3BTME

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btmE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btmE02
1TABE 4ZKRU 2G4TA 1NFWA 1HIAA 1QFKH 1Z7KA 1QIXB 2H9HA 3OY6U 2GMTC 2VWMA 3ODFA 1C5XB 2ZGHA 1OWIA 2D26C 2A4GA 2PSXA 2BD8A 2ZEBA 1NC6A 1VJAU 1O2ZA 1NPMA 1C2EA 2WPMS 5GCHF 1RGQA 3A86A 5C1UA 3SUDA 1BTWA 3SW2B 5DGJA 3O8CA 4IGDA 4X2WA 1XMNB 3RXPA 1BTZA 2G00A 3RM0H 3VXEH 2Z9JA 2ANWA 3B8JA 1CHGA 3MO6A 3UY9A 4E06H 1JOUB 1DVAH 1INCA 1PQ7A 1Y3XA 2G4UA 4GPGA 3D49H 1MAYA 2ZDAH 1LDTT 1A3BH 1E35B 4Z6AH 3M7UA 1QY6A 4UD9H 1FMGA 1L2EA 3SO3A 1P3CA 4Q7YA 4A1TA 4B2AA 3F9FA 3UOUA 5DPAA 4TPYA 1O3HA 4U30A 4ZKSU 3SU0A 3OSYA 3NCLA 1QB6A 1GBFA 4ZKOU 3OX7U 5GWZA 1TQ7B 2VWOA 5JPMH 4CRCA 1THPB 2BD7A 1G2MA 1ZPBA 4JMYA 1ZGVA 3I29A 2CN0H 4RKOB 3LGWA 4X2XA 3BG4B 1FN6A 1LMWB 1ZHPA 4Y8XA 1LHFH 4IW4E 2KAIA 8KME2 4BXWA 4CRGA 5F03A 2ESTE 1GBJA 1SGRE 1D3DB 3LGVA 1MTWA 1LQEA 4ISIH 3RXFA 1F5RA 1QQUA 4FUDA 4AG2A 1O30A 2PUXB 3E3TA 2GZ7A 4Y8ZA 2GDDA 1ANCA 3MU0A 2PSYA 4ISOA 3PWCA 1AE8H 2AEIH 3LGYA 1AWHB 1YCPM 3D65E 3IG6B 5DP6A 1HLTH 1ZPCA 3MH6A 4X8TH 1K1IA 3AW1A 3P92A 2NU0E 3DFLA 1A2CH 2FTMA 1TBRH 2O8LA 1C5RA 3QWCH 4I31A 1HAXB 1NZQH 2LNCA 4A5TS 4MVNA 2ZQ2A 1SOZA 4INHA 2Y82A 4BAHB 4MG3A 1SPJA 1GDNA 5T6GA 3SJ8A 1SGDE 2VINA 2VIOA 1J9CH 2EA3A 1C5NH 4IS5A 1XUIA 1GL0E 1GVLA 4B73A 3U1JB 1GHAF 3FVFB 2O8UA 3TNTA 4LK4A 4XSKU 2WV4A 1MKXH 1YYY1 3RXEA 1FY4A 5CHAC 3BG8A 3HK6B 2VIQA 3RXAA 1TAWA 1DITH 1SOTA 1OX1A 3URCA 4NIWA 3SV7A 3HPTB 4Y71A 3U8RH 1O3CA 3G01A 1BIOA 3SI3H 1TNGA 4X1SU 2OTVA 5E2OA 4X1RU 3HGPA 3Q3KA 1AFQC 4O3UA 1XX9A 1CBWB 2B5TB 4A7IB 4YT6H 2GTBA 3GICB 2OXSA 5DG6A 2QXIA 3W95A 3SU3A 4UONA 5C5NA 4DVAU 1BBRE 1RIWC 3LONA 3SU5A 1EAIA 1UTPA 2THFB 4IMQA 4B71A 1C1WH 1PPHE 1GCTB 1GI6A 1QBOA 4UEHH 2GCHF 4FUCA 3SOSA 4NG9H 4Q7ZA 3ZZ9A 2XXLA 2H9TH 3RXVA 1AI8H 1DANH 1O2SA 1A4WH 1AMHA 3M37A 3Q3XA 1TMBH 2FTLE 2F3CE 5C1YA 1OWHA 2F91A 1OWKA 5G4BA 4YT7H 2WUBA 3LJOA 4I8KA 3M5LA 1UK3A 2G51A 3RMNH 1YC0A 1EKBB 1P9SA 8GCHG 2ZPSA 3U9AH 2FO9A 1C5LH 2PKAB 1RTKA 2J95A 3GY8A 4OS5A 1A5HA 1N8OC 2HOBA 3TGJE 1HFDA 2D1JA 2P8OC 3A88A 2SNVA 1LPZB 4ISHH 2ZU4A 2BZAA 4X2VA 4H6SB 1VGCC 1ESBA 4GCHG 2UUYA 3EAJA 2DE8A 3ZZBA 3SNDA 2QXGA 2Z94A 2OQ5A 1EQ9A 2ZNKH 1VITF 1DICA 1L4ZA 1ETSH 1P57B 1C1MA 1UTNA 2SGQE 2QC2A 3UNRA 2Q6GA 2ZFQH 1ABIH 1SMFE 2BLVA 1BTPA 1GVZA 3PO1B 2HPQH 3ATKA 2OC1A 5FX5A 4ABJA 3UPEA 1C1VH 1MKWK 1AIXH 1O3BA 4D9QA 4FUEA 1EOLA 1L1JA 4INLA 3QZQA 4THNH 1SL3A 3DUXH 2ZDNA 1VJ9U 2ZWLH 2G5VA 4NZQA 3RXIA 4MNVA 4R0IA 3GY6A 1NU7B 3PYHA 5H4IB 2F9PA 3ZZCA 3LC5A 4K1TA 3LJJA 1SSXA 1IQGA 2Z9KA 4Y79A 4WJG2 2J9NA 4Y0ZE 1V3XA 3SQHE 4KTSA 1KLTA 1V2RT 1BB0B 2XCFA 1UTOA 1TGBA 1CU1A 1C5ZB 2BVRH 1TNJA 2FM2A 2GD4B 2CMYA 3TH4H 1IQIA 1OWEA 3RXGA 5IYTA 1BITA 2ZPRA 2EEKA 3GYLB 3UUZA 1JRTA 5JYIA 4FVDA 1THSH 1T8NA 3LPRA 3LGUA 1XUFA 3QO6A 1O3PB 1THRH 2RG3A 1HJAB 2EC9H 2PUQH 1DLEA 1WQSA 2R3YA 1HAYB 2ZDMA 3UIRA 3Q3YA 1O38A 4X8SH 1BRBE 2UWPA 1WYKA 1F5KU 1XKAC 3GOVB 3GCTF 4K5ZA 2CV3A 5EG4A 3ZVAA 1CA0C 1GHBG 1HAVA 3LC3A 1DX5M 1SQTA 3LH1A 1FPHH 1NFUA 4CRAA 2ZG0H 3S69A 4BAMB 4I8GA 2H9EH 4Y10E 9LPRA 2ZGCA 1QRWA 1GCDA 3GDVA 1UCYK 2BDAA 1L1GA 1G36A 1S6FA 1MD8A 3U1IB 3M5NA 2AGEX 1ETRH 1OSSA 1Y3VA 3M3TA 1C5TA 2P93A 1T8MA 4JZEH 5A8XA 1GI4A 1CGIE 2JKHA 1CGHA 1S0QA 1DS2E 2A32A 1C2GA 2GV7A 1YM0A 2FOCA 1UK4A 3HKJB 5AHGH 3T25A 7KMEH 2FI3E 2WPLS 2OD3B 3RXHA 1BJVA 1P03A 5FBEA 3QX5H 3ZZ5A 4K69A 1X7AC 1SVPA 4XDEA 5EXLA 1ABJH 4DCDA 1Y3YA 3K6YA 8LPRA 2C93B 4XBCA 1A0JA 3M35A 1TX7A 1BRAA 5BPEA 3RMMH 1H4WA 1WBGB 2ZU3A 1H9LB 1O3MA 1D4PB 4DOQA 1XUHA 1HAHH 4DIHH 2G52A 3RXUA 4AZ2B 1DWDH 2XWAA 1OS8A 3MU5A 5CE1A 1YP9A 3SV9A 2ZIQH 3B9FH 4KGAA 3BV9B 3RXTA 5J4QA 4RKJB 2C8YB 3V3MA 1AKSB 4Y6DA 1NS3A 2D2DA 5I46H 3EA8A 1GCTC 3BSQA 1LHDH 1AFEH 1RFNA 1VZQH 2FYRA 4IN1A 2A5IA 1NROH 3HKIB 2Z9IA 2BVSH 5A0CA 3GY3A 1S82A 2G5NA 2V0BA 2W5EA 4ZMAH 5C20A 1Z1JA 2VIVA 3UNSA 1BCUH 1TYNA 1DLKB 1SQOA 1DXPA 2VIPA 1QBVH 3A8CA 5T6DA 2Z9LA 5FPTA 3GYMA 1K1OA 1C5OH 3K9XB 3NK8A 2FIRH 2P95A 2Y81A 1YKTA 4FUIA 1MKXK 1V2UT 1TBZH 2STAE 4AFZA 1OOKB 2XNIA 2WPKS 3AVZA 1T7CA 1BHXB 3SJKA 3GCHC 1YLDA 1QRXA 1Y3UA 5GCHG 4XBBA 4B1TA 3SV8A 1E36B 3S9BA 1O2KA 1FXYA 1SHHB 3PM3A 2XRCA 3MMGA 3FZZA 1IQHA 4UE7H 5GJ4B 3RXSA 3ZYEA 3A7WA 3T29A 6ESTA 3PO1C 5I25A 3RXCA 2ODQA 1TPSA 1JMOH 4E05H 3SJ9A 1TE0A 1DT2A 3PLBA 3SN8A 1AFQB 3A7XA 2J2UA 1UVUH 3TU7H 2GT8A 3D62A 4NSVA 1KDQA 1KDQB 3OTJE 5A8YA 3ZVGA 3BTME 1IHTH 3SNEA 1PFXC 4ABIA 3F6UH 3TITA 1K22H 2BTCE 2ALPA 4FVBA 4NIYA 1ZGIA 4I8JA 1O2RA 2JETB 3B23B 1GI8B 2GZ8A 3KN2A 3MO9A 1TLDA 4AG1A 2Y7XA 4K1EA 1L4DA 4JZFH 1F0UA 1O3AA 3VB7A 1EAWA 4FUFA 3M3SA 2Z3DA 2P16A 1ZTLA 4X1NU 1JXPA 2ULLA 3ATIA 1MU6B 4BNRA 1GJBB 2SGFE 5EQSA 2ZKSA 3QLPH 4LXBH 1B0EA 4DGJA 2J38A 2WUCA 3MNSA 3S7KB 2H2ZA 1W12U 2FOBA 2PWXA 1GBDA 1SB1H 1EP5A 4KTUA 2R2MB 3EA7A 2UUJB 3QK1A 1CO7E 2O9QA 3NWUA 4NA7A 2FS9A 1EJNA 1HJAC 2OC7A 5AF9H 1KTTB 1SGQE 2BDHA 2W7UA 1SGPE 1C5SA 2PW8H 2PLXA 2VNTA 4Y7BA 1SGFA 3CS7A 1SGEE 3UWIA 4D7FA 1UVOA 1O5AB 2VVUA 1SLVB 2P94A 2ZHQH 3L33A 4GSOA 1IQKA 1ELTA 2FX4A 3A83A 3MI4A 1GBLA 3PMHB 4RSPA 3SGBE 1VITH 1CQQA 1AVWA 1SGYE 3BTEE 7ESTE 3SUEA 4YOJA 1LVMA 4ABFA 1DPOA 2AYWA 2ZHEH 4M7GA 1O31A 1F92A 3PB1E 1YPEH 4K2YA 4KTCA 2GT7A 4YM9A 1HAPH 2W3KA 2QXJA 1MTVA 3MH5A 1TRMA 2YNBA 2Z6BD 4WF8A 3SGQE 4BAKB 2ZI2H 2FS8A 1HBTH 4QT8C 1KXCA 1QURH 1UCYH 3ITIA 2HWLB 5GDSH 3D23A 2W26A 1PYTD 1DWBH 1S83A 1XVMA 4BTIB 1ANDA 1V2JT 2ZECA 1DXWA 2I6QA 4K3JA 1YGCH 2NU3E 4AOQA 1Y5BT 1B5GH 3QDZB 1O2IA 4NWLA 1SC8U 4FUBA 5C67A 4X2YA 1NY22 4IMZA 3SU6A 3RXBA 3VB4A 1JRSA 4AGJA 4K1SA 1S6HA 2ZFSA 4YLUA 1ZJDA 2XC5A 3SZNA 3ZYDA 3STJA 2BQ6B 3P95A 1NU9A 4CRFA 1P2JA 1GMDF 1D6WA 1O34A 1J16A 2J34A 4KP0A 2FEQH 3SBKA 1ELGA 2QAAA 1P01A 5AFZH 2AERH 1G2LA 3TNSA 4BTTB 5EQQA 4MPXA 1D6RA 2Y7ZA 2FI5E 3MNBA 1IOEA 1O2MA 2BY7X 1CA0B 1FPCH 5L6NH 2GKVE 2OUAA 1DM4B 3T62A 3VXFH 1LPGB 2FODA 3RC6A 3H7OA 4UDWH 1AQ7A 3S0NA 3UR9A 1ARBA 2ZDLA 5E8EH 5HYOA 5E2PA 3E1XB 3A89A 3MOCA 2XWBI 1ZMNA 6CHAB 4JCNA 4DIIH 4Y76A 2ZCHP 1TGSZ 5A0BA 1ARCA 2D8WA 3RC4A 1G3BA 5F8ZA 1GDUA 1SHYA 3JZ2B 2G55A 5DP3A 2C4FH 5JBCS 1GJ7B 1Z6JH 3QGJA 1ZMJA 2QYIA 1FN8A 2PKSB 3LU9B 3LIWA 4GVUA 1IQJA 2VH0A 2R2WU 5A2MH 5JBBS 5T6FA 2XBWA 3TJOA 1VCWA 1WUNH 2ZU5A 1YF4A 3U69H 5AVDA 2AIPA 2QF3A 1ELVA 3OYPA 3U98H 4CRDA 1GHXH 1O3GA 1QB9A 3R0FA 4NA9H 1FUJA 2A4RA 4O03A 3K65B 2BDGA 2ZTXA 1QL8A 4K8BA 1FAKH 3RLYH 1ZLRA 1ZYOA 2BOKA 2PV9B 3A8AA 4CH8B 2VVVA 4A1VA 1C9PA 1NT1A 2ZA5A 2BYAX 3RXDA 2AMDA 1ZRKA 4FU8A 1Z8GA 2OBQA 1QJ7B 1P10A 2A7CA 1DWEH 2HRVA 1G9IE 1YPJH 1TNKA 3E0NB 1QTFA 3P6ZB 1O2UA 1M9UA 3VPKA 3LGTA 1C1RA 3PTNA 4A6LA 4D9RA 6GCHF 1HCGA 2BY5X 2FOFA 1BT7A 1BTUA 2A5KA 1TX8A 5EW1H 3UOPA 2DE9A 1ZHMA 2GZ9A 4HGCA 3KQCA 4Q80A 1H9HE 1MTNB 4XBDA 1ELBA 3SJOA 1IQEA 5DO4H 1O0DH 1O36A 4R8TB 1QGFA 1ANEA 1YBWA 2JETC 4NGAH 4NCYA 1P05A 3UQOA 1SFIA 2ZPQA 1RRKA 3RC5A 1K21H 2FOGA 1C1QA 1E37B 5K7RA 1BBRK 2O8TA 1W10U 2H6MA 1RTLA 2SNWA 3S9CA 4AFQA 2ZGBH 3P8OA 3GDUA 8ESTE 1T4UH 4ASHA 1EOJA 1W7GH 1ELEE 1GMCG 2ZTZA 2WPJS 2TIOA 1GI3A 2PKAA 5ETXA 1XXDA 1MQ6A 3P8NA 5JBTA 4OS7A 1EATA 3MWIU 1D3TB 1GHVH 3SNCA 4XE4A 4BTUB 1MBMA 4X0WU 3TJUA 1KXDA 3LH3A 3SU1A 4J2YB 1OYTH 1FY3A 1MUEB 2Q1JA 2XC0A 2PHBA 3BIUH 2ZCLP 4WXIA 1IQFA 5A0AE 1KSNA 4GLYA 1Y8TA 2STBE 1XVOA 1AVGH 2WYGA 3GCHB 2UUKB 1WCZA 1C2MA 2TPIZ 3C27B 3URDA 1BMLA 3KQDA 1O5CB 3ZZ3A 3DHKH 1EX3A 1E34B 7LPRA 1O2PA 1GI7B 2OC0A 1ZTKA 1CT4E 3DT0H 2A5AA 1AO5A 1F5LA 4IC6A 5EXNA 3IWMA 4MPWA 1N6XA 2ZHFH 2FLRH 2GVFA 1G3DA 3ZVFA 1TALA 2H1UA 3BTTE 2SGEE 4ABBA 5ABWA 1GVKB 3O8BA 1NM6A 3U8OH 1K1MA 2LPRA 2OP9A 2EI7A 3SUGA 1LQDB 2TGTA 2BLQA 1ANBA 3ZZAA 3TPIZ 1ESTA 4MTBA 4O97A 2BVXH 2VIWA 3AW0A 3PMAB 4WMDA 3GCOA 2BB4A 1UJ1A 2ZU1A 4LOYH 3ATWA 2Q6FA 3L6PA 1DSTA 2VU8E 1AHTH 1T32A 2P3FH 2GGVB 3RDZA 3I78A 4BANB 1UVPA 3OY5U 1YPKH 2FI4E 3TVJB 4NA8A 1UTKA 4VGCB 3QN7A 3A7VA 1W13U 1ELAA 1A3EH 5C1XA 1CT2E 3CP7A 1OWJA 1BRCE 2HLCA 1O5BB 5T3HA 1MTSA 3RXKA 1JIMA 4AORA 7GCHG 1GI0A 2BQWB 2HNTE 5EODA 1UTLM 2IN2A 4MPVA 3SJIA 5FPYA 1NRNH 1EJMA 1JBUH 2XW9A 2BY8X 1KLIH 1HJ9A 1HDTH 2BX4A 1C2IA 5TCAA 2FWWA 3U8TH 1Q2WA 3RU4D 1MCVA 3M36A 1UHBB 1C2LA 4Y7AA 1C5PA 2ZFPH 1QA0A 4WMFA 3VEQB 1G3EA 3V12A 5FX6A 2BMGB 2G8TA 1P9UA 2NU4E 1TGNA 1K1PA 1SFQB 2J94A 4D8NA 2FMJA 2B8OH 1E38B 8GCHF 3RXLA 4GHTA 2HPPH 2JH0D 1T31A 1W3CA 1ZZZA 3BTGE 1NRRH 3KNXA 2ZO3H 1A7SA 1GG6B 2P3UB 3E6PH 4AB9A 4JYTA 1XUJA 2NWNA 1C1NA 1TIOA 2IJOB 1BMMH 3KIDU 6CHAC 1GJCB 5PTPA 1MU8B 3BEFB 1NRQH 3QGNB 2UUFB 2ZF0H 5JB9S 4D7GA 1YPHE 4I32A 2ZQ1A 1O5FH 2F9UA 2ODYB 1HNEE 1KXFA 1O2NA 2PKSC 2AGIX 1V2OT 3FFGA 1HYLA 1GL1A 3RUOA 1HAGE 5FPSA 1MCTA 1GJ9B 2ZFFH 1HGTH 3RLWH 1F0SA 2RCEA 3BIVH 5BRRE 4DURA 2TRMA 1GBIA 2F9OA 3A82A 1C4Y2 2OC8A 3MU1A 2Q6DA 4J1YA 4H6TA 3VB6A 1NN6A 2ZC9H 4ZXXH 3Q77A 1C1SA 3LT3A 2EI8A 2SGAA 3SUFA 3GISB 1AD8H 3BTDE 5EOKA 3BEIB 1T4VH 1O2WA 1ZPZA 3VB3A 1GJDB 5A09A 1SGFG 3TH3H 1G32B 3A7YA 3LGIA 3SNAA 1BHXF 4ZHMU 2ILNA 4ISLA 4WXVA 3PLKA 4IC5A 2Y5HA 1MTNC 1DDJA 1AKSA 1A5IA 2AH4X 4YOGA 1JWTA 1FAXA 2A4OA 3E8LA 1QNJA 1W7XH 1SLWB 1FDPA 3SV2H 1KXBA 1NTPA 1FY8E 3QTOH 1RXPA 2ZHWH 1O3NA 5LPEA 4XOJA 5L2YH 1TPAE 2A31A 4ZROA 4ABGA 3OU0A 3ZZ6A 1C4V2 1ZJKA 3MH4A 1OP8A 1BMAA 4LZ1H 2O8MA 1V6DA 1BBRH 1WU1A 5GIBA 2ODPA 2ZDKA 3SGAE 2JH5D 4RN6A 3UWJH 1UVTH 4WY3A 3Q76A 3UREA 1WTGH 2FP7B 2XBXA 4B76A 3HATH 4ABAA 2CXVA 1GBHA 5DP9A 1FLEE 4AYVB 1RTFB 5HMAA 3SI4H 3Q00A 1IAUA 1ID5H 1C1TA 1SLUB 3KHVA 1TA2A 4X6PA 2UWOA 1MMJN 2OBOA 1Z1IA 4AN7A 4ABEA 1TX6A 3A8DA 4ZHAA 3ZZ8A 2J4IA 3ZVDA 1V2ST 1HJ8A 4YOIA 3S9AA 2BXUH 2F9BH 1V2MT 1GMHF 4MLFB 2GCTC 1V2LT 4E7RG 1QA7A 4JZIA 1GBBA 4SGBE 4CREA 3NPSA 1BTXA 3SHCH 1LPKB 1WTHD 3KQEA 1HPGA 1C2JA 1GBMA 4JZ1A 1EB1H 5EW2H 2UWLA 4MDSA 1PYTC 1TFXA 4DY7B 1FNIA 1ZRBA 1HAZB 1BRUP 1F2SE 5FXLA 2BDCA 1DY9A 1AN1E 1QB1A 3EE0B 1W0ZU 2BHGA 3GY7A 1EJAA 2AFQB 4B2BA 3T5FH 1CA8B 2ZP0H 2ZZUH 2BDBA 3NXPA 1EB2A 1V2TT 2AMQA 3BTKE 4ZXYH 2BM2A 1XM1A 2C8WB 2PFEA 4A1XA 4F4OC 3S7HB 2V6NA 1QJ6B 3MFJA 1Q31A 3ATLA 1KXEA 4HTCH 1GJ4H 2P3TB 2HNTC 4VGCC 3SV6A 5FBIA 1ELFA 3PMBB 1G30B 2DUCA 1J15A 1O2LA 4ZH8A 1HRTH 2VWNA 1BMNH 1BDAA 4XFQA 1FIZA 1AWFH 1DFPA 2QV1A 4ISNA 5EU8A 4UFFH 1TMTH 4Z0KA 3FAOA 1GMDG 2BLWA 1PJPA 4INKA 3LKWA 1ZTJA 4PROA 1MZAA 5EGMA 2SGDE 3BEUA 1TONA 3NUMA 3RU4E 1Y5UT 5ESBA 2ASUB 1HB0B 1O2GH 2FDAA 4CHAB 2FOHA 1TOMH 1QL7A 1LHGH 2V35A 2Z3EA 4YESB 2BD4A 1BTYA 1C5WB 1HXEH 1F0RA 4OS2A 1K1JA 1A46H 3TJVA 3SQEE 3E90B 1P2MA 5F8XA 1TNHA 3P8FA 3JZ1B 1SBWA 2F83A 3LOXA 2ZGXH 4H4FA 1CE5A 2FPZA 1ZOMA 1YCPH 1YPHC 5EPNA 2QCYA 1GHZA 1BQYA 2G81E 1LVYA 5FCKA 1O3JA 1LCYA 1GI2A 1GBEA 1L1NA 1GWAA 2K1QA 3PV4A 1LO6A 3KGPA 4CRBA 1K2I1 3E91A 1GG6C 4WWYA 5J4SA 3ZVBA 4K8YA 1A61H 1Z71A 2BD5A 1HIAB 2BD3A 1H9IE 1TRYA 1AUJA 5GPIB 5EPYA 4JYUH 2BY6X 3FP6E 2Z7FE 1MAXA 2OQUA 1P11E 1GHAG 3KCGH 1O2YA 1ELCA 2VGCB 3AASA 1P06A 1C5UA 1EUFA 4NIXA 3KF2A 4OGYA 1JIRA 1XUKA 2P59A 1RS0A 1IQNA 1W11U 2QY0B 2SFAA 5K0HA 3EQ0H 2FXRA 5TCCA 3AAVA 1S0RA 1S84A 3RXMA 3V13A 4D76A 5FHTA 4U2WA 2PTCE 4BOHA 1O3LA 1TQ0B 1YLCA 2AMPA 3ZZDA 2GDEH 3RU4T 1GBTA 2CF8H 2FOEA 6GCHG 2XBYA 1O3DA 1ZHRA 3GCNA 1P12E 1SGCA 3GY5A 3QTVH 1TBQH 1W0YH 3EYDA 2C8ZB 4NSYA 4KELA 1C5YB 2GCHG 1HV7A 2BZ6H 1O2VA 4YLQH 2Y5FA 4ZKNU 4ESTE 1PQ8A 4AFSA 2QA9E 3LDXH 1LTOA 4F49A 2CHAC 1P2QA 5EXMA 1OYQA 2OCVB 2KAIB 2HVXA 3M61U 3RMLH 2AS9A 3ZVEA 3SU4A 1K28D 2W7SA 3SU2A 3PTBA 1EPTC 1GJ6A 1CHOF 5TJXA 1AVXA 1KXAA 4UFEH 3VGCC 1MD7A 1ZSLA 3P70B 1VCQA 3BTHE 3HGNA 1CSOE 3TK5A 2YNAA 1P2IA 4HI3A 1BJUA 1QR3E 1MH0A 2VVCA 3O8DA 2RDLA 2ZHDA 4Q7XA 1O2HA 1QQ4A 3QZRA 4HZHA 3P17H 1NO9H 1C2FA 3TLOA 3M5OA 1VITG 4AX9H 4OS1A 1KYNA 3E0PB 3GDSA 2GX4A 2A1DB 2FESH 5JDUB 4FU7A 1QBNA 4FUHA 1W2KH 1LKAA 3A7TA 1HUTH 4I8LA 1GI9B 3N7OA 2QN5T 4OS4A 5E0JA 1O5DH 5AFYH 2AGGX 3A7ZA 2BX3A 1VR1H 1AZZA 1A0HB 1V2KT 3UTUH 1G3CA 4A92A 1O3OA 3ZVCA 4FU9A 1P2NA 1K1LA 1T8LA 3TK6A 1W14U 5ESTE 1EASA 3EDXB 5HGGA 1C5MD 4ABDA 1D9IA 3WY8A 2XYAA 2OLGA 1ZR0A 3SNBA 1N6YA 1ETTH 1PPEE 3FP7E 3PLPA 2HALA 3E16B 2A7HA 1EXFA 1FQ3A 4MNWA 4FXGH 3ZV8A 5L30H 4I8HA 3T26A 2BQ7B 2Y6TA 5LPRA 4WH6A 2BDYA 3HK3B 3T2NA 1AB9B 1SI5H 3QUMP 4X8VH 2ZCKP 1O32A 1LHCH 4MQAA 1C1OA 3M5MA 1AGJA 1TNIA 3DA9B 1P0SH 1TRNA 2PGBB 1RD3B 5F8TA 3TH2H 4MNYA 1NFXA 4LZ4B 4ABHA 4Y0YE 1W8BH 4Y11E 1N1LA 5JB8S 1QRZA 3DD2H 2IOTA 3K6ZA 1NRSH 1L0ZA 4UFGH 3RM2H 4FUGA 3BTQE 1OWDA 1S85A 5DP7A 1TWXB 4I33A 2VJ1A 4WMEA 1SGIB 1QL9A 4BAQB 2GV6A 4CH2B 1WAYB 1EP6A 1BTHH 1ZSJA 2HGTH 3KEEA 1FONA 1UMAH 3MNXA 4X1PU 2TGDA 1IHSH 3STIA 2B0FA 3O8RA 1FJSA 1SQAA 1F7ZA 1MTUA 4TWYA 4JK6A 2PR3A 5E0HA 3A85A 2HNTF 4CHAC 3GCTG 2BD2A 4I7YH 3FP8E 2GCTB 1C9TA 1Z6EA 3AAUA 1BUIA 1LKBA 3SORA 2ZU2A 5F6MA 4NFFA 3ZV9A 1CVWH 1GHYH 1GPZA 5FCRA 4TY6A 3UNQA 1UTQA 2CJIA 2ZFTA 1OXGA 2VB0A 1O2OA 1RJXB 5DJ7A 3MH7A 1SGTA 3T27A 1K1NA 2FOMB 5C2ZA 2XTTB 2IPHA 2J92A 3H7TA 1GGDB 2A45B 1Y5AT 2RA0A 2A2QH 3MTYA 3TGIE 4TY7A 4X1QU 5IDKA 2V3OH 1P2OA 1BOQA 1V2NT 1OPHB 3CS0A 1GBAA 1F0TA 3F68H 2VGCC 1GJ5H 2F9VA 1J8AA 1O33A 2XBVA 5DK1A 5A8ZA 1ELDE 1GJ8B 1D3QB 2A2XH 4TPIZ 4CBOA 1J17T 3F9HA 2AIQA 3MHWU 2ANKH 1GI5A 1Z8JB 1ZMLA 1AU8A 1ACBE 4YZUA 4CR9A 1P09A 2ZFRH 1PPCE 1O2XA 1UVSH 4CBNA 3MU8A 1TGCA 1EZUC 1GBCA 1CGJE 2PGQB 5DP8A 4GHQA 4IN2A 2C90B 1V2QT 1AZ8A 5DP4A 3KL6A 1UHBA 3T28A 1SR5C 2FLBH 5C5OA 5HM2A 4K60A 3C1KA 1C1UH 1C5QA 1YCPK 1K9OE 4H42U 3UR6A 1GBKA 2WYJA 2ANMH 3BF6H 4DT7B 1B0FA 1LVBA 3BG4C 3M7TA 5JBAS 1UK2A 3MO3A 4SGAE 1UO6A 5B6OA 1GMCF 3GY4A 1GI1A 3EA9A 4BXSA 1P02A 3CENA 3K2UA 5L2ZH 1DSUA 1NRPH 1Y59T 5SGAE 1E0FD 9ESTA 4AB8A 2WPHS 3PWBA 4TYDA 1S81A 2Z9GA 1OKXA 2GMTB 2QF0A 2FOAA 5LGOA 2BY9X 5DP5A 4ZUHA 3I77A 4JYVH 1Z8RA 4GCHF 1FIWA 1O2JA 2R0LA 2Y5GA 5C3NA 2TGAA 1HAVB 1WV7H 1A0LA 1UCYE 1DOJA 1AE5A 3EGKH 2B7DH 2C8XB 4OGXA 1KTSB 1GMHG 1P3EA 3ZZ4A 1BZXE 1T8OA 3TK9A 2QGRA 3MYWA 2VH6A 2FX6A 1WQVH 1FY1A 2VIDA 1EAXA 1S5SA 2ZGJA 4KKDA 3IITA 3RP2A 2XCNA 4BAOB 2GP9B 3RXQA 4DG4A 4B74A 3BTFE 1EZSC 1IQMA 1V2PT 1O3FA 4JZDH 3F9GA 2C3SA 2F9NA 4NZLA 2BDIA 4ZAEA 1FI8A 2B9LA 1GDQA 1SLXB 1MBQA 1YPGH 3A81A 2EI6A 3A84A 3GY2A 4ZHLU 1TOCB 3TJNA 2I6SA 1TGTA 4O3TA 2WINI 5CMXH 2ZDVH 2CHAB 4IBLH 1B7XB 1A5GH 5DKMA 3KQBA 4AYYB 1AB9C 1EAUA 5FAHA 2NU1E 1DUEA 5HXFA 1NFYA 1O5EH 3BTWE 3P8GA 1QHRB 4OS6A 7GCHF 1EPTA 1EPTB 2ZTYA 1O39A 3NKKA 1WSSH 3VGCB 1PQ5A 1Z8IB 4B2CA 4CR5A 1U6QA 3FZDA 3NZIA 1FV9A 3SHAH 1H8IH 1CBWC 1YPMH 2V3HH 2BLOA 2NU2E 1O3IA 2XC4A 1EZXC 1TPOA 2JH6D 3F9EA 3UFAA 3MNCA 4MPUA 1BA8B 1O5GH 3A87A 1GHWH 3PROA 3H5CB 2QXHA 1C2HA 2PTNA 4UFDH 4U01A 2ALVA 1QJ1B 4YTAA 2YOLA 1O37A 1DY8A 1UTMA 1P2KA 5LPFA 1GHBF 1IQLA 2SGPE 1H1BA 1EZQA 4FUJA 4B75A 1MQ5A 1HAIH 4X6OA 1D3PB 2FYQA 3V0XA 1P04A 4X6NA 4NFEA 1FY5A 4HFPB 1TMUH 1TB6H 1O2QA 5GXPA 1A1RA 1XKBC 1ORFA 2A7JA 2WV5A 2VWLA 5HM9A 5LH8A 1TNLA 1KIGH 3M3VA 4Y8YA 1XUGA 3V7TA 1J14A 1O3KA 4X8UH 2OINA 3W94A 1NESE 1OP2A 2CGAA 2R9PA 1TA6A 1KLJH 5CHAB 2H5DA 2QIQA 2Y80A 2TGPZ 1ZSKA 1GGDC 4GAWA 1H8DH 2R0KA 3ESTA 1QCPA 1C1PA 3RMOH 1PQAA 1CT0E 1G37A 1C2KA 4U32A 2BOHB 3ELAH 2TBSA 1ESAA 1O2TA 4DW2U 1HAOH 1MKWH 2O8WA 2BD9A 3RXRA 1PPFE 1XXFA 1DWCH 3MU4A 5E0GA 4YO9A 1O35A 1AY6H 3A8BA 1RIWB 4Q2KA 1PPBH 2RA3A 3F1SB 1V2VT 1LHEH 2Z3CA 1DE7H 3A80A 3DFJA 3RXJA 1TPPA 2ANYA 1MZDA 2BXTH 1C5VA 4E7NA 2A0QB 1HXFH 4AFUA 3ENSB 3M7QA 2A4QA 3UQVA 1UTJA 4WVPE 1OP0A 2R3UA 1O3EA 1FZZA 3ODDA 2H5CA 1SGNE 3RXOA 1WOFA 1LVOA 4AGKA 4TWWA 3ATMA 4NWKA 1VCPA 3VFEA 1PPGE 4NIVA 3TGKE 1SG8B 4JK5A 1N8OB 2WPIS 3VB5A 2W3IA 1KY9A 2P8OB 1CHOG 1V2WT 3PMJA 2FZZA 2M5TA 1AUTC 6LPRA 4DJZB 3TIUA 1Q3XA 4O9VA 3ZZ7A 4X6MA 1DUAA 4WH8A 1VGCB 4GUXA 1C4U2 1GJAB 1Y3WA 3L3TA 2CF9H 4MNXA 5EQRA 3FANA 3BN9A 1YPLH 1P8VC 1PPZA 3R3GB 1C2DA
chains in the Genus database with same CATH superfamily
1TABE 4ZKRU 2G4TA 1NFWA 1HIAA 1QFKH 1Z7KA 1QIXB 2H9HA 3OY6U 2GMTC 2VWMA 3ODFA 1C5XB 2ZGHA 3EE7A 1OWIA 2D26C 2A4GA 2PSXA 2BD8A 2ZEBA 1NC6A 1VJAU 1O2ZA 1NPMA 1C2EA 2WPMS 5GCHF 2J97A 1RGQA 3A86A 5C1UA 3SUDA 1BTWA 3SW2B 5DGJA 3O8CA 4IGDA 4X2WA 1E1QD 1XMNB 2JDID 1BTZA 2G00A 3RXPA 3RM0H 3VXEH 2Z9JA 2ANWA 3B8JA 1CHGA 3MO6A 3UY9A 4E06H 1JOUB 1DVAH 1INCA 2YMSD 1PQ7A 1Y3XA 2G4UA 4GPGA 3D49H 1MAYA 2ZDAH 1LDTT 1A3BH 1E35B 4Z6AH 2RFKC 2F4LA 3M7UA 1QY6A 4UD9H 1FMGA 1L2EA 3SO3A 1P3CA 4Q7YA 4A1TA 4B2AA 3F9FA 3UOUA 5DPAA 4TPYA 1O3HA 4U30A 4ZKSU 3SU0A 3OSYA 4ACAA 3NCLA 1QB6A 2AHME 1GBFA 4ZKOU 3OX7U 5GWZA 1TQ7B 2VWOA 5JPMH 4CRCA 1THPB 2BD7A 1G2MA 1ZPBA 4JMYA 1ZGVA 3I29A 2CN0H 4RKOB 3LGWA 4X2XA 3BG4B 1FN6A 1LMWB 1ZHPA 4Y8XA 1LHFH 4IW4E 2KAIA 8KME2 4BXWA 4CRGA 5F03A 2ESTE 1GBJA 1SGRE 1D3DB 3LGVA 3ZIAD 1MTWA 1LQEA 4ISIH 3RXFA 1F5RA 1QQUA 4FUDA 4AG2A 1O30A 2PUXB 3E3TA 2GZ7A 4Y8ZA 2GDDA 1ANCA 3MU0A 2PSYA 4ISOA 3PWCA 1AE8H 4HG6A 2AEIH 3LGYA 1AWHB 1YCPM 5C0UA 3D65E 3IG6B 5DP6A 1HLTH 2V3MA 1ZPCA 3MH6A 4X8TH 1K1IA 3AW1A 3P92A 2NU0E 2WSSD 3DFLA 1A2CH 2FTMA 1TBRH 2O8LA 1C5RA 3QWCH 4I31A 1HAXB 1NZQH 2LNCA 4A5TS 4MVNA 2ZQ2A 1SOZA 4INHA 2Y82A 4BAHB 4MG3A 1SPJA 1GDNA 5T6GA 3SJ8A 1SGDE 2VINA 2VIOA 1J9CH 2EA3A 1C5NH 4IS5A 1XUIA 1GL0E 1GVLA 4B73A 1E1RD 3U1JB 1GHAF 3FVFB 2O8UA 3TNTA 4LK4A 4XSKU 2WV4A 1MKXH 1YYY1 3RXEA 1FY4A 5CHAC 3BG8A 3HK6B 2VIQA 3RXAA 1TAWA 1DITH 1SOTA 1OX1A 3URCA 1EFRD 4NIWA 3SV7A 3HPTB 4Y71A 3U8RH 1O3CA 3G01A 1BIOA 3SI3H 1TNGA 4X1SU 2J98A 2J98B 2OTVA 5E2OA 4X1RU 3HGPA 3Q3KA 1AFQC 4O3UA 1XX9A 1CBWB 2B5TB 4A7IB 4YT6H 2GTBA 2WV9A 3GICB 2OXSA 5DG6A 2QXIA 3W95A 3SU3A 4UONA 5C5NA 4DVAU 1BBRE 1RIWC 3LONA 3SU5A 1EAIA 1UTPA 2THFB 4IMQA 4B71A 1C1WH 1PPHE 4YXWD 1GCTB 1GI6A 1QBOA 4UEHH 2GCHF 4FUCA 3SOSA 4NG9H 4Q7ZA 3ZZ9A 2XXLA 2H9TH 3RXVA 1AI8H 1DANH 1O2SA 1A4WH 1AMHA 3M37A 3Q3XA 1TMBH 2FTLE 2F3CE 5C1YA 1OWHA 2F91A 3OEED 1OWKA 5G4BA 4YT7H 2WUBA 3LJOA 4I8KA 3M5LA 1UK3A 2G51A 3RMNH 1YC0A 1EKBB 1P9SA 8GCHG 2ZPSA 3U9AH 2FO9A 1C5LH 2PKAB 1RTKA 2J95A 3GY8A 4OS5A 1A5HA 1N8OC 2HOBA 2OK5A 1HFDA 4B6FA 3TGJE 2D1JA 2P8OC 3A88A 2SNVA 1LPZB 4ISHH 2ZU4A 2BZAA 4X2VA 1YWUA 4H6SB 5KEDA 1YY3A 1VGCC 1ESBA 4GCHG 2UUYA 3EAJA 2DE8A 3ZZBA 3SNDA 2QXGA 2Z94A 2OQ5A 1EQ9A 2ZNKH 1VITF 1DICA 1L4ZA 1ETSH 1P57B 1C1MA 1UTNA 2SGQE 2QC2A 3UNRA 2Q6GA 2ZFQH 1ABIH 1SMFE 2BLVA 1BTPA 1GVZA 3PO1B 2HPQH 3ATKA 2OC1A 5FX5A 4ABJA 3UPEA 1C1VH 1MKWK 1AIXH 1O3BA 4D9QA 4FUEA 1EOLA 1L1JA 4INLA 3QZQA 2IPQX 4THNH 1SL3A 3DUXH 2ZDNA 1VJ9U 2ZWLH 2G5VA 4NZQA 3RXIA 4MNVA 4R0IA 3WWFA 3GY6A 1NU7B 3PYHA 5H4IB 2F9PA 3ZZCA 3LC5A 2LP6A 4K1TA 3LJJA 1SSXA 1IQGA 2Z9KA 4Y79A 4WJG2 2J9NA 4Y0ZE 1V3XA 3SQHE 4KTSA 1KLTA 1V2RT 1BB0B 2XCFA 1UTOA 1TGBA 1CU1A 1C5ZB 2BVRH 1TNJA 2FM2A 2GD4B 2CMYA 3TH4H 1KMHB 1IQIA 1OWEA 3RXGA 5IYTA 1BITA 2ZPRA 2EEKA 3GYLB 3UUZA 1JRTA 5JYIA 4FVDA 1THSH 1T8NA 3LPRA 3LGUA 1XUFA 3QO6A 1O3PB 1THRH 2RG3A 1HJAB 2EC9H 2PUQH 1DLEA 1WQSA 2R3YA 1HAYB 2ZDMA 3UIRA 3Q3YA 1O38A 4X8SH 1H8HD 1BRBE 2UWPA 1WYKA 1F5KU 1XKAC 3GOVB 3GCTF 1SQRA 4K5ZA 2CV3A 5EG4A 3ZVAA 1CA0C 1GHBG 1HAVA 3LC3A 1DX5M 1SQTA 3LH1A 1FPHH 1NFUA 4CRAA 2ZG0H 3S69A 4BAMB 4I8GA 5HIYA 2H9EH 2KFWA 2KCOA 4Y10E 9LPRA 2ZGCA 1QRWA 1GCDA 3GDVA 1UCYK 2BDAA 1L1GA 1G36A 1S6FA 1MD8A 3U1IB 3M5NA 2AGEX 1ETRH 1OSSA 1Y3VA 3M3TA 1C5TA 1T8MA 2P93A 4JZEH 5A8XA 1GI4A 1CGIE 2JKHA 1CGHA 1S0QA 1DS2E 2A32A 1BMFD 1C2GA 2GV7A 1YM0A 2FOCA 1UK4A 3HKJB 5AHGH 3T25A 7KMEH 2FI3E 2WPLS 2OD3B 3OAAD 3RXHA 1BJVA 1P03A 5FBEA 3QX5H 3ZZ5A 4K69A 1X7AC 1SVPA 4XDEA 5EXLA 1ABJH 4OM9A 4DCDA 1Y3YA 3K6YA 8LPRA 2C93B 4XBCA 1A0JA 3M35A 1TX7A 1BRAA 3FN8A 2VBCA 5BPEA 3RMMH 1H4WA 1WBGB 2ZU3A 1H9LB 1O3MA 1D4PB 2KCPA 4DOQA 1XUHA 1HAHH 4DIHH 2G52A 3RXUA 4AZ2B 1DWDH 2XWAA 1OS8A 3MU5A 5CE1A 1YP9A 3SV9A 2ZIQH 3B9FH 4KGAA 3BV9B 3RXTA 5J4QA 4RKJB 2C8YB 3V3MA 1AKSB 4Y6DA 2QE7D 1NS3A 2D2DA 5I46H 3EA8A 1GCTC 3BSQA 1LHDH 1AFEH 1RFNA 1VZQH 2FYRA 4IN1A 2A5IA 5CHBA 1NROH 3HKIB 2Z9IA 2BVSH 5A0CA 3GY3A 1S82A 2G5NA 2V0BA 2W5EA 4ZMAH 5C20A 1Z1JA 2VIVA 3UNSA 1BCUH 1TYNA 1DLKB 1SQOA 1DXPA 2VIPA 1QBVH 3A8CA 5T6DA 2Z9LA 5FPTA 3GYMA 1K1OA 1C5OH 3K9XB 3NK8A 2FIRH 2P95A 2Y81A 1YKTA 1FX0B 4FUIA 1MKXK 1V2UT 1TBZH 2STAE 4AFZA 1OOKB 2XNIA 2WPKS 3AVZA 5FL7D 1T7CA 1BHXB 3SJKA 3GCHC 1YLDA 1QRXA 1Y3UA 5GCHG 4XBBA 4B1TA 3SV8A 1E36B 3S9BA 1O2KA 3OTPA 1FXYA 1SHHB 3PM3A 2XRCA 3MMGA 3FZZA 1IQHA 4UE7H 5GJ4B 3RXSA 3ZYEA 3A7WA 2YMSC 3T29A 5EJLA 6ESTA 3PO1C 5I25A 3RXCA 2ODQA 1TPSA 1JMOH 4E05H 3SJ9A 1TE0A 1DT2A 3PLBA 3SN8A 1AFQB 3A7XA 2J2UA 1UVUH 3TU7H 2GT8A 3D62A 4NSVA 1KDQA 1KDQB 3OTJE 5A8YA 3ZVGA 3BTME 1IHTH 5C94A 3H09A 3SNEA 1PFXC 4ABIA 3F6UH 3TITA 1K22H 2BTCE 2ALPA 4FVBA 4NIYA 1ZGIA 4I8JA 1O2RA 2JETB 3B23B 1GI8B 2GZ8A 3KN2A 3MO9A 1TLDA 4AG1A 2Y7XA 4K1EA 1L4DA 4JZFH 1F0UA 1O3AA 3VB7A 1EAWA 4FUFA 3M3SA 2K0QA 2Z3DA 2P16A 1ZTLA 4X1NU 1JXPA 2ULLA 3ATIA 1MU6B 4BNRA 1GJBB 2SGFE 5EQSA 2ZKSA 3QLPH 4LXBH 1B0EA 4DGJA 2J38A 2WUCA 3MNSA 2KCYA 3S7KB 2H2ZA 1W12U 2FOBA 4P00A 2PWXA 1GBDA 1SB1H 2RDEA 1EP5A 4KTUA 2R2MB 3EA7A 2UUJB 1WDIA 3QK1A 1CO7E 2O9QA 3NWUA 4NA7A 2FS9A 1EJNA 1HJAC 2OC7A 5AF9H 1KTTB 1SGQE 2BDHA 2W7UA 1SGPE 1C5SA 2PW8H 2PLXA 2VNTA 4Y7BA 1SGFA 3CS7A 3W1EA 1SGEE 3UWIA 4D7FA 1UVOA 2PP6A 1O5AB 2VVUA 1SLVB 2P94A 2ZHQH 3L33A 4GSOA 1IQKA 1ELTA 2FX4A 3A83A 3MI4A 1GBLA 3PMHB 4RSPA 3SGBE 1VITH 1CQQA 1AVWA 4FOUC 1SGYE 3BTEE 7ESTE 3SUEA 4YOJA 1LVMA 4ABFA 1DPOA 2AYWA 2ZHEH 4M7GA 1O31A 1F92A 3PB1E 1YPEH 4K2YA 4KTCA 2GT7A 4YM9A 1HAPH 2W3KA 2QXJA 1MTVA 3MH5A 1TRMA 2J5UA 2YNBA 2Z6BD 4WF8A 3SGQE 4BAKB 2ZI2H 2FS8A 1HBTH 4QT8C 1KXCA 1QURH 3WW7A 1UCYH 3ITIA 2HWLB 5GDSH 3D23A 2W26A 1PYTD 1DWBH 1S83A 1XVMA 4BTIB 1ANDA 1V2JT 2ZECA 1DXWA 2I6QA 4K3JA 1YGCH 2NU3E 4AOQA 1Y5BT 1B5GH 2V7QD 3QDZB 1O2IA 4NWLA 1SC8U 4FUBA 5C67A 4RI0A 4X2YA 1NY22 4I86A 4IMZA 1UW7A 4M9FA 3SU6A 3RXBA 3VB4A 1JRSA 4AGJA 3F0PA 4K1SA 1S6HA 2ZFSA 1W0KD 4YLUA 1ZJDA 2XC5A 3SZNA 3ZYDA 3STJA 2BQ6B 3P95A 1NU9A 4CRFA 1P2JA 1GMDF 1D6WA 1O34A 1J16A 2J34A 4KP0A 2FEQH 3SBKA 1ELGA 2QAAA 1P01A 5AFZH 2AERH 1G2LA 3TNSA 4BTTB 5EQQA 4MPXA 1D6RA 2Y7ZA 4F48B 2FI5E 3MNBA 1IOEA 1O2MA 2BY7X 1CA0B 1FPCH 5L6NH 2GKVE 2OUAA 1DM4B 3T62A 3VXFH 1LPGB 2EY4C 2FODA 3RC6A 3H7OA 4UDWH 1AQ7A 3S0NA 3UR9A 1ARBA 2ZDLA 5E8EH 5HYOA 5E2PA 3E1XB 3A89A 3MOCA 2WHXA 1ZMNA 2XWBI 6CHAB 4JCNA 4DIIH 4Y76A 2ZCHP 3FO8D 1TGSZ 5A0BA 1ARCA 2D8WA 3RC4A 1G3BA 5F8ZA 1GDUA 3KYGA 1SHYA 3JZ2B 2G55A 5DP3A 2C4FH 5JBCS 1GJ7B 1Z6JH 3QGJA 1ZMJA 2QYIA 1FN8A 2PKSB 3LU9B 3LIWA 4GVUA 1IQJA 2VH0A 2R2WU 5A2MH 5JBBS 5T6FA 2XBWA 3TJOA 1VCWA 1WUNH 3F2FA 2ZU5A 1YF4A 3U69H 5AVDA 2AIPA 2QF3A 1ELVA 3OYPA 3U98H 4CRDA 1GHXH 1O3GA 1QB9A 3R0FA 4NA9H 1FUJA 2A4RA 4O03A 3K65B 2BDGA 2ZTXA 1QL8A 4K8BA 1FAKH 3RLYH 1ZLRA 1ZYOA 2BOKA 2PV9B 3A8AA 4CH8B 2VVVA 4A1VA 1C9PA 1NT1A 2ZA5A 2BYAX 1MABB 5EIYA 3RXDA 2AMDA 1ZRKA 4FU8A 1Z8GA 2OBQA 1QJ7B 1P10A 2A7CA 1DWEH 2HRVA 2KM0A 1G9IE 1YPJH 1TNKA 3E0NB 1QTFA 3P6ZB 1O2UA 1M9UA 3VPKA 3LGTA 1C1RA 3PTNA 4A6LA 4D9RA 6GCHF 1HCGA 2BY5X 2FOFA 1BT7A 1BTUA 2A5KA 1TX8A 5EW1H 3UOPA 2DE9A 1ZHMA 2GZ9A 4HGCA 3PV2A 3KQCA 3N99A 1H9HE 1MTNB 4Q80A 5IK2D 4XBDA 1ELBA 3SJOA 1IQEA 5DO4H 1O0DH 1O36A 4R8TB 1QGFA 1ANEA 1YBWA 3MQKC 2JETC 4NGAH 4NCYA 1P05A 3UQOA 1SFIA 2ZPQA 1RRKA 3RC5A 1K21H 2FOGA 1NBMD 1C1QA 1E37B 5K7RA 1BBRK 2O8TA 1W10U 2H6MA 1RTLA 2SNWA 3S9CA 4AFQA 2ZGBH 3P8OA 3GDUA 8ESTE 1T4UH 4ASHA 1EOJA 1W7GH 3FKSD 1ELEE 1GMCG 2ZTZA 2WPJS 2TIOA 1GI3A 2PKAA 5ETXA 1XXDA 3NRLA 1MQ6A 3P8NA 5JBTA 4OS7A 1EATA 3MWIU 1D3TB 1GHVH 3SNCA 4XE4A 4BTUB 1MBMA 4X0WU 3TJUA 1KXDA 3LH3A 3SU1A 4J2YB 1OYTH 1FY3A 1MUEB 2Q1JA 2XC0A 2PHBA 3BIUH 2ZCLP 4WXIA 1IQFA 5A0AE 1KSNA 4GLYA 1Y8TA 2STBE 1XVOA 1AVGH 2WYGA 3GCHB 2UUKB 1WCZA 1C2MA 2TPIZ 3C27B 3URDA 1BMLA 3KQDA 1O5CB 3ZZ3A 3DHKH 1EX3A 1E34B 7LPRA 1O2PA 1GI7B 1ZTKA 2OC0A 1CT4E 3DT0H 2A5AA 1AO5A 1F5LA 4IC6A 5EXNA 3IWMA 4MPWA 1N6XA 3CNRA 2YMSB 2ZHFH 2FLRH 2GVFA 1G3DA 3ZVFA 1TALA 2H1UA 3BTTE 2SGEE 4ABBA 5ABWA 1GVKB 3O8BA 1NM6A 3U8OH 1K1MA 2LPRA 2OP9A 2EI7A 3SUGA 1LQDB 2TGTA 4AC9A 2BLQA 1ANBA 3ZZAA 3TPIZ 3AK5A 1ESTA 4MTBA 4O97A 2BVXH 2VIWA 3AW0A 3PMAB 4WMDA 3GCOA 2BB4A 1UJ1A 2ZU1A 4LOYH 5DN6D 3ATWA 2Q6FA 3L6PA 1DSTA 2VU8E 1AHTH 1T32A 2P3FH 2GGVB 3RDZA 3I78A 4BANB 1UVPA 3OY5U 1YPKH 2FI4E 3TVJB 3PRDA 4NA8A 1UTKA 4VGCB 3QN7A 3A7VA 5DSFA 1W13U 1ELAA 1A3EH 5C1XA 1CT2E 3CP7A 1OWJA 1BRCE 2HLCA 1O5BB 5T3HA 1MTSA 3RXKA 1JIMA 4AORA 7GCHG 1GI0A 2BQWB 2HNTE 5EODA 1UTLM 2IN2A 4MPVA 3SJIA 3N7DA 5FPYA 1NRNH 1EJMA 1JBUH 2XW9A 2BY8X 1KLIH 1HJ9A 1HDTH 2BX4A 1C2IA 5TCAA 2FWWA 3U8TH 1Q2WA 3RU4D 1MCVA 3M36A 1UHBB 1C2LA 4Y7AA 1C5PA 2ZFPH 1QA0A 4WMFA 3VEQB 1G3EA 3V12A 5FX6A 2BMGB 2G8TA 1P9UA 2NU4E 1TGNA 1K1PA 1SFQB 2J94A 4D8NA 2FMJA 2B8OH 1E38B 8GCHF 3RXLA 4GHTA 2HPPH 2JH0D 1T31A 1W3CA 1ZZZA 3BTGE 1NRRH 3KNXA 2ZO3H 1A7SA 1GG6B 2P3UB 3E6PH 4AB9A 4JYTA 2GJGA 1XUJA 2NWNA 1C1NA 1TIOA 2IJOB 1BMMH 3KIDU 6CHAC 1GJCB 5PTPA 1MU8B 3BEFB 1NRQH 3QGNB 2UUFB 2ZF0H 5JB9S 4D7GA 1YPHE 4I32A 2ZQ1A 1O5FH 2F9UA 2ODYB 1HNEE 1KXFA 1O2NA 2PKSC 2AGIX 1V2OT 3FFGA 1HYLA 1GL1A 3RUOA 1HAGE 5FPSA 1MCTA 1GJ9B 2ZFFH 1HGTH 3RLWH 1F0SA 2RCEA 5EJ1A 3BIVH 5BRRE 2CK3D 4DURA 2TRMA 1GBIA 2F9OA 3A82A 1C4Y2 2OC8A 3MU1A 2Q6DA 4J1YA 4H6TA 3VB6A 1NN6A 2ZC9H 4ZXXH 3Q77A 1C1SA 3LT3A 2EI8A 2SGAA 3SUFA 3GISB 1AD8H 3BTDE 5EOKA 2EQNA 3BEIB 2XOKD 1T4VH 1O2WA 1ZPZA 3VB3A 1GJDB 5A09A 1SGFG 3TH3H 1G32B 3A7YA 3LGIA 3SNAA 1BHXF 4ZHMU 2ILNA 4ISLA 4WXVA 3PLKA 4IC5A 2Y5HA 1MTNC 1DDJA 1AKSA 1A5IA 2AH4X 4YOGA 1JWTA 1FAXA 2A4OA 3E8LA 1QNJA 1W7XH 1NBME 1SLWB 1FDPA 3SV2H 1KXBA 1NTPA 3DSPA 1FY8E 3QTOH 1RXPA 2ZHWH 1O3NA 5LPEA 4XOJA 5L2YH 1TPAE 2A31A 4ZROA 4ABGA 3OU0A 3ZZ6A 1C4V2 1ZJKA 3MH4A 1OP8A 1BMAA 4LZ1H 2O8MA 3DSOA 1V6DA 1BBRH 1WU1A 5GIBA 2ODPA 2ZDKA 3SGAE 2JH5D 4RN6A 3UWJH 1UVTH 3OE7D 4WY3A 3Q76A 3UREA 1WTGH 2FP7B 2XBXA 4B76A 3HATH 4ABAA 2CXVA 1GBHA 5DP9A 1FLEE 4AYVB 1RTFB 5HMAA 3SI4H 3Q00A 1IAUA 1ID5H 3OEHD 1C1TA 1SLUB 3KHVA 1TA2A 4X6PA 2UWOA 1MMJN 2OBOA 1Z1IA 4AN7A 4ABEA 1TX6A 3A8DA 4ZHAA 3ZZ8A 2J4IA 4TT3D 3ZVDA 1V2ST 1HJ8A 4YOIA 3S9AA 2BXUH 2F9BH 1V2MT 1GMHF 4MLFB 2GCTC 1V2LT 4E7RG 1QA7A 4JZIA 1GBBA 4SGBE 4CREA 3NPSA 1BTXA 3SHCH 1LPKB 1WTHD 3KQEA 1HPGA 5B6LA 1C2JA 1GBMA 4JZ1A 1EB1H 2HLDD 2UWLA 4MDSA 5EW2H 1PYTC 1TFXA 4DY7B 1FNIA 1ZRBA 1HAZB 1BRUP 1F2SE 5FXLA 2BDCA 1DY9A 1OHHD 1AN1E 1QB1A 3EE0B 1W0ZU 2BHGA 3GY7A 1EJAA 2AFQB 5HIZA 4B2BA 3T5FH 1CA8B 2ZP0H 2ZZUH 2BDBA 3NXPA 1EB2A 1V2TT 2AMQA 3BTKE 4ZXYH 2BM2A 1XM1A 2C8WB 2PFEA 4A1XA 3PRBA 4F4OC 3S7HB 2V6NA 1QJ6B 3MFJA 1Q31A 3ATLA 1KXEA 4HTCH 1GJ4H 2P3TB 2HNTC 3F0OA 4VGCC 3SV6A 5FBIA 1ELFA 3PMBB 1S6LA 1G30B 2DUCA 1J15A 1O2LA 1K0HA 4ZH8A 1HRTH 2VWNA 1BMNH 1BDAA 4XFQA 1FIZA 1AWFH 1VKYA 1DFPA 2QV1A 4ISNA 5EU8A 4UFFH 1TMTH 4Z0KA 1YLNA 1GMDG 2BLWA 3FAOA 1H8ED 1PJPA 4INKA 3LKWA 1ZTJA 4PROA 1MZAA 5EGMA 2SGDE 3BEUA 1TONA 3NUMA 3RU4E 1Y5UT 5ESBA 2ASUB 1HB0B 1O2GH 2FDAA 4CHAB 2FOHA 1TOMH 1QL7A 1LHGH 2V35A 2Z3EA 4YESB 3U28C 2BD4A 1BTYA 1C5WB 1HXEH 1F0RA 4OS2A 1K1JA 1A46H 3TJVA 3SQEE 3E90B 1P2MA 5F8XA 1TNHA 1QZ8A 3P8FA 3JZ1B 5GNDA 1SBWA 2F83A 3LOXA 2ZGXH 4H4FA 1CE5A 2FPZA 1ZOMA 1YCPH 1YPHC 5EPNA 2QCYA 1GHZA 2L6OA 1BQYA 2G81E 1LVYA 5FCKA 1O3JA 1LCYA 1GI2A 1GBEA 1L1NA 1GWAA 2K1QA 3PV4A 1LO6A 3KGPA 4CRBA 1K2I1 3E91A 1GG6C 4WWYA 5J4SA 3ZVBA 4K8YA 1A61H 1Z71A 2BD5A 1HIAB 2BD3A 1H9IE 1TRYA 1AUJA 5GPIB 5EPYA 4JYUH 2BY6X 3FP6E 2Z7FE 1MAXA 2OQUA 1P11E 1GHAG 3KCGH 1O2YA 1ELCA 2VGCB 3AASA 1P06A 1C5UA 1EUFA 4NIXA 3KF2A 4OGYA 1JIRA 1XUKA 2P59A 1RS0A 1IQNA 1W11U 2QY0B 2SFAA 3OFND 5K0HA 3EQ0H 2FXRA 5TCCA 3AAVA 1S0RA 1S84A 3RXMA 3V13A 4D76A 5FHTA 4U2WA 2PTCE 4BOHA 1O3LA 1TQ0B 1YLCA 2AMPA 3ZZDA 2GDEH 3RU4T 4XRNA 1GBTA 2CF8H 2FOEA 6GCHG 2XBYA 1O3DA 1ZHRA 3N7EA 3GCNA 1P12E 1SGCA 3GY5A 3QTVH 1TBQH 1W0YH 5T1VA 3EYDA 3F2HA 2C8ZB 4NSYA 2LELA 3KYFA 4KELA 1C5YB 2GCHG 1HV7A 2BZ6H 1O2VA 4YLQH 2Y5FA 4ZKNU 2KZ4A 4ESTE 1PQ8A 4AFSA 2QA9E 2KR7A 3LDXH 1LTOA 4F49A 2CHAC 1P2QA 5EXMA 1OYQA 2OCVB 2KAIB 2HVXA 3M61U 3RMLH 2AS9A 3ZVEA 3SU4A 1K28D 2W7SA 3SU2A 3PTBA 1EPTC 1GJ6A 1CHOF 3KQ5A 5TJXA 1AVXA 1KXAA 4UFEH 3VGCC 1MD7A 1ZSLA 3P70B 1VCQA 3BTHE 3HGNA 1CSOE 3TK5A 2YNAA 1P2IA 4HI3A 1BJUA 2KX4A 1WXRA 1QR3E 1MH0A 2VVCA 3O8DA 4ASUD 2RDLA 2ZHDA 4Q7XA 4FETA 1O2HA 1QQ4A 3QZRA 4HZHA 3P17H 1NO9H 1C2FA 3TLOA 3M5OA 1VITG 4AX9H 4OS1A 5KGOA 1KYNA 3E0PB 3GDSA 2GX4A 2A1DB 2FESH 5JDUB 4FU7A 1QBNA 4FUHA 1W2KH 1LKAA 3A7TA 1HUTH 4I8LA 1GI9B 3N7OA 2QN5T 4OS4A 5E0JA 1O5DH 5AFYH 2AGGX 3A7ZA 2BX3A 1VR1H 1AZZA 1A0HB 1V2KT 3UTUH 5C0TA 1G3CA 4A92A 1O3OA 3ZVCA 4FU9A 1P2NA 1K1LA 1T8LA 3TK6A 4P02A 1W14U 5ESTE 1EASA 3EDXB 5HGGA 1C5MD 4ABDA 1D9IA 3WY8A 2XYAA 2OLGA 1ZR0A 2W6ID 3SNBA 1N6YA 1ETTH 1PPEE 3FP7E 3PLPA 2HALA 3E16B 1W0JD 2A7HA 1EXFA 1FQ3A 4MNWA 2F43B 4FXGH 3ZV8A 4XD7D 5C17A 4I8HA 5L30H 3T26A 2BQ7B 2Y6TA 5LPRA 4WH6A 2BDYA 3HK3B 3T2NA 1AB9B 1SI5H 3QUMP 4X8VH 2ZCKP 1O32A 1LHCH 4MQAA 1C1OA 3M5MA 1AGJA 1TNIA 3DA9B 1P0SH 1TRNA 2PGBB 1RD3B 5EJZA 5F8TA 3TH2H 4MNYA 1NFXA 4LZ4B 4ABHA 4Y0YE 1W8BH 4Y11E 1N1LA 5JB8S 1QRZA 3DD2H 2IOTA 3K6ZA 1NRSH 1L0ZA 4UFGH 3RM2H 2JIZD 4FUGA 3BTQE 1OWDA 1S85A 5DP7A 1TWXB 4I33A 2VJ1A 4WMEA 1SGIB 4RT0A 1QL9A 4BAQB 2GV6A 4CH2B 1WAYB 1EP6A 1BTHH 5CDFE 1ZSJA 2IJD1 2HGTH 3KEEA 1FONA 1UMAH 3MNXA 4X1PU 2TGDA 1IHSH 3STIA 2B0FA 3O8RA 1FJSA 1SQAA 1F7ZA 1MTUA 4TWYA 4JK6A 2PR3A 5E0HA 3A85A 2HNTF 4CHAC 3GCTG 2BD2A 4I7YH 3FP8E 2GCTB 1C9TA 3UAIC 3VG8A 1Z6EA 3AAUA 1BUIA 1LKBA 3SORA 2ZU2A 5F6MA 4NFFA 3ZV9A 1CVWH 2M2AA 1GHYH 1GPZA 5FCRA 4TY6A 3UNQA 1UTQA 2CJIA 2ZFTA 1OXGA 2VB0A 1O2OA 1RJXB 5DJ7A 3MH7A 1SGTA 4RT1A 3T27A 3WWBA 1K1NA 2FOMB 5C2ZA 2XTTB 2IPHA 2J92A 3H7TA 1GGDB 2A45B 1Y5AT 2RA0A 2A2QH 3FOAA 3MTYA 3TGIE 4TY7A 4X1QU 5IDKA 2V3OH 1P2OA 1BOQA 1V2NT 1OPHB 3CS0A 1GBAA 1F0TA 3F68H 2VGCC 1GJ5H 2F9VA 1J8AA 1O33A 2XBVA 5DK1A 5A8ZA 1ELDE 1GJ8B 1D3QB 2A2XH 4TPIZ 4CBOA 1J17T 3F9HA 2AIQA 3MHWU 2ANKH 5F53A 1GI5A 1Z8JB 1ZMLA 1AU8A 1ACBE 4YZUA 4CR9A 1P09A 2ZFRH 1PPCE 1O2XA 1UVSH 4CBNA 3MU8A 1TGCA 1EZUC 1GBCA 1CGJE 2PGQB 5DP8A 2HVYB 4GHQA 4IN2A 2C90B 1V2QT 1AZ8A 5DP4A 3KL6A 1UHBA 3T28A 1SR5C 2FLBH 5C5OA 5HM2A 4K60A 3C1KA 1C1UH 1C5QA 1YCPK 1K9OE 4H42U 3UR6A 1GBKA 2WYJA 2ANMH 3BF6H 4DT7B 1B0FA 1LVBA 3BG4C 3M7TA 5JBAS 1COWD 1UK2A 3MO3A 4SGAE 1UO6A 5B6OA 1GMCF 3GY4A 1GI1A 3EA9A 4BXSA 1P02A 3CENA 3K2UA 5L2ZH 1DSUA 1NRPH 1Y59T 5SGAE 1E0FD 9ESTA 4AB8A 2WPHS 3PWBA 4TYDA 5KECA 2QF5A 1S81A 2Z9GA 1OKXA 2GMTB 2QF0A 2FOAA 5LGOA 2BY9X 5DP5A 4ZUHA 3I77A 4JYVH 1Z8RA 4GCHF 1FIWA 1O2JA 2R0LA 2Y5GA 5C3NA 2TGAA 1HAVB 1WV7H 1A0LA 1UCYE 1DOJA 2QF4A 1AE5A 3EGKH 2B7DH 2C8XB 4OGXA 1KTSB 1GMHG 1P3EA 3ZZ4A 1BZXE 1T8OA 3TK9A 1E79D 2QGRA 4Q63A 3MYWA 2VH6A 2FX6A 1WQVH 3PV5A 1FY1A 2VIDA 1EAXA 1S5SA 2ZGJA 4KKDA 3IITA 4TSFD 2XCNA 3RP2A 2K8IA 4BAOB 2GP9B 3RXQA 4DG4A 4B74A 5HKKD 3BTFE 2WPDD 1EZSC 4Z1MD 1IQMA 1V2PT 1O3FA 4JZDH 2L74A 3F9GA 2C3SA 2F9NA 4NZLA 2BDIA 4ZAEA 1FI8A 2B9LA 1GDQA 1SLXB 1MBQA 1YPGH 3A81A 2EI6A 3A84A 3GY2A 4ZHLU 1TOCB 3TJNA 2I6SA 1TGTA 4O3TA 2WINI 4Q4LA 2ZDVH 5CMXH 2CHAB 4IBLH 1B7XB 1A5GH 5DKMA 3KQBA 4AYYB 1AB9C 1EAUA 5FAHA 2NU1E 1DUEA 5HXFA 1NFYA 1O5EH 3BTWE 3P8GA 1QHRB 4OS6A 7GCHF 1EPTA 1EPTB 2ZTYA 1O39A 3NKKA 1WSSH 3VGCB 1PQ5A 1Z8IB 4B2CA 4CR5A 1U6QA 3FZDA 3NZIA 1FV9A 2KCAA 3SHAH 3DCLA 1H8IH 1CBWC 1YPMH 2V3HH 2BLOA 2NU2E 1O3IA 2XC4A 1EZXC 1TPOA 2JH6D 3F9EA 3UFAA 3MNCA 4MPUA 1BA8B 3SZEA 1O5GH 3A87A 1GHWH 3PROA 3H5CB 2QXHA 1C2HA 4ACBA 2PTNA 4UFDH 4U01A 2ALVA 1QJ1B 4YTAA 2YOLA 1O37A 1DY8A 1UTMA 1P2KA 5LPFA 1GHBF 1IQLA 2SGPE 4DT4A 1H1BA 1EZQA 4FUJA 4B75A 1MQ5A 1HAIH 4X6OA 1D3PB 2FYQA 3V0XA 1P04A 4X6NA 4NFEA 1FY5A 2W6JD 4HFPB 1TMUH 1TB6H 1O2QA 5GXPA 1A1RA 1XKBC 1ORFA 4ZCNA 2A7JA 2WV5A 3SYJA 2VWLA 5HM9A 3UB0A 5LH8A 1TNLA 1KIGH 3M3VA 4Y8YA 1XUGA 3V7TA 1SKYE 1J14A 1O3KA 2JJ2D 4X8UH 2OINA 3W94A 1NESE 1OP2A 2CGAA 3DSGA 2R9PA 1TA6A 1KLJH 5CHAB 2H5DA 2QIQA 2Y80A 4B6EA 2TGPZ 1ZSKA 1GGDC 4GAWA 1H8DH 2R0KA 3ESTA 1QCPA 1C1PA 3RMOH 1PQAA 1CT0E 1G37A 1C2KA 4U32A 2BOHB 3ELAH 2TBSA 1ESAA 1O2TA 4DW2U 1HAOH 3GS9A 1MKWH 2O8WA 2BD9A 3RXRA 1PPFE 1XXFA 1DWCH 3MU4A 5E0GA 4YO9A 1O35A 1AY6H 3A8BA 1RIWB 4Q2KA 1PPBH 2RA3A 3F1SB 1V2VT 1LHEH 2Z3CA 1DE7H 3A80A 3DFJA 3RXJA 1TPPA 2ANYA 1MZDA 2BXTH 1C5VA 4E7NA 2A0QB 1HXFH 4AFUA 3ENSB 3M7QA 2A4QA 3UQVA 1UTJA 3F3BA 4WVPE 1OP0A 2R3UA 2JJ1D 2WZQA 1O3EA 1FZZA 3ODDA 2H5CA 1SGNE 3RXOA 1WOFA 3F2GA 1LVOA 4AGKA 4TWWA 3ATMA 4NWKA 1VCPA 3VFEA 1PPGE 4NIVA 3TGKE 1SG8B 4JK5A 1N8OB 2WPIS 3VB5A 2W3IA 4F55A 1KY9A 2P8OB 1CHOG 1V2WT 3PMJA 2FZZA 2M5TA 2XNDD 1AUTC 6LPRA 4DJZB 3TIUA 1Q3XA 4O9VA 3ZZ7A 4X6MA 1DUAA 4WH8A 1VGCB 4GUXA 1C4U2 1GJAB 1Y3WA 3L3TA 2CF9H 4MNXA 5EQRA 3FANA 3BN9A 1YPLH 1P8VC 1PPZA 3R3GB 1C2DA
chains in the Genus database with same CATH topology
1TABE 4ZKRU 2G4TA 1NFWA 1HIAA 1QFKH 1Z7KA 1QIXB 2H9HA 3OY6U 2GMTC 2VWMA 3ODFA 1C5XB 2ZGHA 1OWIA 2D26C 2A4GA 2PSXA 2BD8A 2ZEBA 1NC6A 1VJAU 1O2ZA 1NPMA 1C2EA 2WPMS 5GCHF 1RGQA 3A86A 5C1UA 3SUDA 1BTWA 3SW2B 5DGJA 3O8CA 4IGDA 4X2WA 1XMNB 3RXPA 1BTZA 2G00A 3RM0H 3VXEH 2Z9JA 2ANWA 3B8JA 1CHGA 3MO6A 3UY9A 4E06H 1JOUB 1DVAH 1INCA 1PQ7A 1Y3XA 2G4UA 4GPGA 3D49H 1MAYA 2ZDAH 1LDTT 1A3BH 1E35B 4Z6AH 3M7UA 1QY6A 4UD9H 1FMGA 1L2EA 3SO3A 1P3CA 4Q7YA 4A1TA 4B2AA 3F9FA 3UOUA 5DPAA 4TPYA 1O3HA 4U30A 4ZKSU 3SU0A 3OSYA 3NCLA 1QB6A 1GBFA 4ZKOU 3OX7U 5GWZA 1TQ7B 2VWOA 5JPMH 4CRCA 1THPB 2BD7A 1G2MA 1ZPBA 4JMYA 1ZGVA 3I29A 2CN0H 4RKOB 3LGWA 4X2XA 3BG4B 1FN6A 1LMWB 1ZHPA 4Y8XA 1LHFH 4IW4E 2KAIA 8KME2 4BXWA 4CRGA 5F03A 2ESTE 1GBJA 1SGRE 1D3DB 3LGVA 1MTWA 1LQEA 4ISIH 3RXFA 1F5RA 1QQUA 4FUDA 4AG2A 1O30A 2PUXB 3E3TA 2GZ7A 4Y8ZA 2GDDA 1ANCA 3MU0A 2PSYA 4ISOA 3PWCA 1AE8H 2AEIH 3LGYA 1AWHB 1YCPM 3D65E 3IG6B 5DP6A 1HLTH 1ZPCA 3MH6A 4X8TH 1K1IA 3AW1A 3P92A 2NU0E 3DFLA 1A2CH 2FTMA 1TBRH 2O8LA 1C5RA 3QWCH 4I31A 1HAXB 1NZQH 2LNCA 4A5TS 4MVNA 2ZQ2A 1SOZA 4INHA 2Y82A 4BAHB 4MG3A 1SPJA 1GDNA 5T6GA 3SJ8A 1SGDE 2VINA 2VIOA 1J9CH 2EA3A 1C5NH 4IS5A 1XUIA 1GL0E 1GVLA 4B73A 3U1JB 1GHAF 3FVFB 2O8UA 3TNTA 4LK4A 4XSKU 2WV4A 1MKXH 1YYY1 3RXEA 1FY4A 5CHAC 3BG8A 3HK6B 2VIQA 3RXAA 1TAWA 1DITH 1SOTA 1OX1A 3URCA 4NIWA 3SV7A 3HPTB 4Y71A 3U8RH 1O3CA 3G01A 1BIOA 3SI3H 1TNGA 4X1SU 2OTVA 5E2OA 4X1RU 3HGPA 3Q3KA 1AFQC 4O3UA 1XX9A 1CBWB 2B5TB 4A7IB 4YT6H 2GTBA 3GICB 2OXSA 5DG6A 2QXIA 3W95A 3SU3A 4UONA 5C5NA 4DVAU 1BBRE 1RIWC 3LONA 3SU5A 1EAIA 1UTPA 2THFB 4IMQA 4B71A 1C1WH 1PPHE 1GCTB 1GI6A 1QBOA 4UEHH 2GCHF 4FUCA 3SOSA 4NG9H 4Q7ZA 3ZZ9A 2XXLA 2H9TH 3RXVA 1AI8H 1DANH 1O2SA 1A4WH 1AMHA 3M37A 3Q3XA 1TMBH 2FTLE 2F3CE 5C1YA 1OWHA 2F91A 1OWKA 5G4BA 4YT7H 2WUBA 3LJOA 4I8KA 3M5LA 1UK3A 2G51A 3RMNH 1YC0A 1EKBB 1P9SA 8GCHG 2ZPSA 3U9AH 2FO9A 1C5LH 2PKAB 1RTKA 2J95A 3GY8A 4OS5A 1A5HA 1N8OC 2HOBA 3TGJE 1HFDA 2D1JA 2P8OC 3A88A 2SNVA 1LPZB 4ISHH 2ZU4A 2BZAA 4X2VA 4H6SB 1VGCC 1ESBA 4GCHG 2UUYA 3EAJA 2DE8A 3ZZBA 3SNDA 2QXGA 2Z94A 2OQ5A 1EQ9A 2ZNKH 1VITF 1DICA 1L4ZA 1ETSH 1P57B 1C1MA 1UTNA 2SGQE 2QC2A 3UNRA 2Q6GA 2ZFQH 1ABIH 1SMFE 2BLVA 1BTPA 1GVZA 3PO1B 2HPQH 3ATKA 2OC1A 5FX5A 4ABJA 3UPEA 1C1VH 1MKWK 1AIXH 1O3BA 4D9QA 4FUEA 1EOLA 1L1JA 4INLA 3QZQA 4THNH 1SL3A 3DUXH 2ZDNA 1VJ9U 2ZWLH 2G5VA 4NZQA 3RXIA 4MNVA 4R0IA 3GY6A 1NU7B 3PYHA 5H4IB 2F9PA 3ZZCA 3LC5A 4K1TA 3LJJA 1SSXA 1IQGA 2Z9KA 4Y79A 4WJG2 2J9NA 4Y0ZE 1V3XA 3SQHE 4KTSA 1KLTA 1V2RT 1BB0B 2XCFA 1UTOA 1TGBA 1CU1A 1C5ZB 2BVRH 1TNJA 2FM2A 2GD4B 2CMYA 3TH4H 1IQIA 1OWEA 3RXGA 5IYTA 1BITA 2ZPRA 2EEKA 3GYLB 3UUZA 1JRTA 5JYIA 4FVDA 1THSH 1T8NA 3LPRA 3LGUA 1XUFA 3QO6A 1O3PB 1THRH 2RG3A 1HJAB 2EC9H 2PUQH 1DLEA 1WQSA 2R3YA 1HAYB 2ZDMA 3UIRA 3Q3YA 1O38A 4X8SH 1BRBE 2UWPA 1WYKA 1F5KU 1XKAC 3GOVB 3GCTF 4K5ZA 2CV3A 5EG4A 3ZVAA 1CA0C 1GHBG 1HAVA 3LC3A 1DX5M 1SQTA 3LH1A 1FPHH 1NFUA 4CRAA 2ZG0H 3S69A 4BAMB 4I8GA 2H9EH 4Y10E 9LPRA 2ZGCA 1QRWA 1GCDA 3GDVA 1UCYK 2BDAA 1L1GA 1G36A 1S6FA 1MD8A 3U1IB 3M5NA 2AGEX 1ETRH 1OSSA 1Y3VA 3M3TA 1C5TA 2P93A 1T8MA 4JZEH 5A8XA 1GI4A 1CGIE 2JKHA 1CGHA 1S0QA 1DS2E 2A32A 1C2GA 2GV7A 1YM0A 2FOCA 1UK4A 3HKJB 5AHGH 3T25A 7KMEH 2FI3E 2WPLS 2OD3B 3RXHA 1BJVA 1P03A 5FBEA 3QX5H 3ZZ5A 4K69A 1X7AC 1SVPA 4XDEA 5EXLA 1ABJH 4DCDA 1Y3YA 3K6YA 8LPRA 2C93B 4XBCA 1A0JA 3M35A 1TX7A 1BRAA 5BPEA 3RMMH 1H4WA 1WBGB 2ZU3A 1H9LB 1O3MA 1D4PB 4DOQA 1XUHA 1HAHH 4DIHH 2G52A 3RXUA 4AZ2B 1DWDH 2XWAA 1OS8A 3MU5A 5CE1A 1YP9A 3SV9A 2ZIQH 3B9FH 4KGAA 3BV9B 3RXTA 5J4QA 4RKJB 2C8YB 3V3MA 1AKSB 4Y6DA 1NS3A 2D2DA 5I46H 3EA8A 1GCTC 3BSQA 1LHDH 1AFEH 1RFNA 1VZQH 2FYRA 4IN1A 2A5IA 1NROH 3HKIB 2Z9IA 2BVSH 5A0CA 3GY3A 1S82A 2G5NA 2V0BA 2W5EA 4ZMAH 5C20A 1Z1JA 2VIVA 3UNSA 1BCUH 1TYNA 1DLKB 1SQOA 1DXPA 2VIPA 1QBVH 3A8CA 5T6DA 2Z9LA 5FPTA 3GYMA 1K1OA 1C5OH 3K9XB 3NK8A 2FIRH 2P95A 2Y81A 1YKTA 4FUIA 1MKXK 1V2UT 1TBZH 2STAE 4AFZA 1OOKB 2XNIA 2WPKS 3AVZA 1T7CA 1BHXB 3SJKA 3GCHC 1YLDA 1QRXA 1Y3UA 5GCHG 4XBBA 4B1TA 3SV8A 1E36B 3S9BA 1O2KA 1FXYA 1SHHB 3PM3A 2XRCA 3MMGA 3FZZA 1IQHA 4UE7H 5GJ4B 3RXSA 3ZYEA 3A7WA 3T29A 6ESTA 3PO1C 5I25A 3RXCA 2ODQA 1TPSA 1JMOH 4E05H 3SJ9A 1TE0A 1DT2A 3PLBA 3SN8A 1AFQB 3A7XA 2J2UA 1UVUH 3TU7H 2GT8A 3D62A 4NSVA 1KDQA 1KDQB 3OTJE 5A8YA 3ZVGA 3BTME 1IHTH 3SNEA 1PFXC 4ABIA 3F6UH 3TITA 1K22H 2BTCE 2ALPA 4FVBA 4NIYA 1ZGIA 4I8JA 1O2RA 2JETB 3B23B 1GI8B 2GZ8A 3KN2A 3MO9A 1TLDA 4AG1A 2Y7XA 4K1EA 1L4DA 4JZFH 1F0UA 1O3AA 3VB7A 1EAWA 4FUFA 3M3SA 2Z3DA 2P16A 1ZTLA 4X1NU 1JXPA 2ULLA 3ATIA 1MU6B 4BNRA 1GJBB 2SGFE 5EQSA 2ZKSA 3QLPH 4LXBH 1B0EA 4DGJA 2J38A 2WUCA 3MNSA 3S7KB 2H2ZA 1W12U 2FOBA 2PWXA 1GBDA 1SB1H 1EP5A 4KTUA 2R2MB 3EA7A 2UUJB 3QK1A 1CO7E 2O9QA 3NWUA 4NA7A 2FS9A 1EJNA 1HJAC 2OC7A 5AF9H 1KTTB 1SGQE 2BDHA 2W7UA 1SGPE 1C5SA 2PW8H 2PLXA 2VNTA 4Y7BA 1SGFA 3CS7A 1SGEE 3UWIA 4D7FA 1UVOA 1O5AB 2VVUA 1SLVB 2P94A 2ZHQH 3L33A 4GSOA 1IQKA 1ELTA 2FX4A 3A83A 3MI4A 1GBLA 3PMHB 4RSPA 3SGBE 1VITH 1CQQA 1AVWA 1SGYE 3BTEE 7ESTE 3SUEA 4YOJA 1LVMA 4ABFA 1DPOA 2AYWA 2ZHEH 4M7GA 1O31A 1F92A 3PB1E 1YPEH 4K2YA 4KTCA 2GT7A 4YM9A 1HAPH 2W3KA 2QXJA 1MTVA 3MH5A 1TRMA 2YNBA 2Z6BD 4WF8A 3SGQE 4BAKB 2ZI2H 2FS8A 1HBTH 4QT8C 1KXCA 1QURH 1UCYH 3ITIA 2HWLB 5GDSH 3D23A 2W26A 1PYTD 1DWBH 1S83A 1XVMA 4BTIB 1ANDA 1V2JT 2ZECA 1DXWA 2I6QA 4K3JA 1YGCH 2NU3E 4AOQA 1Y5BT 1B5GH 3QDZB 1O2IA 4NWLA 1SC8U 4FUBA 5C67A 4X2YA 1NY22 4IMZA 3SU6A 3RXBA 3VB4A 1JRSA 4AGJA 4K1SA 1S6HA 2ZFSA 4YLUA 1ZJDA 2XC5A 3SZNA 3ZYDA 3STJA 2BQ6B 3P95A 1NU9A 4CRFA 1P2JA 1GMDF 1D6WA 1O34A 1J16A 2J34A 4KP0A 2FEQH 3SBKA 1ELGA 2QAAA 1P01A 5AFZH 2AERH 1G2LA 3TNSA 4BTTB 5EQQA 4MPXA 1D6RA 2Y7ZA 2FI5E 3MNBA 1IOEA 1O2MA 2BY7X 1CA0B 1FPCH 5L6NH 2GKVE 2OUAA 1DM4B 3T62A 3VXFH 1LPGB 2FODA 3RC6A 3H7OA 4UDWH 1AQ7A 3S0NA 3UR9A 1ARBA 2ZDLA 5E8EH 5HYOA 5E2PA 3E1XB 3A89A 3MOCA 2XWBI 1ZMNA 6CHAB 4JCNA 4DIIH 4Y76A 2ZCHP 1TGSZ 5A0BA 1ARCA 2D8WA 3RC4A 1G3BA 5F8ZA 1GDUA 1SHYA 3JZ2B 2G55A 5DP3A 2C4FH 5JBCS 1GJ7B 1Z6JH 3QGJA 1ZMJA 2QYIA 1FN8A 2PKSB 3LU9B 3LIWA 4GVUA 1IQJA 2VH0A 2R2WU 5A2MH 5JBBS 5T6FA 2XBWA 3TJOA 1VCWA 1WUNH 2ZU5A 1YF4A 3U69H 5AVDA 2AIPA 2QF3A 1ELVA 3OYPA 3U98H 4CRDA 1GHXH 1O3GA 1QB9A 3R0FA 4NA9H 1FUJA 2A4RA 4O03A 3K65B 2BDGA 2ZTXA 1QL8A 4K8BA 1FAKH 3RLYH 1ZLRA 1ZYOA 2BOKA 2PV9B 3A8AA 4CH8B 2VVVA 4A1VA 1C9PA 1NT1A 2ZA5A 2BYAX 3RXDA 2AMDA 1ZRKA 4FU8A 1Z8GA 2OBQA 1QJ7B 1P10A 2A7CA 1DWEH 2HRVA 1G9IE 1YPJH 1TNKA 3E0NB 1QTFA 3P6ZB 1O2UA 1M9UA 3VPKA 3LGTA 1C1RA 3PTNA 4A6LA 4D9RA 6GCHF 1HCGA 2BY5X 2FOFA 1BT7A 1BTUA 2A5KA 1TX8A 5EW1H 3UOPA 2DE9A 1ZHMA 2GZ9A 4HGCA 3KQCA 4Q80A 1H9HE 1MTNB 4XBDA 1ELBA 3SJOA 1IQEA 5DO4H 1O0DH 1O36A 4R8TB 1QGFA 1ANEA 1YBWA 2JETC 4NGAH 4NCYA 1P05A 3UQOA 1SFIA 2ZPQA 1RRKA 3RC5A 1K21H 2FOGA 1C1QA 1E37B 5K7RA 1BBRK 2O8TA 1W10U 2H6MA 1RTLA 2SNWA 3S9CA 4AFQA 2ZGBH 3P8OA 3GDUA 8ESTE 1T4UH 4ASHA 1EOJA 1W7GH 1ELEE 1GMCG 2ZTZA 2WPJS 2TIOA 1GI3A 2PKAA 5ETXA 1XXDA 1MQ6A 3P8NA 5JBTA 4OS7A 1EATA 3MWIU 1D3TB 1GHVH 3SNCA 4XE4A 4BTUB 1MBMA 4X0WU 3TJUA 1KXDA 3LH3A 3SU1A 4J2YB 1OYTH 1FY3A 1MUEB 2Q1JA 2XC0A 2PHBA 3BIUH 2ZCLP 4WXIA 1IQFA 5A0AE 1KSNA 4GLYA 1Y8TA 2STBE 1XVOA 1AVGH 2WYGA 3GCHB 2UUKB 1WCZA 1C2MA 2TPIZ 3C27B 3URDA 1BMLA 3KQDA 1O5CB 3ZZ3A 3DHKH 1EX3A 1E34B 7LPRA 1O2PA 1GI7B 2OC0A 1ZTKA 1CT4E 3DT0H 2A5AA 1AO5A 1F5LA 4IC6A 5EXNA 3IWMA 4MPWA 1N6XA 2ZHFH 2FLRH 2GVFA 1G3DA 3ZVFA 1TALA 2H1UA 3BTTE 2SGEE 4ABBA 5ABWA 1GVKB 3O8BA 1NM6A 3U8OH 1K1MA 2LPRA 2OP9A 2EI7A 3SUGA 1LQDB 2TGTA 2BLQA 1ANBA 3ZZAA 3TPIZ 1ESTA 4MTBA 4O97A 2BVXH 2VIWA 3AW0A 3PMAB 4WMDA 3GCOA 2BB4A 1UJ1A 2ZU1A 4LOYH 3ATWA 2Q6FA 3L6PA 1DSTA 2VU8E 1AHTH 1T32A 2P3FH 2GGVB 3RDZA 3I78A 4BANB 1UVPA 3OY5U 1YPKH 2FI4E 3TVJB 4NA8A 1UTKA 4VGCB 3QN7A 3A7VA 1W13U 1ELAA 1A3EH 5C1XA 1CT2E 3CP7A 1OWJA 1BRCE 2HLCA 1O5BB 5T3HA 1MTSA 3RXKA 1JIMA 4AORA 7GCHG 1GI0A 2BQWB 2HNTE 5EODA 1UTLM 2IN2A 4MPVA 3SJIA 5FPYA 1NRNH