3BTME

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (TRYPSIN)
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
total genus 51
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btmE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btmE02
3K6ZA 1EP6A 1GCTB 4MG3A 1QJ7B 2O9QA 5GCHF 3FANA 6LPRA 2WUBA 3B23B 2BY6X 3SW2B 2W3KA 3ZVBA 4AFUA 1SB1H 2A2QH 4YO9A 4ABDA 2ODPA 1PQ8A 3SNAA 2ZHQH 3A83A 1UVUH 4VGCC 1GBBA 1TNKA 2FOBA 3V13A 1THRH 2B5TB 2G5VA 5EPYA 1FZZA 2GD4B 1ANBA 4O97A 1AI8H 1LHFH 2H9TH 1FAXA 1P02A 2FWWA 2GMTC 4Y76A 4AX9H 4GPGA 2ULLA 1AZ8A 3VXFH 2A32A 1BRUP 2P3TB 2WPKS 2J9NA 3S0NA 3TNSA 3NUMA 3PMJA 8ESTE 3ZVDA 1LVBA 2CGAA 3MU5A 2VGCB 2ZHEH 1EUFA 4UD9H 1FIZA 1SQAA 2SNVA 3BTWE 3CS7A 3DT0H 1BMLA 5JBAS 2ESTE 1Q2WA 2AIQA 1DDJA 1HPGA 4DY7B 3MI4A 1IQHA 5T6DA 1RTLA 4AYVB 1KSNA 1DM4B 2VVCA 1KXCA 4I33A 1NU9A 3AAUA 4INHA 2ZI2H 4A6LA 1VJ9U 4U2WA 4UFDH 1O3DA 2G5NA 2V6NA 4X2YA 4YOIA 1IHTH 4CRAA 3SUGA 3GY6A 3LGUA 4MPUA 4Y8ZA 1DFPA 4INLA 3Q3XA 2C90B 2VINA 2ZGCA 2GCTB 2FOGA 1INCA 1O38A 5A8ZA 3NWUA 2FIRH 4K5ZA 2PV9B 4AFZA 1OP2A 4Y0YE 1NRNH 3U9AH 2D2DA 1G36A 3UFAA 3RC6A 1O34A 1ELCA 3LOXA 5L2YH 1ZLRA 3L3TA 2FDAA 3BSQA 1MU6B 2Y5GA 1EZQA 3PLBA 3ZZ9A 1GHVH 4ZXXH 2VJ1A 3ZV8A 1DOJA 1Y5BT 1KIGH 1IQLA 2OD3B 1P11E 3AW0A 2FOFA 2GV7A 1C1SA 1DWDH 4D7FA 1GVKB 4BAMB 1ANDA 2ZCLP 4GUXA 2AEIH 2J4IA 3U98H 5FPTA 4FUFA 3F6UH 1BZXE 1ZSJA 2EEKA 1C5PA 2KAIB 2UUFB 4B2AA 2Z9LA 1O35A 1O2YA 2BVXH 3B9FH 3PMBB 3RXOA 1P09A 3RXHA 1TBZH 4F49A 2NWNA 2Q6DA 2A45B 1HRTH 1P05A 2PW8H 1OWKA 1EASA 3KF2A 4HGCA 1YYY1 1GBAA 2RCEA 5LPRA 3T2NA 1P8VC 1AVXA 4B73A 1QJ6B 4XDEA 1MTVA 1WYKA 1GMDF 1JMOH 8KME2 3KL6A 1MAYA 4XBBA 4OS5A 3UOUA 3HKJB 1SHYA 1ZSKA 2CF9H 2Y81A 1QGFA 3RXQA 3QK1A 4UEHH 2BM2A 1GHAF 1LCYA 3JZ1B 3ZZDA 1WTGH 2AGEX 2GDDA 3BN9A 1SOZA 1HLTH 3A8CA 1GJDB 1SGEE 2GZ9A 1SVPA 3A82A 1IQJA 1CA0C 1C5NH 1GHWH 2O8MA 3BTDE 3LH1A 3E0NB 5AFYH 1GBHA 1LDTT 1OWHA 1QBOA 3GCTF 4FUDA 3TU7H 1G37A 1N8OB 2EI7A 3ZZ7A 2F91A 1QL7A 4YLUA 1GDQA 2H1UA 2P59A 4ZAEA 1LHEH 2SGAA 1O2NA 1GG6B 5A8XA 5DP8A 2LPRA 1D3TB 1JBUH 2B0FA 2ZDKA 1FDPA 4X1PU 3A8AA 1LKAA 1ZJDA 2VVVA 1KDQA 2BTCE 3TK9A 1UK3A 1H8IH 1LO6A 4JZEH 2ZU5A 1OXGA 1SLXB 3LGYA 2P94A 2BD5A 5EGMA 3V0XA 1EATA 2BD8A 1Y3UA 1GMCF 5E2OA 1OPHB 3OTJE 1O2QA 1ELVA 1QA7A 2PFEA 3JZ2B 1XUHA 1T7CA 2C93B 5JB8S 2SNWA 1C4Y2 3DFLA 1O39A 3EA7A 2V3HH 2BXTH 1UO6A 1AWFH 2Y82A 5GXPA 3P70B 4J1YA 1D9IA 3BEUA 3VPKA 1O3PB 5EQQA 3A80A 1O2TA 1O2PA 4X1SU 4ZHLU 2PSXA 1P10A 1Y5UT 4Q80A 1P57B 3QGJA 1Y59T 1O33A 1SL3A 2BD3A 4NSVA 4OGYA 2GGVB 3RXBA 1AWHB 4FUCA 1NU7B 2A31A 2A4OA 1A3EH 1NFUA 1ELBA 2ZU4A 1O3NA 5LH8A 5JB9S 4M7GA 2F9VA 5TCCA 4CHAC 1A0LA 3T26A 1MMJN 1TX6A 2BDBA 1SGRE 1FY5A 1VITG 4I8HA 1AU8A 1HJAB 3BG4B 1P2OA 2H5DA 1O3CA 1BRBE 3FP7E 4O3TA 1ZJKA 3D65E 1GBKA 1OWEA 1HAOH 1GBCA 2GVFA 2FTLE 3ZVAA 3D23A 2XC4A 1Z6EA 2ZFFH 3U8RH 4I8LA 1FI8A 1G2MA 3BEIB 5HGGA 3MOCA 3F9FA 4IC6A 3TH3H 2XWAA 2XTTB 1GCDA 3FP8E 1EOJA 1ZZZA 2FOHA 3NK8A 3VB7A 4KP0A 5JDUB 3PO1C 3SV6A 4I8KA 3SNBA 4XFQA 1Z8GA 4R0IA 1NS3A 2DE8A 2SGQE 2ZPRA 1C5XB 3QUMP 4HTCH 5A0BA 3HK6B 4MNWA 4AGKA 1V2MT 1ARCA 2AERH 2ANKH 3LJOA 1YLDA 2ZO3H 2P3FH 2GV6A 2NU2E 1IQMA 4K1TA 1TRMA 2OC1A 4J2YB 1P04A 2ZQ2A 5LPEA 5E8EH 1D3QB 1OWIA 2ZFPH 2A0QB 2CHAB 3A8DA 3TGKE 1XMNB 2QIQA 5C5OA 1W2KH 2ODQA 2FI4E 1TGBA 4ZMAH 4U32A 3M37A 1GBEA 2AMDA 1A61H 4WXVA 1V2NT 4GVUA 3SV2H 2FEQH 4ISIH 4R8TB 1YBWA 2BLOA 4H4FA 1CBWB 5C1XA 2IN2A 1LHDH 2ZHWH 1TOCB 1U6QA 2ZFSA 3MH7A 1KYNA 3GY7A 4OS6A 4PROA 3SN8A 1Z71A 1A4WH 1HAGE 4GLYA 5HMAA 4B2CA 2JETC 3GCHC 1E37B 3MYWA 1HGTH 1UCYK 4UE7H 1CT4E 4OGXA 3SU5A 4X8VH 1CHOG 2PKAA 4RN6A 3TPIZ 1HAIH 2TRMA 2PTNA 1O5BB 1KLJH 3TLOA 4NZQA 4BAOB 1KLIH 4Q2KA 1V2KT 4K2YA 2ZTYA 1IQEA 1ZMLA 3P8OA 1FJSA 3TK6A 1TABE 4FUGA 4K8BA 2Z6BD 2P93A 3H7OA 1GBIA 2C8XB 4XOJA 3RXMA 2OBQA 3TIUA 1O0DH 4SGAE 4UFGH 1GDNA 2CMYA 2QN5T 3RUOA 1MTNB 1F0TA 2QA9E 1IAUA 2BD4A 3E6PH 2VWNA 1WOFA 1XUKA 3Q00A 2NU1E 1MUEB 1P06A 4E7NA 2G8TA 1YLCA 4ASHA 4IMQA 4LXBH 1KLTA 2VGCC 5AHGH 5BRRE 1FY4A 2ZHFH 4RKJB 2GP9B 2ANMH 4MNXA 1AZZA 1QCPA 4UFEH 1BTXA 6GCHF 1CGIE 5EU8A 1PPBH 3V3MA 4YZUA 4ZKSU 1OP8A 2A7JA 1B7XB 1MQ6A 1EJAA 3PYHA 1C1TA 2C3SA 1P0SH 1ZR0A 4LK4A 2BYAX 5DGJA 1LHGH 2BDYA 5EODA 1LMWB 4NG9H 2OC7A 1TQ7B 2P8OC 3MWIU 1TAWA 3AW1A 3GOVB 4AG1A 1AKSB 1BA8B 2XCNA 3PMHB 2FP7B 1QTFA 4X1NU 4LOYH 3SNEA 3HPTB 1BBRK 3SU1A 2G00A 2BY8X 3UNSA 3MU8A 1O2OA 3SJOA 5DPAA 3E90B 2GZ8A 2ANYA 3RU4T 1NM6A 3TJVA 5C1UA 3W94A 1ELTA 3P92A 4WMEA 3BG8A 4H6TA 3GYMA 2GCHF 5DG6A 2ASUB 4B74A 3UIRA 4ISOA 4X2XA 5GWZA 4KTSA 3SU3A 4BTUB 4UFFH 1ID5H 3M5MA 1XXDA 3A7VA 4YESB 4ZKRU 2AMQA 1TGTA 1A3BH 3GY8A 3ODDA 5GPIB 1DSTA 4CREA 2ZCKP 2OC8A 1DSUA 2Q6FA 3L6PA 3MHWU 1SHHB 1O2LA 1T32A 2ZZUH 1SFIA 3ZZ8A 2H2ZA 1Y5AT 3MH5A 3SV8A 1VGCC 1PPGE 3ZVCA 5H4IB 2J94A 1W11U 1ETTH 4WF8A 1SG8B 3O8DA 1SR5C 1FV9A 3A7WA 1BIOA 1BDAA 2XYAA 3VXEH 1BHXF 1OWDA 1XUFA 1YPMH 1W0YH 2F83A 3ODFA 4KTCA 4CRCA 4WVPE 1F5LA 2QC2A 3HGPA 3A85A 1JXPA 1BOQA 2BD9A 3IITA 4D76A 1EJNA 5E0GA 1MD8A 4O3UA 1E36B 1XM1A 2ZEBA 1CSOE 3GY2A 1O2GH 1O32A 2SGFE 2YOLA 1CE5A 1O2ZA 3LC3A 3UQVA 1O2KA 5K0HA 1N1LA 3RU4E 2RA0A 4A7IB 1PYTC 4ABFA 1EJMA 1JOUB 1C5UA 2CF8H 3UR9A 4TPIZ 1MTSA 1JWTA 1S0QA 2A4QA 2SGPE 3BF6H 1N8OC 2A5KA 1V2TT 2Z3CA 1BMAA 3UTUH 1F5RA 1GI9B 1XUGA 4B71A 1V2JT 3ZZ5A 1UHBB 4ABAA 1S81A 1GG6C 1C5QA 1JRSA 1W13U 3STIA 3UPEA 1TNJA 1GHZA 3NCLA 3SGAE 4WXIA 3SU2A 1NFXA 2H5CA 1A5IA 3QGNB 5T6GA 4A1TA 1BUIA 1WSSH 3E16B 4ZKNU 1C2MA 1GJ6A 1C4U2 1TE0A 4WMDA 1AUTC 1C1UH 1SOTA 1B5GH 1EZUC 1BB0B 1NN6A 1OWJA 1BCUH 1QY6A 1A1RA 1P01A 4ZROA 1ACBE 2FM2A 4ZUHA 3RXKA 6CHAB 2FOCA 1O3OA 1P3EA 1P2KA 4YOJA 2VIQA 3RXRA 3SQEE 4AFQA 2SGDE 2BXUH 4ABBA 1LVMA 1AGJA 2PR3A 4Y10E 5IYTA 2DUCA 2EI6A 1FN8A 1V2ST 5TJXA 3D62A 1ZPZA 1EQ9A 1LVYA 3PROA 1Y3WA 5K7RA 2PKSB 1NRQH 1K28D 1GMHF 3ESTA 2OC0A 1HBTH 1YPLH 1T8OA 2OINA 1O3FA 4GSOA 2G4UA 3SNDA 1SGNE 3SUFA 1DY9A 1OS8A 3QLPH 3VFEA 2ZDVH 2QY0B 4WH8A 5DP9A 5DP3A 1Y3XA 2FOEA 1WUNH 3RC5A 1TA2A 1TPAE 2HLCA 4E05H 3TGJE 1MZAA 2G51A 4KKDA 4X2VA 2ZFQH 1FN6A 2FLBH 2ZU2A 1HJAC 1ELDE 1MAXA 2RA3A 3BG4C 4NSYA 1P9SA 4FVDA 1WV7H 1P9UA 1BITA 3BIVH 5ETXA 1GBLA 1O2VA 4JK6A 3LGVA 1P2NA 4XSKU 3E91A 2BVSH 1Z1JA 2A4GA 5SGAE 2FS9A 4JK5A 1JIMA 4Z6AH 1HAXB 2VH6A 1K22H 2FS8A 2WPMS 2ZQ1A 1UCYH 1T8LA 3RXSA 2A7HA 5GJ4B 1ZMJA 4IGDA 1ABJH 2ZWLH 1X7AC 2G52A 2UUKB 5FBEA 3RXVA 3A84A 1YCPK 3Q3YA 2ZG0H 3P8GA 3SOSA 2A5AA 1O2XA 2M5TA 2WINI 3C27B 3RDZA 1V3XA 4YTAA 1KXFA 3RXFA 4YLQH 1QL8A 1EAUA 2FXRA 3RXTA 1Y3VA 4MQAA 3UY9A 1K1OA 1AD8H 4GAWA 1BTZA 2W3IA 5A0AE 2CHAC 3SU6A 3RMOH 3MH4A 3BTME 2XRCA 3MMGA 1VCWA 2ZU3A 2B7DH 3ZVEA 1C9PA 2BDIA 1RIWB 2IJOB 1SGTA 1WTHD 1WQVH 3EYDA 5GIBA 1Z7KA 3CP7A 2Z9KA 3MU1A 2HGTH 1TYNA 1V2PT 4BAKB 4DW2U 1CBWC 1BTPA 2STBE 3RLYH 2GTBA 3SJKA 3B8JA 2F3CE 3M35A 7GCHG 3TJOA 3MNXA 1IQIA 4BAHB 3SV9A 2GKVE 1P3CA 1O5FH 1MCTA 1MKXK 1GJ9B 1PPHE 1QRXA 5HM2A 2AGGX 1L4ZA 1C1RA 3RXIA 4IC5A 1LPGB 3F1SB 3U8TH 4THNH 4CH8B 1KDQB 1O5EH 5A2MH 1KY9A 3QWCH 1NTPA 5J4SA 2BLWA 1PPZA 1OKXA 3ELAH 2THFB 4BXWA 1XKBC 4IS5A 2ZKSA 2O8LA 3RXUA 1BTUA 1IHSH 1BTYA 5G4BA 1BBRH 2F9UA 1ANCA 2A7CA 2ZHDA 1AIXH 1BTWA 1GI7B 3UREA 1HIAB 1G3DA 4F4OC 1XVOA 4FXGH 3I29A 3NXPA 1C1VH 1AB9B 1DANH 4AFSA 5L2ZH 4ABEA 1C2GA 2XC5A 1O2SA 1AN1E 3A8BA 3MU4A 1H9LB 1MBMA 3EQ0H 1GHYH 3C1KA 6ESTA 2NU4E 4MLFB 3LGIA 4AOQA 1GJBB 2VNTA 1SI5H 2PUXB 3SUEA 4A1XA 2KAIA 4MPXA 2JH0D 1O3MA 1P2JA 3V12A 2TGTA 1TBRH 1W0ZU 5CE1A 2OBOA 2F9OA 7ESTE 1QB9A 1S85A 1QFKH 3MO9A 3ZZ6A 1C2HA 1L1JA 1P2IA 3PWCA 1NRRH 4OS1A 4OS2A 1PQ5A 1MD7A 2H6MA 4CBNA 1SBWA 5C3NA 3BTEE 1CGJE 5FPSA 1AFQB 1OSSA 1HFDA 3EA9A 2BLVA 4CRDA 1QRZA 1Y8TA 1BT7A 1FPCH 3K2UA 3QZQA 1C1NA 1O3AA 3A81A 2QXIA 1TBQH 1MTUA 2HRVA 1UMAH 3HGNA 3VGCC 2PHBA 4WJG2 4VGCB 1KTTB 1D4PB 3EE0B 1S84A 1VITF 2XBWA 2VVUA 2FOAA 4CR9A 3GICB 3SJ9A 3A87A 2HNTC 2V3OH 1L0ZA 2HWLB 1QBVH 1C1WH 5CHAC 1D6RA 2QGRA 1FY8E 3PLKA 4JYVH 1WQSA 3CENA 3BTGE 4LZ4B 1ELEE 3BTFE 3LH3A 1A0HB 1BHXB 3KEEA 4AGJA 1F0RA 8GCHG 1GDUA 1FIWA 3NZIA 1EZXC 2Z9GA 2VIOA 2WV4A 1HJ8A 4BTTB 2OQUA 1F92A 4DCDA 1C1MA 2BOHB 2BLQA 1HUTH 5FBIA 1P2QA 1DICA 5F8ZA 3ZZAA 3ATMA 2XC0A 1ZTJA 2R9PA 4K1EA 2VWLA 1NRPH 1C5MD 3RXGA 2HNTE 3M5OA 3PMAB 2R3UA 1H1BA 1XUIA 3GY4A 4WWYA 2ZF0H 1GBDA 1S6HA 1C5RA 4H42U 1TRNA 3TH4H 1NY22 1V2LT 1PPCE 3HKIB 3RXLA 7KMEH 1AVGH 4UDWH 1TNGA 1F0SA 1G3CA 3R0FA 1O3BA 5A0CA 3SV7A 1AQ7A 1SQOA 4Y11E 2XBVA 2YNAA 4CRBA 2D1JA 5JBCS 2O8UA 2W5EA 1AFEH 2GX4A 2OP9A 2QXJA 2UUJB 3M3VA 5FHTA 1ZMNA 1PPFE 1WU1A 1C2FA 3RMLH 1V2OT 1CHOF 2FX4A 3URCA 5EXNA 3O8RA 2AYWA 1D3DB 2EC9H 2Y6TA 1T31A 1C5SA 1W3CA 4IN1A 2F9BH 1O5DH 1GCTC 2W7SA 1W8BH 1Z8IB 3VB3A 7LPRA 5E0HA 1PPEE 2PLXA 1BQYA 2C8YB 3IWMA 3STJA 4AORA 4NIYA 1TA6A 1C1QA 1RFNA 1XKAC 1ZGVA 2QCYA 1TNIA 2CV3A 4CBOA 5J4QA 1GJ7B 2R2WU 3BTTE 3QDZB 1CVWH 3PTNA 4HI3A 2ILNA 1O30A 1TX7A 3M61U 1QBNA 4ABIA 2GT7A 1K1NA 4A1VA 1YCPH 2H9EH 2PKSC 1SGIB 1CT0E 2BMGB 1DLEA 3S9AA 2Y80A 4DVAU 4GHTA 5JBBS 2PUQH 4U30A 1FLEE 1C2EA 1IQKA 4GCHG 3GISB 3GDSA 4X1QU 3VEQB 1C2LA 1W7XH 5DO4H 1DXWA 2ZGJA 1BJVA 4SGBE 4DIIH 4Y79A 1A2CH 1YP9A 3UOPA 1S82A 1TIOA 4B76A 1C2IA 1QL9A 1TNLA 3U69H 1BRAA 1D6WA 2DE9A 3W95A 4MPVA 4AN7A 2YNBA 4Z0KA 1Q3XA 4FUHA 4RKOB 1KXDA 3GCOA 2WPHS 3A89A 3F68H 1MKXH 1P03A 1TMBH 2ZGBH 5DP7A 2GCTC 1XUJA 3ATLA 1V2UT 2JKHA 1B0EA 3LONA 1O2MA 2Z94A 2W26A 2XXLA 1LVOA 2NU0E 2QF3A 2VB0A 4H6SB 4Y0ZE 4ZHMU 2TGDA 1DE7H 4BANB 4QT8C 3RC4A 3SGBE 3FP6E 5CMXH 1HAVA 3SUDA 3MO3A 5E0JA 3S9CA 2BDAA 1P12E 1VCQA 3V7TA 8LPRA 3BIUH 1J14A 1EPTB 3LPRA 4YOGA 1ETSH 4NFEA 1ZTLA 1BRCE 1QIXB 4ABGA 3T28A 1T4UH 3M5NA 3QTOH 1EB2A 4FUJA 1WAYB 3ENSB 4XE4A 2BDCA 3RXPA 1BMMH 3DHKH 1UTMA 3OU0A 3UWIA 1E35B 1EZSC 1IQFA 1O31A 3FZDA 4JMYA 4KTUA 5HXFA 3OY6U 1PJPA 1RGQA 3R3GB 1ABIH 1SMFE 1V6DA 4ESTE 1NFWA 3ZZ4A 1MTWA 2G55A 3KQCA 4DOQA 2XW9A 3GDVA 3S7KB 1SGQE 3TVJB 1OP0A 1H4WA 1ZOMA 5JYIA 1H9HE 3ZVGA 1SGDE 3NKKA 1UTKA 4K69A 1C1OA 1UTLM 4HFPB 4ZHAA 1AKSA 3QTVH 1C4V2 1J15A 2CXVA 1FY1A 4Y8YA 4K8YA 5DP6A 2HPPH 1OX1A 1P2MA 3GCNA 3IG6B 1C5VA 3S69A 2F9PA 2OTVA 3RU4D 3I77A 3PO1B 3KQDA 1YGCH 3RP2A 3ZYDA 1ELAA 4JZFH 3RXAA 1MH0A 1XVMA 2W7UA 2WV5A 1W12U 4DJZB 5JPMH 2AMPA 2Z9JA 2RG3A 2FO9A 2ZCHP 1UTOA 3RM2H 1V2WT 3GY5A 1EAXA 1FPHH 5FPYA 1NFYA 5C1YA 3RXJA 1RRKA 1GHBG 3T29A 1SLWB 1DS2E 1GGDB 1C1PA 3ZV9A 1C5OH 1GPZA 2QAAA 1O36A 3T62A 2EA3A 3PM3A 1F2SE 1QRWA 1GJ4H 3SBKA 5E2PA 2J92A 4U01A 4ZH8A 2BDHA 1F0UA 3RMMH 1ESAA 1W7GH 4X6OA 1SC8U 1SSXA 3LGWA 1PYTD 1GL0E 1QNJA 3KQEA 1LPZB 2PTCE 1UTNA 2O8TA 4B75A 3S9BA 2ZGHA 3RM0H 3TGIE 2BY7X 1CO7E 4NIWA 5C2ZA 1C2DA 1QURH 4FU7A 2JETB 2A4RA 3ZZCA 1W14U 1TPSA 2JH5D 4WH6A 2V0BA 3Q77A 2FI3E 3FAOA 1PQAA 3E3TA 4UONA 2ZPQA 4Q7XA 2FYQA 4DURA 1LPKB 3QX5H 3AAVA 1TMTH 1F7ZA 5C5NA 1YPJH 1EAWA 1J8AA 3M3TA 1AFQC 2BZAA 2D26C 2P16A 2BD7A 4FU8A 4B1TA 2XNIA 4K3JA 4TYDA 1YF4A 5GCHG 1F5KU 4IN2A 4ISHH 3VB5A 4DG4A 2ZIQH 4X8TH 4MNVA 5EQSA 4MNYA 1DITH 1UTPA 2G81E 2BY5X 1L2EA 2BB4A 1TOMH 2PWXA 3EAJA 5ESBA 4ISNA 2Q6GA 1J17T 3UQOA 3U8OH 1Z8RA 1FNIA 5EW1H 3M7TA 2ZA5A 1UHBA 4MDSA 1K1LA 3LIWA 3SO3A 2ZC9H 2GZ7A 5C20A 1TNHA 4X8UH 1HAZB 1GMHG 5TCAA 1MQ5A 1EKBB 4FU9A 2HPQH 2FLRH 4NA9H 1PFXC 1TWXB 3SU0A 1ZRBA 1T4VH 2AH4X 1SGPE 1BJUA 3A7XA 2BQWB 3KN2A 3A7ZA 5DP5A 4MTBA 4I8JA 1HJ9A 3PB1E 3LT3A 1GI1A 5FX5A 2SGEE 3SJ8A 1QB6A 2ZGXH 1E0FD 1DXPA 1O2UA 1MKWH 4JZ1A 1RXPA 2P8OB 1UVPA 1AUJA 1K1JA 1UVTH 2TIOA 1GBJA 2XBYA 1WBGB 3ATIA 3LGTA 1O3EA 1TALA 1IOEA 3LDXH 3MNSA 5FXLA 3K6YA 2JH6D 5DP4A 1MCVA 1RJXB 1SGFA 3E1XB 1DLKB 4D9QA 1UTJA 2CJIA 3K9XB 1RS0A 1OOKB 1ESBA 4JZDH 5T3HA 1ZYOA 2P3UB 3EGKH 1DPOA 4IBLH 7GCHF 3F9GA 1GWAA 4CH2B 1GJ5H 1C2JA 3TNTA 5LPFA 1NT1A 3TJNA 1A0JA 3KGPA 4NIVA 5L30H 1L1NA 1C5TA 1CQQA 1TB6H 1YPEH 3SHCH 3F9HA 5DKMA 1TGCA 2VH0A 1TRYA 1ESTA 2J2UA 1CU1A 1YM0A 1C2KA 1LHCH 1GJCB 3Q76A 1B0FA 3RXDA 3VB6A 4BOHA 3TITA 3P6ZB 1YPHC 1FMGA 2ZFRH 3UNRA 3EA8A 1MZDA 1VGCB 1HNEE 2HNTF 3P8FA 2AIPA 1GL1A 3UWJH 1DWBH 4I7YH 3DA9B 3UUZA 1OYQA 1THPB 4MVNA 2G4TA 4Y71A 1KTSB 1S6FA 4NWLA 4K1SA 2VIDA 2ZDAH 2C8ZB 3TJUA 1MTNC 2XCFA 4GHQA 2CN0H 2ZTZA 3FFGA 5LGOA 2TGAA 2PGQB 3A7TA 1O2WA 3LC5A 1GVLA 1GMDG 1YPHE 1C5YB 2HOBA 1AVWA 2OUAA 5EPNA 2BY9X 3NPSA 1AHTH 4TPYA 2FTMA 3FVFB 1TMUH 2I6QA 3Q3KA 1GHAG 2BHGA 2ZTXA 2AGIX 3OX7U 2UWOA 1O3IA 2C4FH 4NIXA 2FX6A 1GJ8B 4FUEA 2GDEH 2BDGA 3GCTG 1SGCA 1K2I1 4AYYB 9ESTA 5F6MA 1LKBA 3BTQE 4NA8A 5HYOA 4A92A 4D8NA 1SGYE 1UCYE 2VU8E 3L33A 2NU3E 1QB1A 2BQ7B 3OY5U 1O3JA 2P95A 1FUJA 1SPJA 3DFJA 1GJAB 1GVZA 1PQ7A 2OQ5A 1VR1H 1NROH 2FI5E 1S0RA 1YCPM 2B8OH 3HATH 4ABJA 3MO6A 3RXCA 1YKTA 2Z3EA 2Z7FE 5I46H 1DUAA 1H9IE 3GDUA 4NCYA 2ANWA 2FYRA 4ABHA 5I25A 1C5ZB 1SLUB 1LQDB 3SJIA 4A5TS 1O3HA 5EW2H 1GI8B 4IMZA 1O2IA 1DT2A 1OYTH 3P8NA 1K1IA 4WY3A 4NFFA 2VIVA 4X8SH 1GMCG 3EDXB 1HIAA 1UTQA 4BAQB 4ZXYH 1YPGH 2V35A 1EPTC 4Q7YA 1GBTA 1E34B 1QA0A 3S7HB 1ANEA 1D3PB 1Y3YA 1UK4A 1QHRB 4YM9A 1GI3A 1ZPBA 2GMTB 1BTHH 2J34A 3QN7A 2I6SA 3E0PB 3P95A 8GCHF 1S83A 3T5FH 2LNCA 2BD2A 3VB4A 4JYTA 3M36A 2WPLS 2QV1A 3H5CB 3BTKE 1AE8H 3O8CA 4NGAH 1CGHA 1UVOA 2OXSA 1AE5A 1TPOA 1VITH 3GY3A 3KHVA 4AG2A 3MNBA 1WCZA 2R0KA 4HZHA 3DUXH 2A2XH 3KCGH 5EXMA 1ZHRA 2BZ6H 4X6PA 3SGQE 2A5IA 2BX4A 1FONA 1KXAA 1ZRKA 5JBTA 1YPKH 4X2WA 4DGJA 4CR5A 4I32A 5FCRA 3URDA 1ZSLA 5EQRA 1EB1H 1VJAU 1UK2A 3MH6A 2J38A 1GI4A 4Y8XA 4OS7A 1XX9A 3CS0A 1MBQA 1FY3A 1SGFG 3TK5A 1NRSH 2WUCA 4O03A 1FAKH 2PKAB 5AF9H 2R3YA 5HM9A 4OS4A 2UUYA 1BBRE 3M7QA 3KQBA 5GDSH 1ZHPA 1IQGA 3SI4H 1UJ1A 3ATWA 5AVDA 2Y5FA 3AASA 1HYLA 1V2RT 3A88A 5L6NH 3ITIA 4TWWA 4JYUH 1ELFA 2QF0A 3F9EA 4X6MA 3PLPA 4CRFA 5T6FA 2IOTA 3A86A 3MNCA 1DVAH 2ZDMA 2RDLA 1GGDC 3T27A 4FUBA 1NPMA 1N6YA 3ZVFA 1HB0B 2VWMA 1K21H 1O5GH 3PTBA 3ZYEA 1T8MA 4AZ2B 1K1PA 5A8YA 1AMHA 2VIWA 5EG4A 1L4DA 1DUEA 1K9OE 1RD3B 1O3GA 1ZHMA 1RTFB 1G32B 4TY6A 3GYLB 4DT7B 1BMNH 1MKWK 2UWPA 1Q31A 6CHAC 4NZLA 1UVSH 1A7SA 2GT8A 1DY8A 2B9LA 3MFJA 3G01A 4K60A 3SZNA 1VCPA 4FVBA 3E8LA 1NO9H 1Z6JH 4Q7ZA 2Z3DA 3ZZ3A 1DWEH 1EXFA 1SFQB 4LZ1H 4Y7BA 3M5LA 4BNRA 1A5HA 2QYIA 3LKWA 3FZZA 2AS9A 1ZTKA 2R0LA 5F8TA 1MU8B 3RLWH 3U1IB 1ORFA 4D9RA 3BV9B 3PWBA 1TQ0B 4GCHF 2FPZA 2BOKA 3PV4A 3KNXA 2ALPA 3M7UA 1GI6A 4Y7AA 3RXEA 2H9HA 2Y5HA 2HALA 3MTYA 4X0WU 1HAVB 1GHXH 1CA0B 4NA7A 1DWCH 2QXHA 4BXSA 2C8WB 1NC6A 1ETRH 2A1DB 4NWKA 5EXLA 3U1JB 4TWYA 2WPJS 1O3KA 1G3BA 1GI0A 3SNCA 1Z1IA 4ZKOU 2Y7XA 5A09A 1TGNA 5ABWA 1NZQH 1A46H 3ZZBA 1O2HA 4X6NA 5IDKA 1O3LA 2UWLA 4WMFA 4AB8A 3M3SA 2STAE 1DX5M 1T8NA 2ZECA 2K1QA 3T25A 2VIPA 1O5CB 2VWOA 3SORA 1C5WB 2EI8A 3P17H 2OCVB 4CRGA 1GBFA 1H8DH 1HCGA 2O8WA 5FAHA 3LJJA 2ODYB 2R2MB 2Q1JA 1THSH 3I78A 6GCHG 3D49H 9LPRA 3A7YA 1ZPCA 5F03A 5B6OA 5DK1A 2ZU1A 4I31A 4I8GA 3BTHE 5ESTE 3TH2H 5DJ7A 1HXFH 4DIHH 1HAYB 1EOLA 1GBMA 4TY7A 2ZNKH 2XWBI 3HK3B 3RMNH 1O5AB 3MU0A 1QJ1B 1XXFA 4IW4E 3K65B 1HXEH 4XBDA 1G2LA 2ZDNA 1TLDA 3SI3H 2ZPSA 4O9VA 5CHAB 1RIWC 2TBSA 1QQ4A 1YC0A 1W10U 1L1GA 4E06H 2ZDLA 2OLGA 3VGCB 2IPHA 1IQNA 1VZQH 1ARBA 4JCNA 1CHGA 4RSPA 1HV7A 4D7GA 4E7RG 4JZIA 2Z9IA 1JRTA 2GCHG 1TX8A 3UR6A 4CHAB 3OYPA 2FOMB 2AFQB 2XBXA 3UNQA 1TONA 1GI2A 1M9UA 1G3EA 1G30B 2HVXA 1N6XA 1O2JA 1GI5A 1Z8JB 2BQ6B 1C9TA 3QZRA 2TPIZ 1SLVB 4KELA 4Y6DA 1V2VT 1CT2E 2WYGA 3N7OA 1JIRA 1CA8B 5C67A 4MPWA 1G9IE 1ELGA 1O37A 2WPIS 1TGSZ 5FX6A 2BX3A 1EX3A 1TFXA 3SHAH 2QXGA 1O2RA 3ATKA 4INKA 4AB9A 1SQTA 3KIDU 1LTOA 2WYJA 2PSYA 1J16A 3H7TA 2FODA 1ZGIA 1E38B 1TPPA 3O8BA 4X1RU 1EPTA 1GHBF 2FMJA 1AB9C 2ALVA 1RTKA 3LU9B 2SFAA 4YT7H 3SQHE 1AO5A 3AVZA 1HAPH 1QQUA 2D8WA 3QO6A 1EAIA 1EP5A 2FESH 2ZFTA 1HDTH 4ISLA 3OSYA 1FQ3A 2ZP0H 1KXBA 2Y7ZA 4XBCA 3DD2H 1V2QT 2BVRH 4B2BA 4FUIA 1FXYA 1J9CH 5EOKA 3SU4A 1AY6H 5AFZH 5FCKA 4BTIB 2F9NA 1C5LH 1QR3E 2TGPZ 5PTPA 2FZZA 3BEFB 2PGBB 1NESE 2J95A 4KGAA 5BPEA 1A5GH 3WY8A 1K1MA 4YT6H 5F8XA 1HAHH 3GCHB 1LQEA 1KXEA 1S5SA
chains in the Genus database with same CATH superfamily
3K6ZA 1EP6A 1GCTB 4MG3A 1QJ7B 2O9QA 5GCHF 3FANA 6LPRA 2WUBA 3B23B 2BY6X 3SW2B 2W3KA 3ZVBA 4AFUA 1SB1H 2A2QH 4YO9A 4ABDA 1K0HA 2ODPA 1PQ8A 3SNAA 2ZHQH 3A83A 1UVUH 4VGCC 1GBBA 1TNKA 2FOBA 3V13A 1SQRA 1THRH 2B5TB 2G5VA 5EPYA 1FZZA 2GD4B 1ANBA 4O97A 1AI8H 1LHFH 2H9TH 1FAXA 1P02A 2FWWA 2GMTC 4Y76A 4AX9H 4GPGA 2ULLA 1AZ8A 3VXFH 2A32A 1BRUP 2P3TB 2WPKS 2J9NA 3S0NA 3TNSA 3NUMA 3PMJA 8ESTE 3ZVDA 1LVBA 2CGAA 3MU5A 2VGCB 2ZHEH 1EUFA 4UD9H 1FIZA 1SQAA 2SNVA 3BTWE 3CS7A 3DT0H 1BMLA 3WWBA 2ESTE 5IK2D 1Q2WA 2AIQA 1DDJA 1HPGA 4DY7B 3MI4A 1IQHA 5C0TA 2K8IA 5T6DA 1RTLA 4AYVB 1KSNA 1DM4B 4ACBA 2VVCA 1KXCA 4I33A 1NU9A 3AAUA 4INHA 2ZI2H 4A6LA 1VJ9U 4U2WA 4UFDH 1O3DA 2G5NA 2V6NA 4X2YA 4YOIA 1IHTH 4CRAA 3SUGA 3GY6A 3LGUA 4MPUA 4Y8ZA 1DFPA 4INLA 3Q3XA 2C90B 2VINA 2ZGCA 2GCTB 2FOGA 1INCA 1O38A 5A8ZA 3NWUA 2FIRH 4K5ZA 5EJLA 2PV9B 4AFZA 1OP2A 4Y0YE 1NRNH 3U9AH 2D2DA 1G36A 3UFAA 3RC6A 1O34A 1ELCA 3LOXA 5L2YH 1ZLRA 3L3TA 2FDAA 3BSQA 1MU6B 2Y5GA 1EZQA 3PLBA 5EJ1A 3ZZ9A 1GHVH 4ZXXH 2VJ1A 3ZV8A 1DOJA 1Y5BT 1KIGH 1IQLA 2OD3B 1P11E 3AW0A 2FOFA 2GV7A 1C1SA 1DWDH 4D7FA 1GVKB 4BAMB 1ANDA 2ZCLP 4GUXA 2AEIH 2J4IA 3U98H 5FPTA 4FUFA 3F6UH 1BZXE 1ZSJA 2JJ1D 2EEKA 1C5PA 2KAIB 2UUFB 4B2AA 2Z9LA 1O35A 1O2YA 2BVXH 3B9FH 3PMBB 3RXOA 1P09A 3RXHA 1TBZH 2KM0A 4F49A 2NWNA 2Q6DA 2A45B 1HRTH 1P05A 2PW8H 1OWKA 1EASA 2WV9A 3KF2A 1YYY1 4HGCA 1GBAA 2RCEA 5LPRA 3T2NA 1P8VC 1AVXA 4B73A 1QJ6B 4XDEA 1MTVA 1WYKA 1GMDF 1JMOH 8KME2 3KL6A 1MAYA 4XBBA 4OS5A 3UOUA 3HKJB 1SHYA 1ZSKA 2CF9H 2Y81A 1QGFA 2KFWA 3RXQA 3QK1A 4UEHH 1COWD 2BM2A 1GHAF 1LCYA 5JBAS 3JZ1B 3ZZDA 1WTGH 2AGEX 2GDDA 3BN9A 1SOZA 1HLTH 3A8CA 1GJDB 1SGEE 2GZ9A 1SVPA 3A82A 1IQJA 1CA0C 1C5NH 1GHWH 2O8MA 3BTDE 3LH1A 3E0NB 5AFYH 1GBHA 1LDTT 1OWHA 1QBOA 3GCTF 4FUDA 3TU7H 1G37A 1N8OB 2EI7A 3ZZ7A 2F91A 1QL7A 4YLUA 1GDQA 2H1UA 2P59A 4ZAEA 1LHEH 2SGAA 1O2NA 1GG6B 5A8XA 5DP8A 2LPRA 1D3TB 1JBUH 2B0FA 4F48B 2ZDKA 1FDPA 4X1PU 3A8AA 1LKAA 1ZJDA 2VVVA 1KDQA 2BTCE 3TK9A 1UK3A 1H8IH 1LO6A 4JZEH 2ZU5A 1OXGA 1SLXB 3LGYA 2P94A 2BD5A 5EGMA 3V0XA 1EATA 2BD8A 1Y3UA 1GMCF 5E2OA 1OPHB 3OTJE 1O2QA 1ELVA 1QA7A 2PFEA 3JZ2B 1XUHA 1T7CA 2C93B 5JB8S 2SNWA 1C4Y2 3DFLA 1O39A 3EA7A 2V3HH 5HIZA 2BXTH 1UO6A 1AWFH 2Y82A 2J98B 5GXPA 3P70B 4J1YA 1D9IA 3BEUA 3VPKA 1O3PB 5EQQA 3A80A 1O2TA 1O2PA 4X1SU 4ZHLU 2PSXA 1P10A 1Y5UT 4Q80A 1P57B 3F0OA 3QGJA 1Y59T 1O33A 1SL3A 2BD3A 4NSVA 4OGYA 2GGVB 3RXBA 1AWHB 4FUCA 1NU7B 2A31A 2A4OA 1A3EH 4ASUD 1NFUA 1ELBA 2ZU4A 1O3NA 5LH8A 5JB9S 1W0JD 4M7GA 2F9VA 5TCCA 2YMSD 1A0LA 4CHAC 3T26A 1MMJN 1TX6A 2BDBA 1SGRE 1FY5A 1VITG 4I8HA 1AU8A 1HJAB 1VKYA 3BG4B 1P2OA 2H5DA 1O3CA 2KCPA 1BRBE 3FP7E 4O3TA 1ZJKA 3D65E 1GBKA 1OWEA 1HAOH 1GBCA 2GVFA 2FTLE 1E79D 3ZVAA 3D23A 2XC4A 1Z6EA 2ZFFH 3U8RH 4I8LA 2RDEA 1FI8A 1G2MA 3BEIB 5HGGA 3MOCA 3F9FA 4IC6A 3TH3H 2XWAA 2XTTB 1GCDA 3FP8E 1EOJA 1ZZZA 2FOHA 3NK8A 3VB7A 4KP0A 5JDUB 3PO1C 3SV6A 4I8KA 3SNBA 4XFQA 1Z8GA 4R0IA 1NS3A 2DE8A 2SGQE 2ZPRA 1C5XB 3QUMP 4HTCH 5A0BA 3HK6B 4MNWA 4AGKA 1V2MT 1ARCA 2AERH 2ANKH 3LJOA 1YLDA 2ZO3H 2P3FH 2GV6A 2NU2E 1IQMA 4K1TA 1TRMA 2OC1A 4J2YB 1P04A 2ZQ2A 5LPEA 5E8EH 1D3QB 1OWIA 2ZFPH 3FOAA 2A0QB 2CHAB 3A8DA 5HIYA 3TGKE 1XMNB 2QIQA 5C5OA 5C94A 1W2KH 2ODQA 2FI4E 1TGBA 4ZMAH 4U32A 3M37A 1GBEA 2AMDA 1A61H 4WXVA 1V2NT 4GVUA 3SV2H 2FEQH 4ISIH 4R8TB 1YBWA 2BLOA 4H4FA 1CBWB 5C1XA 2IN2A 4TSFD 1LHDH 3SYJA 2ZHWH 1TOCB 1U6QA 2ZFSA 3MH7A 1KYNA 3GY7A 4OS6A 4PROA 3SN8A 1Z71A 1A4WH 1HAGE 4GLYA 2RFKC 5HMAA 4B2CA 2JETC 3GCHC 1E37B 3MYWA 1HGTH 1UCYK 4UE7H 1CT4E 4M9FA 4OGXA 3SU5A 4X8VH 1CHOG 2PKAA 4RN6A 3TPIZ 1HAIH 2TRMA 2PTNA 1O5BB 1KLJH 3KYGA 3TLOA 4NZQA 4BAOB 3N7EA 1KLIH 4Q2KA 1V2KT 4K2YA 2ZTYA 1IQEA 2OK5A 1ZMLA 3P8OA 1FJSA 3TK6A 1TABE 4FUGA 4K8BA 2Z6BD 2P93A 3H7OA 1GBIA 2C8XB 4XOJA 3RXMA 2OBQA 3TIUA 1O0DH 4SGAE 4UFGH 1GDNA 2CMYA 2QN5T 3RUOA 1MTNB 1F0TA 2QA9E 4Z1MD 3KYFA 1IAUA 2BD4A 3E6PH 2VWNA 1WOFA 1XUKA 3Q00A 2NU1E 1MUEB 1P06A 4E7NA 2G8TA 1YLCA 3DSOA 4ASHA 4IMQA 4LXBH 1KLTA 2VGCC 5AHGH 5BRRE 1FY4A 2ZHFH 4RKJB 2GP9B 2ANMH 1W0KD 4MNXA 1AZZA 1QCPA 4UFEH 1BTXA 6GCHF 1CGIE 5EU8A 1PPBH 4F55A 3V3MA 4YZUA 4ZKSU 1OP8A 2A7JA 1B7XB 1MQ6A 1EJAA 3PYHA 1C1TA 2C3SA 1P0SH 1ZR0A 4LK4A 2BYAX 5DGJA 1LHGH 2BDYA 4FOUC 5EODA 1LMWB 4NG9H 5CDFE 2OC7A 1TQ7B 2P8OC 3MWIU 1TAWA 3AW1A 3GOVB 4AG1A 1AKSB 1BA8B 2XCNA 3PMHB 1NBME 2FP7B 1QTFA 4X1NU 2JDID 4LOYH 3HPTB 3SNEA 1BBRK 3SU1A 2G00A 2BY8X 3UNSA 3MU8A 1O2OA 3SJOA 5DPAA 3E90B 2GZ8A 2ANYA 5CHBA 3RU4T 1NM6A 3TJVA 5C1UA 3W94A 1ELTA 3P92A 4WMEA 3BG8A 4H6TA 3GYMA 4RT1A 2GCHF 5DG6A 2YMSB 2ASUB 4B74A 3UIRA 4ISOA 4X2XA 5GWZA 4KTSA 3SU3A 4BTUB 4UFFH 1ID5H 3M5MA 1XXDA 3A7VA 4YESB 4ZKRU 2AMQA 1TGTA 1A3BH 3GY8A 3ODDA 5GPIB 1DSTA 4CREA 2ZCKP 2OC8A 1DSUA 2Q6FA 3L6PA 3MHWU 1SHHB 1O2LA 1T32A 2ZZUH 1SFIA 3ZZ8A 2H2ZA 1Y5AT 3F2GA 3MH5A 3SV8A 1E1QD 1VGCC 1PPGE 3ZVCA 5H4IB 1KMHB 2J94A 1W11U 1ETTH 4WF8A 5DN6D 3OAAD 1SG8B 3O8DA 1SR5C 1FV9A 1YWUA 1BIOA 3A7WA 1BDAA 2XYAA 3VXEH 1BHXF 1OWDA 1XUFA 1YPMH 1W0YH 2F83A 3ODFA 4KTCA 4CRCA 4WVPE 1F5LA 2QC2A 3HGPA 3A85A 1JXPA 1BOQA 2BD9A 3IITA 4D76A 1EJNA 5E0GA 1MD8A 4O3UA 1E36B 1XM1A 2ZEBA 1CSOE 3GY2A 1O2GH 1O32A 2SGFE 2YOLA 1CE5A 1O2ZA 3LC3A 3UQVA 1O2KA 5K0HA 1N1LA 3RU4E 2RA0A 4A7IB 1PYTC 4ABFA 1EJMA 1JOUB 1C5UA 2CF8H 3UR9A 4TPIZ 1MTSA 1JWTA 1S0QA 2A4QA 2SGPE 3BF6H 1N8OC 2A5KA 1V2TT 2Z3CA 1BMAA 3UTUH 1F5RA 1GI9B 1XUGA 4B71A 1V2JT 3ZZ5A 1UHBB 3FN8A 4ABAA 1S81A 1GG6C 1C5QA 1JRSA 1W13U 3STIA 3UPEA 1TNJA 1GHZA 3NCLA 3SGAE 4WXIA 3SU2A 1NFXA 2H5CA 1A5IA 3QGNB 5T6GA 4A1TA 1BUIA 1WSSH 3E16B 4ZKNU 1C2MA 1GJ6A 1C4U2 1TE0A 3PV5A 4WMDA 1AUTC 2KCYA 1C1UH 1SOTA 1B5GH 1EZUC 1BB0B 1NN6A 1OWJA 1BCUH 1QY6A 1A1RA 1P01A 4ZROA 1ACBE 2FM2A 4ZUHA 3RXKA 6CHAB 2FOCA 1O3OA 1P3EA 1P2KA 4YOJA 2VIQA 3RXRA 3SQEE 4AFQA 2SGDE 2BXUH 4ABBA 1LVMA 1AGJA 2PR3A 4Y10E 5IYTA 2DUCA 2EI6A 1FN8A 1V2ST 5TJXA 3D62A 1ZPZA 1EQ9A 1LVYA 3PROA 1Y3WA 2V7QD 5K7RA 1NRQH 2PKSB 1K28D 1GMHF 3ESTA 2OC0A 1HBTH 1YPLH 1T8OA 2OINA 1O3FA 4GSOA 2G4UA 3SNDA 1SGNE 3SUFA 1DY9A 1OS8A 3QLPH 3VFEA 2ZDVH 2QY0B 4WH8A 5DP9A 5DP3A 1Y3XA 2FOEA 1WUNH 3RC5A 1TA2A 1TPAE 2HLCA 4E05H 3TGJE 1MZAA 2G51A 4KKDA 4X2VA 2ZFQH 1FN6A 2FLBH 2ZU2A 1HJAC 1ELDE 1MAXA 2RA3A 3BG4C 4NSYA 1P9SA 4FVDA 1WV7H 1P9UA 3F3BA 1BITA 3BIVH 5ETXA 1GBLA 1O2VA 4JK6A 3LGVA 1P2NA 4XSKU 3E91A 2BVSH 1Z1JA 2A4GA 5SGAE 2FS9A 4JK5A 1JIMA 4Z6AH 1HAXB 2VH6A 1K22H 2FS8A 2WPMS 2ZQ1A 1UCYH 1T8LA 3RXSA 3GS9A 2A7HA 5GJ4B 1ZMJA 4IGDA 1ABJH 2ZWLH 1X7AC 2G52A 2UUKB 5FBEA 3RXVA 3A84A 1YCPK 3Q3YA 2ZG0H 3P8GA 3SOSA 2A5AA 1O2XA 2M5TA 2WINI 3OE7D 3C27B 3RDZA 1V3XA 4YTAA 1KXFA 3RXFA 4YLQH 1QL8A 1EAUA 2FXRA 3RXTA 1Y3VA 4MQAA 3UY9A 1K1OA 1AD8H 4GAWA 1BTZA 2W3IA 5A0AE 2CHAC 4Q63A 3SU6A 3RMOH 3MH4A 3BTME 2XRCA 3MMGA 1VCWA 2ZU3A 2L6OA 2B7DH 3ZVEA 1C9PA 2LELA 2BDIA 1RIWB 2IJOB 1SGTA 1WTHD 1WQVH 3EYDA 5GIBA 3F0PA 1Z7KA 3CP7A 2Z9KA 3MU1A 2HGTH 1TYNA 1V2PT 4BAKB 4DW2U 1CBWC 1BTPA 2STBE 3RLYH 2GTBA 3SJKA 3B8JA 2F3CE 3M35A 7GCHG 3TJOA 1YY3A 3MNXA 1IQIA 4BAHB 3SV9A 2GKVE 1P3CA 1O5FH 1MCTA 1MKXK 1GJ9B 1PPHE 1QRXA 5HM2A 2AGGX 1L4ZA 1C1RA 3RXIA 4YXWD 4IC5A 1LPGB 3F1SB 3U8TH 4THNH 4CH8B 2F4LA 1KDQB 1O5EH 5A2MH 1KY9A 3QWCH 1NTPA 3SZEA 5J4SA 2BLWA 1PPZA 1OKXA 3ELAH 2THFB 4BXWA 1XKBC 4IS5A 2ZKSA 2O8LA 3RXUA 1BTUA 1IHSH 1BTYA 5G4BA 1BBRH 2F9UA 1ANCA 2A7CA 2ZHDA 1AIXH 1BTWA 1GI7B 3UREA 1HIAB 1G3DA 4F4OC 1XVOA 4FXGH 4I86A 3I29A 3NXPA 1C1VH 1AB9B 1DANH 4AFSA 5L2ZH 4ABEA 1C2GA 2XC5A 1O2SA 1AN1E 3A8BA 3MU4A 1H9LB 1MBMA 3EQ0H 1GHYH 3C1KA 6ESTA 2NU4E 4MLFB 3LGIA 4AOQA 1GJBB 2VNTA 1SI5H 2PUXB 3SUEA 4A1XA 2KAIA 4MPXA 2JH0D 1O3MA 1P2JA 3V12A 2TGTA 1TBRH 1W0ZU 5CE1A 2OBOA 2F9OA 7ESTE 1QB9A 1S85A 1QFKH 3MO9A 3ZZ6A 1C2HA 1L1JA 1P2IA 3PWCA 1NRRH 4OS1A 4OS2A 1PQ5A 1MD7A 2H6MA 4CBNA 1SBWA 5C3NA 3BTEE 1CGJE 5FPSA 1AFQB 1OSSA 1HFDA 3EA9A 2BLVA 2CK3D 1QRZA 4CRDA 1Y8TA 1BT7A 1FPCH 3K2UA 3QZQA 1C1NA 1O3AA 3A81A 2QXIA 1TBQH 1MTUA 2HRVA 1UMAH 3HGNA 3VGCC 2PHBA 4WJG2 4VGCB 1KTTB 1D4PB 3EE0B 1S84A 1VITF 2XBWA 2VVUA 2FOAA 4CR9A 3GICB 3SJ9A 3A87A 2HNTC 2V3OH 1L0ZA 2HWLB 1QBVH 1C1WH 5CHAC 1D6RA 1E1RD 2QGRA 2XOKD 1FY8E 3PLKA 4JYVH 1WQSA 3CENA 3BTGE 4LZ4B 1ELEE 3BTFE 3LH3A 1A0HB 1BHXB 3KEEA 4AGJA 1F0RA 8GCHG 1GDUA 1FIWA 3NZIA 1EZXC 5HKKD 2Z9GA 2VIOA 2WV4A 1HJ8A 4BTTB 2OQUA 1F92A 4DCDA 1C1MA 2BOHB 2BLQA 1HUTH 5FBIA 2KZ4A 1P2QA 1DICA 5F8ZA 3ZZAA 3ATMA 1MABB 2XC0A 1ZTJA 3OFND 2R9PA 4K1EA 2VWLA 1NRPH 1C5MD 3RXGA 2HNTE 3M5OA 3PMAB 2R3UA 1H1BA 1XUIA 2J98A 3GY4A 4WWYA 2ZF0H 1GBDA 1S6HA 1C5RA 4H42U 1TRNA 3TH4H 1NY22 3EE7A 1V2LT 1PPCE 3HKIB 3RXLA 7KMEH 1AVGH 2KX4A 4UDWH 1TNGA 1F0SA 1G3CA 3R0FA 1O3BA 5A0CA 3SV7A 1AQ7A 1UW7A 1SQOA 4Y11E 2XBVA 2YNAA 4CRBA 2D1JA 5KGOA 5JBCS 2O8UA 2W5EA 1AFEH 2GX4A 2OP9A 2QXJA 2UUJB 3M3VA 5FHTA 1ZMNA 1PPFE 1WU1A 1C2FA 3RMLH 1V2OT 1CHOF 2FX4A 3URCA 5EXNA 3O8RA 2AYWA 1D3DB 2EC9H 2Y6TA 1T31A 1C5SA 1W3CA 4IN1A 2F9BH 1O5DH 1GCTC 2W7SA 1W8BH 1Z8IB 3VB3A 7LPRA 5E0HA 1PPEE 2PLXA 1BQYA 2C8YB 3IWMA 3STJA 4AORA 4NIYA 1TA6A 1C1QA 1RFNA 1XKAC 1ZGVA 2QCYA 1TNIA 2CV3A 4CBOA 3FO8D 5J4QA 1GJ7B 2R2WU 3BTTE 3QDZB 1CVWH 3FKSD 3PTNA 4HI3A 2ILNA 1SKYE 1O30A 1TX7A 2W6JD 3M61U 1QBNA 4ABIA 2GT7A 1K1NA 4A1VA 1YCPH 2H9EH 2PKSC 1SGIB 1CT0E 5GNDA 2BMGB 1DLEA 3S9AA 2Y80A 4DVAU 4GHTA 5JBBS 2PUQH 4U30A 3VG8A 1FLEE 1C2EA 5EJZA 1IQKA 4GCHG 3GISB 3GDSA 4X1QU 3VEQB 1C2LA 1W7XH 5DO4H 1DXWA 2ZGJA 1BJVA 4SGBE 4DIIH 1S6LA 4Y79A 1A2CH 1YP9A 3UOPA 1S82A 1TIOA 4B76A 1C2IA 1QL9A 1TNLA 4XD7D 3U69H 1BRAA 1D6WA 2DE9A 2KCOA 3W95A 4MPVA 1YLNA 4AN7A 2YNBA 4Z0KA 1Q3XA 1EFRD 4FUHA 4RKOB 1KXDA 3GCOA 2WPHS 3A89A 3F68H 1NBMD 1MKXH 1P03A 1TMBH 2ZGBH 5DP7A 2GCTC 1XUJA 3ATLA 1V2UT 2JKHA 1B0EA 3LONA 1O2MA 2QE7D 2Z94A 2W26A 2XXLA 1LVOA 2NU0E 2QF3A 2VB0A 4H6SB 4Y0ZE 4ZHMU 2TGDA 1DE7H 4BANB 4QT8C 3RC4A 3SGBE 3FP6E 5CMXH 1HAVA 2K0QA 3SUDA 3MO3A 5E0JA 3S9CA 2BDAA 1P12E 1VCQA 3V7TA 8LPRA 3BIUH 1J14A 1EPTB 3LPRA 4YOGA 1ETSH 4NFEA 1ZTLA 1BRCE 1QIXB 4ABGA 3T28A 1T4UH 3M5NA 3QTOH 1EB2A 4FUJA 1WAYB 3ENSB 4OM9A 4XE4A 2BDCA 5C0UA 2AHME 3RXPA 1BMMH 3DHKH 1UTMA 3OU0A 3UWIA 1E35B 1EZSC 1IQFA 1O31A 3FZDA 4JMYA 4KTUA 5HXFA 3OY6U 1PJPA 1RGQA 3PRDA 3R3GB 1ABIH 1SMFE 1V6DA 4ESTE 1NFWA 3ZZ4A 1MTWA 2G55A 3KQCA 4DOQA 2XW9A 3GDVA 3S7KB 1SGQE 3TVJB 1OP0A 1H4WA 1ZOMA 5JYIA 1H9HE 3ZVGA 1SGDE 1OHHD 3NKKA 1UTKA 4K69A 1C1OA 1UTLM 4HFPB 4ZHAA 1AKSA 3QTVH 1C4V2 1J15A 2CXVA 1FY1A 4P02A 4Y8YA 3OEHD 4K8YA 5DP6A 2HPPH 3N99A 1OX1A 1P2MA 3GCNA 3IG6B 1H8ED 1C5VA 3S69A 2KCAA 2F9PA 2OTVA 3RU4D 3I77A 3PO1B 3KQDA 1YGCH 3RP2A 3ZYDA 1ELAA 4JZFH 3RXAA 1MH0A 1XVMA 2W7UA 2WV5A 1W12U 4DJZB 5JPMH 2AMPA 2Z9JA 2RG3A 2FO9A 2ZCHP 1UTOA 3RM2H 1V2WT 3GY5A 1EAXA 1FPHH 5FPYA 1NFYA 5C1YA 3RXJA 1RRKA 1GHBG 3T29A 1SLWB 1DS2E 1GGDB 1C1PA 3ZV9A 1C5OH 1GPZA 2QAAA 1O36A 3T62A 2EA3A 3PM3A 1F2SE 1QRWA 1GJ4H 3SBKA 5E2PA 2J92A 4U01A 5DSFA 4ZH8A 2BDHA 1F0UA 4DT4A 3RMMH 1ESAA 1W7GH 4X6OA 1SC8U 1SSXA 3LGWA 1PYTD 1GL0E 1QNJA 3KQEA 1LPZB 2PTCE 1UTNA 2O8TA 4B75A 3S9BA 2ZGHA 3RM0H 3TGIE 2BY7X 1CO7E 4NIWA 5C2ZA 1C2DA 1QURH 4FU7A 2JETB 2A4RA 3ZZCA 1W14U 1TPSA 2JH5D 4WH6A 2V0BA 3Q77A 2FI3E 3FAOA 1PQAA 3E3TA 4UONA 2ZPQA 4Q7XA 2FYQA 4DURA 1LPKB 3QX5H 3AAVA 1TMTH 1F7ZA 5C5NA 1YPJH 1EAWA 1J8AA 3M3TA 1AFQC 2BZAA 2D26C 2P16A 2BD7A 4FU8A 4B1TA 2XNIA 4K3JA 4TYDA 1YF4A 5GCHG 1F5KU 4IN2A 4ISHH 3VB5A 2IJD1 4DG4A 2ZIQH 4X8TH 4MNVA 5EQSA 3OTPA 1DITH 1UTPA 4MNYA 3CNRA 2G81E 2BY5X 1L2EA 2BB4A 1TOMH 2PWXA 3EAJA 5ESBA 4ISNA 2Q6GA 1J17T 3UQOA 3U8OH 1Z8RA 1FNIA 2EQNA 5EW1H 3M7TA 2ZA5A 1UHBA 4MDSA 1K1LA 3PV2A 3LIWA 3SO3A 2ZC9H 2GZ7A 5C20A 1TNHA 4X8UH 1HAZB 1FX0B 1GMHG 5TCAA 1MQ5A 1EKBB 3ZIAD 4FU9A 2HPQH 2FLRH 4NA9H 1PFXC 1TWXB 3SU0A 1ZRBA 2EY4C 1T4VH 2AH4X 1SGPE 1BJUA 3A7XA 2BQWB 3KN2A 3A7ZA 5DP5A 4MTBA 3W1EA 4I8JA 3H09A 1HJ9A 3PB1E 3UAIC 3LT3A 1GI1A 5FX5A 2SGEE 3SJ8A 1QB6A 2ZGXH 1E0FD 1WDIA 1DXPA 1O2UA 1MKWH 4JZ1A 1RXPA 2P8OB 1UVPA 1AUJA 1K1JA 1UVTH 2TIOA 1GBJA 2XBYA 1WBGB 3ATIA 3LGTA 1O3EA 1TALA 1IOEA 3LDXH 3MNSA 5FXLA 3K6YA 2JH6D 5DP4A 1MCVA 1RJXB 1SGFA 3E1XB 1DLKB 4D9QA 1UTJA 2CJIA 3K9XB 1RS0A 1OOKB 4AC9A 1ESBA 4JZDH 5T3HA 1ZYOA 2P3UB 3EGKH 1DPOA 4IBLH 7GCHF 3F9GA 1GWAA 4CH2B 3PRBA 1GJ5H 1C2JA 3TNTA 5LPFA 1NT1A 3TJNA 1A0JA 3KGPA 4NIVA 5EIYA 5L30H 1L1NA 1C5TA 1CQQA 1TB6H 1YPEH 3SHCH 3F9HA 5DKMA 1TGCA 2VH0A 1TRYA 2J5UA 1ESTA 2J2UA 1H8HD 1CU1A 1YM0A 1C2KA 1LHCH 1GJCB 3Q76A 1B0FA 3RXDA 4RI0A 3VB6A 4BOHA 3TITA 3P6ZB 1YPHC 1FMGA 2ZFRH 3UNRA 3EA8A 1MZDA 1VGCB 1HNEE 4XRNA 2HNTF 3P8FA 2AIPA 1GL1A 3UWJH 1DWBH 4ZCNA 3DSGA 3DA9B 3UUZA 1OYQA 1QZ8A 1THPB 4I7YH 4MVNA 2G4TA 4Y71A 1KTSB 1S6FA 4NWLA 4K1SA 2VIDA 2ZDAH 2C8ZB 3TJUA 1MTNC 2XCFA 4GHQA 3MQKC 2CN0H 2ZTZA 3FFGA 5LGOA 2TGAA 2PGQB 3A7TA 1O2WA 3LC5A 1GVLA 5FL7D 1GMDG 1YPHE 1C5YB 2HOBA 1AVWA 2OUAA 5EPNA 2BY9X 3NPSA 1AHTH 4TPYA 2FTMA 3FVFB 1TMUH 2I6QA 3Q3KA 1GHAG 2BHGA 2ZTXA 2AGIX 3OX7U 2UWOA 1O3IA 2C4FH 4NIXA 2FX6A 1GJ8B 4FUEA 2GDEH 2BDGA 3GCTG 1SGCA 1K2I1 4AYYB 9ESTA 5F6MA 1LKBA 3BTQE 4NA8A 5HYOA 4A92A 4D8NA 1SGYE 1UCYE 2VU8E 2JJ2D 2NU3E 3L33A 1QB1A 2BQ7B 3OY5U 1O3JA 3AK5A 2P95A 1FUJA 1SPJA 3DFJA 3KQ5A 4P00A 1GJAB 1GVZA 1PQ7A 2OQ5A 1VR1H 1NROH 2FI5E 1S0RA 1YCPM 2B8OH 3HATH 4ABJA 3MO6A 3RXCA 1YKTA 2Z3EA 2Z7FE 5I46H 1DUAA 1H9IE 3GDUA 4NCYA 2ANWA 3F2HA 2FYRA 4ABHA 5I25A 1C5ZB 1SLUB 1LQDB 3SJIA 4A5TS 1O3HA 5EW2H 1GI8B 4IMZA 1O2IA 1DT2A 1OYTH 3P8NA 1K1IA 4WY3A 4NFFA 2VIVA 4X8SH 1GMCG 2YMSC 3EDXB 1HIAA 1UTQA 4BAQB 4ZXYH 1YPGH 2V35A 1EPTC 4Q7YA 1GBTA 1E34B 1QA0A 3S7HB 1ANEA 1D3PB 1Y3YA 1UK4A 1QHRB 4YM9A 1GI3A 1ZPBA 2GMTB 1BTHH 2J34A 3QN7A 5F53A 2I6SA 3E0PB 3P95A 8GCHF 1WXRA 1S83A 3T5FH 2LNCA 2BD2A 3VB4A 4JYTA 3M36A 4FETA 2WPLS 2QV1A 3H5CB 3BTKE 1AE8H 3O8CA 4NGAH 1CGHA 1UVOA 2OXSA 1AE5A 1TPOA 1VITH 3GY3A 3KHVA 4AG2A 3MNBA 1WCZA 2R0KA 4HZHA 3DUXH 2A2XH 3KCGH 5EXMA 1ZHRA 2BZ6H 4X6PA 3SGQE 2A5IA 2BX4A 1FONA 1KXAA 1ZRKA 2WSSD 5JBTA 1YPKH 4B6FA 4X2WA 4DGJA 4CR5A 4I32A 5FCRA 3URDA 1ZSLA 5EQRA 1EB1H 1VJAU 1UK2A 3MH6A 2J38A 1GI4A 4Y8XA 4OS7A 1XX9A 3CS0A 1MBQA 1FY3A 1SGFG 3TK5A 1NRSH 2WUCA 4O03A 4ACAA 1FAKH 2PKAB 2GJGA 5AF9H 2R3YA 5HM9A 4OS4A 2UUYA 1BBRE 3M7QA 3KQBA 5GDSH 1ZHPA 1IQGA 3SI4H 2QF4A 1UJ1A 3ATWA 5AVDA 2M2AA 4TT3D 2Y5FA 3AASA 1HYLA 1V2RT 3A88A 5L6NH 3ITIA 4TWWA 4JYUH 1ELFA 2JIZD 2QF0A 3F9EA 4X6MA 3PLPA 4CRFA 5T6FA 2IOTA 3A86A 3MNCA 1DVAH 2ZDMA 2RDLA 4HG6A 1GGDC 3T27A 4FUBA 1NPMA 1N6YA 3ZVFA 1HB0B 2VWMA 1K21H 5T1VA 1O5GH 3PTBA 3ZYEA 1T8MA 4AZ2B 1K1PA 5A8YA 1AMHA 2F43B 2VIWA 5EG4A 1L4DA 1DUEA 1K9OE 1RD3B 1O3GA 1ZHMA 1RTFB 1G32B 4TY6A 2J97A 3GYLB 4DT7B 1BMNH 1MKWK 2UWPA 1Q31A 6CHAC 4NZLA 1UVSH 1A7SA 2GT8A 1DY8A 2B9LA 3MFJA 3G01A 4K60A 3SZNA 1VCPA 4FVBA 4Q4LA 3E8LA 1NO9H 1Z6JH 4Q7ZA 2Z3DA 3ZZ3A 1DWEH 1EXFA 1SFQB 2WPDD 4LZ1H 4Y7BA 3M5LA 4BNRA 1A5HA 2QYIA 3LKWA 3FZZA 2AS9A 1ZTKA 2R0LA 5F8TA 1MU8B 3RLWH 3U1IB 1ORFA 4D9RA 3BV9B 3PWBA 1TQ0B 4GCHF 2FPZA 2BOKA 3PV4A 3KNXA 2ALPA 3M7UA 1GI6A 4Y7AA 3RXEA 2H9HA 2Y5HA 2HALA 3MTYA 4X0WU 1HAVB 1GHXH 1CA0B 4NA7A 1DWCH 2QXHA 4BXSA 2C8WB 1NC6A 1ETRH 2A1DB 4NWKA 5EXLA 3U1JB 4TWYA 2WPJS 1O3KA 1G3BA 1GI0A 3SNCA 1Z1IA 4ZKOU 2Y7XA 5A09A 1TGNA 5ABWA 1NZQH 1A46H 3ZZBA 1O2HA 4X6NA 5IDKA 1O3LA 2UWLA 4WMFA 4AB8A 3M3SA 2STAE 1DX5M 1T8NA 2ZECA 2K1QA 3UB0A 3T25A 2KR7A 2VIPA 1O5CB 2VWOA 3SORA 3U28C 1C5WB 2EI8A 3P17H 2OCVB 4CRGA 1GBFA 1H8DH 1HCGA 2O8WA 2W6ID 2XNDD 5FAHA 3LJJA 4RT0A 2ODYB 2R2MB 3F2FA 2Q1JA 1THSH 3I78A 6GCHG 3D49H 9LPRA 3A7YA 1ZPCA 2WZQA 5F03A 5B6OA 5DK1A 2ZU1A 4I31A 4I8GA 3BTHE 5ESTE 3TH2H 5DJ7A 1HXFH 4DIHH 1HAYB 1EOLA 1GBMA 4TY7A 2ZNKH 4B6EA 2XWBI 3HK3B 3RMNH 1O5AB 3MU0A 3OEED 1QJ1B 1XXFA 4IW4E 3K65B 1HXEH 4XBDA 1G2LA 2ZDNA 1TLDA 3SI3H 2ZPSA 4O9VA 5CHAB 1RIWC 2TBSA 5B6LA 1QQ4A 1YC0A 1W10U 1L1GA 5KECA 4E06H 1BMFD 2ZDLA 2OLGA 3VGCB 2IPHA 2V3MA 2WHXA 1IQNA 1VZQH 1ARBA 4JCNA 1CHGA 4RSPA 1HV7A 3WW7A 4D7GA 4E7RG 4JZIA 2Z9IA 3WWFA 1JRTA 2GCHG 2HVYB 1TX8A 3UR6A 4CHAB 3OYPA 2FOMB 2AFQB 2XBXA 3UNQA 1TONA 1GI2A 1M9UA 1G3EA 1G30B 2HVXA 1N6XA 1O2JA 1GI5A 1Z8JB 2BQ6B 1C9TA 2L74A 3DCLA 3QZRA 2TPIZ 1SLVB 4KELA 4Y6DA 1V2VT 1CT2E 2WYGA 3N7OA 1JIRA 3N7DA 1CA8B 5C67A 4MPWA 1G9IE 1ELGA 1O37A 5KEDA 2WPIS 1TGSZ 5FX6A 2BX3A 1EX3A 1TFXA 3SHAH 2QXGA 1O2RA 3ATKA 4INKA 4AB9A 1SQTA 2VBCA 3KIDU 1LTOA 2WYJA 2PSYA 1J16A 3H7TA 2FODA 1ZGIA 1E38B 1TPPA 3O8BA 4X1RU 1EPTA 1GHBF 2FMJA 1AB9C 2ALVA 1RTKA 3DSPA 3LU9B 2SFAA 4YT7H 2HLDD 2QF5A 3SQHE 1AO5A 3AVZA 1HAPH 1QQUA 2D8WA 3QO6A 2PP6A 1EAIA 1EP5A 2FESH 2ZFTA 1HDTH 4ISLA 2LP6A 3OSYA 1FQ3A 2ZP0H 1KXBA 2Y7ZA 2IPQX 4XBCA 3DD2H 1V2QT 2BVRH 4B2BA 4FUIA 1FXYA 1J9CH 5EOKA 3SU4A 1AY6H 5AFZH 3NRLA 5FCKA 4BTIB 2F9NA 1C5LH 1QR3E 2TGPZ 5PTPA 2FZZA 3BEFB 2PGBB 1NESE 2J95A 4KGAA 5BPEA 1A5GH 3WY8A 1K1MA 4YT6H 5F8XA 1HAHH 3GCHB 1LQEA 1KXEA 1S5SA 5C17A
chains in the Genus database with same CATH topology
3K6ZA 1EP6A 1GCTB 4MG3A 1QJ7B 2O9QA 5GCHF 3FANA 6LPRA 2WUBA 3B23B 2BY6X 3SW2B 2W3KA 3ZVBA 4AFUA 1SB1H 2A2QH 4YO9A 4ABDA 2ODPA 1PQ8A 3SNAA 2ZHQH 3A83A 1UVUH 4VGCC 1GBBA 1TNKA 2FOBA 3V13A 1THRH 2B5TB 2G5VA 5EPYA 1FZZA 2GD4B 1ANBA 4O97A 1AI8H 1LHFH 2H9TH 1FAXA 1P02A 2FWWA 2GMTC 4Y76A 4AX9H 4GPGA 2ULLA 1AZ8A 3VXFH 2A32A 1BRUP 2P3TB 2WPKS 2J9NA 3S0NA 3TNSA 3NUMA 3PMJA 8ESTE 3ZVDA 1LVBA 2CGAA 3MU5A 2VGCB 2ZHEH 1EUFA 4UD9H 1FIZA 1SQAA 2SNVA 3BTWE 3CS7A 3DT0H 1BMLA 5JBAS 2ESTE 1Q2WA 2AIQA 1DDJA 1HPGA 4DY7B 3MI4A 1IQHA 5T6DA 1RTLA 4AYVB 1KSNA 1DM4B 2VVCA 1KXCA 4I33A 1NU9A 3AAUA 4INHA 2ZI2H 4A6LA 1VJ9U 4U2WA 4UFDH 1O3DA 2G5NA 2V6NA 4X2YA 4YOIA 1IHTH 4CRAA 3SUGA 3GY6A 3LGUA 4MPUA 4Y8ZA 1DFPA 4INLA 3Q3XA 2C90B 2VINA 2ZGCA 2GCTB 2FOGA 1INCA 1O38A 5A8ZA 3NWUA 2FIRH 4K5ZA 2PV9B 4AFZA 1OP2A 4Y0YE 1NRNH 3U9AH 2D2DA 1G36A 3UFAA 3RC6A 1O34A 1ELCA 3LOXA 5L2YH 1ZLRA 3L3TA 2FDAA 3BSQA 1MU6B 2Y5GA 1EZQA 3PLBA 3ZZ9A 1GHVH 4ZXXH 2VJ1A 3ZV8A 1DOJA 1Y5BT 1KIGH 1IQLA 2OD3B 1P11E 3AW0A 2FOFA 2GV7A 1C1SA 1DWDH 4D7FA 1GVKB 4BAMB 1ANDA 2ZCLP 4GUXA 2AEIH 2J4IA 3U98H 5FPTA 4FUFA 3F6UH 1BZXE 1ZSJA 2EEKA 1C5PA 2KAIB 2UUFB 4B2AA 2Z9LA 1O35A 1O2YA 2BVXH 3B9FH 3PMBB 3RXOA 1P09A 3RXHA 1TBZH 4F49A 2NWNA 2Q6DA 2A45B 1HRTH 1P05A 2PW8H 1OWKA 1EASA 3KF2A 4HGCA 1YYY1 1GBAA 2RCEA 5LPRA 3T2NA 1P8VC 1AVXA 4B73A 1QJ6B 4XDEA 1MTVA 1WYKA 1GMDF 1JMOH 8KME2 3KL6A 1MAYA 4XBBA 4OS5A 3UOUA 3HKJB 1SHYA 1ZSKA 2CF9H 2Y81A 1QGFA 3RXQA 3QK1A 4UEHH 2BM2A 1GHAF 1LCYA 3JZ1B 3ZZDA 1WTGH 2AGEX 2GDDA 3BN9A 1SOZA 1HLTH 3A8CA 1GJDB 1SGEE 2GZ9A 1SVPA 3A82A 1IQJA 1CA0C 1C5NH 1GHWH 2O8MA 3BTDE 3LH1A 3E0NB 5AFYH 1GBHA 1LDTT 1OWHA 1QBOA 3GCTF 4FUDA 3TU7H 1G37A 1N8OB 2EI7A 3ZZ7A 2F91A 1QL7A 4YLUA 1GDQA 2H1UA 2P59A 4ZAEA 1LHEH 2SGAA 1O2NA 1GG6B 5A8XA 5DP8A 2LPRA 1D3TB 1JBUH 2B0FA 2ZDKA 1FDPA 4X1PU 3A8AA 1LKAA 1ZJDA 2VVVA 1KDQA 2BTCE 3TK9A 1UK3A 1H8IH 1LO6A 4JZEH 2ZU5A 1OXGA 1SLXB 3LGYA 2P94A 2BD5A 5EGMA 3V0XA 1EATA 2BD8A 1Y3UA 1GMCF 5E2OA 1OPHB 3OTJE 1O2QA 1ELVA 1QA7A 2PFEA 3JZ2B 1XUHA 1T7CA 2C93B 5JB8S 2SNWA 1C4Y2 3DFLA 1O39A 3EA7A 2V3HH 2BXTH 1UO6A 1AWFH 2Y82A 5GXPA 3P70B 4J1YA 1D9IA 3BEUA 3VPKA 1O3PB 5EQQA 3A80A 1O2TA 1O2PA 4X1SU 4ZHLU 2PSXA 1P10A 1Y5UT 4Q80A 1P57B 3QGJA 1Y59T 1O33A 1SL3A 2BD3A 4NSVA 4OGYA 2GGVB 3RXBA 1AWHB 4FUCA 1NU7B 2A31A 2A4OA 1A3EH 1NFUA 1ELBA 2ZU4A 1O3NA 5LH8A 5JB9S 4M7GA 2F9VA 5TCCA 4CHAC 1A0LA 3T26A 1MMJN 1TX6A 2BDBA 1SGRE 1FY5A 1VITG 4I8HA 1AU8A 1HJAB 3BG4B 1P2OA 2H5DA 1O3CA 1BRBE 3FP7E 4O3TA 1ZJKA 3D65E 1GBKA 1OWEA 1HAOH 1GBCA 2GVFA 2FTLE 3ZVAA 3D23A 2XC4A 1Z6EA 2ZFFH 3U8RH 4I8LA 1FI8A 1G2MA 3BEIB 5HGGA 3MOCA 3F9FA 4IC6A 3TH3H 2XWAA 2XTTB 1GCDA 3FP8E 1EOJA 1ZZZA 2FOHA 3NK8A 3VB7A 4KP0A 5JDUB 3PO1C 3SV6A 4I8KA 3SNBA 4XFQA 1Z8GA 4R0IA 1NS3A 2DE8A 2SGQE 2ZPRA 1C5XB 3QUMP 4HTCH 5A0BA 3HK6B 4MNWA 4AGKA 1V2MT 1ARCA 2AERH 2ANKH 3LJOA 1YLDA 2ZO3H 2P3FH 2GV6A 2NU2E 1IQMA 4K1TA 1TRMA 2OC1A 4J2YB 1P04A 2ZQ2A 5LPEA 5E8EH 1D3QB 1OWIA 2ZFPH 2A0QB 2CHAB 3A8DA 3TGKE 1XMNB 2QIQA 5C5OA 1W2KH 2ODQA 2FI4E 1TGBA 4ZMAH 4U32A 3M37A 1GBEA 2AMDA 1A61H 4WXVA 1V2NT 4GVUA 3SV2H 2FEQH 4ISIH 4R8TB 1YBWA 2BLOA 4H4FA 1CBWB 5C1XA 2IN2A 1LHDH 2ZHWH 1TOCB 1U6QA 2ZFSA 3MH7A 1KYNA 3GY7A 4OS6A 4PROA 3SN8A 1Z71A 1A4WH 1HAGE 4GLYA 5HMAA 4B2CA 2JETC 3GCHC 1E37B 3MYWA 1HGTH 1UCYK 4UE7H 1CT4E 4OGXA 3SU5A 4X8VH 1CHOG 2PKAA 4RN6A 3TPIZ 1HAIH 2TRMA 2PTNA 1O5BB 1KLJH 3TLOA 4NZQA 4BAOB 1KLIH 4Q2KA 1V2KT 4K2YA 2ZTYA 1IQEA 1ZMLA 3P8OA 1FJSA 3TK6A 1TABE 4FUGA 4K8BA 2Z6BD 2P93A 3H7OA 1GBIA 2C8XB 4XOJA 3RXMA 2OBQA 3TIUA 1O0DH 4SGAE 4UFGH 1GDNA 2CMYA 2QN5T 3RUOA 1MTNB 1F0TA 2QA9E 1IAUA 2BD4A 3E6PH 2VWNA 1WOFA 1XUKA 3Q00A 2NU1E 1MUEB 1P06A 4E7NA 2G8TA 1YLCA 4ASHA 4IMQA 4LXBH 1KLTA 2VGCC 5AHGH 5BRRE 1FY4A 2ZHFH 4RKJB 2GP9B 2ANMH 4MNXA 1AZZA 1QCPA 4UFEH 1BTXA 6GCHF 1CGIE 5EU8A 1PPBH 3V3MA 4YZUA 4ZKSU 1OP8A 2A7JA 1B7XB 1MQ6A 1EJAA 3PYHA 1C1TA 2C3SA 1P0SH 1ZR0A 4LK4A 2BYAX 5DGJA 1LHGH 2BDYA 5EODA 1LMWB 4NG9H 2OC7A 1TQ7B 2P8OC 3MWIU 1TAWA 3AW1A 3GOVB 4AG1A 1AKSB 1BA8B 2XCNA 3PMHB 2FP7B 1QTFA 4X1NU 4LOYH 3SNEA 3HPTB 1BBRK 3SU1A 2G00A 2BY8X 3UNSA 3MU8A 1O2OA 3SJOA 5DPAA 3E90B 2GZ8A 2ANYA 3RU4T 1NM6A 3TJVA 5C1UA 3W94A 1ELTA 3P92A 4WMEA 3BG8A 4H6TA 3GYMA 2GCHF 5DG6A 2ASUB 4B74A 3UIRA 4ISOA 4X2XA 5GWZA 4KTSA 3SU3A 4BTUB 4UFFH 1ID5H 3M5MA 1XXDA 3A7VA 4YESB 4ZKRU 2AMQA 1TGTA 1A3BH 3GY8A 3ODDA 5GPIB 1DSTA 4CREA 2ZCKP 2OC8A 1DSUA 2Q6FA 3L6PA 3MHWU 1SHHB 1O2LA 1T32A 2ZZUH 1SFIA 3ZZ8A 2H2ZA 1Y5AT 3MH5A 3SV8A 1VGCC 1PPGE 3ZVCA 5H4IB 2J94A 1W11U 1ETTH 4WF8A 1SG8B 3O8DA 1SR5C 1FV9A 3A7WA 1BIOA 1BDAA 2XYAA 3VXEH 1BHXF 1OWDA 1XUFA 1YPMH 1W0YH 2F83A 3ODFA 4KTCA 4CRCA 4WVPE 1F5LA 2QC2A 3HGPA 3A85A 1JXPA 1BOQA 2BD9A 3IITA 4D76A 1EJNA 5E0GA 1MD8A 4O3UA 1E36B 1XM1A 2ZEBA 1CSOE 3GY2A 1O2GH 1O32A 2SGFE 2YOLA 1CE5A 1O2ZA 3LC3A 3UQVA 1O2KA 5K0HA 1N1LA 3RU4E 2RA0A 4A7IB 1PYTC 4ABFA 1EJMA 1JOUB 1C5UA 2CF8H 3UR9A 4TPIZ 1MTSA 1JWTA 1S0QA 2A4QA 2SGPE 3BF6H 1N8OC 2A5KA 1V2TT 2Z3CA 1BMAA 3UTUH 1F5RA 1GI9B 1XUGA 4B71A 1V2JT 3ZZ5A 1UHBB 4ABAA 1S81A 1GG6C 1C5QA 1JRSA 1W13U 3STIA 3UPEA 1TNJA 1GHZA 3NCLA 3SGAE 4WXIA 3SU2A 1NFXA 2H5CA 1A5IA 3QGNB 5T6GA 4A1TA 1BUIA 1WSSH 3E16B 4ZKNU 1C2MA 1GJ6A 1C4U2 1TE0A 4WMDA 1AUTC 1C1UH 1SOTA 1B5GH 1EZUC 1BB0B 1NN6A 1OWJA 1BCUH 1QY6A 1A1RA 1P01A 4ZROA 1ACBE 2FM2A 4ZUHA 3RXKA 6CHAB 2FOCA 1O3OA 1P3EA 1P2KA 4YOJA 2VIQA 3RXRA 3SQEE 4AFQA 2SGDE 2BXUH 4ABBA 1LVMA 1AGJA 2PR3A 4Y10E 5IYTA 2DUCA 2EI6A 1FN8A 1V2ST 5TJXA 3D62A 1ZPZA 1EQ9A 1LVYA 3PROA 1Y3WA 5K7RA 2PKSB 1NRQH 1K28D 1GMHF 3ESTA 2OC0A 1HBTH 1YPLH 1T8OA 2OINA 1O3FA 4GSOA 2G4UA 3SNDA 1SGNE 3SUFA 1DY9A 1OS8A 3QLPH 3VFEA 2ZDVH 2QY0B 4WH8A 5DP9A 5DP3A 1Y3XA 2FOEA 1WUNH 3RC5A 1TA2A 1TPAE 2HLCA 4E05H 3TGJE 1MZAA 2G51A 4KKDA 4X2VA 2ZFQH 1FN6A 2FLBH 2ZU2A 1HJAC 1ELDE 1MAXA 2RA3A 3BG4C 4NSYA 1P9SA 4FVDA 1WV7H 1P9UA 1BITA 3BIVH 5ETXA 1GBLA 1O2VA 4JK6A 3LGVA 1P2NA 4XSKU 3E91A 2BVSH 1Z1JA 2A4GA 5SGAE 2FS9A 4JK5A 1JIMA 4Z6AH 1HAXB 2VH6A 1K22H 2FS8A 2WPMS 2ZQ1A 1UCYH 1T8LA 3RXSA 2A7HA 5GJ4B 1ZMJA 4IGDA 1ABJH 2ZWLH 1X7AC 2G52A 2UUKB 5FBEA 3RXVA 3A84A 1YCPK 3Q3YA 2ZG0H 3P8GA 3SOSA 2A5AA 1O2XA 2M5TA 2WINI 3C27B 3RDZA 1V3XA 4YTAA 1KXFA 3RXFA 4YLQH 1QL8A 1EAUA 2FXRA 3RXTA 1Y3VA 4MQAA 3UY9A 1K1OA 1AD8H 4GAWA 1BTZA 2W3IA 5A0AE 2CHAC 3SU6A 3RMOH 3MH4A 3BTME 2XRCA 3MMGA 1VCWA 2ZU3A 2B7DH 3ZVEA 1C9PA 2BDIA 1RIWB 2IJOB 1SGTA 1WTHD 1WQVH 3EYDA 5GIBA 1Z7KA 3CP7A 2Z9KA 3MU1A 2HGTH 1TYNA 1V2PT 4BAKB 4DW2U 1CBWC 1BTPA 2STBE 3RLYH 2GTBA 3SJKA 3B8JA 2F3CE 3M35A 7GCHG 3TJOA 3MNXA 1IQIA 4BAHB 3SV9A 2GKVE 1P3CA 1O5FH 1MCTA 1MKXK 1GJ9B 1PPHE 1QRXA 5HM2A 2AGGX 1L4ZA 1C1RA 3RXIA 4IC5A 1LPGB 3F1SB 3U8TH 4THNH 4CH8B 1KDQB 1O5EH 5A2MH 1KY9A 3QWCH 1NTPA 5J4SA 2BLWA 1PPZA 1OKXA 3ELAH 2THFB 4BXWA 1XKBC 4IS5A 2ZKSA 2O8LA 3RXUA 1BTUA 1IHSH 1BTYA 5G4BA 1BBRH 2F9UA 1ANCA 2A7CA 2ZHDA 1AIXH 1BTWA 1GI7B 3UREA 1HIAB 1G3DA 4F4OC 1XVOA 4FXGH 3I29A 3NXPA 1C1VH 1AB9B 1DANH 4AFSA 5L2ZH 4ABEA 1C2GA 2XC5A 1O2SA 1AN1E 3A8BA 3MU4A 1H9LB 1MBMA 3EQ0H 1GHYH 3C1KA 6ESTA 2NU4E 4MLFB 3LGIA 4AOQA 1GJBB 2VNTA 1SI5H 2PUXB 3SUEA 4A1XA 2KAIA 4MPXA 2JH0D 1O3MA 1P2JA 3V12A 2TGTA 1TBRH 1W0ZU 5CE1A 2OBOA 2F9OA 7ESTE 1QB9A 1S85A 1QFKH 3MO9A 3ZZ6A 1C2HA 1L1JA 1P2IA 3PWCA 1NRRH 4OS1A 4OS2A 1PQ5A 1MD7A 2H6MA 4CBNA 1SBWA 5C3NA 3BTEE 1CGJE 5FPSA 1AFQB 1OSSA 1HFDA 3EA9A 2BLVA 4CRDA 1QRZA 1Y8TA 1BT7A 1FPCH 3K2UA 3QZQA 1C1NA 1O3AA 3A81A 2QXIA 1TBQH 1MTUA 2HRVA 1UMAH 3HGNA 3VGCC 2PHBA 4WJG2 4VGCB 1KTTB 1D4PB 3EE0B 1S84A 1VITF 2XBWA 2VVUA 2FOAA 4CR9A 3GICB 3SJ9A 3A87A 2HNTC 2V3OH 1L0ZA 2HWLB 1QBVH 1C1WH 5CHAC 1D6RA 2QGRA 1FY8E 3PLKA 4JYVH 1WQSA 3CENA 3BTGE 4LZ4B 1ELEE 3BTFE 3LH3A 1A0HB 1BHXB 3KEEA 4AGJA 1F0RA 8GCHG 1GDUA 1FIWA 3NZIA 1EZXC 2Z9GA 2VIOA 2WV4A 1HJ8A 4BTTB 2OQUA 1F92A 4DCDA 1C1MA 2BOHB 2BLQA 1HUTH 5FBIA 1P2QA 1DICA 5F8ZA 3ZZAA 3ATMA 2XC0A 1ZTJA 2R9PA 4K1EA 2VWLA 1NRPH 1C5MD