3A83A

Crystal structure of trypsin complexed with pre-synthesized (e)-4-((2-nicotinoylhydrazono)methyl)benzimidamide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a83A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a83A02
1YPGH 2A7CA 1BBRH 1NC6A 1S85A 1VCQA 5DP6A 3RXTA 1P2KA 5HM2A 1L4DA 1AKSA 3T5FH 2QF0A 1SC8U 1BRBE 1E0FD 2P93A 1QQUA 3T25A 1H9HE 6GCHG 2BMGB 3SZNA 2QXHA 4WY3A 5EW2H 2AGEX 2BZ6H 4O03A 4VGCC 3SU2A 2ZDLA 3B9FH 3LC3A 4FUFA 1OX1A 5FXLA 2J38A 3ZYEA 1IQJA 1O2OA 4FVDA 3K65B 4ZKRU 2SGAA 1NS3A 1K1LA 2CF9H 1IQNA 2ZDNA 5HYOA 4GPGA 1P10A 4JK6A 4CRDA 3V13A 4X1RU 2O8WA 2BD2A 4Q2KA 2A7HA 1P3EA 4MPWA 4MPXA 2GKVE 3GY3A 3NWUA 3TITA 2VNTA 2ZPSA 3OYPA 2XWBI 3BTTE 1UVPA 5LPEA 2BLWA 1E36B 1SGYE 5G4BA 1G2LA 1GGDC 2ZTYA 1ZTLA 3K6ZA 4AG2A 5GPIB 1GMHF 2R9PA 2XC0A 2BLQA 8GCHG 3M61U 1GJDB 5CHAB 3ZVEA 1RS0A 1DSTA 3M7QA 1GJ4H 1KYNA 1YKTA 2H2ZA 4NFEA 4X2XA 2FM2A 1P03A 1AE5A 2EC9H 3GISB 6CHAC 2H9HA 1DWCH 3K2UA 4NWKA 1SGCA 4D9QA 2GMTB 2AIPA 1FAKH 2Q1JA 2J4IA 1O3PB 1Y5AT 5C5OA 4FUCA 2QXIA 2Y5GA 3UOUA 2IPHA 2WPMS 1MMJN 1G36A 3A89A 4B71A 1G3BA 2XCNA 1GHBF 1AIXH 1SL3A 1GMDG 4WXIA 2OC7A 1LPGB 1MBQA 4Q7YA 1K1MA 1C2JA 2C3SA 1BJUA 4YESB 1AZZA 4Q7XA 5IYTA 3MU8A 3FZZA 4JZ1A 1D6RA 2BDYA 2F9NA 2V3HH 2OUAA 1D3TB 4TY7A 2Z7FE 1O39A 1S0RA 5EW1H 2BX4A 2SGFE 1SGTA 3IG6B 2ZFTA 2QC2A 3O8RA 5FHTA 1WTGH 2P16A 1NO9H 3BEUA 3ZZ6A 1NFXA 2VWOA 4BTUB 1QTFA 1O2MA 2PGBB 2OC8A 1J14A 3U98H 2BM2A 3ZVGA 3AVZA 1C1TA 1V2PT 3DFJA 2G52A 3QUMP 2VH0A 3HK3B 5DP4A 5TCAA 1UTNA 3S9AA 1QJ7B 2K1QA 3RMLH 3A7VA 3FP6E 2ANWA 1C5WB 3A81A 2ZGCA 1W13U 1YGCH 2G00A 2ZNKH 2FS8A 1ZR0A 1LHEH 2AGIX 2V0BA 4Z6AH 2F9VA 1SLWB 4OS7A 5EPNA 3SU6A 3ZVCA 2HNTC 3MU1A 1QBNA 1MTNB 1TAWA 3ATKA 3RXDA 1O3JA 4RKOB 1UCYE 5TCCA 1ESBA 2ZEBA 1DWDH 1O34A 1PQ7A 1TNJA 2A31A 1FY1A 1ANBA 1TNKA 2KAIA 3OTJE 3K9XB 4ISLA 1TX6A 4K60A 5LPRA 1DITH 1QJ6B 2XWAA 1ZSKA 2ZU1A 4LZ4B 3VB5A 1VR1H 3LGWA 4X6PA 3SOSA 3EE0B 1P2MA 1DT2A 4YO9A 1DDJA 2G5VA 1W0YH 1GBHA 4RN6A 2F91A 3GY5A 2VWNA 2NU4E 4BAOB 4ISHH 4Y79A 1NU9A 4XBBA 2BVXH 3E16B 2XRCA 1MQ6A 4H6SB 2CF8H 1HJ8A 2VIVA 2G51A 4Z0KA 1DVAH 1EAWA 3HGPA 1A5IA 2VVCA 1KXBA 3SJIA 2Y82A 3QZRA 3TJUA 2OC1A 1GHXH 1QRXA 3LGIA 1EOLA 4YOJA 3RXSA 3EYDA 2QV1A 1OWKA 4BAHB 1KXCA 3A88A 3RDZA 2GGVB 4YOGA 2FTLE 5F8ZA 1YLDA 1NU7B 2OC0A 2BY5X 2SGEE 4DW2U 1WOFA 4ISNA 5JPMH 5A0BA 3E91A 5EG4A 1S81A 4AYVB 1JRTA 2GDEH 2XC4A 3OU0A 3SV2H 3UNRA 4YOIA 1C2KA 1GJ5H 2J9NA 3FFGA 3H5CB 3LH1A 4GHTA 3PLPA 1W11U 3VGCB 4CRBA 1C5ZB 4B2CA 1HLTH 2FOGA 3LJOA 1ACBE 3T27A 3UFAA 2ZC9H 3MH4A 1O30A 2D26C 2PW8H 1G3EA 1C5OH 1MAYA 2XW9A 3SUGA 2A32A 1O32A 1W12U 1DXWA 1VITH 4CR9A 3BG4C 1CGJE 2H6MA 5FBEA 3P8GA 1Z8JB 1TX7A 2Q6DA 1WBGB 1YP9A 2YOLA 2HPQH 1C9TA 1O2IA 1QRZA 1L2EA 1GJ6A 1TFXA 1ETTH 4IS5A 1OWDA 1QB6A 1ZYOA 1RIWC 2ZHEH 2R2MB 4R8TB 2WPHS 5EPYA 3UOPA 2B0FA 2G55A 2THFB 3RC4A 1T8LA 1EOJA 1YLCA 1ZTKA 1ZHPA 2ZZUH 4FUHA 4D76A 3TH2H 1P2JA 5AF9H 1OP0A 2H9TH 2HNTE 2BD4A 3TIUA 5GCHF 1OS8A 4QT8C 2QCYA 1P2QA 4GSOA 2JKHA 3SGAE 4CH8B 3GCHB 2AEIH 2W3KA 2P3TB 3OX7U 1NTPA 2ZTXA 1EZSC 2BTCE 4JYVH 5ESBA 3SU3A 3VB4A 1GDNA 1HAZB 3E90B 1C5RA 1MU6B 4F4OC 4A1VA 1AUJA 3QN7A 5EODA 3N7OA 1KY9A 4FU9A 1CU1A 4R0IA 1AGJA 3EDXB 1B0EA 3NXPA 3BTEE 3M5LA 1VCWA 3A85A 1GPZA 2W7UA 3PWBA 1V2NT 2BDHA 1C5PA 2JH5D 3M7UA 4FUEA 1TOCB 3SW2B 2EA3A 5JBTA 4Y71A 3PLBA 2FI3E 1K1OA 1MBMA 2FP7B 4WVPE 2VIWA 1IQLA 1O36A 3VB3A 2HPPH 2PUXB 1C1NA 2Y5FA 2STBE 1HFDA 1FN6A 1O3EA 2GTBA 4WMEA 4DURA 3QLPH 1J17T 4RSPA 2I6SA 4MPVA 4I32A 1MTWA 1DWBH 1ZPBA 1PPEE 2ODPA 3RXOA 4MVNA 1W3CA 1ELVA 1O2PA 1Z1JA 3ZV8A 4ZKOU 1C4V2 4CRGA 1FN8A 3LH3A 1QBVH 1C1WH 2PKAA 1RRKA 3Q76A 1E34B 2C8ZB 1UK2A 5FPTA 1CA0C 3PROA 1O3CA 4OS6A 1QRWA 1YYY1 3Q3YA 2ZGXH 1Y3VA 3EGKH 1JRSA 3LJJA 4CREA 5E2OA 1DFPA 4GVUA 1UTJA 1TRNA 3TNSA 1FUJA 1XKBC 4MNXA 1AKSB 2FTMA 2TGDA 2A2XH 1GCDA 1XXFA 2I6QA 2UUJB 1SR5C 1O2VA 4X6MA 2WINI 4Y6DA 4I33A 3MU5A 4Y7AA 2GCHF 3A86A 1OWIA 1LPKB 1O3IA 1NFWA 4OGXA 4VGCB 1DICA 3F68H 2AYWA 3PO1C 4BANB 1GI0A 2NU1E 2NU3E 1IQMA 5E0JA 2GVFA 4HI3A 1O2SA 2DE8A 3A83A 3E6PH 4AOQA 1GBDA 1UJ1A 1BB0B 2ZTZA 5GWZA 4MPUA 3GCTF 1SBWA 3QX5H 2ZKSA 5PTPA 2Z9KA 5GXPA 1C2MA 4J2YB 1ZGVA 4AZ2B 4K1SA 2HOBA 2BY7X 1ZSLA 1JIRA 4GCHG 2A0QB 1UTKA 1SGEE 2ZPQA 1GWAA 1OP2A 3RC5A 4BXWA 1GGDB 2CHAC 1TLDA 3TJNA 5L2ZH 1O5EH 4B2BA 3BN9A 5GJ4B 3SI3H 1F2SE 1SFQB 1FNIA 1MTVA 1NRPH 2FEQH 3ATMA 1SGDE 3RU4D 4X0WU 1UHBA 2SNVA 4YLUA 1AHTH 1XMNB 3ESTA 4I31A 1CVWH 1L0ZA 2AERH 2CJIA 2BDIA 1C5NH 4BNRA 2FZZA 6CHAB 2PFEA 5GIBA 1UVUH 3UR9A 3A8DA 1SQAA 2LPRA 1NESE 1K1IA 3GY2A 3TPIZ 4ZAEA 5A8ZA 2CGAA 5EQQA 1CGIE 2QXJA 1DE7H 3GCHC 1N6YA 4JCNA 3UWJH 1O5GH 1MKWK 3LGYA 1NM6A 2HALA 2BB4A 2J95A 2GV6A 1S6FA 3Q00A 3BTWE 1SLVB 2GCTC 3CS7A 5FBIA 3PTNA 2FESH 3DHKH 5HGGA 1PJPA 1TRYA 1ZMLA 2AH4X 1T32A 4J1YA 3KQEA 5DG6A 2AFQB 4FUIA 1GJBB 2NWNA 4MNWA 4FUDA 3P8FA 1QBOA 2W7SA 2FPZA 4X8VH 3D49H 4A5TS 1C5VA 1ANCA 1GJ9B 4ZXYH 1DY8A 4Y8YA 1UK4A 1IHTH 1AVWA 1TMTH 1IQGA 4Y11E 1C1QA 4NFFA 5DJ7A 3DA9B 1T4UH 2OP9A 1H9IE 2XCFA 1TGNA 1SGPE 1UVSH 5A0CA 2GZ9A 2ODYB 2BY9X 4LOYH 3KQCA 1BRAA 2D2DA 1GI6A 1BMLA 1TONA 3M36A 2W3IA 1V2VT 3SNCA 1BUIA 3U8OH 4D9RA 4IMQA 2CXVA 1A4WH 5ABWA 1ORFA 5DPAA 1ESAA 1EZUC 1BIOA 1W14U 4LK4A 1A5HA 3GDUA 1HBTH 1WSSH 4FU8A 3V7TA 1MKWH 3MYWA 3NKKA 2AGGX 2GZ7A 4B74A 1C1SA 1C1VH 3OSYA 2F83A 3TK5A 1O2QA 2KAIB 3E8LA 3P95A 3Q77A 5EGMA 2GP9B 2WPKS 2TGAA 1LTOA 1K22H 4E06H 5L2YH 1GMCF 2QGRA 4ABGA 4AFSA 1QB9A 4X8UH 2FWWA 2BLOA 4HTCH 1RTFB 3QWCH 1S0QA 1Z8GA 3PMAB 1A3BH 4OS4A 1C1PA 1FV9A 1BRCE 1HJ9A 1O3BA 2VVVA 4NA8A 5C3NA 1W10U 1G3CA 3HK6B 2PSYA 3EA7A 5CMXH 2ZWLH 4XDEA 2D8WA 3UNQA 3V0XA 1TPPA 2TGTA 1HDTH 3KQBA 1C1UH 3SJ8A 1FI8A 1ZGIA 1ZMJA 5BPEA 4TY6A 4X8TH 3MHWU 1TGBA 1ETSH 2Y80A 3M35A 3BTFE 2A1DB 3VB6A 4BAMB 3UWIA 1ZMNA 2PTCE 4TPYA 5K7RA 1XUFA 3A87A 1TIOA 3PM3A 3RP2A 4FUJA 1YPJH 3BF6H 1JWTA 1BZXE 1AI8H 5CE1A 1ELBA 1TQ0B 2FMJA 5AVDA 1TNIA 2C8YB 1NRSH 1VGCC 3U1JB 5L6NH 1Y3WA 8ESTE 3C27B 2TGPZ 3SU5A 1DWEH 1XUGA 3JZ2B 1OYTH 1CGHA 4YT7H 2G4TA 4I8KA 1AE8H 5DGJA 1TA6A 2IN2A 4HFPB 4OGYA 2AMDA 3SV7A 3S0NA 1DUAA 3VFEA 1TQ7B 1TRMA 3MH5A 3SHCH 5JBAS 2Y7ZA 2PR3A 3LONA 4X1PU 1GDUA 1KLJH 1QHRB 3UUZA 2OXSA 3RU4E 2ZHWH 2XBWA 1DX5M 1B5GH 4A1XA 3BG4B 1P8VC 1S82A 1E37B 2ZFPH 4IN1A 4TYDA 4I7YH 1NZQH 2A4GA 3DFLA 1AMHA 2ZGHA 1A7SA 1RFNA 2QIQA 1ZHRA 3A7ZA 5C67A 5A09A 2A5IA 1ETRH 1RIWB 1PQ8A 1AFEH 1FIWA 2FYQA 3AASA 4H6TA 1ELAA 2AMQA 2QN5T 3G01A 1O2YA 3SUDA 3F9FA 2OINA 1QY6A 1O3OA 5DKMA 1LPZB 1E35B 1V2JT 5BRRE 1NRQH 3DT0H 2WPIS 1N1LA 3A8CA 3QGNB 7GCHF 1D3QB 4INKA 3RXBA 4IC5A 1ZJDA 7ESTE 2FOHA 1GVZA 4UD9H 3FANA 4ZH8A 1XUJA 1CHOF 1TNHA 1EAIA 3LDXH 4MNYA 1U6QA 4WWYA 1XVOA 2BD3A 5H4IB 2VB0A 9ESTA 1QR3E 4NG9H 1SHYA 4Y0YE 5F6MA 2H9EH 1OSSA 4UFFH 1BHXB 1KXAA 5DP5A 4OS5A 3SI4H 1MD8A 4O9VA 1V2OT 2ZDMA 3MWIU 5F03A 5A2MH 1LCYA 1VITF 1LKAA 3BTKE 1GI3A 4BTIB 3RXGA 4Y76A 3RMOH 3RXMA 3D23A 3GDVA 1OPHB 2J2UA 1V2UT 3S7HB 1AN1E 4JZFH 1YPLH 3BIUH 1EAXA 2A4RA 4WH8A 3U1IB 3ZZCA 2ZF0H 1GHAG 4GAWA 2O9QA 4I8GA 2TRMA 1FY5A 1O35A 4DIHH 3EA9A 1FY4A 1QURH 4KKDA 1HPGA 1O3MA 1GHZA 4I8HA 1Y5UT 1MD7A 3PYHA 4JZDH 2FO9A 2VWLA 1HV7A 3ZZ7A 4NA7A 5AHGH 5E0HA 3F1SB 1YCPM 2XXLA 1PYTD 4A6LA 1GBEA 5DP8A 5J4SA 1P2IA 5AFYH 3A7TA 1HYLA 2EI8A 2XNIA 3SNEA 1DLEA 3W94A 1A46H 3AAUA 2ZQ2A 4E7NA 1VJAU 3UQVA 1CQQA 1JIMA 1V2ST 2W26A 1CT2E 2PKAB 3KIDU 1H9LB 3BV9B 1TE0A 1QNJA 1CA0B 3M5NA 1Z6JH 1QQ4A 1SVPA 3SV6A 4Y7BA 1XXDA 2RA0A 4ZHLU 2FDAA 3BG8A 4ZHMU 4NIXA 4ESTE 2P8OC 4JYTA 1Z8RA 1GI5A 4AFUA 2BOKA 3UR6A 1RD3B 3LGTA 1X7AC 4KTUA 1GBBA 4NIWA 3RXKA 1ID5H 3STJA 1BITA 2WUBA 3ZV9A 3A7WA 5I25A 2Z94A 2PUQH 1GBMA 1BA8B 3KGPA 1WU1A 1Z7KA 2SFAA 3MI4A 1UVOA 1CHGA 3O8DA 4ABEA 1UCYK 1GJ7B 1MUEB 1PYTC 3MH7A 3PO1B 4NIVA 2Q6FA 1HAYB 1YCPK 3RLWH 3FAOA 1BQYA 1TPSA 1LVYA 1TYNA 2BX3A 1Z8IB 5IDKA 1BMNH 4INHA 2FXRA 4B1TA 3NUMA 1P04A 3A7XA 3MNXA 1Q31A 2F9OA 1T31A 1T4VH 3MO6A 4FVBA 3SU0A 2RCEA 4JZIA 2G8TA 4ABAA 2J92A 2FS9A 3TGKE 3SBKA 3KEEA 1YPMH 3SNDA 2WUCA 1ARCA 1D9IA 1Y59T 2CHAB 3LPRA 4YTAA 4K8BA 3ZZ9A 3ZZ5A 4B75A 1FLEE 4A7IB 1IQIA 3T28A 5F8TA 1ZOMA 1UTMA 5FPYA 1AZ8A 1ELEE 1O2UA 2TPIZ 4UFDH 6GCHF 1GCTC 1UHBB 4X1SU 3FP8E 3NZIA 4K3JA 1O31A 3DD2H 3RMMH 1NPMA 3MFJA 2BDBA 4BTTB 1RJXB 1C5YB 3P17H 2BDCA 1UCYH 2OCVB 1SOZA 1RTLA 3OY5U 1EPTA 1O0DH 1EPTC 2ANYA 3RXEA 3KCGH 1YCPH 1BTZA 1BMAA 1C5MD 3Q3XA 3GY6A 3MH6A 1F5RA 5E8EH 2YNBA 1TWXB 2FX4A 1XKAC 2ALPA 3ZZBA 2GCTB 1B7XB 3RMNH 8LPRA 3B23B 1M9UA 1YPEH 1P02A 2WYGA 1TALA 1MAXA 1HJAC 2HNTF 4KGAA 1EUFA 1TGSZ 2VIQA 3GY8A 1QFKH 4ZKSU 1QCPA 2EI6A 4KP0A 1EX3A 1PPCE 2STAE 3TJVA 8GCHF 2OTVA 2VGCC 2R2WU 2VVUA 1V2WT 1C4U2 1O2TA 3NK8A 2FI5E 1C5SA 2DUCA 3OY6U 3GYMA 1UTLM 1K2I1 3QTOH 2FOAA 2ZO3H 3TU7H 2BZAA 3RXCA 1CE5A 1C2GA 1IQFA 5L30H 4JK5A 2FOFA 4ZROA 2ZQ1A 1FY3A 4K8YA 6LPRA 3SV8A 1Y3XA 2QYIA 1THSH 3CENA 1S6HA 5A8XA 1MZDA 2ZU4A 2BQWB 4ABFA 4B76A 2B8OH 3TGJE 1D4PB 2V3OH 4MTBA 3ZVDA 1L4ZA 3QO6A 1BTWA 1GMHG 1ANDA 2D1JA 1XVMA 1GMDF 1BCUH 3EQ0H 1IQEA 4Q80A 1H1BA 1GVKB 1P06A 2F3CE 1YBWA 4MDSA 1FJSA 1G9IE 1GG6C 1IHSH 2ZDAH 1O2ZA 1QA0A 1CA8B 3KHVA 1EXFA 4INLA 4UFEH 3U8RH 2XBYA 5EXLA 1B0FA 3GCOA 1HIAA 3RXFA 5JBBS 2Y81A 1Y5BT 4GHQA 5FCKA 1FPHH 2ZECA 3R0FA 3TH4H 4AORA 3AAVA 1XX9A 5C20A 1O2KA 1O2JA 4Y8ZA 1KDQB 1P2OA 1C5XB 1NN6A 2ANKH 2Z9GA 3P8OA 3SORA 3HATH 1EAUA 4TWWA 3AW1A 3SUEA 2ZFQH 1ELGA 2BD9A 4KELA 2P59A 1DUEA 5FX6A 1C2IA 3TGIE 4DT7B 4B2AA 3NCLA 3PWCA 4OS2A 1GHBG 3BTHE 3F9GA 3LOXA 5C2ZA 1P12E 1Y3YA 1O5CB 1GI1A 3ENSB 1FMGA 2HWLB 1HCGA 1TB6H 1HAPH 1BTHH 3ODFA 2XYAA 3GICB 5FPSA 4XFQA 3BEIB 1D3PB 1J8AA 1P11E 2A5AA 3RXAA 2A4OA 1BBRE 1O3GA 1VGCB 1WYKA 4TPIZ 4CR5A 5HM9A 4CRAA 1TOMH 2HLCA 3F9EA 1MKXK 1FAXA 3QZQA 2BXTH 1LO6A 2QY0B 4FU7A 2Z9IA 3ZZ4A 2PV9B 3VB7A 1CT4E 5ETXA 4BXSA 5C1UA 1MZAA 1UMAH 3QK1A 1ELFA 4ZMAH 1LKBA 1DOJA 2QXGA 3RXPA 3LT3A 4K1EA 1P2NA 2G5NA 2ZU3A 1H4WA 3L33A 3VPKA 4IN2A 5EQSA 1DY9A 1Z71A 2VJ1A 3BIVH 2ZFRH 3L3TA 8KME2 3RXIA 2Z9LA 4ZUHA 1A1RA 1N6XA 3TLOA 2ASUB 3URCA 4X6NA 1NRNH 3TK9A 1ELDE 1BHXF 4D7FA 1KXFA 1SHHB 2QF3A 1PPZA 3O8CA 1P05A 1JXPA 1UTQA 2O8TA 1A5GH 4UE7H 1KIGH 4MG3A 2Y5HA 4WMFA 2B7DH 5DP9A 1A0JA 5EU8A 2A7JA 2VWMA 1HXFH 1P3CA 2FODA 2Z3EA 2BVRH 3PMJA 2WPJS 2ZFSA 4D7GA 5LGOA 4AG1A 1AD8H 1C2DA 1C2HA 1AU8A 1V2MT 1MKXH 3KN2A 2VIOA 1K9OE 4DVAU 1O3KA 4JZEH 3WY8A 2H5CA 4X1QU 1ABIH 1GBLA 3LKWA 4TWYA 3MNBA 1C1MA 3M5MA 2Y6TA 1WQVH 2EEKA 3A84A 2Z3DA 3Q3KA 4ISOA 1FZZA 1P9UA 4FUBA 1IQKA 4JMYA 3GY7A 1SQTA 3LGUA 3MO9A 4IW4E 1LQEA 1GBKA 1K1NA 1WCZA 3RXRA 1GI4A 4UDWH 1HAXB 1CBWC 3STIA 3I29A 2C4FH 2J34A 1LQDB 1GBFA 3PLKA 1W0ZU 1V2TT 4ZXXH 3RUOA 1A61H 5C1YA 4DGJA 4MQAA 3BTQE 1C2FA 1QGFA 2ZFFH 1TPAE 2UUKB 1YM0A 1GBIA 6ESTA 2SGQE 2OD3B 3I78A 1PPBH 1KDQA 1O2WA 3H7OA 1HAHH 2RDLA 1FPCH 1PQ5A 2G81E 4NWLA 4AB8A 2ZHDA 1ZZZA 2B5TB 2WPLS 1JBUH 1EP6A 4UONA 1SI5H 3L6PA 2BY6X 1T8OA 2TBSA 1RXPA 1RTKA 2OLGA 2PLXA 4U01A 3BEFB 1O3DA 2P8OB 2QA9E 1AFQC 3HPTB 1OWJA 2NU2E 4NSVA 1TGCA 5GCHG 3T62A 4DG4A 1ZTJA 3PTBA 3ODDA 1GI8B 5DK1A 2GDDA 5A8YA 2VIPA 4GUXA 1EASA 2Y7XA 2ZP0H 1K1PA 2SGPE 3SJOA 1NT1A 1KLTA 1YPHC 4A1TA 1ABJH 1W7XH 2F9BH 3TH3H 3KQDA 5ESTE 1UK3A 4CHAC 1HB0B 2A5KA 5EXNA 1D6WA 1GL1A 4AB9A 3GDSA 4YT6H 3ATWA 1WQSA 3SJKA 3URDA 1YF4A 4U30A 3FP7E 4UEHH 3RXLA 3E3TA 1AQ7A 3R3GB 1ARBA 1BOQA 1SGFA 2W5EA 1W2KH 2OQUA 2IOTA 3P70B 3M37A 1V3XA 1MCTA 2NU0E 2YNAA 4Y10E 2ZHFH 4ZKNU 2J94A 3RXJA 2UWPA 3FVFB 4A92A 3H7TA 4WMDA 1W7GH 1C5UA 3E0NB 1HAOH 3PB1E 2XBXA 1TMUH 1IAUA 3RC6A 4K69A 1GCTB 2V35A 3UREA 1HAVA 1SSXA 2ZU2A 1GJCB 4AFQA 3C1KA 2A4QA 2GZ8A 3FZDA 3RXQA 1LVBA 2JETC 2VH6A 3A80A 2Z6BD 1UVTH 3ZYDA 3VXEH 1C5TA 1QJ1B 2A45B 3TVJB 1N8OC 1S84A 1NY22 1ZLRA 1L1GA 3UNSA 3M5OA 2F9UA 1KTTB 2AS9A 2VU8E 1EPTB 1K21H 4SGBE 4Y8XA 2ZU5A 5C1XA 4AFZA 1LVMA 1YPKH 2WV5A 4H4FA 3P8NA 4LZ1H 1SG8B 4XBDA 4GCHF 1E38B 3BTDE 5B6OA 1UTPA 1C2EA 1TMBH 3TJOA 1Z6EA 2BD7A 4FUGA 4NGAH 2H5DA 3MU0A 2PKSC 4JYUH 1V2LT 1EB1H 1ZRBA 3SN8A 4CBOA 1AB9C 1HJAB 1L1JA 1OWEA 2FOBA 1PFXC 1A3EH 2GCHG 3ATLA 3GCNA 3NPSA 3RM2H 3MO3A 2VGCB 1Z1IA 1GVLA 3SGBE 1SMFE 3BTME 2ZPRA 2BHGA 5LPFA 2FOEA 1QL9A 4E05H 1DLKB 3EA8A 4NZLA 1F5LA 4CH2B 3SUFA 4MLFB 1L1NA 1MH0A 3BTGE 4FXGH 3GCTG 3V3MA 1Q2WA 2UUYA 3QDZB 1C1OA 1GI2A 2ODQA 5JB9S 1O2NA 1ANEA 1J16A 4NIYA 1YC0A 1O33A 1TBRH 4YZUA 4IMZA 1S83A 4CBNA 1NROH 1PPGE 4IBLH 3ZZAA 2XBVA 3SV9A 4KTSA 3ITIA 1GL0E 1ESTA 2C93B 2Z3CA 4Y0ZE 1NFUA 1OOKB 2BD8A 1LMWB 1YPHE 2GD4B 4CRFA 2A2QH 3GY4A 4DOQA 1TBZH 5EOKA 1LDTT 2Z9JA 5FCRA 3LC5A 1V6DA 1IQHA 1GG6B 3U8TH 2ZA5A 4NZQA 2P94A 4K1TA 4ABBA 3T29A 4XBCA 1HIAB 1SGIB 1UO6A 4X6OA 4U2WA 2RA3A 1KXDA 1ZPCA 4B73A 2PTNA 5K0HA 4X8SH 1Y8TA 1AUTC 1O3AA 1TPOA 3TK6A 4BOHA 4IGDA 2BY8X 2VIDA 1IOEA 1O2HA 1O3FA 1P9SA 1BJVA 2ZGBH 2PSXA 4H42U 3HGNA 2ZI2H 2O8LA 4WXVA 2H1UA 1TNLA 3ZVFA 1LHFH 3QTVH 3SHAH 1FDPA 2B9LA 4HZHA 5C5NA 1SB1H 3SU4A 1Q3XA 1XUHA 3MMGA 3KF2A 4LXBH 1HAGE 3GYLB 1MQ5A 4X2WA 1EJNA 3O8BA 1NFYA 4DY7B 2OBOA 3SU1A 1HAIH 3MNCA 3SNAA 4BAQB 5CHAC 1GBAA 1EP5A 1ELTA 4E7RG 1DM4B 4MNVA 3B8JA 5SGAE 3RM0H 1THRH 3ZZ8A 3MU4A 1UTOA 1GDQA 1XUIA 3UIRA 3M3SA 1OYQA 1TABE 4ISIH 3S9CA 3A8BA 3T2NA 1TNGA 3SQEE 4X1NU 1VJ9U 1BRUP 3ELAH 3UQOA 7KMEH 3CS0A 4AYYB 2GV7A 1GI7B 2FLBH 2GMTC 5HMAA 1V2QT 2R3UA 1BTPA 4CRCA 3ZZDA 1WAYB 1P0SH 4AX9H 1CO7E 5JYIA 1O2XA 2BDAA 3RXHA 3A82A 3UTUH 3CP7A 2ZGJA 2OBQA 2C90B 4RKJB 1GBJA 2BXUH 1RGQA 3D62A 1FQ3A 2AMPA 2UWLA 1FONA 1MTUA 1C4Y2 4K5ZA 2ZDKA 4O3UA 4F49A 3P92A 1INCA 1WUNH 1O5AB 3TNTA 1D3DB 1OWHA 2O8MA 1GMCG 2BQ6B 2IJOB 1JOUB 5JBCS 1A0HB 1ELCA 3VXFH 2ZDVH 4ABHA 3A8AA 3SO3A 3ZZ3A 1ZJKA 3JZ1B 3IITA 1K1JA 1PQAA 1TGTA 1O3NA 1AO5A 1EKBB 1V2RT 1KSNA 2HRVA 1HRTH 2FLRH 1KXEA 4DJZB 2GX4A 4SGAE 3E1XB 2R0LA 2ZCHP 1P01A 4K2YA 1PPHE 1ZSJA 1GBCA 1V2KT 3EAJA 4DIIH 4WJG2 1THPB 3M7TA 1Y3UA 1MTNC 1P09A 1C2LA 2P3UB 4ZHAA 4ABDA 3BSQA 5LH8A 3UPEA 3F9HA 4HGCA 4AN7A 1OKXA 1F0UA 2ALVA 5I46H 1QB1A 4O97A 1QL8A 1J9CH 5DO4H 3UY9A 1MCVA 1J15A 4AGKA 2TIOA 1BMMH 1A2CH 1ZHMA 2ZIQH 1C5LH 1H8DH 1P57B 1TX8A 2AIQA 2GT8A 1EB2A 3RXVA 2FOCA 1O37A 3PMHB 2LNCA 1CBWB 1SLUB 2ANMH 2HGTH 2FIRH 1EZXC 2CMYA 2ZHQH 1TBQH 4I8LA 2OQ5A 4BAKB 1HXEH 1PPFE 1AWHB 1AVGH 5T6GA 4I8JA 1W8BH 1G30B 3GOVB 1AWFH 1VCPA 1C1RA 1DS2E 1O5FH 2FYRA 1GJ8B 3SNBA 1QL7A 4PROA 4NSYA 2DE9A 2ZCKP 3D65E 3ATIA 3M3TA 3RU4T 1O2GH 3U69H 2BD5A 1G37A 2JH6D 3T26A 1AFQB 3VEQB 4ASHA 4WF8A 3P6ZB 1F0RA 1XUKA 2VINA 3PV4A 2M5TA 5T6DA 1GHAF 5DP3A 2BYAX 2BDGA 7GCHG 2PWXA 2ESTE 2GT7A 1G32B 4YLQH 5T6FA 2BVSH 3QGJA 3VGCC 2PGQB 4ABIA 2XTTB 1CHOG 2V6NA 3ZVBA 1BTXA 2CN0H 3E0PB 1NRRH 1LHCH 2WYJA 2UWOA 4IC6A 2SGDE 5EQRA 1GI9B 3LU9B 2PHBA 4CHAB 2O8UA 1O5BB 2Q6GA 1FXYA 1BTYA 2ZCLP 1F5KU 1T8NA 1JMOH 1S5SA 1LHDH 2FOMB 2BQ7B 1F0SA 1KLIH 1SGNE 1T8MA 1GJAB 4ABJA 5HXFA 1VITG 4XOJA 1SFIA 5F8XA 3HKIB 1DXPA 1QIXB 1GHWH 1WTHD 4GLYA 4WH6A 1EZQA 3F6UH 3S69A 1AVXA 3M3VA 1LVOA 2JH0D 5GDSH 1EJAA 1C9PA 4X2YA 3IWMA 1OXGA 1DANH 3KL6A 4THNH 3KNXA 1GHVH 2ZG0H 2BLVA 2SNWA 4Q7ZA 4XE4A 3SQHE 2C8XB 3V12A 3S9BA 1LHGH 1G3DA 1FY8E 5JB8S 1HAVB 2F9PA 3LGVA 4OS1A 1BDAA 4M7GA 1MU8B 2JETB 5E2PA 3SJ9A 2C8WB 2P3FH 4XSKU 3S7KB 2G4UA 2RG3A 1DPOA 1O2LA 1H8IH 1N8OB 1QA7A 1TA2A 1ZPZA 2WV4A 2R3YA 1F92A 4O3TA 1BTUA 4UFGH 1F7ZA 7LPRA 1BBRK 2XC5A 5TJXA 2UUFB 1GHYH 4DCDA 4U32A 1DSUA 4YM9A 1MTSA 1C5QA 5E0GA 3ZVAA 1CSOE 1VZQH 1ZRKA 1K28D 5FX5A 3W95A 1F0TA 3MTYA 1EQ9A 4NCYA 1SQOA 2CV3A 3RLYH 2PKSB 3A7YA 5J4QA 3LIWA 1AB9B 1CT0E 2FI4E 1O2RA 3MOCA 2BOHB 1O5DH 3U9AH 2QAAA 2EI7A 3PMBB 1SLXB 2HVXA 2ILNA 2FX6A 1AY6H 1SGRE 1SGQE 3HKJB 4AGJA 1EJMA 1O38A 4KTCA 5DP7A 4D8NA 1SOTA 1A0LA 3I77A 4NA9H 1SPJA 1BT7A 1XM1A 1T7CA 9LPRA 4X2VA 5EXMA 1WV7H 1SGFG 3MNSA 1FIZA 1KTSB 1O3HA 5AFZH 2P95A 3AW0A 5JDUB 5T3HA 3SGQE 3DUXH 1OP8A 2ULLA 1G2MA 1GBTA 5A0AE 5FAHA 3K6YA 1O3LA 1EATA 3RXUA 1HGTH 2R0KA 1HNEE 1HUTH
chains in the Genus database with same CATH superfamily
1YPGH 2A7CA 1BBRH 1NC6A 1S85A 1VCQA 5DP6A 3RXTA 1P2KA 5HM2A 1L4DA 1AKSA 3T5FH 2QF0A 1SC8U 1BRBE 1E0FD 2P93A 3H09A 1QQUA 3T25A 1H9HE 6GCHG 2BMGB 3SZNA 2QXHA 4WY3A 5EW2H 2AGEX 2BZ6H 4O03A 4VGCC 3SU2A 2ZDLA 3B9FH 3LC3A 4FUFA 5C0UA 1OX1A 2J5UA 5FXLA 2J38A 3ZYEA 1IQJA 1O2OA 3OAAD 4FVDA 3K65B 4ZKRU 3WWFA 2SGAA 1NS3A 1K1LA 2CF9H 1IQNA 2ZDNA 5HYOA 4GPGA 1P10A 4JK6A 4CRDA 3V13A 4X1RU 2O8WA 2BD2A 4Q2KA 2A7HA 1P3EA 4MPWA 4MPXA 2GKVE 3GY3A 3NWUA 3TITA 2VNTA 2ZPSA 3OYPA 2XWBI 3BTTE 1UVPA 5LPEA 2BLWA 4P00A 1E36B 1SGYE 4AC9A 5G4BA 1G2LA 1GGDC 2ZTYA 1ZTLA 3K6ZA 4AG2A 5GPIB 2WSSD 1GMHF 2R9PA 2XC0A 2BLQA 8GCHG 3M61U 1GJDB 5CHAB 3ZVEA 1RS0A 1DSTA 3N99A 3M7QA 1GJ4H 3OEED 1KYNA 1YKTA 2H2ZA 4NFEA 4X2XA 2FM2A 1P03A 1AE5A 2EC9H 3GISB 6CHAC 2H9HA 1DWCH 3K2UA 4NWKA 1SGCA 4D9QA 2GMTB 2AIPA 1VKYA 1FAKH 2Q1JA 2J4IA 1O3PB 1Y5AT 5C5OA 4FUCA 2QXIA 2Y5GA 3UOUA 2IPHA 2WPMS 1MMJN 1G36A 3A89A 4B71A 1G3BA 2XCNA 1GHBF 1AIXH 1SL3A 1OHHD 1GMDG 4WXIA 2OC7A 1LPGB 1MBQA 4Q7YA 1K1MA 1NBME 1C2JA 2C3SA 1BJUA 4YESB 1AZZA 4Q7XA 5IYTA 3MU8A 3FZZA 4JZ1A 1D6RA 2BDYA 2F9NA 2V3HH 2OUAA 2K8IA 1D3TB 4TY7A 2Z7FE 1O39A 5CHBA 3UAIC 1S0RA 5EW1H 2BX4A 2SGFE 1SGTA 3IG6B 2ZFTA 2QC2A 3O8RA 5FHTA 1WTGH 2P16A 1NO9H 3BEUA 3ZZ6A 1NFXA 2VWOA 4BTUB 1QTFA 1O2MA 2PGBB 5EJ1A 2OC8A 1J14A 3U98H 2BM2A 3ZVGA 3AVZA 1C1TA 1V2PT 3DFJA 2G52A 3QUMP 2VH0A 3HK3B 5DP4A 5TCAA 1UTNA 3S9AA 1QJ7B 2K1QA 3RMLH 3A7VA 3FP6E 2ANWA 1C5WB 3A81A 2ZGCA 1W13U 1YGCH 2G00A 2ZNKH 2FS8A 1ZR0A 1LHEH 2AGIX 2V0BA 4Z6AH 2F9VA 1SLWB 4OS7A 5EPNA 3SU6A 3ZVCA 2EQNA 2HNTC 3MU1A 4RT0A 1QBNA 1MTNB 1TAWA 3ATKA 5FL7D 3RXDA 1O3JA 4RKOB 1UCYE 5TCCA 1ESBA 2ZEBA 1DWDH 1O34A 2W6JD 1PQ7A 1TNJA 2A31A 1FY1A 1ANBA 1TNKA 2KAIA 3OTJE 3K9XB 4ISLA 1TX6A 4K60A 5HIYA 1DITH 5LPRA 1QJ6B 2XWAA 1ZSKA 2ZU1A 4LZ4B 3VB5A 1VR1H 3LGWA 4X6PA 3SOSA 3EE0B 1P2MA 1DT2A 4YO9A 1DDJA 2G5VA 1W0YH 1GBHA 4RN6A 2F91A 3GY5A 2VWNA 2NU4E 4BAOB 4ISHH 4Y79A 1NU9A 4XBBA 2BVXH 3E16B 2XRCA 1MQ6A 4H6SB 2CF8H 1HJ8A 2VIVA 2G51A 4Z0KA 1DVAH 1EAWA 3HGPA 1A5IA 2VVCA 1KXBA 3SJIA 2Y82A 3QZRA 3TJUA 2OC1A 1GHXH 1QRXA 3LGIA 1EOLA 4YOJA 3F0PA 3RXSA 3EYDA 2QV1A 1OWKA 4BAHB 1KXCA 3A88A 3RDZA 2GGVB 4YOGA 2FTLE 5F8ZA 1YLDA 1NU7B 2OC0A 2BY5X 2SGEE 4DW2U 1WOFA 4ISNA 5JPMH 5A0BA 3E91A 5CDFE 5EG4A 1S81A 4AYVB 1JRTA 2GDEH 2XC4A 3OU0A 3SV2H 3UNRA 4YOIA 1C2KA 2W6ID 1GJ5H 2J9NA 3FFGA 3H5CB 3LH1A 4GHTA 3PLPA 1W11U 3VGCB 4CRBA 1C5ZB 4B2CA 1HLTH 2FOGA 3LJOA 1ACBE 3T27A 3UFAA 2ZC9H 3MH4A 1O30A 2D26C 2PW8H 1G3EA 1C5OH 1MAYA 2XW9A 3SUGA 4XRNA 2A32A 1O32A 1W12U 1DXWA 1VITH 4CR9A 3BG4C 1CGJE 2H6MA 5FBEA 3P8GA 1Z8JB 1TX7A 2Q6DA 1WBGB 1YP9A 2YOLA 2HPQH 1C9TA 1O2IA 1QRZA 1L2EA 1GJ6A 1TFXA 1ETTH 4IS5A 1OWDA 1QB6A 1ZYOA 1RIWC 2ZHEH 2OK5A 2R2MB 4R8TB 2WPHS 5EPYA 3UOPA 2B0FA 2G55A 2THFB 3RC4A 1T8LA 1EOJA 1YLCA 1ZTKA 1ZHPA 2ZZUH 4FUHA 4D76A 3TH2H 1P2JA 5AF9H 1OP0A 2QF5A 2H9TH 2HNTE 2BD4A 3TIUA 5GCHF 1OS8A 4QT8C 2QCYA 1P2QA 4GSOA 2JKHA 3SGAE 4CH8B 3GCHB 2AEIH 2W3KA 2P3TB 3OX7U 1NTPA 2ZTXA 1EZSC 2BTCE 4JYVH 5ESBA 3SU3A 3VB4A 1GDNA 1HAZB 3E90B 1C5RA 1MU6B 4F4OC 4A1VA 1AUJA 3QN7A 5EODA 3N7OA 1KY9A 4FU9A 1CU1A 4R0IA 1AGJA 3EDXB 1B0EA 3NXPA 3BTEE 3M5LA 1VCWA 3A85A 1GPZA 2W7UA 3PWBA 1V2NT 2BDHA 1C5PA 2JH5D 3M7UA 4FUEA 4TT3D 1TOCB 3SW2B 2EA3A 5JBTA 4Y71A 3PLBA 2FI3E 1K1OA 1MBMA 2FP7B 4WVPE 2VIWA 1IQLA 1O36A 3VB3A 2HPPH 2PUXB 1C1NA 2Y5FA 2STBE 1HFDA 1FN6A 1O3EA 2GTBA 4WMEA 4DURA 3DSOA 3F2HA 3KYFA 3QLPH 1J17T 4RSPA 2I6SA 4MPVA 4I32A 1MTWA 1DWBH 1ZPBA 1PPEE 2ODPA 3RXOA 4MVNA 1W3CA 1ELVA 1O2PA 1Z1JA 3OE7D 3ZV8A 4ZKOU 1C4V2 3WW7A 4CRGA 1FN8A 3LH3A 1QBVH 1C1WH 2PKAA 1RRKA 3Q76A 1E34B 2C8ZB 1UK2A 5FPTA 1CA0C 3PROA 1O3CA 4OS6A 1QRWA 1YYY1 3Q3YA 2ZGXH 1Y3VA 3EGKH 1JRSA 3LJJA 4F48B 4CREA 5E2OA 1DFPA 4GVUA 1UTJA 1TRNA 3TNSA 1FUJA 1XKBC 4MNXA 1AKSB 2FTMA 2TGDA 2A2XH 1GCDA 1XXFA 2I6QA 2UUJB 1SR5C 1O2VA 4X6MA 2WINI 4Y6DA 4I33A 3MU5A 4Y7AA 2GCHF 3A86A 1OWIA 1LPKB 1O3IA 1NFWA 4OGXA 5B6LA 4VGCB 1DICA 3F68H 2AYWA 3PO1C 4BANB 1GI0A 2NU1E 2NU3E 1IQMA 5E0JA 2GVFA 4HI3A 1O2SA 2DE8A 3A83A 3E6PH 4AOQA 1GBDA 2GJGA 1UJ1A 1BB0B 2ZTZA 5GWZA 4MPUA 3GCTF 1SBWA 3QX5H 2ZKSA 5PTPA 2Z9KA 5GXPA 1YWUA 1C2MA 4J2YB 1ZGVA 4AZ2B 4K1SA 2HOBA 2BY7X 1ZSLA 1JIRA 4GCHG 2A0QB 1K0HA 1UTKA 1COWD 1SGEE 2ZPQA 1GWAA 1OP2A 3RC5A 4BXWA 1GGDB 2CHAC 1TLDA 3TJNA 5L2ZH 4B6FA 1O5EH 4B2BA 3BN9A 5GJ4B 3SI3H 1F2SE 1SFQB 1FNIA 1MTVA 1NRPH 2FEQH 3ATMA 1SGDE 3RU4D 4X0WU 1UHBA 2SNVA 4YLUA 1AHTH 1XMNB 3ESTA 4I31A 1CVWH 1L0ZA 2AERH 2CJIA 2BDIA 1C5NH 4BNRA 3CNRA 5C94A 2FZZA 6CHAB 2PFEA 5GIBA 1UVUH 3UR9A 3A8DA 1SQAA 2LPRA 1NESE 1K1IA 3GY2A 3N7DA 4ZAEA 3TPIZ 5A8ZA 2CGAA 5EQQA 1CGIE 2QXJA 1DE7H 2WHXA 3GCHC 1N6YA 4JCNA 3UWJH 1O5GH 1MKWK 3LGYA 1NM6A 2HALA 2BB4A 2J95A 2GV6A 1S6FA 3Q00A 3BTWE 1SLVB 2GCTC 3CS7A 5FBIA 1NBMD 3PTNA 2FESH 3DHKH 5HGGA 1PJPA 1TRYA 1ZMLA 2AH4X 1T32A 4J1YA 3KQEA 5DG6A 2AFQB 4FUIA 1GJBB 2NWNA 3OTPA 4RI0A 4MNWA 4FUDA 3P8FA 1QBOA 2W7SA 1QZ8A 2FPZA 4X8VH 3D49H 4A5TS 1C5VA 1ANCA 5DSFA 1GJ9B 4ZXYH 1DY8A 4Y8YA 1UK4A 1IHTH 1AVWA 1TMTH 1IQGA 4Y11E 1C1QA 4NFFA 5DJ7A 3DA9B 1T4UH 2OP9A 1H9IE 2XCFA 1TGNA 1SGPE 1UVSH 5A0CA 2GZ9A 2JJ2D 2ODYB 2BY9X 4LOYH 3KQCA 1BRAA 2D2DA 1GI6A 1BMLA 1TONA 3M36A 2W3IA 3PV5A 1V2VT 3SNCA 1BUIA 3U8OH 4D9RA 4IMQA 2CXVA 1A4WH 5ABWA 3DSGA 1ORFA 5DPAA 1ESAA 1EZUC 1BIOA 1W14U 4LK4A 1A5HA 3GDUA 1HBTH 1WSSH 4FU8A 3V7TA 1MKWH 3MYWA 3NKKA 2AGGX 5T1VA 2GZ7A 4B74A 1C1SA 1C1VH 3OSYA 2F83A 3TK5A 1O2QA 2KAIB 3E8LA 3P95A 3Q77A 5EGMA 2GP9B 2WPKS 2TGAA 1LTOA 1K22H 4E06H 5L2YH 1GMCF 2QGRA 4ABGA 4AFSA 1QB9A 4X8UH 2FWWA 2BLOA 4FOUC 1RTFB 4HTCH 3QWCH 1S0QA 1Z8GA 3PMAB 1A3BH 4OS4A 1C1PA 1FV9A 1BRCE 1HJ9A 1O3BA 2VVVA 4NA8A 5C3NA 1W10U 1G3CA 3HK6B 2PSYA 3EA7A 5CMXH 2ZWLH 4XDEA 2D8WA 3UNQA 3V0XA 1TPPA 2TGTA 1HDTH 1EFRD 1C1UH 3KQBA 3SJ8A 1FI8A 1ZGIA 1ZMJA 5BPEA 4TY6A 4X8TH 3MHWU 1TGBA 1ETSH 2Y80A 3M35A 3BTFE 2A1DB 3VB6A 3DCLA 3UWIA 1ZMNA 4BAMB 2PTCE 4TPYA 5K7RA 1XUFA 3A87A 1TIOA 3PM3A 3RP2A 4FUJA 1YPJH 3BF6H 1JWTA 1BZXE 1AI8H 5CE1A 1ELBA 1TQ0B 2FMJA 5AVDA 1TNIA 2C8YB 1NRSH 1VGCC 3U1JB 5L6NH 1Y3WA 8ESTE 3C27B 2TGPZ 1S6LA 3SU5A 1DWEH 1XUGA 3JZ2B 1OYTH 1CGHA 4YT7H 2G4TA 4I8KA 1AE8H 5DGJA 1TA6A 2IN2A 4HFPB 4OGYA 2AMDA 3SV7A 3S0NA 1DUAA 3VFEA 1TQ7B 1TRMA 3MH5A 3SHCH 5JBAS 2Y7ZA 2PR3A 4ZCNA 3LONA 4X1PU 1GDUA 1H8ED 1KLJH 1QHRB 3UUZA 2OXSA 3RU4E 2ZHWH 2XBWA 1DX5M 1B5GH 4A1XA 3BG4B 1P8VC 1S82A 1E37B 2ZFPH 4IN1A 4TYDA 4I7YH 1NZQH 2A4GA 3DFLA 1AMHA 2ZGHA 1A7SA 1RFNA 2QIQA 1ZHRA 3A7ZA 5C67A 2JJ1D 5A09A 2A5IA 1ETRH 1RIWB 1PQ8A 1AFEH 2QF4A 1FIWA 2FYQA 3AASA 4H6TA 1ELAA 2AMQA 2QN5T 3G01A 1O2YA 3SUDA 2XOKD 3F9FA 2OINA 1QY6A 1O3OA 5DKMA 1LPZB 1E35B 1V2JT 5BRRE 1NRQH 3DT0H 2WPIS 1N1LA 3A8CA 3F2FA 3QGNB 7GCHF 1D3QB 4INKA 3RXBA 4IC5A 1ZJDA 7ESTE 2FOHA 1GVZA 4UD9H 3FANA 4ZH8A 1XUJA 1CHOF 1TNHA 1EAIA 3LDXH 4MNYA 1U6QA 4WWYA 1XVOA 2BD3A 5H4IB 2VB0A 9ESTA 1QR3E 2KCYA 4NG9H 2AHME 1SHYA 4Y0YE 5F6MA 2H9EH 1OSSA 4UFFH 1BHXB 1KXAA 5DP5A 4OS5A 3SI4H 1MD8A 4O9VA 1V2OT 2ZDMA 3MWIU 5F03A 5A2MH 1LCYA 1VITF 1LKAA 3BTKE 1GI3A 4XD7D 4BTIB 3RXGA 4Y76A 3RMOH 3RXMA 3D23A 3GDVA 1OPHB 2J2UA 1V2UT 3S7HB 1AN1E 4JZFH 1YPLH 3BIUH 1EAXA 2A4RA 4WH8A 3U1IB 3ZZCA 2ZF0H 1E1QD 1GHAG 2J97A 4GAWA 2O9QA 4I8GA 2TRMA 1FY5A 1O35A 4DIHH 3EA9A 1FY4A 1QURH 4KKDA 1HPGA 1O3MA 1GHZA 4I8HA 1Y5UT 1MD7A 3PYHA 4JZDH 2FO9A 2VWLA 2KZ4A 1HV7A 3ZZ7A 4NA7A 5AHGH 5E0HA 3F1SB 1YCPM 2XXLA 1PYTD 4A6LA 1GBEA 5DP8A 5J4SA 1P2IA 5AFYH 3A7TA 1HYLA 5HKKD 2EI8A 2XNIA 3SNEA 1DLEA 3W94A 1A46H 3AAUA 2ZQ2A 4E7NA 1VJAU 3UQVA 1CQQA 1JIMA 1V2ST 2W26A 1CT2E 2PKAB 3KIDU 1H9LB 3BV9B 1TE0A 1QNJA 1CA0B 3M5NA 1YLNA 1Z6JH 1QQ4A 1SVPA 3SV6A 2JDID 4Y7BA 1XXDA 2RA0A 4ZHLU 2FDAA 3BG8A 4ZHMU 4NIXA 4ESTE 2HLDD 2P8OC 4JYTA 1Z8RA 1GI5A 4AFUA 2BOKA 3UR6A 1RD3B 3LGTA 1X7AC 4KTUA 1GBBA 4NIWA 3RXKA 1ID5H 3STJA 1BITA 2WUBA 3ZV9A 3A7WA 5I25A 2Z94A 2PUQH 1GBMA 1BA8B 3KGPA 1WU1A 1Z7KA 2SFAA 3MI4A 1UVOA 1CHGA 3O8DA 4ABEA 1UCYK 1GJ7B 1MUEB 1PYTC 3KYGA 3MH7A 3PO1B 4NIVA 3OFND 2Q6FA 2F4LA 1HAYB 1YCPK 3RLWH 3FAOA 1BQYA 1TPSA 1LVYA 1TYNA 2BX3A 1Z8IB 5IDKA 1BMNH 4INHA 2FXRA 4B1TA 3NUMA 1P04A 3A7XA 3MNXA 1Q31A 2F9OA 1T31A 1T4VH 5KGOA 3MO6A 4FVBA 3SU0A 2RCEA 4JZIA 2G8TA 4ABAA 2J92A 2FS9A 3TGKE 3SBKA 3KEEA 1YPMH 3SNDA 2WUCA 4HG6A 1ARCA 1D9IA 1Y59T 4Q63A 2CHAB 3LPRA 4YTAA 4K8BA 3ZZ9A 3ZZ5A 4B75A 1FLEE 4A7IB 1IQIA 3T28A 5F8TA 1ZOMA 1UTMA 5FPYA 1AZ8A 1ELEE 1O2UA 3ZIAD 2TPIZ 4UFDH 6GCHF 1GCTC 1UHBB 1UW7A 4X1SU 3FP8E 3NZIA 4K3JA 1O31A 3DD2H 3RMMH 1NPMA 3MFJA 2BDBA 4BTTB 1RJXB 3PRDA 1C5YB 3P17H 2BDCA 4OM9A 1UCYH 2OCVB 1SOZA 1RTLA 3OY5U 1EPTA 1O0DH 1EPTC 2ANYA 3RXEA 3KCGH 1YCPH 1BTZA 1BMAA 1C5MD 3Q3XA 3GY6A 3MH6A 1F5RA 5E8EH 2YNBA 1TWXB 2FX4A 1XKAC 2ALPA 3ZZBA 2GCTB 1B7XB 3RMNH 8LPRA 3B23B 1M9UA 1YPEH 1P02A 2WYGA 1TALA 1MAXA 1HJAC 2HNTF 4KGAA 1EUFA 1TGSZ 2VIQA 3GY8A 1QFKH 4ZKSU 1QCPA 2EI6A 4KP0A 1EX3A 1PPCE 2STAE 3TJVA 8GCHF 2OTVA 2VGCC 2R2WU 2VVUA 1V2WT 3N7EA 1C4U2 1O2TA 3NK8A 2FI5E 1C5SA 2DUCA 3OY6U 3UB0A 3GYMA 4ASUD 1UTLM 1K2I1 3QTOH 2FOAA 2ZO3H 5EJLA 3TU7H 2BZAA 3RXCA 1CE5A 1C2GA 1IQFA 5L30H 3SYJA 4JK5A 2FOFA 4ZROA 2ZQ1A 1FY3A 4K8YA 6LPRA 3SV8A 1Y3XA 3GS9A 2QYIA 1THSH 3CENA 1S6HA 5A8XA 1MZDA 2ZU4A 2BQWB 4ABFA 4B76A 2B8OH 3TGJE 1D4PB 2V3OH 4MTBA 3ZVDA 1L4ZA 3QO6A 1BTWA 1GMHG 1ANDA 2D1JA 1XVMA 1GMDF 1BCUH 3EQ0H 1IQEA 4Q80A 1SKYE 1H1BA 1GVKB 1P06A 2F3CE 1YBWA 4MDSA 1FJSA 1G9IE 1GG6C 1IHSH 2ZDAH 1O2ZA 5C0TA 1QA0A 1CA8B 3KHVA 1EXFA 4INLA 4UFEH 3U8RH 2XBYA 5EXLA 1B0FA 3GCOA 1HIAA 3RXFA 5JBBS 2Y81A 1Y5BT 4GHQA 5FCKA 1FPHH 2ZECA 3R0FA 3TH4H 4AORA 4FETA 1MABB 3AAVA 2LELA 3SZEA 1XX9A 5C20A 1O2KA 1O2JA 4Y8ZA 1KDQB 1P2OA 1C5XB 1NN6A 2ANKH 2Z9GA 3P8OA 3SORA 3HATH 1EAUA 4TWWA 3AW1A 3SUEA 2ZFQH 1ELGA 2BD9A 4KELA 4YXWD 2P59A 1DUEA 5FX6A 1C2IA 3TGIE 4DT7B 4B2AA 3NCLA 2M2AA 3PWCA 1GHBG 4OS2A 3BTHE 3F9GA 3LOXA 5C2ZA 1P12E 2KR7A 1Y3YA 1O5CB 1GI1A 3ENSB 1FMGA 2HWLB 3F3BA 1HCGA 1TB6H 1HAPH 3DSPA 1BTHH 3ODFA 2XYAA 3GICB 5FPSA 1E1RD 4XFQA 3BEIB 1D3PB 1J8AA 1P11E 2A5AA 3RXAA 2A4OA 1BBRE 1O3GA 1VGCB 1WYKA 4TPIZ 4CR5A 5HM9A 4CRAA 1TOMH 2HLCA 3F9EA 1MKXK 1FAXA 3QZQA 5EIYA 2BXTH 1LO6A 2QY0B 2PP6A 4FU7A 2Z9IA 3ZZ4A 2PV9B 2XNDD 3VB7A 2L74A 1CT4E 5ETXA 4BXSA 5C1UA 1MZAA 1UMAH 3QK1A 1ELFA 4ZMAH 1LKBA 1DOJA 2QXGA 3RXPA 3LT3A 4K1EA 1P2NA 2G5NA 2ZU3A 1H4WA 3L33A 3VPKA 4IN2A 5EQSA 1DY9A 4F55A 1Z71A 2VJ1A 3BIVH 2ZFRH 3L3TA 8KME2 3RXIA 2Z9LA 2YMSC 4ZUHA 1A1RA 1N6XA 3TLOA 2ASUB 3URCA 4X6NA 5EJZA 1NRNH 3TK9A 1ELDE 1BHXF 4D7FA 1KXFA 1SHHB 2QF3A 1PPZA 3O8CA 1P05A 1JXPA 1UTQA 2O8TA 1A5GH 4UE7H 1KIGH 4MG3A 2Y5HA 4WMFA 2B7DH 5DP9A 1A0JA 5EU8A 2A7JA 2VWMA 1HXFH 1P3CA 2FODA 2Z3EA 2BVRH 3PMJA 2WPJS 2ZFSA 4D7GA 5LGOA 4AG1A 1AD8H 1C2DA 1C2HA 1AU8A 1V2MT 1MKXH 3KN2A 2VIOA 1K9OE 2KM0A 4DVAU 1O3KA 4JZEH 3WY8A 2H5CA 4X1QU 1ABIH 1GBLA 3LKWA 4TWYA 3MNBA 1C1MA 3PV2A 3M5MA 2Y6TA 1WQVH 2EEKA 3A84A 2Z3DA 3Q3KA 4ISOA 1FZZA 1P9UA 4FUBA 1IQKA 4JMYA 3GY7A 1SQTA 3LGUA 3MO9A 4IW4E 1LQEA 1GBKA 1K1NA 1WCZA 5HIZA 3RXRA 1GI4A 4UDWH 1WDIA 1HAXB 1CBWC 3STIA 3I29A 2C4FH 2J34A 1LQDB 1GBFA 2HVYB 3PLKA 1W0ZU 1V2TT 4ZXXH 3RUOA 1A61H 5C1YA 4DGJA 4MQAA 3BTQE 1C2FA 1QGFA 2ZFFH 1TPAE 2UUKB 1YM0A 5DN6D 1GBIA 6ESTA 2SGQE 2OD3B 3I78A 1PPBH 1KDQA 1O2WA 3H7OA 1HAHH 2RDLA 1FPCH 2QE7D 1PQ5A 2G81E 4NWLA 3VG8A 4AB8A 2ZHDA 1ZZZA 2B5TB 2WPLS 1JBUH 1EP6A 4UONA 1SI5H 3L6PA 2BY6X 2WV9A 3MQKC 1T8OA 2TBSA 1RXPA 1RTKA 2OLGA 5F53A 2PLXA 4U01A 3BEFB 1O3DA 2P8OB 2QA9E 1AFQC 3HPTB 1OWJA 2NU2E 4NSVA 1YY3A 1TGCA 5GCHG 3T62A 4DG4A 3EE7A 1ZTJA 3PTBA 3ODDA 2VBCA 1GI8B 5DK1A 2GDDA 3WWBA 5A8YA 2VIPA 4GUXA 1EASA 2Y7XA 2ZP0H 1K1PA 2SGPE 3SJOA 1NT1A 1KLTA 1YPHC 4A1TA 1ABJH 1W7XH 2F9BH 3TH3H 3KQDA 5ESTE 1UK3A 4CHAC 2WZQA 1HB0B 2A5KA 5EXNA 1D6WA 1GL1A 2J98A 4AB9A 3GDSA 4YT6H 3ATWA 1WQSA 3SJKA 3URDA 1YF4A 4U30A 3FP7E 4UEHH 3RXLA 3E3TA 1AQ7A 1BMFD 3R3GB 1W0KD 1ARBA 1BOQA 1SGFA 2W5EA 1W2KH 2OQUA 2IOTA 3P70B 3M37A 1V3XA 1MCTA 2NU0E 2YNAA 4Y10E 2ZHFH 4ZKNU 2J94A 3RXJA 2UWPA 3FVFB 4A92A 3H7TA 4WMDA 1W7GH 1C5UA 3E0NB 1HAOH 3PB1E 2XBXA 1TMUH 3F0OA 1IAUA 3RC6A 4K69A 1GCTB 2V35A 3UREA 1HAVA 1SSXA 2ZU2A 1GJCB 4AFQA 3C1KA 2A4QA 2GZ8A 3FZDA 3RXQA 1LVBA 2JETC 2VH6A 3A80A 2IPQX 2Z6BD 1UVTH 3ZYDA 3VXEH 1C5TA 1QJ1B 2A45B 3TVJB 1N8OC 1S84A 1NY22 1ZLRA 1L1GA 3UNSA 3M5OA 2F9UA 1KTTB 2AS9A 2VU8E 1EPTB 1K21H 4SGBE 4Y8XA 2ZU5A 5C1XA 4AFZA 1LVMA 1YPKH 2WV5A 2RFKC 4H4FA 3P8NA 4LZ1H 1SG8B 4XBDA 1FX0B 4GCHF 1E38B 3BTDE 5B6OA 1UTPA 1C2EA 1TMBH 2CK3D 1Z6EA 3TJOA 2BD7A 4FUGA 4NGAH 2H5DA 3MU0A 2PKSC 4JYUH 1V2LT 1EB1H 1ZRBA 3SN8A 4CBOA 1AB9C 1HJAB 1L1JA 1OWEA 2FOBA 1PFXC 1A3EH 2GCHG 3ATLA 3GCNA 3NPSA 3RM2H 3MO3A 2VGCB 1Z1IA 1GVLA 3U28C 3SGBE 1SMFE 3BTME 2ZPRA 2KCOA 2BHGA 5LPFA 2FOEA 1QL9A 4E05H 1DLKB 3EA8A 4NZLA 1F5LA 4CH2B 3SUFA 4MLFB 1L1NA 1MH0A 3BTGE 4FXGH 3GCTG 3V3MA 1SQRA 1Q2WA 2UUYA 3QDZB 1C1OA 1GI2A 2ODQA 5JB9S 5IK2D 1O2NA 1ANEA 2V7QD 1J16A 4NIYA 1YC0A 1O33A 5KECA 1TBRH 4YZUA 4IMZA 1S83A 4CBNA 1NROH 1PPGE 4IBLH 3FKSD 3ZZAA 2XBVA 3SV9A 4KTSA 3ITIA 1GL0E 4P02A 1ESTA 2C93B 2Z3CA 4Y0ZE 1NFUA 1OOKB 2BD8A 2V3MA 1LMWB 1YPHE 2GD4B 4CRFA 3NRLA 2A2QH 3GY4A 4DOQA 5KEDA 1TBZH 5EOKA 1LDTT 2Z9JA 5FCRA 3LC5A 1V6DA 1IQHA 1KMHB 1GG6B 3U8TH 2ZA5A 4NZQA 2P94A 4K1TA 4ABBA 3T29A 4DT4A 4XBCA 1HIAB 1SGIB 1UO6A 4X6OA 4U2WA 1W0JD 2RA3A 1KXDA 1ZPCA 4B73A 5C17A 2PTNA 5K0HA 4X8SH 1Y8TA 1AUTC 1O3AA 1TPOA 3TK6A 4BOHA 4IGDA 2BY8X 2VIDA 1IOEA 1O2HA 1O3FA 1P9SA 1BJVA 2ZGBH 2PSXA 4H42U 3HGNA 2ZI2H 2O8LA 4WXVA 2H1UA 1TNLA 3ZVFA 1LHFH 3QTVH 3SHAH 1FDPA 2B9LA 4HZHA 5C5NA 1SB1H 3SU4A 1Q3XA 1XUHA 3MMGA 3KF2A 4LXBH 1HAGE 3GYLB 1MQ5A 4X2WA 1EJNA 3O8BA 1NFYA 4DY7B 2OBOA 3SU1A 1HAIH 3MNCA 3SNAA 4BAQB 5CHAC 1GBAA 1EP5A 1ELTA 4E7RG 1DM4B 4MNVA 2L6OA 3B8JA 3OEHD 5SGAE 3RM0H 1THRH 3ZZ8A 3MU4A 1UTOA 1GDQA 1XUIA 3UIRA 3M3SA 1OYQA 1TABE 4ISIH 3S9CA 3A8BA 3T2NA 1TNGA 3SQEE 4X1NU 1VJ9U 1BRUP 3ELAH 3UQOA 7KMEH 3CS0A 4AYYB 2GV7A 1GI7B 2FLBH 2GMTC 4RT1A 5GNDA 1V2QT 5HMAA 2R3UA 1BTPA 4CRCA 3ZZDA 1WAYB 1P0SH 4AX9H 1CO7E 5JYIA 1O2XA 2BDAA 3RXHA 3A82A 3UTUH 3CP7A 2ZGJA 2OBQA 2C90B 4RKJB 1GBJA 2BXUH 1RGQA 3D62A 1FQ3A 2AMPA 2UWLA 1FONA 1MTUA 1C4Y2 4K5ZA 2ZDKA 4O3UA 4F49A 2YMSB 3P92A 1INCA 1WUNH 1O5AB 3TNTA 1D3DB 1OWHA 2O8MA 1GMCG 2BQ6B 2IJOB 1JOUB 5JBCS 1A0HB 1WXRA 1ELCA 3VXFH 2ZDVH 4ABHA 3A8AA 3SO3A 3ZZ3A 1ZJKA 3JZ1B 3IITA 1K1JA 1PQAA 1TGTA 1O3NA 1AO5A 1EKBB 1V2RT 1KSNA 2HRVA 1HRTH 2FLRH 1KXEA 4DJZB 2GX4A 4SGAE 3E1XB 2R0LA 2ZCHP 1P01A 4K2YA 1PPHE 1ZSJA 1GBCA 1V2KT 3EAJA 4DIIH 4WJG2 1THPB 3M7TA 1Y3UA 1MTNC 1P09A 1C2LA 2P3UB 4ZHAA 4ABDA 3BSQA 5LH8A 3UPEA 3F9HA 4HGCA 4AN7A 1OKXA 1F0UA 2ALVA 5I46H 1QB1A 4O97A 1QL8A 1J9CH 5DO4H 3UY9A 1MCVA 2KFWA 1J15A 4AGKA 2TIOA 2WPDD 2KCPA 1BMMH 1A2CH 1ZHMA 2ZIQH 1C5LH 1H8DH 1P57B 1TX8A 2AIQA 2GT8A 1EB2A 3RXVA 2FOCA 1O37A 3PMHB 2LNCA 1CBWB 1SLUB 2ANMH 2HGTH 2FIRH 1EZXC 2CMYA 2ZHQH 1TBQH 4I8LA 2OQ5A 4BAKB 1HXEH 1PPFE 1AWHB 1AVGH 5T6GA 4I8JA 1W8BH 1G30B 3GOVB 1AWFH 1VCPA 1C1RA 1DS2E 1O5FH 2FYRA 1GJ8B 3SNBA 1QL7A 4PROA 4NSYA 2RDEA 2DE9A 2ZCKP 3D65E 4Q4LA 3ATIA 3M3TA 3RU4T 1O2GH 3U69H 2BD5A 1G37A 2JH6D 3T26A 1AFQB 3VEQB 4ASHA 3KQ5A 4WF8A 3P6ZB 1F0RA 1XUKA 2VINA 3PV4A 2M5TA 2JIZD 1GHAF 5T6DA 5DP3A 3W1EA 2BYAX 2BDGA 7GCHG 2PWXA 2ESTE 2GT7A 1G32B 4YLQH 5T6FA 2YMSD 2BVSH 3QGJA 3VGCC 2PGQB 4ABIA 2XTTB 1CHOG 2V6NA 3ZVBA 1BTXA 2CN0H 3E0PB 1NRRH 1LHCH 2WYJA 2UWOA 4IC6A 2KX4A 2SGDE 5EQRA 1GI9B 3LU9B 2PHBA 4CHAB 2O8UA 1O5BB 2Q6GA 1FXYA 1BTYA 2ZCLP 1F5KU 1T8NA 1JMOH 2KCAA 1S5SA 2J98B 1LHDH 2FOMB 2BQ7B 1F0SA 1KLIH 1SGNE 1T8MA 1GJAB 4ABJA 5HXFA 1VITG 4XOJA 1SFIA 5F8XA 3AK5A 3HKIB 1DXPA 4ACAA 1QIXB 1GHWH 1WTHD 4GLYA 4WH6A 1EZQA 3F6UH 3S69A 4M9FA 1AVXA 3M3VA 1LVOA 2JH0D 5GDSH 1EJAA 3FOAA 1C9PA 4X2YA 3IWMA 1OXGA 1DANH 3KL6A 4THNH 3KNXA 1GHVH 2ZG0H 2BLVA 2SNWA 4Q7ZA 4XE4A 3SQHE 2C8XB 3V12A 3S9BA 1LHGH 2K0QA 1G3DA 1FY8E 5JB8S 3F2GA 1HAVB 2F9PA 3LGVA 4OS1A 1BDAA 4M7GA 4Z1MD 1MU8B 2JETB 5E2PA 3SJ9A 2C8WB 2P3FH 4XSKU 3S7KB 2G4UA 2RG3A 1DPOA 1O2LA 1H8IH 1N8OB 1QA7A 1TA2A 1ZPZA 2F43B 2R3YA 2WV4A 1F92A 4O3TA 1BTUA 4UFGH 1F7ZA 7LPRA 1BBRK 2XC5A 5TJXA 2UUFB 1GHYH 4DCDA 4U32A 1DSUA 2EY4C 4YM9A 1MTSA 1C5QA 5E0GA 4I86A 3ZVAA 1CSOE 1VZQH 1ZRKA 1K28D 5FX5A 1E79D 4ACBA 3W95A 1F0TA 3MTYA 1EQ9A 4NCYA 1SQOA 2CV3A 3RLYH 2PKSB 3A7YA 5J4QA 3LIWA 1AB9B 1CT0E 2FI4E 1O2RA 3MOCA 2BOHB 1O5DH 3U9AH 4B6EA 2QAAA 3FO8D 2EI7A 3PMBB 1SLXB 2HVXA 2ILNA 2FX6A 1AY6H 1SGRE 1SGQE 3HKJB 4AGJA 1EJMA 1O38A 4KTCA 5DP7A 4D8NA 1SOTA 2LP6A 1A0LA 3I77A 4NA9H 1SPJA 1BT7A 1XM1A 1T7CA 9LPRA 3FN8A 4X2VA 5EXMA 1WV7H 1SGFG 3MNSA 1FIZA 1KTSB 4TSFD 1O3HA 5AFZH 2P95A 1H8HD 3AW0A 5JDUB 3PRBA 5T3HA 3SGQE 3DUXH 1OP8A 2ULLA 1G2MA 1GBTA 5A0AE 5FAHA 3K6YA 1O3LA 1EATA 2IJD1 3RXUA 1HGTH 2R0KA 1HNEE 1HUTH
chains in the Genus database with same CATH topology
1YPGH 2A7CA 1BBRH 1NC6A 1S85A 1VCQA 5DP6A 3RXTA 1P2KA 5HM2A 1L4DA 1AKSA 3T5FH 2QF0A 1SC8U 1BRBE 1E0FD 2P93A 1QQUA 3T25A 1H9HE 6GCHG 2BMGB 3SZNA 2QXHA 4WY3A 5EW2H 2AGEX 2BZ6H 4O03A 4VGCC 3SU2A 2ZDLA 3B9FH 3LC3A 4FUFA 1OX1A 5FXLA 2J38A 3ZYEA 1IQJA 1O2OA 4FVDA 3K65B 4ZKRU 2SGAA 1NS3A 1K1LA 2CF9H 1IQNA 2ZDNA 5HYOA 4GPGA 1P10A 4JK6A 4CRDA 3V13A 4X1RU 2O8WA 2BD2A 4Q2KA 2A7HA 1P3EA 4MPWA 4MPXA 2GKVE 3GY3A 3NWUA 3TITA 2VNTA 2ZPSA 3OYPA 2XWBI 3BTTE 1UVPA 5LPEA 2BLWA 1E36B 1SGYE 5G4BA 1G2LA 1GGDC 2ZTYA 1ZTLA 3K6ZA 4AG2A 5GPIB 1GMHF 2R9PA 2XC0A 2BLQA 8GCHG 3M61U 1GJDB 5CHAB 3ZVEA 1RS0A 1DSTA 3M7QA 1GJ4H 1KYNA 1YKTA 2H2ZA 4NFEA 4X2XA 2FM2A 1P03A 1AE5A 2EC9H 3GISB 6CHAC 2H9HA 1DWCH 3K2UA 4NWKA 1SGCA 4D9QA 2GMTB 2AIPA 1FAKH 2Q1JA 2J4IA 1O3PB 1Y5AT 5C5OA 4FUCA 2QXIA 2Y5GA 3UOUA 2IPHA 2WPMS 1MMJN 1G36A 3A89A 4B71A 1G3BA 2XCNA 1GHBF 1AIXH 1SL3A 1GMDG 4WXIA 2OC7A 1LPGB 1MBQA 4Q7YA 1K1MA 1C2JA 2C3SA 1BJUA 4YESB 1AZZA 4Q7XA 5IYTA 3MU8A 3FZZA 4JZ1A 1D6RA 2BDYA 2F9NA 2V3HH 2OUAA 1D3TB 4TY7A 2Z7FE 1O39A 1S0RA 5EW1H 2BX4A 2SGFE 1SGTA 3IG6B 2ZFTA 2QC2A 3O8RA 5FHTA 1WTGH 2P16A 1NO9H 3BEUA 3ZZ6A 1NFXA 2VWOA 4BTUB 1QTFA 1O2MA 2PGBB 2OC8A 1J14A 3U98H 2BM2A 3ZVGA 3AVZA 1C1TA 1V2PT 3DFJA 2G52A 3QUMP 2VH0A 3HK3B 5DP4A 5TCAA 1UTNA 3S9AA 1QJ7B 2K1QA 3RMLH 3A7VA 3FP6E 2ANWA 1C5WB 3A81A 2ZGCA 1W13U 1YGCH 2G00A 2ZNKH 2FS8A 1ZR0A 1LHEH 2AGIX 2V0BA 4Z6AH 2F9VA 1SLWB 4OS7A 5EPNA 3SU6A 3ZVCA 2HNTC 3MU1A 1QBNA 1MTNB 1TAWA 3ATKA 3RXDA 1O3JA 4RKOB 1UCYE 5TCCA 1ESBA 2ZEBA 1DWDH 1O34A 1PQ7A 1TNJA 2A31A 1FY1A 1ANBA 1TNKA 2KAIA 3OTJE 3K9XB 4ISLA 1TX6A 4K60A 5LPRA 1DITH 1QJ6B 2XWAA 1ZSKA 2ZU1A 4LZ4B 3VB5A 1VR1H 3LGWA 4X6PA 3SOSA 3EE0B 1P2MA 1DT2A 4YO9A 1DDJA 2G5VA 1W0YH 1GBHA 4RN6A 2F91A 3GY5A 2VWNA 2NU4E 4BAOB 4ISHH 4Y79A 1NU9A 4XBBA 2BVXH 3E16B 2XRCA 1MQ6A 4H6SB 2CF8H 1HJ8A 2VIVA 2G51A 4Z0KA 1DVAH 1EAWA 3HGPA 1A5IA 2VVCA 1KXBA 3SJIA 2Y82A 3QZRA 3TJUA 2OC1A 1GHXH 1QRXA 3LGIA 1EOLA 4YOJA 3RXSA 3EYDA 2QV1A 1OWKA 4BAHB 1KXCA 3A88A 3RDZA 2GGVB 4YOGA 2FTLE 5F8ZA 1YLDA 1NU7B 2OC0A 2BY5X 2SGEE 4DW2U 1WOFA 4ISNA 5JPMH 5A0BA 3E91A 5EG4A 1S81A 4AYVB 1JRTA 2GDEH 2XC4A 3OU0A 3SV2H 3UNRA 4YOIA 1C2KA 1GJ5H 2J9NA 3FFGA 3H5CB 3LH1A 4GHTA 3PLPA 1W11U 3VGCB 4CRBA 1C5ZB 4B2CA 1HLTH 2FOGA 3LJOA 1ACBE 3T27A 3UFAA 2ZC9H 3MH4A 1O30A 2D26C 2PW8H 1G3EA 1C5OH 1MAYA 2XW9A 3SUGA 2A32A 1O32A 1W12U 1DXWA 1VITH 4CR9A 3BG4C 1CGJE 2H6MA 5FBEA 3P8GA 1Z8JB 1TX7A 2Q6DA 1WBGB 1YP9A 2YOLA 2HPQH 1C9TA 1O2IA 1QRZA 1L2EA 1GJ6A 1TFXA 1ETTH 4IS5A 1OWDA 1QB6A 1ZYOA 1RIWC 2ZHEH 2R2MB 4R8TB 2WPHS 5EPYA 3UOPA 2B0FA 2G55A 2THFB 3RC4A 1T8LA 1EOJA 1YLCA 1ZTKA 1ZHPA 2ZZUH 4FUHA 4D76A 3TH2H 1P2JA 5AF9H 1OP0A 2H9TH 2HNTE 2BD4A 3TIUA 5GCHF 1OS8A 4QT8C 2QCYA 1P2QA 4GSOA 2JKHA 3SGAE 4CH8B 3GCHB 2AEIH 2W3KA 2P3TB 3OX7U 1NTPA 2ZTXA 1EZSC 2BTCE 4JYVH 5ESBA 3SU3A 3VB4A 1GDNA 1HAZB 3E90B 1C5RA 1MU6B 4F4OC 4A1VA 1AUJA 3QN7A 5EODA 3N7OA 1KY9A 4FU9A 1CU1A 4R0IA 1AGJA 3EDXB 1B0EA 3NXPA 3BTEE 3M5LA 1VCWA 3A85A 1GPZA 2W7UA 3PWBA 1V2NT 2BDHA 1C5PA 2JH5D 3M7UA 4FUEA 1TOCB 3SW2B 2EA3A 5JBTA 4Y71A 3PLBA 2FI3E 1K1OA 1MBMA 2FP7B 4WVPE 2VIWA 1IQLA 1O36A 3VB3A 2HPPH 2PUXB 1C1NA 2Y5FA 2STBE 1HFDA 1FN6A 1O3EA 2GTBA 4WMEA 4DURA 3QLPH 1J17T 4RSPA 2I6SA 4MPVA 4I32A 1MTWA 1DWBH 1ZPBA 1PPEE 2ODPA 3RXOA 4MVNA 1W3CA 1ELVA 1O2PA 1Z1JA 3ZV8A 4ZKOU 1C4V2 4CRGA 1FN8A 3LH3A 1QBVH 1C1WH 2PKAA 1RRKA 3Q76A 1E34B 2C8ZB 1UK2A 5FPTA 1CA0C 3PROA 1O3CA 4OS6A 1QRWA 1YYY1 3Q3YA 2ZGXH 1Y3VA 3EGKH 1JRSA 3LJJA 4CREA 5E2OA 1DFPA 4GVUA 1UTJA 1TRNA 3TNSA 1FUJA 1XKBC 4MNXA 1AKSB 2FTMA 2TGDA 2A2XH 1GCDA 1XXFA 2I6QA 2UUJB 1SR5C 1O2VA 4X6MA 2WINI 4Y6DA 4I33A 3MU5A 4Y7AA 2GCHF 3A86A 1OWIA 1LPKB 1O3IA 1NFWA 4OGXA 4VGCB 1DICA 3F68H 2AYWA 3PO1C 4BANB 1GI0A 2NU1E 2NU3E 1IQMA 5E0JA 2GVFA 4HI3A 1O2SA 2DE8A 3A83A 3E6PH 4AOQA 1GBDA 1UJ1A 1BB0B 2ZTZA 5GWZA 4MPUA 3GCTF 1SBWA 3QX5H 2ZKSA 5PTPA 2Z9KA 5GXPA 1C2MA 4J2YB 1ZGVA 4AZ2B 4K1SA 2HOBA 2BY7X 1ZSLA 1JIRA 4GCHG 2A0QB 1UTKA 1SGEE 2ZPQA 1GWAA 1OP2A 3RC5A 4BXWA 1GGDB 2CHAC 1TLDA 3TJNA 5L2ZH 1O5EH 4B2BA 3BN9A 5GJ4B 3SI3H 1F2SE 1SFQB 1FNIA 1MTVA 1NRPH 2FEQH 3ATMA 1SGDE 3RU4D 4X0WU 1UHBA 2SNVA 4YLUA 1AHTH 1XMNB 3ESTA 4I31A 1CVWH 1L0ZA 2AERH 2CJIA 2BDIA 1C5NH 4BNRA 2FZZA 6CHAB 2PFEA 5GIBA 1UVUH 3UR9A 3A8DA 1SQAA 2LPRA 1NESE 1K1IA 3GY2A 3TPIZ 4ZAEA 5A8ZA 2CGAA 5EQQA 1CGIE 2QXJA 1DE7H 3GCHC 1N6YA 4JCNA 3UWJH 1O5GH 1MKWK 3LGYA 1NM6A 2HALA 2BB4A 2J95A 2GV6A 1S6FA 3Q00A 3BTWE 1SLVB 2GCTC 3CS7A 5FBIA 3PTNA 2FESH 3DHKH 5HGGA 1PJPA 1TRYA 1ZMLA 2AH4X 1T32A 4J1YA 3KQEA 5DG6A 2AFQB 4FUIA 1GJBB 2NWNA 4MNWA 4FUDA 3P8FA 1QBOA 2W7SA 2FPZA 4X8VH 3D49H 4A5TS 1C5VA 1ANCA 1GJ9B 4ZXYH 1DY8A 4Y8YA 1UK4A 1IHTH 1AVWA 1TMTH 1IQGA 4Y11E 1C1QA 4NFFA 5DJ7A 3DA9B 1T4UH 2OP9A 1H9IE 2XCFA 1TGNA 1SGPE 1UVSH 5A0CA 2GZ9A 2ODYB 2BY9X 4LOYH 3KQCA 1BRAA 2D2DA 1GI6A 1BMLA 1TONA 3M36A 2W3IA 1V2VT 3SNCA 1BUIA 3U8OH 4D9RA 4IMQA 2CXVA 1A4WH 5ABWA 1ORFA 5DPAA 1ESAA 1EZUC 1BIOA 1W14U 4LK4A 1A5HA 3GDUA 1HBTH 1WSSH 4FU8A 3V7TA 1MKWH 3MYWA 3NKKA 2AGGX 2GZ7A 4B74A 1C1SA 1C1VH 3OSYA 2F83A 3TK5A 1O2QA 2KAIB 3E8LA 3P95A 3Q77A 5EGMA 2GP9B 2WPKS 2TGAA 1LTOA 1K22H 4E06H 5L2YH 1GMCF 2QGRA 4ABGA 4AFSA 1QB9A 4X8UH 2FWWA 2BLOA 4HTCH 1RTFB 3QWCH 1S0QA 1Z8GA 3PMAB 1A3BH 4OS4A 1C1PA 1FV9A 1BRCE 1HJ9A 1O3BA 2VVVA 4NA8A 5C3NA 1W10U 1G3CA 3HK6B 2PSYA 3EA7A 5CMXH 2ZWLH 4XDEA 2D8WA 3UNQA 3V0XA 1TPPA 2TGTA 1HDTH 3KQBA 1C1UH 3SJ8A 1FI8A 1ZGIA 1ZMJA 5BPEA 4TY6A 4X8TH 3MHWU 1TGBA 1ETSH 2Y80A 3M35A 3BTFE 2A1DB 3VB6A 4BAMB 3UWIA 1ZMNA 2PTCE 4TPYA 5K7RA 1XUFA 3A87A 1TIOA 3PM3A 3RP2A 4FUJA 1YPJH 3BF6H 1JWTA 1BZXE 1AI8H 5CE1A 1ELBA 1TQ0B 2FMJA 5AVDA 1TNIA 2C8YB 1NRSH 1VGCC 3U1JB 5L6NH 1Y3WA 8ESTE 3C27B 2TGPZ 3SU5A 1DWEH 1XUGA 3JZ2B 1OYTH 1CGHA 4YT7H 2G4TA 4I8KA 1AE8H 5DGJA 1TA6A 2IN2A 4HFPB 4OGYA 2AMDA 3SV7A 3S0NA 1DUAA 3VFEA 1TQ7B 1TRMA 3MH5A 3SHCH 5JBAS 2Y7ZA 2PR3A 3LONA 4X1PU 1GDUA 1KLJH 1QHRB 3UUZA 2OXSA 3RU4E 2ZHWH 2XBWA 1DX5M 1B5GH 4A1XA 3BG4B 1P8VC 1S82A 1E37B 2ZFPH 4IN1A 4TYDA 4I7YH 1NZQH 2A4GA 3DFLA 1AMHA 2ZGHA 1A7SA 1RFNA 2QIQA 1ZHRA 3A7ZA 5C67A 5A09A 2A5IA 1ETRH 1RIWB 1PQ8A 1AFEH 1FIWA 2FYQA 3AASA 4H6TA 1ELAA 2AMQA 2QN5T 3G01A 1O2YA 3SUDA 3F9FA 2OINA 1QY6A 1O3OA 5DKMA 1LPZB 1E35B 1V2JT 5BRRE 1NRQH 3DT0H 2WPIS 1N1LA 3A8CA 3QGNB 7GCHF 1D3QB 4INKA 3RXBA 4IC5A 1ZJDA 7ESTE 2FOHA 1GVZA 4UD9H 3FANA 4ZH8A 1XUJA 1CHOF 1TNHA 1EAIA 3LDXH 4MNYA 1U6QA 4WWYA 1XVOA 2BD3A 5H4IB 2VB0A 9ESTA 1QR3E 4NG9H 1SHYA 4Y0YE 5F6MA 2H9EH 1OSSA 4UFFH 1BHXB 1KXAA 5DP5A 4OS5A 3SI4H 1MD8A 4O9VA 1V2OT 2ZDMA 3MWIU 5F03A 5A2MH 1LCYA 1VITF 1LKAA 3BTKE 1GI3A 4BTIB 3RXGA 4Y76A 3RMOH 3RXMA 3D23A 3GDVA 1OPHB 2J2UA 1V2UT 3S7HB 1AN1E 4JZFH 1YPLH 3BIUH 1EAXA 2A4RA 4WH8A 3U1IB 3ZZCA 2ZF0H 1GHAG 4GAWA 2O9QA 4I8GA 2TRMA 1FY5A 1O35A 4DIHH 3EA9A 1FY4A 1QURH 4KKDA 1HPGA 1O3MA 1GHZA 4I8HA 1Y5UT 1MD7A 3PYHA 4JZDH 2FO9A 2VWLA 1HV7A 3ZZ7A 4NA7A 5AHGH 5E0HA 3F1SB 1YCPM 2XXLA 1PYTD 4A6LA 1GBEA 5DP8A 5J4SA 1P2IA 5AFYH 3A7TA 1HYLA 2EI8A 2XNIA 3SNEA 1DLEA 3W94A 1A46H 3AAUA 2ZQ2A 4E7NA 1VJAU 3UQVA 1CQQA 1JIMA 1V2ST 2W26A 1CT2E 2PKAB 3KIDU 1H9LB 3BV9B 1TE0A 1QNJA 1CA0B 3M5NA 1Z6JH 1QQ4A 1SVPA 3SV6A 4Y7BA 1XXDA 2RA0A 4ZHLU 2FDAA 3BG8A 4ZHMU 4NIXA 4ESTE 2P8OC 4JYTA 1Z8RA 1GI5A 4AFUA 2BOKA 3UR6A 1RD3B 3LGTA 1X7AC 4KTUA 1GBBA 4NIWA 3RXKA 1ID5H 3STJA 1BITA 2WUBA 3ZV9A 3A7WA 5I25A 2Z94A 2PUQH 1GBMA 1BA8B 3KGPA 1WU1A 1Z7KA 2SFAA 3MI4A 1UVOA 1CHGA 3O8DA 4ABEA 1UCYK 1GJ7B 1MUEB 1PYTC 3MH7A 3PO1B 4NIVA 2Q6FA 1HAYB 1YCPK 3RLWH 3FAOA 1BQYA 1TPSA 1LVYA 1TYNA 2BX3A 1Z8IB 5IDKA 1BMNH 4INHA 2FXRA 4B1TA 3NUMA 1P04A 3A7XA 3MNXA 1Q31A 2F9OA 1T31A 1T4VH 3MO6A 4FVBA 3SU0A 2RCEA 4JZIA 2G8TA 4ABAA 2J92A 2FS9A 3TGKE 3SBKA 3KEEA 1YPMH 3SNDA 2WUCA 1ARCA 1D9IA 1Y59T 2CHAB 3LPRA 4YTAA 4K8BA 3ZZ9A 3ZZ5A 4B75A 1FLEE 4A7IB 1IQIA 3T28A 5F8TA 1ZOMA 1UTMA 5FPYA 1AZ8A 1ELEE 1O2UA 2TPIZ 4UFDH 6GCHF 1GCTC 1UHBB 4X1SU 3FP8E 3NZIA 4K3JA 1O31A 3DD2H 3RMMH 1NPMA