4K2YA

Crystal structure of human chymase in complex with fragment inhibitor 6-chloro-1,3-dihydro-2h-indol-2-one
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
226
structure length
217
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymase
publication title Discovery of Potent, Selective Chymase Inhibitors via Fragment Linking Strategies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 217
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k2yA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k2yA02
4K1TA 4NSYA 2A31A 2H6MA 3UWIA 2PGBB 3QO6A 1PPZA 2GCTC 1HPGA 3SGQE 2J94A 3H7OA 4NFEA 1K1JA 1WBGB 1WV7H 4MVNA 1SPJA 1AKSB 1UK3A 3E8LA 3ZVAA 4AB9A 5A0AE 8ESTE 2A4GA 1YPHC 5JBBS 2QXHA 2NWNA 2RCEA 2Z3CA 4IW4E 1DM4B 1XKAC 3D23A 1C5XB 2ALPA 1C2DA 1MAYA 1PYTC 5H4IB 3NZIA 4YLQH 1TA2A 2Y7ZA 1SGQE 4VGCB 1ZGVA 2SNWA 1TGCA 1W12U 1ZMLA 1ZRKA 2FEQH 1GBHA 1MTSA 3SJIA 1GVLA 1VZQH 2ZHDA 3LDXH 2ZF0H 3LGVA 4CHAB 5C1UA 4I8HA 2ZA5A 2WV4A 3UR9A 3BF6H 3ZV8A 1L4DA 1ELEE 1GMCF 5EXLA 4CREA 3KGPA 1P2JA 2AMQA 5CMXH 1K1PA 1P0SH 2GCTB 3ZZBA 2VIPA 2ZCLP 1O37A 3BTQE 3RXLA 1IQKA 5JBAS 2BVRH 1O5AB 2ZFTA 4GPGA 3MH6A 1BRCE 3QUMP 4MLFB 3SUGA 1YPGH 1O2SA 1C2EA 1SL3A 1IQHA 1TGNA 4NG9H 4YOGA 5DG6A 1NPMA 4E05H 2P16A 2BX3A 2ZPRA 4FVBA 2ANKH 1EB1H 1Z8JB 1CVWH 2R3YA 4JYUH 1EP6A 3RC5A 1PQ8A 3ZZ9A 4H6TA 1FONA 1ELBA 3R0FA 1S0RA 4JCNA 1UMAH 1V2ST 1OYTH 1WTGH 2O8TA 2UWOA 1FMGA 2ZCHP 1TYNA 1RGQA 2Y81A 3A83A 3UNQA 3LC3A 4ZKOU 5LGOA 4GHQA 4K3JA 3LH3A 3GDVA 3M7UA 4MPXA 3H7TA 1WAYB 5C2ZA 1SGDE 3O8RA 1INCA 3BG4B 3RM2H 4CR5A 1JXPA 3ELAH 1YF4A 2BOKA 1QQUA 3PLBA 4LXBH 2A4OA 2VIVA 3LIWA 3E16B 1S6FA 1O3JA 3L3TA 1V2RT 2WV5A 1BTXA 4AFZA 2V35A 4TPYA 4Y7BA 5EODA 3QZQA 3ZVDA 3SU5A 1VITH 2PKAA 2JH5D 1ANBA 4K60A 1UCYK 3IITA 1HIAA 3EYDA 4BNRA 1YCPM 2B5TB 1QR3E 3F9EA 3OU0A 4XE4A 1O3GA 1O2UA 4DJZB 4WF8A 1OYQA 1JIRA 1OWKA 1C2JA 1HUTH 1QBOA 3FFGA 3EQ0H 1P9SA 2XCFA 1NZQH 3BTGE 1A0HB 2OC1A 2BLWA 3LPRA 1MKWK 2ZO3H 3ZZ5A 3OX7U 1UTLM 1JWTA 1V2OT 1GMDG 1ZJKA 1WU1A 2A7CA 2AYWA 4U01A 1TGSZ 1IQGA 1IQLA 2FYRA 5DGJA 1O2IA 1P06A 1F92A 1V2JT 2ZTXA 3SI4H 1AFQC 1NRQH 1DWDH 3M5MA 1SB1H 3D49H 1FUJA 2NU3E 4JZEH 4I8JA 1GJBB 2BMGB 2OD3B 1S84A 1C5TA 4ABJA 1ABIH 4JK5A 3P92A 4O97A 2ZPSA 2P95A 3U1IB 4YT7H 1Z7KA 4I31A 1RFNA 5LPRA 3RP2A 1O30A 1HB0B 1ZSLA 1CT4E 3DT0H 5A09A 2IPHA 3ITIA 2BY7X 1RJXB 1FLEE 4WH8A 4K1SA 3A89A 4B75A 3PYHA 4ASHA 3BN9A 1HAGE 2XBVA 5EQQA 3KF2A 5EXMA 5JYIA 1TALA 1A5HA 2A0QB 2BHGA 4NZLA 5AFZH 1AWHB 1K22H 5PTPA 1P57B 1A5IA 1C5VA 1TOCB 3PLPA 1QCPA 3HGPA 3UREA 1XUFA 2A4RA 2W3KA 1F5KU 4X6NA 4YTAA 3OYPA 1G30B 1GWAA 3RXUA 1S81A 4BTUB 2BOHB 3SO3A 4DG4A 1GG6C 3SJ9A 1V6DA 3DFLA 5C1YA 1C4Y2 2H9TH 2PSYA 1O2YA 1ID5H 1EPTC 3SV7A 1C1NA 1OKXA 2GVFA 3SQEE 1ELGA 2DE8A 1C5MD 4K5ZA 5TJXA 3QTVH 3TJUA 1T8OA 4B2BA 2QAAA 1ZPZA 1YPJH 2BVSH 4TY7A 3V0XA 1KYNA 2GMTB 3BEIB 3I77A 4OS4A 1TLDA 3GCTG 1YBWA 1TE0A 1TQ0B 3T28A 1TMUH 3FAOA 4Y8ZA 1NFYA 2BD5A 4MQAA 4Z6AH 3RXCA 1PJPA 3VPKA 1GBDA 1TONA 2RDLA 4FU7A 1L1JA 3P8NA 4TWWA 1FPCH 2ZDNA 3HKJB 4KTUA 3A84A 4A1XA 4BAMB 1PQ7A 1UTQA 1OPHB 1JIMA 2C4FH 2BYAX 4NA9H 1QFKH 2ZU2A 3S9AA 2FTLE 1DT2A 3BV9B 5HM9A 1O2MA 5DPAA 1TX8A 1C1TA 4X8SH 3ZYEA 1ESBA 1CGJE 1EPTB 1H4WA 5CHAC 2PWXA 3RUOA 1SMFE 1LHCH 4Y79A 1O2LA 1C1QA 3SNAA 1N6YA 1LQEA 1TPPA 5HM2A 3E90B 4CRDA 1SLVB 3K65B 1ETRH 1YKTA 1K2I1 3S69A 1DUEA 1A7SA 4Q7XA 1TA6A 3LGYA 2A4QA 5HYOA 4TYDA 2XBXA 1FAKH 3TITA 1E36B 5HXFA 1FY8E 4NSVA 3A85A 3Q76A 3PLKA 1WYKA 2P59A 2SGDE 2TIOA 3IG6B 2G5VA 1IHTH 4FUBA 2LNCA 2XRCA 3TPIZ 1QL9A 5GXPA 2FIRH 2BDYA 2VIOA 1GI1A 1O3KA 3GICB 2NU4E 1FN8A 3RXFA 3W95A 5A8XA 1CO7E 5K0HA 4UEHH 1GDNA 1ZSJA 2BTCE 1TGBA 3GY8A 2QXGA 3DHKH 1SFQB 5GIBA 7ESTE 1XUKA 2OXSA 1RIWC 3ODFA 1Y3VA 3B23B 5CHAB 4DGJA 3SV8A 2P8OC 1DE7H 1V2MT 1WQVH 4RKJB 1JBUH 5E2PA 1EXFA 3STIA 1AI8H 1HAZB 4ABIA 2CHAC 1XKBC 1C1SA 4ABEA 3GY6A 4OS2A 1O39A 3ZVFA 1GI4A 2AERH 2SFAA 4AG1A 2KAIA 1K1NA 6GCHG 1Z1JA 1ZZZA 3MU8A 2HOBA 3TGKE 3V13A 1O3EA 1QA7A 2ANMH 3A82A 2TGTA 3SI3H 4K8YA 4Q7YA 1MD8A 2GV7A 2WUBA 1F0TA 5SGAE 1KLTA 1MTUA 1AE8H 4X8TH 2CN0H 1NFWA 4UFEH 1HAHH 2FYQA 5DK1A 1VITF 2ZKSA 3CP7A 4X2VA 2ILNA 1V2TT 1YC0A 3OY6U 3U98H 1W3CA 1T8LA 1MTVA 3HPTB 4UDWH 5T6DA 3B8JA 1O36A 1RIWB 9ESTA 4IGDA 2OUAA 1TNIA 2P8OB 2O8MA 1MBQA 3K6ZA 1C5UA 1SQTA 2VJ1A 1BTYA 3MTYA 4XDEA 2Y82A 4BAOB 2PFEA 5FPTA 4NIYA 3SHAH 1BMNH 4WY3A 4CRGA 1MAXA 1YPKH 2FOAA 1W0ZU 4MTBA 3PTBA 1L1GA 3PROA 2FDAA 5L2YH 5C5NA 2W7UA 1UTKA 1UVPA 3PWBA 2ZG0H 4I33A 3MU1A 2J38A 1DANH 1E37B 1H9LB 1HFDA 3VGCC 1O2VA 3ZVCA 1ZGIA 1AB9C 1XXFA 2Z3EA 1O35A 1DXPA 2J4IA 2JKHA 1AGJA 4JYVH 3KCGH 1MUEB 2VH6A 1AFEH 1C5ZB 4FU8A 3RXRA 4GVUA 1RXPA 1BT7A 2TPIZ 9LPRA 5DP4A 4XBCA 1BRBE 1YGCH 1AY6H 2V6NA 2ZNKH 3MNXA 2HPPH 1BTHH 2VWOA 2FOFA 3RXBA 1KXEA 5T6GA 3TJVA 3MFJA 2ODYB 2SGAA 2BLVA 1L2EA 2GKVE 2OLGA 3AAVA 4LZ1H 4MNVA 1GJ6A 2GCHF 1FDPA 1O2KA 1EZUC 4U32A 2ZU3A 2F91A 2TGPZ 4BAHB 1C9TA 3VGCB 1FN6A 3RXGA 4UFGH 2PSXA 2BDGA 2W26A 3ZZAA 2R0LA 1AB9B 1ARCA 4TPIZ 4DOQA 4BXWA 1WQSA 1AKSA 3VXFH 1FI8A 2UUJB 4GSOA 1HAPH 4AGJA 5JB9S 5J4QA 4D9RA 3O8BA 4B73A 2ZGJA 4BTIB 4FUEA 2BQ7B 3QLPH 1A3EH 3NKKA 3M3TA 4CRFA 1YLDA 1PPGE 1EZXC 3KHVA 3C27B 1P09A 2FI4E 3MNBA 2XWBI 1X7AC 3IWMA 3U8OH 2QF0A 3N7OA 3SV6A 4J2YB 1LMWB 1LPGB 1O5GH 1MKXH 2BZAA 4D76A 1DDJA 1UHBA 1XVOA 2WYJA 1EZSC 2VVUA 1DWEH 2CJIA 2HALA 1IQEA 3LGTA 2ANYA 2SGFE 2ZFRH 2AGGX 1N8OC 5E8EH 1UVOA 4O3TA 3M61U 1KXBA 1SOTA 2IN2A 3RXJA 3SUFA 4YM9A 1C2HA 1HAXB 4GLYA 3T25A 3RC6A 4B1TA 1QRWA 3GY2A 5FX5A 3SJKA 4DCDA 4X6PA 5JPMH 5LPFA 3L33A 1DX5M 1MKWH 2J34A 1E0FD 4ZKRU 2ZCKP 1Z8IB 6LPRA 2Y80A 1BTPA 1JRSA 1BMMH 4VGCC 1MH0A 1TFXA 3LU9B 2HLCA 2GZ7A 3F6UH 3QX5H 2ALVA 3ATIA 2GDDA 4JMYA 2AFQB 4UE7H 3SOSA 1BOQA 4B2CA 3FANA 1KIGH 1ANEA 2B7DH 3SORA 3MNSA 4NIWA 2C8YB 1CBWC 3LC5A 1P8VC 2AIQA 1TPAE 3TNSA 3V7TA 2GCHG 3T26A 1F5RA 1NO9H 1W0YH 1N8OB 3PTNA 1KTSB 3KQCA 4X2YA 1IQNA 2BXUH 4AYYB 1VCQA 3TH4H 4D8NA 2D8WA 4NA8A 2FOEA 4AZ2B 2NU1E 3DA9B 1RS0A 1UO6A 1C5SA 5ETXA 2VWNA 4I8GA 3BTTE 4DIHH 2M5TA 3EA7A 3GY5A 2F9OA 2WINI 1TNJA 3GOVB 5E2OA 2BLOA 3A86A 2ZDKA 2D26C 1G3DA 2A1DB 1K1LA 1NY22 2AS9A 1EAIA 1ELFA 4BAKB 1YP9A 4IC5A 2G4TA 1O5BB 4UD9H 1OWIA 1GHXH 2RA3A 3NCLA 1CBWB 1S5SA 4ABAA 7KMEH 1Y3UA 3BG4C 2BY6X 1CHOF 1G2MA 3KQEA 4THNH 3F68H 4XBBA 3CS0A 1GHZA 1VCPA 3UPEA 4GCHF 1Y3YA 2QCYA 4DURA 5IDKA 2V3HH 3HK6B 4FUHA 3BTHE 8LPRA 2AH4X 4WVPE 1FY3A 1NFXA 1XUGA 2FOGA 4AGKA 3GY3A 3F9FA 4D9QA 1GGDC 1BMAA 2Y5HA 1O2HA 2D2DA 1O2JA 5EQSA 1RTFB 1W11U 3RU4E 2HGTH 2BDAA 1AD8H 4INKA 4PROA 2C3SA 3DUXH 4YESB 4Z0KA 1AO5A 3A81A 2HVXA 3HGNA 1SVPA 1O2NA 4YOIA 2Z9KA 1UVUH 2H2ZA 3RXQA 3UTUH 1P2MA 1MZAA 1KDQB 2OQUA 5ESTE 3ZYDA 1S6HA 4ZH8A 1MTNC 4OS7A 2HPQH 4KKDA 1Z1IA 1MKXK 4BANB 3AW1A 3KQDA 4XOJA 1VCWA 1GDUA 1GGDB 2GX4A 2V3OH 2QYIA 5FCRA 4A92A 4X1RU 4R8TB 1BUIA 3PMBB 2XC5A 2FX4A 3RC4A 1GJ7B 1SC8U 2I6SA 4MNYA 1ORFA 3UY9A 1V2UT 5I46H 2QIQA 4A1VA 1GMCG 5L6NH 1CGHA 3ZZ3A 1CHOG 1DY8A 1P03A 3GCOA 1KXDA 1SFIA 1NRPH 5DO4H 4AX9H 3STJA 3A7VA 1EJMA 1SGEE 2OBOA 2BZ6H 1JRTA 1BITA 1GI3A 1H1BA 4BTTB 1P10A 2WPLS 1H9HE 3SU0A 2A45B 3P8GA 2EA3A 4RSPA 1FPHH 2G5NA 1MTNB 2G55A 2R9PA 4ABHA 4DY7B 2AIPA 4X6OA 5F6MA 4Y71A 3WY8A 5T3HA 4KP0A 2VVVA 3ZV9A 3MNCA 1O3IA 1C4V2 4Y0YE 1NT1A 5EG4A 2ZQ1A 5GWZA 1L4ZA 1LQDB 1W2KH 4X2XA 3KL6A 2CGAA 1QB9A 2BD8A 1SGPE 1TAWA 3MU5A 2GMTC 3K9XB 2BB4A 3S7HB 1O2ZA 1P2IA 2Z9IA 4KTCA 2CV3A 1BBRK 1SSXA 5DP8A 8GCHF 1GBLA 3UNSA 3I78A 1ZTJA 2WUCA 2A32A 1VJ9U 2J92A 1NU7B 4X8UH 2XBYA 2C90B 2PUXB 1GVKB 5J4SA 3URCA 3TU7H 4ABBA 1AVWA 3FZDA 4NWKA 3T29A 1HAYB 1N6XA 1IQMA 2P3TB 1O2GH 1XXDA 3SV9A 1HRTH 3PMHB 5EPNA 1OP0A 3A7XA 4NIXA 2PHBA 4FVDA 3SNDA 5DP5A 1GBTA 3D65E 2F3CE 3LGWA 1YPEH 2H5DA 4ISNA 2ZEBA 2SGPE 1HCGA 2C93B 1A0JA 1BMLA 3A7TA 5LH8A 1NRNH 1CA0B 1OSSA 2G81E 3MH7A 2Z94A 3PV4A 2ZI2H 4ISOA 4ISHH 2AMDA 2ANWA 1D3PB 1PQAA 2QXJA 1VGCC 3TLOA 1FIWA 1ZLRA 2FTMA 3HATH 5EPYA 1D3DB 3GCHC 1THSH 4AORA 4MPWA 1WTHD 5C3NA 5JBCS 2HNTF 2PTCE 2PUQH 4MNXA 4MNWA 2H1UA 4AFSA 1LVYA 2CMYA 4K1EA 3T62A 1TX7A 3DFJA 3R3GB 1C5NH 2HRVA 2ULLA 2Z7FE 3PB1E 5JB8S 3TH3H 1OP2A 1IQJA 4AYVB 4CH8B 2GZ9A 1O3MA 3K2UA 4NZQA 3NUMA 4ISIH 1Z6EA 4Y0ZE 1FV9A 5GPIB 2I6QA 2HNTC 2BD9A 2CF8H 3RLYH 2BD7A 1DSTA 1UTNA 4X1PU 1AE5A 1P11E 3EE0B 4LOYH 1GI0A 1EUFA 1FNIA 2TBSA 3A8AA 1C2KA 2ODPA 4X1QU 1HDTH 2LPRA 4GAWA 1HAOH 1Y3XA 2PLXA 4J1YA 3BEFB 5EOKA 3GDSA 1TQ7B 2FOMB 1C9PA 1GI9B 1VGCB 2FLRH 2BXTH 5AHGH 1THRH 1DLKB 1ELTA 4AFUA 3GCHB 1O0DH 1OOKB 1J15A 3UQOA 1KLJH 1EZQA 3A8DA 4MPUA 3GYMA 2PW8H 1GL0E 4DW2U 2SGQE 2ZHQH 1O2QA 2A7JA 2XCNA 3KNXA 2NU2E 4A6LA 1OX1A 2ZC9H 1C5LH 1T4UH 5DJ7A 4WMDA 1W10U 3ESTA 1QL7A 1UVSH 1P05A 4FUCA 1ACBE 3ZVGA 1A4WH 3QN7A 1TBRH 4MPVA 1L0ZA 2FOBA 1DFPA 5DP3A 4IMQA 3LT3A 1OXGA 1PQ5A 2ODQA 4GHTA 4GUXA 4YLUA 3URDA 5G4BA 4X8VH 2WPIS 1LKBA 2EI6A 1BTWA 2VB0A 2ZDLA 1LHFH 2OC0A 1W8BH 5JBTA 5LPEA 1C1VH 1HAVB 4I32A 3U8RH 6ESTA 1Y59T 2F9VA 1T8NA 4ESTE 1O3BA 3Q3YA 1Y8TA 1EJNA 1ZMJA 4HI3A 4NFFA 4Q2KA 2ZFQH 1C1OA 2QY0B 1M9UA 1NM6A 2AGEX 4Y11E 3SN8A 3UUZA 3FP7E 1HYLA 1O5EH 4F49A 4YOJA 3BTDE 1XUIA 3G01A 3M5OA 5TCCA 1KLIH 3VB5A 3ATMA 1GL1A 1ZPBA 1GBJA 1GBCA 1H9IE 1QIXB 4JZIA 1ZJDA 6CHAC 2Y5GA 2W7SA 1AWFH 5BPEA 2ZGHA 2Q6GA 4FUJA 3TJNA 1HXEH 3O8CA 1GMHF 1GHVH 1EX3A 2F9UA 2FI3E 1SGRE 2Y6TA 5GCHF 3NK8A 1ZRBA 4B74A 2DUCA 5C20A 1THPB 1GHBF 1UVTH 2RG3A 1B0FA 3F1SB 2ZFSA 4WH6A 1IQIA 1GHYH 1SGNE 4JZFH 2ZIQH 1GJAB 2EEKA 1DLEA 1GPZA 3MH4A 1LHDH 1AN1E 1YPMH 1GVZA 3KN2A 2UUKB 1TNLA 3UOPA 1ZHPA 3S9CA 2ZHFH 1WSSH 1A0LA 1XM1A 1H8IH 3QGJA 2ZFPH 3A8BA 1GJ5H 3QGNB 2FESH 2IJOB 5EGMA 2XWAA 4I8KA 3E91A 2Z9GA 4K69A 3RXSA 1C5QA 1C5RA 1F7ZA 1CSOE 1C1UH 1K1IA 2C8XB 1QBNA 6CHAB 1C5PA 3D62A 1TRNA 2FX6A 1O3PB 1PPBH 1MD7A 4YT6H 5A8YA 3RXIA 1A1RA 2ZGBH 3VB4A 2FODA 2ZGCA 5DP7A 3EAJA 1LHEH 3I29A 2ZU4A 1O2OA 4RN6A 2R3UA 2Q1JA 3FP8E 2V0BA 1MZDA 1ZSKA 4OS6A 4U2WA 1C1MA 1RTLA 5E0GA 1G36A 3RMNH 3AAUA 5FX6A 2Z9LA 3Q77A 5EW1H 2Z3DA 1EB2A 3SGBE 1B0EA 1TOMH 2ZU5A 1NESE 1B5GH 1XUHA 3JZ1B 2A5IA 1QGFA 3ZZ7A 1AVXA 5C5OA 1QJ7B 4AN7A 2H9EH 2PV9B 4X1NU 1RD3B 1VITG 1NN6A 4CRCA 1K28D 3SZNA 5E0HA 1TNHA 4DIIH 3TNTA 2F83A 2WPKS 3QTOH 1OWHA 4IN1A 2VU8E 3TH2H 3W94A 1V2NT 1O2WA 1HLTH 1MCTA 1P9UA 1D6RA 3V12A 1C2GA 4H6SB 2P3UB 4UFFH 5GCHG 5FHTA 3ENSB 1MTWA 1GJ4H 3L6PA 4CR9A 2BM2A 1AU8A 1FY5A 3TJOA 3VXEH 2ASUB 1YYY1 2BVXH 3LGUA 1TBZH 1B7XB 1QRXA 1BBRE 1FXYA 4BXSA 3MH5A 2JH6D 1NU9A 1V3XA 4CBOA 1C4U2 4NIVA 1V2WT 3SV2H 4ZXXH 3P70B 2AGIX 2C8ZB 3TGJE 1N1LA 2OC7A 3RXOA 1XX9A 1HV7A 2FZZA 3ATKA 1HJ8A 4CRBA 1GHWH 4O03A 2ZHEH 3MOCA 1D6WA 4E06H 1Q31A 1Z8GA 1NS3A 3U69H 2TRMA 3TVJB 3GCNA 1XUJA 3FVFB 3M37A 3SGAE 2ZWLH 5HMAA 1P04A 3AVZA 1CU1A 1F2SE 1AHTH 1HJAC 1ZHMA 3MMGA 1C2MA 1P2OA 1F5LA 1AUJA 2XYAA 5AVDA 1D3TB 1AIXH 2BD3A 3LH1A 4HFPB 4WWYA 4D7FA 1ZMNA 1NTPA 1O2XA 1O3FA 4Y76A 1Y5BT 4RKOB 3BSQA 1P2QA 2P94A 2UWLA 3RXAA 2ZFFH 5FXLA 3U8TH 1O3HA 3A88A 3RXHA 4A5TS 3KIDU 1KXFA 1LPKB 2A5KA 1GBAA 3UOUA 2UWPA 3GY4A 1BTZA 1O5DH 2QN5T 1BBRH 1SGFG 1ZPCA 3OY5U 1A61H 3P8FA 2CF9H 3RXTA 1C1WH 1KDQA 5HGGA 1DPOA 1JMOH 4ABGA 2PGQB 1MBMA 1TMTH 5F8TA 1GI6A 4Y10E 1PPCE 4NCYA 1C5OH 3S9BA 1BIOA 1LKAA 2VIDA 4DT7B 4ZKNU 1HJAB 1SLXB 1Y5AT 2FXRA 2OP9A 3E6PH 2WPHS 1SGYE 2GDEH 1ELDE 2JETC 3SNBA 4FUIA 1GI5A 2R2MB 2J9NA 3KEEA 1UHBB 1FZZA 1Z6JH 1G37A 1ETTH 2FPZA 1O2PA 2AEIH 3M3VA 1WUNH 2Q6DA 3T2NA 3RMOH 1UTMA 2BX4A 2ZHWH 4I8LA 3VFEA 3SU4A 4ZHMU 1E34B 1OWDA 1W7XH 5FBIA 1EQ9A 4B71A 3K6YA 1O31A 2H9HA 3RU4T 1H8DH 3SU1A 1BZXE 1GMDF 3GDUA 4Y8YA 1MQ5A 3SHCH 1IQFA 2VINA 2FOCA 4Y6DA 2G8TA 3QZRA 4AFQA 3ZZDA 1QJ6B 3B9FH 5AFYH 3P8OA 1UTJA 1ZTLA 3Q3XA 2RA0A 5L2ZH 1DWCH 1Q3XA 2THFB 4WXIA 1BCUH 2JETB 4ZHLU 2B8OH 1MU8B 4IMZA 3E0NB 2F9PA 5C1XA 4Q80A 5BRRE 3RMMH 1ZR0A 1LTOA 3BIUH 5GJ4B 1YCPH 1GI8B 4Q7ZA 5EXNA 3U9AH 1P01A 3Q00A 4IS5A 4OS5A 1K21H 4WMFA 3RXKA 2FM2A 4SGAE 2ZZUH 1CQQA 2ZDVH 5A8ZA 1TPSA 4M7GA 2EI8A 5ABWA 3LGIA 1CGIE 1TBQH 2TGAA 3ZZ8A 1DVAH 1LVMA 4KELA 2XC4A 1ARBA 1IAUA 1O3LA 3M7QA 1ELAA 5I25A 5CE1A 1MU6B 2PR3A 1LVOA 4A1TA 1KTTB 1P3EA 2BLQA 2YNBA 3ZVEA 4X2WA 3U1JB 3SBKA 3TK9A 1TMBH 7LPRA 2Y7XA 4GCHG 2WPMS 3BTFE 1UTPA 1LDTT 4MG3A 2XW9A 1YPLH 2QA9E 1F0UA 1BDAA 1BJVA 5JDUB 1SG8B 3P95A 2P3FH 5FAHA 3BTEE 1S83A 1NC6A 1YLCA 1RRKA 4NGAH 1PFXC 2VVCA 1SR5C 1MMJN 1A46H 1SGCA 1PPHE 1GBBA 2A2QH 3GCTF 3LOXA 4B76A 1J14A 1A3BH 2FP7B 1ELVA 3VB7A 3FP6E 1A2CH 3NXPA 2FLBH 2DE9A 1P2KA 2G52A 4TY6A 2O8LA 3GISB 1CHGA 3SNEA 2VWMA 5IYTA 4ZHAA 5DP9A 2XC0A 1CA0C 1EPTA 5AF9H 1K1MA 4NA7A 2WPJS 1J16A 4OS1A 1IHSH 2BY8X 2QC2A 2F9NA 4HTCH 2ZECA 4FU9A 4OGYA 3KQBA 4TWYA 4O9VA 1GBFA 1UK2A 2O8UA 4NWLA 1KXAA 1MQ6A 2UUFB 4IBLH 3RU4D 4ABFA 1SOZA 1LO6A 4ZUHA 1V2PT 3SQHE 1GDQA 1TPOA 1QB1A 2VWLA 1KSNA 4LZ4B 3UIRA 5FCKA 3MU0A 7GCHF 3JZ2B 1XVMA 2XXLA 1G3BA 3S0NA 4KGAA 5A2MH 2QGRA 4BOHA 4ABDA 2OBQA 3ATWA 1YM0A 2PKAB 1S0QA 2G51A 3O8DA 2Q6FA 1O2TA 4WXVA 1HIAB 1W14U 2FS9A 1Z71A 1P02A 1Y5UT 1D3QB 1AFQB 1TGTA 1G3EA 1O38A 1YPHE 3BTWE 1EOLA 1EAXA 1SLWB 4INLA 4CBNA 1BB0B 3BTME 3SU6A 1DWBH 3SJOA 2IOTA 3RXEA 1BTUA 4O3UA 3VB3A 3SU3A 3SU2A 2GZ8A 1O3DA 4CH2B 3HK3B 1E38B 3E1XB 5B6OA 1HAVA 1A5GH 1GCTC 1QHRB 4CRAA 1DY9A 3BG8A 4X1SU 2B0FA 1EAUA 1NFUA 1TRMA 2UUYA 3SJ8A 2K1QA 1CT0E 1SI5H 4FUFA 5C67A 2NU0E 3F9GA 2GT7A 1ZOMA 6GCHF 1LHGH 1O3AA 1TB6H 3TK5A 1GJCB 4WMEA 3NWUA 1O33A 3A8CA 1GCDA 1QB6A 4ZROA 1GG6B 4B2AA 1YCPK 1QTFA 5DKMA 4X0WU 2ZGXH 8GCHG 1TABE 1S82A 4AB8A 2VH0A 1ESAA 1GBKA 2W5EA 4JZ1A 2SNVA 1QNJA 1EASA 4LK4A 4FXGH 1ETSH 3LONA 1CE5A 3M35A 1C1RA 2O9QA 8KME2 1NRSH 2FI5E 3SUEA 7GCHG 1TNGA 2A2XH 1EP5A 1D4PB 1GCTB 4I7YH 2OTVA 3A80A 4ISLA 1KXCA 1P12E 5F8XA 1HXFH 3T5FH 1J17T 3RXMA 2ZDMA 2B9LA 2P93A 3PO1C 2C8WB 2BD4A 3P6ZB 2A7HA 4ZXYH 1T31A 3UWJH 2ZDAH 1DITH 1UTOA 2EC9H 2FMJA 3MYWA 1PPEE 4UONA 4HZHA 1C2LA 4IC6A 3MI4A 3M3SA 3MO9A 5DP6A 2GGVB 5A0CA 4MDSA 3ZVBA 2OQ5A 2XNIA 3M5NA 3MWIU 4E7RG 1F0SA 3ZZ4A 4XBDA 3EA9A 2GT8A 1TNKA 1LCYA 3QWCH 3SNCA 4ZKSU 1C1PA 2H5CA 1FY4A 2QF3A 1BA8B 2WYGA 1ZHRA 3LJOA 1FAXA 1ZTKA 3VEQB 3RMLH 3M5LA 3E0PB 5T6FA 1DOJA 1XMNB 1GJDB 1DICA 3RLWH 3T27A 3S7KB 3M7TA 3GYLB 5FBEA 1OP8A 2JH0D 2AMPA 1BJUA 1C2FA 3ZZCA 1QBVH 1SGIB 1QURH 1TIOA 2TGDA 1QJ1B 1TWXB 1PYTD 2PKSC 3PO1B 1QA0A 1ELCA 2J2UA 2BDIA 2R2WU 1BQYA 4YO9A 2ZU1A 3MHWU 3OTJE 5F03A 1KY9A 2ZP0H 1LPZB 3LJJA 2BQ6B 1FY1A 2Z9JA 1T7CA 3H5CB 1C5YB 1DUAA 1LVBA 4X6MA 5EW2H 2STAE 5EQRA 4JK6A 2YNAA 1HAIH 1OWJA 1IOEA 3ZZ6A 4H4FA 1WCZA 2FO9A 2ESTE 2Y5FA 1Q2WA 3TGIE 2GV6A 2FWWA 4AG2A 2OCVB 2FOHA 3PM3A 1BRAA 1W7GH 1JOUB 1ANCA 1EKBB 5E0JA 1U6QA 1QRZA 3SUDA 1QL8A 3PMJA 4ZMAH 2XBWA 1BHXF 3C1KA 3DD2H 1SLUB 2CHAB 4K2YA 3LKWA 2G4UA 3AASA 1QQ4A 2GTBA 1GBIA 1GHAF 1UK4A 1P3CA 2PKSB 1EATA 3EGKH 5F8ZA 2GP9B 1O5CB 5GDSH 2OINA 3Q3KA 3GY7A 1WOFA 2BDHA 3F9HA 1EOJA 1HBTH 5K7RA 1K9OE 2O8WA 1ESTA 4XFQA 1GI2A 1GJ8B 1TRYA 1GBMA 1UCYE 3PMAB 4U30A 1DS2E 4FUDA 1EAWA 1NRRH 4ZAEA 3NPSA 4OGXA 4WJG2 3MO3A 5ESBA 1T4VH 5EU8A 4YZUA 2FS8A 1GI7B 1OWEA 1FQ3A 1SQAA 2SGEE 2VIQA 1V2QT 1PPFE 3RXVA 4A7IB 5FPYA 1HNEE 1G3CA 1AZ8A 1C5WB 1SGFA 1O2RA 1J8AA 2ZQ2A 5FPSA 4D7GA 3EDXB 3FZZA 5L30H 2KAIB 3E3TA 2J95A 1VJAU 2A5AA 3EA8A 1SQOA 1AUTC 1J9CH 1O3CA 1Y3WA 4E7NA 3A7ZA 3MU4A 3QK1A 1ANDA 1O3NA 2VNTA 1DSUA 2CXVA 3UNRA 3UFAA 4QT8C 3ATLA 2OC8A 4FUGA 2ZTZA 1GJ9B 2BY5X 3TK6A 2BDCA 1SHYA 1G2LA 1GMHG 4HGCA 2XTTB 4UFDH 1V2LT 3TIUA 1S85A 1O3OA 1BHXB 2PTNA 3A7YA 4BAQB 1GHBG 3M36A 3SW2B 1SBWA 1AVGH 1FJSA 2G00A 5TCAA 3UQVA 2BY9X 1V2KT 2ZPQA 4AOQA 4H42U 3UR6A 2F9BH 4SGBE 1UJ1A 1VR1H 1GBEA 1L1NA 2ZTYA 1K1OA 3OSYA 1G9IE 1AMHA 1C2IA 2R0KA 3VB6A 3QDZB 1TX6A 2VGCC 3RXDA 4JYTA 2W3IA 4Y8XA 1O5FH 4INHA 4IN2A 2BDBA 2HNTE 1G32B 1UCYH 3CS7A 3BEUA 5A0BA 1QY6A 1AZZA 4JZDH 1MCVA 4F4OC 4XSKU 1W13U 2BD2A 1Z8RA 1GHAG 2GD4B 1T32A 2QXIA 1CA8B 1ZYOA 1NROH 1D9IA 3V3MA 4KTSA 1EJAA 3ODDA 1F0RA 3P17H 3RXPA 2STBE 1P2NA 3HKIB 2YOLA 2D1JA 1SHHB 3RDZA 3RM0H 1ABJH 2BQWB 3AW0A 3PWCA 1V2VT 1BRUP 2HWLB 4K8BA 1SGTA 1DXWA 4Y7AA 2Z6BD 3A7WA 1AQ7A 1O32A 1T8MA 2QV1A 2VIWA 3BTKE 1E35B 1O34A 3A87A 4DVAU 1RTKA 2EI7A 4R0IA 1HJ9A 1HGTH 1OS8A 4CHAC 3BIVH 1CT2E 3CENA 2VGCB 3MO6A 1FIZA
chains in the Genus database with same CATH superfamily
4K1TA 4NSYA 2A31A 2H6MA 3UWIA 2PGBB 3QO6A 1PPZA 2GCTC 1HPGA 2WV9A 3SGQE 2J94A 3H7OA 2WZQA 4NFEA 1K1JA 1WBGB 1WV7H 4MVNA 1SPJA 1AKSB 1UK3A 3E8LA 3ZVAA 4AB9A 5A0AE 8ESTE 2A4GA 1YPHC 3FN8A 5JBBS 2QXHA 2NWNA 2RCEA 2Z3CA 4IW4E 1DM4B 1XKAC 3D23A 1C5XB 2ALPA 1C2DA 1MAYA 1PYTC 5H4IB 3NZIA 4YLQH 1TA2A 2Y7ZA 3U28C 1SGQE 4VGCB 1ZGVA 2SNWA 1TGCA 1W12U 1ZMLA 1ZRKA 2FEQH 3F2HA 1GBHA 1MTSA 3SJIA 1GVLA 1VZQH 2ZHDA 3LDXH 2ZF0H 3LGVA 4CHAB 5C1UA 4I8HA 2ZA5A 2WV4A 3UR9A 3BF6H 3ZV8A 1L4DA 1ELEE 1GMCF 5EXLA 4CREA 3KGPA 1P2JA 2AMQA 5CMXH 1K1PA 1P0SH 2GCTB 3ZZBA 2VIPA 2ZCLP 1O37A 3BTQE 3DCLA 3RXLA 1IQKA 5JBAS 2BVRH 1O5AB 2ZFTA 4GPGA 3MH6A 1BRCE 3QUMP 4MLFB 3SUGA 1YPGH 1O2SA 1C2EA 1SL3A 1IQHA 1TGNA 4NG9H 4YOGA 5DG6A 1NPMA 4E05H 2P16A 2BX3A 2ZPRA 4FVBA 2ANKH 1EB1H 1Z8JB 1CVWH 2R3YA 4JYUH 1EP6A 1E1QD 3RC5A 1PQ8A 3ZZ9A 4H6TA 1FONA 1ELBA 3R0FA 1S0RA 4JCNA 1UMAH 1V2ST 2W6JD 1OYTH 1WTGH 2O8TA 2UWOA 1FMGA 2ZCHP 1TYNA 1RGQA 2Y81A 3A83A 3UNQA 3LC3A 1W0JD 4ZKOU 5LGOA 4GHQA 4K3JA 3LH3A 3GDVA 3M7UA 4MPXA 3H7TA 1WAYB 5C2ZA 1SGDE 3O8RA 1INCA 3BG4B 3RM2H 4CR5A 2RFKC 1JXPA 3ELAH 1YF4A 2BOKA 1QQUA 3PLBA 2J98A 2A4OA 2VIVA 4LXBH 3LIWA 3E16B 1S6FA 1O3JA 3L3TA 1V2RT 2WV5A 1BTXA 4AFZA 2V35A 4TPYA 4Y7BA 5EODA 3QZQA 3ZVDA 3SU5A 1VITH 2PKAA 2JH5D 1ANBA 4K60A 1UCYK 1UW7A 3IITA 1HIAA 3EYDA 4BNRA 1YCPM 2B5TB 1QR3E 3F9EA 3OU0A 4XE4A 1O3GA 1O2UA 4DJZB 4WF8A 1OYQA 1JIRA 1OWKA 1C2JA 1HUTH 1QBOA 3FFGA 3EQ0H 1P9SA 2XCFA 1NZQH 3BTGE 1A0HB 2OC1A 2BLWA 3LPRA 1MKWK 4OM9A 2F43B 2ZO3H 3ZZ5A 3OX7U 1UTLM 1JWTA 1V2OT 1GMDG 1ZJKA 1WU1A 2A7CA 3OTPA 5KEDA 2AYWA 4U01A 1TGSZ 1IQGA 1IQLA 2FYRA 5DGJA 1O2IA 1P06A 1F92A 1V2JT 2ZTXA 3SI4H 1AFQC 1NRQH 1DWDH 3M5MA 1SB1H 3D49H 1FUJA 2NU3E 4JZEH 4I8JA 1GJBB 2BMGB 2OD3B 1S84A 1C5TA 4ABJA 1ABIH 4JK5A 3P92A 4O97A 2ZPSA 2P95A 3KYGA 3U1IB 4YT7H 1Z7KA 4I31A 1RFNA 5LPRA 3RP2A 1O30A 1HB0B 1ZSLA 1CT4E 3DT0H 5A09A 4FOUC 2IPHA 3ITIA 2BY7X 1RJXB 1FLEE 1FX0B 4WH8A 2F4LA 1K0HA 4K1SA 3A89A 4B75A 3PYHA 4ASHA 3BN9A 1HAGE 2XBVA 5EQQA 3KF2A 5EXMA 1YY3A 5JYIA 1TALA 1A5HA 2A0QB 2BHGA 4NZLA 5AFZH 1AWHB 1K22H 5PTPA 1P57B 1A5IA 1C5VA 1TOCB 3PLPA 1QCPA 3HGPA 3UREA 1XUFA 2A4RA 2W3KA 1F5KU 4X6NA 4YTAA 3OYPA 1G30B 1GWAA 3RXUA 1S81A 4BTUB 2BOHB 3SO3A 4DG4A 1GG6C 3SJ9A 1V6DA 3DFLA 5C1YA 1C4Y2 3W1EA 2GJGA 2H9TH 2PSYA 1O2YA 1ID5H 1EPTC 3SV7A 1C1NA 1OKXA 2GVFA 3SQEE 2HVYB 2CK3D 1ELGA 2DE8A 1C5MD 4K5ZA 5TJXA 3QTVH 3TJUA 1T8OA 4B2BA 2QAAA 1ZPZA 1YPJH 2BVSH 3OFND 4TY7A 3V0XA 3NRLA 1KYNA 2GMTB 3BEIB 3I77A 4OS4A 1TLDA 3GCTG 1YBWA 1TE0A 1TQ0B 3T28A 1TMUH 2PP6A 3FAOA 4Y8ZA 1NFYA 2BD5A 4MQAA 4Z6AH 3RXCA 1PJPA 3VPKA 1GBDA 1TONA 2RDLA 4FU7A 1L1JA 3P8NA 1COWD 4TWWA 1FPCH 5GNDA 2ZDNA 3HKJB 4KTUA 3A84A 4A1XA 4BAMB 1PQ7A 1UTQA 1OPHB 1JIMA 2C4FH 2BYAX 4NA9H 1QFKH 2ZU2A 3S9AA 2FTLE 1DT2A 3BV9B 5HM9A 1O2MA 5DPAA 1TX8A 1C1TA 4X8SH 3ZYEA 1ESBA 1CGJE 1EPTB 1H4WA 5CHAC 3DSGA 2PWXA 3RUOA 1SMFE 1LHCH 4Y79A 1O2LA 1C1QA 3SNAA 1N6YA 1LQEA 2J97A 1TPPA 5HM2A 3E90B 4CRDA 1SLVB 3K65B 1ETRH 1YKTA 1K2I1 3S69A 1DUEA 1A7SA 4Q7XA 1TA6A 3LGYA 2A4QA 5HYOA 4TYDA 2XBXA 1FAKH 3TITA 1E36B 5HXFA 1FY8E 4NSVA 3A85A 3Q76A 3PLKA 1WYKA 2P59A 2SGDE 2TIOA 3IG6B 2G5VA 1IHTH 4FUBA 2LNCA 2XRCA 3TPIZ 1QL9A 5GXPA 2L6OA 2FIRH 2BDYA 2VIOA 1GI1A 1O3KA 3GICB 1FN8A 2NU4E 3RXFA 3W95A 5A8XA 1CO7E 5K0HA 4UEHH 1GDNA 1ZSJA 2BTCE 1TGBA 3GY8A 2QXGA 3DHKH 1SFQB 5GIBA 2EQNA 7ESTE 1XUKA 2OXSA 1RIWC 3ODFA 1Y3VA 3B23B 5CHAB 4DGJA 3SV8A 2P8OC 1DE7H 1V2MT 1WQVH 4RKJB 1JBUH 5E2PA 1EXFA 3STIA 1AI8H 1HAZB 4ABIA 2CHAC 1XKBC 1C1SA 4ABEA 3GY6A 4OS2A 4ZCNA 1O39A 2XOKD 3ZVFA 1GI4A 2AERH 2SFAA 4AG1A 2KAIA 1K1NA 6GCHG 1MABB 1Z1JA 1ZZZA 3MU8A 2HOBA 3TGKE 3V13A 1O3EA 1QA7A 2ANMH 3A82A 2TGTA 3SI3H 4K8YA 4Q7YA 1MD8A 2GV7A 2WUBA 1F0TA 5SGAE 1KLTA 1MTUA 1AE8H 4X8TH 2CN0H 1NFWA 3OE7D 4UFEH 1HAHH 2FYQA 5DK1A 1VITF 2ZKSA 3CP7A 4X2VA 2ILNA 5EJLA 1V2TT 1YC0A 3OY6U 3U98H 1W3CA 1T8LA 1MTVA 3HPTB 2QF5A 4UDWH 5T6DA 3B8JA 1O36A 1RIWB 9ESTA 4IGDA 2OUAA 1TNIA 2P8OB 2O8MA 1MBQA 3K6ZA 1C5UA 1SQTA 2VJ1A 1BTYA 3MTYA 4XDEA 2Y82A 4BAOB 2PFEA 5FPTA 4NIYA 3SHAH 1BMNH 4WY3A 4CRGA 1MAXA 1YPKH 2FOAA 1W0ZU 4MTBA 3PTBA 1L1GA 3PROA 2FDAA 5L2YH 5C5NA 2W7UA 1UTKA 1UVPA 3PWBA 2ZG0H 4I33A 3MU1A 2J38A 1DANH 1E37B 1H9LB 1HFDA 3VGCC 1O2VA 3ZVCA 1ZGIA 4ASUD 1AB9C 1XXFA 2Z3EA 1O35A 1DXPA 2J4IA 2JKHA 1AGJA 4JYVH 3KCGH 1MUEB 2VH6A 1AFEH 1C5ZB 4FU8A 3RXRA 4GVUA 1RXPA 1BT7A 2TPIZ 9LPRA 5DP4A 4XBCA 4XD7D 5CDFE 1BRBE 4I86A 1YGCH 1AY6H 2V6NA 2ZNKH 3MNXA 2HPPH 1BTHH 2VWOA 2FOFA 3RXBA 1KXEA 5T6GA 3TJVA 3MFJA 2ODYB 2SGAA 2BLVA 1L2EA 2GKVE 2OLGA 3AAVA 4LZ1H 4MNVA 1GJ6A 2GCHF 1FDPA 1O2KA 1EZUC 4U32A 2ZU3A 2F91A 2TGPZ 4BAHB 1C9TA 3VGCB 1FN6A 3RXGA 4UFGH 2PSXA 2BDGA 2W26A 3ZZAA 2R0LA 1AB9B 1ARCA 4TPIZ 4DOQA 4BXWA 1WQSA 1AKSA 3VXFH 1FI8A 2UUJB 4GSOA 1HAPH 4AGJA 5JB9S 5J4QA 4D9RA 3O8BA 4B73A 2ZGJA 4BTIB 4FUEA 2BQ7B 5CHBA 1A3EH 3QLPH 3NKKA 3M3TA 4CRFA 1YLDA 1PPGE 1EZXC 3KHVA 3C27B 1P09A 2FI4E 3MNBA 2XWBI 1X7AC 3IWMA 3U8OH 2QF0A 3N7OA 3SV6A 5FL7D 4J2YB 1LMWB 1LPGB 1O5GH 1MKXH 2BZAA 4D76A 1DDJA 1UHBA 3WWBA 1XVOA 2WYJA 1EZSC 2VVUA 1DWEH 2CJIA 2HALA 1IQEA 3LGTA 2ANYA 2SGFE 2ZFRH 2AGGX 1N8OC 5E8EH 1UVOA 4O3TA 4B6EA 3M61U 1KXBA 1SOTA 3PV5A 2IN2A 3RXJA 3SUFA 2KCYA 4YM9A 1C2HA 1HAXB 4GLYA 3T25A 3RC6A 4B1TA 1QRWA 3GY2A 5FX5A 3SJKA 4DCDA 4X6PA 5JPMH 5LPFA 3L33A 1DX5M 1MKWH 2J34A 1E0FD 4ZKRU 5EIYA 2ZCKP 1Z8IB 6LPRA 2Y80A 1BTPA 1JRSA 1BMMH 4VGCC 1MH0A 1TFXA 3LU9B 2HLCA 3KQ5A 2GZ7A 3F6UH 3QX5H 2ALVA 3ATIA 2GDDA 4JMYA 2AFQB 5DN6D 4UE7H 3SOSA 1BOQA 4B2CA 3FANA 1KIGH 1ANEA 2B7DH 3SORA 3MNSA 4NIWA 2C8YB 1CBWC 3LC5A 1P8VC 2AIQA 1TPAE 3TNSA 3V7TA 2GCHG 3T26A 1F5RA 1NO9H 1W0YH 1N8OB 3PTNA 1KTSB 3KQCA 4X2YA 1IQNA 2BXUH 4AYYB 1VCQA 3TH4H 4D8NA 2D8WA 4NA8A 2FOEA 4AZ2B 2NU1E 3DA9B 1RS0A 1UO6A 1C5SA 5ETXA 2VWNA 4I8GA 3BTTE 4DIHH 2M5TA 3EA7A 3GY5A 2F9OA 2WINI 1TNJA 3GOVB 5E2OA 2BLOA 3A86A 2ZDKA 2D26C 1G3DA 2A1DB 1K1LA 1NY22 2AS9A 1EAIA 1ELFA 4BAKB 1YP9A 4IC5A 2G4TA 1O5BB 4UD9H 1OWIA 1GHXH 2RA3A 3NCLA 1CBWB 1S5SA 4ABAA 7KMEH 1Y3UA 3BG4C 2BY6X 1CHOF 1G2MA 3EE7A 3KQEA 4THNH 3F68H 4XBBA 3CS0A 1GHZA 1VCPA 3UPEA 4GCHF 1Y3YA 2QCYA 4DURA 5IDKA 2V3HH 3HK6B 4FUHA 3BTHE 8LPRA 2AH4X 4WVPE 5HIYA 1FY3A 3SZEA 1NFXA 1XUGA 2FOGA 4AGKA 3GY3A 3F9FA 4D9QA 1GGDC 1BMAA 2Y5HA 2QE7D 1O2HA 2D2DA 2KX4A 1O2JA 3F0PA 5EQSA 1RTFB 1W11U 3RU4E 2HGTH 2BDAA 1AD8H 4INKA 4PROA 2C3SA 3DUXH 4YESB 4Z0KA 5C0UA 1AO5A 3DSPA 3A81A 2HVXA 3HGNA 4HG6A 1SVPA 1O2NA 4YOIA 2Z9KA 1UVUH 2H2ZA 3RXQA 3UTUH 1P2MA 1MZAA 1KDQB 2OQUA 3OAAD 5ESTE 3ZYDA 1S6HA 3PV2A 4ZH8A 1MTNC 4OS7A 2HPQH 4KKDA 2WHXA 1Z1IA 1MKXK 4BANB 3AW1A 3KQDA 4XOJA 1VCWA 1E79D 1GDUA 1GGDB 2GX4A 2V3OH 1S6LA 4TT3D 2QYIA 5FCRA 4A92A 4X1RU 2KCPA 1BUIA 3PMBB 4R8TB 2XC5A 2FX4A 3RC4A 1GJ7B 1SC8U 2I6SA 4MNYA 2JDID 1ORFA 3UY9A 1V2UT 5I46H 2QIQA 4A1VA 1GMCG 5L6NH 1CGHA 3ZZ3A 1CHOG 1DY8A 1P03A 3GCOA 1KXDA 1SFIA 1NRPH 5DO4H 4AX9H 3STJA 3A7VA 2LP6A 1EJMA 1SGEE 2OBOA 2BZ6H 1JRTA 1BITA 3WWFA 4P00A 1GI3A 1H1BA 4BTTB 1P10A 1KMHB 2WPLS 1H9HE 3SU0A 2A45B 2J5UA 3P8GA 2EA3A 4RSPA 1FPHH 2G5NA 1MTNB 2G55A 2R9PA 4ABHA 4DY7B 2AIPA 4X6OA 5F6MA 4Y71A 3WY8A 4RI0A 5T3HA 4KP0A 2VVVA 1QZ8A 3ZV9A 3MNCA 1O3IA 1C4V2 4Y0YE 1NT1A 5EG4A 2ZQ1A 4ACBA 5GWZA 1L4ZA 1LQDB 1W2KH 4X2XA 4FETA 3KL6A 2CGAA 1QB9A 2BD8A 1SGPE 1TAWA 3MU5A 2GMTC 3K9XB 2BB4A 3S7HB 3PRDA 1O2ZA 1P2IA 3WW7A 2Z9IA 4KTCA 2CV3A 1BBRK 1SSXA 5DP8A 8GCHF 1GBLA 3UNSA 3I78A 1ZTJA 2WUCA 2A32A 3VG8A 1VJ9U 2J92A 1NU7B 4X8UH 2XBYA 2C90B 2PUXB 1GVKB 5J4SA 3URCA 3TU7H 4ABBA 1AVWA 3FZDA 4NWKA 3T29A 1HAYB 1N6XA 1IQMA 2P3TB 1O2GH 1XXDA 3SV9A 1HRTH 2JJ1D 3PMHB 1OP0A 5EPNA 3A7XA 4NIXA 2PHBA 4FVDA 3SNDA 5DP5A 4Q63A 2JIZD 1GBTA 3D65E 2F3CE 3LGWA 1YPEH 2H5DA 4ISNA 2ZEBA 2SGPE 1HCGA 2C93B 1A0JA 1BMLA 3A7TA 5LH8A 1NRNH 1CA0B 1OSSA 2G81E 3MH7A 2Z94A 3PV4A 2ZI2H 4ISOA 4ISHH 2AMDA 2ANWA 1D3PB 1PQAA 3UB0A 2QXJA 1VGCC 3TLOA 1FIWA 1ZLRA 2FTMA 3HATH 5EPYA 1D3DB 3GCHC 1THSH 4AORA 4MPWA 1WTHD 5C3NA 5JBCS 2HNTF 2PTCE 2PUQH 4MNXA 4MNWA 2H1UA 4AFSA 1LVYA 2CMYA 4K1EA 3T62A 1TX7A 5EJZA 3DFJA 3R3GB 1C5NH 3MQKC 2HRVA 2ULLA 2Z7FE 3PB1E 5JB8S 3TH3H 1OP2A 1IQJA 4AYVB 4CH8B 2GZ9A 1O3MA 3K2UA 4NZQA 3NUMA 4ISIH 1Z6EA 4Y0ZE 1FV9A 5GPIB 2I6QA 4Q4LA 2HNTC 2BD9A 2CF8H 3RLYH 2BD7A 1DSTA 1UTNA 4X1PU 1AE5A 1P11E 3EE0B 4LOYH 1GI0A 1EUFA 1FNIA 2TBSA 3A8AA 1C2KA 2ODPA 4X1QU 1HDTH 2LPRA 4GAWA 1HAOH 1Y3XA 2PLXA 4J1YA 2L74A 3BEFB 5EOKA 3GDSA 1TQ7B 2FOMB 1C9PA 1GI9B 2K8IA 1VGCB 2FLRH 2BXTH 5AHGH 1THRH 1DLKB 1ELTA 4AFUA 3GCHB 1O0DH 1OOKB 1J15A 3UQOA 1KLJH 1EZQA 3A8DA 4MPUA 3GYMA 2PW8H 1GL0E 4DW2U 2SGQE 2ZHQH 1O2QA 2A7JA 2XCNA 3KNXA 2NU2E 4A6LA 1OX1A 2ZC9H 1C5LH 1T4UH 5DJ7A 4WMDA 1W10U 5HKKD 3ESTA 1QL7A 1UVSH 1P05A 4FUCA 1ACBE 3ZVGA 1A4WH 3QN7A 1TBRH 4MPVA 1L0ZA 2LELA 2FOBA 1DFPA 5DP3A 4IMQA 3LT3A 1OXGA 2OK5A 1PQ5A 2ODQA 4GHTA 4GUXA 4YLUA 3URDA 5G4BA 4X8VH 2WPIS 1LKBA 2EI6A 4DT4A 1BTWA 2VB0A 2ZDLA 3F3BA 1LHFH 2OC0A 1W8BH 5JBTA 5LPEA 1C1VH 1HAVB 3F2GA 4I32A 3U8RH 6ESTA 1Y59T 2F9VA 1T8NA 4ESTE 1O3BA 3Q3YA 1Y8TA 1EJNA 1ZMJA 4HI3A 4NFFA 4Q2KA 2ZFQH 1C1OA 2QY0B 1M9UA 5KECA 1NM6A 2AGEX 4Y11E 3SN8A 3UUZA 3FP7E 1H8ED 2V7QD 1HYLA 1O5EH 5DSFA 4F49A 4YOJA 3BTDE 1XUIA 3G01A 3M5OA 5TCCA 1KLIH 3VB5A 3ATMA 1GL1A 1ZPBA 1GBJA 1GBCA 1H9IE 1QIXB 4JZIA 1ZJDA 6CHAC 2Y5GA 2W7SA 1AWFH 5BPEA 2ZGHA 2Q6GA 4FUJA 3TJNA 1HXEH 3O8CA 1GMHF 1GHVH 1EX3A 2F9UA 2FI3E 4F48B 1SGRE 2Y6TA 5GCHF 2HLDD 3NK8A 1ZRBA 4B74A 2DUCA 5C20A 1THPB 1GHBF 1UVTH 2RG3A 1B0FA 3F1SB 2ZFSA 4WH6A 1IQIA 1GHYH 1SGNE 4JZFH 2ZIQH 1GJAB 2EEKA 1DLEA 1GPZA 3MH4A 1LHDH 1AN1E 1YPMH 1GVZA 3KN2A 2UUKB 1TNLA 3UOPA 1ZHPA 3S9CA 3KYFA 2ZHFH 1WSSH 1A0LA 1XM1A 3UAIC 1H8IH 3QGJA 2ZFPH 3A8BA 1GJ5H 3QGNB 2FESH 2IJOB 5EGMA 5HIZA 2XWAA 4I8KA 3E91A 2Z9GA 3FKSD 4K69A 3RXSA 1C5QA 1C5RA 1F7ZA 1CSOE 1C1UH 1K1IA 2C8XB 1QBNA 6CHAB 1C5PA 2WSSD 3D62A 1TRNA 2FX6A 1O3PB 1PPBH 1MD7A 4YT6H 5A8YA 3RXIA 1A1RA 2ZGBH 3VB4A 2FODA 2ZGCA 5DP7A 3EAJA 1LHEH 3I29A 2ZU4A 1O2OA 4RN6A 2R3UA 2Q1JA 3FP8E 2V0BA 1MZDA 1ZSKA 4OS6A 4U2WA 1C1MA 1RTLA 5E0GA 1G36A 3RMNH 3AAUA 5FX6A 2Z9LA 3Q77A 5EW1H 2Z3DA 1EB2A 3SGBE 1B0EA 1TOMH 2ZU5A 1NESE 1B5GH 1XUHA 3JZ1B 2A5IA 1QGFA 3ZZ7A 1AVXA 5C5OA 1QJ7B 4AN7A 2H9EH 2PV9B 4X1NU 1RD3B 1VITG 1NN6A 4F55A 4CRCA 1K28D 3SZNA 5E0HA 1W0KD 1TNHA 4DIIH 3TNTA 2F83A 2WPKS 3QTOH 1BMFD 1OWHA 4IN1A 2VU8E 3TH2H 3W94A 5C94A 1V2NT 1O2WA 1HLTH 1MCTA 1P9UA 1D6RA 3V12A 1C2GA 4H6SB 2P3UB 4UFFH 5GCHG 5FHTA 3ENSB 1MTWA 1GJ4H 3L6PA 4CR9A 2BM2A 1AU8A 1FY5A 3TJOA 3VXEH 2ASUB 1YYY1 2BVXH 3LGUA 1TBZH 1B7XB 1VKYA 1QRXA 1BBRE 1FXYA 4BXSA 3MH5A 2JH6D 1NU9A 1V3XA 4CBOA 1C4U2 4NIVA 1V2WT 3SV2H 4ZXXH 3P70B 5B6LA 2AGIX 2C8ZB 3TGJE 1N1LA 2OC7A 3RXOA 1XX9A 1HV7A 2FZZA 3ATKA 1HJ8A 4CRBA 1GHWH 4O03A 2ZHEH 3MOCA 1D6WA 2KM0A 4E06H 1Q31A 1Z8GA 1NS3A 3U69H 2TRMA 3TVJB 3GCNA 1XUJA 3FVFB 3M37A 3SGAE 2ZWLH 5HMAA 1P04A 3AVZA 1CU1A 1F2SE 1AHTH 3N99A 1HJAC 2K0QA 1ZHMA 3MMGA 2XNDD 1WXRA 1C2MA 1P2OA 1F5LA 1AUJA 2XYAA 5AVDA 1D3TB 2BD3A 1AIXH 1YLNA 3LH1A 4HFPB 4WWYA 4D7FA 1ZMNA 1NTPA 1O2XA 1O3FA 4Y76A 1Y5BT 4RKOB 3BSQA 2KCOA 1P2QA 2P94A 2UWLA 3RXAA 2ZFFH 5FXLA 3U8TH 1O3HA 3A88A 3RXHA 4A5TS 3KIDU 3F2FA 1KXFA 1LPKB 2A5KA 1GBAA 3UOUA 2UWPA 3GY4A 1BTZA 1O5DH 2QN5T 1BBRH 1SGFG 1ZPCA 3OY5U 1A61H 3P8FA 2CF9H 3RXTA 1C1WH 1KDQA 5HGGA 1DPOA 1JMOH 4ABGA 2PGQB 1MBMA 1TMTH 5F8TA 1GI6A 4Y10E 1PPCE 4NCYA 1C5OH 3S9BA 1BIOA 1LKAA 2VIDA 4DT7B 4ZKNU 1HJAB 1SLXB 1Y5AT 2FXRA 2OP9A 3E6PH 2WPHS 1SGYE 2GDEH 1ELDE 2JETC 3SNBA 4FUIA 1GI5A 2R2MB 2WPDD 2J9NA 3KEEA 1UHBB 1FZZA 1Z6JH 1G37A 1ETTH 2FPZA 1O2PA 4TSFD 2AEIH 3M3VA 1WUNH 2Q6DA 3T2NA 3RMOH 1WDIA 1UTMA 2BX4A 2ZHWH 4I8LA 3VFEA 3SU4A 3SYJA 5KGOA 4ZHMU 1E34B 1OWDA 3FO8D 1W7XH 5FBIA 1EQ9A 4B71A 4YXWD 2KZ4A 3K6YA 1O31A 2H9HA 3RU4T 1H8DH 3SU1A 1BZXE 1GMDF 3GDUA 4Y8YA 1MQ5A 3SHCH 1IQFA 1SQRA 2VINA 2FOCA 4Y6DA 2G8TA 3QZRA 4AFQA 3ZZDA 1QJ6B 3H09A 3B9FH 5AFYH 3P8OA 1UTJA 1ZTLA 3Q3XA 2RA0A 1NBMD 5L2ZH 1DWCH 1Q3XA 2THFB 4WXIA 1BCUH 2JETB 4ZHLU 2B8OH 1MU8B 4IMZA 3E0NB 3N7EA 2F9PA 5C1XA 4Q80A 5BRRE 2M2AA 3RMMH 1ZR0A 1LTOA 3BIUH 5GJ4B 1YCPH 1GI8B 4Q7ZA 5EXNA 3U9AH 1P01A 3Q00A 4IS5A 4OS5A 1K21H 4WMFA 3RXKA 2FM2A 4SGAE 2ZZUH 1E1RD 1CQQA 2ZDVH 5A8ZA 1TPSA 4M7GA 2EI8A 5ABWA 3LGIA 1CGIE 1TBQH 2TGAA 3ZZ8A 5IK2D 1DVAH 1LVMA 4KELA 2XC4A 1ARBA 1IAUA 1O3LA 3M7QA 1ELAA 3FOAA 5I25A 5CE1A 1MU6B 4XRNA 2PR3A 1LVOA 4A1TA 1KTTB 1P3EA 2BLQA 2YNBA 3ZVEA 4X2WA 3U1JB 3SBKA 3TK9A 1TMBH 7LPRA 2Y7XA 4GCHG 2QF4A 2WPMS 3BTFE 1UTPA 1LDTT 4MG3A 2XW9A 1YPLH 2QA9E 1F0UA 1BDAA 1BJVA 1YWUA 5C0TA 5JDUB 1SG8B 3P95A 2P3FH 5FAHA 3BTEE 1S83A 1NC6A 1YLCA 1RRKA 4NGAH 1PFXC 2VVCA 1SR5C 1MMJN 1A46H 1SGCA 1PPHE 1GBBA 2A2QH 3GCTF 3LOXA 4B76A 1J14A 1A3BH 2FP7B 1ELVA 3VB7A 3FP6E 1A2CH 3NXPA 2FLBH 2DE9A 1P2KA 2G52A 4TY6A 2O8LA 3GISB 1CHGA 3SNEA 2VWMA 5IYTA 4ZHAA 5DP9A 2XC0A 1CA0C 1EPTA 5AF9H 1K1MA 4NA7A 2WPJS 1J16A 4OS1A 1IHSH 2BY8X 2QC2A 2F9NA 4HTCH 2ZECA 4FU9A 4OGYA 3KQBA 4TWYA 2V3MA 1GBFA 4O9VA 1UK2A 2O8UA 2YMSD 4NWLA 1KXAA 1MQ6A 2UUFB 4IBLH 3RU4D 4ABFA 1SOZA 1LO6A 4ZUHA 1V2PT 3SQHE 1GDQA 1TPOA 1QB1A 2J98B 2VWLA 1KSNA 4LZ4B 3UIRA 5FCKA 3MU0A 7GCHF 3JZ2B 1XVMA 2XXLA 3F0OA 1G3BA 3S0NA 4KGAA 5A2MH 2QGRA 4BOHA 4ABDA 2OBQA 2IJD1 3ATWA 1YM0A 2PKAB 1S0QA 2G51A 3O8DA 2Q6FA 1O2TA 4WXVA 1HIAB 1W14U 2FS9A 1Z71A 1P02A 1Y5UT 2RDEA 1D3QB 1AFQB 1TGTA 1G3EA 1O38A 1YPHE 2JJ2D 3BTWE 1EOLA 3OEED 1EAXA 1SLWB 4INLA 4CBNA 1BB0B 3BTME 5EJ1A 3SU6A 1DWBH 3SJOA 2IOTA 3RXEA 1BTUA 4O3UA 3VB3A 3SU3A 3SU2A 2GZ8A 1O3DA 4CH2B 3HK3B 1E38B 3E1XB 5B6OA 1HAVA 1A5GH 1GCTC 1QHRB 4CRAA 1DY9A 3BG8A 4X1SU 2B0FA 1EAUA 1NFUA 1TRMA 2UUYA 3SJ8A 2K1QA 1CT0E 1SI5H 4FUFA 5C67A 2NU0E 3F9GA 2GT7A 1ZOMA 6GCHF 1LHGH 1O3AA 1TB6H 3TK5A 1GJCB 4WMEA 3NWUA 1O33A 3A8CA 1GCDA 1QB6A 4ZROA 1GG6B 4B2AA 1YCPK 1QTFA 5DKMA 4X0WU 2ZGXH 8GCHG 1TABE 1S82A 4AB8A 2VH0A 1ESAA 1GBKA 2W5EA 4JZ1A 2SNVA 1QNJA 1EASA 4LK4A 4FXGH 1ETSH 3LONA 1CE5A 3M35A 2KFWA 1C1RA 2O9QA 8KME2 1NRSH 2FI5E 4ACAA 3SUEA 7GCHG 1TNGA 2AHME 2A2XH 1EP5A 1D4PB 1GCTB 2EY4C 4I7YH 2OTVA 3A80A 4ISLA 1KXCA 1P12E 5F8XA 1HXFH 3T5FH 1J17T 3RXMA 2ZDMA 2B9LA 2P93A 3PO1C 2C8WB 2BD4A 3P6ZB 2A7HA 4ZXYH 1T31A 3UWJH 2ZDAH 1DITH 1UTOA 2EC9H 2FMJA 3MYWA 1PPEE 5T1VA 4HZHA 4UONA 1C2LA 4IC6A 3MI4A 3M3SA 3MO9A 5DP6A 2KCAA 2GGVB 5A0CA 2VBCA 4MDSA 3ZVBA 2OQ5A 2XNIA 3M5NA 3MWIU 4E7RG 1F0SA 1EFRD 3ZZ4A 4XBDA 3EA9A 2GT8A 1TNKA 1LCYA 3QWCH 3SNCA 4ZKSU 1C1PA 2H5CA 1FY4A 2QF3A 1BA8B 2WYGA 2IPQX 4M9FA 1ZHRA 3LJOA 1FAXA 1ZTKA 3VEQB 3RMLH 3M5LA 3E0PB 5T6FA 1DOJA 1XMNB 1GJDB 1DICA 3RLWH 3T27A 3S7KB 3M7TA 3GYLB 5FBEA 1OP8A 2JH0D 2AMPA 1BJUA 1C2FA 3ZZCA 1QBVH 1SGIB 1QURH 1TIOA 5C17A 2TGDA 1QJ1B 1TWXB 1PYTD 2PKSC 3PO1B 1QA0A 3GS9A 1ELCA 2J2UA 2BDIA 2R2WU 1BQYA 4YO9A 2ZU1A 3MHWU 1OHHD 3OTJE 5F03A 1KY9A 1H8HD 2ZP0H 1LPZB 3LJJA 2BQ6B 1FY1A 2Z9JA 1T7CA 3H5CB 1C5YB 1DUAA 1LVBA 4RT0A 4X6MA 5EW2H 2STAE 5EQRA 4JK6A 2YNAA 1HAIH 1OWJA 1IOEA 3ZZ6A 4H4FA 1WCZA 3PRBA 2FO9A 2ESTE 2Y5FA 3AK5A 1Q2WA 3TGIE 2GV6A 2KR7A 2FWWA 4AG2A 2OCVB 2FOHA 3PM3A 1BRAA 1W7GH 1JOUB 1ANCA 1EKBB 5E0JA 1U6QA 1QRZA 3SUDA 1QL8A 3PMJA 4ZMAH 2XBWA 1BHXF 3C1KA 3DD2H 4Z1MD 1SLUB 2CHAB 3N7DA 4K2YA 3LKWA 2G4UA 3AASA 1QQ4A 2GTBA 1GBIA 3CNRA 1GHAF 1UK4A 1P3CA 2PKSB 1EATA 3EGKH 5F8ZA 2GP9B 1O5CB 4RT1A 5GDSH 2YMSC 2OINA 3Q3KA 3GY7A 1WOFA 2BDHA 3F9HA 3OEHD 1EOJA 1HBTH 5K7RA 5F53A 1K9OE 2O8WA 1ESTA 4XFQA 1GI2A 1GJ8B 1TRYA 1GBMA 1UCYE 3PMAB 4U30A 1DS2E 4FUDA 1EAWA 1NRRH 4P02A 4ZAEA 3NPSA 4OGXA 4WJG2 3MO3A 5ESBA 1T4VH 5EU8A 4YZUA 2FS8A 1GI7B 1OWEA 1FQ3A 1SQAA 2SGEE 2VIQA 1V2QT 1PPFE 3RXVA 4A7IB 5FPYA 1HNEE 1G3CA 1AZ8A 1C5WB 1SGFA 1O2RA 1J8AA 2ZQ2A 5FPSA 4D7GA 3EDXB 3FZZA 5L30H 2KAIB 3E3TA 2J95A 1VJAU 2A5AA 3EA8A 1SQOA 1AUTC 1J9CH 1O3CA 1Y3WA 2W6ID 1SKYE 4E7NA 3A7ZA 3MU4A 3QK1A 1ANDA 1O3NA 2VNTA 1DSUA 2CXVA 3UNRA 3UFAA 4QT8C 3ATLA 2OC8A 4FUGA 2ZTZA 1GJ9B 2BY5X 3TK6A 2BDCA 1SHYA 2YMSB 1G2LA 1GMHG 4HGCA 2XTTB 4UFDH 1V2LT 3TIUA 1S85A 1O3OA 1BHXB 2PTNA 3A7YA 4BAQB 1GHBG 3M36A 3SW2B 1SBWA 1AVGH 1FJSA 2G00A 5TCAA 3UQVA 2BY9X 1V2KT 2ZPQA 4AOQA 4H42U 3UR6A 2F9BH 4SGBE 1UJ1A 1VR1H 1GBEA 1L1NA 2ZTYA 1K1OA 3OSYA 1G9IE 1AMHA 1C2IA 2R0KA 3VB6A 4B6FA 3QDZB 1TX6A 2VGCC 3RXDA 4JYTA 2W3IA 4Y8XA 1O5FH 4INHA 4IN2A 2BDBA 2HNTE 1G32B 1UCYH 3CS7A 3BEUA 3ZIAD 5A0BA 1QY6A 1AZZA 4JZDH 1MCVA 4F4OC 4XSKU 1W13U 2BD2A 1Z8RA 1GHAG 2GD4B 1T32A 2QXIA 1CA8B 1ZYOA 1NROH 1D9IA 3DSOA 3V3MA 4KTSA 1EJAA 3ODDA 1F0RA 3P17H 3RXPA 2STBE 1P2NA 3HKIB 4AC9A 2YOLA 2D1JA 1SHHB 3RDZA 3RM0H 1ABJH 2BQWB 3AW0A 3PWCA 1V2VT 1BRUP 2HWLB 1NBME 4K8BA 1SGTA 1DXWA 4Y7AA 2Z6BD 3A7WA 1AQ7A 1O32A 1T8MA 2QV1A 2VIWA 3BTKE 1E35B 1O34A 3A87A 4DVAU 1RTKA 2EI7A 4R0IA 1HJ9A 1HGTH 1OS8A 4CHAC 3BIVH 1CT2E 3CENA 2VGCB 3MO6A 1FIZA
chains in the Genus database with same CATH topology
4K1TA 4NSYA 2A31A 2H6MA 3UWIA 2PGBB 3QO6A 1PPZA 2GCTC 1HPGA 3SGQE 2J94A 3H7OA 4NFEA 1K1JA 1WBGB 1WV7H 4MVNA 1SPJA 1AKSB 1UK3A 3E8LA 3ZVAA 4AB9A 5A0AE 8ESTE 2A4GA 1YPHC 5JBBS 2QXHA 2NWNA 2RCEA 2Z3CA 4IW4E 1DM4B 1XKAC 3D23A 1C5XB 2ALPA 1C2DA 1MAYA 1PYTC 5H4IB 3NZIA 4YLQH 1TA2A 2Y7ZA 1SGQE 4VGCB 1ZGVA 2SNWA 1TGCA 1W12U 1ZMLA 1ZRKA 2FEQH 1GBHA 1MTSA 3SJIA 1GVLA 1VZQH 2ZHDA 3LDXH 2ZF0H 3LGVA 4CHAB 5C1UA 4I8HA 2ZA5A 2WV4A 3UR9A 3BF6H 3ZV8A 1L4DA 1ELEE 1GMCF 5EXLA 4CREA 3KGPA 1P2JA 2AMQA 5CMXH 1K1PA 1P0SH 2GCTB 3ZZBA 2VIPA 2ZCLP 1O37A 3BTQE 3RXLA 1IQKA 5JBAS 2BVRH 1O5AB 2ZFTA 4GPGA 3MH6A 1BRCE 3QUMP 4MLFB 3SUGA 1YPGH 1O2SA 1C2EA 1SL3A 1IQHA 1TGNA 4NG9H 4YOGA 5DG6A 1NPMA 4E05H 2P16A 2BX3A 2ZPRA 4FVBA 2ANKH 1EB1H 1Z8JB 1CVWH 2R3YA 4JYUH 1EP6A 3RC5A 1PQ8A 3ZZ9A 4H6TA 1FONA 1ELBA 3R0FA 1S0RA 4JCNA 1UMAH 1V2ST 1OYTH 1WTGH 2O8TA 2UWOA 1FMGA 2ZCHP 1TYNA 1RGQA 2Y81A 3A83A 3UNQA 3LC3A 4ZKOU 5LGOA 4GHQA 4K3JA 3LH3A 3GDVA 3M7UA 4MPXA 3H7TA 1WAYB 5C2ZA 1SGDE 3O8RA 1INCA 3BG4B 3RM2H 4CR5A 1JXPA 3ELAH 1YF4A 2BOKA 1QQUA 3PLBA 4LXBH 2A4OA 2VIVA 3LIWA 3E16B 1S6FA 1O3JA 3L3TA 1V2RT 2WV5A 1BTXA 4AFZA 2V35A 4TPYA 4Y7BA 5EODA 3QZQA 3ZVDA 3SU5A 1VITH 2PKAA 2JH5D 1ANBA 4K60A 1UCYK 3IITA 1HIAA 3EYDA 4BNRA 1YCPM 2B5TB 1QR3E 3F9EA 3OU0A 4XE4A 1O3GA 1O2UA 4DJZB 4WF8A 1OYQA 1JIRA 1OWKA 1C2JA 1HUTH 1QBOA 3FFGA 3EQ0H 1P9SA 2XCFA 1NZQH 3BTGE 1A0HB 2OC1A 2BLWA 3LPRA 1MKWK 2ZO3H 3ZZ5A 3OX7U 1UTLM 1JWTA 1V2OT 1GMDG 1ZJKA 1WU1A 2A7CA 2AYWA 4U01A 1TGSZ 1IQGA 1IQLA 2FYRA 5DGJA 1O2IA 1P06A 1F92A 1V2JT 2ZTXA 3SI4H 1AFQC 1NRQH 1DWDH 3M5MA 1SB1H 3D49H 1FUJA 2NU3E 4JZEH 4I8JA 1GJBB 2BMGB 2OD3B 1S84A 1C5TA 4ABJA 1ABIH 4JK5A 3P92A 4O97A 2ZPSA 2P95A 3U1IB 4YT7H 1Z7KA 4I31A 1RFNA 5LPRA 3RP2A 1O30A 1HB0B 1ZSLA 1CT4E 3DT0H 5A09A 2IPHA 3ITIA 2BY7X 1RJXB 1FLEE 4WH8A 4K1SA 3A89A 4B75A 3PYHA 4ASHA 3BN9A 1HAGE 2XBVA 5EQQA 3KF2A 5EXMA 5JYIA 1TALA 1A5HA 2A0QB 2BHGA 4NZLA 5AFZH 1AWHB 1K22H 5PTPA 1P57B 1A5IA 1C5VA 1TOCB 3PLPA 1QCPA 3HGPA 3UREA 1XUFA 2A4RA 2W3KA 1F5KU 4X6NA 4YTAA 3OYPA 1G30B 1GWAA 3RXUA 1S81A 4BTUB 2BOHB 3SO3A 4DG4A 1GG6C 3SJ9A 1V6DA 3DFLA 5C1YA 1C4Y2 2H9TH 2PSYA 1O2YA 1ID5H 1EPTC 3SV7A 1C1NA 1OKXA 2GVFA 3SQEE 1ELGA 2DE8A 1C5MD 4K5ZA 5TJXA 3QTVH 3TJUA 1T8OA 4B2BA 2QAAA 1ZPZA 1YPJH 2BVSH 4TY7A 3V0XA 1KYNA 2GMTB 3BEIB 3I77A 4OS4A 1TLDA 3GCTG 1YBWA 1TE0A 1TQ0B 3T28A 1TMUH 3FAOA 4Y8ZA 1NFYA 2BD5A 4MQAA 4Z6AH 3RXCA 1PJPA 3VPKA 1GBDA 1TONA 2RDLA 4FU7A 1L1JA 3P8NA 4TWWA 1FPCH 2ZDNA 3HKJB 4KTUA 3A84A 4A1XA 4BAMB 1PQ7A 1UTQA 1OPHB 1JIMA 2C4FH 2BYAX 4NA9H 1QFKH 2ZU2A 3S9AA 2FTLE 1DT2A 3BV9B 5HM9A 1O2MA 5DPAA 1TX8A 1C1TA 4X8SH 3ZYEA 1ESBA 1CGJE 1EPTB 1H4WA 5CHAC 2PWXA 3RUOA 1SMFE 1LHCH 4Y79A 1O2LA 1C1QA 3SNAA 1N6YA 1LQEA 1TPPA 5HM2A 3E90B 4CRDA 1SLVB 3K65B 1ETRH 1YKTA 1K2I1 3S69A 1DUEA 1A7SA 4Q7XA 1TA6A 3LGYA 2A4QA 5HYOA 4TYDA 2XBXA 1FAKH 3TITA 1E36B 5HXFA 1FY8E 4NSVA 3A85A 3Q76A 3PLKA 1WYKA 2P59A 2SGDE 2TIOA 3IG6B 2G5VA 1IHTH 4FUBA 2LNCA 2XRCA 3TPIZ 1QL9A 5GXPA 2FIRH 2BDYA 2VIOA 1GI1A 1O3KA 3GICB 2NU4E 1FN8A 3RXFA 3W95A 5A8XA 1CO7E 5K0HA 4UEHH 1GDNA 1ZSJA 2BTCE 1TGBA 3GY8A 2QXGA 3DHKH 1SFQB 5GIBA 7ESTE 1XUKA 2OXSA 1RIWC 3ODFA 1Y3VA 3B23B 5CHAB 4DGJA 3SV8A 2P8OC 1DE7H 1V2MT 1WQVH 4RKJB 1JBUH 5E2PA 1EXFA 3STIA 1AI8H 1HAZB 4ABIA 2CHAC 1XKBC 1C1SA 4ABEA 3GY6A 4OS2A 1O39A 3ZVFA 1GI4A 2AERH 2SFAA 4AG1A 2KAIA 1K1NA 6GCHG 1Z1JA 1ZZZA 3MU8A 2HOBA 3TGKE 3V13A 1O3EA 1QA7A 2ANMH 3A82A 2TGTA 3SI3H 4K8YA 4Q7YA 1MD8A 2GV7A 2WUBA 1F0TA 5SGAE 1KLTA 1MTUA 1AE8H 4X8TH 2CN0H 1NFWA 4UFEH 1HAHH 2FYQA 5DK1A 1VITF 2ZKSA 3CP7A 4X2VA 2ILNA 1V2TT 1YC0A 3OY6U 3U98H 1W3CA 1T8LA 1MTVA 3HPTB 4UDWH 5T6DA 3B8JA 1O36A 1RIWB 9ESTA 4IGDA 2OUAA 1TNIA 2P8OB 2O8MA 1MBQA 3K6ZA 1C5UA 1SQTA 2VJ1A 1BTYA 3MTYA 4XDEA 2Y82A 4BAOB 2PFEA 5FPTA 4NIYA 3SHAH 1BMNH 4WY3A 4CRGA 1MAXA 1YPKH 2FOAA 1W0ZU 4MTBA 3PTBA 1L1GA 3PROA 2FDAA 5L2YH 5C5NA 2W7UA 1UTKA 1UVPA 3PWBA 2ZG0H 4I33A 3MU1A 2J38A 1DANH 1E37B 1H9LB 1HFDA 3VGCC 1O2VA 3ZVCA 1ZGIA 1AB9C 1XXFA 2Z3EA 1O35A 1DXPA 2J4IA 2JKHA 1AGJA 4JYVH 3KCGH 1MUEB 2VH6A 1AFEH 1C5ZB 4FU8A 3RXRA 4GVUA 1RXPA 1BT7A 2TPIZ 9LPRA 5DP4A 4XBCA 1BRBE 1YGCH 1AY6H 2V6NA 2ZNKH 3MNXA 2HPPH 1BTHH 2VWOA 2FOFA 3RXBA 1KXEA 5T6GA 3TJVA 3MFJA 2ODYB 2SGAA 2BLVA 1L2EA 2GKVE 2OLGA 3AAVA 4LZ1H 4MNVA 1GJ6A 2GCHF 1FDPA 1O2KA 1EZUC 4U32A 2ZU3A 2F91A 2TGPZ 4BAHB 1C9TA 3VGCB 1FN6A 3RXGA 4UFGH 2PSXA 2BDGA 2W26A 3ZZAA 2R0LA 1AB9B 1ARCA 4TPIZ 4DOQA 4BXWA 1WQSA 1AKSA 3VXFH 1FI8A 2UUJB 4GSOA 1HAPH 4AGJA 5JB9S 5J4QA 4D9RA 3O8BA 4B73A 2ZGJA 4BTIB 4FUEA 2BQ7B 3QLPH 1A3EH 3NKKA 3M3TA 4CRFA 1YLDA 1PPGE 1EZXC 3KHVA 3C27B 1P09A 2FI4E 3MNBA 2XWBI 1X7AC 3IWMA 3U8OH 2QF0A 3N7OA 3SV6A 4J2YB 1LMWB 1LPGB 1O5GH 1MKXH 2BZAA 4D76A 1DDJA 1UHBA 1XVOA 2WYJA 1EZSC 2VVUA 1DWEH 2CJIA 2HALA 1IQEA 3LGTA 2ANYA 2SGFE 2ZFRH 2AGGX 1N8OC 5E8EH 1UVOA 4O3TA 3M61U 1KXBA 1SOTA 2IN2A 3RXJA 3SUFA 4YM9A 1C2HA 1HAXB 4GLYA 3T25A 3RC6A 4B1TA 1QRWA 3GY2A 5FX5A 3SJKA 4DCDA 4X6PA 5JPMH 5LPFA 3L33A 1DX5M 1MKWH 2J34A 1E0FD 4ZKRU 2ZCKP 1Z8IB 6LPRA 2Y80A 1BTPA 1JRSA 1BMMH 4VGCC 1MH0A 1TFXA 3LU9B 2HLCA 2GZ7A 3F6UH 3QX5H 2ALVA 3ATIA 2GDDA 4JMYA 2AFQB 4UE7H 3SOSA 1BOQA 4B2CA 3FANA 1KIGH 1ANEA 2B7DH 3SORA 3MNSA 4NIWA 2C8YB 1CBWC 3LC5A 1P8VC 2AIQA 1TPAE 3TNSA 3V7TA 2GCHG 3T26A 1F5RA 1NO9H 1W0YH 1N8OB 3PTNA 1KTSB 3KQCA 4X2YA 1IQNA 2BXUH 4AYYB 1VCQA 3TH4H 4D8NA 2D8WA 4NA8A 2FOEA 4AZ2B 2NU1E 3DA9B 1RS0A 1UO6A 1C5SA 5ETXA 2VWNA 4I8GA 3BTTE 4DIHH 2M5TA 3EA7A 3GY5A 2F9OA 2WINI 1TNJA 3GOVB 5E2OA 2BLOA 3A86A 2ZDKA 2D26C 1G3DA 2A1DB 1K1LA 1NY22 2AS9A 1EAIA 1ELFA 4BAKB 1YP9A 4IC5A 2G4TA 1O5BB 4UD9H 1OWIA 1GHXH 2RA3A 3NCLA 1CBWB 1S5SA 4ABAA 7KMEH 1Y3UA 3BG4C 2BY6X 1CHOF 1G2MA 3KQEA 4THNH 3F68H 4XBBA 3CS0A 1GHZA 1VCPA 3UPEA 4GCHF 1Y3YA 2QCYA 4DURA 5IDKA 2V3HH 3HK6B 4FUHA 3BTHE 8LPRA 2AH4X 4WVPE 1FY3A 1NFXA 1XUGA 2FOGA 4AGKA 3GY3A 3F9FA 4D9QA 1GGDC 1BMAA 2Y5HA 1O2HA 2D2DA 1O2JA 5EQSA 1RTFB 1W11U 3RU4E 2HGTH 2BDAA 1AD8H 4INKA 4PROA 2C3SA 3DUXH 4YESB 4Z0KA 1AO5A 3A81A 2HVXA 3HGNA 1SVPA 1O2NA 4YOIA 2Z9KA 1UVUH 2H2ZA 3RXQA 3UTUH 1P2MA 1MZAA 1KDQB 2OQUA 5ESTE 3ZYDA 1S6HA 4ZH8A 1MTNC 4OS7A 2HPQH 4KKDA 1Z1IA 1MKXK 4BANB 3AW1A 3KQDA 4XOJA 1VCWA 1GDUA 1GGDB 2GX4A 2V3OH 2QYIA 5FCRA 4A92A 4X1RU 4R8TB 1BUIA 3PMBB 2XC5A 2FX4A 3RC4A 1GJ7B 1SC8U 2I6SA 4MNYA 1ORFA 3UY9A 1V2UT 5I46H 2QIQA 4A1VA 1GMCG 5L6NH 1CGHA 3ZZ3A 1CHOG 1DY8A 1P03A 3GCOA 1KXDA 1SFIA 1NRPH 5DO4H 4AX9H 3STJA 3A7VA 1EJMA 1SGEE 2OBOA 2BZ6H 1JRTA 1BITA 1GI3A 1H1BA 4BTTB 1P10A 2WPLS 1H9HE 3SU0A 2A45B 3P8GA 2EA3A 4RSPA 1FPHH 2G5NA 1MTNB 2G55A 2R9PA 4ABHA 4DY7B 2AIPA 4X6OA 5F6MA 4Y71A 3WY8A 5T3HA 4KP0A 2VVVA 3ZV9A 3MNCA 1O3IA 1C4V2 4Y0YE 1NT1A 5EG4A 2ZQ1A 5GWZA 1L4ZA 1LQDB 1W2KH 4X2XA 3KL6A 2CGAA 1QB9A 2BD8A 1SGPE 1TAWA 3MU5A 2GMTC 3K9XB 2BB4A 3S7HB 1O2ZA 1P2IA 2Z9IA 4KTCA 2CV3A 1BBRK 1SSXA 5DP8A 8GCHF 1GBLA 3UNSA 3I78A 1ZTJA 2WUCA 2A32A 1VJ9U 2J92A 1NU7B 4X8UH 2XBYA 2C90B 2PUXB 1GVKB 5J4SA 3URCA 3TU7H 4ABBA 1AVWA 3FZDA 4NWKA 3T29A 1HAYB 1N6XA 1IQMA 2P3TB 1O2GH 1XXDA 3SV9A 1HRTH 3PMHB 5EPNA 1OP0A 3A7XA 4NIXA 2PHBA 4FVDA 3SNDA 5DP5A 1GBTA 3D65E 2F3CE 3LGWA 1YPEH 2H5DA 4ISNA 2ZEBA 2SGPE 1HCGA 2C93B 1A0JA 1BMLA 3A7TA 5LH8A 1NRNH 1CA0B 1OSSA 2G81E 3MH7A 2Z94A 3PV4A 2ZI2H 4ISOA 4ISHH 2AMDA 2ANWA 1D3PB 1PQAA 2QXJA 1VGCC 3TLOA 1FIWA 1ZLRA 2FTMA 3HATH 5EPYA 1D3DB 3GCHC 1THSH 4AORA 4MPWA 1WTHD 5C3NA 5JBCS 2HNTF 2PTCE 2PUQH 4MNXA 4MNWA 2H1UA 4AFSA 1LVYA 2CMYA 4K1EA 3T62A 1TX7A 3DFJA 3R3GB 1C5NH 2HRVA 2ULLA 2Z7FE 3PB1E 5JB8S 3TH3H 1OP2A 1IQJA 4AYVB 4CH8B 2GZ9A 1O3MA 3K2UA 4NZQA 3NUMA 4ISIH 1Z6EA 4Y0ZE 1FV9A 5GPIB 2I6QA 2HNTC 2BD9A 2CF8H 3RLYH 2BD7A 1DSTA 1UTNA 4X1PU 1AE5A 1P11E 3EE0B 4LOYH 1GI0A 1EUFA 1FNIA 2TBSA 3A8AA 1C2KA 2ODPA 4X1QU 1HDTH 2LPRA 4GAWA 1HAOH 1Y3XA 2PLXA 4J1YA 3BEFB 5EOKA 3GDSA 1TQ7B 2FOMB 1C9PA 1GI9B 1VGCB 2FLRH 2BXTH 5AHGH 1THRH 1DLKB 1ELTA 4AFUA 3GCHB 1O0DH