3A83A

Crystal structure of trypsin complexed with pre-synthesized (e)-4-((2-nicotinoylhydrazono)methyl)benzimidamide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a83A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a83A02
1GJAB 3VB5A 3JZ2B 1QBOA 2V3HH 1NRNH 2NWNA 1SFQB 3VGCC 1MTNB 2I6SA 5E0JA 1GMCF 4ISOA 2VVVA 1ELFA 1IQMA 4KP0A 1TA6A 3PMJA 4IW4E 2CN0H 2VWOA 3FP7E 1AWFH 3SU1A 2G5NA 1GL1A 4DIIH 3A88A 1TGTA 2BDHA 2VWLA 1A0LA 4FUCA 4WF8A 2XW9A 1C1WH 2HNTF 1U6QA 2Y81A 4FUIA 5A09A 2ZFFH 1LCYA 1TYNA 3I29A 5FPSA 3KL6A 4B2BA 4CHAC 3HKJB 1FIWA 1IQNA 1C5YB 2ZFSA 4VGCC 4FUEA 2BYAX 2ODQA 1Y3UA 1ESBA 1TWXB 4ZKSU 1C5LH 3QTOH 1O2ZA 2ZGCA 3PO1C 6ESTA 2H6MA 1NFUA 1T31A 4YLQH 1RIWC 1HBTH 2BB4A 4MPVA 5F6MA 2OC1A 2JETC 1V2RT 1IQFA 2GMTB 1K1PA 2JH0D 3Q3YA 1GBBA 2B8OH 1S83A 3MO9A 5LPEA 1HJ9A 2D8WA 2ZGJA 1W7XH 2C90B 2XC0A 2ZZUH 2R0KA 3RXPA 1G3CA 4X0WU 1MD7A 2Z9GA 1GJ8B 1MKXK 1QJ7B 1TQ7B 1XM1A 2GZ8A 1GGDB 1DSUA 2B7DH 4NIYA 1W13U 3BEIB 2B9LA 2Z9KA 3FP6E 4JYVH 5I25A 1BA8B 1DLKB 1BTZA 1ELDE 2SGPE 4NA8A 1XUHA 1HB0B 3TITA 1BJVA 1TX7A 1SHHB 2ZDVH 1Z6JH 1E0FD 2RA0A 5JBAS 2HWLB 3MYWA 5F03A 1AB9C 3VB4A 1KLJH 2Y82A 4XBBA 5DKMA 3MU8A 4ABEA 2O8LA 3LH3A 1O5FH 4AYVB 1GBTA 1C5XB 2HALA 3S9CA 3KGPA 1Z1IA 1SQTA 2BDGA 1ZLRA 3SU4A 2OQUA 2AIPA 3TK5A 5AFYH 2ZG0H 4NG9H 2OBOA 1AMHA 1LHCH 1V3XA 4AYYB 1DANH 2ULLA 1HXEH 2A7JA 3PV4A 4ABDA 3T28A 4Y10E 4KELA 1BITA 1ZHMA 3UREA 1TNHA 2QGRA 3I78A 1MBMA 1OKXA 2CGAA 2VIVA 1HAHH 3P6ZB 5PTPA 1V2ST 3NKKA 2F9VA 1LQEA 1NPMA 4U32A 3S69A 3A82A 1LVMA 4IBLH 1BTYA 1C1VH 1O3OA 1O2LA 1Y5BT 1NN6A 2ZECA 1XKAC 3C1KA 7KMEH 1LPKB 1SVPA 2BY7X 1GI6A 4Y8YA 2ZTXA 4RKJB 4K2YA 1HAVA 3F9GA 1A3BH 1EPTC 1C4Y2 2RCEA 2ANKH 5FXLA 1GG6B 2J95A 3U1IB 4FXGH 1BTPA 1DY8A 3ZYEA 1G32B 3TJVA 4NIWA 5EPNA 1ZPZA 1YBWA 2XCFA 4FUBA 1HDTH 1C2FA 2J4IA 2XCNA 1NFYA 2SGQE 5I46H 5HYOA 4K1TA 1GJ7B 2Q6GA 3MNSA 1RGQA 3BIVH 4I8LA 1C5TA 4WH6A 3M3SA 3UNRA 2BDYA 4H4FA 3RXDA 1ANEA 1CO7E 4JYUH 3DFJA 1LKBA 1HPGA 2GGVB 2ZEBA 1O39A 1GI7B 1RD3B 3KIDU 4NSVA 5F8TA 1UO6A 3UPEA 2G4TA 3E0NB 3MMGA 3SJKA 2Y5FA 2FX6A 3UR9A 3U8RH 4X1SU 2SGFE 4ABGA 1A5GH 2R2WU 1F5KU 1TBRH 4OGXA 3ZVEA 2BY6X 2ZFQH 1GI5A 2F9BH 1QRWA 2ESTE 1ELTA 2VIOA 3CS7A 2WPIS 1WUNH 3EAJA 1HLTH 1FUJA 4B2AA 1YLCA 5A0CA 3M7UA 2AFQB 2DE9A 4Q7ZA 1K1LA 3LH1A 3P70B 2BVSH 2VGCC 2IOTA 1X7AC 1F5RA 5HM9A 4NCYA 1O3IA 4GHQA 3O8RA 2G5VA 1MQ6A 3ELAH 3OU0A 1QRXA 3F9EA 2IPHA 1AN1E 3M5OA 5A8YA 3M7TA 1CT2E 5FBIA 1SMFE 1GG6C 4ZHAA 2B5TB 1WOFA 3UQOA 1T4VH 2YNAA 1HAIH 4X2YA 2VIPA 2P3FH 5ESTE 1TRMA 2BOKA 1GBJA 3IWMA 4Y76A 1IHTH 3A7VA 3KQDA 1N8OC 4XSKU 3GDUA 1DX5M 3AW0A 1MAYA 1TNJA 5FBEA 4HZHA 1YPGH 4MPUA 2A2QH 4XBDA 1MKXH 1SR5C 4ISHH 4FUDA 3SV9A 2FWWA 4FUHA 1O30A 2ZF0H 2FOMB 1HJAB 3RLWH 1UK3A 4IGDA 1QB1A 1LPZB 3T62A 4F4OC 2R3UA 2M5TA 2CJIA 2HNTE 1RS0A 1DFPA 1LKAA 3LC3A 2C8WB 2Y80A 4ZKRU 4O97A 8GCHG 3SJOA 1FY8E 2AMQA 2ZGXH 1QFKH 3RXQA 1ZPCA 1EZSC 2P3TB 1HAZB 1TPOA 3SO3A 2ZPRA 1DWDH 5EG4A 1C1RA 3RLYH 2ZDAH 4ZMAH 1IQGA 4U30A 1C5WB 3RXKA 1FLEE 3BIUH 3QLPH 1LQDB 2O8MA 2WPKS 1FI8A 4DG4A 1C2KA 3A85A 2W7SA 3UUZA 1PQ7A 4TWWA 3RXFA 1E35B 2Z9IA 8KME2 2H9TH 1A3EH 1ETSH 1TOCB 4UFEH 3E16B 2SNWA 2J34A 1TABE 1NU9A 1PPEE 1GJ9B 2BX3A 1C5NH 4K69A 4WMDA 4GCHG 1O5AB 1T8NA 1C1OA 3ZVBA 1QL9A 4HFPB 3GYLB 1O35A 2FOAA 1GHYH 1OS8A 1Z6EA 1PPHE 2CHAC 1EPTA 4LOYH 1C1SA 1E36B 4DOQA 5HMAA 1IAUA 1CE5A 1FAXA 3L6PA 4IMQA 4AZ2B 2A5AA 3SNCA 2ZWLH 4MNVA 4RN6A 1D4PB 1QA0A 4UONA 1HXFH 1E38B 1TX6A 3QDZB 1EAIA 5L6NH 2AGEX 3RXHA 4R8TB 1OP0A 5EXNA 1ANDA 1QHRB 3PWCA 3RMMH 1NU7B 1OWKA 1O2RA 2Q1JA 4QT8C 4BAQB 3ITIA 1K22H 2SFAA 3P17H 1THRH 2ZO3H 2QAAA 1O37A 1KTTB 5C5OA 1RRKA 3G01A 5H4IB 2FO9A 2QF3A 2ALVA 3UOUA 4TYDA 1BMNH 3PLBA 2WYJA 2ZIQH 2XWAA 1OSSA 3S9BA 3BTFE 1GDQA 4ZH8A 3ZVGA 3A81A 4JYTA 3GISB 4WMFA 1FXYA 2BD8A 1EXFA 2FS9A 4NA7A 7ESTE 4NA9H 2ZKSA 1JXPA 4CH2B 1PPBH 2PGBB 1UHBA 2TGTA 3P95A 1ZSJA 3RU4T 2FI3E 3E6PH 2QF0A 1ZMJA 1FQ3A 1C2DA 2TBSA 5B6OA 3P8GA 1B0FA 1A7SA 1EASA 3RC4A 1P12E 2V35A 4BANB 2ZA5A 4U2WA 3BG4C 1BHXB 2Y5HA 5E2OA 1G2MA 2CF8H 3SHCH 3STIA 1ELEE 3TH2H 1GCTC 1EOLA 1YPEH 1G9IE 1H9HE 4DW2U 5HXFA 1O2UA 5JBCS 1HIAA 3IG6B 3UY9A 3T5FH 1EX3A 4CRCA 1E34B 4GSOA 3BTKE 4Y8XA 1GVZA 3DA9B 4B76A 2FLBH 3A89A 3SJIA 1MU8B 1P2KA 4ISNA 3BTTE 2OQ5A 2HRVA 5GXPA 3OY6U 3TIUA 1RJXB 1BOQA 3H7TA 1ZTKA 1EZQA 1Z8IB 1TIOA 2EI6A 1QURH 1OYQA 2PFEA 3UR6A 3M5MA 4X6NA 3ZZ5A 2PHBA 1NTPA 1SHYA 2BLQA 4E06H 3RC6A 1NFXA 3BSQA 2FOEA 3ENSB 5JB8S 5AFZH 4AORA 1GBLA 4D76A 2BY9X 2BZAA 3KQCA 3MOCA 1AKSA 3M36A 5BPEA 3HGNA 1TALA 3AAUA 4GCHF 1O38A 1AU8A 3SNEA 8ESTE 1O5GH 3PB1E 4E05H 3PYHA 1L0ZA 4AG1A 3RXMA 2V6NA 4YESB 1CHGA 1ZMLA 4GUXA 1ACBE 3SV7A 3SU0A 2TGDA 1GWAA 1G3BA 5GPIB 1UK2A 3A8CA 2TGAA 1GJ5H 1TBQH 2SGAA 3O8CA 1ARBA 1S0QA 1HGTH 2ZPSA 1C5MD 1O3MA 2JKHA 1QBNA 3QO6A 3PO1B 2QV1A 3SI3H 4CBOA 2HPQH 5J4SA 1DY9A 3LGWA 3LT3A 1RIWB 2HVXA 1ABJH 2ODPA 2JETB 1UK4A 1YPHE 1C1UH 3SGAE 1AWHB 1DITH 1YCPK 1GCDA 1ELBA 6GCHF 3KN2A 1O5BB 1PQ8A 9LPRA 3QUMP 1ID5H 3MH4A 1V2TT 1P2IA 4UFGH 1NESE 1GPZA 4OS6A 1OWIA 1AVGH 1O31A 4AB8A 4MQAA 4YOJA 3SQHE 3WY8A 1GI0A 1TOMH 4D9QA 5JDUB 1CQQA 4D9RA 3NK8A 4ABFA 1SLVB 1WQVH 1P2MA 1ZRBA 3RMLH 4IMZA 3ZZ4A 4NWLA 2A2XH 1WSSH 3TJNA 1EATA 2BD4A 2R2MB 3QN7A 1OWJA 4Z6AH 3B23B 3OYPA 2GKVE 1QA7A 1T7CA 4A1TA 2VVUA 1A0HB 4B75A 1GI9B 2GDEH 5FX5A 1AB9B 3KCGH 2FX4A 1SGQE 3ZVAA 3ZZBA 3SJ9A 2ZCLP 1WBGB 4E7RG 2GTBA 2AYWA 2NU1E 4XBCA 5HM2A 3RUOA 4UFFH 1CA0C 3ODFA 3O8DA 2AS9A 1TNGA 4E7NA 2PTCE 3LJOA 1QGFA 2XC4A 3S7KB 2PWXA 5DP7A 1O2YA 1GMHG 3GICB 3ZVFA 4NGAH 1A4WH 5A8XA 4GLYA 2ZFPH 1EAWA 4I8GA 1ANCA 1G30B 1AI8H 1H9LB 5E0GA 4CRFA 1P09A 2IJOB 3T27A 1P04A 1FN6A 1CA8B 1NC6A 2BX4A 1L1JA 1VZQH 4CBNA 1NM6A 1RTLA 1BBRE 3TH3H 5GDSH 3NUMA 3ATWA 5E8EH 1V2JT 2CMYA 4X1PU 3ATIA 1C5ZB 1EUFA 1VJ9U 1PPGE 5T6FA 1UTLM 1VGCC 1V2LT 2PKSC 1MCTA 1BHXF 1EPTB 1QIXB 5F8ZA 5K7RA 1Z7KA 2BXUH 1EAXA 2WPLS 2ZCHP 3TJUA 1HAYB 1KIGH 3LGVA 3HATH 4AOQA 1EAUA 3ESTA 1KXEA 5ETXA 2P8OC 3MH6A 1DVAH 1QR3E 3DFLA 3RXRA 3RXVA 1C5QA 2BD3A 1SQAA 2YNBA 1TE0A 4CRAA 1WTGH 5T6DA 3AW1A 3GCNA 1OWEA 3UFAA 2PUQH 3K9XB 2F3CE 1V2PT 1YM0A 2A5IA 1SGTA 3P8FA 5EU8A 1P2JA 2GT8A 2Q6FA 2P16A 1K1MA 1ZGVA 2ZU3A 1BTXA 4Y79A 1GBEA 1DICA 1P57B 1ESAA 4OS5A 1ZTJA 1DS2E 1WYKA 2CXVA 1XX9A 1YF4A 1OP2A 1NZQH 4RKOB 1TNKA 3GY6A 5DP6A 1VCQA 3PMHB 4A1XA 1SOTA 1KY9A 3TNSA 1SGEE 4UDWH 1YPKH 1ZYOA 1P11E 1SGIB 4FVDA 1W8BH 3NPSA 3V12A 5IYTA 5AHGH 4HGCA 2VGCB 3I77A 1O5CB 1GHBG 1UCYE 5FAHA 5AVDA 3ZZ9A 4BTIB 1UHBB 5TCCA 1YPLH 1P03A 2Z3CA 2OC8A 4X2XA 1DXWA 1BQYA 3M5LA 1PJPA 3SV8A 3ZV8A 2GP9B 4HTCH 4NFFA 2C3SA 2A7CA 2VIDA 3U9AH 1JMOH 2FOBA 4WJG2 4WMEA 1SLUB 2GT7A 1ZMNA 2V3OH 5A8ZA 1OXGA 1S82A 4ISIH 2XC5A 4F49A 4IC6A 1GHWH 2VINA 2P94A 4AFQA 2G4UA 2WPJS 5C1UA 2ZU5A 3UNSA 1HIAB 3Q3XA 2VNTA 1GJ6A 1GDUA 2FODA 1N8OB 1ANBA 3RXGA 2ZI2H 3TK6A 4Q80A 1P06A 3D65E 3UNQA 3K6YA 5EODA 4BTUB 1B0EA 2DUCA 2ANWA 1MMJN 1GMHF 3BG8A 1DLEA 2BQ6B 2G52A 6CHAC 1MTVA 4YZUA 3RM0H 1BTUA 1V2KT 1Z8GA 4NIXA 1L4ZA 1TB6H 2A4GA 2EA3A 1QY6A 1P0SH 1S6FA 2AMPA 2C93B 3EGKH 1JOUB 2Q6DA 1D3PB 2A7HA 2GZ7A 1TPSA 1BZXE 2BXTH 3KNXA 1W0ZU 1VR1H 4Y71A 3D49H 3TGIE 6LPRA 3TGKE 1T32A 4TY7A 4U01A 1S81A 2BHGA 1LMWB 5C5NA 1AKSB 2XYAA 2BDCA 3A87A 2FS8A 3H7OA 4ZKOU 4A7IB 3EQ0H 3BV9B 2J94A 3F6UH 3GCTG 3Q76A 5DP3A 2NU2E 1MCVA 3SNBA 2VVCA 2WV4A 1O32A 1ZRKA 4MLFB 3A84A 3TVJB 1LTOA 1Y59T 2STAE 1JRTA 2ZQ2A 2AGGX 2FOFA 1S85A 1TMTH 2WV5A 4I32A 1KXFA 1ZGIA 2GV7A 3RXTA 1AFQB 3SUDA 4ZUHA 1HAOH 2BD7A 3KQBA 5EXLA 3A8DA 3RXAA 4DT7B 5JYIA 1W14U 3S0NA 4JZFH 2G8TA 2CHAB 1YLDA 4INHA 4JK5A 1EJMA 3ZV9A 1GBIA 1T4UH 2ZQ1A 2FMJA 2UUYA 1MTSA 2UUKB 3BF6H 3RXIA 2ZHDA 4D8NA 2AIQA 1RTKA 1IQIA 3M7QA 2OD3B 2P93A 3MH5A 3A7XA 5EPYA 2FZZA 4A1VA 3A80A 4XOJA 1A61H 1KXCA 3TLOA 1BMAA 1LHGH 1Q3XA 1FIZA 1C5RA 3BTME 4TPYA 2VIWA 1G2LA 1SL3A 1O5EH 1TGBA 2WPHS 3TU7H 1FY4A 2WINI 1WU1A 3VB6A 1DWCH 1P9SA 1NRRH 1WTHD 3SBKA 1YCPM 1F0UA 3SGQE 1KTSB 1O34A 1K1NA 2PUXB 1C2GA 1BUIA 3AVZA 2STBE 1C2IA 2JH5D 3GYMA 1C1TA 2Y6TA 1SGDE 4DGJA 1GHBF 1Y8TA 3LGIA 3URDA 3A7TA 2RA3A 2GCHF 3RP2A 3SN8A 2C8YB 2A4RA 3MH7A 4R0IA 2ZC9H 3OX7U 5A0BA 1VCWA 1C4V2 3HKIB 1A2CH 5FCKA 1T8MA 3PLKA 4ZHLU 3BTQE 3LONA 3RDZA 4CRDA 2ZHWH 4X1QU 3BTHE 3RXEA 1GJBB 5GWZA 1CHOG 5TCAA 1H4WA 1C1NA 1ELVA 5JBBS 1O3EA 5LPFA 1EJNA 3SOSA 1AFQC 3B9FH 2ASUB 3ATMA 1JWTA 2G00A 2NU4E 1GBMA 1FNIA 1EP6A 5BRRE 1VITG 2F9UA 1K1JA 3MNBA 1LHFH 2ZU2A 5GCHG 2ZHFH 1EB1H 3BG4B 2UWOA 1C2MA 1V2OT 2Z94A 4FU9A 1AY6H 3NWUA 1GCTB 3QTVH 4JZ1A 2R9PA 3RXBA 1O3JA 1NROH 1TGNA 1NRQH 1P3CA 1M9UA 2VU8E 2BDBA 5DO4H 2VB0A 4DJZB 4DVAU 2GX4A 2Z3EA 2ZP0H 1CBWC 4CR9A 1GJCB 1P9UA 1O3PB 3F1SB 3MNCA 1VITH 3RU4E 4MDSA 1V2QT 1C2JA 1K28D 1AVWA 1UTQA 3GOVB 6GCHG 2Y7ZA 4X8VH 5J4QA 4FU7A 1HYLA 2PV9B 2ZPQA 3GCTF 1SGFA 3HK3B 4X8UH 1HAXB 1ZTLA 1D9IA 1QJ6B 2O8TA 2QY0B 1C1PA 1V2UT 4NZLA 3GY4A 1SC8U 1IQEA 2BVRH 2A5KA 1F0SA 2QCYA 5EGMA 1JIRA 3ZZ6A 1BJUA 1TRNA 1IOEA 3ZVCA 2VWMA 1J15A 1DE7H 1YYY1 1BMLA 3H5CB 3T26A 3SUFA 1TONA 1L1NA 2XWBI 2WYGA 2HOBA 1D3QB 5ESBA 1P8VC 2BOHB 3T2NA 3Q00A 1CT4E 1NRSH 3MO6A 1O0DH 4D7FA 3EA7A 1K2I1 1GHXH 5HGGA 1MU6B 3SUGA 3SNDA 1W0YH 1AGJA 1JIMA 2QXJA 4MG3A 4OGYA 2FEQH 3PROA 4B73A 1SI5H 3ATKA 1XXFA 1O5DH 4WWYA 2EI7A 1FY5A 2XTTB 1KLIH 1XKBC 1QNJA 1EB2A 1AUTC 3R0FA 4JZIA 2ZTYA 3E90B 3K2UA 1XVOA 2ZFRH 1KYNA 1ZJKA 3V13A 1AZ8A 1CGJE 4ABHA 1TX8A 1BRUP 1O2KA 1UTOA 3TGJE 3VB7A 1S6HA 3TH4H 3EE0B 4GPGA 2F91A 3LU9B 3SJ8A 1ZR0A 4KTSA 1UVTH 1BDAA 1WV7H 3LIWA 2ANMH 3MTYA 4H6SB 2G55A 1ZJDA 5JPMH 2UUFB 4D7GA 3V3MA 1GL0E 4JZDH 1O33A 3A8BA 3RXJA 5ABWA 2XBXA 1F5LA 2FESH 1GBFA 1O2HA 4BXWA 2VH0A 2OP9A 5EW1H 1WAYB 2HNTC 1C2EA 5EQRA 1GBHA 5JBTA 1CHOF 1VJAU 2C8XB 3HK6B 1ZPBA 3LDXH 1HCGA 1SB1H 4INLA 1XUJA 5CE1A 2FI5E 4AFSA 1W3CA 4MNYA 1YPMH 4OS1A 1BTHH 2UUJB 2G81E 4Y8ZA 2ZCKP 2Z7FE 3HGPA 3UTUH 4IS5A 1MH0A 1TPPA 1VITF 1YC0A 1QTFA 2XBWA 3S9AA 2F9PA 1JBUH 1QJ1B 5GCHF 3AASA 1CA0B 1F2SE 2Y7XA 3U69H 1BB0B 1Z71A 2UWLA 2H2ZA 1YGCH 5L2YH 1PFXC 1Q2WA 3LGYA 3E3TA 1OX1A 1FN8A 1K21H 3SGBE 3M35A 5CMXH 1L2EA 3MI4A 1ELGA 3M3TA 3ZZ8A 2PKAA 1MTWA 4IC5A 2QA9E 1AFEH 1DOJA 3C27B 3GCOA 1MKWK 2OTVA 1IQHA 1A46H 2FXRA 2ILNA 3NCLA 1GI1A 4K5ZA 1H1BA 2VJ1A 1HAPH 1MZDA 1Z1JA 2BLWA 1WCZA 4I8HA 4LZ4B 1ELCA 2O9QA 5E0HA 1N6XA 1PYTD 1O3AA 2H1UA 1O2SA 1NO9H 2BZ6H 5TJXA 4B74A 4BOHA 2BY8X 1H8DH 2TIOA 1QCPA 1UMAH 2ZHEH 3TNTA 3ZZ3A 5AF9H 1VGCB 1QQUA 4NSYA 5FHTA 2PKSB 2ZU1A 5L30H 1ZSLA 1EZUC 3CENA 4ZKNU 1T8LA 3E0PB 2F83A 2A32A 1DT2A 1IQKA 1DDJA 1W7GH 4XDEA 2P8OB 1P2OA 3SW2B 3Q77A 1SGNE 1TAWA 3GCHC 4MVNA 3PM3A 1D3DB 3OSYA 1HAGE 1AQ7A 4ABBA 2PSXA 1GJDB 2V0BA 1TPAE 1O2JA 2LPRA 1HUTH 3TK9A 4X1NU 3BEUA 1DUAA 4TPIZ 4YO9A 1KXBA 5F8XA 1SFIA 1NT1A 4FUJA 1C1QA 4UFDH 2ZGHA 3RMNH 1K1OA 4TWYA 2PSYA 2FYRA 2A4QA 2GVFA 5DG6A 1VCPA 4JCNA 3SU2A 4IN2A 1Y3XA 1GI2A 2FIRH 1Z8RA 1GDNA 4JMYA 5K0HA 1GJ4H 2DE8A 1TNLA 2P95A 1BTWA 2CV3A 1UJ1A 2ZTZA 3M37A 1CU1A 1P01A 3PMAB 2OBQA 4H42U 2XBVA 3S7HB 1S0RA 2H9HA 1G36A 5G4BA 1BBRK 4K8BA 2RDLA 3BEFB 3LC5A 3RXSA 1UTKA 4X8TH 4KGAA 1GMDG 1AUJA 1TNIA 3M3VA 1O2NA 2BMGB 1TMBH 2AMDA 4AX9H 3QK1A 3BTWE 3RU4D 3W94A 1B5GH 2BY5X 4Z0KA 1YKTA 2HLCA 1KLTA 3QZRA 4RSPA 1C5VA 1GBKA 3LJJA 2EEKA 2BDAA 1SPJA 2GCTC 3OY5U 1K9OE 1F0TA 4AB9A 4CRBA 1V2MT 1GI4A 2H5CA 3T25A 1GVLA 2OLGA 3IITA 4MNWA 1O3KA 3RMOH 2RG3A 3P92A 3P8NA 3MNXA 1MTNC 4I8KA 2Z9LA 2O8WA 4BAHB 1PPZA 5EOKA 3ZZAA 1FPHH 1IHSH 5L2ZH 1DWEH 3KHVA 4OS4A 1TGCA 1T8OA 5C1YA 1MQ5A 4X6MA 2ZDMA 4AFZA 4DY7B 6CHAB 2KAIA 2Z6BD 2BQWB 3EA9A 2SGDE 1ETTH 1QB6A 4YLUA 3ZVDA 9ESTA 3VFEA 1C5OH 3SZNA 1LPGB 1WQSA 1H8IH 3PMBB 1MZAA 5GJ4B 5DK1A 1P02A 4H6TA 1UTPA 4X2VA 4OS2A 2XRCA 1PPCE 2ALPA 3GDSA 2D1JA 1E37B 2FOCA 2D2DA 3D62A 3FZZA 1QBVH 1UVPA 1FY3A 1V2VT 2AEIH 2GDDA 2OINA 2AH4X 1UCYK 2EI8A 3TJOA 1O3LA 3LGUA 2GCHG 1PPFE 3AAVA 2AGIX 1PQAA 4INKA 4AGJA 3U1JB 2F9OA 4PROA 5A2MH 1FZZA 1CSOE 1SOZA 1F0RA 4GHTA 1C5PA 1MKWH 1AIXH 1O3GA 3KEEA 1GHAF 3NXPA 3UWJH 3GY5A 4AN7A 1SBWA 1ZHRA 5C67A 2BVXH 2GMTC 1YPHC 4ZAEA 3MU0A 2WUBA 4HI3A 1YCPH 3URCA 1SGFG 3VPKA 3K65B 4NIVA 3PTBA 1K1IA 2TGPZ 2FYQA 4JK6A 3OTJE 4WXVA 2JH6D 1OYTH 1KXDA 5FPYA 5DP8A 4XFQA 2FOGA 1THPB 3RXUA 4K60A 1D3TB 4Y11E 4FUGA 3EA8A 3PWBA 2W5EA 1DPOA 3A7YA 1P05A 1GGDC 4ABAA 1H9IE 4UD9H 3KQEA 2QIQA 5C3NA 4KTUA 7LPRA 1ELAA 3STJA 4FUFA 1BIOA 3SV2H 4ISLA 2PLXA 2TRMA 1G37A 4Q7XA 1AVXA 4X6PA 3SNAA 2J38A 1ABIH 4Q7YA 5T6GA 3QWCH 2Z9JA 3VEQB 1O3CA 1FMGA 1J17T 1Z8JB 1HNEE 1UTJA 4WVPE 1D6RA 2QN5T 3PTNA 2BDIA 1HJ8A 4MPWA 4YOIA 3BTDE 2XBYA 3UOPA 1IQJA 1GVKB 3UQVA 1KDQA 3SU6A 4BAMB 1Y5AT 2GD4B 4X6OA 3UIRA 1GI3A 1GMDF 3K6ZA 1FV9A 1QL8A 3GY8A 1ZZZA 3ATLA 1XXDA 1FPCH 2BQ7B 2BLOA 2QXHA 3RC5A 5EW2H 4FU8A 2ZFTA 1IQLA 1BRAA 4K3JA 2P3UB 4DCDA 3CP7A 1Y5UT 2HGTH 1FJSA 4ASHA 1S5SA 5T3HA 1TRYA 1Y3YA 4FVBA 3MU4A 3B8JA 4SGBE 3VXFH 1J9CH 1C9PA 1UVSH 1BBRH 2VH6A 1KSNA 1NY22 1O3NA 4A5TS 2PKAB 1QL7A 2VWNA 2A0QB 4ESTE 1LHDH 3ZZDA 1FONA 3ZZ7A 3F68H 4O9VA 4DIHH 1O2OA 2UWPA 4MNXA 1EOJA 4J2YB 1C2HA 1O3FA 1LO6A 1THSH 3LGTA 3E8LA 5FX6A 1W12U 1AO5A 2NU0E 2XXLA 4MPXA 1NS3A 1XUIA 1CBWB 1W11U 2A31A 4A6LA 1SG8B 4BTTB 1DSTA 3O8BA 2ZGBH 3JZ1B 4J1YA 1C5UA 1AHTH 5DP9A 7GCHG 4I33A 1BMMH 1LVBA 5CHAB 4NWKA 3A86A 4LZ1H 2PTNA 1EJAA 3SI4H 3T29A 3FZDA 1YPJH 2ZDKA 2BLVA 3MFJA 1O36A 1FAKH 5C20A 4CH8B 1O3BA 1XVMA 1XUKA 2PW8H 3RXCA 4ZROA 2C8ZB 4YT7H 1O2TA 2YOLA 3SORA 3ZYDA 3FVFB 1ARCA 3BN9A 5EQQA 1O2XA 4CRGA 3MU1A 5DJ7A 1ORFA 1EZXC 2OXSA 1JRSA 4TY6A 1AZZA 1DM4B 2LNCA 2A4OA 1ESTA 5LGOA 2BD2A 2J9NA 1CGIE 3F9FA 4X2WA 4Y7BA 4AGKA 4OS7A 4WY3A 2WUCA 2PR3A 1Y3WA 4YM9A 1UCYH 1S84A 3LOXA 4BNRA 3SU5A 1EKBB 1DWBH 3QGJA 5DGJA 3FFGA 2ZNKH 3SV6A 2NU3E 4AFUA 2W3KA 2GZ9A 2ZU4A 2FOHA 1J8AA 4NZQA 4O3UA 2SNVA 3HPTB 2F9NA 5LPRA 2J92A 2R0LA 1BT7A 2OC7A 1EP5A 1TFXA 2B0FA 4XE4A 3DUXH 1UTMA 1TMUH 1LHEH 1XMNB 1HV7A 3U8OH 3QZQA 1DUEA 1INCA 3SUEA 1OPHB 2VIQA 1OOKB 2XNIA 3GY7A 3MO3A 1NRPH 2P59A 1AD8H 1GHZA 2Y5GA 1L4DA 1MAXA 3LKWA 1XUFA 2A45B 5CHAC 2Z3DA 4UEHH 1Y3VA 1AE8H 1CT0E 1LVYA 3A7ZA 1V2WT 1HJAC 2SGEE 4Y7AA 1MD8A 1F7ZA 3A8AA 1J14A 2CF9H 4X8SH 3U98H 4BAOB 4I8JA 4M7GA 1P3EA 1BRBE 1A0JA 1SSXA 3MHWU 4MTBA 1O2QA 3PLPA 2BD5A 3BTGE 8LPRA 2BTCE 1FDPA 3VB3A 4CR5A 4X1RU 1O2WA 3F9HA 3MWIU 1ZOMA 3FP8E 1O2VA 1OP8A 3E1XB 1O2IA 4SGAE 2C4FH 2OCVB 3GDVA 1HRTH 4Y0YE 2H9EH 3UWIA 3L33A 1G3DA 5DP4A 2FLRH 3GY3A 2QYIA 1GBAA 2FM2A 4ZXXH 5EQSA 5GIBA 3M5NA 4KTCA 1SGRE 2KAIB 1XUGA 3FAOA 5E2PA 1DXPA 4Y6DA 1GMCG 5C2ZA 3TPIZ 3W95A 2QXIA 3R3GB 4K1EA 4GAWA 1C1MA 1A5HA 1UVUH 3RM2H 2W26A 1MBQA 4LK4A 5SGAE 2BM2A 1F92A 3V0XA 2ZDLA 1C4U2 2OC0A 3U8TH 1C9TA 1MUEB 2PGQB 4B1TA 1A5IA 1RTFB 4KKDA 4O03A 1SGPE 3Q3KA 1GBCA 3SU3A 2J2UA 7GCHF 3N7OA 2WPMS 1A1RA 4UE7H 5EXMA 3MU5A 2ANYA 3NZIA 1C2LA 3DT0H 4B71A 5JB9S 2W7UA 3DHKH 3GY2A 1SLWB 5FPTA 4ABJA 3A83A 1SQOA 5FCRA 1RXPA 1KXAA 4A92A 4ABIA 2FI4E 1GBDA 4BAKB 8GCHF 3M61U 1ETRH 4LXBH 1O2PA 1LDTT 1PYTC 4NFEA 3EYDA 1J16A 3A7WA 3E91A 1P2NA 5IDKA 1HAVB 3LPRA 3SQEE 2HPPH 1TGSZ 3BTEE 2OUAA 2H5DA 1C5SA 4WH8A 1UTNA 1BRCE 1UVOA 3L3TA 1TA2A 3GCHB 3P8OA 1SGCA 1PQ5A 2FP7B 2EC9H 3KF2A 3VGCB 4DURA 5DPAA 3CS0A 2W3IA 1CVWH 4WXIA 2IN2A 4Q2KA 4O3TA 3RXOA 1OWDA 2QC2A 3RXLA 1SLXB 1N1LA 1O2GH 1O2MA 5A0AE 1AE5A 3ODDA 1RFNA 1NFWA 1TBZH 3VXEH 1O3DA 1LVOA 1TQ0B 1W2KH 2A1DB 4CREA 1CGHA 1KDQB 2D26C 3SHAH 4THNH 1QRZA 2G51A 1P2QA 1BCUH 2ZDNA 4ZHMU 3FANA 4IN1A 3V7TA 2I6QA 4ZXYH 1L1GA 4CHAB 3DD2H 4B2CA 1Q31A 2K1QA 2FTMA 4AG2A 4VGCB 4Y0ZE 1N6YA 1P10A 2ZHQH 4I7YH 1ZHPA 4YT6H 1V6DA 1TLDA 1QQ4A 1ZSKA 1HFDA 1GHVH 1V2NT 1O3HA 4YTAA 1FY1A 2AERH 4K8YA 1D6WA 1MTUA 2THFB 3QX5H 5C1XA 3EDXB 5DP5A 3ZZCA 1YP9A 4K1SA 2O8UA 4GVUA 2BD9A 2GV6A 2FPZA 4YOGA 1QB9A 1OWHA 2FDAA 2TPIZ 2R3YA 4JZEH 2GCTB 2FTLE 1W10U 1GI8B 1SGYE 4I31A 1GHAG 2ODYB 1G3EA 4BXSA 5LH8A 3QGNB 1EQ9A 3D23A 1B7XB 2QXGA
chains in the Genus database with same CATH superfamily
1GJAB 3VB5A 3JZ2B 1QBOA 2V3HH 1NRNH 2NWNA 5HIZA 1SFQB 3VGCC 1MTNB 2I6SA 5E0JA 1GMCF 4ISOA 2VVVA 1ELFA 1IQMA 4KP0A 1TA6A 2VBCA 3PMJA 4IW4E 2CN0H 2VWOA 3FP7E 1AWFH 3SU1A 2G5NA 1GL1A 4DIIH 3A88A 1TGTA 2BDHA 2VWLA 1A0LA 4FUCA 4WF8A 1WDIA 5B6LA 2XW9A 1C1WH 2HNTF 1U6QA 2Y81A 4FUIA 5A09A 2ZFFH 1LCYA 1TYNA 3I29A 5FPSA 3KL6A 4B2BA 4CHAC 3HKJB 1FIWA 1IQNA 2WV9A 1C5YB 2ZFSA 4VGCC 4FUEA 2BYAX 2ODQA 1Y3UA 1ESBA 1TWXB 4ZKSU 1C5LH 3QTOH 1O2ZA 2ZGCA 3PO1C 6ESTA 2H6MA 1NFUA 1T31A 4YLQH 1RIWC 1HBTH 2BB4A 4MPVA 5F6MA 2OC1A 2JETC 1V2RT 1IQFA 2GMTB 1K1PA 2JH0D 3Q3YA 1GBBA 2B8OH 1S83A 3MO9A 5LPEA 1HJ9A 2D8WA 2ZGJA 1W7XH 2C90B 2XC0A 2ZZUH 2R0KA 3RXPA 1G3CA 4X0WU 1MD7A 2Z9GA 1GJ8B 1MKXK 1QJ7B 1TQ7B 1XM1A 2GZ8A 1GGDB 1DSUA 2B7DH 4NIYA 1W13U 3BEIB 2B9LA 2Z9KA 3FP6E 4JYVH 5I25A 1BA8B 1DLKB 1BTZA 1ELDE 2SGPE 4NA8A 1XUHA 1HB0B 3TITA 1BJVA 1TX7A 1SHHB 2ZDVH 1Z6JH 1E0FD 2RA0A 5JBAS 2HWLB 3MYWA 5F03A 1AB9C 3VB4A 1KLJH 2Y82A 4XBBA 5DKMA 2KCOA 3MU8A 4ABEA 2O8LA 4B6EA 3LH3A 1O5FH 4AYVB 1GBTA 1C5XB 2HALA 3S9CA 3KGPA 1Z1IA 1SQTA 2BDGA 1ZLRA 3SU4A 2OQUA 2AIPA 3TK5A 5AFYH 2ZG0H 4NG9H 2OBOA 1AMHA 1LHCH 1V3XA 4AYYB 1DANH 2AHME 2ULLA 1HXEH 2A7JA 3PV4A 4ABDA 3N7EA 3T28A 4Y10E 4KELA 1BITA 1ZHMA 3UREA 1TNHA 2QGRA 3I78A 1MBMA 1OKXA 2CGAA 2VIVA 1HAHH 3KQ5A 3P6ZB 5PTPA 1V2ST 3NKKA 2F9VA 1LQEA 1NPMA 4U32A 3S69A 3A82A 1LVMA 4IBLH 1BTYA 1C1VH 1O3OA 1O2LA 1Y5BT 1NN6A 2ZECA 1XKAC 3C1KA 7KMEH 1LPKB 1SVPA 2BY7X 1GI6A 4Y8YA 2ZTXA 2J5UA 4RKJB 4K2YA 1HAVA 3F9GA 1A3BH 1EPTC 3OEED 1C4Y2 2RCEA 2ANKH 5FXLA 1GG6B 2J95A 3U1IB 4FXGH 1BTPA 1DY8A 3ZYEA 1G32B 3TJVA 4NIWA 5EPNA 1ZPZA 1YBWA 2XCFA 4FUBA 1HDTH 1C2FA 2J4IA 2XCNA 1NFYA 2SGQE 5I46H 5HYOA 4K1TA 1GJ7B 2Q6GA 3MNSA 1RGQA 3BIVH 4I8LA 1C5TA 4WH6A 3M3SA 3UNRA 2BDYA 4H4FA 3RXDA 1ANEA 1CO7E 4JYUH 3DFJA 1LKBA 1HPGA 2GGVB 2ZEBA 2KCPA 1O39A 1GI7B 1RD3B 3KIDU 4NSVA 5F8TA 1UO6A 3UPEA 3SZEA 2G4TA 3E0NB 3MMGA 3SJKA 4TT3D 2Y5FA 2FX6A 3UR9A 3U8RH 2KX4A 4X1SU 3WWBA 2SGFE 4ABGA 1A5GH 2R2WU 1F5KU 1TBRH 4OGXA 3ZVEA 2BY6X 2ZFQH 1GI5A 2F9BH 1QRWA 2ESTE 1ELTA 2VIOA 3CS7A 2WPIS 1WUNH 3EAJA 1HLTH 1FUJA 4B2AA 1YLCA 5A0CA 3M7UA 2AFQB 2DE9A 4Q7ZA 1K1LA 3LH1A 3P70B 2BVSH 2VGCC 2IOTA 1X7AC 3OFND 1F5RA 5HM9A 4F48B 4NCYA 1O3IA 4GHQA 3O8RA 2G5VA 1MQ6A 3ELAH 3OU0A 1QRXA 3F9EA 2IPHA 1AN1E 2QE7D 3M5OA 3M7TA 5A8YA 1CT2E 5FBIA 1SMFE 1GG6C 4ZHAA 2B5TB 1WOFA 3UQOA 1T4VH 2YNAA 1HAIH 4X2YA 2VIPA 2P3FH 5ESTE 1TRMA 2BOKA 1GBJA 3IWMA 4Y76A 1IHTH 3A7VA 3KQDA 1N8OC 4XSKU 3GDUA 1DX5M 3AW0A 1MAYA 1TNJA 5FBEA 4HZHA 1YPGH 4MPUA 2A2QH 4XBDA 1MKXH 1SR5C 4ISHH 4Z1MD 4FUDA 3SV9A 2FWWA 4FUHA 1O30A 2ZF0H 2FOMB 1HJAB 3RLWH 1UK3A 4IGDA 1QB1A 1LPZB 3T62A 4F4OC 2R3UA 2M5TA 2CJIA 2HNTE 1RS0A 1DFPA 1LKAA 3LC3A 2C8WB 1VKYA 2Y80A 4ZKRU 4O97A 8GCHG 3SJOA 1FY8E 2AMQA 2ZGXH 1QFKH 3RXQA 1ZPCA 1EZSC 1EFRD 2P3TB 1HAZB 1TPOA 1OHHD 3GS9A 3SO3A 2ZPRA 1DWDH 5EG4A 1C1RA 3RLYH 2ZDAH 4ZMAH 1IQGA 4U30A 1C5WB 3RXKA 1FLEE 3BIUH 3QLPH 1LQDB 2O8MA 2WPKS 1FI8A 4DG4A 1C2KA 3A85A 2W7SA 3UUZA 1PQ7A 4TWWA 3RXFA 1E35B 2Z9IA 8KME2 2H9TH 1A3EH 1ETSH 1TOCB 4UFEH 3E16B 2SNWA 2J34A 1TABE 1NU9A 1PPEE 1GJ9B 2BX3A 4P00A 1C5NH 4K69A 4WMDA 3KYFA 1O5AB 4GCHG 1T8NA 1C1OA 1YWUA 3ZVBA 1QL9A 4HFPB 3GYLB 1O35A 2FOAA 1GHYH 1OS8A 1Z6EA 1PPHE 2CHAC 1EPTA 4LOYH 1C1SA 1E36B 4DOQA 5HMAA 1IAUA 1CE5A 1FAXA 2F43B 3L6PA 4IMQA 4AZ2B 2A5AA 3SNCA 2ZWLH 4MNVA 4RN6A 1D4PB 1QA0A 4UONA 1HXFH 1UW7A 1E38B 1TX6A 3QDZB 1EAIA 5L6NH 2AGEX 3RXHA 4R8TB 1OP0A 5EXNA 1ANDA 1QHRB 3PWCA 3RMMH 2PP6A 1NU7B 1OWKA 1O2RA 2Q1JA 2XNDD 4QT8C 3ITIA 4BAQB 1K22H 2SFAA 3P17H 1THRH 2ZO3H 2QAAA 1O37A 2QF4A 1KTTB 5C5OA 1RRKA 2KCYA 3G01A 5H4IB 2FO9A 2QF3A 2ALVA 3UOUA 2RDEA 4TYDA 5FL7D 1BMNH 3PLBA 2WYJA 2ZIQH 2XWAA 1OSSA 3S9BA 3BTFE 1GDQA 4ZH8A 3ZVGA 3A81A 4JYTA 3GISB 4WMFA 1FXYA 2BD8A 1EXFA 2FS9A 4NA7A 7ESTE 4NA9H 2ZKSA 1JXPA 4CH2B 1PPBH 2PGBB 1UHBA 2TGTA 3P95A 1ZSJA 3RU4T 2FI3E 3E6PH 2QF0A 1ZMJA 1FQ3A 1C2DA 2TBSA 5B6OA 3P8GA 1B0FA 1A7SA 1EASA 3RC4A 1YY3A 1P12E 2V35A 2IJD1 4BANB 2ZA5A 4U2WA 3BG4C 1BHXB 2Y5HA 5E2OA 1G2MA 2CF8H 3SHCH 3STIA 1ELEE 3TH2H 3UAIC 1GCTC 1EOLA 1YPEH 3F3BA 1G9IE 1H9HE 4DW2U 5HXFA 1O2UA 5JBCS 1HIAA 3IG6B 3UY9A 3T5FH 1EX3A 4CRCA 1E34B 4GSOA 3BTKE 4Y8XA 1GVZA 3DA9B 4B76A 2FLBH 3A89A 3SJIA 1MU8B 1P2KA 4ISNA 3BTTE 2OQ5A 2HRVA 5GXPA 3OY6U 3TIUA 1RJXB 1BOQA 3H7TA 1ZTKA 1EZQA 1Z8IB 1TIOA 2EI6A 1QURH 1OYQA 2PFEA 3UR6A 3M5MA 4X6NA 3ZZ5A 2PHBA 1NTPA 1SHYA 2BLQA 2WSSD 4E06H 3RC6A 1NFXA 3BSQA 2WPDD 2FOEA 3ENSB 4AC9A 5JB8S 5AFZH 4AORA 1GBLA 4D76A 2BY9X 5C94A 2BZAA 3KQCA 3MOCA 1AKSA 3M36A 5BPEA 3HGNA 1TALA 3AAUA 4GCHF 1O38A 1AU8A 3SNEA 8ESTE 1O5GH 3PB1E 4E05H 3PYHA 1L0ZA 4AG1A 3RXMA 2V6NA 4YESB 1CHGA 1ZMLA 4GUXA 1ACBE 3SV7A 3SU0A 2TGDA 2K0QA 1GWAA 1G3BA 5GPIB 1UK2A 4RT1A 3A8CA 2TGAA 1GJ5H 1TBQH 2SGAA 3O8CA 1ARBA 1S0QA 1HGTH 2ZPSA 1C5MD 1O3MA 2JKHA 1QBNA 3QO6A 3PO1B 2QV1A 3SI3H 4CBOA 2HPQH 5J4SA 1DY9A 3LGWA 3LT3A 1RIWB 2HVXA 1ABJH 2ODPA 2JETB 1UK4A 1YPHE 1C1UH 3SGAE 1AWHB 1DITH 1YCPK 1GCDA 2L74A 1ELBA 6GCHF 3KN2A 1O5BB 1PQ8A 9LPRA 3QUMP 2YMSD 4Q4LA 1ID5H 3MH4A 1V2TT 1P2IA 4UFGH 1NESE 4B6FA 1GPZA 4OS6A 1OWIA 1AVGH 1O31A 4AB8A 4MQAA 2LELA 4YOJA 3SQHE 3WY8A 1GI0A 1TOMH 4D9QA 5JDUB 1CQQA 4D9RA 3NK8A 4ABFA 1SLVB 1WQVH 5DSFA 1P2MA 4FETA 1ZRBA 3RMLH 4IMZA 3ZZ4A 4NWLA 2A2XH 1WSSH 3TJNA 1EATA 2BD4A 2R2MB 3QN7A 1OWJA 4Z6AH 3B23B 3OYPA 2GKVE 1QA7A 1T7CA 4A1TA 2VVUA 1A0HB 4B75A 1GI9B 2GDEH 5FX5A 1AB9B 5C17A 3KCGH 2FX4A 1SGQE 3ZVAA 2EY4C 3ZZBA 3SJ9A 2ZCLP 1WBGB 4E7RG 2GTBA 2AYWA 2NU1E 4XBCA 5HM2A 3RUOA 4UFFH 1CA0C 3ODFA 3O8DA 2AS9A 1TNGA 4E7NA 2PTCE 3LJOA 1QGFA 2XC4A 3S7KB 2PWXA 5DP7A 1O2YA 1GMHG 3GICB 3ZVFA 4NGAH 1A4WH 5A8XA 4GLYA 2ZFPH 1EAWA 4I8GA 3CNRA 1ANCA 1G30B 1AI8H 1H9LB 5E0GA 2KR7A 4CRFA 1P09A 3WWFA 2IJOB 3T27A 1P04A 1FN6A 1CA8B 1NC6A 1E1RD 2BX4A 1L1JA 1VZQH 4CBNA 1NM6A 1RTLA 5CDFE 1BBRE 3TH3H 5GDSH 3NUMA 3ATWA 5E8EH 1V2JT 2CMYA 4X1PU 3ATIA 1C5ZB 1EUFA 1VJ9U 1PPGE 1H8ED 1UTLM 5T6FA 1VGCC 1V2LT 2PKSC 1MCTA 4FOUC 1BHXF 1EPTB 1QIXB 5F8ZA 5K7RA 1Z7KA 2BXUH 1EAXA 2WPLS 2ZCHP 3TJUA 1HAYB 1KIGH 3LGVA 3HATH 4AOQA 1EAUA 3ESTA 1KXEA 5ETXA 2P8OC 3MH6A 1DVAH 1QR3E 3DFLA 3RXRA 3RXVA 1C5QA 2BD3A 1SQAA 2YNBA 1TE0A 4CRAA 1WTGH 5T6DA 3AW1A 3GCNA 1OWEA 3UFAA 2PUQH 3K9XB 2F3CE 1V2PT 1YM0A 2A5IA 3NRLA 1SGTA 3P8FA 5EU8A 1P2JA 2GT8A 2Q6FA 2P16A 1K1MA 1ZGVA 2ZU3A 1BTXA 4Y79A 2LP6A 1GBEA 1DICA 1P57B 1ESAA 4OS5A 1ZTJA 1DS2E 1WYKA 2CXVA 1XX9A 1YF4A 1OP2A 1NZQH 4RKOB 1TNKA 3GY6A 5DP6A 1VCQA 3PMHB 4A1XA 1H8HD 1SOTA 1KY9A 3TNSA 1SGEE 4UDWH 1YPKH 1ZYOA 1K0HA 1P11E 1SGIB 4FVDA 5F53A 1W8BH 3OEHD 3NPSA 3V12A 5IYTA 5AHGH 4HGCA 2VGCB 3I77A 1O5CB 1GHBG 1UCYE 5FAHA 5AVDA 3ZZ9A 4BTIB 1UHBB 5TCCA 3DSGA 1YPLH 1P03A 2Z3CA 2OC8A 4X2XA 1DXWA 1BQYA 3M5LA 1PJPA 3SV8A 4RI0A 3ZV8A 2GP9B 4HTCH 4NFFA 2C3SA 2A7CA 2VIDA 3U9AH 1JMOH 2FOBA 4WJG2 4WMEA 1SLUB 2GT7A 1ZMNA 2V3OH 5A8ZA 1OXGA 1S82A 4ISIH 2XC5A 4F49A 4IC6A 1GHWH 2VINA 2P94A 4AFQA 2G4UA 2WPJS 5C1UA 2ZU5A 3UNSA 1HIAB 3Q3XA 2VNTA 3U28C 1GJ6A 1GDUA 2FODA 1N8OB 1ANBA 3RXGA 2ZI2H 3TK6A 4Q80A 1P06A 3D65E 3UNQA 3K6YA 5EODA 4BTUB 1B0EA 2DUCA 2ANWA 1MMJN 1GMHF 2W6JD 3BG8A 1DLEA 2BQ6B 2G52A 6CHAC 1MTVA 4YZUA 3RM0H 1BTUA 1V2KT 1Z8GA 4NIXA 1FX0B 1L4ZA 1TB6H 2A4GA 2EA3A 1QY6A 1P0SH 1S6FA 4I86A 2AMPA 2OK5A 2C93B 3EGKH 1JOUB 2Q6DA 1D3PB 2A7HA 2GZ7A 1TPSA 1BZXE 2BXTH 3KNXA 1W0ZU 1VR1H 4Y71A 3D49H 2IPQX 3TGIE 3OE7D 6LPRA 3TGKE 1T32A 4TY7A 4U01A 1S81A 2BHGA 1LMWB 5EJLA 5C5NA 1AKSB 2XYAA 2BDCA 3A87A 2FS8A 3H7OA 4ZKOU 4A7IB 3EQ0H 3BV9B 2J94A 3F6UH 3GCTG 3Q76A 5DP3A 2NU2E 1MCVA 3SNBA 2VVCA 2J97A 2JIZD 2WV4A 3ZIAD 1O32A 1ZRKA 4MLFB 3A84A 3TVJB 1LTOA 1Y59T 2STAE 1JRTA 2ZQ2A 2AGGX 2FOFA 1S85A 1TMTH 2WV5A 4I32A 1KXFA 1ZGIA 2GV7A 3RXTA 1AFQB 3SUDA 4ZUHA 1HAOH 2BD7A 3KQBA 5EXLA 3A8DA 3RXAA 4DT7B 5JYIA 1W14U 3S0NA 4JZFH 2G8TA 2CHAB 1YLDA 4INHA 4JK5A 1EJMA 3ZV9A 1GBIA 1T4UH 2GJGA 2ZQ1A 2FMJA 2UUYA 1MTSA 2UUKB 3BF6H 3RXIA 2ZHDA 4D8NA 2AIQA 1RTKA 1IQIA 3M7QA 2OD3B 2P93A 3MH5A 1QZ8A 3A7XA 5EPYA 2FZZA 4A1VA 3A80A 4XOJA 1A61H 1KXCA 3TLOA 1BMAA 1LHGH 1Q3XA 1FIZA 1C5RA 3BTME 4TPYA 2VIWA 1G2LA 1SL3A 1O5EH 1TGBA 2WPHS 3TU7H 1E1QD 1FY4A 2WINI 1WU1A 3VB6A 1DWCH 1P9SA 1NRRH 1WTHD 3SBKA 1YCPM 1F0UA 3SGQE 1KTSB 1O34A 3OTPA 1K1NA 2PUXB 1C2GA 1BUIA 3AVZA 1SQRA 2STBE 1C2IA 2JH5D 3GYMA 1C1TA 2Y6TA 1SGDE 3FN8A 4DGJA 2WHXA 1GHBF 1Y8TA 3LGIA 3URDA 3A7TA 2RA3A 2GCHF 3RP2A 3SN8A 2C8YB 2A4RA 3MH7A 4R0IA 2ZC9H 3OX7U 5A0BA 1VCWA 1C4V2 3HKIB 1A2CH 5FCKA 1T8MA 3PLKA 4ZHLU 3BTQE 3LONA 3RDZA 4CRDA 2ZHWH 4X1QU 3BTHE 3RXEA 1GJBB 5GWZA 1CHOG 5TCAA 1H4WA 1C1NA 1ELVA 5JBBS 1O3EA 5LPFA 1EJNA 3SOSA 1YLNA 3KYGA 1AFQC 3B9FH 2ASUB 3ATMA 1JWTA 2G00A 2NU4E 1GBMA 4F55A 1FNIA 1EP6A 5BRRE 1VITG 2F9UA 1K1JA 3MNBA 1LHFH 2ZU2A 5GCHG 2ZHFH 1EB1H 3BG4B 2UWOA 1C2MA 1V2OT 2Z94A 3F2FA 4FU9A 1AY6H 3NWUA 1GCTB 3PRDA 3QTVH 4JZ1A 2R9PA 3RXBA 1O3JA 1NROH 1TGNA 1NRQH 2V7QD 1P3CA 1M9UA 2VU8E 2BDBA 5DO4H 2VB0A 4DJZB 4DVAU 4RT0A 2GX4A 2Z3EA 2ZP0H 1CBWC 4CR9A 1GJCB 1P9UA 2K8IA 1O3PB 3F1SB 3MNCA 1VITH 3RU4E 4MDSA 1V2QT 1C2JA 1K28D 1AVWA 1UTQA 3GOVB 6GCHG 2Y7ZA 4X8VH 5J4QA 4FU7A 1HYLA 2PV9B 2WZQA 2ZPQA 3GCTF 1SGFA 3HK3B 4X8UH 1HAXB 1ZTLA 1D9IA 1QJ6B 2O8TA 2QY0B 1C1PA 1V2UT 4NZLA 3GY4A 1SC8U 1IQEA 2BVRH 2A5KA 1F0SA 2QCYA 5EGMA 1JIRA 3ZZ6A 1BJUA 1TRNA 2F4LA 1IOEA 3ZVCA 2VWMA 4OM9A 1J15A 1DE7H 1YYY1 1BMLA 3H5CB 3T26A 3SUFA 1TONA 1L1NA 2XWBI 2WYGA 2HOBA 1D3QB 2V3MA 5ESBA 1P8VC 2BOHB 3T2NA 1SKYE 3Q00A 3WW7A 1CT4E 1NRSH 3MO6A 1O0DH 4D7FA 3EA7A 1K2I1 1GHXH 5HGGA 1MU6B 2HLDD 3SUGA 3SNDA 1W0YH 1AGJA 1JIMA 2QXJA 4MG3A 4OGYA 2FEQH 3PROA 4ACBA 4B73A 1SI5H 3ATKA 1XXFA 1O5DH 4WWYA 2EI7A 1FY5A 2XTTB 1KLIH 1XKBC 1QNJA 1EB2A 1AUTC 3R0FA 4JZIA 2ZTYA 3E90B 3K2UA 1XVOA 2ZFRH 1KYNA 1ZJKA 3V13A 1AZ8A 1CGJE 4ABHA 1TX8A 1BRUP 1O2KA 5HIYA 1UTOA 3TGJE 3VB7A 1S6HA 3TH4H 3EE0B 4GPGA 2F91A 1W0KD 2QF5A 3LU9B 3SJ8A 1ZR0A 4KTSA 1UVTH 1BDAA 1WV7H 3LIWA 2ANMH 3MTYA 4H6SB 2G55A 1ZJDA 5JPMH 2UUFB 4D7GA 3V3MA 1GL0E 4JZDH 1O33A 3A8BA 3RXJA 5ABWA 2XBXA 1F5LA 2FESH 2YMSC 1GBFA 1O2HA 4BXWA 2VH0A 2KZ4A 2OP9A 5EW1H 1WAYB 2HNTC 1C2EA 5EQRA 1GBHA 5JBTA 1CHOF 1VJAU 2C8XB 3HK6B 4DT4A 1ZPBA 3LDXH 1HCGA 1SB1H 4INLA 1XUJA 5CE1A 2FI5E 4AFSA 1W3CA 4MNYA 1YPMH 4OS1A 1BTHH 2UUJB 2G81E 4Y8ZA 2ZCKP 2Z7FE 3HGPA 3UTUH 4IS5A 1MH0A 1TPPA 1VITF 1YC0A 1QTFA 5T1VA 2XBWA 3S9AA 2F9PA 2J98A 1JBUH 1QJ1B 5GCHF 3AASA 2M2AA 1CA0B 1F2SE 2Y7XA 3U69H 1BB0B 1Z71A 2UWLA 2H2ZA 1YGCH 5L2YH 1PFXC 1Q2WA 3LGYA 3E3TA 1OX1A 1FN8A 1K21H 3SGBE 3M35A 5CMXH 1L2EA 3MI4A 1ELGA 3EE7A 3M3TA 3ZZ8A 2PKAA 1MTWA 4IC5A 2QA9E 1AFEH 1DOJA 3C27B 3GCOA 1MKWK 2OTVA 1IQHA 1A46H 2FXRA 2ILNA 3PV2A 3NCLA 1GI1A 4K5ZA 1H1BA 2VJ1A 3W1EA 1HAPH 1MZDA 1Z1JA 2BLWA 1WCZA 4I8HA 4LZ4B 1ELCA 2O9QA 5E0HA 3FOAA 1N6XA 1PYTD 5CHBA 1O3AA 2H1UA 1O2SA 1NO9H 2BZ6H 5TJXA 4B74A 4BOHA 2BY8X 1H8DH 2TIOA 3H09A 1QCPA 1UMAH 2ZHEH 4P02A 3TNTA 3ZZ3A 5AF9H 2W6ID 1VGCB 1QQUA 4NSYA 5FHTA 2PKSB 2ZU1A 5L30H 1ZSLA 1EZUC 3CENA 4ZKNU 1T8LA 3E0PB 2F83A 5EJ1A 2A32A 1DT2A 1IQKA 1DDJA 1W7GH 4XDEA 2P8OB 1P2OA 3SW2B 3Q77A 1SGNE 1TAWA 3PV5A 3GCHC 4MVNA 3PM3A 1D3DB 3OSYA 1HAGE 3DSOA 1AQ7A 4ABBA 2PSXA 1GJDB 2V0BA 1TPAE 1O2JA 2LPRA 1HUTH 3TK9A 4X1NU 3F0PA 3BEUA 2L6OA 1DUAA 4TPIZ 4YO9A 1KXBA 5F8XA 1SFIA 1NT1A 4FUJA 1C1QA 3F2GA 4UFDH 2ZGHA 3RMNH 1K1OA 4ACAA 3FO8D 2KFWA 4TWYA 2PSYA 2FYRA 2A4QA 2GVFA 5DG6A 1VCPA 4JCNA 3SU2A 4IN2A 1Y3XA 1GI2A 2FIRH 1Z8RA 1GDNA 4JMYA 5K0HA 1GJ4H 2DE8A 1TNLA 2P95A 1BTWA 2CV3A 1UJ1A 2ZTZA 3M37A 1CU1A 1P01A 3PMAB 2OBQA 4H42U 2XBVA 3S7HB 1S0RA 2H9HA 1G36A 5G4BA 1BBRK 4K8BA 2RDLA 3BEFB 3LC5A 3RXSA 1UTKA 4X8TH 4KGAA 4YXWD 1GMDG 1AUJA 1TNIA 3M3VA 1O2NA 2BMGB 1TMBH 2AMDA 4AX9H 3QK1A 3BTWE 3RU4D 3W94A 1B5GH 2BY5X 4Z0KA 1YKTA 2HLCA 1KMHB 1KLTA 3QZRA 4RSPA 1C5VA 1GBKA 3LJJA 2EEKA 2BDAA 1NBMD 1SPJA 2GCTC 3OY5U 1K9OE 3UB0A 1F0TA 4AB9A 4CRBA 1V2MT 1GI4A 5KECA 2H5CA 3T25A 1GVLA 2OLGA 3IITA 4MNWA 1O3KA 3RMOH 2RG3A 3P92A 3P8NA 3MNXA 1MTNC 4I8KA 2Z9LA 3N7DA 2O8WA 4BAHB 1PPZA 5EOKA 3ZZAA 5C0TA 1FPHH 1IHSH 5L2ZH 1DWEH 3KHVA 3DSPA 4OS4A 1TGCA 1T8OA 5C1YA 1MQ5A 4X6MA 2ZDMA 4AFZA 4DY7B 6CHAB 2KAIA 2Z6BD 2BQWB 3EA9A 2SGDE 1ETTH 1QB6A 4YLUA 3ZVDA 9ESTA 3VFEA 1C5OH 3SZNA 1LPGB 1WQSA 1H8IH 3PMBB 1MZAA 5GJ4B 5DK1A 1P02A 4H6TA 1UTPA 4X2VA 4OS2A 2XRCA 1PPCE 2ALPA 3GDSA 2D1JA 1E37B 2FOCA 2D2DA 3D62A 3FZZA 1QBVH 1UVPA 1FY3A 1V2VT 2AEIH 2GDDA 2OINA 2AH4X 1UCYK 2EI8A 3TJOA 1O3LA 3LGUA 2GCHG 1PPFE 3AAVA 2AGIX 1PQAA 4INKA 4AGJA 3U1JB 3MQKC 2F9OA 4PROA 5A2MH 1FZZA 1CSOE 1SOZA 1F0RA 4GHTA 1C5PA 1MKWH 1AIXH 1O3GA 3KEEA 1GHAF 3NXPA 3UWJH 3GY5A 4AN7A 1SBWA 1ZHRA 5C67A 2BVXH 2EQNA 2GMTC 1YPHC 4ZAEA 3MU0A 2WUBA 4HI3A 1YCPH 3URCA 5C0UA 4XD7D 1SGFG 3VPKA 3K65B 4NIVA 3PTBA 5GNDA 1K1IA 2TGPZ 2FYQA 4JK6A 3OTJE 4WXVA 2JH6D 1OYTH 1KXDA 5FPYA 5DP8A 4XFQA 2FOGA 1THPB 3RXUA 4K60A 1D3TB 4Y11E 4FUGA 3EA8A 3PWBA 2W5EA 1DPOA 3A7YA 1P05A 1GGDC 4ABAA 1H9IE 2JDID 4UD9H 3F0OA 3KQEA 2QIQA 5C3NA 4KTUA 7LPRA 1ELAA 3STJA 4FUFA 1BIOA 3SV2H 4ISLA 4HG6A 5IK2D 2PLXA 2TRMA 1G37A 4Q7XA 1AVXA 4X6PA 3SNAA 2J38A 1ABIH 4Q7YA 5T6GA 3QWCH 2Z9JA 3VEQB 3PRBA 1O3CA 1FMGA 1J17T 1Z8JB 1HNEE 1UTJA 4WVPE 1D6RA 2QN5T 3DCLA 3PTNA 2BDIA 1HJ8A 1MABB 4MPWA 3BTDE 2XBYA 4YOIA 1IQJA 1GVKB 3UOPA 3UQVA 1KDQA 4M9FA 3SU6A 4BAMB 1Y5AT 2GD4B 4X6OA 3UIRA 1GI3A 1GMDF 3K6ZA 1FV9A 1QL8A 3GY8A 1ZZZA 3ATLA 1XXDA 1FPCH 2BQ7B 2BLOA 2QXHA 3RC5A 5EW2H 4FU8A 2ZFTA 1IQLA 1BRAA 4K3JA 2P3UB 4DCDA 3CP7A 2J98B 1Y5UT 2HGTH 1FJSA 4ASHA 1S5SA 5T3HA 1TRYA 1Y3YA 4FVBA 3MU4A 3B8JA 4SGBE 3VXFH 1J9CH 1C9PA 1UVSH 1BBRH 2VH6A 1KSNA 1NY22 1O3NA 4A5TS 2PKAB 1QL7A 2VWNA 2A0QB 4ESTE 1LHDH 3ZZDA 1FONA 3ZZ7A 3F68H 4O9VA 4DIHH 1O2OA 2UWPA 4MNXA 1EOJA 4J2YB 1C2HA 1O3FA 1LO6A 1THSH 3LGTA 3E8LA 5FX6A 1W12U 1AO5A 3SYJA 2NU0E 2XXLA 4MPXA 1NS3A 1XUIA 1CBWB 1W11U 2A31A 4A6LA 1SG8B 4BTTB 1DSTA 3O8BA 2XOKD 2ZGBH 5KEDA 3JZ1B 4J1YA 1C5UA 1AHTH 5DP9A 7GCHG 4I33A 1BMMH 1LVBA 1S6LA 5CHAB 2KM0A 4NWKA 3A86A 4LZ1H 2PTNA 1EJAA 3SI4H 3T29A 4ZCNA 3FZDA 1YPJH 2ZDKA 2BLVA 3MFJA 1O36A 1FAKH 5C20A 4CH8B 1O3BA 1XVMA 1XUKA 2PW8H 3RXCA 4ZROA 2C8ZB 4YT7H 1O2TA 2YOLA 3SORA 3ZYDA 3FVFB 1ARCA 3BN9A 5EQQA 1O2XA 4CRGA 3MU1A 5DJ7A 1ORFA 1EZXC 2OXSA 1JRSA 4TY6A 1AZZA 1DM4B 2LNCA 2A4OA 1WXRA 1W0JD 1ESTA 5LGOA 2BD2A 2J9NA 1CGIE 3F9FA 1COWD 4X2WA 4Y7BA 4AGKA 4OS7A 4WY3A 2WUCA 2PR3A 1Y3WA 4YM9A 1UCYH 1S84A 3LOXA 4BNRA 3SU5A 1EKBB 1DWBH 3N99A 3QGJA 5DGJA 3FFGA 2ZNKH 3SV6A 2NU3E 4AFUA 2W3KA 2GZ9A 2ZU4A 2FOHA 1J8AA 4NZQA 4O3UA 2SNVA 3HPTB 2F9NA 5LPRA 2J92A 2R0LA 1BT7A 2OC7A 1EP5A 1TFXA 2B0FA 4XE4A 3DUXH 1UTMA 1TMUH 1LHEH 1XMNB 5DN6D 1HV7A 3U8OH 2JJ1D 3QZQA 1DUEA 1INCA 3SUEA 1OPHB 2VIQA 1OOKB 2XNIA 3GY7A 3MO3A 1NRPH 2P59A 1AD8H 1GHZA 2Y5GA 2CK3D 1L4DA 1MAXA 3LKWA 1XUFA 2A45B 5CHAC 2Z3DA 4UEHH 2JJ2D 1Y3VA 1AE8H 1CT0E 1LVYA 1NBME 3A7ZA 1V2WT 1HJAC 2SGEE 4Y7AA 1MD8A 1F7ZA 3A8AA 1J14A 1BMFD 2CF9H 4X8SH 3U98H 2YMSB 4BAOB 4I8JA 4M7GA 5EJZA 1P3EA 1BRBE 1A0JA 1SSXA 3MHWU 4MTBA 1O2QA 3PLPA 2BD5A 3BTGE 8LPRA 2BTCE 1FDPA 3VB3A 4CR5A 4X1RU 1O2WA 3F9HA 3MWIU 1ZOMA 3FP8E 1O2VA 1OP8A 3E1XB 1O2IA 4SGAE 2C4FH 2OCVB 3GDVA 1HRTH 4Y0YE 2H9EH 3UWIA 3L33A 1G3DA 5DP4A 2FLRH 3GY3A 2QYIA 1GBAA 2FM2A 4ZXXH 4XRNA 5EQSA 5GIBA 2RFKC 3M5NA 4KTCA 1SGRE 2KAIB 1XUGA 3FAOA 5E2PA 1DXPA 4Y6DA 1GMCG 5C2ZA 3TPIZ 3W95A 2QXIA 3R3GB 4K1EA 4GAWA 1C1MA 1A5HA 1UVUH 3RM2H 4TSFD 2W26A 1MBQA 3OAAD 4LK4A 5SGAE 2BM2A 1F92A 3V0XA 2ZDLA 1C4U2 2OC0A 3U8TH 1C9TA 1MUEB 2PGQB 4B1TA 1A5IA 1RTFB 4KKDA 4O03A 1SGPE 3Q3KA 1GBCA 3SU3A 2J2UA 7GCHF 3N7OA 2WPMS 1A1RA 4UE7H 5EXMA 3MU5A 2ANYA 3NZIA 1C2LA 3DT0H 4B71A 5JB9S 5EIYA 2W7UA 3DHKH 3GY2A 1SLWB 5FPTA 4ABJA 3A83A 1SQOA 5FCRA 1RXPA 1KXAA 4A92A 4ABIA 3AK5A 2FI4E 1GBDA 4BAKB 8GCHF 3M61U 1ETRH 4LXBH 1O2PA 4ASUD 1LDTT 1PYTC 4NFEA 3EYDA 1J16A 5KGOA 3A7WA 3E91A 1P2NA 5IDKA 1HAVB 3VG8A 3LPRA 3SQEE 2HPPH 1TGSZ 3BTEE 2OUAA 2H5DA 1C5SA 4WH8A 1UTNA 1BRCE 1UVOA 3L3TA 1TA2A 3GCHB 3P8OA 1SGCA 1PQ5A 2FP7B 5HKKD 2EC9H 3KF2A 3VGCB 4DURA 5DPAA 3CS0A 2W3IA 1CVWH 4WXIA 2IN2A 4Q2KA 4O3TA 3RXOA 1OWDA 2QC2A 3RXLA 1SLXB 1N1LA 1O2GH 1O2MA 5A0AE 1AE5A 3ODDA 1RFNA 1NFWA 1TBZH 3VXEH 1O3DA 1LVOA 1TQ0B 1W2KH 2A1DB 4CREA 1CGHA 1KDQB 2D26C 3SHAH 4THNH 1QRZA 2G51A 1P2QA 1BCUH 2ZDNA 4ZHMU 3FANA 4IN1A 3V7TA 2I6QA 4ZXYH 1L1GA 4CHAB 3DD2H 4B2CA 1Q31A 2K1QA 2FTMA 4AG2A 4VGCB 4Y0ZE 1N6YA 1P10A 2ZHQH 4I7YH 1ZHPA 4YT6H 2KCAA 1V6DA 1TLDA 1QQ4A 1ZSKA 1HFDA 1GHVH 1V2NT 1O3HA 4YTAA 1FY1A 2AERH 4K8YA 1D6WA 1MTUA 2THFB 3F2HA 3QX5H 5C1XA 3EDXB 5DP5A 3ZZCA 1YP9A 4K1SA 2O8UA 1E79D 4GVUA 2BD9A 2GV6A 2FPZA 4YOGA 1QB9A 1OWHA 2FDAA 2TPIZ 2R3YA 4JZEH 2GCTB 4Q63A 2FTLE 1W10U 1GI8B 2HVYB 1SGYE 4I31A 1GHAG 2ODYB 1G3EA 4BXSA 5LH8A 3QGNB 1EQ9A 3D23A 1B7XB 3FKSD 2QXGA
chains in the Genus database with same CATH topology
1GJAB 3VB5A 3JZ2B 1QBOA 2V3HH 1NRNH 2NWNA 1SFQB 3VGCC 1MTNB 2I6SA 5E0JA 1GMCF 4ISOA 2VVVA 1ELFA 1IQMA 4KP0A 1TA6A 3PMJA 4IW4E 2CN0H 2VWOA 3FP7E 1AWFH 3SU1A 2G5NA 1GL1A 4DIIH 3A88A 1TGTA 2BDHA 2VWLA 1A0LA 4FUCA 4WF8A 2XW9A 1C1WH 2HNTF 1U6QA 2Y81A 4FUIA 5A09A 2ZFFH 1LCYA 1TYNA 3I29A 5FPSA 3KL6A 4B2BA 4CHAC 3HKJB 1FIWA 1IQNA 1C5YB 2ZFSA 4VGCC 4FUEA 2BYAX 2ODQA 1Y3UA 1ESBA 1TWXB 4ZKSU 1C5LH 3QTOH 1O2ZA 2ZGCA 3PO1C 6ESTA 2H6MA 1NFUA 1T31A 4YLQH 1RIWC 1HBTH 2BB4A 4MPVA 5F6MA 2OC1A 2JETC 1V2RT 1IQFA 2GMTB 1K1PA 2JH0D 3Q3YA 1GBBA 2B8OH 1S83A 3MO9A 5LPEA 1HJ9A 2D8WA 2ZGJA 1W7XH 2C90B 2XC0A 2ZZUH 2R0KA 3RXPA 1G3CA 4X0WU 1MD7A 2Z9GA 1GJ8B 1MKXK 1QJ7B 1TQ7B 1XM1A 2GZ8A 1GGDB 1DSUA 2B7DH 4NIYA 1W13U 3BEIB 2B9LA 2Z9KA 3FP6E 4JYVH 5I25A 1BA8B 1DLKB 1BTZA 1ELDE 2SGPE 4NA8A 1XUHA 1HB0B 3TITA 1BJVA 1TX7A 1SHHB 2ZDVH 1Z6JH 1E0FD 2RA0A 5JBAS 2HWLB 3MYWA 5F03A 1AB9C 3VB4A 1KLJH 2Y82A 4XBBA 5DKMA 3MU8A 4ABEA 2O8LA 3LH3A 1O5FH 4AYVB 1GBTA 1C5XB 2HALA 3S9CA 3KGPA 1Z1IA 1SQTA 2BDGA 1ZLRA 3SU4A 2OQUA 2AIPA 3TK5A 5AFYH 2ZG0H 4NG9H 2OBOA 1AMHA 1LHCH 1V3XA 4AYYB 1DANH 2ULLA 1HXEH 2A7JA 3PV4A 4ABDA 3T28A 4Y10E 4KELA 1BITA 1ZHMA 3UREA 1TNHA 2QGRA 3I78A 1MBMA 1OKXA 2CGAA 2VIVA 1HAHH 3P6ZB 5PTPA 1V2ST 3NKKA 2F9VA 1LQEA 1NPMA 4U32A 3S69A 3A82A 1LVMA 4IBLH 1BTYA 1C1VH 1O3OA 1O2LA 1Y5BT 1NN6A 2ZECA 1XKAC 3C1KA 7KMEH 1LPKB 1SVPA 2BY7X 1GI6A 4Y8YA 2ZTXA 4RKJB 4K2YA 1HAVA 3F9GA 1A3BH 1EPTC 1C4Y2 2RCEA 2ANKH 5FXLA 1GG6B 2J95A 3U1IB 4FXGH 1BTPA 1DY8A 3ZYEA 1G32B 3TJVA 4NIWA 5EPNA 1ZPZA 1YBWA 2XCFA 4FUBA 1HDTH 1C2FA 2J4IA 2XCNA 1NFYA 2SGQE 5I46H 5HYOA 4K1TA 1GJ7B 2Q6GA 3MNSA 1RGQA 3BIVH 4I8LA 1C5TA 4WH6A 3M3SA 3UNRA 2BDYA 4H4FA 3RXDA 1ANEA 1CO7E 4JYUH 3DFJA 1LKBA 1HPGA 2GGVB 2ZEBA 1O39A 1GI7B 1RD3B 3KIDU 4NSVA 5F8TA 1UO6A 3UPEA 2G4TA 3E0NB 3MMGA 3SJKA 2Y5FA 2FX6A 3UR9A 3U8RH 4X1SU 2SGFE 4ABGA 1A5GH 2R2WU 1F5KU 1TBRH 4OGXA 3ZVEA 2BY6X 2ZFQH 1GI5A 2F9BH 1QRWA 2ESTE 1ELTA 2VIOA 3CS7A 2WPIS 1WUNH 3EAJA 1HLTH 1FUJA 4B2AA 1YLCA 5A0CA 3M7UA 2AFQB 2DE9A 4Q7ZA 1K1LA 3LH1A 3P70B 2BVSH 2VGCC 2IOTA 1X7AC 1F5RA 5HM9A 4NCYA 1O3IA 4GHQA 3O8RA 2G5VA 1MQ6A 3ELAH 3OU0A 1QRXA 3F9EA 2IPHA 1AN1E 3M5OA 5A8YA 3M7TA 1CT2E 5FBIA 1SMFE 1GG6C 4ZHAA 2B5TB 1WOFA 3UQOA 1T4VH 2YNAA 1HAIH 4X2YA 2VIPA 2P3FH 5ESTE 1TRMA 2BOKA 1GBJA 3IWMA 4Y76A 1IHTH 3A7VA 3KQDA 1N8OC 4XSKU 3GDUA 1DX5M 3AW0A 1MAYA 1TNJA 5FBEA 4HZHA 1YPGH 4MPUA 2A2QH 4XBDA 1MKXH 1SR5C 4ISHH 4FUDA 3SV9A 2FWWA 4FUHA 1O30A 2ZF0H 2FOMB 1HJAB 3RLWH 1UK3A 4IGDA 1QB1A 1LPZB 3T62A 4F4OC 2R3UA 2M5TA 2CJIA 2HNTE 1RS0A 1DFPA 1LKAA 3LC3A 2C8WB 2Y80A 4ZKRU 4O97A 8GCHG 3SJOA 1FY8E 2AMQA 2ZGXH 1QFKH 3RXQA 1ZPCA 1EZSC 2P3TB 1HAZB 1TPOA 3SO3A 2ZPRA 1DWDH 5EG4A 1C1RA 3RLYH 2ZDAH 4ZMAH 1IQGA 4U30A 1C5WB 3RXKA 1FLEE 3BIUH 3QLPH 1LQDB 2O8MA 2WPKS 1FI8A 4DG4A 1C2KA 3A85A 2W7SA 3UUZA 1PQ7A 4TWWA 3RXFA 1E35B 2Z9IA 8KME2 2H9TH 1A3EH 1ETSH 1TOCB 4UFEH 3E16B 2SNWA 2J34A 1TABE 1NU9A 1PPEE 1GJ9B 2BX3A 1C5NH 4K69A 4WMDA 4GCHG 1O5AB 1T8NA 1C1OA 3ZVBA 1QL9A 4HFPB 3GYLB 1O35A 2FOAA 1GHYH 1OS8A 1Z6EA 1PPHE 2CHAC 1EPTA 4LOYH 1C1SA 1E36B 4DOQA 5HMAA 1IAUA 1CE5A 1FAXA 3L6PA 4IMQA 4AZ2B 2A5AA 3SNCA 2ZWLH 4MNVA 4RN6A 1D4PB 1QA0A 4UONA 1HXFH 1E38B 1TX6A 3QDZB 1EAIA 5L6NH 2AGEX 3RXHA 4R8TB 1OP0A 5EXNA 1ANDA 1QHRB 3PWCA 3RMMH 1NU7B 1OWKA 1O2RA 2Q1JA 4QT8C 4BAQB 3ITIA 1K22H 2SFAA 3P17H 1THRH 2ZO3H 2QAAA 1O37A 1KTTB 5C5OA 1RRKA 3G01A 5H4IB 2FO9A 2QF3A 2ALVA 3UOUA 4TYDA 1BMNH 3PLBA 2WYJA 2ZIQH 2XWAA 1OSSA 3S9BA 3BTFE 1GDQA 4ZH8A 3ZVGA 3A81A 4JYTA 3GISB 4WMFA 1FXYA 2BD8A 1EXFA 2FS9A 4NA7A 7ESTE 4NA9H 2ZKSA 1JXPA 4CH2B 1PPBH 2PGBB 1UHBA 2TGTA 3P95A 1ZSJA 3RU4T 2FI3E 3E6PH 2QF0A 1ZMJA 1FQ3A 1C2DA 2TBSA 5B6OA 3P8GA 1B0FA 1A7SA 1EASA 3RC4A 1P12E 2V35A 4BANB 2ZA5A 4U2WA 3BG4C 1BHXB 2Y5HA 5E2OA 1G2MA 2CF8H 3SHCH 3STIA 1ELEE 3TH2H 1GCTC 1EOLA 1YPEH 1G9IE 1H9HE 4DW2U 5HXFA 1O2UA 5JBCS 1HIAA 3IG6B 3UY9A 3T5FH 1EX3A 4CRCA 1E34B 4GSOA 3BTKE 4Y8XA 1GVZA 3DA9B 4B76A 2FLBH 3A89A 3SJIA 1MU8B 1P2KA 4ISNA 3BTTE 2OQ5A 2HRVA 5GXPA 3OY6U 3TIUA 1RJXB 1BOQA 3H7TA 1ZTKA 1EZQA 1Z8IB 1TIOA 2EI6A 1QURH 1OYQA 2PFEA 3UR6A 3M5MA 4X6NA 3ZZ5A 2PHBA 1NTPA 1SHYA 2BLQA 4E06H 3RC6A 1NFXA 3BSQA 2FOEA 3ENSB 5JB8S 5AFZH 4AORA 1GBLA 4D76A 2BY9X 2BZAA 3KQCA 3MOCA 1AKSA 3M36A 5BPEA 3HGNA 1TALA 3AAUA 4GCHF 1O38A 1AU8A 3SNEA 8ESTE 1O5GH 3PB1E 4E05H 3PYHA 1L0ZA 4AG1A 3RXMA 2V6NA 4YESB 1CHGA 1ZMLA 4GUXA 1ACBE 3SV7A 3SU0A 2TGDA 1GWAA 1G3BA 5GPIB 1UK2A 3A8CA 2TGAA 1GJ5H 1TBQH 2SGAA 3O8CA 1ARBA 1S0QA 1HGTH 2ZPSA 1C5MD 1O3MA 2JKHA 1QBNA 3QO6A 3PO1B 2QV1A 3SI3H 4CBOA 2HPQH 5J4SA 1DY9A 3LGWA 3LT3A 1RIWB 2HVXA 1ABJH 2ODPA 2JETB 1UK4A 1YPHE 1C1UH 3SGAE 1AWHB 1DITH 1YCPK 1GCDA 1ELBA 6GCHF 3KN2A 1O5BB 1PQ8A 9LPRA 3QUMP 1ID5H 3MH4A 1V2TT 1P2IA 4UFGH 1NESE 1GPZA 4OS6A 1OWIA 1AVGH 1O31A 4AB8A 4MQAA 4YOJA 3SQHE 3WY8A 1GI0A 1TOMH 4D9QA 5JDUB 1CQQA 4D9RA 3NK8A 4ABFA 1SLVB 1WQVH 1P2MA 1ZRBA 3RMLH 4IMZA 3ZZ4A 4NWLA 2A2XH 1WSSH 3TJNA 1EATA 2BD4A 2R2MB 3QN7A 1OWJA 4Z6AH 3B23B 3OYPA 2GKVE 1QA7A 1T7CA 4A1TA 2VVUA 1A0HB 4B75A 1GI9B 2GDEH 5FX5A 1AB9B 3KCGH 2FX4A 1SGQE 3ZVAA 3ZZBA 3SJ9A 2ZCLP 1WBGB 4E7RG 2GTBA 2AYWA 2NU1E 4XBCA 5HM2A 3RUOA 4UFFH 1CA0C 3ODFA 3O8DA 2AS9A 1TNGA 4E7NA 2PTCE 3LJOA 1QGFA 2XC4A 3S7KB 2PWXA 5DP7A 1O2YA 1GMHG 3GICB 3ZVFA 4NGAH 1A4WH 5A8XA 4GLYA 2ZFPH 1EAWA 4I8GA 1ANCA 1G30B 1AI8H 1H9LB 5E0GA 4CRFA 1P09A 2IJOB 3T27A 1P04A 1FN6A 1CA8B 1NC6A 2BX4A 1L1JA 1VZQH 4CBNA 1NM6A 1RTLA 1BBRE 3TH3H 5GDSH 3NUMA 3ATWA 5E8EH 1V2JT 2CMYA 4X1PU 3ATIA 1C5ZB 1EUFA 1VJ9U 1PPGE 5T6FA 1UTLM 1VGCC 1V2LT 2PKSC 1MCTA 1BHXF 1EPTB 1QIXB 5F8ZA 5K7RA 1Z7KA 2BXUH 1EAXA 2WPLS 2ZCHP 3TJUA 1HAYB 1KIGH 3LGVA 3HATH 4AOQA 1EAUA 3ESTA 1KXEA 5ETXA 2P8OC 3MH6A 1DVAH 1QR3E 3DFLA 3RXRA 3RXVA 1C5QA 2BD3A 1SQAA 2YNBA 1TE0A 4CRAA 1WTGH 5T6DA 3AW1A 3GCNA 1OWEA 3UFAA 2PUQH 3K9XB 2F3CE 1V2PT 1YM0A 2A5IA 1SGTA 3P8FA 5EU8A 1P2JA 2GT8A 2Q6FA 2P16A 1K1MA 1ZGVA 2ZU3A 1BTXA 4Y79A 1GBEA 1DICA 1P57B 1ESAA 4OS5A 1ZTJA 1DS2E 1WYKA 2CXVA 1XX9A 1YF4A 1OP2A 1NZQH 4RKOB 1TNKA 3GY6A 5DP6A 1VCQA 3PMHB 4A1XA 1SOTA 1KY9A 3TNSA 1SGEE 4UDWH 1YPKH 1ZYOA 1P11E 1SGIB 4FVDA 1W8BH 3NPSA 3V12A 5IYTA 5AHGH 4HGCA 2VGCB 3I77A 1O5CB 1GHBG 1UCYE 5FAHA 5AVDA 3ZZ9A 4BTIB 1UHBB 5TCCA 1YPLH 1P03A 2Z3CA 2OC8A 4X2XA 1DXWA 1BQYA 3M5LA 1PJPA 3SV8A 3ZV8A 2GP9B 4HTCH 4NFFA 2C3SA 2A7CA 2VIDA 3U9AH 1JMOH 2FOBA 4WJG2 4WMEA 1SLUB 2GT7A 1ZMNA 2V3OH 5A8ZA 1OXGA 1S82A 4ISIH 2XC5A 4F49A 4IC6A 1GHWH 2VINA 2P94A 4AFQA 2G4UA 2WPJS 5C1UA 2ZU5A 3UNSA 1HIAB 3Q3XA 2VNTA 1GJ6A 1GDUA 2FODA 1N8OB 1ANBA 3RXGA 2ZI2H 3TK6A 4Q80A 1P06A 3D65E 3UNQA 3K6YA 5EODA 4BTUB 1B0EA 2DUCA 2ANWA 1MMJN 1GMHF 3BG8A 1DLEA 2BQ6B 2G52A 6CHAC 1MTVA 4YZUA 3RM0H 1BTUA 1V2KT 1Z8GA 4NIXA 1L4ZA 1TB6H 2A4GA 2EA3A 1QY6A 1P0SH 1S6FA 2AMPA 2C93B 3EGKH 1JOUB 2Q6DA 1D3PB 2A7HA 2GZ7A 1TPSA 1BZXE 2BXTH 3KNXA 1W0ZU 1VR1H 4Y71A 3D49H 3TGIE 6LPRA 3TGKE 1T32A 4TY7A 4U01A 1S81A 2BHGA 1LMWB 5C5NA 1AKSB 2XYAA 2BDCA 3A87A 2FS8A 3H7OA 4ZKOU 4A7IB 3EQ0H 3BV9B 2J94A 3F6UH 3GCTG 3Q76A 5DP3A 2NU2E 1MCVA 3SNBA 2VVCA 2WV4A 1O32A 1ZRKA 4MLFB 3A84A 3TVJB 1LTOA 1Y59T 2STAE 1JRTA 2ZQ2A 2AGGX 2FOFA 1S85A 1TMTH 2WV5A 4I32A 1KXFA 1ZGIA 2GV7A 3RXTA 1AFQB 3SUDA 4ZUHA 1HAOH 2BD7A 3KQBA 5EXLA 3A8DA 3RXAA 4DT7B 5JYIA 1W14U 3S0NA 4JZFH 2G8TA 2CHAB 1YLDA 4INHA 4JK5A 1EJMA 3ZV9A 1GBIA 1T4UH 2ZQ1A 2FMJA 2UUYA 1MTSA 2UUKB 3BF6H 3RXIA 2ZHDA 4D8NA 2AIQA 1RTKA 1IQIA 3M7QA 2OD3B 2P93A 3MH5A 3A7XA 5EPYA 2FZZA 4A1VA 3A80A 4XOJA 1A61H 1KXCA 3TLOA 1BMAA 1LHGH 1Q3XA 1FIZA 1C5RA 3BTME 4TPYA 2VIWA 1G2LA 1SL3A 1O5EH 1TGBA 2WPHS 3TU7H 1FY4A 2WINI 1WU1A 3VB6A 1DWCH 1P9SA 1NRRH 1WTHD 3SBKA 1YCPM 1F0UA 3SGQE 1KTSB 1O34A 1K1NA 2PUXB 1C2GA 1BUIA 3AVZA 2STBE 1C2IA 2JH5D 3GYMA 1C1TA 2Y6TA 1SGDE 4DGJA 1GHBF 1Y8TA 3LGIA 3URDA 3A7TA 2RA3A 2GCHF 3RP2A 3SN8A 2C8YB 2A4RA 3MH7A 4R0IA 2ZC9H 3OX7U 5A0BA 1VCWA 1C4V2 3HKIB 1A2CH 5FCKA 1T8MA 3PLKA 4ZHLU 3BTQE 3LONA 3RDZA 4CRDA 2ZHWH <