4K2YA

Crystal structure of human chymase in complex with fragment inhibitor 6-chloro-1,3-dihydro-2h-indol-2-one
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
226
structure length
217
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymase
publication title Discovery of Potent, Selective Chymase Inhibitors via Fragment Linking Strategies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 217
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k2yA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k2yA02
5EU8A 2W7SA 3TK5A 2VIPA 2OBOA 1GHBG 3GY4A 1OSSA 1GI7B 1SVPA 1GGDC 4NA7A 3SN8A 4B2CA 2ZU1A 2BTCE 3LJJA 2ANMH 4AFZA 3GY7A 2OBQA 1O2IA 4JK6A 7KMEH 2Q6DA 2FOAA 1T4VH 1ESBA 3VPKA 1LHCH 1ANEA 3SNEA 3SV6A 1DE7H 4VGCB 3T26A 1FY3A 1AVWA 1T32A 1YKTA 3LC5A 1L1JA 3EE0B 1JRSA 2R0KA 3GDSA 3P8GA 1W14U 2B9LA 4XBBA 4KTSA 1O5AB 1DSTA 4I31A 4A1XA 2FX6A 2G4UA 3GDVA 4XOJA 3E16B 1O2UA 6CHAC 1J14A 2GP9B 2XW9A 1PFXC 3BEUA 1FAKH 3N7OA 3VFEA 3RXQA 3SNAA 1D3DB 1KTTB 1GBFA 1MAYA 3LC3A 3SU5A 1N6XA 2NWNA 3ZZ5A 2AIQA 2ZU4A 1HJ8A 1N8OB 3D23A 1TMTH 4X6OA 4AFUA 3BG4C 4BAMB 3I77A 2EI6A 2W7UA 1D3PB 3KQEA 3OY5U 3ODDA 3PO1C 3LPRA 1AUTC 1LPZB 1O2MA 1FY4A 4JYVH 2O8UA 2J38A 1C2JA 3A7ZA 1UHBB 2H1UA 2SGDE 4HGCA 1ZPCA 2BD9A 3MO3A 2K1QA 2BXTH 1D6RA 1C1VH 4GSOA 2PKAB 1IQJA 3S9AA 1SFIA 3OY6U 1V2ST 1P2KA 4D7FA 2OTVA 2F83A 1AN1E 2BVRH 4ABGA 4B76A 5GXPA 2RA3A 1DWEH 1BTYA 1NM6A 3EGKH 1K2I1 4H6SB 8KME2 1O5FH 1G32B 1C5MD 1TONA 2IN2A 3TGKE 3LGIA 2ZDVH 1CA8B 2VIQA 3IITA 3GY2A 2Y82A 3GICB 1TGSZ 1UTKA 4K8YA 1O2LA 4DIIH 9LPRA 1C9PA 3GY6A 3SOSA 1KLJH 4D8NA 2Q6FA 1W11U 1MQ6A 3RC4A 1MTVA 3E3TA 1GMDG 1C2DA 1BTHH 1LHEH 5BPEA 2YNBA 4UD9H 2AERH 1JBUH 2PW8H 1UVUH 4DG4A 3ZZ6A 4I8JA 1KDQB 3EA9A 5A0CA 1GHVH 5E8EH 5ESBA 4BAHB 3KHVA 4Y6DA 1UVPA 3LJOA 1C4Y2 4ABDA 1BB0B 4ISHH 3ZZ3A 2HNTF 2PGBB 1TNGA 2PWXA 2JH6D 3M5OA 1P12E 3UNQA 1LHGH 1PPBH 3U1JB 1A5HA 3G01A 1YPHE 4YOGA 1EAUA 1F0RA 1K1PA 5H4IB 5JYIA 2OC7A 4K69A 2Z9JA 5B6OA 3AW1A 1QRWA 5L2YH 4IC5A 3ZYDA 2VIOA 3V3MA 1SHHB 1HXFH 1ANBA 1XKBC 1Z8RA 2FESH 2A7CA 3E90B 2XTTB 1LPKB 2R0LA 1GBIA 3RXUA 1F5KU 1Z8GA 2OINA 2Y7ZA 3FZZA 5C1UA 1DXPA 3RXFA 1V2RT 5DP6A 3P8FA 1C5UA 2OC1A 1RRKA 1GPZA 1QGFA 3CP7A 4IBLH 2Z9LA 3A7VA 2H9HA 2W3KA 2PR3A 3JZ2B 3RUOA 1PPFE 2W5EA 1FIZA 2ZQ1A 3A8CA 1CT4E 1LPGB 2SFAA 2ZCLP 2OC0A 5DKMA 4Y71A 1VCQA 1PYTC 4FVBA 4U32A 1EKBB 2Y5GA 3TVJB 3R0FA 4NZQA 2ZDAH 1G3CA 1HJAB 1MTSA 1SI5H 2ZU3A 4OS5A 4IC6A 3SJOA 4TWYA 1JIRA 1BRBE 2ULLA 4ZMAH 1A2CH 2P95A 1Z71A 2BY8X 2Z3EA 3BTTE 4D76A 1O3GA 1P09A 3U8RH 1DUAA 1ZJKA 4X2VA 1W7XH 1O5GH 3PMAB 1MCTA 2C8YB 4MNWA 4X0WU 1QBOA 3NUMA 1AFQB 4Z6AH 1EAXA 2O8TA 2GDEH 3MWIU 7ESTE 4NIWA 4MNYA 2UUYA 3FANA 3QZRA 3A84A 2JETB 4ZKSU 5TCCA 1GI0A 1BBRH 2XC4A 3B8JA 2TBSA 4K3JA 4X1SU 3RLYH 1VJ9U 1A0LA 1HAVB 1HRTH 1BRCE 1A0HB 1ZPBA 4XDEA 4ZHAA 2ZPRA 1ELTA 1BMAA 1F0SA 2QA9E 4H42U 1P57B 1SFQB 4LXBH 2OXSA 1UVSH 2EI8A 3D62A 1TPPA 1S6HA 4OS2A 1LQDB 2BY9X 3SNCA 1DPOA 1CE5A 1OP8A 5DO4H 3UQOA 3SHCH 1IQIA 1UCYE 4KTCA 3GYMA 3QK1A 1GGDB 2V0BA 1BITA 4D7GA 1WQVH 2ZZUH 1B7XB 5EQRA 1YM0A 1UJ1A 1IAUA 2VWLA 4H4FA 1GI9B 1O2GH 1SGEE 3RXVA 1VR1H 4D9QA 2BM2A 4ZXXH 5HM2A 1O2YA 3BTFE 5GCHF 2HRVA 3UREA 5EXNA 2GV6A 1GI5A 3QX5H 7GCHF 1PQ5A 2OCVB 3SU2A 3ZVAA 3ZVBA 2BLQA 3PWCA 4SGBE 1TOMH 3GCTF 1O3FA 2ZFRH 3KQCA 4Q80A 1EZQA 3RXJA 5C5NA 6CHAB 1QFKH 1AWHB 4IMZA 1SLXB 3QZQA 2TGDA 4GCHF 4YT6H 2VVUA 1GCDA 1V2WT 3CS7A 3Q76A 1ETTH 1PJPA 1HAGE 2PSYA 3HK6B 1O2TA 1P3EA 3BG4B 2GCHF 1TQ0B 1MAXA 2QN5T 1P11E 2WPJS 4MPVA 1GJ4H 3QDZB 3PO1B 2Q1JA 2FTLE 2TRMA 3U8TH 2XNIA 2UWOA 2C8ZB 1V6DA 2BYAX 2QY0B 2TGAA 3O8DA 1GDUA 2ZDKA 4CRBA 5F6MA 4YESB 2YNAA 1NO9H 1A61H 2OC8A 4MPXA 1C4V2 1C1MA 5FX5A 1GBEA 1Z1JA 3K65B 1J8AA 1THPB 2ZQ2A 2FTMA 1ELFA 1SB1H 4X2XA 1TAWA 3I29A 1QA7A 5EG4A 2QGRA 2PTNA 5DPAA 4I8LA 5DJ7A 4GPGA 2FEQH 3C27B 1DANH 5C67A 3MMGA 4YLQH 3UY9A 2ZKSA 3ZVCA 5FCRA 1TIOA 3ZV8A 1PPGE 1DWCH 2HALA 4JZEH 4JYUH 5GPIB 4MTBA 1EX3A 1Q3XA 5DP3A 1DFPA 4UFFH 1FXYA 4MVNA 2IOTA 2ZEBA 2FI3E 3QN7A 1GL0E 2A0QB 1KSNA 3V0XA 1V2UT 1UK4A 2ODYB 2A4OA 1BUIA 1H9HE 1BHXB 4DJZB 3NCLA 2QXIA 1TA2A 3MU8A 1AB9C 3Q3KA 2VH0A 1LVYA 1WQSA 5TCAA 1NRNH 2ZO3H 4X1QU 1ZTJA 2FI4E 3FAOA 2LNCA 1FN8A 2XBYA 2BX3A 4OS4A 4MNXA 2ZA5A 1TMUH 1OX1A 3MTYA 3DA9B 2ZCKP 1BCUH 1J15A 4INKA 4CH8B 1TALA 2FMJA 4RSPA 3SO3A 1O5CB 1DLEA 2PGQB 1OYTH 1NROH 1A7SA 4ZHLU 4CH2B 2QIQA 1HGTH 2ZGCA 1ARBA 1C1OA 1MTNC 4BANB 1LVBA 2A2QH 2FX4A 1RXPA 1Z8IB 4AN7A 4AB8A 2QCYA 3P17H 3Q3XA 4A5TS 1GVKB 2UUKB 1NS3A 1JRTA 4CRGA 1C2MA 2A31A 3MNSA 1FI8A 2WV4A 4JZ1A 2IPHA 1IQEA 2ZPQA 1RJXB 3UNRA 1S6FA 4TPIZ 1AZ8A 3SGBE 1Z6JH 1P2IA 1S0RA 2BZ6H 2ZU5A 3ZV9A 4CRFA 2NU2E 1BHXF 2AYWA 2ZG0H 3MO6A 3EA7A 1OKXA 3LGTA 1VITH 1FV9A 1ORFA 4K1EA 4CBOA 1GJ7B 1C2EA 2CGAA 5A8XA 1TGCA 2GVFA 1GCTB 4AG1A 3MFJA 4AGKA 3MO9A 1G30B 1GMCG 3RC6A 2CJIA 2ZNKH 3KN2A 2BY5X 3DD2H 1BMNH 3TH2H 3LOXA 4WY3A 2VGCB 1ID5H 1BQYA 1GBDA 1OWKA 1TRNA 3ENSB 1IQGA 4X6MA 3A7XA 1EUFA 4O03A 4FUEA 1ABIH 4WVPE 4NIVA 1S84A 1GHAG 3UNSA 4F49A 1SQOA 1EP6A 1DX5M 3SJKA 3MU1A 1EB1H 4KELA 4FVDA 2HWLB 4NWKA 1VCWA 1F92A 2A1DB 3QTVH 4DGJA 1O39A 2ZFQH 1J17T 2ZI2H 2CN0H 3DUXH 2FOBA 3IG6B 2ZFFH 2AGEX 2TGPZ 3MH4A 3VXFH 4AORA 3M3VA 2VJ1A 5A8ZA 2CMYA 3GISB 3S7KB 1SLWB 3QLPH 3GCHC 2TIOA 1T31A 4KKDA 5IDKA 3TJVA 3UPEA 3PMBB 3VGCC 4AFQA 3E91A 1KLIH 1L2EA 4TWWA 3OSYA 2EEKA 3GDUA 4FU7A 1DLKB 3ATWA 1P9SA 3LH1A 4Y79A 2C3SA 1E37B 4UEHH 1GI4A 4ISLA 5T6DA 1D3TB 4MNVA 1KLTA 1F0UA 1ZOMA 1F2SE 3AAUA 3H7OA 2BOKA 3NK8A 1SC8U 2ZFTA 2G51A 4A7IB 6GCHF 5GJ4B 2BD5A 5FPTA 4BTUB 2F9NA 1D6WA 5HXFA 1ELEE 4K1SA 1ACBE 1V2LT 2IJOB 3BTEE 4AYYB 1TX8A 3SU6A 1W2KH 1S81A 4GHQA 1TNJA 4O97A 4AGJA 1L1GA 1IQKA 2J9NA 1JOUB 3W94A 5IYTA 3KF2A 3ATIA 2UWLA 5JB9S 4IGDA 1NFWA 3OU0A 3ZZ9A 1MH0A 1O3DA 3QTOH 1GJAB 1CA0C 4A6LA 2CHAC 2GDDA 3MU5A 4I8GA 2SGPE 1RFNA 2ANYA 4WH8A 1GVLA 1UTJA 4Q7ZA 2V3OH 1NFXA 3TJOA 2VINA 4IMQA 3BN9A 4Y11E 1Y3XA 3TGJE 1CU1A 3SJ9A 2VWOA 3QUMP 1DY9A 1UTNA 2Z94A 3GY3A 4H6TA 5EODA 3BTKE 1GBLA 1O3EA 3SU4A 1MKWK 1EAWA 2P3UB 2XWAA 3Q00A 1SLUB 3RXSA 2WPKS 3PM3A 4LZ1H 2WPIS 3KEEA 1XVOA 1GG6C 4XFQA 1UCYK 1YPLH 3T29A 1T8OA 2O8MA 2WYJA 5DP7A 1C9TA 4OS7A 5DP5A 4NG9H 5FBIA 2HPQH 2ZGHA 3BSQA 3M3TA 1ZPZA 3L3TA 4K5ZA 4FUIA 4KP0A 2FYQA 2B8OH 3SV8A 1GMHF 5AF9H 3HKIB 1DY8A 2Z9IA 2ZU2A 1QHRB 3F6UH 1O3LA 1CGJE 1W0YH 1TGNA 1WOFA 1E36B 1O33A 1WYKA 1MTWA 3V7TA 1H8IH 3M36A 1EASA 4GUXA 3SU0A 6LPRA 1OWIA 3VXEH 3SI4H 2Q6GA 3BTGE 1WSSH 1K1MA 1YBWA 4ZUHA 2FOHA 1ABJH 4A92A 3M5NA 1GJ9B 3T5FH 4U30A 4IW4E 1TPSA 2H9EH 1P06A 1DSUA 5E2OA 1TOCB 1EPTA 1ESAA 3TU7H 1O36A 1AB9B 1C2HA 1XX9A 1LVMA 1VJAU 2HVXA 1BT7A 2BDHA 1MU6B 2W3IA 3SNDA 1RGQA 4K2YA 2G8TA 4WXIA 1O38A 3QWCH 3C1KA 4OS6A 1AUJA 4B71A 5FXLA 3SQEE 3F1SB 2Z9KA 1XUGA 1PQ7A 2GV7A 2GZ9A 2XC5A 4MDSA 5EPNA 4WH6A 1C5OH 2OD3B 1C5SA 2ALVA 1O3PB 5SGAE 1MTNB 5ETXA 5CMXH 3AW0A 2V3HH 2OUAA 1ELGA 1S0QA 2Y6TA 1GI2A 1K1NA 3TLOA 4ABAA 2XXLA 1O2ZA 1GJDB 2ZP0H 2HLCA 3P8OA 5GIBA 1WBGB 2G4TA 3TK9A 2LPRA 3SUFA 3BIUH 1DDJA 1FPHH 1EP5A 4D9RA 1PPEE 4NIXA 1P04A 1FY1A 2A7HA 1P2NA 1A0JA 1SGRE 4BOHA 3NXPA 2PUXB 1ZSJA 3SV2H 1YCPM 1XUKA 1IHSH 3O8RA 2BVSH 1TRMA 1C1WH 1K9OE 5EQQA 4GVUA 4WMDA 1HUTH 2G5NA 4CR9A 3A86A 4Y7BA 1TPAE 2J2UA 1OWDA 1O2PA 1FNIA 1C1SA 2BD4A 1E38B 3A7TA 1NZQH 1O37A 3B9FH 1LCYA 5EXLA 1QL7A 3F68H 2FPZA 4X2YA 1HNEE 5JB8S 2ZGXH 5FPSA 5J4SA 4ABEA 4FUCA 4XSKU 1SG8B 3ZVEA 1YPEH 2PHBA 1GBTA 3TJNA 3T62A 1EJMA 2B0FA 2NU0E 1DOJA 3PB1E 4ZAEA 5K0HA 7LPRA 1JIMA 1UCYH 1K1OA 4FUBA 5CHAC 1GJ8B 2G55A 1SHYA 2UUFB 4F4OC 1NT1A 1SSXA 1FN6A 3BEFB 1CO7E 2BD8A 5EQSA 1QJ7B 5L6NH 5JBCS 2P59A 5C5OA 1GI6A 1PPZA 1W0ZU 2QV1A 2PFEA 3MOCA 1YC0A 1B5GH 3LDXH 4AZ2B 4DW2U 1EZUC 2BDIA 1C5XB 4ABFA 1LDTT 2GT8A 1KXEA 3GCHB 2TPIZ 1EZXC 3LGWA 3U69H 3K6YA 1OP2A 1U6QA 3Q3YA 2BDCA 3A81A 1Q2WA 1Y3WA 1GBKA 4FUFA 3LONA 1P0SH 1NRSH 1CQQA 3MU4A 2HGTH 1ETSH 2R9PA 4GLYA 2FZZA 2B7DH 2BDGA 3SUEA 1UTLM 1FPCH 1L4ZA 4Q2KA 3TNSA 1EPTC 4DY7B 2BQWB 5J4QA 1O3AA 1PQ8A 2P93A 5LPEA 2RA0A 4GHTA 4JYTA 3ATLA 1NRRH 4AOQA 2C8WB 1HJ9A 1C5QA 1HAZB 1KYNA 5JBTA 4O9VA 4Q7YA 3MH7A 5PTPA 1D4PB 1EZSC 1ZRBA 4O3TA 2AGIX 5T3HA 1HB0B 3ZVDA 1GBBA 1CHGA 1SBWA 4CREA 1ZSKA 1YLCA 3EYDA 1QIXB 5GCHG 2ANKH 3KQBA 1CA0B 2CHAB 2SGEE 3U9AH 1H9LB 1F5RA 4B73A 1LTOA 3SUGA 2A5KA 1KXBA 1DXWA 1MZAA 7GCHG 4IN2A 4E06H 2QC2A 1NU7B 2BOHB 4YOIA 1UVTH 3TNTA 2Z3CA 3FP8E 1HDTH 2BLOA 3GCTG 4WMFA 1O3KA 1A46H 2J4IA 2QXHA 4U01A 2ODQA 1ZGVA 3RMMH 2VIDA 1V2NT 1O2VA 2HNTE 3I78A 1HAOH 1QY6A 4NWLA 4GCHG 1E0FD 1SR5C 1C1UH 1CT2E 1OOKB 2OLGA 4BXSA 1C5VA 2R2WU 2GCHG 1GG6B 2GCTC 3HGNA 3GY8A 3RXDA 2ZHWH 3H7TA 3BTME 3KIDU 5EOKA 1OXGA 2BY6X 1W10U 1IHTH 4WJG2 3U8OH 1FAXA 4UFDH 1SGTA 1P3CA 4KTUA 5E0JA 2BDYA 4JZFH 1PYTD 4Y8ZA 1HAPH 4Y0ZE 1XXFA 1AE5A 2BQ6B 2ZTZA 1VCPA 2VVVA 4ZKRU 4NZLA 3E0NB 1SMFE 1HPGA 1V2MT 2Y7XA 1FDPA 1M9UA 1OWJA 4Y0YE 1L0ZA 2J34A 1KXAA 2R2MB 1BJUA 4WMEA 1HAYB 2O9QA 3LU9B 4X6PA 1SGFG 3NPSA 3UWIA 1ELDE 1CVWH 1QNJA 3UWJH 1LKAA 3VB4A 3V13A 2H6MA 3A7YA 1TQ7B 1C5LH 4B2BA 4A1VA 5BRRE 1WTGH 3RXCA 2RG3A 4UE7H 4WWYA 1N8OC 3PLKA 3TJUA 4UFGH 1E35B 2OP9A 1BOQA 1WAYB 3R3GB 1ANCA 2VIWA 1G36A 2FO9A 2RCEA 3A88A 5F8ZA 1BTWA 1T8NA 2ZCHP 2W26A 1QB6A 2ZPSA 2C8XB 4MPUA 1GBAA 2H9TH 1HFDA 5L2ZH 1ETRH 2FXRA 3S69A 5C20A 4UDWH 4BNRA 3UR9A 4J1YA 1VITF 2PLXA 1AVXA 2J94A 1TNIA 3L6PA 1QB1A 1H1BA 2D2DA 1QRZA 2QYIA 2Z7FE 3MNBA 2SGAA 3GCOA 4CRCA 3M61U 3SJ8A 1NESE 2FDAA 4Y7AA 3ODFA 3HATH 2GGVB 3MNCA 2AIPA 1C2LA 3SI3H 5C3NA 1HIAA 1QB9A 2F3CE 1NPMA 4TY7A 1SGYE 5AHGH 1KTSB 2ZTYA 3GYLB 4FUHA 1HAVA 3BTQE 4NIYA 4FUDA 1UK2A 2J92A 1ZHMA 3O8CA 2BB4A 5DP4A 3T28A 2XYAA 4ZH8A 1H8DH 1S85A 1QQ4A 3RMLH 1G3EA 1MCVA 2C90B 1G37A 1O34A 1SPJA 2P8OC 5C2ZA 3KNXA 4QT8C 1LHDH 1YP9A 1EAIA 1ELBA 3DT0H 1WTHD 3NWUA 4B74A 4E7RG 1OP0A 3E8LA 1AZZA 3K6ZA 2BDAA 2GZ8A 3AAVA 4LOYH 1ZSLA 4E7NA 1Y3YA 4O3UA 4YLUA 5GDSH 2GZ7A 2AFQB 2ILNA 1VGCC 1TPOA 1YPGH 1OYQA 1OWEA 2FOGA 4YTAA 3SU1A 2FYRA 2BD7A 3PLBA 5I25A 5F8XA 3UIRA 3F9HA 1CHOF 2VNTA 1TX6A 1YCPK 1G2MA 3FP7E 2ZHEH 3BTWE 1NU9A 3TITA 2ZDLA 5T6GA 1BMLA 2Y5HA 1GI8B 2NU4E 1C4U2 3ZZ7A 1TBQH 1ZHPA 1JXPA 5JPMH 3S9CA 1ZTKA 5CHAB 2R3YA 4Y76A 4BAKB 1GDNA 3HPTB 3EA8A 1ZR0A 3A80A 5A0AE 2SGQE 5AFYH 3URDA 5C1XA 1GHYH 1TGBA 1XUJA 3STJA 2HPPH 2WINI 1CGHA 3RU4T 1MU8B 1O3HA 2BHGA 2THFB 5DP9A 5EW1H 1L4DA 1GI3A 2BD3A 1ZGIA 4ZKNU 3SGAE 1NFUA 1OS8A 1W7GH 4R8TB 1O2SA 2AMQA 3ZYEA 1MD8A 2F91A 1LHFH 1O2XA 1GJBB 3MU0A 4K8BA 5E2PA 2BLVA 1K21H 1GL1A 3ZZBA 1P02A 1G9IE 1KIGH 1ZRKA 3MH5A 3RXPA 3SV7A 3FP6E 3KCGH 2BDBA 3PTNA 5F03A 3BF6H 3A8DA 3E6PH 1RD3B 3TK6A 3ZVGA 1RIWC 2PKSC 3A89A 4JK5A 1HJAC 2AH4X 3SV9A 4ZHMU 1B0EA 1O32A 1DICA 2BX4A 1P03A 2ZDNA 1Y3VA 2ZGJA 4M7GA 1OPHB 1BIOA 4MG3A 1EPTB 4JMYA 2XBVA 1LMWB 4ZKOU 1KXCA 3ATMA 4ABHA 3A7WA 4AB9A 1T4UH 3PMJA 5HYOA 5ABWA 1XUHA 1AFQC 2FOMB 4WF8A 2XBWA 6ESTA 1OWHA 1GHZA 3M3SA 1BA8B 2JH0D 3P92A 1O3MA 3SJIA 5TJXA 1O5DH 6GCHG 5LGOA 1MQ5A 2Z9GA 3RU4D 1C2KA 1TMBH 1H9IE 1EQ9A 1A4WH 1AU8A 1ZJDA 1YPMH 1O30A 2A4QA 4X2WA 1O2KA 2FOEA 4NGAH 1HXEH 1YF4A 1C5RA 2CF8H 2NU3E 3PTBA 4X1NU 2VB0A 5FBEA 3PROA 1QL8A 1TWXB 1FLEE 1C5TA 1IQNA 1ZZZA 1UTMA 3A87A 2A2XH 2BY7X 2BXUH 4RKJB 4I8KA 3UR6A 2F9VA 1T7CA 2Z6BD 1GHBF 2WPLS 1TNHA 4AYVB 4TPYA 2V6NA 5I46H 1Z1IA 2BD2A 2VWNA 4BXWA 2VVCA 3RP2A 2ZFPH 3UFAA 3BTDE 3QO6A 2P16A 1YCPH 1BTZA 2GCTB 3ZZDA 1DWBH 3M37A 3BV9B 2FLRH 4B1TA 4PROA 1TGTA 1V2OT 3W95A 4MLFB 3F9EA 1DVAH 1C1QA 2CV3A 2STAE 2ZHDA 3RDZA 5LPFA 1W3CA 4BAOB 2DE8A 4YM9A 3M35A 1C5ZB 4NFEA 1TE0A 1GJCB 1TYNA 1UTPA 1O3IA 2ZWLH 3CS0A 4ISIH 5JDUB 5A2MH 1K1JA 4BTIB 4Y8XA 4ISNA 3A8AA 1TX7A 3P95A 5F8TA 1EJAA 1P9UA 4HTCH 3IWMA 3P6ZB 3RXLA 3FFGA 2G5VA 1O2WA 1GMHG 1BTXA 2VH6A 2ZDMA 1UTQA 4RN6A 4YO9A 4B2AA 2M5TA 2P3TB 1O5BB 4X8SH 2QXJA 5E0HA 2VIVA 1C1PA 2GKVE 1KXDA 2CF9H 2A32A 4UONA 1TB6H 1TBZH 1TNKA 2D8WA 4ZXYH 3MI4A 5DG6A 4CR5A 2FOCA 2P3FH 3FVFB 1CGIE 1C2FA 1EOJA 1QBNA 5LPRA 1BTPA 2UWPA 1O35A 2ZECA 4Q7XA 4AG2A 1C1TA 1BJVA 2FWWA 3TH3H 5DK1A 1XVMA 1MTUA 1X7AC 1AMHA 1XXDA 1YYY1 5HMAA 4IN1A 1HAHH 2JKHA 2QAAA 3TPIZ 1QA0A 1EB2A 3RMOH 2BVXH 1NC6A 5ESTE 1BBRK 3ZZAA 1C5YB 4ABJA 5FHTA 1BDAA 2A7JA 2F9UA 1YLDA 2FODA 2KAIA 4ASHA 2O8LA 4ABIA 2B5TB 2ZGBH 3ATKA 2P8OB 1C2IA 1QBVH 5HM9A 3UTUH 1EOLA 2RDLA 5EW2H 3OYPA 1AKSA 2C93B 3AASA 2ASUB 1SLVB 1AWFH 3RXMA 3HKJB 1GMDF 1N6YA 1VGCB 3ZZ8A 1V2TT 1W12U 3RXTA 4FXGH 3VB5A 2Y81A 2ODPA 3KL6A 4DURA 2JH5D 3U1IB 1VZQH 1LO6A 1ELVA 3T2NA 1LVOA 1QURH 2D1JA 5C1YA 3D49H 1C1RA 1QRXA 1FUJA 4DIHH 1THSH 1WUNH 3TH4H 3Q77A 1BTUA 1GJ6A 4NSVA 4MPWA 1Z6EA 3SZNA 3BG8A 1ZMNA 2R3UA 1HYLA 5EGMA 1YPJH 4ISOA 3TIUA 3BIVH 1QTFA 3B23B 4ESTE 1WCZA 1GBCA 1V2KT 2FLBH 1MKWH 1ZMJA 1INCA 3LKWA 3EQ0H 2F9OA 2ZTXA 1K22H 1L1NA 1S5SA 1EATA 1RTFB 1UTOA 2BZAA 5HGGA 2GMTC 4CHAC 4YT7H 1SOZA 3GOVB 1WV7H 1GDQA 1QR3E 5DP8A 1O3OA 4BTTB 1V2VT 1V2JT 1IQLA 2Z3DA 4U2WA 1DUEA 1FZZA 1CT0E 3RXIA 3E1XB 2WYGA 2AMPA 3A82A 2OQUA 4KGAA 1MBQA 1TFXA 2AS9A 1NRPH 2DUCA 1LKBA 1GCTC 2EA3A 4OGYA 1V3XA 1IQFA 1NFYA 2G81E 1MD7A 1RIWB 2PKSB 3HGPA 2H5DA 1MMJN 2A4RA 4OGXA 1JWTA 2VGCC 1Y8TA 3A8BA 4LZ4B 3ZVFA 1C1NA 1KXFA 3VGCB 3RMNH 2FP7B 3PLPA 4DOQA 1UHBA 2BLWA 1F5LA 1YPHC 1QCPA 1A3EH 5DGJA 3GY5A 1HAIH 2AGGX 1SGNE 2PKAA 1S83A 4JZDH 2OQ5A 1GJ5H 2EC9H 2ZHFH 3MYWA 1NY22 5GWZA 1G3DA 3DHKH 2BQ7B 4INLA 2ZHQH 1NTPA 4I32A 1UK3A 4INHA 1H4WA 3EAJA 2GT7A 3EDXB 1HIAB 3PYHA 1F7ZA 2FIRH 2WPMS 4FUGA 4GAWA 2ZIQH 2XBXA 1ARCA 2WV5A 2V35A 3HK3B 3ZZ4A 4Y10E 1C2GA 1CBWC 4J2YB 1D9IA 2AMDA 1T8LA 2TGTA 3KGPA 4JCNA 3P8NA 3VEQB 1O2QA 3CENA 3PV4A 4YZUA 3VB7A 3SQHE 1Y5BT 4X8VH 1BRAA 1AE8H 1PQAA 2XC0A 3PWBA 2QXGA 2AEIH 1O2JA 1K28D 3T25A 3TGIE 2I6QA 4MQAA 1AQ7A 3RXRA 1O3BA 1PPHE 1KDQA 3SORA 2ALPA 1XMNB 4NSYA 1C5NH 1FQ3A 3O8BA 1UO6A 3QGJA 1G3BA 5G4BA 8GCHG 2A45B 1AI8H 3K2UA 3RXBA 1P2JA 2STBE 2NU1E 8GCHF 1UVOA 3S9BA 2FOFA 3PMHB 4HI3A 1HAXB 1HCGA 3RXGA 3SHAH 2SGFE 1IQHA 4K1TA 4XBCA 4RKOB 2DE9A 4E05H 4NFFA 3K9XB 4AX9H 2A4GA 4NA8A 2XRCA 2PV9B 3SBKA 2I6SA 2GTBA 3RXEA 2EI7A 3ESTA 3UOUA 1TABE 1P05A 1D3QB 3F9GA 4UFEH 4VGCC 3UQVA 2CXVA 5JBBS 1BBRE 3DFLA 1ELCA 3MNXA 2A5AA 1P10A 3RU4E 1GVZA 3URCA 1HBTH 1BMMH 1QJ1B 3RXOA 5A8YA 3LGVA 2H5CA 5EXMA 2PUQH 1MZDA 3VB6A 2Y5FA 3NZIA 1QQUA 1ZLRA 2F9PA 4K60A 8ESTE 4FU9A 3OTJE 1WU1A 3ZZCA 1ANDA 1O0DH 2D26C 1FJSA 1O2RA 2FM2A 1GBMA 2VWMA 1YGCH 1O3JA 1XUFA 5EPYA 1V2QT 4WXVA 3SU3A 1SQAA 1SOTA 1O2OA 3V12A 2ZC9H 2FS9A 1P2OA 1VITG 1GI1A 1B0FA 1MKXK 1AGJA 3KQDA 3S0NA 1SGDE 4TYDA 1PPCE 3UOPA 4B75A 4ZROA 5L30H 4XBDA 3RXKA 2O8WA 1QJ6B 2Y80A 2P94A 3M7TA 5FPYA 4CRAA 4HZHA 1GHXH 1ZHRA 3BTHE 3VB3A 2G00A 3D65E 2HNTC 4CRDA 4X1RU 2XCNA 5LH8A 1EXFA 1SGPE 1AHTH 1T8MA 1FMGA 1S82A 1E34B 3DFJA 3SGQE 4ABBA 1W8BH 1C5PA 3JZ1B 3T27A 1GBJA 1O3CA 2WUCA 1THRH 3ELAH 3H5CB 4FU8A 3QGNB 5JBAS 1AFEH 1FY5A 4THNH 3L33A 2SNVA 3RXAA 2J95A 3A83A 3F9FA 1A1RA 1QL9A 1IOEA 1IQMA 1TRYA 2SNWA 1A5IA 2GX4A 3A85A 1K1IA 1NRQH 1FIWA 1K1LA 4XE4A 1BRUP 1P8VC 2VU8E 1O2NA 1CHOG 4SGAE 3MH6A 1TBRH 1MBMA 3SNBA 9ESTA 1CSOE 2PSXA 2YOLA 4LK4A 1RTLA 1TLDA 1XUIA 1C5WB 4AFSA 3S7HB 3M7UA 1Y59T 1DITH 1N1LA 2H2ZA 1ZMLA 3MHWU 3OX7U 3M7QA 1SGCA 3RM2H 5CE1A 2GMTB 3LIWA 4CHAB 1ZYOA 1XM1A 4DCDA 3BEIB 1SGFA 1SQTA 1Q31A 4NA9H 2PTCE 4JZIA 4CBNA 1G2LA 3WY8A 1FY8E 1A5GH 1HV7A 1Z8JB 2WPHS 4BAQB 5K7RA 2ZF0H 5FX6A 4DVAU 3UUZA 1Y5AT 2G52A 1RS0A 4TY6A 4FUJA 1Y5UT 8LPRA 5AFZH 1XKAC 1GWAA 2WUBA 5A0BA 1BZXE 1GMCF 2ZFSA 3SUDA 1J16A 4R0IA 4Z0KA 1EJNA 1Z7KA 1SGQE 1AIXH 3AVZA 3E0PB 5FCKA 1DWDH 1DT2A 1KY9A 5E0GA 3STIA 3P70B 1LQEA 1V2PT 3SW2B 1GHAF 4Y8YA 1AO5A 3LH3A 3M5LA 4X8TH 1MUEB 4HFPB 1P2QA 1W13U 2QF0A 1NN6A 1AVGH 1J9CH 3RLWH 1GHWH 1YPKH 1MKXH 4A1TA 1TA6A 1ELAA 4X8UH 1ZTLA 1F0TA 1FONA 2QF3A 2ANWA 4DT7B 1DS2E 1O5EH 3ITIA 2BMGB 1JMOH 1O2HA 1CBWB 3FZDA 3LGYA 4X1PU 1AD8H 2UUJB 2XWBI 1TNLA 5AVDA 1O31A 1P2MA 2XCFA 3M5MA 4IS5A 4X6NA 2GD4B 2A5IA 2KAIB 3RM0H 1UMAH 1O3NA 1HLTH 4I33A 3U98H 2JETC 1AY6H 3GCNA 4I8HA 4I7YH 5T6FA 1GBHA 1DM4B 2ESTE 5FAHA 4OS1A 2HOBA 3RC5A 1P01A 2FS8A 2FI5E 1AKSB 3LGUA 2F9BH 3RXHA 1SL3A 1ESTA 4NCYA 1Y3UA 3NKKA 5A09A 1RTKA 3LT3A 2C4FH 4YOJA 1A3BH 1SGIB
chains in the Genus database with same CATH superfamily
5EU8A 2XNDD 2W7SA 3TK5A 2VIPA 2OBOA 1GHBG 3GY4A 1OSSA 1WDIA 1GI7B 1SVPA 1GGDC 4NA7A 3SN8A 4B2CA 2ZU1A 2BTCE 3LJJA 2ANMH 4AFZA 3GY7A 4M9FA 2OBQA 1O2IA 4JK6A 7KMEH 2Q6DA 2FOAA 1T4VH 1ESBA 3VPKA 1LHCH 1ANEA 3SNEA 3SV6A 1DE7H 4VGCB 3T26A 1FY3A 1AVWA 1T32A 1YKTA 3LC5A 1L1JA 3EE0B 1JRSA 2R0KA 3GDSA 3P8GA 1W14U 2WSSD 2B9LA 4XBBA 4KTSA 1O5AB 1DSTA 4I31A 4A1XA 2FX6A 4F48B 2G4UA 3GDVA 4XOJA 3E16B 1O2UA 6CHAC 1J14A 2GP9B 2XW9A 1PFXC 3BEUA 1FAKH 3N7OA 3VFEA 3RXQA 3SNAA 5C0TA 1D3DB 1KTTB 1GBFA 1MAYA 3LC3A 3SU5A 1N6XA 2NWNA 3ZZ5A 2AIQA 2ZU4A 1HJ8A 1N8OB 3D23A 1TMTH 4X6OA 4AFUA 3BG4C 4BAMB 3I77A 2EI6A 2W7UA 1D3PB 3KQEA 1VKYA 3OY5U 3ODDA 3PO1C 3LPRA 1AUTC 1LPZB 1O2MA 1FY4A 4JYVH 2O8UA 2J38A 1C2JA 3A7ZA 1UHBB 2H1UA 2SGDE 4HGCA 1ZPCA 2BD9A 3MO3A 2K1QA 2BXTH 1D6RA 1C1VH 4GSOA 2PKAB 1IQJA 3S9AA 1SFIA 3OY6U 3PRDA 1V2ST 1P2KA 4D7FA 2OTVA 2F83A 1AN1E 2BVRH 4ABGA 4B76A 5GXPA 2RA3A 2EY4C 2QF5A 1DWEH 1BTYA 1NM6A 3EGKH 1K2I1 4H6SB 8KME2 1O5FH 1G32B 1C5MD 1TONA 2IN2A 3TGKE 3LGIA 2ZDVH 1CA8B 2VIQA 3IITA 3GY2A 4ASUD 5B6LA 2Y82A 3GICB 1TGSZ 1UTKA 4K8YA 2V7QD 1O2LA 2YMSD 4DIIH 9LPRA 1C9PA 3GS9A 3GY6A 3SOSA 1KLJH 4D8NA 2Q6FA 1W11U 1MQ6A 3RC4A 1MTVA 3E3TA 1GMDG 1C2DA 1BTHH 1LHEH 5BPEA 2YNBA 4UD9H 2AERH 1JBUH 2PW8H 1UVUH 2WHXA 4DG4A 3ZZ6A 4I8JA 1KDQB 3EA9A 5A0CA 1GHVH 5E8EH 5ESBA 4BAHB 3MQKC 3KHVA 4Y6DA 1UVPA 3LJOA 1C4Y2 4ABDA 1BB0B 4ISHH 3ZZ3A 2HNTF 2PGBB 1TNGA 2PWXA 2JH6D 3M5OA 1P12E 3UNQA 1LHGH 1PPBH 3U1JB 1A5HA 3G01A 1YPHE 4YOGA 1EAUA 1F0RA 1K1PA 5H4IB 3OAAD 5JYIA 2OC7A 4K69A 2Z9JA 5B6OA 3AW1A 4HG6A 1QRWA 3W1EA 5L2YH 4IC5A 3ZYDA 2VIOA 3V3MA 1SHHB 1HXFH 1ANBA 1XKBC 1Z8RA 2FESH 2A7CA 3E90B 2XTTB 2HVYB 1LPKB 2R0LA 1GBIA 3RXUA 1F5KU 1Z8GA 2OINA 2Y7ZA 3FZZA 5C1UA 1DXPA 3RXFA 1V2RT 5DP6A 3P8FA 1C5UA 2OC1A 1RRKA 1GPZA 1QGFA 3CP7A 4IBLH 2Z9LA 3A7VA 2H9HA 2W3KA 5FL7D 2PR3A 3JZ2B 3RUOA 1PPFE 2W5EA 1FIZA 2ZQ1A 3A8CA 1CT4E 1LPGB 2SFAA 2ZCLP 2OC0A 5DKMA 4Y71A 1VCQA 1PYTC 4FVBA 4U32A 1EKBB 2Y5GA 1MABB 3TVJB 3R0FA 4NZQA 4P00A 2ZDAH 1G3CA 1HJAB 1MTSA 5KGOA 1SI5H 3PV5A 2ZU3A 4OS5A 4IC6A 3SJOA 4TWYA 1JIRA 1BRBE 2ULLA 4ZMAH 1A2CH 1Z71A 2BY8X 2P95A 2Z3EA 3BTTE 4D76A 1O3GA 1P09A 3U8RH 1DUAA 1ZJKA 4X2VA 1W7XH 1O5GH 3PMAB 1MCTA 2C8YB 4MNWA 4X0WU 1QBOA 3NUMA 1AFQB 4Z6AH 1EAXA 2O8TA 2GDEH 3MWIU 7ESTE 3PV2A 4MNYA 4NIWA 2UUYA 3FANA 3QZRA 3A84A 2JETB 4ZKSU 5TCCA 1GI0A 1BBRH 2XC4A 2YMSB 3B8JA 2TBSA 4K3JA 4X1SU 3RLYH 1VJ9U 1A0LA 1HAVB 2VBCA 1HRTH 1BRCE 1A0HB 1ZPBA 4XDEA 4ZHAA 2ZPRA 1ELTA 1BMAA 1F0SA 2QA9E 4H42U 1P57B 1SFQB 4LXBH 2OXSA 4ZCNA 3DSPA 1UVSH 2EI8A 3D62A 1TPPA 1S6HA 4OS2A 1LQDB 2BY9X 3SNCA 1DPOA 1YLNA 1CE5A 1OP8A 5DO4H 3UQOA 3SHCH 1IQIA 1UCYE 4KTCA 3GYMA 3QK1A 1GGDB 2V0BA 1BITA 4D7GA 1WQVH 4Z1MD 2ZZUH 1B7XB 5EQRA 3F0PA 1YM0A 1UJ1A 1IAUA 2VWLA 4H4FA 1GI9B 1O2GH 1SGEE 2QE7D 1VR1H 3RXVA 4D9QA 2BM2A 4ZXXH 5HM2A 1O2YA 3BTFE 5GCHF 2HRVA 3UREA 5EXNA 2GV6A 1GI5A 3QX5H 3FN8A 7GCHF 1PQ5A 3FO8D 2OCVB 3SU2A 3ZVAA 3ZVBA 2BLQA 3PWCA 4SGBE 1TOMH 3GCTF 1O3FA 2ZFRH 3KQCA 4Q80A 1EZQA 3RXJA 5C5NA 6CHAB 1QFKH 1AWHB 4IMZA 1SLXB 3QZQA 2TGDA 4GCHF 4YT6H 2VVUA 1GCDA 1V2WT 3CS7A 3Q76A 1ETTH 1PJPA 1HAGE 2PSYA 3HK6B 1O2TA 1P3EA 3BG4B 2GCHF 1TQ0B 1MAXA 5GNDA 2QN5T 1P11E 2KCOA 2WPJS 4MPVA 1GJ4H 3QDZB 3PO1B 2Q1JA 2FTLE 2TRMA 3U8TH 2XNIA 2UWOA 2C8ZB 1V6DA 4DT4A 2BYAX 2QY0B 2TGAA 3O8DA 1GDUA 2ZDKA 4CRBA 5F6MA 4YESB 2YNAA 1NO9H 1A61H 2OC8A 4MPXA 1C4V2 1C1MA 1QZ8A 5FX5A 1GBEA 1Z1JA 3K65B 1J8AA 1THPB 2ZQ2A 5HIZA 2FTMA 1ELFA 1SB1H 4X2XA 1TAWA 3I29A 1QA7A 5EG4A 2QGRA 2PTNA 4Q4LA 5EJ1A 5DPAA 1W0KD 4I8LA 5DJ7A 4GPGA 2FEQH 3C27B 1DANH 5C67A 3MMGA 4YLQH 3UY9A 2ZKSA 3ZVCA 5FCRA 1TIOA 3ZV8A 1PPGE 1DWCH 2HALA 4JZEH 4JYUH 5GPIB 4MTBA 1EX3A 1Q3XA 5DP3A 1DFPA 4UFFH 1FXYA 4MVNA 2IOTA 2ZEBA 2FI3E 3QN7A 1GL0E 2A0QB 1KSNA 3V0XA 1V2UT 1UK4A 2ODYB 2A4OA 1BUIA 1H9HE 1BHXB 4DJZB 3NCLA 2L74A 2QXIA 1TA2A 3MU8A 1AB9C 3Q3KA 3OFND 2VH0A 1LVYA 1WQSA 5TCAA 1NRNH 2ZO3H 4X1QU 1ZTJA 2FI4E 3FAOA 2LNCA 1FN8A 2XBYA 2BX3A 4OS4A 4MNXA 2ZA5A 1TMUH 1OX1A 3MTYA 3DA9B 2ZCKP 1BCUH 1J15A 4INKA 4CH8B 1TALA 2FMJA 4RSPA 3SO3A 1O5CB 1DLEA 2PGQB 1OYTH 1NROH 1A7SA 3DCLA 4ZHLU 4CH2B 2QIQA 1HGTH 2ZGCA 1ARBA 1C1OA 1MTNC 4BANB 1LVBA 2A2QH 2FX4A 1RXPA 1Z8IB 4AN7A 4AB8A 2QCYA 3P17H 3Q3XA 4A5TS 1GVKB 2UUKB 1NS3A 1JRTA 4CRGA 1C2MA 2A31A 3MNSA 1FI8A 2WV4A 4JZ1A 2IPHA 1IQEA 2ZPQA 1RJXB 3FOAA 3UNRA 1S6FA 4TPIZ 1AZ8A 3SGBE 1Z6JH 1P2IA 1S0RA 2BZ6H 2ZU5A 3ZV9A 4CRFA 2NU2E 1BHXF 2AYWA 2ZG0H 3MO6A 3EA7A 1OKXA 3LGTA 1VITH 1FV9A 1ORFA 4K1EA 4B6FA 4CBOA 1GJ7B 1C2EA 2CGAA 5A8XA 1TGCA 2GVFA 2W6JD 1GCTB 4AG1A 3MFJA 4AGKA 3MO9A 1G30B 1GMCG 3RC6A 2CJIA 2ZNKH 3KN2A 2BY5X 3DD2H 1BMNH 3TH2H 3LOXA 4WY3A 2VGCB 1ID5H 1BQYA 1GBDA 1OWKA 1TRNA 3ENSB 1IQGA 4X6MA 3A7XA 1EUFA 4O03A 4FUEA 1ABIH 4WVPE 4NIVA 1S84A 1GHAG 3UNSA 4F49A 1SQOA 1EP6A 1DX5M 3SJKA 3MU1A 1EB1H 3FKSD 4KELA 4FVDA 2HWLB 4NWKA 1VCWA 1F92A 2A1DB 3QTVH 1E1QD 4DGJA 1O39A 2ZFQH 1J17T 2ZI2H 2CN0H 3DUXH 2FOBA 3IG6B 2ZFFH 2AGEX 2TGPZ 3MH4A 3VXFH 4AORA 3M3VA 2VJ1A 5A8ZA 2CMYA 3GISB 3S7KB 1SLWB 3QLPH 3GCHC 2TIOA 1T31A 4KKDA 5IDKA 3TJVA 3UPEA 3PMBB 3VGCC 4AFQA 3CNRA 3E91A 1KLIH 1L2EA 4TWWA 3OSYA 2EEKA 3GDUA 4FU7A 1DLKB 4AC9A 3ATWA 1P9SA 3LH1A 4Y79A 2C3SA 1E37B 4UEHH 5C17A 1GI4A 4ISLA 5T6DA 1D3TB 4MNVA 3VG8A 1KLTA 1F0UA 1ZOMA 1F2SE 3AAUA 3H7OA 2BOKA 3NK8A 1SC8U 2ZFTA 2G51A 4A7IB 6GCHF 5GJ4B 2BD5A 5FPTA 4BTUB 2F9NA 1D6WA 5HXFA 1ELEE 4K1SA 1ACBE 1V2LT 2IJOB 3BTEE 4AYYB 1TX8A 3SU6A 1W2KH 1S81A 4GHQA 1TNJA 4O97A 5KEDA 4AGJA 3F2GA 1L1GA 1IQKA 2J9NA 1JOUB 3W94A 5IYTA 3KF2A 3ATIA 2UWLA 5JB9S 4IGDA 1NFWA 3OU0A 3ZZ9A 1MH0A 1O3DA 3QTOH 1GJAB 1CA0C 4A6LA 2CHAC 2GDDA 3MU5A 4I8GA 2SGPE 1RFNA 2ANYA 4WH8A 1GVLA 1UTJA 4Q7ZA 5DN6D 4Q63A 3F2FA 2V3OH 3NRLA 1NFXA 3TJOA 2VINA 4IMQA 3BN9A 4Y11E 1Y3XA 3TGJE 1CU1A 3SJ9A 2VWOA 3QUMP 1DY9A 1UTNA 2Z94A 3GY3A 4H6TA 5EODA 3BTKE 1GBLA 1O3EA 3UAIC 5C94A 3SU4A 1S6LA 1MKWK 1EAWA 2P3UB 2XWAA 3Q00A 1SLUB 3RXSA 2WPKS 3PM3A 4LZ1H 2WPIS 3KEEA 1XVOA 1GG6C 4XFQA 1UCYK 1YPLH 3T29A 1T8OA 2O8MA 2WYJA 5DP7A 1C9TA 4OS7A 5DP5A 4NG9H 4I86A 5FBIA 3SYJA 2HPQH 5F53A 2ZGHA 3BSQA 3M3TA 1ZPZA 3L3TA 4K5ZA 4FUIA 3OTPA 1K0HA 4KP0A 2FYQA 2B8OH 5DSFA 3SV8A 1GMHF 5AF9H 3HKIB 1DY8A 2Z9IA 2ZU2A 1QHRB 3F6UH 1O3LA 4RI0A 1CGJE 1W0YH 1TGNA 1WOFA 1E36B 1O33A 1WYKA 3SZEA 1MTWA 3V7TA 1H8IH 3M36A 1EASA 4GUXA 3SU0A 6LPRA 1OWIA 3VXEH 3SI4H 2Q6GA 3BTGE 1WSSH 1K1MA 1YBWA 4ZUHA 2FOHA 1ABJH 4A92A 3M5NA 1GJ9B 3T5FH 4U30A 4IW4E 1TPSA 2H9EH 4ACAA 1P06A 1DSUA 2EQNA 5E2OA 1TOCB 1EPTA 1ESAA 3TU7H 1O36A 1AB9B 1C2HA 1XX9A 1LVMA 1VJAU 2HVXA 1BT7A 2BDHA 1MU6B 2W3IA 3SNDA 1RGQA 3KYGA 4K2YA 2G8TA 4WXIA 2F43B 1O38A 3QWCH 3C1KA 4OS6A 1AUJA 4B71A 5FXLA 3SQEE 3F1SB 2Z9KA 1XUGA 3F3BA 1PQ7A 2GV7A 2GZ9A 2XC5A 4MDSA 5EPNA 4WH6A 1H8HD 1C5OH 2OD3B 1C5SA 2ALVA 1O3PB 5SGAE 1MTNB 5ETXA 5CMXH 3AW0A 2V3HH 2OUAA 1ELGA 1S0QA 2Y6TA 1GI2A 1K1NA 3TLOA 4ABAA 2XXLA 1O2ZA 1GJDB 2ZP0H 2HLCA 3P8OA 5GIBA 1WBGB 2G4TA 3TK9A 2LPRA 3SUFA 3BIUH 1DDJA 1FPHH 1EP5A 4D9RA 1PPEE 4NIXA 1P04A 1FY1A 2A7HA 1P2NA 1A0JA 1SGRE 3H09A 4BOHA 3NXPA 2PUXB 1ZSJA 3SV2H 1YCPM 1XUKA 1IHSH 3O8RA 2BVSH 1TRMA 1C1WH 1K9OE 5EQQA 4XRNA 2WV9A 4GVUA 2LELA 4WMDA 1HUTH 2G5NA 4CR9A 3A86A 1YY3A 4Y7BA 1TPAE 2J2UA 1OWDA 1O2PA 1FNIA 1C1SA 2BD4A 1E38B 3A7TA 1NZQH 1O37A 3B9FH 1LCYA 5EXLA 1QL7A 3F68H 2FPZA 1SKYE 1HNEE 4X2YA 5JB8S 2ZGXH 5FPSA 5J4SA 4ABEA 4FUCA 4XSKU 2WZQA 1SG8B 3ZVEA 1YPEH 2PP6A 2PHBA 1GBTA 3TJNA 3T62A 1EJMA 2B0FA 2NU0E 1DOJA 3PB1E 4ZAEA 5K0HA 5EJLA 7LPRA 1JIMA 1UCYH 1K1OA 4FUBA 5CHAC 1GJ8B 2G55A 1SHYA 2UUFB 4F4OC 1NT1A 1SSXA 1FN6A 3BEFB 1CO7E 2BD8A 5EQSA 1QJ7B 5L6NH 5JBCS 2P59A 5C5OA 1GI6A 1PPZA 1W0ZU 2QV1A 2PFEA 3MOCA 1YC0A 1B5GH 3LDXH 4AZ2B 4DW2U 1EZUC 2BDIA 1C5XB 4ABFA 1LDTT 2GT8A 1KXEA 3GCHB 2TPIZ 1EZXC 3LGWA 3U69H 3K6YA 1OP2A 1U6QA 3Q3YA 4ACBA 2BDCA 3A81A 1Q2WA 1Y3WA 1GBKA 4FUFA 3LONA 3EE7A 1P0SH 1NRSH 1CQQA 3MU4A 2HGTH 1ETSH 2R9PA 4GLYA 2FZZA 2B7DH 2BDGA 3SUEA 3F2HA 1UTLM 1FPCH 3OEHD 1L4ZA 4Q2KA 3TNSA 3WW7A 1EPTC 4DY7B 2BQWB 5J4QA 1O3AA 1PQ8A 2P93A 1KMHB 5LPEA 2RA0A 4GHTA 4JYTA 3ATLA 1NRRH 4AOQA 2C8WB 1HJ9A 1C5QA 1HAZB 1KYNA 5JBTA 4O9VA 4Q7YA 3MH7A 5PTPA 1D4PB 1EZSC 1ZRBA 4O3TA 2AGIX 5T3HA 1HB0B 3ZVDA 1GBBA 1CHGA 1SBWA 4CREA 1ZSKA 1YLCA 1E1RD 3EYDA 1QIXB 5GCHG 2ANKH 3KQBA 1CA0B 2CHAB 2M2AA 2SGEE 3U9AH 1H9LB 1F5RA 4B73A 1LTOA 3SUGA 2A5KA 1KXBA 1DXWA 2J97A 1MZAA 7GCHG 4IN2A 4E06H 2QC2A 1NU7B 2BOHB 4YOIA 1UVTH 3TNTA 2Z3CA 3FP8E 1HDTH 2BLOA 3GCTG 4WMFA 1O3KA 1A46H 2J4IA 2QXHA 4U01A 2ODQA 1ZGVA 3RMMH 2VIDA 1V2NT 1O2VA 2HNTE 3I78A 1HAOH 1QY6A 4NWLA 4GCHG 1E0FD 1SR5C 1C1UH 1CT2E 1OOKB 2OLGA 4BXSA 1C5VA 2R2WU 2GCHG 1GG6B 2GCTC 3HGNA 3GY8A 3RXDA 2ZHWH 3H7TA 3BTME 3KIDU 5EOKA 1OXGA 2BY6X 1W10U 1IHTH 4WJG2 3U8OH 1FAXA 4UFDH 1SGTA 1P3CA 4KTUA 5E0JA 2BDYA 4JZFH 1PYTD 4Y8ZA 1HAPH 4Y0ZE 1XXFA 1AE5A 2BQ6B 2ZTZA 1VCPA 2VVVA 4ZKRU 4NZLA 3E0NB 1SMFE 1HPGA 1V2MT 2Y7XA 1FDPA 1M9UA 1OWJA 4Y0YE 1L0ZA 2J34A 1KXAA 2R2MB 1BJUA 4WMEA 1HAYB 2O9QA 3LU9B 4X6PA 1SGFG 3NPSA 3UWIA 1ELDE 1CVWH 1QNJA 3UWJH 1LKAA 3VB4A 3V13A 2H6MA 3A7YA 1TQ7B 1C5LH 4B2BA 4A1VA 5BRRE 1WTGH 3RXCA 2RG3A 4UE7H 4WWYA 1N8OC 3PLKA 3TJUA 4UFGH 1E35B 2OP9A 1BOQA 1WAYB 3R3GB 1ANCA 2VIWA 1G36A 2FO9A 2RCEA 3A88A 5F8ZA 1BTWA 1T8NA 2ZCHP 2W26A 1QB6A 2ZPSA 2C8XB 4MPUA 1GBAA 2H9TH 1HFDA 5L2ZH 1ETRH 2FXRA 3S69A 2RDEA 5C20A 4UDWH 4BNRA 3UR9A 4J1YA 1VITF 2PLXA 1AVXA 2J94A 1TNIA 3L6PA 1QB1A 1H1BA 2D2DA 1QRZA 2QYIA 2Z7FE 3MNBA 2SGAA 3GCOA 2JJ2D 4CRCA 3M61U 3SJ8A 1NESE 2FDAA 4Y7AA 3ODFA 3HATH 2GGVB 3MNCA 2AIPA 1C2LA 3SI3H 5C3NA 1HIAA 1QB9A 2F3CE 1NPMA 2CK3D 4TY7A 1SGYE 5AHGH 1KTSB 2ZTYA 3GYLB 4FUHA 2L6OA 1HAVA 3BTQE 4NIYA 4FUDA 1UK2A 2J92A 1ZHMA 3O8CA 2BB4A 5DP4A 3T28A 2XYAA 4ZH8A 1H8DH 1S85A 1QQ4A 3RMLH 1G3EA 1MCVA 2C90B 1G37A 1O34A 1SPJA 2P8OC 5C2ZA 3KNXA 4QT8C 1LHDH 1YP9A 1W0JD 1EAIA 1ELBA 3DT0H 1WTHD 3NWUA 4B74A 4E7RG 1OP0A 3E8LA 1AZZA 3K6ZA 2BDAA 2GZ8A 3AAVA 4LOYH 1ZSLA 4E7NA 1Y3YA 2JJ1D 4O3UA 4YLUA 5GDSH 2GZ7A 2AFQB 2ILNA 1VGCC 1TPOA 1YPGH 1OYQA 1OWEA 2FOGA 4YTAA 3SU1A 2FYRA 2BD7A 3PLBA 5I25A 5F8XA 2IPQX 3UIRA 3F9HA 1CHOF 2VNTA 1TX6A 1YCPK 1G2MA 3FP7E 2ZHEH 3BTWE 1NU9A 3TITA 2HLDD 2ZDLA 5T6GA 1BMLA 2Y5HA 1GI8B 2NU4E 1C4U2 3ZZ7A 2J98A 1TBQH 1ZHPA 2RFKC 1JXPA 5JPMH 3S9CA 1OHHD 1ZTKA 5CHAB 2R3YA 4Y76A 4BAKB 1GDNA 3HPTB 3EA8A 1ZR0A 5IK2D 3A80A 5A0AE 2SGQE 5AFYH 3URDA 5C1XA 1GHYH 1TGBA 1XUJA 3STJA 2HPPH 2WINI 1CGHA 3RU4T 1MU8B 1O3HA 2BHGA 2THFB 5DP9A 5EW1H 1L4DA 1GI3A 1SQRA 2BD3A 1ZGIA 4ZKNU 3SGAE 1NFUA 1OS8A 1W7GH 4R8TB 1O2SA 2AMQA 3ZYEA 1MD8A 2F91A 1LHFH 1O2XA 1GJBB 3MU0A 4K8BA 5E2PA 2BLVA 1K21H 1GL1A 3ZZBA 1P02A 1G9IE 1KIGH 1ZRKA 3MH5A 3RXPA 3SV7A 3FP6E 3KCGH 2BDBA 3PTNA 5F03A 3BF6H 3A8DA 3E6PH 1RD3B 3TK6A 3ZVGA 1RIWC 2PKSC 3A89A 4JK5A 1HJAC 2AH4X 3SV9A 4ZHMU 1B0EA 3N7EA 1O32A 1DICA 2BX4A 1P03A 2ZDNA 1Y3VA 2ZGJA 4M7GA 1OPHB 1BIOA 4MG3A 1EPTB 4JMYA 2XBVA 1LMWB 4ZKOU 1KXCA 3ATMA 4ABHA 2KX4A 3A7WA 4AB9A 3WWFA 1BMFD 1T4UH 3PMJA 2JDID 5ABWA 5HYOA 1XUHA 1AFQC 2FOMB 4WF8A 2XBWA 6ESTA 1OWHA 1GHZA 3M3SA 1BA8B 2JH0D 3P92A 1O3MA 4FOUC 5TJXA 1O5DH 3SJIA 6GCHG 5LGOA 1MQ5A 2Z9GA 1E79D 1C2KA 1TMBH 3RU4D 1H9IE 4XD7D 1EQ9A 1A4WH 1AU8A 1ZJDA 1YPMH 1O30A 2A4QA 4X2WA 1O2KA 2FOEA 4NGAH 1HXEH 1YF4A 1C5RA 2CF8H 2AHME 2NU3E 3PTBA 4X1NU 2VB0A 5FBEA 3PROA 1QL8A 1TWXB 1FLEE 1C5TA 1IQNA 1ZZZA 1UTMA 3A87A 2A2XH 2BY7X 2BXUH 4RKJB 4I8KA 3UR6A 2F9VA 1T7CA 2Z6BD 1GHBF 2WPLS 1TNHA 4AYVB 4TPYA 2V6NA 5I46H 1Z1IA 2BD2A 2VWNA 4BXWA 2VVCA 3RP2A 2ZFPH 3UFAA 3BTDE 3QO6A 2P16A 1YCPH 1BTZA 2GCTB 3UB0A 3ZZDA 1DWBH 3M37A 3BV9B 2FLRH 4B1TA 4PROA 1TGTA 1V2OT 3W95A 4MLFB 3F9EA 1DVAH 1C1QA 2CV3A 2STAE 2ZHDA 3RDZA 3DSOA 5LPFA 1W3CA 4BAOB 2DE8A 4YM9A 3M35A 1C5ZB 4NFEA 1TE0A 1GJCB 1TYNA 1UTPA 1O3IA 2ZWLH 3CS0A 4ISIH 5JDUB 1COWD 5A2MH 1K1JA 4BTIB 4Y8XA 4ISNA 3A8AA 1TX7A 3P95A 5F8TA 1EJAA 1P9UA 4HTCH 3IWMA 3P6ZB 3RXLA 1UW7A 3FFGA 2G5VA 1O2WA 1GMHG 1BTXA 2VH6A 2ZDMA 5EIYA 2QF4A 1UTQA 4RN6A 2WPDD 1EFRD 4YO9A 4B2AA 2M5TA 2P3TB 1O5BB 4X8SH 2QXJA 5E0HA 2VIVA 1C1PA 2GKVE 1KXDA 2CF9H 2A32A 4UONA 1TB6H 1TBZH 1TNKA 2D8WA 4ZXYH 3MI4A 5DG6A 4CR5A 2FOCA 2P3FH 3FVFB 1CGIE 1C2FA 1EOJA 1QBNA 5LPRA 1BTPA 2K8IA 2UWPA 1O35A 2ZECA 4Q7XA 4AG2A 1C1TA 1BJVA 2FWWA 2KCPA 3TH3H 2W6ID 5DK1A 1XVMA 1MTUA 1X7AC 1AMHA 1XXDA 3KQ5A 1YYY1 5HMAA 4IN1A 1HAHH 2JKHA 2QAAA 3TPIZ 1QA0A 1EB2A 3N7DA 3RMOH 2BVXH 1NC6A 5ESTE 1BBRK 2J5UA 3ZZAA 1C5YB 4ABJA 5FHTA 2KM0A 1BDAA 2A7JA 2F9UA 1YLDA 2FODA 3AK5A 2KAIA 4ASHA 2O8LA 4ABIA 2B5TB 2ZGBH 3ATKA 2P8OB 1C2IA 1QBVH 2F4LA 5HM9A 3UTUH 1EOLA 2RDLA 5EW2H 3OYPA 1AKSA 2C93B 3AASA 2ASUB 1SLVB 1AWFH 1NBMD 3RXMA 3HKJB 1GMDF 1N6YA 1VGCB 3ZZ8A 1V2TT 1W12U 3RXTA 4FXGH 3VB5A 2Y81A 2ODPA 3KL6A 3OEED 4DURA 5KECA 2JH5D 3U1IB 1VZQH 1LO6A 1ELVA 3T2NA 1LVOA 1QURH 2D1JA 5C1YA 3U28C 3D49H 1C1RA 1QRXA 1FUJA 4DIHH 1THSH 1WUNH 3TH4H 3Q77A 1BTUA 1GJ6A 4NSVA 4MPWA 1Z6EA 3SZNA 3BG8A 1ZMNA 2R3UA 1HYLA 5EGMA 1YPJH 4ISOA 3TIUA 3BIVH 2GJGA 1QTFA 3B23B 4ESTE 1WCZA 1GBCA 1V2KT 2FLBH 1MKWH 1ZMJA 1INCA 3LKWA 3EQ0H 2F9OA 2ZTXA 1K22H 1L1NA 1S5SA 1EATA 1RTFB 1UTOA 2V3MA 2BZAA 5HGGA 2GMTC 4CHAC 2OK5A 4YT7H 1SOZA 3GOVB 1WV7H 1GDQA 1QR3E 5DP8A 1O3OA 4BTTB 1V2VT 1V2JT 1IQLA 2Z3DA 4U2WA 1DUEA 1FZZA 1CT0E 3RXIA 3E1XB 2WYGA 2AMPA 3A82A 2OQUA 4KGAA 1MBQA 1TFXA 2AS9A 1NRPH 2DUCA 1LKBA 1GCTC 2EA3A 4OGYA 1V3XA 1IQFA 1NFYA 2G81E 1FX0B 1MD7A 1RIWB 2PKSB 3HGPA 2H5DA 1MMJN 2A4RA 4OGXA 1JWTA 2VGCC 1Y8TA 3A8BA 4LZ4B 3ZVFA 1C1NA 1KXFA 3VGCB 3RMNH 2FP7B 3PLPA 4DOQA 1UHBA 2BLWA 1F5LA 1YPHC 1QCPA 1A3EH 5DGJA 3GY5A 4B6EA 1HAIH 2AGGX 1SGNE 2PKAA 1S83A 4JZDH 2OQ5A 1GJ5H 2EC9H 2ZHFH 3MYWA 1NY22 5GWZA 1G3DA 3DHKH 2BQ7B 4INLA 2ZHQH 1NTPA 4I32A 1UK3A 4INHA 1H4WA 3EAJA 2GT7A 3EDXB 1HIAB 3PYHA 1F7ZA 2FIRH 2WPMS 4FUGA 4GAWA 2ZIQH 2XBXA 1ARCA 2WV5A 2V35A 3HK3B 3ZZ4A 5CDFE 4Y10E 1C2GA 1CBWC 4J2YB 1D9IA 2AMDA 5HKKD 4FETA 1T8LA 2TGTA 3KGPA 4JCNA 3KYFA 3P8NA 3VEQB 1O2QA 3CENA 4TSFD 3PV4A 4YZUA 3VB7A 3SQHE 1Y5BT 4X8VH 1BRAA 1AE8H 1PQAA 2XC0A 3PWBA 2QXGA 2AEIH 1O2JA 1K28D 3T25A 3TGIE 2I6QA 4MQAA 1AQ7A 3RXRA 1O3BA 1PPHE 5T1VA 3F0OA 1KDQA 3SORA 2ALPA 1XMNB 4NSYA 1C5NH 1FQ3A 3O8BA 1UO6A 3QGJA 1G3BA 5G4BA 4RT1A 8GCHG 2A45B 1AI8H 3K2UA 4RT0A 3RXBA 1P2JA 2STBE 2NU1E 8GCHF 1UVOA 3S9BA 2FOFA 3PMHB 4HI3A 1HAXB 1HCGA 3RXGA 3SHAH 2SGFE 1IQHA 4K1TA 4XBCA 2J98B 2DE9A 4RKOB 4E05H 4NFFA 2IJD1 1YWUA 3K9XB 4AX9H 2A4GA 4NA8A 2XRCA 2PV9B 3SBKA 2I6SA 4TT3D 2GTBA 2K0QA 3RXEA 2EI7A 3ESTA 3UOUA 1TABE 1P05A 1D3QB 3F9GA 4UFEH 3OE7D 4VGCC 3UQVA 1H8ED 2CXVA 5JBBS 1BBRE 3DFLA 1ELCA 3MNXA 2A5AA 1P10A 3RU4E 1GVZA 3URCA 1HBTH 1BMMH 1QJ1B 3RXOA 5A8YA 3LGVA 2H5CA 5EXMA 2PUQH 1MZDA 3VB6A 2Y5FA 3NZIA 1QQUA 1ZLRA 2F9PA 4K60A 8ESTE 4FU9A 3OTJE 1WU1A 5EJZA 3ZZCA 1ANDA 1O0DH 2D26C 1FJSA 1O2RA 2FM2A 1GBMA 2VWMA 1YGCH 1O3JA 1XUFA 5EPYA 1V2QT 4WXVA 3SU3A 1SQAA 1SOTA 1O2OA 3V12A 2ZC9H 2FS9A 1P2OA 1VITG 1GI1A 1B0FA 1MKXK 1AGJA 3KQDA 3S0NA 1SGDE 4TYDA 1PPCE 3UOPA 4B75A 4ZROA 5L30H 4XBDA 3RXKA 2O8WA 1QJ6B 3PRBA 2Y80A 2P94A 3M7TA 5FPYA 4CRAA 4HZHA 1GHXH 1ZHRA 3BTHE 3VB3A 2G00A 4P02A 3D65E 2HNTC 4CRDA 4X1RU 2XCNA 3ZIAD 5LH8A 1EXFA 1SGPE 1AHTH 1T8MA 1FMGA 1S82A 1E34B 3DFJA 3SGQE 2LP6A 4ABBA 1W8BH 1C5PA 3JZ1B 3T27A 1GBJA 1O3CA 2WUCA 1THRH 3ELAH 3H5CB 4FU8A 5CHBA 3QGNB 5JBAS 1AFEH 1FY5A 4THNH 3L33A 2SNVA 3RXAA 2J95A 3A83A 3F9FA 1A1RA 1QL9A 1IOEA 1IQMA 1TRYA 2SNWA 1A5IA 2GX4A 3A85A 1K1IA 1NRQH 1FIWA 1K1LA 4XE4A 1BRUP 1P8VC 2VU8E 1O2NA 1CHOG 4SGAE 3MH6A 1TBRH 1MBMA 3SNBA 9ESTA 1CSOE 2PSXA 2YOLA 4LK4A 1RTLA 1TLDA 1XUIA 1C5WB 2KZ4A 4AFSA 3S7HB 3M7UA 1Y59T 5HIYA 1DITH 1N1LA 2H2ZA 1ZMLA 3MHWU 3OX7U 3M7QA 1SGCA 3RM2H 5CE1A 2GMTB 3LIWA 4CHAB 1ZYOA 1XM1A 4DCDA 3BEIB 1SGFA 1SQTA 1Q31A 4NA9H 2PTCE 4JZIA 4CBNA 1G2LA 3WY8A 1FY8E 1A5GH 1HV7A 1Z8JB 2WPHS 4BAQB 5K7RA 2ZF0H 5FX6A 4DVAU 3UUZA 1Y5AT 2G52A 1RS0A 4TY6A 4YXWD 4FUJA 1Y5UT 8LPRA 5AFZH 1XKAC 1GWAA 2WUBA 5A0BA 2JIZD 1BZXE 3WWBA 1GMCF 2ZFSA 3SUDA 1NBME 1J16A 4R0IA 4Z0KA 1EJNA 1Z7KA 1SGQE 3N99A 1AIXH 3AVZA 4OM9A 3E0PB 5FCKA 1DWDH 1DT2A 1KY9A 5C0UA 5E0GA 3STIA 3P70B 1LQEA 1V2PT 3SW2B 1GHAF 4Y8YA 1AO5A 3LH3A 3M5LA 2XOKD 4X8TH 1MUEB 4HFPB 1P2QA 1W13U 2QF0A 1NN6A 1AVGH 1J9CH 3RLWH 1GHWH 1YPKH 1MKXH 4A1TA 1TA6A 1ELAA 4X8UH 1ZTLA 1F0TA 1FONA 2QF3A 2ANWA 4DT7B 1DS2E 1O5EH 3ITIA 2BMGB 1JMOH 1O2HA 1CBWB 3FZDA 3LGYA 4X1PU 1AD8H 2UUJB 2XWBI 1TNLA 5AVDA 1O31A 1P2MA 2XCFA 3M5MA 4IS5A 2KR7A 4X6NA 2GD4B 2A5IA 2KAIB 3RM0H 1UMAH 1O3NA 1HLTH 4I33A 3U98H 3DSGA 2JETC 1AY6H 2YMSC 3GCNA 4I8HA 1WXRA 4I7YH 5T6FA 1GBHA 1DM4B 2ESTE 5FAHA 4OS1A 2HOBA 3RC5A 1P01A 2FS8A 2FI5E 1AKSB 3LGUA 2KCAA 2F9BH 3RXHA 1SL3A 1ESTA 4NCYA 1Y3UA 2KFWA 3NKKA 4F55A 5A09A 1RTKA 3LT3A 2C4FH 4YOJA 1A3BH 2KCYA 1SGIB
chains in the Genus database with same CATH topology
5EU8A 2W7SA 3TK5A 2VIPA 2OBOA 1GHBG 3GY4A 1OSSA 1GI7B 1SVPA 1GGDC 4NA7A 3SN8A 4B2CA 2ZU1A 2BTCE 3LJJA 2ANMH 4AFZA 3GY7A 2OBQA 1O2IA 4JK6A 7KMEH 2Q6DA 2FOAA 1T4VH 1ESBA 3VPKA 1LHCH 1ANEA 3SNEA 3SV6A 1DE7H 4VGCB 3T26A 1FY3A 1AVWA 1T32A 1YKTA 3LC5A 1L1JA 3EE0B 1JRSA 2R0KA 3GDSA 3P8GA 1W14U 2B9LA 4XBBA 4KTSA 1O5AB 1DSTA 4I31A 4A1XA 2FX6A 2G4UA 3GDVA 4XOJA 3E16B 1O2UA 6CHAC 1J14A 2GP9B 2XW9A 1PFXC 3BEUA 1FAKH 3N7OA 3VFEA 3RXQA 3SNAA 1D3DB 1KTTB 1GBFA 1MAYA 3LC3A 3SU5A 1N6XA 2NWNA 3ZZ5A 2AIQA 2ZU4A 1HJ8A 1N8OB 3D23A 1TMTH 4X6OA 4AFUA 3BG4C 4BAMB 3I77A 2EI6A 2W7UA 1D3PB 3KQEA 3OY5U 3ODDA 3PO1C 3LPRA 1AUTC 1LPZB 1O2MA 1FY4A 4JYVH 2O8UA 2J38A 1C2JA 3A7ZA 1UHBB 2H1UA 2SGDE 4HGCA 1ZPCA 2BD9A 3MO3A 2K1QA 2BXTH 1D6RA 1C1VH 4GSOA 2PKAB 1IQJA 3S9AA 1SFIA 3OY6U 1V2ST 1P2KA 4D7FA 2OTVA 2F83A 1AN1E 2BVRH 4ABGA 4B76A 5GXPA 2RA3A 1DWEH 1BTYA 1NM6A 3EGKH 1K2I1 4H6SB 8KME2 1O5FH 1G32B 1C5MD 1TONA 2IN2A 3TGKE 3LGIA 2ZDVH 1CA8B 2VIQA 3IITA 3GY2A 2Y82A 3GICB 1TGSZ 1UTKA 4K8YA 1O2LA 4DIIH 9LPRA 1C9PA 3GY6A 3SOSA 1KLJH 4D8NA 2Q6FA 1W11U 1MQ6A 3RC4A 1MTVA 3E3TA 1GMDG 1C2DA 1BTHH 1LHEH 5BPEA 2YNBA 4UD9H 2AERH 1JBUH 2PW8H 1UVUH 4DG4A 3ZZ6A 4I8JA 1KDQB 3EA9A 5A0CA 1GHVH 5E8EH 5ESBA 4BAHB 3KHVA 4Y6DA 1UVPA 3LJOA 1C4Y2 4ABDA 1BB0B 4ISHH 3ZZ3A 2HNTF 2PGBB 1TNGA 2PWXA 2JH6D 3M5OA 1P12E 3UNQA 1LHGH 1PPBH 3U1JB 1A5HA 3G01A 1YPHE 4YOGA 1EAUA 1F0RA 1K1PA 5H4IB 5JYIA 2OC7A 4K69A 2Z9JA 5B6OA 3AW1A 1QRWA 5L2YH 4IC5A 3ZYDA 2VIOA 3V3MA 1SHHB 1HXFH 1ANBA 1XKBC 1Z8RA 2FESH 2A7CA 3E90B 2XTTB 1LPKB 2R0LA 1GBIA 3RXUA 1F5KU 1Z8GA 2OINA 2Y7ZA 3FZZA 5C1UA 1DXPA 3RXFA 1V2RT 5DP6A 3P8FA 1C5UA 2OC1A 1RRKA 1GPZA 1QGFA 3CP7A 4IBLH 2Z9LA 3A7VA 2H9HA 2W3KA 2PR3A 3JZ2B 3RUOA 1PPFE 2W5EA 1FIZA 2ZQ1A 3A8CA 1CT4E 1LPGB 2SFAA 2ZCLP 2OC0A 5DKMA 4Y71A 1VCQA 1PYTC 4FVBA 4U32A 1EKBB 2Y5GA 3TVJB 3R0FA 4NZQA 2ZDAH 1G3CA 1HJAB 1MTSA 1SI5H 2ZU3A 4OS5A 4IC6A 3SJOA 4TWYA 1JIRA 1BRBE 2ULLA 4ZMAH 1A2CH 2P95A 1Z71A 2BY8X 2Z3EA 3BTTE 4D76A 1O3GA 1P09A 3U8RH 1DUAA 1ZJKA 4X2VA 1W7XH 1O5GH 3PMAB 1MCTA 2C8YB 4MNWA 4X0WU 1QBOA 3NUMA 1AFQB 4Z6AH 1EAXA 2O8TA 2GDEH 3MWIU 7ESTE 4NIWA 4MNYA 2UUYA 3FANA 3QZRA 3A84A 2JETB 4ZKSU 5TCCA 1GI0A 1BBRH 2XC4A 3B8JA 2TBSA 4K3JA 4X1SU 3RLYH 1VJ9U 1A0LA 1HAVB 1HRTH 1BRCE 1A0HB 1ZPBA 4XDEA 4ZHAA 2ZPRA 1ELTA 1BMAA 1F0SA 2QA9E 4H42U 1P57B 1SFQB 4LXBH 2OXSA 1UVSH 2EI8A 3D62A 1TPPA 1S6HA 4OS2A 1LQDB 2BY9X 3SNCA 1DPOA 1CE5A 1OP8A 5DO4H 3UQOA 3SHCH 1IQIA 1UCYE 4KTCA 3GYMA 3QK1A 1GGDB 2V0BA 1BITA 4D7GA 1WQVH 2ZZUH 1B7XB 5EQRA 1YM0A 1UJ1A 1IAUA 2VWLA 4H4FA 1GI9B 1O2GH 1SGEE 3RXVA 1VR1H 4D9QA 2BM2A 4ZXXH 5HM2A 1O2YA 3BTFE 5GCHF 2HRVA 3UREA 5EXNA 2GV6A 1GI5A 3QX5H 7GCHF 1PQ5A 2OCVB 3SU2A 3ZVAA 3ZVBA 2BLQA 3PWCA 4SGBE 1TOMH 3GCTF 1O3FA 2ZFRH 3KQCA 4Q80A 1EZQA 3RXJA 5C5NA 6CHAB 1QFKH 1AWHB 4IMZA 1SLXB 3QZQA 2TGDA 4GCHF 4YT6H 2VVUA 1GCDA 1V2WT 3CS7A 3Q76A 1ETTH 1PJPA 1HAGE 2PSYA 3HK6B 1O2TA 1P3EA 3BG4B 2GCHF 1TQ0B 1MAXA 2QN5T 1P11E 2WPJS 4MPVA 1GJ4H 3QDZB 3PO1B 2Q1JA 2FTLE 2TRMA 3U8TH 2XNIA 2UWOA 2C8ZB 1V6DA 2BYAX 2QY0B 2TGAA 3O8DA 1GDUA 2ZDKA 4CRBA 5F6MA 4YESB 2YNAA 1NO9H 1A61H 2OC8A 4MPXA 1C4V2 1C1MA 5FX5A 1GBEA 1Z1JA 3K65B 1J8AA 1THPB 2ZQ2A 2FTMA 1ELFA 1SB1H 4X2XA 1TAWA 3I29A 1QA7A 5EG4A 2QGRA 2PTNA 5DPAA 4I8LA 5DJ7A 4GPGA 2FEQH 3C27B 1DANH 5C67A 3MMGA 4YLQH 3UY9A 2ZKSA 3ZVCA 5FCRA 1TIOA 3ZV8A 1PPGE 1DWCH 2HALA 4JZEH 4JYUH 5GPIB 4MTBA 1EX3A 1Q3XA 5DP3A 1DFPA 4UFFH 1FXYA 4MVNA 2IOTA 2ZEBA 2FI3E 3QN7A 1GL0E 2A0QB 1KSNA 3V0XA 1V2UT 1UK4A 2ODYB 2A4OA 1BUIA 1H9HE 1BHXB 4DJZB 3NCLA 2QXIA 1TA2A 3MU8A 1AB9C 3Q3KA 2VH0A 1LVYA 1WQSA 5TCAA 1NRNH 2ZO3H 4X1QU 1ZTJA 2FI4E 3FAOA 2LNCA 1FN8A 2XBYA 2BX3A 4OS4A 4MNXA 2ZA5A 1TMUH 1OX1A 3MTYA 3DA9B 2ZCKP 1BCUH 1J15A 4INKA 4CH8B 1TALA 2FMJA 4RSPA 3SO3A 1O5CB 1DLEA 2PGQB 1OYTH 1NROH 1A7SA 4ZHLU 4CH2B 2QIQA 1HGTH 2ZGCA 1ARBA 1C1OA 1MTNC 4BANB 1LVBA 2A2QH 2FX4A 1RXPA 1Z8IB 4AN7A 4AB8A 2QCYA 3P17H 3Q3XA 4A5TS 1GVKB 2UUKB 1NS3A 1JRTA 4CRGA 1C2MA 2A31A 3MNSA 1FI8A 2WV4A 4JZ1A 2IPHA 1IQEA 2ZPQA 1RJXB 3UNRA 1S6FA 4TPIZ 1AZ8A 3SGBE 1Z6JH 1P2IA 1S0RA 2BZ6H 2ZU5A 3ZV9A 4CRFA 2NU2E 1BHXF 2AYWA 2ZG0H 3MO6A 3EA7A 1OKXA 3LGTA 1VITH 1FV9A 1ORFA 4K1EA 4CBOA 1GJ7B 1C2EA 2CGAA 5A8XA 1TGCA 2GVFA 1GCTB 4AG1A 3MFJA 4AGKA 3MO9A 1G30B 1GMCG 3RC6A 2CJIA 2ZNKH 3KN2A 2BY5X 3DD2H 1BMNH 3TH2H 3LOXA 4WY3A 2VGCB 1ID5H 1BQYA 1GBDA 1OWKA 1TRNA 3ENSB 1IQGA 4X6MA 3A7XA 1EUFA 4O03A 4FUEA 1ABIH 4WVPE 4NIVA 1S84A 1GHAG 3UNSA 4F49A 1SQOA 1EP6A 1DX5M 3SJKA 3MU1A 1EB1H 4KELA 4FVDA 2HWLB 4NWKA 1VCWA 1F92A 2A1DB 3QTVH 4DGJA 1O39A 2ZFQH 1J17T 2ZI2H 2CN0H 3DUXH 2FOBA 3IG6B 2ZFFH 2AGEX 2TGPZ 3MH4A 3VXFH 4AORA 3M3VA 2VJ1A 5A8ZA 2CMYA 3GISB 3S7KB 1SLWB 3QLPH 3GCHC 2TIOA 1T31A 4KKDA 5IDKA 3TJVA 3UPEA 3PMBB 3VGCC 4AFQA 3E91A 1KLIH 1L2EA 4TWWA 3OSYA 2EEKA 3GDUA 4FU7A 1DLKB 3ATWA 1P9SA 3LH1A 4Y79A 2C3SA 1E37B 4UEHH 1GI4A 4ISLA 5T6DA 1D3TB 4MNVA 1KLTA 1F0UA 1ZOMA 1F2SE 3AAUA 3H7OA 2BOKA 3NK8A 1SC8U 2ZFTA 2G51A 4A7IB 6GCHF 5GJ4B 2BD5A 5FPTA 4BTUB 2F9NA 1D6WA 5HXFA 1ELEE 4K1SA 1ACBE 1V2LT 2IJOB 3BTEE 4AYYB 1TX8A 3SU6A 1W2KH 1S81A 4GHQA 1TNJA 4O97A 4AGJA 1L1GA 1IQKA 2J9NA 1JOUB 3W94A 5IYTA 3KF2A 3ATIA 2UWLA 5JB9S 4IGDA 1NFWA 3OU0A 3ZZ9A 1MH0A 1O3DA 3QTOH 1GJAB 1CA0C 4A6LA 2CHAC 2GDDA 3MU5A 4I8GA 2SGPE 1RFNA 2ANYA 4WH8A 1GVLA 1UTJA 4Q7ZA 2V3OH 1NFXA 3TJOA 2VINA 4IMQA 3BN9A 4Y11E 1Y3XA 3TGJE 1CU1A 3SJ9A 2VWOA 3QUMP 1DY9A 1UTNA 2Z94A 3GY3A 4H6TA 5EODA 3BTKE 1GBLA 1O3EA 3SU4A 1MKWK 1EAWA 2P3UB 2XWAA 3Q00A 1SLUB 3RXSA 2WPKS 3PM3A 4LZ1H 2WPIS 3KEEA 1XVOA 1GG6C 4XFQA 1UCYK 1YPLH 3T29A 1T8OA 2O8MA 2WYJA 5DP7A 1C9TA 4OS7A 5DP5A 4NG9H 5FBIA 2HPQH 2ZGHA 3BSQA 3M3TA 1ZPZA 3L3TA 4K5ZA 4FUIA 4KP0A 2FYQA 2B8OH 3SV8A 1GMHF 5AF9H 3HKIB 1DY8A 2Z9IA 2ZU2A 1QHRB 3F6UH 1O3LA 1CGJE 1W0YH 1TGNA 1WOFA 1E36B 1O33A 1WYKA 1MTWA 3V7TA 1H8IH 3M36A 1EASA 4GUXA 3SU0A 6LPRA 1OWIA 3VXEH 3SI4H 2Q6GA 3BTGE 1WSSH 1K1MA 1YBWA 4ZUHA 2FOHA 1ABJH 4A92A 3M5NA 1GJ9B 3T5FH 4U30A 4IW4E 1TPSA 2H9EH 1P06A 1DSUA 5E2OA 1TOCB 1EPTA 1ESAA 3TU7H 1O36A 1AB9B 1C2HA 1XX9A 1LVMA 1VJAU 2HVXA 1BT7A 2BDHA 1MU6B 2W3IA 3SNDA 1RGQA 4K2YA 2G8TA 4WXIA 1O38A 3QWCH 3C1KA 4OS6A 1AUJA 4B71A 5FXLA 3SQEE 3F1SB 2Z9KA 1XUGA 1PQ7A 2GV7A 2GZ9A 2XC5A 4MDSA 5EPNA 4WH6A 1C5OH 2OD3B 1C5SA 2ALVA 1O3PB 5SGAE 1MTNB 5ETXA 5CMXH 3AW0A 2V3HH 2OUAA 1ELGA 1S0QA 2Y6TA 1GI2A 1K1NA 3TLOA 4ABAA 2XXLA 1O2ZA 1GJDB 2ZP0H 2HLCA 3P8OA 5GIBA 1WBGB 2G4TA 3TK9A 2LPRA 3SUFA 3BIUH 1DDJA 1FPHH 1EP5A 4D9RA 1PPEE 4NIXA 1P04A 1FY1A 2A7HA 1P2NA 1A0JA 1SGRE 4BOHA 3NXPA 2PUXB 1ZSJA 3SV2H 1YCPM 1XUKA 1IHSH 3O8RA 2BVSH 1TRMA 1C1WH 1K9OE 5EQQA 4GVUA 4WMDA 1HUTH 2G5NA 4CR9A 3A86A 4Y7BA 1TPAE 2J2UA 1OWDA 1O2PA 1FNIA 1C1SA 2BD4A 1E38B 3A7TA 1NZQH 1O37A 3B9FH 1LCYA 5EXLA 1QL7A 3F68H 2FPZA 4X2YA 1HNEE 5JB8S 2ZGXH 5FPSA 5J4SA 4ABEA 4FUCA 4XSKU 1SG8B 3ZVEA 1YPEH 2PHBA 1GBTA 3TJNA 3T62A 1EJMA 2B0FA 2NU0E 1DOJA 3PB1E 4ZAEA 5K0HA 7LPRA 1JIMA 1UCYH 1K1OA 4FUBA 5CHAC 1GJ8B 2G55A 1SHYA 2UUFB 4F4OC 1NT1A 1SSXA 1FN6A 3BEFB 1CO7E 2BD8A 5EQSA 1QJ7B 5L6NH 5JBCS 2P59A 5C5OA 1GI6A 1PPZA 1W0ZU 2QV1A 2PFEA 3MOCA 1YC0A 1B5GH 3LDXH 4AZ2B 4DW2U 1EZUC 2BDIA 1C5XB 4ABFA 1LDTT 2GT8A 1KXEA 3GCHB 2TPIZ 1EZXC 3LGWA 3U69H 3K6YA 1OP2A 1U6QA 3Q3YA 2BDCA 3A81A 1Q2WA 1Y3WA 1GBKA 4FUFA 3LONA 1P0SH 1NRSH 1CQQA 3MU4A 2HGTH 1ETSH 2R9PA 4GLYA 2FZZA 2B7DH 2BDGA 3SUEA 1UTLM 1FPCH 1L4ZA 4Q2KA 3TNSA 1EPTC 4DY7B 2BQWB 5J4QA 1O3AA 1PQ8A 2P93A 5LPEA 2RA0A 4GHTA 4JYTA 3ATLA 1NRRH 4AOQA 2C8WB 1HJ9A 1C5QA 1HAZB 1KYNA 5JBTA 4O9VA 4Q7YA 3MH7A 5PTPA 1D4PB 1EZSC 1ZRBA 4O3TA 2AGIX 5T3HA 1HB0B 3ZVDA 1GBBA 1CHGA 1SBWA 4CREA 1ZSKA 1YLCA 3EYDA 1QIXB 5GCHG 2ANKH 3KQBA 1CA0B 2CHAB 2SGEE 3U9AH 1H9LB 1F5RA 4B73A 1LTOA 3SUGA 2A5KA 1KXBA 1DXWA 1MZAA 7GCHG 4IN2A 4E06H 2QC2A 1NU7B 2BOHB 4YOIA 1UVTH 3TNTA 2Z3CA 3FP8E 1HDTH 2BLOA 3GCTG 4WMFA 1O3KA 1A46H 2J4IA 2QXHA 4U01A 2ODQA 1ZGVA 3RMMH 2VIDA 1V2NT 1O2VA