3MU5A

Comparison of the character and the speed of x-ray-induced structural changes of porcine pancreatic elastase at two temperatures, 100 and 15k. the data set was collected from region b of the crystal. third step of radiation damage
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
total genus 64
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mu5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mu5A01
3H7TA 1QGFA 3MHWU 1B0EA 2JH6D 4BAQB 1BTUA 2BYAX 1W12U 4INKA 3OSYA 3SU1A 1BHXB 4D9RA 2NU3E 5FHTA 3U98H 4UDWH 4BAMB 5TJXA 1G37A 3KQEA 1YP9A 2G8TA 2G00A 3U8RH 4ZKNU 1MZDA 2AMDA 4GUXA 2FDAA 1GJ7B 1QJ7B 4X6PA 4ABHA 1GBAA 1LTOA 1W3CA 1QBOA 1C5MD 4O3TA 4YOJA 1EASA 1UTPA 4CRBA 4CRGA 1JIRA 1LHGH 1JWTA 1A5IA 4ABAA 1HAYB 1P3EA 3VXEH 4Y10E 3H5CB 3F9GA 3LC5A 1O2GH 4A1VA 1NS3A 4J1YA 1F5RA 3D65E 3ZZCA 3HK3B 3SGQE 1NM6A 4Z0KA 3A88A 4B73A 2GV6A 4OS2A 1V2KT 3ZZAA 1ESTA 4XBBA 1A5HA 1X7AC 4GLYA 1ARCA 5HMAA 4BAHB 2Q6FA 3SORA 1RTLA 1L0ZA 1C1QA 2A2XH 4Z6AH 1DXWA 2DUCA 4X1RU 3JZ2B 1W14U 2XYAA 1TBZH 2ZDMA 3K65B 3O8BA 2FYRA 1V2QT 4AB8A 3K6ZA 1EZXC 1GDUA 2W3KA 1S85A 5LPFA 1YLDA 4PROA 1BZXE 1PYTD 1C5TA 2OBQA 1ZSKA 2CN0H 4B74A 1TNHA 1HAVA 4TY7A 1ELCA 4ZMAH 1A46H 3SNBA 2Z9LA 2ZCHP 1GHBF 1LPKB 1O2JA 3PWBA 1F5KU 2THFB 4Y6DA 1KLIH 1DLKB 2A32A 1OWEA 3A84A 3GDSA 3FP6E 5L2ZH 1UVUH 2BQ6B 1G2MA 4NIYA 1ZTJA 4GCHF 4CRAA 1TRMA 2AS9A 1SFQB 2HPPH 1Z1IA 2A31A 1A0JA 2BVXH 4TWWA 3LH3A 1P2MA 5E0JA 2Y5HA 3NK8A 4KKDA 1F7ZA 3M3VA 1ZJKA 1IQJA 2GZ7A 1GMCF 3M37A 2GKVE 1NPMA 3EA8A 1S82A 2IOTA 3PLBA 7KMEH 2ASUB 1C1TA 1F92A 4I8JA 1DANH 1IQMA 1SBWA 1DUAA 1NRQH 1C4V2 4JCNA 3GYLB 2O8MA 1G9IE 2W3IA 3TK9A 1ACBE 1ARBA 3SU4A 2OD3B 1BBRH 4AG2A 1P02A 2HWLB 3SUGA 2GV7A 3RU4D 1O3MA 4XDEA 1GVZA 2Q1JA 2IN2A 1O2IA 1K21H 1GJ5H 4NG9H 4CR5A 2K1QA 1NT1A 2C93B 3SU5A 3T2NA 3T26A 1HAXB 1NY22 1PYTC 1W2KH 1SGFA 4GCHG 1MBMA 1TRNA 2WYGA 1S5SA 5JBAS 1GJAB 3NPSA 4MNVA 5K0HA 1IHTH 3F68H 1KYNA 1MU6B 3ENSB 5I46H 3ZV9A 1UTQA 2JH5D 3S69A 5F8ZA 3SW2B 1C1VH 3KL6A 1GBTA 1FUJA 3BG8A 4JK5A 1XUFA 2F83A 3ESTA 3SNAA 3C27B 1IQIA 1FN6A 4RSPA 5F03A 1HBTH 1A5GH 5BPEA 4UE7H 1HGTH 2RDLA 4ZHLU 3RMMH 4JYTA 3UQOA 2G52A 1DITH 4I8LA 1GHZA 1A0HB 1UK2A 3BTQE 3M5MA 2A4RA 1V2TT 3MU1A 4X8TH 4DY7B 2QCYA 1YBWA 1P01A 3GCHB 1O5FH 3MFJA 1S0RA 3QX5H 1ELGA 1EX3A 1SOTA 3HKIB 3TGJE 5EU8A 2FS9A 3P8FA 2RG3A 1XUKA 1P03A 1WOFA 2BXTH 1A3EH 2PWXA 3A7TA 1HAVB 1TA6A 4QT8C 1AU8A 3OY5U 1THSH 1XKBC 1O2SA 1HV7A 5FX5A 3M7UA 1IQHA 2P94A 1HXFH 1O2YA 4TPIZ 3EA9A 1TBRH 1J8AA 2BDYA 3RXBA 1P9SA 1RJXB 1G3CA 2AH4X 1WQVH 5EPNA 2PR3A 2ZHFH 4FU9A 2H2ZA 4Y71A 2BDAA 2NWNA 1BRCE 1ABJH 1AVGH 1Y5UT 1HCGA 1WV7H 2ZGJA 3DHKH 3HPTB 2BLQA 1VR1H 3F9EA 1TPOA 1SFIA 2ZI2H 1ZTKA 2FI4E 2TRMA 4JK6A 1L4ZA 1VITG 4BAKB 1AZZA 3RLYH 1UCYH 1A3BH 4UONA 1Z7KA 2H6MA 4WVPE 3PV4A 2C8XB 4GVUA 2M5TA 4JYVH 4UFGH 1DWEH 3A8DA 1HJAB 1LKAA 1ZPZA 1Z71A 1XX9A 3AAUA 1P2KA 3E0NB 4E7NA 1YKTA 2O9QA 3Q3KA 1NROH 3RM2H 5ETXA 2VIQA 2BX4A 3ZZ5A 1BRBE 2Z94A 1ZHRA 2BY5X 1HAZB 3ZVAA 1AN1E 1P0SH 5J4SA 3RXFA 2UUFB 1AE8H 1QY6A 4BOHA 2R0KA 2WUBA 2C8WB 2VNTA 2F9NA 2FS8A 4CRDA 1ORFA 1SGPE 5A8ZA 1QB1A 3ZVFA 3PMHB 1PPBH 2F9PA 3S0NA 1GI4A 1GVKB 3VB5A 2D2DA 4X6MA 1LMWB 1EOLA 2VH0A 1HNEE 1MD8A 3URDA 2B0FA 3RXKA 2FTLE 2FI3E 1TAWA 2XC5A 4THNH 4XSKU 2ZC9H 1WCZA 4JZIA 1O3NA 2EI8A 2R3UA 4FUHA 1UVOA 3ZZ6A 2W5EA 1JBUH 1EPTA 4ZHMU 5FAHA 3EQ0H 3RMOH 3MH4A 1TOMH 1OYQA 3RLWH 4GAWA 1SGQE 3R3GB 1H8IH 2Z3DA 3GCHC 4O3UA 2Y5FA 5LGOA 1OS8A 1SLVB 2FYQA 1TLDA 2A7CA 1C5PA 2BD5A 1VGCB 4X8SH 3TJOA 1Y3UA 1SR5C 5PTPA 2XBWA 4INLA 1INCA 3U8TH 4WWYA 4FXGH 1CGHA 2ZDVH 5E0GA 4NFEA 1FY1A 4MPUA 5CE1A 1GHXH 1RD3B 2CV3A 2FOEA 5EXMA 1TOCB 1WSSH 5GCHF 2ZHWH 4KP0A 5E8EH 2ZDKA 3MU4A 1HYLA 2BDGA 4K8YA 1O37A 3PROA 2EA3A 3GCNA 1ETSH 2RCEA 3TJNA 2CF9H 3ATMA 2G4TA 2ZTYA 3PMJA 3SJOA 3P70B 2F9UA 3M61U 4AFZA 4JZ1A 2ZU4A 1M9UA 1JIMA 1OWIA 1RTKA 4B2CA 1G3DA 2ZZUH 4E06H 3BIUH 1RTFB 2OC7A 4I8GA 2ODYB 4DGJA 1CE5A 4ISHH 5SGAE 1SQTA 1VITH 5E2PA 2W7SA 1EJNA 4ZUHA 3A80A 3R0FA 1K1LA 3GY3A 4XBCA 5HXFA 4ABFA 1PQ8A 1PQAA 2ZWLH 1GI5A 1V2PT 4A7IB 1TYNA 2BLWA 3W94A 4Y79A 1P2OA 1TX6A 3BTTE 4FUEA 3O8CA 2VIDA 2Y7XA 5A0AE 3GY7A 5FPTA 1HJAC 3D49H 3L3TA 1EAWA 3DUXH 3SGBE 1NU7B 5ESTE 1CA0C 4I33A 2AMPA 3W95A 1C9TA 2BD9A 3GOVB 5GCHG 4ABDA 2J92A 4M7GA 2ODPA 1N6XA 3A82A 3QWCH 4AYVB 3KEEA 2A4OA 3C1KA 3BF6H 3AVZA 1Y59T 2OINA 3MH5A 1EB2A 2WPIS 1XVOA 2A5KA 1PPFE 2BMGB 3K9XB 2XTTB 1C5LH 2BZ6H 1EJMA 5GIBA 2I6QA 3NCLA 5JB9S 4JYUH 1NU9A 1BMLA 1O2XA 3MOCA 2VU8E 3BV9B 4RN6A 7ESTE 1GMHF 1GVLA 4NWLA 5DO4H 4NGAH 1TNLA 2A2QH 1E35B 1K1MA 4OS1A 1SOZA 4MQAA 3FANA 1L4DA 1DS2E 3TLOA 3ATLA 1S81A 2VWNA 1EQ9A 1FI8A 1MCTA 3KN2A 2HNTF 1SGIB 5LPRA 2ZKSA 1OYTH 1U6QA 4TWYA 1SB1H 1YCPM 2VJ1A 1EPTB 2XWAA 1MKXK 2TPIZ 2HPQH 5E0HA 5LPEA 1TABE 1FQ3A 2SNWA 5C1UA 1ELAA 4TPYA 3QTVH 1ZMLA 2XW9A 1GBCA 1O3GA 1TX8A 3P92A 1VGCC 4MVNA 2BD7A 2FESH 3QN7A 5L6NH 1C1MA 2P3UB 3D23A 4ISOA 1LHFH 1KXFA 1TPAE 1W0YH 2ZU2A 2ZGXH 3I78A 5T3HA 4X1QU 3AW1A 1DPOA 3VFEA 4XBDA 4NIVA 3PM3A 1QFKH 1XVMA 2H9HA 1C2EA 1LVOA 1IOEA 7GCHF 1AY6H 3SV7A 4ASHA 1GMHG 1MKWH 2VIWA 3SJIA 4Y8XA 2PSXA 2XC4A 5EXLA 1SC8U 9ESTA 3S9CA 3KNXA 3RP2A 4CR9A 1DWCH 4IW4E 3TK6A 2BD2A 1FY5A 1BMNH 1K9OE 2OXSA 1FAKH 1ZRBA 3BTEE 1D3QB 4FUDA 1VZQH 4GHTA 4HFPB 2B7DH 2V3OH 5A8YA 2PTNA 3GICB 4FVDA 5EPYA 2QXIA 3ZZ7A 3MO6A 1EATA 1HLTH 4AFSA 2GZ8A 1DWDH 4E7RG 1SHHB 5C20A 3RXPA 1YPKH 3ATWA 2VIPA 2UWOA 1V2MT 3ATKA 3FZZA 1C2JA 1TE0A 1WU1A 1SLXB 4UEHH 3ZVBA 4LZ4B 7GCHG 1BTZA 1YCPK 2EEKA 3RU4T 1OP0A 1SGCA 2HALA 1N6YA 1T8NA 3DT0H 3RXLA 1L2EA 1V2VT 4LOYH 1EUFA 1C1NA 4UFEH 2GGVB 4AGJA 4I8HA 3A7VA 3ZZ4A 1CSOE 1O3HA 3LONA 1AZ8A 3TK5A 3KHVA 1HDTH 2UWLA 1THPB 9LPRA 4WJG2 3SJKA 1QB6A 2IJOB 3M5NA 1Z8GA 4WMEA 2NU2E 2OP9A 1BMAA 1EOJA 1A1RA 3AASA 4Q7YA 2A5AA 1H9HE 1LCYA 4FUGA 5LH8A 3BSQA 1V2RT 2AIPA 5JBBS 1SGTA 4KGAA 3UNRA 2R2MB 1OXGA 2CHAB 3A83A 4NA8A 4ZHAA 1O2HA 3ZZ3A 2ZFSA 2A7JA 1C5RA 1YM0A 3L6PA 3A81A 1B0FA 1EPTC 1ZGIA 3A86A 2VINA 4MPWA 1MTWA 4X2XA 5C67A 6LPRA 1FJSA 2GCHF 1VCWA 3UPEA 1ABIH 3WY8A 3GY8A 1J17T 1GHAF 4Y11E 2VWMA 1NZQH 3P95A 1QL7A 2BQWB 2GTBA 2PKAA 4AFUA 1EZUC 3TPIZ 1P2IA 3RDZA 2Q6DA 1D6RA 2O8LA 3A7XA 1O0DH 2ZU3A 1Z6EA 1G36A 2CMYA 2QF3A 1DWBH 1Q31A 1NC6A 3NUMA 2BXUH 1P8VC 1QNJA 4VGCB 5F8TA 4D8NA 2RA0A 1C2HA 1OPHB 8LPRA 1O33A 3SI3H 1SHYA 3F9FA 3A89A 1BUIA 2Z3EA 4CBOA 4YM9A 1W7XH 2ALPA 4AB9A 1O2KA 1TWXB 1YYY1 3RC5A 3KQCA 5HM9A 4ZKRU 4I31A 4Q7XA 1GG6B 1W11U 1BBRE 4O03A 1TONA 1O3IA 4CREA 1HJ9A 1GHAG 3F6UH 2C4FH 4CH2B 4FUFA 1Q2WA 2V3HH 3PMAB 5GXPA 3S9AA 2J95A 2HVXA 3OU0A 2BY6X 1OWHA 1C5VA 1GBKA 2OLGA 2G5NA 1C5YB 2PKSB 3UNQA 2FWWA 3F9HA 3MI4A 1A61H 1DSTA 1BA8B 1L1NA 1O5DH 2ZPSA 1V2OT 3E3TA 3RM0H 1GBFA 1DICA 1GI7B 4IGDA 4SGBE 4CBNA 3QGJA 4GSOA 2OC0A 1BRAA 1C2MA 2QXJA 3SV9A 2VH6A 1F0RA 3MH6A 2WPLS 4KTSA 4UFFH 3ZV8A 1O2UA 2F3CE 1DE7H 2ZDLA 1FY8E 1CA8B 1ID5H 1HB0B 5L30H 3TJVA 1NRPH 2FOAA 2JETB 2Y80A 1RXPA 3RXUA 5T6FA 1JMOH 1AKSA 5BRRE 1T4VH 2C90B 2CHAC 1GHBG 1NFWA 4A5TS 2QAAA 1P9UA 1YPJH 3P6ZB 1XXDA 3RXDA 2B5TB 4Q2KA 3T62A 1C1UH 3EA7A 5FBEA 3LDXH 2BHGA 3UTUH 3S7HB 2FODA 3SU6A 3MNXA 1MTSA 2WPMS 1H9IE 1TGNA 3ZZBA 3A8BA 3QGNB 5FX6A 1CHOF 1JXPA 2AYWA 1IAUA 4TYDA 4D7GA 2FX4A 3GISB 5GPIB 1G30B 2ULLA 6ESTA 2PKAB 1GMCG 3SJ9A 5H4IB 2FP7B 3UIRA 5DJ7A 4BANB 2PLXA 3LT3A 1BQYA 3SQHE 2H9EH 3M36A 3U69H 1GBLA 4HGCA 4VGCC 1UK3A 1VCQA 1ZMJA 5GDSH 2Y81A 4AOQA 1H1BA 2QXGA 4UD9H 1HAHH 2SGDE 5J4QA 1C1SA 4AORA 1C2DA 5A0BA 1UCYE 1SGNE 2FLRH 1W8BH 1HAOH 3FFGA 2PV9B 1CVWH 4ABEA 3LOXA 4NSYA 2QC2A 5HYOA 3RC4A 1GG6C 1V2NT 1MAXA 1EAUA 4DIIH 1W7GH 3KCGH 1CHOG 3LJJA 3LU9B 1SVPA 2BDCA 3TVJB 1XXFA 1JOUB 4NIXA 3QZQA 1JRSA 1BBRK 4ZH8A 2ZFTA 4ISIH 1QR3E 2ZFFH 1Z8RA 1T4UH 2R2WU 2ZDNA 2PKSC 1MTNB 2IPHA 2VVCA 2BX3A 3OX7U 1O3FA 4DW2U 2FEQH 1OSSA 4HZHA 1O39A 2GP9B 1O3BA 3TIUA 2ESTE 1MQ6A 3K2UA 1F0TA 3TGIE 2Z7FE 2FLBH 4BTIB 3UQVA 1S83A 1BHXF 1ZMNA 3RXRA 2ILNA 3D62A 5FCRA 1O34A 1KDQA 2ZECA 5ESBA 1QQUA 1DDJA 1O5AB 2UWPA 2YNAA 1KXDA 3DFLA 5AHGH 4D76A 3VB3A 2OQ5A 4Y8ZA 2ZPRA 5IYTA 2TBSA 2H5DA 1QL9A 4LXBH 2P3FH 3E6PH 1Q3XA 2JETC 5DP7A 1O38A 3M35A 1J15A 3GY2A 3ZZ8A 1QJ6B 1AVWA 2ZDAH 3RC6A 4AN7A 3EGKH 2AEIH 1AKSB 2XBVA 4MPXA 2ZTZA 2ZQ2A 1MZAA 4I8KA 4I7YH 1UTJA 1TPSA 1C1OA 2Z9IA 5EOKA 2BD3A 4U01A 5DP5A 1WTGH 1QCPA 3ZVCA 1UTNA 2ZEBA 3BEFB 1D3TB 2ZPQA 1P06A 3SU3A 3UREA 1FNIA 1C5WB 3SV2H 3QK1A 3RMNH 1GJCB 1ZPCA 5EQRA 1O2TA 1O3CA 3Q77A 3LGVA 3QTOH 3HKJB 2WPJS 3SBKA 1ESAA 3UFAA 2A0QB 2FOMB 1SQAA 2B8OH 4BNRA 3VEQB 1TX7A 4DJZB 3MNBA 2G55A 4IN2A 1AWHB 1DFPA 1DM4B 1YC0A 1CGJE 3SHAH 4X2YA 1A0LA 2PW8H 1ANCA 3LGYA 3ZVDA 1H9LB 2BD4A 4HTCH 3RXJA 4WXIA 4H6SB 2XXLA 1BRUP 2FO9A 1DX5M 1C2KA 1LQEA 2OC1A 3AAVA 1UCYK 4NFFA 1ANBA 1GBIA 1ZOMA 3O8RA 1YPLH 3BTFE 1FDPA 3A85A 3SNEA 1AUJA 1QIXB 2C3SA 3OY6U 3TH4H 3ITIA 2HLCA 4A92A 1DSUA 3ZYEA 2FI5E 3RXEA 1TNIA 4OS6A 2XRCA 2P95A 4YOGA 1N1LA 2NU0E 1ZSLA 4CRFA 4B2AA 1AHTH 1C5ZB 3NWUA 1WBGB 1ELVA 1C5UA 1O36A 2A4GA 2FM2A 1SSXA 4AX9H 1OOKB 1GWAA 1TMUH 3EAJA 4WMDA 4FU8A 1GMDF 4K1SA 1UVSH 2H9TH 3DFJA 2KAIA 4LK4A 4GPGA 1XUJA 2BLOA 3ZVGA 4U30A 1AB9B 3EE0B 1YPHE 1KXBA 2OBOA 2FXRA 2BDIA 2BY8X 5EW2H 3QUMP 1KLTA 1P04A 4K69A 4YLQH 2BY9X 1K22H 4Y0ZE 1KDQB 1T8OA 1CO7E 1CT0E 3HATH 3RXAA 2O8UA 1QBNA 1Z6JH 3VGCB 4NZLA 4ZKOU 1V2JT 1YPEH 1EAIA 1MTUA 2AGIX 2G81E 4AG1A 3E91A 1LQDB 3KIDU 1F5LA 4Y8YA 3GDUA 4H4FA 4B75A 2HGTH 4DVAU 2F9VA 5EG4A 2NU4E 8GCHF 2FTMA 5FBIA 2ANWA 5DG6A 1LHEH 1N8OB 1K1JA 2UUKB 1TFXA 4YTAA 4X2VA 1CBWB 1EJAA 4OS7A 3TJUA 3UOUA 2QGRA 1AFQB 5G4BA 2ZGCA 1K2I1 1TPPA 3RXHA 1V2UT 2SNVA 1FY4A 2JH0D 1PPCE 1P2JA 1SLWB 3JZ1B 5DP8A 3SU2A 2AIQA 2ZU1A 1QBVH 3UNSA 4CH8B 4YZUA 1IQGA 1IQNA 2FMJA 4YT6H 1Y8TA 1ELTA 1AIXH 1GL1A 1O2PA 1VCPA 1ZPBA 3BTME 2GMTB 1IQLA 1GHVH 4MLFB 3NZIA 3LPRA 3RXMA 1E34B 1GBDA 2QY0B 2ZCKP 3GY6A 4TY6A 5AF9H 5B6OA 1GJ4H 2JKHA 1QQ4A 1O2ZA 2Y6TA 1GCTB 2ZO3H 1FY3A 8GCHG 4BTUB 1BTXA 1C4U2 1WAYB 3A7ZA 1H4WA 1ZGVA 3M3SA 5DKMA 5T6DA 2ANKH 1GBBA 2V6NA 1TQ7B 2SGPE 1AE5A 2WYJA 3T28A 2XWBI 1JRTA 3MO3A 4ABIA 4AYYB 4ABBA 1TRYA 4X8VH 1LVYA 2ZFQH 5A09A 3QLPH 2D26C 2PGQB 1G3EA 1L1GA 5L2YH 5ABWA 4IC6A 4NIWA 1TQ0B 2XNIA 4R8TB 4I32A 1D4PB 2R9PA 2KAIB 1C2LA 1GDQA 1AB9C 3IWMA 5EW1H 2PUXB 3M5LA 4NSVA 1MH0A 4O97A 2H1UA 2ZTXA 1AVXA 3MNSA 1EP5A 1LVMA 1RRKA 5JBCS 1UTOA 1K1OA 4WH8A 1BDAA 3ZYDA 5GWZA 4K1TA 4INHA 3M7TA 3PTBA 4FUIA 3BEIB 2BD8A 3G01A 1GBJA 3SV6A 3VGCC 3BIVH 1S84A 5DP3A 1CHGA 3RXCA 1KLJH 2DE8A 1EZQA 4A6LA 3VB6A 1E37B 2BZAA 1CT2E 2G51A 4RKOB 1PQ5A 1V3XA 3U9AH 2PGBB 1GCDA 1HAGE 1GDNA 1O3EA 1YLCA 1N8OC 4YO9A 1E38B 1SI5H 1CBWC 2AFQB 1FXYA 2ZCLP 1AFQC 1GJ9B 3MYWA 5JBTA 2QA9E 2WINI 3MWIU 1B5GH 1UJ1A 3SUDA 1BJUA 3VXFH 1ZLRA 1C1RA 3E0PB 3PTNA 3FAOA 4DT7B 2GD4B 1MKWK 2GMTC 1P10A 3OYPA 2J4IA 2P59A 2HNTE 6GCHF 1A2CH 3GDVA 3UWJH 3ATIA 3TH2H 1GPZA 4ISLA 1SGFG 3L33A 2SFAA 2C8YB 2GCTB 2GVFA 4R0IA 4AZ2B 3RXSA 1GCTC 3HGNA 4XE4A 3LGTA 1E0FD 3CP7A 1SPJA 4Y7BA 1A7SA 3UR6A 1HUTH 2BDHA 3IG6B 1OX1A 2OC8A 4MNXA 2OTVA 1IQKA 4AFQA 3PB1E 3DA9B 2DE9A 1PJPA 8ESTE 1NESE 2FOHA 1C5OH 4B1TA 3GCOA 4FUBA 4HI3A 5F8XA 3SNDA 1HXEH 4XOJA 4F4OC 1ELFA 3TITA 4O9VA 1T31A 1QRWA 3SHCH 2D1JA 4WH6A 4ZROA 1VJ9U 4MTBA 3ZVEA 4K5ZA 5FPSA 2SGEE 6GCHG 1BB0B 3PLPA 1D6WA 1CT4E 1W10U 1J16A 3BTDE 2BVSH 1Y3WA 2BY7X 1TMTH 2GCHG 1G3BA 1ETRH 3M7QA 1HRTH 4NA7A 1K1NA 2FZZA 1O3JA 3A8CA 1KTSB 3V0XA 1LHDH 1DVAH 1G32B 1KSNA 3HK6B 1VJAU 3Q3YA 3MU5A 2CF8H 2VVVA 1F0UA 3Q00A 1ZHMA 1O3KA 5JYIA 1C2GA 5A0CA 4MDSA 2AGGX 4JZEH 2GT7A 3RXIA 1RIWB 5DP9A 1UTLM 2FOCA 3CENA 2UUYA 1P3CA 1SG8B 1GI0A 1YPGH 4ZKSU 3BG4B 4FUCA 1CU1A 2XBXA 3E90B 4FVBA 3E16B 3FP7E 1QA7A 3TH3H 1TGCA 1ELEE 1GJBB 2BQ7B 4WXVA 5DGJA 4DURA 2WV4A 4AGKA 5I25A 3P8OA 1GHWH 1L1JA 1TALA 1O31A 1UVPA 2VWLA 1O2LA 2ZGHA 3RXGA 3BEUA 3I29A 4Y7AA 1OP8A 4OS4A 2SGAA 5FCKA 2F9BH 1SLUB 1TIOA 1O3PB 1NFYA 4NWKA 1MMJN 3STIA 4BAOB 1RFNA 1O2NA 4E05H 1B7XB 4X8UH 1C5QA 2HRVA 6CHAB 1W13U 1DY9A 4K8BA 2ANYA 1C5SA 1QJ1B 1P11E 1SGEE 4ZXYH 1SGYE 1V2LT 2Q6GA 3T25A 1TGBA 2B9LA 1GJ6A 3BTHE 1ANEA 3LGIA 3PMBB 2J34A 2FOGA 2F9OA 1YPHC 1CGIE 3SN8A 2GCTC 1ZYOA 1Y3XA 1WTHD 1Y5AT 1TMBH 3MMGA 2BDBA 2VIVA 1ZR0A 4ABGA 1S6FA 3UR9A 2F91A 1PQ7A 4A1TA 4CRCA 3SUEA 1UO6A 2GDEH 1K28D 4WF8A 2A1DB 1C2FA 3RXQA 2ZP0H 2A4QA 2RA3A 5CHAB 3TGKE 2VWOA 4UFDH 1O2RA 2A45B 1ZSJA 5EGMA 2YNBA 1AD8H 3KQDA 1GI6A 1O32A 5DK1A 1D9IA 1LPGB 1C5NH 1KY9A 1XKAC 1ZRKA 1OWDA 1GBMA 3V13A 1G2LA 2Z3CA 3SI4H 3VB7A 2QF0A 2GDDA 4IS5A 4Y0YE 1Z8JB 1TA2A 4IBLH 1PPZA 1XM1A 2ZF0H 1NFXA 3TNTA 4ZAEA 4MNYA 2PFEA 2EI6A 2GT8A 1GHYH 1MTVA 3SU0A 4Q80A 1FMGA 3SJ8A 1O2WA 1MQ5A 2ZFRH 3LKWA 1VITF 1FPHH 4ZXXH 1S0QA 1LPZB 1FIZA 2ANMH 3TNSA 1KIGH 2BM2A 1QTFA 1O2OA 1HJ8A 1ZHPA 1AQ7A 4YOIA 1HIAA 1AFEH 1RIWC 1XMNB 1MU8B 1O2VA 3CS0A 1C2IA 1AMHA 5A8XA 3EYDA 3BG4C 3HGPA 2TGPZ 1IQFA 1BCUH 2XBYA 2YOLA 1F2SE 5C3NA 1DXPA 3M5OA 1SGDE 2QN5T 1MBQA 4X6NA 3TU7H 5JPMH 3SNCA 1FPCH 2PSYA 1GBEA 1PPEE 1W0ZU 1P09A 2P8OB 3FZDA 3NXPA 3ZZDA 2CXVA 3A7WA 5DP4A 3SGAE 1NRRH 3GY5A 5CMXH 1TB6H 2XCNA 1YPMH 2Z9GA 3ZZ9A 1QA0A 1Z1JA 1O5EH 3RXOA 4K1EA 2ALVA 6CHAC 3A8AA 1IHSH 2UUJB 1NN6A 1HFDA 1C9PA 1KXCA 1C1PA 4B76A 1J14A 2EC9H 2FPZA 5K7RA 1GGDB 3MO9A 1V2ST 3RMLH 1ETTH 1EB1H 3BTWE 2C8ZB 2FIRH 1OWJA 4IMQA 4B2BA 2J2UA 5EODA 3MNCA 1FIWA 1GI8B 1GI2A 1IQEA 2A5IA 2PTCE 2QIQA 2TGDA 2O8TA 3S9BA 4BXWA 1UHBA 1CA0B 1TGTA 4ABJA 2QYIA 2H5CA 3PLKA 4H6TA 3UY9A 2CJIA 1FONA 2ZHEH 3MH7A 4KTCA 1FN8A 1MUEB 2J9NA 2CGAA 2J94A 1TBQH 3MTYA 3PYHA 1FAXA 4DIHH 1WUNH 4NZQA 3QO6A 5CHAC 1CQQA 1KXEA 1MD7A 2TGAA 1T8MA 4JMYA 3BTGE 1HAIH 5T6GA 1O3AA 5JB8S 1LKBA 3BTKE 3PWCA 2G5VA 2R0LA 3ODDA 3LC3A 2W7UA 3MU8A 5EQQA 4Q7ZA 2ZA5A 1O3OA 2O8WA 5C1XA 3DD2H 1E36B 3FVFB 4CHAB 1Y3YA 4BTTB 4IC5A 3IITA 3A87A 1BITA 3H7OA 1H8DH 3STJA 1BTPA 1K1PA 5A2MH 1SQOA 1MAYA 1F0SA 2LNCA 3LGWA 2OCVB 3B23B 3RXVA 1PPGE 2FOBA 5HM2A 3V12A 4IN1A 2EI7A 1GL0E 4RKJB 1GJ8B 2HNTC 5EXNA 4U32A 3E1XB 1KTTB 1MTNC 3P8NA 1HIAB 2D8WA 3OTJE 2QXHA 2Z9JA 5HGGA 4WMFA 4U2WA 3GCTF 4K3JA 3E8LA 2ZGBH 1FLEE 1DY8A 1ZTLA 1DT2A 2ZIQH 1C5XB 4JZDH 4K60A 2VGCB 4IMZA 1OP2A 1BTHH 1P05A 4GHQA 4X0WU 1QHRB 4YESB 3Q3XA 1XUHA 1SL3A 5DP6A 2P8OC 4FUJA 1UK4A 1EP6A 1OWKA 1WYKA 1TNKA 2SGQE 1P2NA 4YLUA 1MKXH 2ZNKH 5AVDA 2FX6A 5AFZH 4SGAE 3SOSA 1O3LA 4YT7H 3I77A 2V0BA 3B8JA 1PFXC 1V2WT 1XUIA 1ELBA 1GJDB 2GZ9A 2Y7ZA 1GGDC 1C4Y2 3URCA 1C1WH 3VB4A 1EAXA 2STAE 4DOQA 3LJOA 4A1XA 1TGSZ 1NRNH 3VPKA 4F49A 1S6HA 3PO1B 1YF4A 1P57B 5FPYA 2PHBA 3U1IB 1ESBA 4ESTE 2ZHDA 1GMDG 3GCTG 2P16A 2ZFPH 1QURH 3KGPA 1AI8H 3SO3A 4D7FA 1YGCH 1UHBB 4KELA 2BTCE 2A7HA 1D3DB 2WPKS 1AWFH 3LH1A 5C5OA 2XCFA 2I6SA 4MG3A 5AFYH 2BVRH 1DUEA 2VIOA 1O30A 5GJ4B 4NCYA 4K2YA 3UOPA 1UTMA 1KXAA 1RGQA 1AO5A 4X6OA 3UUZA 3A7YA 2V35A 2WUCA 5FXLA 2BOHB 1Y3VA 1RS0A 2P3TB 2Z9KA 5DPAA 3FP8E 2OQUA 2NU1E 3BN9A 3RUOA 2Z6BD 3MU0A 2XC0A 1QB9A 3N7OA 4WY3A 3M3TA 3V3MA 4MPVA 1LHCH 3RU4E 5EQSA 3T5FH 3QZRA 7LPRA 4CHAC 2BOKA 5F6MA 4H42U 4X1PU 5C2ZA 1YCPH 2BLVA 1LDTT 1NFUA 1SGRE 1TNJA 1DLEA 1BIOA 3K6YA 1BMMH 2Y82A 3F1SB 1ZJDA 3SZNA 3GY4A 3S7KB 3V7TA 1P12E 2LPRA 2AMQA 1EZSC 3SV8A 3GYMA 5E2OA 3T29A 1O2MA 2ZQ1A 3KF2A 3U8OH 2AERH 8KME2 2Y5GA 4OGYA 1BTWA 2P93A 1P2QA 4X2WA 1O5BB 1O5GH 1O3DA 1WQSA 1NRSH 4OGXA 1DOJA 1Z8IB 1UTKA 1NO9H 2OUAA 1FV9A 1HPGA 1T32A 3AW0A 2PUQH 1GBHA 3T27A 2ZHQH 3P8GA 1OKXA 4J2YB 1SMFE 4OS5A 1XUGA 2GX4A 1T8LA 2VGCC 1ELDE 1TNGA 4NA9H 1ANDA 2SGFE 4ISNA 4JZFH 1A4WH 1EKBB 2FOFA 1ZZZA 1T7CA 1K1IA 3EDXB 2HOBA 2VVUA 1BOQA 5TCAA 1UVTH 2R3YA 1FZZA 2G4UA 4Y76A 5C5NA 1BTYA 5TCCA 3SUFA 3B9FH 1LO6A 1BT7A 1GI1A 2TGTA 4B71A 2J38A 1QRXA 4X1SU 5C1YA 3P17H 1V6DA 1EXFA 1LVBA 1QRZA 1AUTC 1HAPH 3O8DA 2ZU5A 2VB0A 1D3PB 3LGUA 1GI9B 5JDUB 2ODQA 2ZG0H 2TIOA 4DG4A 3U1JB 1Y5BT 3QDZB 3PO1C 1MCVA 3SQEE 2QV1A 4D9QA 1AGJA 3UWIA 1BJVA 4LZ1H 3ELAH 3CS7A 4MNWA 1O35A 1QL8A 4X1NU 2WV5A 4DCDA 2WPHS 1GI3A 1O5CB 1UMAH 1O2QA 4BXSA 3KQBA 2AGEX 3LIWA 2STBE 3ODFA 2BB4A 3RXTA 2W26A 3Q76A 1THRH 5IDKA 4FU7A 4XFQA 3NKKA 1NTPA 1J9CH 4KTUA 1PPHE
chains in the Genus database with same CATH superfamily
3H7TA 1QGFA 3MHWU 1B0EA 2JH6D 4BAQB 1BTUA 2BYAX 1W12U 4INKA 3OSYA 3SU1A 1BHXB 4D9RA 2NU3E 5FHTA 3U98H 4UDWH 4BAMB 5TJXA 1G37A 3KQEA 1YP9A 2G8TA 2G00A 3U8RH 4ZKNU 1MZDA 2AMDA 4GUXA 2FDAA 1GJ7B 1QJ7B 4X6PA 4ABHA 1GBAA 1LTOA 1W3CA 1QBOA 1C5MD 4TSFD 4O3TA 3OEHD 4YOJA 1EASA 2V7QD 1UTPA 4CRBA 4CRGA 1JIRA 1LHGH 1JWTA 1A5IA 4ABAA 1HAYB 1P3EA 3VXEH 4Y10E 3H5CB 3F9GA 3LC5A 1O2GH 1BMFD 1NS3A 4J1YA 4A1VA 1F5RA 3D65E 3ZZCA 3HK3B 3SGQE 1NM6A 4Z0KA 3A88A 4B73A 2EY4C 2GV6A 4OS2A 1V2KT 3ZZAA 2RDEA 1ESTA 4XBBA 1A5HA 1X7AC 4GLYA 1ARCA 5HMAA 4BAHB 2Q6FA 3SORA 1RTLA 1L0ZA 1C1QA 2A2XH 4Z6AH 1DXWA 2DUCA 4X1RU 3JZ2B 1W14U 2XYAA 1TBZH 2ZDMA 3K65B 1NBMD 3O8BA 2FYRA 1V2QT 4AB8A 3K6ZA 1EZXC 1GDUA 2K8IA 2W3KA 1S85A 2KCOA 5LPFA 1YLDA 4PROA 1BZXE 1PYTD 1C5TA 2OBQA 1ZSKA 2CN0H 4B74A 1TNHA 1HAVA 4TY7A 1ELCA 4ZMAH 1A46H 3SNBA 2Z9LA 2ZCHP 1GHBF 3OE7D 1LPKB 1O2JA 3PWBA 1F5KU 3OAAD 2THFB 4Y6DA 2IJD1 1KLIH 1DLKB 2A32A 1OWEA 3A84A 3GDSA 3FP6E 4ASUD 1UVUH 5L2ZH 2BQ6B 1G2MA 4NIYA 1ZTJA 4GCHF 4CRAA 1TRMA 2AS9A 1SFQB 2HPPH 1Z1IA 2A31A 1A0JA 2BVXH 4TWWA 3LH3A 1P2MA 5E0JA 2Y5HA 3NK8A 4KKDA 1F7ZA 3M3VA 1ZJKA 1IQJA 2GZ7A 1GMCF 3F2HA 3M37A 2GKVE 1NPMA 3EA8A 1S82A 2IOTA 3PLBA 7KMEH 2ASUB 1C1TA 1F92A 4I8JA 5HIZA 1DANH 1IQMA 1SBWA 1DUAA 1NRQH 1H8HD 1C4V2 4JCNA 3GYLB 2O8MA 1G9IE 2W3IA 3TK9A 1ACBE 1ARBA 3SU4A 5EJZA 2OD3B 1BBRH 4AG2A 1P02A 2HWLB 3SUGA 2GV7A 3RU4D 3WWFA 1O3MA 3N7DA 4HG6A 4XDEA 1GVZA 2Q1JA 2IN2A 1O2IA 1K21H 1GJ5H 4NG9H 4CR5A 2K1QA 1NT1A 2C93B 3SU5A 3T2NA 3T26A 1HAXB 1NY22 1PYTC 1W2KH 1SGFA 4GCHG 1MBMA 1TRNA 2WYGA 1S5SA 5JBAS 1GJAB 3NPSA 4MNVA 5K0HA 1IHTH 3F68H 1KYNA 1MU6B 3ENSB 5I46H 3GS9A 1UTQA 3ZV9A 2JH5D 3S69A 5F8ZA 3SW2B 1C1VH 3KL6A 1GBTA 1FUJA 3BG8A 4JK5A 1XUFA 2F83A 3ESTA 3SNAA 3C27B 1IQIA 1FN6A 4RSPA 4RT1A 5F03A 1HBTH 1A5GH 5BPEA 4UE7H 1HGTH 2RDLA 2WHXA 3RMMH 4ZHLU 4JYTA 3UQOA 2G52A 1DITH 4I8LA 1GHZA 1A0HB 1UK2A 3BTQE 3M5MA 2A4RA 1V2TT 3MU1A 4X8TH 4DY7B 2QCYA 1YBWA 1P01A 3GCHB 1O5FH 3MFJA 2W6JD 1S0RA 3QX5H 1ELGA 1EX3A 1SOTA 3HKIB 3TGJE 5EU8A 2FS9A 3P8FA 2RG3A 1XUKA 1P03A 1WOFA 2BXTH 1A3EH 2PWXA 3FOAA 3A7TA 1HAVB 1TA6A 4P00A 4QT8C 1AU8A 3OY5U 1THSH 1XKBC 1O2SA 1HV7A 5FX5A 3M7UA 1IQHA 2P94A 1HXFH 1O2YA 4TPIZ 3PRDA 3EA9A 1TBRH 1J8AA 2BDYA 3RXBA 1P9SA 1RJXB 1G3CA 2AH4X 1WQVH 5EPNA 2PR3A 2ZHFH 4FU9A 3F0OA 2H2ZA 4Y71A 2BDAA 2NWNA 1BRCE 1ABJH 1AVGH 1Y5UT 1HCGA 1WV7H 2ZGJA 3DHKH 3HPTB 2BLQA 1VR1H 3F9EA 1TPOA 1SFIA 2ZI2H 1ZTKA 2FI4E 2TRMA 4JK6A 1L4ZA 1VITG 4BAKB 1AZZA 3RLYH 1UCYH 1A3BH 4UONA 1Z7KA 2H6MA 4WVPE 5GNDA 3PV4A 2C8XB 4GVUA 2M5TA 4JYVH 4UFGH 1DWEH 3A8DA 1HJAB 5CHBA 1LKAA 1ZPZA 1Z71A 1XX9A 3AAUA 1P2KA 3E0NB 4E7NA 1YKTA 2O9QA 3Q3KA 1NROH 3RM2H 5ETXA 2VIQA 2BX4A 3ZZ5A 1BRBE 2Z94A 1ZHRA 2BY5X 1HAZB 3ZVAA 1AN1E 1P0SH 5J4SA 3RXFA 2UUFB 1AE8H 3AK5A 1QY6A 4BOHA 2R0KA 2WUBA 2C8WB 2VNTA 2F9NA 2FS8A 5C0UA 4CRDA 1ORFA 1SGPE 5A8ZA 1QB1A 3ZVFA 3PMHB 1PPBH 2F9PA 3S0NA 1GI4A 1GVKB 3VB5A 2D2DA 4X6MA 1LMWB 1EOLA 2VH0A 1HNEE 1MD8A 3URDA 2B0FA 3RXKA 2FTLE 2FI3E 1TAWA 2XC5A 4THNH 4XSKU 1E1QD 2ZC9H 1WCZA 4JZIA 1O3NA 2EI8A 2R3UA 4FUHA 1UVOA 3ZZ6A 2W5EA 1JBUH 1EPTA 4ZHMU 5FAHA 3EQ0H 3RMOH 3MH4A 1TOMH 1OYQA 3RLWH 4GAWA 1SGQE 3R3GB 1H8IH 2Z3DA 3GCHC 4O3UA 2Y5FA 5LGOA 1OS8A 1SLVB 2FYQA 1TLDA 2A7CA 1C5PA 2BD5A 1VGCB 4X8SH 3TJOA 1Y3UA 1SR5C 5PTPA 2XBWA 4INLA 1INCA 3U8TH 4WWYA 4FXGH 1CGHA 2ZDVH 5E0GA 1UW7A 4NFEA 1FY1A 4MPUA 3F2FA 5CE1A 1E79D 1GHXH 1RD3B 1VKYA 2FOEA 2CV3A 5EXMA 1TOCB 1WSSH 5GCHF 2ZHWH 4KP0A 5E8EH 2ZDKA 3MU4A 5HIYA 1HYLA 2BDGA 4K8YA 1O37A 3PROA 2EA3A 3GCNA 1ETSH 2RCEA 3TJNA 2CF9H 3ATMA 2G4TA 4Q63A 2ZTYA 3PMJA 2LELA 3SJOA 3P70B 2F9UA 3M61U 4AFZA 4JZ1A 2ZU4A 1M9UA 1JIMA 1OWIA 1RTKA 4B2CA 1G3DA 2ZZUH 4E06H 3BIUH 1RTFB 2OC7A 4I8GA 2ODYB 4DGJA 1CE5A 4ISHH 5SGAE 1SQTA 1VITH 5E2PA 2W7SA 1EJNA 4ZUHA 3A80A 3R0FA 1K1LA 3GY3A 4XBCA 5HXFA 4ABFA 1PQ8A 1PQAA 2ZWLH 1GI5A 1V2PT 4A7IB 1TYNA 2BLWA 3W94A 2GJGA 2QF4A 4Y79A 1P2OA 1TX6A 3BTTE 4FUEA 5KECA 2VIDA 2Y7XA 5A0AE 3O8CA 2HVYB 3GY7A 5FPTA 1HJAC 3D49H 3L3TA 1EAWA 3DUXH 3SGBE 1NU7B 5ESTE 1CA0C 4I33A 2AMPA 3W95A 1C9TA 2BD9A 3GOVB 5GCHG 4ABDA 4I86A 2J92A 4M7GA 2ODPA 1N6XA 3A82A 3QWCH 4AYVB 3KEEA 2A4OA 3C1KA 3OEED 3BF6H 3AVZA 1Y59T 2OINA 3MH5A 1EB2A 5CDFE 2WPIS 2L6OA 1XVOA 2A5KA 1PPFE 2BMGB 2KCPA 3K9XB 2XTTB 1C5LH 2BZ6H 1EJMA 5GIBA 2I6QA 3NCLA 1H8ED 5JB9S 4JYUH 1NU9A 1BMLA 1O2XA 3MOCA 3U28C 2VU8E 3BV9B 4RN6A 7ESTE 1GMHF 1GVLA 4NWLA 5DO4H 5C94A 4NGAH 1TNLA 3UB0A 2A2QH 1E35B 1K1MA 4OS1A 1SOZA 4MQAA 3FANA 1L4DA 1DS2E 3TLOA 3ATLA 1S81A 2VWNA 1EQ9A 1FI8A 1MCTA 3KN2A 2HNTF 1SGIB 5LPRA 5KEDA 2ZKSA 1OYTH 1U6QA 4TWYA 1SB1H 1YCPM 2KZ4A 2VJ1A 1EPTB 2XWAA 1YY3A 1MKXK 2TPIZ 2HPQH 5E0HA 5LPEA 1TABE 1FQ3A 2SNWA 5C1UA 1ELAA 4TPYA 2JJ2D 3QTVH 1ZMLA 2XW9A 1GBCA 1O3GA 1TX8A 3P92A 1VGCC 4MVNA 2BD7A 2FESH 3QN7A 5L6NH 1C1MA 2P3UB 3D23A 4ISOA 1LHFH 1KXFA 1TPAE 1W0YH 2ZU2A 2ZGXH 3I78A 5T3HA 4X1QU 3AW1A 1DPOA 3VFEA 4XBDA 4NIVA 3PM3A 1E1RD 1QFKH 1XVMA 2H9HA 1C2EA 1LVOA 1IOEA 7GCHF 2HLDD 1K0HA 1AY6H 3SV7A 3H09A 4ASHA 1GMHG 1MKWH 2VIWA 3SJIA 4Y8XA 2PSXA 2XC4A 5EXLA 1SC8U 9ESTA 3S9CA 3KNXA 3RP2A 4CR9A 1DWCH 4IW4E 3TK6A 2BD2A 1FY5A 1BMNH 1K9OE 2OXSA 1FAKH 1ZRBA 3BTEE 1D3QB 4FUDA 1VZQH 4GHTA 4HFPB 2B7DH 2V3OH 5A8YA 2PTNA 3GICB 4FVDA 5EPYA 2QXIA 3ZZ7A 2KCAA 1EATA 1HLTH 3MO6A 4F55A 4AFSA 2GZ8A 1DWDH 4E7RG 1SHHB 5C20A 3RXPA 1YPKH 3ATWA 2VIPA 2UWOA 1V2MT 3ATKA 3FZZA 1C2JA 1TE0A 4TT3D 1WU1A 1SLXB 4UEHH 3ZVBA 4LZ4B 7GCHG 1BTZA 1YCPK 2EEKA 3RU4T 1OP0A 1SGCA 2HALA 1N6YA 1T8NA 3DT0H 3RXLA 5C17A 1L2EA 1V2VT 4LOYH 1EUFA 1C1NA 4UFEH 2GGVB 4AGJA 4I8HA 3A7VA 3ZZ4A 1CSOE 4Z1MD 1O3HA 3LONA 1AZ8A 3TK5A 3KHVA 1W0JD 1HDTH 2UWLA 1THPB 9LPRA 4WJG2 3SJKA 1QB6A 2IJOB 3M5NA 1Z8GA 4WMEA 2NU2E 2OP9A 1BMAA 1EOJA 1A1RA 3AASA 4Q7YA 2A5AA 1H9HE 1LCYA 4FUGA 5LH8A 3BSQA 1V2RT 2AIPA 5JBBS 4B6EA 1SGTA 4KGAA 3UNRA 2R2MB 1OXGA 2CHAB 3A83A 4NA8A 4ZHAA 1O2HA 3ZZ3A 2ZFSA 2A7JA 1C5RA 1YM0A 3L6PA 3A81A 1B0FA 1EPTC 1ZGIA 3A86A 2VINA 4MPWA 1MTWA 4X2XA 5C67A 6LPRA 1FJSA 2GCHF 1VCWA 3UPEA 1ABIH 3WY8A 3GY8A 1J17T 1GHAF 4Y11E 2VWMA 1NZQH 3P95A 1QL7A 2BQWB 2GTBA 2PKAA 4AFUA 1EZUC 2L74A 1P2IA 2VBCA 3TPIZ 3RDZA 2Q6DA 1D6RA 2O8LA 3A7XA 1O0DH 2ZU3A 1Z6EA 1G36A 2CMYA 2QF3A 1DWBH 1Q31A 1NC6A 2J5UA 3NUMA 2BXUH 1P8VC 1QNJA 4VGCB 5F8TA 4D8NA 2RA0A 2KM0A 1C2HA 1OPHB 8LPRA 1O33A 3SI3H 1SHYA 3F9FA 3A89A 1BUIA 2Z3EA 4CBOA 4YM9A 1W7XH 2ALPA 4AB9A 1O2KA 1TWXB 1YYY1 3RC5A 3KQCA 5HM9A 4ZKRU 4I31A 4Q7XA 1GG6B 2RFKC 1W11U 1BBRE 4O03A 1TONA 1O3IA 4CREA 1HJ9A 1GHAG 3F6UH 2C4FH 4CH2B 4FUFA 1Q2WA 2V3HH 3PMAB 5GXPA 3S9AA 2J95A 2HVXA 3OU0A 2BY6X 1OWHA 1C5VA 1GBKA 2OLGA 2G5NA 1C5YB 2PKSB 3UNQA 2FWWA 3F9HA 3MI4A 1YWUA 5T1VA 1A61H 1DSTA 1BA8B 1L1NA 1O5DH 2ZPSA 1V2OT 3E3TA 3RM0H 1GBFA 1DICA 1GI7B 4IGDA 4SGBE 4CBNA 3QGJA 4GSOA 2OC0A 1BRAA 1C2MA 2QXJA 3SV9A 2VH6A 1F0RA 3MH6A 2WPLS 4KTSA 4UFFH 3ZV8A 1O2UA 2F3CE 1DE7H 2ZDLA 1FY8E 1CA8B 1ID5H 1HB0B 5L30H 3TJVA 1NRPH 2FOAA 2JETB 2Y80A 1RXPA 3RXUA 5T6FA 1JMOH 1AKSA 5BRRE 1T4VH 2C90B 2CHAC 1GHBG 1NFWA 4A5TS 2QAAA 1P9UA 1YPJH 3P6ZB 1XXDA 3RXDA 2B5TB 4Q2KA 3T62A 1C1UH 3EA7A 5FBEA 3LDXH 2BHGA 3UTUH 3S7HB 2FODA 3SU6A 3MNXA 1MTSA 2WPMS 1H9IE 1TGNA 3ZZBA 3A8BA 3QGNB 5FX6A 1CHOF 1JXPA 2AYWA 1IAUA 4TYDA 4D7GA 2FX4A 3GISB 5GPIB 1G30B 2ULLA 6ESTA 2PKAB 4M9FA 1GMCG 3SJ9A 5H4IB 2FP7B 3UIRA 5DJ7A 4BANB 2PLXA 4YXWD 3LT3A 1BQYA 3SQHE 2H9EH 3M36A 3U69H 1GBLA 4HGCA 4VGCC 2AHME 1UK3A 1VCQA 1ZMJA 5GDSH 2Y81A 4AOQA 1H1BA 2QXGA 4UD9H 1HAHH 2SGDE 5J4QA 1C1SA 4AORA 1WXRA 1C2DA 5A0BA 1UCYE 1SGNE 2FLRH 1W8BH 1HAOH 3FFGA 2PV9B 2J97A 1CVWH 4ABEA 3LOXA 4NSYA 2QC2A 5HYOA 1OHHD 2F4LA 3RC4A 1GG6C 1V2NT 1MAXA 1EAUA 4DIIH 1W7GH 3KCGH 1CHOG 3LJJA 3LU9B 1SVPA 2BDCA 3TVJB 1XXFA 1JOUB 4NIXA 3QZQA 1JRSA 1BBRK 4ZH8A 5EJ1A 2ZFTA 4ISIH 1QR3E 2ZFFH 1Z8RA 1T4UH 2R2WU 2ZDNA 2PKSC 1MTNB 2IPHA 2VVCA 2BX3A 3OX7U 1O3FA 4DW2U 2FEQH 1OSSA 4HZHA 2J98A 5IK2D 1O39A 2GP9B 1O3BA 3TIUA 2ESTE 1MQ6A 3K2UA 1F0TA 2KCYA 3TGIE 2Z7FE 2FLBH 4BTIB 3UQVA 1S83A 1BHXF 1ZMNA 3RXRA 2ILNA 3D62A 5FCRA 1O34A 1KDQA 2ZECA 5ESBA 1QQUA 1DDJA 1O5AB 2UWPA 2YNAA 1KXDA 3DFLA 5AHGH 4D76A 3VB3A 2OQ5A 4Y8ZA 2ZPRA 5IYTA 2TBSA 2H5DA 1QL9A 4LXBH 2P3FH 3E6PH 1Q3XA 2JETC 5DP7A 1O38A 3M35A 1J15A 3GY2A 3ZZ8A 1QJ6B 1AVWA 2ZDAH 3RC6A 4AN7A 3EGKH 2AEIH 1AKSB 2XBVA 4MPXA 2ZTZA 4ZCNA 2ZQ2A 1MZAA 4XD7D 4I8KA 4I7YH 1UTJA 1TPSA 1C1OA 2Z9IA 5EOKA 2BD3A 4U01A 5DP5A 1WTGH 1QCPA 3ZVCA 1UTNA 2ZEBA 3BEFB 1D3TB 2ZPQA 1P06A 3SU3A 3UREA 1FNIA 1C5WB 3SV2H 3QK1A 3RMNH 1GJCB 1ZPCA 5EQRA 1O2TA 1O3CA 3Q77A 3LGVA 3QTOH 3HKJB 2WPJS 3SBKA 1ESAA 3UFAA 2A0QB 2FOMB 1SQAA 2B8OH 4BNRA 3VEQB 1TX7A 4DJZB 3MNBA 2G55A 4IN2A 1AWHB 1DFPA 3W1EA 1DM4B 2YMSB 1YC0A 1CGJE 3SHAH 4X2YA 1A0LA 2PW8H 1ANCA 3LGYA 3ZVDA 1H9LB 2BD4A 4HTCH 3RXJA 4WXIA 4H6SB 2XXLA 1BRUP 2FO9A 1DX5M 1C2KA 1LQEA 2OC1A 3AAVA 1UCYK 4NFFA 1ANBA 1GBIA 1ZOMA 3O8RA 1YPLH 3BTFE 1FDPA 3A85A 3SNEA 1AUJA 1QIXB 2C3SA 3OY6U 3TH4H 3ITIA 2HLCA 4A92A 1DSUA 3ZYEA 2FI5E 3RXEA 1TNIA 4OS6A 3OTPA 2XRCA 2P95A 4YOGA 1N1LA 2NU0E 1ZSLA 3FN8A 4CRFA 4B2AA 1AHTH 1C5ZB 3NWUA 1WBGB 1ELVA 1C5UA 1O36A 2A4GA 2FM2A 1SSXA 4AX9H 1OOKB 1GWAA 1TMUH 3EAJA 4WMDA 4FU8A 1GMDF 4K1SA 1UVSH 2H9TH 2WV9A 3DFJA 2KAIA 4LK4A 2J98B 4GPGA 1XUJA 2BLOA 3ZVGA 4U30A 1AB9B 3EE0B 1YPHE 1KXBA 2OBOA 2FXRA 2BDIA 2BY8X 2KR7A 3QUMP 1KLTA 5EW2H 1P04A 4Q4LA 4K69A 4YLQH 2BY9X 1K22H 4Y0ZE 5DSFA 1KDQB 3NRLA 3DSPA 2CK3D 1T8OA 4FETA 1CO7E 1CT0E 3HATH 3RXAA 2O8UA 1QBNA 1Z6JH 4ACAA 3VGCB 4NZLA 4ZKOU 1V2JT 1YPEH 1EAIA 1MTUA 2AGIX 2G81E 4AG1A 3E91A 1LQDB 3KIDU 1F5LA 4Y8YA 5FL7D 3GDUA 4H4FA 4B75A 2HGTH 4DVAU 2F9VA 5EG4A 2NU4E 8GCHF 2FTMA 5FBIA 2ANWA 5DG6A 1LHEH 1N8OB 1K1JA 5KGOA 2UUKB 1TFXA 4YTAA 4X2VA 1CBWB 1EJAA 4OS7A 3TJUA 3UOUA 2QGRA 1AFQB 5G4BA 2ZGCA 1K2I1 1TPPA 3RXHA 1V2UT 2SNVA 1FY4A 2JH0D 1PPCE 1P2JA 1SLWB 3JZ1B 5DP8A 3SU2A 2AIQA 2ZU1A 1QBVH 3UNSA 4CH8B 4YZUA 1IQGA 1IQNA 2FMJA 4YT6H 1Y8TA 1ELTA 1AIXH 1GL1A 1O2PA 1VCPA 1ZPBA 3BTME 2GMTB 1IQLA 1GHVH 4MLFB 3NZIA 1YLNA 2YMSC 3LPRA 3RXMA 1E34B 1GBDA 2QY0B 2ZCKP 3GY6A 4TY6A 5AF9H 5B6OA 1GJ4H 2JKHA 1QQ4A 1O2ZA 2Y6TA 1GCTB 2ZO3H 1FY3A 8GCHG 4BTUB 1BTXA 1C4U2 1WAYB 3A7ZA 1H4WA 1ZGVA 3M3SA 5DKMA 5T6DA 2ANKH 1GBBA 2V6NA 1TQ7B 2SGPE 3SZEA 1AE5A 2WYJA 3T28A 2XWBI 1JRTA 3MO3A 4ABIA 4AYYB 3WW7A 4ABBA 1TRYA 4X8VH 1LVYA 2ZFQH 5A09A 3QLPH 4DT4A 2D26C 2PGQB 4RT0A 1G3EA 1L1GA 5L2YH 5ABWA 4IC6A 4NIWA 1TQ0B 2XNIA 4R8TB 4I32A 3VG8A 1D4PB 2R9PA 2KAIB 1C2LA 1GDQA 1AB9C 3IWMA 5EW1H 2PUXB 3M5LA 4NSVA 1MH0A 4O97A 2H1UA 4RI0A 2ZTXA 1AVXA 3MNSA 1EP5A 2QE7D 1LVMA 1RRKA 1EFRD 5JBCS 1UTOA 1K1OA 4WH8A 3DSGA 1BDAA 3ZYDA 5GWZA 4K1TA 4INHA 3WWBA 3M7TA 3PTBA 2OK5A 4FUIA 3BEIB 2BD8A 3G01A 1GBJA 3SV6A 3VGCC 3BIVH 1S84A 5DP3A 1CHGA 3RXCA 1KLJH 2DE8A 1EZQA 4A6LA 3VB6A 1E37B 2BZAA 1CT2E 2G51A 4RKOB 1PQ5A 1V3XA 3U9AH 2PGBB 1GCDA 1HAGE 1GDNA 1O3EA 1YLCA 3PV5A 1N8OC 4YO9A 1E38B 1SI5H 1CBWC 3PV2A 2AFQB 1FXYA 2ZCLP 1AFQC 1GJ9B 3MYWA 5JBTA 2QA9E 2WINI 3MWIU 1B5GH 1UJ1A 3SUDA 1BJUA 3VXFH 1ZLRA 1C1RA 3E0PB 3PTNA 2KFWA 3FAOA 4DT7B 2GD4B 1MKWK 2GMTC 1P10A 3OYPA 2J4IA 2P59A 2HNTE 6GCHF 1A2CH 2V3MA 3GDVA 3UWJH 3ATIA 3TH2H 1GPZA 4ISLA 1SGFG 3L33A 2SFAA 2C8YB 2GCTB 2GVFA 4R0IA 4AZ2B 3RXSA 1GCTC 3HGNA 4XE4A 3LGTA 1E0FD 3CP7A 1SPJA 4Y7BA 3KQ5A 1A7SA 3N7EA 3UR6A 1HUTH 2BDHA 3IG6B 1OX1A 2OC8A 4MNXA 2OTVA 1IQKA 4AFQA 3PB1E 3DA9B 2DE9A 1PJPA 1FX0B 8ESTE 1NESE 2FOHA 1C5OH 4B1TA 3GCOA 4FUBA 4HI3A 5F8XA 3SNDA 1HXEH 4XOJA 4F4OC 1ELFA 3TITA 4O9VA 2K0QA 1T31A 1QRWA 3SHCH 2D1JA 4WH6A 4ZROA 1VJ9U 4MTBA 3ZVEA 4K5ZA 5FPSA 2SGEE 6GCHG 1BB0B 3PLPA 1D6WA 1CT4E 1W10U 1J16A 3BTDE 2BVSH 1Y3WA 2BY7X 5HKKD 1TMTH 2GCHG 1G3BA 1ETRH 3KYFA 1HRTH 3M7QA 4NA7A 1K1NA 2FZZA 1O3JA 3A8CA 1KTSB 3V0XA 1LHDH 1DVAH 1G32B 1KSNA 3HK6B 1VJAU 3Q3YA 3MU5A 2CF8H 2VVVA 1F0UA 3Q00A 1ZHMA 1O3KA 5JYIA 1C2GA 5A0CA 4MDSA 2AGGX 4JZEH 2GT7A 3RXIA 1RIWB 5DP9A 1UTLM 2FOCA 3CENA 2UUYA 1P3CA 1SG8B 1GI0A 1YPGH 4ZKSU 3BG4B 4FUCA 1CU1A 2XBXA 3E90B 4FVBA 3E16B 2JDID 3FP7E 1QA7A 3TH3H 1TGCA 1ELEE 1GJBB 2BQ7B 4WXVA 5DGJA 4DURA 2WV4A 4AGKA 5I25A 3P8OA 1GHWH 1L1JA 1TALA 1O31A 1UVPA 2VWLA 1O2LA 2ZGHA 3RXGA 3BEUA 3I29A 4Y7AA 1OP8A 4OS4A 2SGAA 5FCKA 2F9BH 1SLUB 1TIOA 1O3PB 1NFYA 4NWKA 1MMJN 3STIA 4BAOB 1RFNA 1O2NA 4E05H 1B7XB 1MABB 4X8UH 1C5QA 2HRVA 6CHAB 1W13U 1DY9A 4K8BA 5F53A 2ANYA 1C5SA 1QJ1B 1P11E 1SGEE 4ZXYH 1SGYE 1V2LT 2Q6GA 3T25A 1TGBA 2B9LA 1GJ6A 3BTHE 1ANEA 3LGIA 3PMBB 2J34A 2FOGA 2F9OA 1YPHC 1CGIE 3SN8A 2GCTC 1ZYOA 1Y3XA 1WTHD 1Y5AT 1TMBH 3MMGA 2BDBA 1SKYE 2VIVA 1ZR0A 2LP6A 4ABGA 1S6FA 3UR9A 2F91A 5EJLA 1PQ7A 4A1TA 4CRCA 3SUEA 1UO6A 2GDEH 1K28D 4WF8A 3F0PA 2A1DB 1C2FA 3RXQA 2ZP0H 3EE7A 2A4QA 2RA3A 5CHAB 3TGKE 2VWOA 4UFDH 1O2RA 2A45B 1ZSJA 5EGMA 2YNBA 1AD8H 3KQDA 3F2GA 1GI6A 1O32A 5DK1A 1D9IA 1LPGB 1C5NH 1KY9A 1XKAC 1ZRKA 1OWDA 1GBMA 3V13A 1G2LA 2Z3CA 3SI4H 3VB7A 2XNDD 2QF0A 2GDDA 4IS5A 4Y0YE 1Z8JB 1TA2A 4IBLH 1PPZA 1XM1A 2ZF0H 1NFXA 3TNTA 4ZAEA 4MNYA 2PFEA 2EI6A 2GT8A 1GHYH 1MTVA 3SU0A 4Q80A 5C0TA 1FMGA 3SJ8A 1O2WA 5EIYA 1MQ5A 2ZFRH 3LKWA 1VITF 1FPHH 2PP6A 4ZXXH 1S0QA 1COWD 1FIZA 1LPZB 2ANMH 4B6FA 3OFND 3TNSA 1KIGH 2BM2A 1QTFA 1O2OA 3MQKC 1HJ8A 1ZHPA 1AQ7A 4YOIA 1HIAA 1AFEH 1RIWC 1XMNB 1MU8B 1O2VA 3CS0A 1C2IA 1AMHA 5A8XA 3EYDA 3BG4C 3HGPA 2TGPZ 1IQFA 1BCUH 2XBYA 2YOLA 1F2SE 5C3NA 1DXPA 3M5OA 1SGDE 2QN5T 1MBQA 4X6NA 3TU7H 5JPMH 3SNCA 1FPCH 2PSYA 1GBEA 1PPEE 1W0ZU 1P09A 2P8OB 3FZDA 3NXPA 2EQNA 3ZZDA 2CXVA 3A7WA 5DP4A 3SGAE 1NRRH 3GY5A 5CMXH 1TB6H 2XCNA 1YPMH 2Z9GA 3ZZ9A 1QA0A 1Z1JA 1O5EH 3RXOA 4K1EA 2ALVA 4XRNA 3A8AA 6CHAC 1IHSH 2UUJB 1NN6A 1HFDA 1C9PA 1KXCA 1C1PA 4B76A 3UAIC 1J14A 2EC9H 2FPZA 5K7RA 1GGDB 3MO9A 1V2ST 3RMLH 1ETTH 2XOKD 1EB1H 3BTWE 2C8ZB 2FIRH 1S6LA 1OWJA 4IMQA 4B2BA 2J2UA 5EODA 3MNCA 1FIWA 1GI8B 1GI2A 5DN6D 2QF5A 1IQEA 2A5IA 2PTCE 2QIQA 2TGDA 2O8TA 3S9BA 4BXWA 1UHBA 1CA0B 1TGTA 4ABJA 2QYIA 2H5CA 3PLKA 4H6TA 3UY9A 2CJIA 1FONA 2ZHEH 3MH7A 4KTCA 1FN8A 1SQRA 1MUEB 2J9NA 2CGAA 2J94A 1TBQH 3MTYA 3PYHA 1FAXA 4DIHH 1WUNH 4NZQA 3QO6A 5CHAC 1CQQA 1KXEA 1MD7A 2TGAA 3KYGA 1T8MA 4JMYA 3BTGE 1HAIH 5T6GA 1O3AA 5JB8S 1LKBA 3F3BA 3BTKE 3PWCA 2G5VA 2R0LA 3ODDA 3LC3A 2W7UA 3MU8A 5EQQA 4Q7ZA 2ZA5A 1O3OA 2O8WA 5C1XA 3DD2H 1E36B 3FVFB 4CHAB 1Y3YA 4BTTB 4IC5A 3IITA 3A87A 1BITA 3H7OA 1H8DH 3STJA 1BTPA 1K1PA 5A2MH 1SQOA 1MAYA 1F0SA 2LNCA 3LGWA 2OCVB 3B23B 3RXVA 1PPGE 2FOBA 5HM2A 3V12A 4IN1A 2EI7A 1GL0E 4RKJB 3CNRA 1GJ8B 2HNTC 5EXNA 4U32A 3E1XB 4AC9A 1KTTB 1MTNC 3P8NA 1HIAB 2D8WA 3FKSD 3OTJE 2QXHA 2Z9JA 5HGGA 4WMFA 4U2WA 3GCTF 4K3JA 3E8LA 2ZGBH 1FLEE 1DY8A 2YMSD 4F48B 1ZTLA 1DT2A 2ZIQH 1C5XB 4JZDH 4K60A 2VGCB 4IMZA 1OP2A 1BTHH 1P05A 4GHQA 4X0WU 1QHRB 4YESB 3Q3XA 1XUHA 1SL3A 5DP6A 2P8OC 4OM9A 1NBME 4FUJA 1UK4A 1EP6A 1OWKA 1WYKA 1TNKA 2SGQE 1P2NA 4YLUA 1MKXH 2ZNKH 5AVDA 2FX6A 5AFZH 4SGAE 3SOSA 1O3LA 4YT7H 3I77A 2V0BA 2KX4A 3B8JA 1PFXC 1V2WT 1XUIA 1ELBA 1W0KD 1GJDB 2GZ9A 3SYJA 2Y7ZA 1GGDC 1C4Y2 3URCA 1C1WH 3VB4A 1EAXA 2STAE 4DOQA 3LJOA 4A1XA 1TGSZ 1NRNH 4P02A 3VPKA 4F49A 3DSOA 1S6HA 3PO1B 1YF4A 1P57B 5FPYA 2PHBA 3U1IB 1ESBA 4ESTE 2ZHDA 1GMDG 3GCTG 2P16A 2ZFPH 1QURH 3KGPA 1AI8H 2W6ID 3SO3A 4D7FA 1YGCH 1UHBB 4KELA 2BTCE 4FOUC 2A7HA 1D3DB 2WPKS 1AWFH 3LH1A 1WDIA 5C5OA 2XCFA 2I6SA 4MG3A 2WSSD 5AFYH 2BVRH 5B6LA 1DUEA 2VIOA 1O30A 5GJ4B 4NCYA 4K2YA 3UOPA 1UTMA 1KXAA 1RGQA 1AO5A 4X6OA 3UUZA 3A7YA 2V35A 2WUCA 5FXLA 2BOHB 1Y3VA 1RS0A 2P3TB 2Z9KA 3ZIAD 5DPAA 3FP8E 2OQUA 2NU1E 3BN9A 3RUOA 2Z6BD 3MU0A 2XC0A 1QB9A 3N7OA 4WY3A 3M3TA 3V3MA 4MPVA 1LHCH 3RU4E 5EQSA 3T5FH 3QZRA 7LPRA 4CHAC 2BOKA 5F6MA 4H42U 4X1PU 5C2ZA 1YCPH 2BLVA 1LDTT 1NFUA 1SGRE 1TNJA 1DLEA 4ACBA 1BIOA 3K6YA 1BMMH 2Y82A 3F1SB 1ZJDA 3SZNA 3GY4A 3S7KB 3V7TA 1P12E 2LPRA 2AMQA 1EZSC 3SV8A 3GYMA 5E2OA 3T29A 1O2MA 2ZQ1A 3KF2A 2JIZD 3U8OH 2AERH 8KME2 2Y5GA 4OGYA 1BTWA 2P93A 1P2QA 4X2WA 1O5BB 1O5GH 1O3DA 1WQSA 1NRSH 4OGXA 1DOJA 1Z8IB 1UTKA 1NO9H 2OUAA 1FV9A 1HPGA 1T32A 3AW0A 2IPQX 2PUQH 1GBHA 3T27A 2ZHQH 3P8GA 1OKXA 4J2YB 1SMFE 4OS5A 1QZ8A 2GX4A 1T8LA 1XUGA 2VGCC 1ELDE 1TNGA 4NA9H 1ANDA 2SGFE 4ISNA 4JZFH 1A4WH 1EKBB 2FOFA 1ZZZA 1T7CA 1K1IA 3EDXB 2HOBA 2VVUA 1BOQA 5TCAA 1UVTH 2R3YA 1FZZA 2G4UA 4Y76A 5C5NA 1BTYA 5TCCA 3SUFA 3B9FH 1LO6A 1BT7A 1GI1A 2TGTA 4B71A 2J38A 1QRXA 4X1SU 5C1YA 3P17H 1V6DA 1EXFA 1LVBA 1QRZA 2F43B 1AUTC 1HAPH 3O8DA 2ZU5A 2VB0A 1D3PB 3LGUA 1GI9B 5JDUB 2ODQA 2ZG0H 2M2AA 3DCLA 2TIOA 4DG4A 3U1JB 1Y5BT 3QDZB 3PO1C 1MCVA 3N99A 2QV1A 3SQEE 4D9QA 1AGJA 3UWIA 1BJVA 4LZ1H 3ELAH 3FO8D 3CS7A 4MNWA 1O35A 1QL8A 4X1NU 2WV5A 4DCDA 2WPHS 1GI3A 1O5CB 1UMAH 1O2QA 2WPDD 4BXSA 3KQBA 2AGEX 3LIWA 2JJ1D 2STBE 3ODFA 2BB4A 3RXTA 2W26A 3Q76A 1THRH 5IDKA 4FU7A 1KMHB 4XFQA 3NKKA 1NTPA 2WZQA 3PRBA 1J9CH 4KTUA 1PPHE
chains in the Genus database with same CATH topology
3H7TA 1QGFA 3MHWU 1B0EA 2JH6D 4BAQB 1BTUA 2BYAX 1W12U 4INKA 3OSYA 3SU1A 1BHXB 4D9RA 2NU3E 5FHTA 3U98H 4UDWH 4BAMB 5TJXA 1G37A 3KQEA 1YP9A 2G8TA 2G00A 3U8RH 4ZKNU 1MZDA 2AMDA 4GUXA 2FDAA 1GJ7B 1QJ7B 4X6PA 4ABHA 1GBAA 1LTOA 1W3CA 1QBOA 1C5MD 4O3TA 4YOJA 1EASA 1UTPA 4CRBA 4CRGA 1JIRA 1LHGH 1JWTA 1A5IA 4ABAA 1HAYB 1P3EA 3VXEH 4Y10E 3H5CB 3F9GA 3LC5A 1O2GH 4A1VA 1NS3A 4J1YA 1F5RA 3D65E 3ZZCA 3HK3B 3SGQE 1NM6A 4Z0KA 3A88A 4B73A 2GV6A 4OS2A 1V2KT 3ZZAA 1ESTA 4XBBA 1A5HA 1X7AC 4GLYA 1ARCA 5HMAA 4BAHB 2Q6FA 3SORA 1RTLA 1L0ZA 1C1QA 2A2XH 4Z6AH 1DXWA 2DUCA 4X1RU 3JZ2B 1W14U 2XYAA 1TBZH 2ZDMA 3K65B 3O8BA 2FYRA 1V2QT 4AB8A 3K6ZA 1EZXC 1GDUA 2W3KA 1S85A 5LPFA 1YLDA 4PROA 1BZXE 1PYTD 1C5TA 2OBQA 1ZSKA 2CN0H 4B74A 1TNHA 1HAVA 4TY7A 1ELCA 4ZMAH 1A46H 3SNBA 2Z9LA 2ZCHP 1GHBF 1LPKB 1O2JA 3PWBA 1F5KU 2THFB 4Y6DA 1KLIH 1DLKB 2A32A 1OWEA 3A84A 3GDSA 3FP6E 5L2ZH 1UVUH 2BQ6B 1G2MA 4NIYA 1ZTJA 4GCHF 4CRAA 1TRMA 2AS9A 1SFQB 2HPPH 1Z1IA 2A31A 1A0JA 2BVXH 4TWWA 3LH3A 1P2MA 5E0JA 2Y5HA 3NK8A 4KKDA 1F7ZA 3M3VA 1ZJKA 1IQJA 2GZ7A 1GMCF 3M37A 2GKVE 1NPMA 3EA8A 1S82A 2IOTA 3PLBA 7KMEH 2ASUB 1C1TA 1F92A 4I8JA 1DANH 1IQMA 1SBWA 1DUAA 1NRQH 1C4V2 4JCNA 3GYLB 2O8MA 1G9IE 2W3IA 3TK9A 1ACBE 1ARBA 3SU4A 2OD3B 1BBRH 4AG2A 1P02A 2HWLB 3SUGA 2GV7A 3RU4D 1O3MA 4XDEA 1GVZA 2Q1JA 2IN2A 1O2IA 1K21H 1GJ5H 4NG9H 4CR5A 2K1QA 1NT1A 2C93B 3SU5A 3T2NA 3T26A 1HAXB 1NY22 1PYTC 1W2KH 1SGFA 4GCHG 1MBMA 1TRNA 2WYGA 1S5SA 5JBAS 1GJAB 3NPSA 4MNVA 5K0HA 1IHTH 3F68H 1KYNA 1MU6B 3ENSB 5I46H 3ZV9A 1UTQA 2JH5D 3S69A 5F8ZA 3SW2B 1C1VH 3KL6A 1GBTA 1FUJA 3BG8A 4JK5A 1XUFA 2F83A 3ESTA 3SNAA 3C27B 1IQIA 1FN6A 4RSPA 5F03A 1HBTH 1A5GH 5BPEA 4UE7H 1HGTH 2RDLA 4ZHLU 3RMMH 4JYTA 3UQOA 2G52A 1DITH 4I8LA 1GHZA 1A0HB 1UK2A 3BTQE 3M5MA 2A4RA 1V2TT 3MU1A 4X8TH 4DY7B 2QCYA 1YBWA 1P01A 3GCHB 1O5FH 3MFJA 1S0RA 3QX5H 1ELGA 1EX3A 1SOTA 3HKIB 3TGJE 5EU8A 2FS9A 3P8FA 2RG3A 1XUKA 1P03A 1WOFA 2BXTH 1A3EH 2PWXA 3A7TA 1HAVB 1TA6A 4QT8C 1AU8A 3OY5U 1THSH 1XKBC 1O2SA 1HV7A 5FX5A 3M7UA 1IQHA 2P94A 1HXFH 1O2YA 4TPIZ 3EA9A 1TBRH 1J8AA 2BDYA 3RXBA 1P9SA 1RJXB 1G3CA 2AH4X 1WQVH 5EPNA 2PR3A 2ZHFH 4FU9A 2H2ZA 4Y71A 2BDAA 2NWNA 1BRCE 1ABJH 1AVGH 1Y5UT 1HCGA 1WV7H 2ZGJA 3DHKH 3HPTB 2BLQA 1VR1H 3F9EA 1TPOA 1SFIA 2ZI2H 1ZTKA 2FI4E 2TRMA 4JK6A 1L4ZA 1VITG 4BAKB 1AZZA 3RLYH 1UCYH 1A3BH 4UONA 1Z7KA 2H6MA 4WVPE 3PV4A 2C8XB 4GVUA 2M5TA 4JYVH 4UFGH 1DWEH 3A8DA 1HJAB 1LKAA 1ZPZA 1Z71A 1XX9A 3AAUA 1P2KA 3E0NB 4E7NA 1YKTA 2O9QA 3Q3KA 1NROH 3RM2H 5ETXA 2VIQA 2BX4A 3ZZ5A 1BRBE 2Z94A 1ZHRA 2BY5X 1HAZB 3ZVAA 1AN1E 1P0SH 5J4SA 3RXFA 2UUFB 1AE8H 1QY6A 4BOHA 2R0KA 2WUBA 2C8WB 2VNTA 2F9NA 2FS8A 4CRDA 1ORFA 1SGPE 5A8ZA 1QB1A 3ZVFA 3PMHB 1PPBH 2F9PA 3S0NA 1GI4A 1GVKB 3VB5A 2D2DA 4X6MA 1LMWB 1EOLA 2VH0A 1HNEE 1MD8A 3URDA 2B0FA 3RXKA 2FTLE 2FI3E 1TAWA 2XC5A 4THNH 4XSKU 2ZC9H 1WCZA 4JZIA 1O3NA 2EI8A 2R3UA 4FUHA 1UVOA 3ZZ6A 2W5EA 1JBUH 1EPTA 4ZHMU 5FAHA 3EQ0H 3RMOH 3MH4A 1TOMH 1OYQA 3RLWH 4GAWA 1SGQE 3R3GB 1H8IH 2Z3DA 3GCHC 4O3UA 2Y5FA 5LGOA 1OS8A 1SLVB 2FYQA 1TLDA 2A7CA 1C5PA 2BD5A 1VGCB 4X8SH 3TJOA 1Y3UA 1SR5C 5PTPA 2XBWA 4INLA 1INCA 3U8TH 4WWYA 4FXGH 1CGHA 2ZDVH 5E0GA 4NFEA 1FY1A 4MPUA 5CE1A 1GHXH 1RD3B 2CV3A 2FOEA 5EXMA 1TOCB 1WSSH 5GCHF 2ZHWH 4KP0A 5E8EH 2ZDKA 3MU4A 1HYLA 2BDGA 4K8YA 1O37A 3PROA 2EA3A 3GCNA 1ETSH 2RCEA 3TJNA 2CF9H 3ATMA 2G4TA 2ZTYA 3PMJA 3SJOA 3P70B 2F9UA 3M61U 4AFZA 4JZ1A 2ZU4A 1M9UA 1JIMA 1OWIA 1RTKA 4B2CA 1G3DA 2ZZUH 4E06H 3BIUH 1RTFB 2OC7A 4I8GA 2ODYB 4DGJA 1CE5A 4ISHH 5SGAE 1SQTA 1VITH 5E2PA 2W7SA 1EJNA 4ZUHA 3A80A 3R0FA 1K1LA 3GY3A 4XBCA 5HXFA 4ABFA 1PQ8A 1PQAA 2ZWLH 1GI5A 1V2PT 4A7IB 1TYNA 2BLWA 3W94A 4Y79A 1P2OA 1TX6A 3BTTE 4FUEA 3O8CA 2VIDA 2Y7XA 5A0AE 3GY7A 5FPTA 1HJAC 3D49H 3L3TA 1EAWA 3DUXH 3SGBE 1NU7B 5ESTE 1CA0C 4I33A 2AMPA 3W95A 1C9TA 2BD9A 3GOVB 5GCHG 4ABDA 2J92A 4M7GA 2ODPA 1N6XA 3A82A 3QWCH 4AYVB 3KEEA 2A4OA 3C1KA 3BF6H 3AVZA 1Y59T 2OINA 3MH5A 1EB2A 2WPIS 1XVOA 2A5KA 1PPFE 2BMGB 3K9XB 2XTTB 1C5LH 2BZ6H 1EJMA 5GIBA 2I6QA 3NCLA 5JB9S 4JYUH 1NU9A 1BMLA 1O2XA 3MOCA 2VU8E 3BV9B 4RN6A 7ESTE 1GMHF 1GVLA 4NWLA 5DO4H 4NGAH 1TNLA 2A2QH 1E35B 1K1MA 4OS1A 1SOZA 4MQAA 3FANA 1L4DA 1DS2E 3TLOA 3ATLA 1S81A 2VWNA 1EQ9A 1FI8A 1MCTA 3KN2A 2HNTF 1SGIB 5LPRA 2ZKSA 1OYTH 1U6QA 4TWYA 1SB1H 1YCPM 2VJ1A 1EPTB 2XWAA 1MKXK 2TPIZ 2HPQH 5E0HA 5LPEA 1TABE 1FQ3A 2SNWA 5C1UA 1ELAA 4TPYA 3QTVH 1ZMLA 2XW9A 1GBCA 1O3GA 1TX8A 3P92A 1VGCC 4MVNA 2BD7A 2FESH 3QN7A 5L6NH 1C1MA 2P3UB 3D23A 4ISOA 1LHFH 1KXFA 1TPAE 1W0YH 2ZU2A 2ZGXH 3I78A 5T3HA 4X1QU 3AW1A 1DPOA 3VFEA 4XBDA 4NIVA 3PM3A 1QFKH 1XVMA 2H9HA 1C2EA 1LVOA 1IOEA 7GCHF 1AY6H 3SV7A 4ASHA 1GMHG 1MKWH 2VIWA 3SJIA 4Y8XA 2PSXA 2XC4A 5EXLA 1SC8U 9ESTA 3S9CA 3KNXA 3RP2A 4CR9A 1DWCH 4IW4E 3TK6A 2BD2A 1FY5A 1BMNH 1K9OE 2OXSA 1FAKH 1ZRBA 3BTEE 1D3QB 4FUDA 1VZQH 4GHTA 4HFPB 2B7DH 2V3OH 5A8YA 2PTNA 3GICB 4FVDA 5EPYA 2QXIA 3ZZ7A 3MO6A 1EATA 1HLTH 4AFSA 2GZ8A 1DWDH 4E7RG 1SHHB 5C20A 3RXPA 1YPKH 3ATWA 2VIPA 2UWOA 1V2MT 3ATKA 3FZZA 1C2JA 1TE0A 1WU1A 1SLXB 4UEHH 3ZVBA 4LZ4B 7GCHG 1BTZA 1YCPK 2EEKA 3RU4T 1OP0A 1SGCA 2HALA 1N6YA 1T8NA 3DT0H 3RXLA 1L2EA 1V2VT 4LOYH 1EUFA 1C1NA 4UFEH 2GGVB 4AGJA 4I8HA 3A7VA 3ZZ4A 1CSOE 1O3HA 3LONA 1AZ8A 3TK5A 3KHVA 1HDTH 2UWLA 1THPB 9LPRA 4WJG2 3SJKA 1QB6A 2IJOB 3M5NA 1Z8GA 4WMEA 2NU2E 2OP9A 1BMAA 1EOJA 1A1RA 3AASA 4Q7YA 2A5AA 1H9HE 1LCYA 4FUGA 5LH8A 3BSQA 1V2RT 2AIPA 5JBBS 1SGTA 4KGAA 3UNRA 2R2MB 1OXGA 2CHAB 3A83A 4NA8A 4ZHAA 1O2HA 3ZZ3A 2ZFSA 2A7JA 1C5RA 1YM0A 3L6PA 3A81A 1B0FA 1EPTC 1ZGIA 3A86A 2VINA 4MPWA 1MTWA 4X2XA 5C67A 6LPRA 1FJSA 2GCHF 1VCWA 3UPEA 1ABIH 3WY8A 3GY8A 1J17T 1GHAF 4Y11E 2VWMA 1NZQH 3P95A 1QL7A 2BQWB 2GTBA 2PKAA 4AFUA 1EZUC 3TPIZ 1P2IA 3RDZA 2Q6DA 1D6RA 2O8LA 3A7XA 1O0DH 2ZU3A 1Z6EA 1G36A 2CMYA 2QF3A 1DWBH 1Q31A 1NC6A 3NUMA 2BXUH 1P8VC 1QNJA 4VGCB 5F8TA 4D8NA 2RA0A 1C2HA 1OPHB 8LPRA 1O33A 3SI3H 1SHYA 3F9FA 3A89A 1BUIA 2Z3EA 4CBOA 4YM9A 1W7XH 2ALPA 4AB9A 1O2KA 1TWXB 1YYY1 3RC5A 3KQCA 5HM9A 4ZKRU 4I31A 4Q7XA 1GG6B 1W11U 1BBRE 4O03A 1TONA 1O3IA 4CREA 1HJ9A 1GHAG 3F6UH 2C4FH 4CH2B 4FUFA 1Q2WA 2V3HH 3PMAB 5GXPA 3S9AA 2J95A 2HVXA 3OU0A 2BY6X 1OWHA 1C5VA 1GBKA 2OLGA 2G5NA 1C5YB 2PKSB 3UNQA 2FWWA 3F9HA 3MI4A 1A61H 1DSTA 1BA8B 1L1NA 1O5DH 2ZPSA 1V2OT 3E3TA 3RM0H 1GBFA 1DICA 1GI7B 4IGDA 4SGBE 4CBNA 3QGJA 4GSOA 2OC0A 1BRAA 1C2MA 2QXJA 3SV9A 2VH6A 1F0RA 3MH6A 2WPLS 4KTSA 4UFFH 3ZV8A 1O2UA 2F3CE 1DE7H 2ZDLA 1FY8E 1CA8B 1ID5H 1HB0B 5L30H 3TJVA 1NRPH 2FOAA 2JETB 2Y80A 1RXPA 3RXUA 5T6FA 1JMOH 1AKSA 5BRRE 1T4VH 2C90B 2CHAC 1GHBG 1NFWA 4A5TS 2QAAA 1P9UA 1YPJH 3P6ZB 1XXDA 3RXDA 2B5TB 4Q2KA 3T62A 1C1UH 3EA7A 5FBEA 3LDXH 2BHGA 3UTUH 3S7HB 2FODA 3SU6A 3MNXA 1MTSA 2WPMS 1H9IE 1TGNA 3ZZBA 3A8BA 3QGNB 5FX6A 1CHOF 1JXPA 2AYWA 1IAUA 4TYDA 4D7GA 2FX4A 3GISB 5GPIB 1G30B 2ULLA 6ESTA 2PKAB 1GMCG 3SJ9A 5H4IB 2FP7B 3UIRA 5DJ7A 4BANB 2PLXA 3LT3A 1BQYA 3SQHE 2H9EH 3M36A 3U69H 1GBLA 4HGCA 4VGCC 1UK3A 1VCQA 1ZMJA 5GDSH 2Y81A 4AOQA 1H1BA 2QXGA 4UD9H 1HAHH 2SGDE 5J4QA 1C1SA 4AORA 1C2DA 5A0BA 1UCYE 1SGNE 2FLRH 1W8BH 1HAOH 3FFGA 2PV9B 1CVWH 4ABEA 3LOXA 4NSYA 2QC2A 5HYOA 3RC4A 1GG6C 1V2NT 1MAXA 1EAUA 4DIIH 1W7GH 3KCGH 1CHOG 3LJJA 3LU9B 1SVPA 2BDCA 3TVJB 1XXFA 1JOUB 4NIXA 3QZQA 1JRSA 1BBRK 4ZH8A 2ZFTA 4ISIH 1QR3E 2ZFFH 1Z8RA 1T4UH 2R2WU 2ZDNA 2PKSC 1MTNB 2IPHA 2VVCA 2BX3A 3OX7U 1O3FA 4DW2U 2FEQH 1OSSA 4HZHA 1O39A 2GP9B 1O3BA 3TIUA 2ESTE 1MQ6A 3K2UA 1F0TA 3TGIE 2Z7FE 2FLBH 4BTIB 3UQVA 1S83A 1BHXF 1ZMNA 3RXRA 2ILNA 3D62A 5FCRA 1O34A 1KDQA 2ZECA 5ESBA 1QQUA 1DDJA 1O5AB 2UWPA 2YNAA 1KXDA 3DFLA 5AHGH 4D76A 3VB3A 2OQ5A 4Y8ZA 2ZPRA 5IYTA 2TBSA 2H5DA 1QL9A 4LXBH 2P3FH 3E6PH 1Q3XA 2JETC 5DP7A 1O38A 3M35A 1J15A 3GY2A 3ZZ8A 1QJ6B 1AVWA 2ZDAH 3RC6A 4AN7A 3EGKH 2AEIH 1AKSB 2XBVA 4MPXA 2ZTZA 2ZQ2A 1MZAA 4I8KA 4I7YH 1UTJA 1TPSA 1C1OA 2Z9IA 5EOKA 2BD3A 4U01A 5DP5A 1WTGH 1QCPA 3ZVCA 1UTNA 2ZEBA 3BEFB 1D3TB 2ZPQA 1P06A 3SU3A 3UREA 1FNIA 1C5WB 3SV2H 3QK1A <