 4WVPE 2JH6D 1V2QT 4SGAE 1B0FA 1HDTH 3A83A 5FPTA 5CHAC 4Z6AH 5LPRA 1F92A 3TNSA 2F9VA 5EU8A 1DOJA 1F0SA 3V7TA 4KKDA 1D9IA 1UCYH 1FLEE 4NA9H 3RP2A 2TGDA 3UFAA 4X1QU 1S0QA 1TX6A 4IMZA 4K69A 5FHTA 2VIVA 2FYQA 2WYJA 3ODDA 1Z6EA 1DY9A 2VB0A 3PTNA 5F8XA 2FX6A 5LH8A 1BITA 1GHYH 5EXLA 1Y3XA 1OPHB 2GV7A 2WUCA 2W26A 2A7JA 1UK2A 4HTCH 1GMDG 1J9CH 2ZCLP 5ESBA 1J16A 1BQYA 2AEIH 2OLGA 4KP0A 1FY1A 1AGJA 1HJ8A 1C4V2 1A61H 2EC9H 1VITG 1QA0A 4JZIA 1T4UH 1V2NT 2GVFA 2KAIA 1GHWH 3SU4A 1GI5A 4LZ4B 1ZRKA 2BY6X 2ZU4A 4FUEA 2ZEBA 4JK5A 3PMAB 4CR5A 3S9AA 3T26A 4D7FA 3GCHB 1GI3A 2FOHA 3A8DA 3PMHB 1BCUH 3C1KA 2VNTA 4D9QA 1VGCB 1A5IA 1IQMA 3P8GA 1GBCA 2G4UA 1CHGA 2OP9A 2WV5A 3TJNA 1NFUA 1K1NA 1BTPA 1KY9A 4CH2B 1CBWB 1L4DA 4Y71A 4CBOA 1BRAA 1KXAA 1BMAA 1AFQC 1BUIA 1OYQA 1QRXA 1V2UT 2ZGJA 3ZVCA 1ELBA 4SGBE 4TY7A 3SN8A 2JETB 1GJ6A 5J4SA 3SNBA 2GCHF 4AX9H 3M5NA 3QO6A 3MH6A 1NRQH 4IC5A 3KQBA 2ZFFH 1L2EA 3SNCA 1SGTA 1SLVB 1OKXA 3UPEA 4NIXA 3MNCA 4I31A 1ORFA 2BD5A 3M3SA 4WWYA 1BJUA 4MPXA 2P8OC 2HALA 5AVDA 2BDBA 1ELFA 3BG4C 2FP7B 2H1UA 3E90B 3TJVA 1ZHPA 3UNRA 1GJDB 1G2LA 3A85A 4A5TS 3RXGA 2THFB 1O2XA 8KME2 1LVBA 1TBQH 1MCVA 2J34A 1AY6H 1A3EH 3PB1E 5ESTE 1MZAA 4ABHA 1O5AB 4XFQA 3B23B 1DXPA 3SU0A 3I78A 1FAXA 1SGEE 3ELAH 1LHFH 3TH2H 2Q6GA 1O32A 3E8LA 3LGTA 4YOJA 5DP3A 4B2AA 2WPKS 1HAPH 4RSPA 1BB0B 2ESTE 3D23A 4IW4E 1UK3A 3NWUA 4GLYA 1UHBA 3M7UA 2VWLA 3M3TA 2G55A 3EQ0H 1N6XA 3F9GA 3GY3A 2ZHWH 3ZZ4A 3ODFA 1H9HE 1W2KH 4FXGH 7GCHF 4BXSA 1O3FA 4JK6A 4YT6H 2ILNA 2ULLA 3A7VA 4AFSA 1H8IH 1RIWC 5DPAA 2OBQA 2FXRA 1SBWA 4TWWA 4CRGA 2Z3CA 1C9TA 4NCYA 3BTDE 1K2I1 4X1PU 1DLKB 4INHA 2AFQB 2OTVA 1EPTB 3VB7A 1TABE 1AI8H 1TWXB 1TNHA 1IQFA 1O3PB 1XXDA 3M5LA 4O03A 1PPBH 3MU8A 2SGPE 3LDXH 2XWAA 3ZZCA 1SLUB 1AVGH 1IQIA 1SGYE 2VWNA 4IS5A 1W7XH 1QURH 2B7DH 3Q77A 5CE1A 1GJAB 1KXEA 1T8LA 2K1QA 3ZZ7A 2VGCB 1A1RA 2V35A 2NU4E 1H1BA 1YPGH 3P8NA 1U6QA 1D3QB 3LC5A 1C2MA 1HV7A 1JRSA 1IQNA 5B6OA 2RG3A 6CHAB 2Z7FE 4I8GA 1BRCE 1UTKA 1K1JA 2ODQA 4GCHF 1XKAC 1V2PT 2ASUB 1BZXE 1P2KA 3S0NA 2FOEA 5FCKA 3A81A 3SV7A 1O39A 3RXHA 1F5RA 1GJ7B 1PPHE 3A89A 2VWMA 4O97A 1EATA 1XMNB 1AB9B 2TIOA 1GHBF 4Y8XA 1PPZA 4Y6DA 1P11E 3KNXA 1Y3UA 1SQOA 2UWPA 4NWKA 3RXKA 3V0XA 4ABDA 2WPJS 1EZUC 2Y80A 1O2OA 4DT7B 1E36B 2NU2E 4YO9A 1WQVH 1TB6H 3RM2H 1BTZA 1O3BA 3AW0A 5DK1A 2G8TA 4O3UA 3ATWA 5ETXA 2GP9B 1E0FD 1LMWB 4BTTB 5EW1H 1YPJH 3GOVB 1HNEE 2FM2A 4NZLA 5IDKA 2P16A 1TQ0B 3GY6A 1N1LA 1MU6B 1C5SA 1O2NA 2FS8A 1MKWH 3TH3H 1A0JA 1HPGA 4ASHA 1RTLA 8GCHG 2HGTH 5T6DA 1YBWA 3QTOH 4ZROA 3SJOA 3LONA 2ZGCA 3VPKA 2Q1JA 1NRSH 3DHKH 1FXYA 3RMNH 2R0LA 3SHCH 2OCVB 1PPEE 5H4IB 3RC5A 3SNEA 2VIPA 2QYIA 1GJ9B 3KL6A 5C1UA 2DUCA 5C5NA 3ZVBA 1P09A 1DITH 2ZU2A 2Z9JA 3PLPA 2PKSB 2ZECA 1XKBC 2H9TH 3TJUA 3M61U 4R0IA 2A0QB 4QT8C 5A8ZA 3EA8A 2Z94A 3P8OA 2FZZA 3N7OA 1O3IA 1C2KA 2UWOA 3OSYA 5LPFA 2BHGA 1K1MA 2CN0H 1EXFA 4Q7ZA 1V2RT 2R3UA 4Y0ZE 5DJ7A 1BTUA 1WU1A 1O2RA 1DSUA 3IG6B 2BB4A 3LJOA 2XBYA 1PQ8A 3TU7H 2UUYA 3D62A 5T6GA 1WYKA 4FUDA 3RXLA 4ABIA 1QCPA 4DVAU 2Z3EA 3S7HB 1C5NH 2B0FA 1LQDB 2Y81A 3GICB 4TPIZ 5DP4A 3GY2A 1EOJA 2HNTC 1BMMH 3UOPA 1NN6A 1UJ1A 2BZ6H 3SJ8A 4A92A 3E91A 3BTGE 1HJAC 4LOYH 1O3CA 2HWLB 2Y5FA 1O31A 1SC8U 1DE7H 3V3MA 2EEKA 2F9BH 5L2YH 2C8ZB 3Q76A 1XVOA 2G00A 3LH3A 3TVJB 1FUJA 1GJCB 1MCTA 3MI4A 1ESTA 1C1WH 2BLOA 1B0EA 1JMOH 5A0BA 2TGPZ 3SUEA 4FU7A 2AMDA 4AB9A 2BVXH 3PWBA 3LOXA 2XC4A 1BTHH 5JDUB 2VVVA 3RU4E 1XXFA 1O2IA 2ZGXH 5FBIA 3W95A 1TYNA 1KYNA 4NFEA 1SGIB 5E2OA 1L4ZA 4LZ1H 1O2GH 9ESTA 3BTQE 2AMQA 5A8XA 1MTVA 1D6WA 1HRTH 1CO7E 2SGDE 2TRMA 1AVXA 2F3CE 1GI2A 1FQ3A 4I33A 3BTTE 1DWCH 2CV3A 1XUJA 2W7UA 1P9UA 1ZPBA 1ZLRA 4WMEA 1UTNA 3ATKA 1KSNA 4DG4A 2A7CA 5E8EH 1W7GH 1O3HA 3SUGA 1P57B 3M3VA 3OY6U 4D9RA 4ZHMU 8ESTE 1MU8B 5L30H 1BA8B 2ZDLA 1YM0A 1OWHA 1GI4A 2ZFSA 4CRBA 4K8BA 4IBLH 4Y76A 3RXUA 4U30A 1ETTH 1ID5H 1TBZH 4FVBA 1C2FA 3H7TA 3SW2B 2FODA 1AIXH 1NC6A 5E0GA 1ARCA 2BX4A 4A6LA 4CRCA 2A4OA 3RC4A 5LPEA 1TOCB 1GVZA 3V12A 2A31A 1FI8A 1UTOA 1ZZZA 1QL9A 1TA6A 4HZHA 1AE8H 2BDGA 1ZMJA 3E6PH 4B71A 1CBWC 2G52A 3FFGA 4B2CA 2FTMA 4UONA 2PKAA 1JOUB 3SU3A 2PUQH 3JZ2B 2FDAA 4D8NA 1NS3A 4AFZA 3TJOA 2J94A 1GL0E 1FY3A 3ZV9A 3PLBA 1O2JA 4FUIA 1B5GH 1LKAA 3DFJA 1BTWA 1ZPZA 2J38A 3LC3A 1KXFA 1O2HA 1YYY1 2G4TA 4INLA 1VCWA 3RXQA 3M7QA 5GDSH 5FPSA 5FPYA 2GV6A 4WH8A 4Q7XA 3CP7A 1RXPA 1SGCA 5GWZA 1ZSLA 2A4RA 1GBEA 1FIWA 2IOTA 1QR3E 1Q2WA 1KIGH 1OP0A 4JZEH 4VGCB 1SGNE 1C1PA 4YZUA 5K7RA 2ZFTA 1WQSA 4WY3A 3T28A 2FWWA 2WUBA 2YNAA 3A88A 3RXPA 1C1QA 2BOHB 2XW9A 1C9PA 1EX3A 1PQ7A 2ZU5A 4TWYA 4B1TA 1GPZA 3S7KB 1O3KA 8GCHF 3OX7U 1GBLA 2AIPA 1HXEH 4R8TB 3PTBA 3EGKH 1ZOMA 4X2VA 1HBTH 1EP6A 1GBDA 2BY7X 1JIMA 4ZMAH 1YCPH 1FDPA 4MQAA 3K65B 3SNAA 1ZTJA 3PMJA 2KAIB 1P2MA 4BAHB 3TLOA 1GI6A 3F9FA 3KQCA 1TPPA 1O3JA 4K1SA 1P2NA 3RXOA 3QN7A 2JH0D 3S9CA 5C2ZA 5E0JA 5EODA 1NFXA 4UE7H 3KHVA 4BANB 1GMCF 1GHAF 4IGDA 5TCAA 3MO6A 3PO1B 3BEIB 1Z7KA 1Z8JB 3E1XB 2FOAA 3FP7E 5C5OA 3TGIE 3SHAH 1PYTD 5DP9A 3MNSA 1GI9B 1QBVH 4CRFA 1AWFH 1L1JA 1QBOA 2Z6BD 1N6YA 5GCHG 2ZPRA 2QGRA 4CHAB 1XUFA 5I25A 4Q7YA 3P92A 2Y5HA 1BT7A 2P59A 1C1MA 1IHSH 4BAOB 2IJOB 3UY9A 6ESTA 2PTCE 3UWIA 1DM4B 3MOCA 5DP5A 2W7SA 2ZGBH 4XE4A 2HNTF 2ZIQH 1SHYA 4UFDH 1ZMNA