4K2YA

Crystal structure of human chymase in complex with fragment inhibitor 6-chloro-1,3-dihydro-2h-indol-2-one
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
226
structure length
217
Chain Sequence
b'IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymase
publication title Discovery of Potent, Selective Chymase Inhibitors via Fragment Linking Strategies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 217
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k2yA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k2yA02
3IWMA 2GV6A 4NWKA 3UWJH 1O3CA 3A89A 3BTQE 3SGBE 1LVMA 4NIVA 1P04A 1O2QA 1TGNA 1W14U 2P3FH 3LOXA 3H5CB 1QRXA 2Q1JA 1HAYB 5DO4H 1IQIA 1EAUA 2FWWA 2J9NA 1J14A 4ZHLU 1ZHMA 2WUCA 2ZKSA 3F9EA 1ZHPA 3SJOA 3SUGA 4ESTE 2XCNA 3RXDA 4AGKA 1VITF 5DP9A 2IN2A 3LONA 3SGAE 2ODYB 3BEUA 3TPIZ 3SI3H 3DT0H 3ZV9A 4YZUA 3T5FH 2VWNA 2AGEX 1RTKA 1O2NA 5E2OA 1T31A 1RJXB 2ZF0H 1GGDC 1W0YH 2D2DA 4NA9H 1LHCH 2G8TA 4X6NA 2C8WB 1NRNH 4ABGA 2Z9GA 1HXFH 2ZFQH 3QGJA 2ZDNA 3P8OA 5HM9A 4CR9A 1HNEE 1B0FA 3SJIA 1QR3E 2BD7A 3F9HA 1EPTB 4XE4A 1A5IA 1OWJA 3EA8A 1O37A 3MFJA 2HOBA 4CHAB 3ODDA 1S85A 4AGJA 5JDUB 2BQWB 2CN0H 5T3HA 3RXHA 1PYTD 3M36A 1F7ZA 2AIQA 2C8XB 4MPVA 1ELCA 4YT7H 3ZZ8A 4CH2B 1LVOA 4BTIB 2O8TA 3I77A 1S83A 4DVAU 1FIWA 1ETTH 5JBAS 4RSPA 3ZZDA 2Y6TA 1NFUA 5EU8A 4RKJB 1V2KT 3PV4A 1P2JA 5EXNA 1IQGA 3MU4A 1AZZA 3UPEA 1LVYA 2SGEE 2TBSA 3MU1A 3K6YA 3VGCB 3UOPA 1HJAC 4NIYA 1BCUH 1YKTA 4OGYA 2A4GA 5I25A 2FS8A 1L0ZA 1UTNA 3BTDE 1P57B 1SGDE 3RXPA 3SQEE 1A0LA 3EA7A 4AYVB 3SI4H 3S9BA 1BTZA 2BYAX 3GCNA 1W12U 1XUKA 1P9UA 1ETSH 2OCVB 3RUOA 2SGQE 1SSXA 3BTKE 2A2QH 1BTPA 1P2NA 4WXIA 2F9BH 1BTHH 3UQVA 3GDSA 3SV7A 1Y3WA 4MPUA 1O2WA 1CO7E 1IQEA 3UQOA 1F5LA 3U8TH 2ZC9H 1RS0A 4ZUHA 1QA0A 2XBWA 4B1TA 1GMCG 5A0AE 3EGKH 4UDWH 2Z3EA 4NGAH 1BBRH 4NA8A 3QGNB 1ZOMA 2G55A 1C5OH 1FAXA 3SU6A 1CGJE 3HK6B 1GJBB 1GBDA 4DIIH 1QBVH 1GBMA 1BIOA 1DDJA 4LZ4B 4INKA 1LQDB 1CT4E 2TGAA 2XW9A 4DJZB 2ANWA 2RDLA 4FXGH 2QGRA 3U98H 3M61U 1OP8A 1GVZA 1W7XH 1K21H 1ZRBA 1IQMA 3QUMP 1CA8B 1U6QA 4U01A 1YPHE 1GHBG 1KLTA 1ZPZA 2BDHA 4ABBA 1BITA 2NU1E 3A8DA 2CHAB 1UVOA 3T28A 5EW2H 3NPSA 1RXPA 3MO9A 4OS7A 4ZHAA 2PWXA 1SQAA 2BMGB 1NT1A 1EZXC 3H7OA 1GMDG 3GISB 1SR5C 8ESTE 3TIUA 1CT0E 1L1NA 2ZHWH 1GMHF 2GGVB 3M35A 1F92A 1OSSA 1XUIA 4TYDA 4Y79A 1E37B 4YLUA 3OY6U 3RM2H 4Y11E 4UONA 4BNRA 4D7GA 3TH4H 2FOEA 2P16A 2XC0A 3PMBB 2YNAA 3Q3XA 3GY8A 3VB4A 3PO1C 1UTLM 2FX4A 1SOZA 4CR5A 1FNIA 1GI1A 2BX3A 3FZDA 2OBOA 1FLEE 1UTKA 1V3XA 1FAKH 5A2MH 1SGYE 2P59A 2W26A 1L1JA 2VNTA 4X2VA 3E90B 4WJG2 4B2CA 1XXFA 3V12A 1KYNA 1RIWC 1FY1A 3DFLA 4K1TA 1TMUH 2PTCE 3I78A 3E3TA 3A7VA 3VPKA 1NTPA 2DE9A 3KQCA 3PROA 1VCWA 3UFAA 5EPNA 1K28D 1WAYB 1DVAH 1NFXA 5GXPA 2ZHFH 4BOHA 3VB6A 3NKKA 4X1QU 1MU8B 1DT2A 2FOMB 5I46H 1PFXC 5BRRE 1TPSA 2CMYA 2OC8A 1F2SE 1CT2E 2R2WU 4I8JA 3RXSA 1CA0C 1O2VA 3U69H 1O36A 3SZNA 3EDXB 3UR6A 2GD4B 2PV9B 1GDUA 3E6PH 1XKAC 1QL7A 3M7UA 5CHAB 1PPBH 1QRZA 3NZIA 2A5KA 2P3UB 1C2FA 1BDAA 6LPRA 1TRMA 1MCVA 2HWLB 7GCHF 2BY9X 1RTFB 2R3YA 4K3JA 4FVBA 1G36A 1Y3XA 1V2TT 4CH8B 2JH6D 4AFSA 1SGQE 1MTNB 1YLDA 1K9OE 2NU3E 3ZVEA 3O8BA 3U1IB 1ZLRA 1S6FA 1WV7H 2FZZA 3DA9B 4FU9A 2XC5A 1JXPA 4NIWA 3RC5A 1A2CH 4VGCC 5IDKA 1DSUA 4J2YB 1TRYA 2FS9A 2VWMA 3UTUH 5ESBA 1MTVA 2TRMA 3P8FA 3RP2A 2SNVA 2V35A 2GCTC 4Y7AA 1GG6B 2BLWA 2ZQ2A 2ZU5A 4BAKB 1C1WH 1BTXA 1HAHH 1C9TA 2A45B 2BDIA 4FUDA 1P2IA 1O2IA 2UWLA 1NFWA 4BAHB 1C1MA 2Z9JA 3PTNA 1JOUB 2H5DA 3JZ1B 1O30A 1O2TA 4I31A 4I33A 2A1DB 2P95A 3RXOA 3A8AA 1O3EA 4I8KA 1L2EA 4NZLA 3T29A 4NZQA 1MKXH 1Q3XA 1YCPM 4MVNA 4JK6A 1F0UA 2SGPE 1V2OT 4IS5A 1O35A 3P95A 2BTCE 8GCHG 3SU2A 1KXCA 3RMLH 1EZUC 2AMQA 2Y5HA 1C5WB 1N8OB 1Q2WA 3GY2A 2ZNKH 2BQ6B 3AAVA 1M9UA 4K5ZA 2WPJS 5L2YH 1K1LA 3MO3A 1AB9B 4FUBA 1CBWC 1O3DA 3MU8A 3SNBA 2O9QA 1C1QA 2IOTA 6ESTA 3MNBA 1BHXF 2BDAA 3T2NA 1NRPH 2AFQB 1O3BA 1LVBA 1UHBB 2BM2A 5DP4A 3L3TA 4D8NA 2RA3A 2Z9LA 2ZGXH 1OXGA 1C5QA 2C4FH 2VWLA 1A46H 1OWDA 2A4QA 2J34A 4TY6A 5EXMA 2KAIB 1TIOA 1ZMJA 4B73A 4FU7A 2Z3DA 4JK5A 1WOFA 2W7SA 3QN7A 2NWNA 3TJUA 1ID5H 2D26C 3RC4A 3ZVAA 1DUEA 1P02A 1E38B 2UUKB 3TU7H 1EUFA 2H9HA 3FFGA 1YPKH 4UFGH 4F49A 3CENA 1UJ1A 1T8OA 2ZCLP 1LTOA 2GKVE 1SHHB 1JRSA 2G52A 4AOQA 1EX3A 4NWLA 1PPHE 2EI8A 1AFQB 1UTJA 4YT6H 2UUYA 1JMOH 3TJNA 3PLKA 2SFAA 1G9IE 1PQAA 3ENSB 3SU0A 1DXWA 1BMMH 1P9SA 4Z0KA 5GDSH 1EASA 1PPFE 1VCPA 4IBLH 3RMOH 3VB7A 3VB3A 2BDGA 3NWUA 2PFEA 4IN1A 1G3BA 1UHBA 1MKWK 1O2ZA 4YOIA 1LQEA 1AKSB 1EJAA 4K8BA 2C3SA 4ISOA 2FYRA 1C4V2 1SPJA 1Y3UA 3BEFB 3BTFE 5HYOA 1WTGH 1C1OA 4BANB 1C2LA 1VCQA 2P8OB 1BBRK 4TWYA 1ZSKA 3UWIA 4DG4A 2AEIH 1UCYK 2AS9A 3LU9B 4QT8C 1BHXB 3O8CA 2BD4A 1AVGH 1O33A 1RRKA 1AHTH 1TABE 5LH8A 1P10A 2ZI2H 1UK3A 1D6RA 1HAXB 1S0RA 1MH0A 3GCTF 3LGTA 2QYIA 1ZR0A 1GBLA 1GHYH 4X2YA 5DG6A 3TGJE 2DUCA 2ZDAH 5HMAA 4GSOA 2ZU1A 1XUJA 2A7JA 2ALPA 1OYTH 2PSXA 1WQSA 4CRDA 3CS7A 1TONA 1HDTH 1SI5H 3K2UA 4IC6A 2V3OH 2UWPA 3E8LA 1NU7B 3LGIA 1TA2A 1GJCB 1AUJA 1HAOH 4WMFA 1AKSA 4JZIA 2V0BA 4NSYA 1Q31A 2R2MB 2ZHDA 1TYNA 2A7CA 3GCHC 2JH0D 3KHVA 4FUCA 3G01A 1O39A 2ZDVH 4B2BA 3P92A 1OWIA 2AMDA 1FPHH 4ZH8A 2GCTB 4FUHA 1GCTC 2V6NA 3SJ8A 2SGAA 1ELBA 1XXDA 2PR3A 2RCEA 3SW2B 1C1RA 5C1UA 4OGXA 4DT7B 2HNTF 4IGDA 1O2OA 2A2XH 1LPGB 2PGBB 2GV7A 1KXDA 4FUJA 2W3KA 3SNCA 1P3EA 4MDSA 4K1EA 1IOEA 4TWWA 4XBCA 1QIXB 1IQKA 1EAIA 2QN5T 4Y10E 1ZRKA 1NZQH 2THFB 3MNXA 4JYTA 5K7RA 1A3EH 1TGBA 3B9FH 3P8NA 5JBTA 1V2ST 1K1OA 1O0DH 1TALA 1TBRH 2QXJA 3Q00A 4BXSA 2P93A 1AU8A 3OU0A 3RXFA 3R3GB 4WXVA 3M7QA 1F0RA 2Z9KA 1OX1A 3RU4E 3LDXH 4I32A 1BBRE 1JIRA 3M5OA 2BOKA 1UCYE 2BVRH 1SC8U 2GCHG 1UTMA 3BG4B 4X1SU 1GJDB 5AFZH 5EOKA 3GY5A 5DP6A 4WMEA 1GJ5H 2GMTB 1CBWB 5JYIA 4BAMB 1MD7A 2PW8H 2STAE 3NUMA 2J94A 2Y5FA 4ABJA 3PYHA 2HVXA 3TLOA 1O2UA 1ZJDA 2VB0A 3S7KB 1Y3YA 1A7SA 1ELEE 1BMAA 1ELVA 3U8OH 4A7IB 3A7XA 3TJOA 2OINA 2BY7X 3SU1A 2GDDA 1MTSA 1NRRH 3VXEH 2OBQA 2FOGA 1LHGH 1O3IA 1XUFA 2C93B 4TY7A 3M3TA 4F4OC 5TJXA 4GCHG 2OUAA 3FP6E 1FY5A 1O2SA 1CU1A 3W95A 4YOGA 2H9TH 1TNGA 4CRCA 2QAAA 3RXTA 1C1PA 1D3TB 1HV7A 3T27A 5DP8A 4X2XA 1BJVA 1FY3A 1RTLA 5L6NH 2M5TA 5F8TA 5FX6A 3MTYA 1O34A 2P3TB 4FUEA 1JBUH 2ZA5A 1BA8B 5A8YA 1K1JA 4IN2A 1P3CA 4H4FA 3SHAH 1HAZB 5EQQA 1GDNA 1TGSZ 3ZV8A 2AMPA 3K65B 4X8SH 5J4QA 3FZZA 1AY6H 3LKWA 1GVKB 5J4SA 1E34B 4DIHH 4K2YA 2A32A 1EP5A 4YOJA 1NU9A 1YM0A 1Z6JH 2UWOA 1A0JA 3EAJA 1HCGA 4UD9H 4JZFH 3LIWA 2PSYA 3A83A 2FEQH 3UOUA 1BJUA 2OC1A 1MTUA 1NC6A 3F6UH 1ZMLA 4ZHMU 2BY6X 3A86A 3BSQA 1S6HA 1AD8H 1J8AA 1EZQA 1LDTT 5E8EH 4B2AA 3E91A 4Q7YA 1O3JA 2Y81A 4ASHA 2P94A 2ZU4A 1Z1IA 4MNVA 1F5KU 1ZYOA 1O2GH 2W7UA 1O32A 1V2RT 1L1GA 1YP9A 1GI3A 1O2XA 3BTTE 2Z94A 3URDA 2ODQA 1VGCB 4INHA 1Y59T 3GOVB 1C1VH 1QHRB 3EE0B 3V0XA 4LOYH 1Z7KA 2Y7ZA 1SLWB 4Y0YE 1EPTA 2XWAA 3MH6A 2ZHQH 1MBQA 3T26A 6CHAC 1C5LH 1HB0B 2FLBH 4SGAE 2FOHA 2G4UA 3QZQA 1GHWH 1GI8B 1YPJH 2R9PA 5C2ZA 4AYYB 5HM2A 1HJ9A 4U30A 2VIPA 4X2WA 4PROA 1SGIB 2JETC 1RD3B 4ABDA 3BIVH 1V2QT 2VGCB 1GHBF 5GPIB 4AB9A 1OWHA 3RXLA 1HRTH 2ZZUH 2GZ8A 4A5TS 2ZP0H 1GCTB 1O3LA 1ANCA 3D23A 1BRAA 3SV6A 3M3SA 2EA3A 1TMBH 3LJJA 2FOFA 4GHQA 1Z6EA 4Y0ZE 2IJOB 3ZVDA 1HLTH 1GMDF 1TBZH 1AQ7A 2W5EA 4I8GA 1K1PA 4X8VH 2QXIA 4AORA 1JRTA 3K9XB 1C1UH 5LPRA 1GL0E 1MUEB 1P2OA 3ODFA 4FUGA 1C2KA 1YLCA 3GY7A 3GDUA 1YBWA 2RG3A 3LJOA 4ABFA 3QTVH 2ZTXA 2TIOA 2G81E 1O2YA 1ORFA 3OY5U 3SV8A 4IC5A 3QO6A 3RC6A 4O3TA 2ZDLA 3HKJB 4HTCH 4XBBA 1SQOA 4WF8A 4DURA 3V3MA 1K1NA 1W0ZU 1WSSH 1DWBH 2BHGA 3CS0A 3KNXA 1SGPE 3RXCA 1ZTKA 2GVFA 3S9CA 3SOSA 1GI4A 1C2EA 5DK1A 3EQ0H 3FP8E 4X6OA 2G51A 4YTAA 1K22H 3A84A 3ESTA 1MMJN 1TGCA 1MQ5A 2ODPA 3GDVA 1QBOA 3QWCH 2QV1A 1P06A 3UY9A 1V2PT 3Q3KA 2BXTH 1IQFA 1TX7A 1ZTJA 2ANYA 1H9HE 2B7DH 4IW4E 2WV5A 4KELA 3SV9A 1CHGA 3LC5A 2FYQA 3PLBA 4OS2A 2HGTH 1O31A 2ASUB 1H1BA 1BRBE 1ANDA 1C5XB 1DSTA 1GGDB 4MPWA 2ZCKP 3MH5A 1GVLA 3A88A 5T6FA 3QTOH 1HBTH 3MH4A 3ZZ6A 2J2UA 3QX5H 2Y7XA 3UNRA 2PKAB 4UFEH 1HAVB 1TMTH 3SHCH 4JZDH 1TFXA 4A92A 2H9EH 1A5GH 1DM4B 1SB1H 1KTSB 2AIPA 5G4BA 2FTLE 3AASA 1Y8TA 2HALA 1ANEA 1QJ6B 4ZKRU 4ABAA 1HIAB 3ATIA 1GBEA 5JB8S 5L30H 3RMNH 8LPRA 1EAWA 1LO6A 1TOMH 4HGCA 1ZPBA 4O9VA 2H5CA 3HK3B 2XBVA 1SGFA 3OX7U 1IQHA 2QIQA 3AW1A 3ZVFA 3A87A 4BAOB 3ZZBA 4X8UH 5FBEA 2PKSC 2EI6A 2TGDA 3BV9B 2FP7B 2H1UA 1TX6A 1MU6B 1C1NA 1WYKA 1FV9A 4OS5A 1L4DA 1D3PB 2FOCA 1H8IH 3S9AA 1LHDH 1GI7B 3BIUH 1HJAB 4BAQB 4J1YA 7ESTE 1O2RA 4ZXXH 1FY4A 3P17H 8GCHF 4JZEH 1H4WA 4NA7A 1K1IA 4AZ2B 2ILNA 2F91A 2PKAA 1XM1A 3RMMH 1QNJA 4B75A 1MAYA 2WV4A 4DY7B 2JKHA 3T62A 5EQSA 4ISNA 1C5MD 2HNTE 1HAIH 2FI5E 2ZTZA 2TPIZ 1J16A 1AIXH 4THNH 5AVDA 3MU0A 2ZWLH 1DS2E 4WH8A 4RN6A 4UFDH 3LGVA 4FUFA 3U9AH 1TX8A 1TNKA 1ELDE 1GPZA 1F0SA 3SUEA 2VIQA 2ZFPH 1HJ8A 3MH7A 5F6MA 5LGOA 4OS6A 3ZZ5A 3KQBA 3L6PA 2A7HA 2NU4E 1O2HA 1N6XA 2XYAA 1VR1H 1CHOG 2UUFB 3ZZCA 3RXAA 5EGMA 3S0NA 2BOHB 4Q80A 1JWTA 3VB5A 4X8TH 5K0HA 1BB0B 3N7OA 5C5NA 3VEQB 4FU8A 5GWZA 3U1JB 1C5YB 3RU4T 2ZEBA 2C8ZB 5ABWA 3A80A 3I29A 1LHFH 4X6PA 1K2I1 1TWXB 2QF3A 3E16B 4SGBE 2FDAA 1P2KA 3HPTB 1KSNA 3P70B 2BB4A 3TH3H 4XOJA 4X1RU 3H7TA 4Z6AH 1G3EA 2XBXA 3F9GA 1C2JA 2GTBA 1BZXE 4Q7ZA 1QB6A 2XNIA 3RXEA 2Q6DA 5TCAA 3HKIB 3GY3A 1PPGE 1NROH 2QCYA 2A0QB 1A3BH 1GJAB 1UVUH 1J15A 2OXSA 4M7GA 1YCPH 2QA9E 1L4ZA 3GYLB 2FO9A 3SO3A 3SJ9A 4RKOB 1TAWA 1EAXA 2HPQH 2XXLA 3DUXH 4MNYA 4E7RG 2AH4X 2F9PA 4OS1A 1AZ8A 3Q76A 3PO1B 5SGAE 2XBYA 4MQAA 1BQYA 4O3UA 3UIRA 1EXFA 4CRGA 4B76A 4CRFA 5HXFA 3MYWA 1NN6A 3PWCA 5ESTE 4HZHA 1YPEH 1EPTC 1RIWB 3KIDU 1GBAA 2DE8A 5DJ7A 3HGNA 1EB2A 1BMNH 4X0WU 3ATWA 3LPRA 3MHWU 1LCYA 3A82A 1QY6A 1SHYA 5C67A 4ISHH 4Y8XA 2G00A 4CHAC 1NY22 2BXUH 2KAIA 3E0NB 1O3MA 1Z8IB 1QFKH 1O2JA 3KQDA 1DWDH 2BDYA 1CGIE 3RXBA 5GCHG 1O2LA 1UO6A 1UTPA 1DWCH 4KKDA 5F8ZA 2BY5X 3KGPA 2BX4A 1CA0B 3Q77A 4MNXA 4B71A 3PTBA 4GHTA 1GI0A 1DY8A 5FBIA 3O8DA 1S5SA 1HYLA 2ZGJA 2FMJA 1PQ7A 1W13U 5E0JA 5GIBA 1E36B 1C1TA 2ZPQA 1QJ1B 3KQEA 3TNSA 1E0FD 5E0GA 5EPYA 2VVVA 1AVXA 1FN6A 3ZYDA 1BRCE 4JMYA 3GYMA 4XSKU 2F9VA 3PWBA 1YPGH 1PQ8A 4HI3A 5E0HA 4AFZA 5AFYH 2AGIX 2D8WA 1MD8A 1H9LB 2B8OH 1IAUA 1Y5AT 4VGCB 1KY9A 1TOCB 5LPEA 3IITA 2PKSB 1AN1E 1GHAG 3MNSA 1IHTH 2A31A 3UNQA 2SNWA 2BZAA 1KXBA 4I8LA 1O5AB 1QJ7B 2OD3B 1GBTA 2LNCA 2EEKA 1QL9A 1G32B 3F68H 3LGYA 1FQ3A 1QB9A 1GI2A 2BD2A 1FUJA 2ZGBH 1FXYA 1KLJH 4ISIH 4GPGA 1MCTA 3HGPA 3ZZ9A 2VH6A 2C8YB 2ZPRA 3UREA 4ZMAH 1DFPA 3SJKA 4ZKOU 2B9LA 1A0HB 1D3DB 2ZFTA 2GCHF 3K6ZA 3LGWA 1ARCA 2ANKH 1NM6A 1O5EH 3S7HB 1A61H 1FJSA 2YOLA 3TNTA 1DX5M 6GCHG 3BTGE 1Z8JB 4CRBA 3HATH 3KN2A 4K69A 1DY9A 4K60A 2CHAC 3LT3A 2VIVA 2FI3E 4XFQA 1BMLA 1J9CH 1MAXA 1TPAE 1MTWA 1GL1A 3ATLA 4YLQH 1FI8A 2NU0E 3UNSA 1UVPA 2CF8H 3GICB 3C27B 5EODA 1QURH 1O3GA 2PGQB 4CBNA 3A7ZA 4YO9A 3OTJE 1EZSC 2ULLA 1O5GH 3GCOA 1KXFA 1TB6H 5F03A 1W10U 1GHXH 2FXRA 1SLXB 5EQRA 1O2PA 4GCHF 1C5PA 2JH5D 1AO5A 1PPEE 2A4RA 1Y5UT 2FPZA 2NU2E 1VITH 5AF9H 3A81A 4X6MA 2ZHEH 5H4IB 2WPIS 3PMJA 2LPRA 5FHTA 2WYJA 3A7TA 1GWAA 5B6OA 2WUBA 4INLA 1S84A 4WWYA 1TNJA 5A09A 2ZO3H 3SV2H 3PLPA 3RXJA 5T6DA 2R0LA 3ZZ3A 2ALVA 1DOJA 1XMNB 2ZU3A 9ESTA 1CSOE 4LZ1H 3RXQA 1O5BB 4IMZA 5L2ZH 1C4U2 4D9QA 2PUXB 1ESTA 1UK2A 2ZU2A 2TGTA 2PLXA 4K8YA 1EOLA 4NIXA 4ZXYH 4IMQA 1O5FH 2XRCA 1VITG 2Z6BD 1UTOA 4AFQA 3ATMA 1NO9H 1MKXK 1MZAA 2PHBA 2AERH 5DKMA 1G30B 5CHAC 1WBGB 1XUHA 1GHZA 1W3CA 4LXBH 3E1XB 1UVTH 2BLOA 2XC4A 3E0PB 3M5LA 1GI5A 1ZPCA 2FIRH 5DPAA 1S81A 1B7XB 3BTME 2Z3CA 5JBBS 4MPXA 1D6WA 2OC7A 1MTNC 2ZDKA 2FM2A 2OP9A 1NPMA 2A5IA 3A8BA 2YNBA 2RA0A 3D49H 3KF2A 3TGIE 4ABEA 3ELAH 3O8RA 5HGGA 4HFPB 4KP0A 2XTTB 3ZVGA 2F9UA 1GDQA 5C5OA 4A1XA 2CJIA 3LGUA 1UMAH 1DXPA 5FPYA 2VVUA 1QQ4A 5JBCS 1UVSH 1S0QA 3CP7A 1SGRE 3RXUA 2UUJB 5C1XA 1GG6C 1NS3A 5EXLA 1AGJA 1DLEA 3JZ2B 4KTUA 1GI6A 1GMCF 1FONA 1XKBC 2FX6A 2J4IA 2FLRH 3BG8A 1GJ9B 2ANMH 1C1SA 7KMEH 4H6TA 1PJPA 1GJ8B 3EA9A 4GUXA 5DP5A 4KGAA 1P2QA 3VFEA 1AWHB 2WINI 4A6LA 7LPRA 2WPMS 1SGEE 1E35B 1C2IA 4YESB 1QB1A 2F3CE 2XCFA 1V2UT 1D9IA 4TPIZ 1TLDA 3DHKH 1DUAA 2K1QA 4Q7XA 1DICA 4UE7H 4E06H 1LHEH 1O3KA 2ZGHA 5DGJA 2B0FA 1MKWH 1YCPK 2WYGA 3GCHB 1PPZA 1OS8A 1V2JT 2J92A 1N8OC 1QRWA 1DWEH 3WY8A 2A5AA 1Z8GA 1GBKA 1OOKB 4LK4A 4ZAEA 1P09A 1AB9C 3M5MA 1GBBA 1H9IE 1CE5A 1V6DA 1V2VT 1ESAA 5FX5A 1UCYH 1MZDA 1DPOA 1O5CB 5ETXA 4AX9H 3A7WA 1SGFG 3SQHE 2O8UA 1ELAA 1SL3A 4Y76A 1ZMNA 3DD2H 1D4PB 4DW2U 4H6SB 1IQNA 3MU5A 3SU4A 1WU1A 1OYQA 1SVPA 1ZGIA 1TRNA 1WCZA 4AG1A 1OKXA 1SLUB 1ETRH 2H2ZA 2ZCHP 3FAOA 3TITA 1KXAA 1T4VH 2V3HH 4X1PU 1O2KA 1B0EA 4ZKSU 1OWEA 5C3NA 1WUNH 3S69A 4X1NU 3LH3A 1T8LA 1O3FA 5T6GA 1YC0A 1BUIA 1NRQH 1Z1JA 4GVUA 4UFFH 1ESBA 1NFYA 1KXEA 2Z7FE 4O03A 3QLPH 1C4Y2 5DP7A 4R8TB 2QXGA 2VINA 2ZFRH 1SMFE 2XWBI 1HUTH 3QK1A 2BLVA 2IPHA 3NCLA 5IYTA 1FY8E 5A0BA 3SN8A 1FN8A 4ABHA 3M3VA 2Y82A 2EC9H 1FZZA 4E7NA 3T25A 5EG4A 1AFQC 1X7AC 3RU4D 1GJ7B 1EJMA 1V2MT 2BLQA 1GMHG 5FAHA 3D65E 1CVWH 1EATA 1ABIH 2ZG0H 1MQ6A 5EW1H 2VIOA 4Q2KA 4U32A 4XBDA 3RLYH 3TJVA 1P03A 4AB8A 3MI4A 2O8MA 1G3CA 1TNHA 3SU5A 2FODA 1W11U 1CQQA 4DCDA 1YPHC 2FI4E 1JIMA 1G3DA 1P8VC 2R3UA 1SOTA 1QTFA 2VH0A 1ZTLA 2ESTE 1SBWA 1ZSJA 1EJNA 1Z71A 2P8OC 4MLFB 3NXPA 5CMXH 4NCYA 1P2MA 2ZTYA 1C5VA 2ZPSA 3LC3A 2F9NA 2OQ5A 2ZDMA 4AG2A 5E2PA 1QL8A 1V2WT 1WQVH 1VZQH 3C1KA 2GX4A 5LPFA 5FCKA 3ZZAA 2SGDE 2H6MA 1T4UH 2BD5A 2Z9IA 1PPCE 3OYPA 3P8GA 2OLGA 2VU8E 1EP6A 1O3OA 2I6QA 1AE8H 1C5RA 1EKBB 1A1RA 3FVFB 1Z8RA 5JB9S 1EOJA 1TPOA 3QZRA 1P05A 2OQUA 4I8HA 1O38A 3UUZA 3PB1E 1GBJA 1AVWA 3ZYEA 1OP2A 3V13A 1T8MA 2OC0A 2BD9A 4NFEA 7GCHG 3AW0A 1NESE 3SNDA 1C5SA 1SFQB 1IHSH 2BD8A 4R0IA 2CGAA 3DFJA 2GT8A 3M5NA 2ZECA 3D62A 4NG9H 1DLKB 1ELFA 1THSH 4H42U 4B74A 4ISLA 1O3NA 9LPRA 3AVZA 1HAVA 4KTCA 2ZIQH 5FPSA 1A4WH 2Q6GA 3RDZA 4A1TA 3BTHE 2FOBA 2EI7A 3RXKA 2O8WA 6CHAB 4K1SA 3TK9A 3TK5A 1Y5BT 1THRH 1HPGA 1CHOF 2BD3A 5FXLA 2C90B 1HIAA 1F0TA 1F5RA 1WTHD 4JYUH 5A0CA 3NK8A 1GCDA 1SFIA 3L33A 3B8JA 1TE0A 1HXEH 3MOCA 4ABIA 2GDEH 4YM9A 2JETB 1LPZB 1J17T 4FUIA 4D7FA 2FOAA 1W2KH 1SGNE 1SQTA 1C5TA 4Y8ZA 5FPTA 3ATKA 3SBKA 1QCPA 1SGTA 1RFNA 1P11E 1TBQH 1O3PB 1ANBA 1GBCA 2J38A 1O3AA 2HPPH 2D1JA 4DGJA 3TGKE 5F8XA 1QA7A 3RXMA 3BG4C 1G2LA 3FANA 3M37A 1FDPA 2ZGCA 4JCNA 5DP3A 1QBNA 5C20A 2GMTC 3AAUA 1FPCH 4DOQA 3IG6B 4CBOA 1O5DH 4WH6A 3VXFH 1DE7H 4ZKNU 2G4TA 1D3QB 1O3HA 1TGTA 2BY8X 1DITH 4BTTB 1OPHB 1P12E 4ZROA 2VIDA 2VWOA 1ZGVA 2BDBA 4E05H 2G5VA 1ZZZA 1YF4A 1AMHA 1KTTB 1YPMH 2GZ7A 5JPMH 1GJ6A 3MO6A 4WY3A 3STJA 1LMWB 4AN7A 1KDQB 1BTUA 1P01A 2W3IA 1KIGH 1QGFA 5GJ4B 1TNIA 1W8BH 3PMHB 1UTQA 2Y5GA 4XDEA 4MTBA 3KCGH 1KLIH 2BVXH 1TQ0B 3A8CA 4I7YH 2WPKS 5A8XA 3MMGA 4GLYA 1OP0A 4CRAA 1YPLH 2HNTC 1ELGA 1GBHA 4D9RA 1G2MA 2F83A 4FVDA 1A5HA 1AI8H 1T7CA 4JZ1A 5AHGH 1BTWA 4AFUA 2PUQH 3SUDA 3UR9A 2CV3A 4BXWA 4GAWA 1ZSLA 5FCRA 2VIWA 2G5NA 3LH1A 1BTYA 4TPYA 5GCHF 1UK4A 3SGQE 3TH2H 5CE1A 3ITIA 1XVOA 1FIZA 2GT7A 3STIA 1PQ5A 1YGCH 4WMDA 3SUFA 1C5ZB 1BRUP 1W7GH 3SNEA 3ZZ4A 3V7TA 1LKBA 1HFDA 3SORA 2Y80A 3RXIA 1OWKA 1MBMA 2FTMA 1AE5A 3GY4A 2QXHA 1TQ7B 5TCCA 1XVMA 3BTEE 1KDQA 1AUTC 1XX9A 1AWFH 3PMAB 1C2HA 3TK6A 2FESH 3RXVA 1GBIA 4OS4A 2QY0B 3RLWH 3RXRA 1TPPA 3VGCC 3W94A 3RXGA 1INCA 4NFFA 2SGFE 1GJ4H 1Y3VA 1ABJH 1VJ9U 3BF6H 3Q3YA 4KTSA 1B5GH 1IQJA 2HRVA 1HAPH 3TVJB 1C2GA 3BTWE 3RM0H 4UEHH 1VGCC 1ARBA 4Y8YA 2BQ7B 2OTVA 1GHAF 1NRSH 3F1SB 1SLVB 1HGTH 3BEIB 1TNLA 4WVPE 2WPLS 4JYVH 2A4OA 1P0SH 1VJAU 1ACBE 1ZJKA 1XUGA 1EQ9A 4MNWA 1PYTC 1IQLA 1ELTA 1V2LT 2BDCA 3GY6A 1G37A 1THPB 4O97A 2ZQ1A 3SU3A 3A85A 1QQUA 1V2NT 1C5NH 3GCTG 4Y7BA 1T32A 4U2WA 1SG8B 2CXVA 2AGGX 1DANH 1C9PA 1S82A 3R0FA 2J95A 2WPHS 3MNCA 4A1VA 4BTUB 5A8ZA 2HLCA 1O2MA 1YYY1 2O8LA 5PTPA 2VGCC 6GCHF 3F9FA 3QDZB 3ZVBA 1ZHRA 1FMGA 3KL6A 1GBFA 3B23B 1N6YA 3M7TA 3FP7E 2Q6FA 1HAGE 2VVCA 2PTNA 2CF9H 5BPEA 3KEEA 1H8DH 2BZ6H 1AFEH 2F9OA 4NSVA 1RGQA 1C2MA 1TA6A 2GP9B 2TGPZ 1LKAA 1BT7A 4CREA 3ZZ7A 2VJ1A 3ZVCA 1C5UA 1GHVH 2STBE 5C1YA 3SNAA 2BVSH 3A7YA 1CGHA 1T8NA 1EB1H 3BN9A 3PM3A 2AYWA 3P6ZB 4Y71A 1BOQA 1C2DA 4D76A 3URCA 2QC2A 2R0KA 4Y6DA 2GZ9A 1LPKB 1N1LA 3MWIU 1K1MA 2B5TB 3EYDA 2ZFSA 1GI9B 2ZFFH 1SGCA 2QF0A 4MG3A 3OSYA 2I6SA 3U8RH 8KME2
chains in the Genus database with same CATH superfamily
3IWMA 2GV6A 4NWKA 3UWJH 1O3CA 3A89A 3BTQE 3SGBE 1LVMA 4NIVA 1P04A 1O2QA 1TGNA 1W14U 2JJ2D 2P3FH 3LOXA 3H5CB 1QRXA 2HLDD 2Q1JA 1HAYB 5DO4H 1IQIA 1EAUA 2FWWA 2J9NA 1J14A 4ZHLU 1ZHMA 2WUCA 2ZKSA 3F9EA 1ZHPA 3SJOA 3SUGA 4ESTE 2XCNA 3RXDA 4AGKA 1VITF 2KR7A 5DP9A 2IN2A 3LONA 3SGAE 2ODYB 3BEUA 3TPIZ 3SI3H 3DT0H 3ZV9A 2VBCA 4YZUA 3T5FH 2HVYB 2VWNA 2AGEX 1RTKA 1O2NA 5E2OA 1T31A 1RJXB 2ZF0H 1GGDC 1W0YH 2D2DA 4NA9H 1LHCH 2G8TA 4X6NA 2C8WB 1NRNH 4ABGA 2Z9GA 1HXFH 2ZFQH 3QGJA 2ZDNA 3P8OA 5HM9A 4CR9A 1HNEE 1B0FA 3SJIA 1QR3E 3OFND 2BD7A 3F9HA 1EPTB 4XE4A 1A5IA 1E1RD 1OWJA 3EA8A 1O37A 3MFJA 2HOBA 4CHAB 3ODDA 1S85A 4AGJA 5JDUB 2BQWB 2CN0H 5T3HA 3RXHA 1PYTD 3M36A 1F7ZA 2AIQA 2C8XB 4MPVA 1ELCA 4YT7H 3ZZ8A 1MABB 4CH2B 1LVOA 4BTIB 2O8TA 3I77A 1S83A 4DVAU 1FIWA 2L6OA 1ETTH 5JBAS 4RSPA 3ZZDA 2Y6TA 1NFUA 5EU8A 4RKJB 1V2KT 3PV4A 1P2JA 5EXNA 1IQGA 4ZCNA 3MU4A 1AZZA 3UPEA 1LVYA 2SGEE 2TBSA 3MU1A 3K6YA 3VGCB 3UOPA 1HJAC 4NIYA 1BCUH 1YKTA 4OGYA 2A4GA 5I25A 2FS8A 1L0ZA 1UTNA 3BTDE 1P57B 1SGDE 3RXPA 3SQEE 1A0LA 3EA7A 4AYVB 3SI4H 3S9BA 1BTZA 2BYAX 3GCNA 1W12U 1XUKA 1P9UA 1ETSH 2OCVB 3RUOA 2SGQE 1SSXA 3BTKE 2A2QH 1BTPA 1P2NA 4WXIA 3N99A 2F9BH 1BTHH 3UQVA 3GDSA 3SV7A 1Y3WA 5KGOA 4MPUA 1O2WA 1CO7E 4RT0A 1IQEA 3UQOA 1F5LA 3U8TH 2ZC9H 1RS0A 4ZUHA 1QA0A 2XBWA 4B1TA 3OEHD 1GMCG 5A0AE 3EGKH 4UDWH 2Z3EA 4NGAH 1BBRH 3F0OA 4NA8A 3QGNB 1ZOMA 1YY3A 2G55A 1C5OH 3KYFA 1FAXA 3SU6A 1CGJE 3HK6B 1GJBB 1GBDA 4DIIH 1QBVH 1GBMA 1BIOA 1DDJA 4LZ4B 4INKA 1LQDB 1CT4E 2TGAA 2XW9A 4DJZB 2ANWA 2RDLA 4FXGH 2QGRA 3U98H 3M61U 1OP8A 1GVZA 1W7XH 1K21H 1ZRBA 1QZ8A 4XRNA 1IQMA 3QUMP 1CA8B 1U6QA 4U01A 1YPHE 1GHBG 1KLTA 1ZPZA 2BDHA 4ABBA 1BITA 2NU1E 3A8DA 2CHAB 1UVOA 3T28A 5EW2H 3NPSA 1RXPA 3MO9A 4OS7A 4ZHAA 2PWXA 1SQAA 2BMGB 3F2GA 1NT1A 3NRLA 1EZXC 3H7OA 1GMDG 3GISB 1SR5C 8ESTE 3TIUA 1CT0E 1L1NA 2ZHWH 1GMHF 2GGVB 3M35A 4ACAA 1F92A 1OSSA 1XUIA 4TYDA 4Y79A 1E37B 4YLUA 3OY6U 3RM2H 4Y11E 4UONA 4BNRA 4D7GA 3TH4H 2FOEA 2P16A 2XC0A 3PMBB 1YLNA 2YNAA 3Q3XA 3GY8A 3VB4A 1H8ED 3PO1C 1UTLM 2FX4A 1SOZA 4CR5A 1FNIA 1GI1A 2BX3A 3FZDA 1BMFD 2OBOA 1FLEE 1UTKA 1V3XA 1FAKH 5A2MH 1SGYE 2P59A 2W26A 1L1JA 2VNTA 4X2VA 3E90B 4WJG2 4B2CA 1XXFA 3V12A 1KYNA 1RIWC 1FY1A 3DFLA 4K1TA 3FN8A 1TMUH 2PTCE 3I78A 3E3TA 3A7VA 3VPKA 1NTPA 2DE9A 3KQCA 3PROA 1VCWA 3UFAA 5EPNA 1K28D 1WAYB 1DVAH 1NFXA 5GXPA 2ZHFH 4BOHA 3VB6A 3NKKA 4X1QU 1MU8B 1DT2A 2FOMB 5I46H 1PFXC 5BRRE 1TPSA 2CMYA 2OC8A 1F2SE 1CT2E 2R2WU 4I8JA 3RXSA 1CA0C 1O2VA 3U69H 1O36A 3SZNA 3EDXB 3UR6A 2GD4B 2PV9B 1GDUA 3E6PH 1XKAC 1QL7A 3M7UA 5CHAB 1PPBH 1QRZA 3NZIA 2A5KA 2P3UB 1C2FA 1BDAA 6LPRA 1TRMA 1MCVA 2HWLB 3F0PA 7GCHF 2BY9X 1RTFB 2R3YA 4K3JA 4FVBA 1G36A 1Y3XA 1V2TT 4CH8B 2JH6D 4AFSA 1SGQE 1MTNB 1YLDA 1K9OE 2NU3E 3ZVEA 3O8BA 3U1IB 1ZLRA 1S6FA 1WV7H 3AK5A 2FZZA 3DA9B 4FU9A 2XC5A 1JXPA 4NIWA 2EY4C 1A2CH 4VGCC 3RC5A 5IDKA 1DSUA 4J2YB 1TRYA 2FS9A 2VWMA 3UTUH 5ESBA 1MTVA 2TRMA 3P8FA 3RP2A 2SNVA 2V35A 4TT3D 2GCTC 4Y7AA 1GG6B 2BLWA 2ZQ2A 2ZU5A 4BAKB 1C1WH 1BTXA 1HAHH 1C9TA 2A45B 2BDIA 4ACBA 4FUDA 1P2IA 5C0TA 1O2IA 2UWLA 1NFWA 1YWUA 4BAHB 1C1MA 2Z9JA 3PTNA 1JOUB 2H5DA 3JZ1B 1O30A 1O2TA 4I31A 4I33A 2A1DB 2P95A 3CNRA 3RXOA 3A8AA 1O3EA 3DSGA 1L2EA 4I8KA 4NZLA 3T29A 4NZQA 1MKXH 1Q3XA 1YCPM 4MVNA 4JK6A 1F0UA 2SGPE 1V2OT 4IS5A 1O35A 3P95A 2BTCE 8GCHG 3SU2A 1KXCA 3RMLH 1COWD 1EZUC 2AMQA 2Y5HA 1C5WB 1N8OB 1Q2WA 3GY2A 2ZNKH 2BQ6B 1KMHB 3AAVA 1M9UA 4K5ZA 2WPJS 5L2YH 1K1LA 3MO3A 1AB9B 4FUBA 1CBWC 2CK3D 1O3DA 3MU8A 3SNBA 2O9QA 1C1QA 2IOTA 6ESTA 2JIZD 3MNBA 1BHXF 2BDAA 3T2NA 1NRPH 2AFQB 1O3BA 1LVBA 1UHBB 2BM2A 5DP4A 3L3TA 4D8NA 2RA3A 2Z9LA 2ZGXH 1OXGA 1C5QA 2C4FH 2VWLA 1A46H 1OWDA 2A4QA 2J34A 4TY6A 5EXMA 1NBME 2KAIB 1TIOA 1ZMJA 2W6ID 3WWBA 4B73A 4FU7A 2Z3DA 4JK5A 1WOFA 2W7SA 3QN7A 2NWNA 3TJUA 1ID5H 2D26C 3RC4A 3ZVAA 1DUEA 1P02A 1E38B 2UUKB 3TU7H 1EUFA 2H9HA 3FFGA 1YPKH 4UFGH 4F49A 3CENA 1UJ1A 2M2AA 1T8OA 2ZCLP 1LTOA 2GKVE 1SHHB 1JRSA 2G52A 4AOQA 1EX3A 4NWLA 1PPHE 2EI8A 1AFQB 1UTJA 4YT6H 2UUYA 1JMOH 3TJNA 3PLKA 2SFAA 1G9IE 1PQAA 3ENSB 3SU0A 2IJD1 3DSPA 1DXWA 1BMMH 1P9SA 4Z0KA 5GDSH 1EASA 1PPFE 1VCPA 4IBLH 3RMOH 3VB7A 3VB3A 2BDGA 3NWUA 2PFEA 4IN1A 1G3BA 1UHBA 1MKWK 1O2ZA 4YOIA 1LQEA 1AKSB 1EJAA 4K8BA 2C3SA 4ISOA 2FYRA 1C4V2 1SPJA 1Y3UA 3BEFB 3BTFE 5HYOA 1WTGH 1C1OA 4BANB 1C2LA 1VCQA 3H09A 1VKYA 2P8OB 1BBRK 4TWYA 1ZSKA 3OEED 3UWIA 4DG4A 2AEIH 1UCYK 2AS9A 3LU9B 4QT8C 1BHXB 3O8CA 2BD4A 1AVGH 1WDIA 1O33A 5HIYA 1RRKA 1AHTH 1TABE 5LH8A 1P10A 2ZI2H 1UK3A 1D6RA 1HAXB 1S0RA 1MH0A 3GCTF 3LGTA 2QYIA 1ZR0A 1GBLA 1GHYH 4X2YA 5DG6A 3TGJE 2DUCA 2ZDAH 5HMAA 4GSOA 2ZU1A 1XUJA 2A7JA 2ALPA 1OYTH 2PSXA 1WQSA 4CRDA 3SYJA 3CS7A 1TONA 1HDTH 1SI5H 3K2UA 4IC6A 5CHBA 2V3OH 2UWPA 3E8LA 1NU7B 3LGIA 1TA2A 1GJCB 1AUJA 1HAOH 4WMFA 1AKSA 4JZIA 2V0BA 2QF4A 5GNDA 4NSYA 1Q31A 2R2MB 2ZHDA 1TYNA 2A7CA 3GCHC 2JH0D 3KHVA 4FUCA 3G01A 1O39A 2ZDVH 4B2BA 3P92A 1OWIA 2AMDA 1FPHH 4ZH8A 2GCTB 4FUHA 1GCTC 2V6NA 3SJ8A 2SGAA 1ELBA 1XXDA 2PR3A 2RCEA 3SW2B 1C1RA 5C1UA 4OGXA 4DT7B 2HNTF 4IGDA 1O2OA 2A2XH 1LPGB 2PGBB 2GV7A 1KXDA 4FUJA 2W3KA 3SNCA 1P3EA 2LELA 4MDSA 4K1EA 1IOEA 4TWWA 4XBCA 1QIXB 1IQKA 1EAIA 2QN5T 4Y10E 4FETA 1ZRKA 1NZQH 2THFB 3MNXA 4JYTA 5K7RA 1A3EH 1TGBA 3B9FH 3P8NA 5JBTA 1V2ST 1K1OA 1O0DH 1TALA 1TBRH 2QXJA 3Q00A 4BXSA 2P93A 1AU8A 3OU0A 3RXFA 3R3GB 4WXVA 3M7QA 1F0RA 2Z9KA 1OX1A 3RU4E 3LDXH 4I32A 1BBRE 1JIRA 3M5OA 2BOKA 1UCYE 2BVRH 1SC8U 2GCHG 1UTMA 3BG4B 4X1SU 1GJDB 4F55A 5AFZH 5EOKA 3GY5A 5DP6A 4WMEA 1GJ5H 2GMTB 1CBWB 5JYIA 4BAMB 1MD7A 2PW8H 2STAE 3NUMA 2J94A 2Y5FA 4ABJA 3PYHA 2HVXA 3TLOA 1O2UA 5DN6D 1ZJDA 2VB0A 3S7KB 1Y3YA 1WXRA 3KYGA 4YXWD 1A7SA 1ELEE 1BMAA 1ELVA 3U8OH 4A7IB 3A7XA 3TJOA 2OINA 2BY7X 3SU1A 2GDDA 1MTSA 1NRRH 3VXEH 2JJ1D 2OBQA 2FOGA 1LHGH 1O3IA 1XUFA 2C93B 4TY7A 3M3TA 4F4OC 5TJXA 4GCHG 2OUAA 3FP6E 1OHHD 1FY5A 1O2SA 1CU1A 3W95A 4YOGA 3VG8A 2H9TH 1TNGA 4CRCA 2QAAA 3RXTA 1C1PA 1D3TB 1HV7A 3T27A 2K8IA 5DP8A 4X2XA 1BJVA 1FY3A 1RTLA 5L6NH 2M5TA 5F8TA 5FX6A 3MTYA 1O34A 2P3TB 3N7EA 4FUEA 1JBUH 2ZA5A 1BA8B 5A8YA 1K1JA 4IN2A 1P3CA 2J97A 4H4FA 3SHAH 1HAZB 5EQQA 1GDNA 1TGSZ 3ZV8A 2AMPA 3K65B 4X8SH 5J4QA 3FZZA 1AY6H 3LKWA 1GVKB 5J4SA 1E34B 4DIHH 4K2YA 2A32A 1EP5A 4YOJA 1NU9A 1YM0A 1Z6JH 2UWOA 1A0JA 3EAJA 1HCGA 4UD9H 4JZFH 3LIWA 2PSYA 3A83A 2FEQH 3UOUA 1BJUA 2OC1A 1MTUA 1NC6A 3F6UH 3DCLA 1ZMLA 4ZHMU 2BY6X 3A86A 3BSQA 1S6HA 1AD8H 1J8AA 1EZQA 1LDTT 5E8EH 4B2AA 5CDFE 3E91A 4Q7YA 1O3JA 2Y81A 4ASHA 2P94A 2ZU4A 1Z1IA 4MNVA 1F5KU 1ZYOA 1O2GH 2W7UA 1O32A 1V2RT 1L1GA 1YP9A 1GI3A 1O2XA 3BTTE 2Z94A 3URDA 2ODQA 1VGCB 4INHA 1Y59T 3GOVB 1C1VH 1QHRB 3EE0B 3V0XA 4LOYH 1Z7KA 2Y7ZA 1SLWB 4Y0YE 1EPTA 2XWAA 3MH6A 2ZHQH 1MBQA 3T26A 6CHAC 1C5LH 1HB0B 2FLBH 4SGAE 2FOHA 2G4UA 3QZQA 1GHWH 1GI8B 1YPJH 2R9PA 5C2ZA 4AYYB 2WHXA 1HJ9A 4U30A 2VIPA 5HM2A 4X2WA 4PROA 1SGIB 2JETC 1RD3B 4ABDA 3BIVH 1V2QT 2VGCB 1GHBF 5GPIB 4AB9A 1OWHA 3RXLA 1HRTH 2ZZUH 2GZ8A 4A5TS 2ZP0H 1GCTB 1O3LA 1ANCA 3D23A 1BRAA 3SV6A 3M3SA 2EA3A 1TMBH 3LJJA 2FOFA 4GHQA 1Z6EA 4Y0ZE 2IJOB 3ZVDA 1HLTH 1GMDF 1TBZH 3W1EA 1AQ7A 2W5EA 4I8GA 1K1PA 4X8VH 2QXIA 4AORA 1JRTA 3K9XB 1C1UH 5LPRA 1GL0E 1MUEB 1P2OA 3ODFA 4FUGA 1C2KA 1YLCA 3GY7A 3GDUA 1YBWA 2RG3A 3LJOA 4ABFA 3QTVH 2ZTXA 2TIOA 2G81E 1O2YA 1ORFA 3OY5U 3SV8A 4IC5A 2XOKD 3QO6A 3RC6A 4O3TA 2ZDLA 2WSSD 3PRBA 3HKJB 4HTCH 4XBBA 1SQOA 1W0JD 4WF8A 4DURA 3V3MA 1K1NA 1W0ZU 1WSSH 1DWBH 2BHGA 3CS0A 3KNXA 3PRDA 3WW7A 1SGPE 3RXCA 1ZTKA 2GVFA 3S9CA 3SOSA 1GI4A 1C2EA 2YMSC 5DK1A 3EQ0H 3FP8E 4X6OA 2G51A 4YTAA 2KM0A 1K22H 3A84A 3ESTA 3OE7D 1MMJN 1TGCA 1MQ5A 2ODPA 3GDVA 1QBOA 3QWCH 2QV1A 2V3MA 1P06A 3UY9A 2J98B 1V2PT 3Q3KA 2BXTH 1IQFA 1TX7A 1ZTJA 2ANYA 1H9HE 2B7DH 4IW4E 2WV5A 4KELA 3U28C 1CHGA 3LC5A 2FYQA 3SV9A 3PLBA 4OS2A 2HGTH 1O31A 2ASUB 1H1BA 1BRBE 1ANDA 1C5XB 1DSTA 1GGDB 4M9FA 4MPWA 2RDEA 2ZCKP 3MH5A 1GVLA 4B6FA 3A88A 3MQKC 1E79D 5T6FA 3QTOH 1HBTH 3MH4A 3ZZ6A 2J2UA 3QX5H 2Y7XA 3UNRA 2PKAB 4UFEH 1HAVB 1TMTH 3SHCH 4JZDH 1TFXA 4A92A 2H9EH 1A5GH 1DM4B 1SB1H 1KTSB 2AIPA 5G4BA 2FTLE 3AASA 1Y8TA 3WWFA 2HALA 1ANEA 1QJ6B 4ZKRU 4ABAA 1HIAB 3ATIA 1GBEA 5JB8S 5L30H 3RMNH 8LPRA 1EAWA 1LO6A 1TOMH 4HGCA 1ZPBA 4O9VA 2H5CA 3HK3B 2XBVA 1SGFA 3OX7U 1IQHA 2QIQA 3AW1A 3ZVFA 3A87A 4BAOB 3ZZBA 4X8UH 2J98A 5EJZA 2EI6A 2PKSC 5FBEA 2TGDA 3BV9B 4OM9A 2FP7B 2H1UA 1TX6A 1MU6B 1C1NA 1WYKA 1FV9A 4OS5A 1L4DA 1D3PB 2FOCA 1H8IH 3S9AA 1LHDH 1GI7B 3BIUH 1HJAB 4BAQB 1E1QD 4J1YA 7ESTE 1O2RA 4ZXXH 1FY4A 3P17H 8GCHF 4JZEH 1H4WA 4NA7A 1K1IA 4AZ2B 2ILNA 2F91A 2PKAA 1XM1A 3RMMH 5C94A 1QNJA 4B75A 1MAYA 2WV4A 4DY7B 5KEDA 2GJGA 2JKHA 3T62A 5EQSA 4ISNA 1C5MD 2HNTE 1HAIH 2FI5E 2ZTZA 2TPIZ 1J16A 1AIXH 4THNH 5AVDA 3MU0A 2ZWLH 1DS2E 4WH8A 4RI0A 4RN6A 1SKYE 4UFDH 3GS9A 3LGVA 4FUFA 1TX8A 3U9AH 1TNKA 1ELDE 1GPZA 1F0SA 2WPDD 3SUEA 2VIQA 2ZFPH 1HJ8A 3MH7A 5F6MA 5LGOA 3FOAA 4OS6A 3ZZ5A 3KQBA 3L6PA 2A7HA 2NU4E 1O2HA 1N6XA 2XYAA 1VR1H 1CHOG 2UUFB 3ZZCA 3RXAA 5EGMA 3S0NA 2XNDD 5EJLA 2BOHB 4Q80A 1JWTA 3VB5A 4X8TH 2YMSD 5K0HA 1BB0B 3N7OA 5C5NA 3VEQB 4FU8A 4RT1A 5GWZA 3U1JB 1C5YB 3RU4T 2ZEBA 2C8ZB 5ABWA 3A80A 3I29A 1LHFH 4X6PA 1K2I1 1TWXB 2QF3A 3E16B 4SGBE 2QE7D 2FDAA 1P2KA 3HPTB 1KSNA 3P70B 4XD7D 2BB4A 3TH3H 4XOJA 4X1RU 3H7TA 4Z6AH 1G3EA 2XBXA 3F9GA 1C2JA 2GTBA 1BZXE 4Q7ZA 1QB6A 4FOUC 2XNIA 3RXEA 2Q6DA 5TCAA 3HKIB 3GY3A 1PPGE 1NROH 2QCYA 2A0QB 1K0HA 1A3BH 1GJAB 1UVUH 1J15A 2OXSA 4M7GA 1YCPH 2QA9E 1L4ZA 3GYLB 2FO9A 3SO3A 3SJ9A 1S6LA 4RKOB 1TAWA 1EAXA 2HPQH 2XXLA 3DUXH 4MNYA 4E7RG 2AH4X 2F9PA 4OS1A 1AZ8A 3EE7A 3Q76A 3PO1B 5SGAE 2XBYA 4MQAA 1BQYA 4O3UA 3UIRA 1EXFA 4CRGA 4B76A 4CRFA 5HXFA 3MYWA 1NN6A 3PWCA 5ESTE 4HZHA 1YPEH 1EPTC 1RIWB 3KIDU 1GBAA 2DE8A 5DJ7A 3HGNA 1EB2A 1BMNH 4X0WU 3ATWA 3LPRA 3MHWU 1LCYA 3A82A 1QY6A 1SHYA 5C67A 4ISHH 4Y8XA 2G00A 4CHAC 1NY22 2BXUH 2KAIA 3E0NB 1O3MA 1Z8IB 1QFKH 1O2JA 3KQDA 1DWDH 2KCOA 2BDYA 1CGIE 3RXBA 5GCHG 1O2LA 1UO6A 1UTPA 1DWCH 4KKDA 5F8ZA 3UB0A 2BY5X 3KGPA 2BX4A 1CA0B 3Q77A 4MNXA 4TSFD 3PV2A 4B71A 3PTBA 4GHTA 1GI0A 1DY8A 5FBIA 3O8DA 1S5SA 1HYLA 2ZGJA 2FMJA 1PQ7A 1W13U 4DT4A 5E0JA 5GIBA 1E36B 1C1TA 2ZPQA 1QJ1B 3KQEA 3TNSA 1E0FD 5E0GA 5EPYA 2VVVA 1AVXA 4P00A 1FN6A 3ZYDA 1BRCE 4JMYA 3GYMA 4XSKU 2F9VA 3PWBA 1YPGH 1PQ8A 4HI3A 5E0HA 4AFZA 5AFYH 2AGIX 2D8WA 1MD8A 1H9LB 2B8OH 1IAUA 1Y5AT 4VGCB 1KY9A 1TOCB 5LPEA 3IITA 2PKSB 1AN1E 1GHAG 3MNSA 1IHTH 2A31A 3UNQA 2SNWA 2BZAA 1KXBA 5F53A 4F48B 4I8LA 4ASUD 1O5AB 1QJ7B 2OD3B 1GBTA 2LNCA 2EEKA 1QL9A 1G32B 3F68H 3LGYA 1FQ3A 1QB9A 1GI2A 2BD2A 1FUJA 2ZGBH 1FXYA 1KLJH 4ISIH 4GPGA 1MCTA 3HGPA 3ZZ9A 1FX0B 2VH6A 2C8YB 2ZPRA 3UREA 4ZMAH 1DFPA 3SJKA 4ZKOU 2B9LA 1A0HB 1D3DB 5EIYA 2ZFTA 2GCHF 3K6ZA 3LGWA 2LP6A 1ARCA 2ANKH 1NM6A 1O5EH 3S7HB 1A61H 1FJSA 2YOLA 3TNTA 1DX5M 6GCHG 3BTGE 1Z8JB 2KX4A 5HKKD 4CRBA 3HATH 3KN2A 4K69A 1DY9A 4K60A 2CHAC 3LT3A 2VIVA 2FI3E 4XFQA 1BMLA 3ZIAD 1J9CH 1MAXA 1TPAE 1MTWA 1GL1A 3ATLA 4YLQH 1FI8A 2NU0E 3UNSA 1UVPA 2CF8H 3GICB 3C27B 5EODA 1QURH 1O3GA 2PGQB 4CBNA 3A7ZA 4YO9A 3OTJE 1EZSC 2ULLA 1O5GH 3GCOA 1KXFA 1TB6H 5F03A 1W10U 1GHXH 2FXRA 1SLXB 5EQRA 1O2PA 3DSOA 4GCHF 1C5PA 2JH5D 1AO5A 1PPEE 2A4RA 1Y5UT 2FPZA 2NU2E 1VITH 5AF9H 3A81A 4X6MA 2ZHEH 5H4IB 2WPIS 3PMJA 2RFKC 2LPRA 5FHTA 2WYJA 3A7TA 2KZ4A 1GWAA 5B6OA 2WUBA 4INLA 1S84A 4WWYA 1TNJA 5A09A 2ZO3H 3SV2H 3PLPA 3RXJA 5T6DA 2R0LA 3ZZ3A 2ALVA 1DOJA 1XMNB 2ZU3A 9ESTA 1CSOE 4LZ1H 3RXQA 1O5BB 4IMZA 5L2ZH 1C4U2 4D9QA 2PUXB 1ESTA 1UK2A 2ZU2A 5FL7D 2TGTA 2PLXA 4K8YA 1EOLA 4NIXA 4ZXYH 4IMQA 5C0UA 1O5FH 4Q63A 2PP6A 2XRCA 1VITG 2Z6BD 1NBMD 1UTOA 4AFQA 3ATMA 1NO9H 1MKXK 3OAAD 1MZAA 2PHBA 2AERH 5DKMA 1G30B 5CHAC 1WBGB 1XUHA 1GHZA 1W3CA 4LXBH 3E1XB 1UVTH 2BLOA 2XC4A 3E0PB 3M5LA 1GI5A 1ZPCA 2FIRH 5DPAA 1S81A 1B7XB 3BTME 2Z3CA 5JBBS 4MPXA 1D6WA 2OC7A 2KCYA 1MTNC 2ZDKA 2FM2A 2OP9A 1NPMA 2A5IA 3A8BA 2YNBA 2RA0A 3D49H 3KF2A 3TGIE 4ABEA 3ELAH 3O8RA 5HGGA 4HFPB 4KP0A 2XTTB 3ZVGA 2F9UA 1GDQA 5C5OA 4A1XA 2CJIA 2WV9A 3LGUA 1UMAH 1DXPA 5FPYA 2VVUA 1QQ4A 5JBCS 1UVSH 1S0QA 3CP7A 1SGRE 3RXUA 2UUJB 5C1XA 1GG6C 1NS3A 5EXLA 1AGJA 1DLEA 3JZ2B 4KTUA 1GI6A 1GMCF 1FONA 4Q4LA 1XKBC 2FX6A 2J4IA 2FLRH 3BG8A 1GJ9B 2ANMH 1C1SA 7KMEH 4H6TA 5KECA 2QF5A 1PJPA 1GJ8B 3EA9A 4GUXA 5DP5A 4KGAA 1P2QA 3VFEA 1AWHB 2WINI 4A6LA 7LPRA 2WPMS 1SGEE 1E35B 1C2IA 4YESB 1QB1A 2F3CE 2XCFA 1V2UT 1D9IA 2IPQX 4TPIZ 5DSFA 1TLDA 3DHKH 1DUAA 2K1QA 4Q7XA 1DICA 4UE7H 4E06H 1LHEH 1O3KA 2F4LA 2ZGHA 5DGJA 2B0FA 1MKWH 1YCPK 2WYGA 3GCHB 1PPZA 1OS8A 1V2JT 2J92A 1N8OC 1QRWA 1DWEH 3WY8A 2A5AA 1SQRA 1Z8GA 1GBKA 1OOKB 4LK4A 4ZAEA 1P09A 1UW7A 1AB9C 3M5MA 1GBBA 1H9IE 1CE5A 1V6DA 1V2VT 1ESAA 5FX5A 1UCYH 1MZDA 1DPOA 1O5CB 5ETXA 4AX9H 3A7WA 1SGFG 3SQHE 2O8UA 1ELAA 1SL3A 4Y76A 1ZMNA 3DD2H 1D4PB 4DW2U 4H6SB 1IQNA 3MU5A 3SU4A 2L74A 1WU1A 1OYQA 1SVPA 1ZGIA 1TRNA 1WCZA 4AG1A 1OKXA 2WZQA 1SLUB 1ETRH 2H2ZA 2ZCHP 3FAOA 3TITA 1KXAA 1T4VH 2V3HH 4X1PU 1O2KA 1B0EA 4ZKSU 1OWEA 5C3NA 1WUNH 2KCPA 3S69A 4X1NU 3LH3A 1T8LA 1O3FA 5T6GA 1YC0A 1BUIA 1NRQH 2KFWA 1Z1JA 4GVUA 4UFFH 1ESBA 1NFYA 1KXEA 2Z7FE 4O03A 3QLPH 1C4Y2 5DP7A 4R8TB 2QXGA 2VINA 2ZFRH 1SMFE 2XWBI 1HUTH 3QK1A 2BLVA 2IPHA 3NCLA 5IYTA 1FY8E 5A0BA 2J5UA 3SN8A 1FN8A 3FO8D 4ABHA 3M3VA 2Y82A 2EC9H 1FZZA 4E7NA 3T25A 5EG4A 1AFQC 1X7AC 3RU4D 1GJ7B 1EJMA 3OTPA 1V2MT 2BLQA 1GMHG 1H8HD 5FAHA 3D65E 1CVWH 1EATA 2V7QD 1ABIH 2ZG0H 1MQ6A 5EW1H 2VIOA 4Q2KA 4U32A 4XBDA 3RLYH 3TJVA 1P03A 4AB8A 3MI4A 2O8MA 1G3CA 1TNHA 3SU5A 2FODA 1W11U 1CQQA 4DCDA 1YPHC 2FI4E 1JIMA 1G3DA 1P8VC 2R3UA 1SOTA 1QTFA 2VH0A 1ZTLA 2ESTE 3KQ5A 1SBWA 1ZSJA 1EJNA 1Z71A 2P8OC 4MLFB 3NXPA 1W0KD 5CMXH 4NCYA 1P2MA 2ZTYA 1C5VA 2ZPSA 3LC3A 2F9NA 2OQ5A 2ZDMA 4AG2A 5E2PA 1QL8A 1V2WT 1WQVH 1VZQH 4P02A 3C1KA 2GX4A 5LPFA 5FCKA 2AHME 3ZZAA 2SGDE 5B6LA 2H6MA 1T4UH 2BD5A 2Z9IA 1PPCE 3OYPA 3P8GA 2OLGA 2JDID 2VU8E 1EP6A 1O3OA 2I6QA 1AE8H 1C5RA 1EKBB 1A1RA 3FVFB 1Z8RA 5JB9S 1EFRD 1EOJA 1TPOA 3QZRA 1P05A 2OQUA 4I8HA 1O38A 3UUZA 3PB1E 1GBJA 1AVWA 3ZYEA 1OP2A 3V13A 1T8MA 2OC0A 2BD9A 4NFEA 7GCHG 3AW0A 1NESE 3SNDA 1C5SA 1SFQB 1IHSH 2BD8A 4R0IA 2CGAA 3DFJA 2GT8A 3M5NA 2ZECA 3PV5A 2F43B 3D62A 4NG9H 1DLKB 1ELFA 1THSH 4H42U 4B74A 4ISLA 3F3BA 1O3NA 9LPRA 3AVZA 1HAVA 4KTCA 2ZIQH 5FPSA 1A4WH 2Q6GA 3RDZA 4A1TA 3BTHE 2FOBA 2EI7A 3RXKA 2O8WA 6CHAB 4K1SA 3TK9A 3TK5A 1Y5BT 1THRH 1HPGA 1CHOF 2BD3A 5FXLA 2C90B 1HIAA 1F0TA 1F5RA 1WTHD 4JYUH 3N7DA 3NK8A 5A0CA 1GCDA 1SFIA 3L33A 3B8JA 1TE0A 1HXEH 3MOCA 4ABIA 2GDEH 4YM9A 2JETB 1LPZB 1J17T 4FUIA 4Z1MD 4D7FA 2FOAA 1W2KH 1SGNE 5T1VA 1SQTA 1C5TA 4Y8ZA 5FPTA 3ATKA 3SBKA 1QCPA 1SGTA 1RFNA 1P11E 1TBQH 1O3PB 1ANBA 1GBCA 2J38A 1O3AA 2HPPH 2D1JA 4DGJA 3TGKE 5F8XA 1QA7A 3RXMA 3BG4C 1G2LA 3FANA 3M37A 1FDPA 2ZGCA 4JCNA 5DP3A 1QBNA 5C20A 2GMTC 3AAUA 1FPCH 4DOQA 3IG6B 4CBOA 1O5DH 4WH6A 3VXFH 1DE7H 4ZKNU 2KCAA 4HG6A 2G4TA 1D3QB 1O3HA 1TGTA 2BY8X 1DITH 4BTTB 1OPHB 1P12E 4ZROA 2VIDA 2VWOA 1ZGVA 2BDBA 3FKSD 4E05H 2G5VA 1ZZZA 2OK5A 1YF4A 1AMHA 5IK2D 1KTTB 1YPMH 2GZ7A 5JPMH 1GJ6A 3MO6A 4WY3A 2W6JD 3STJA 1LMWB 4AN7A 1KDQB 1BTUA 1P01A 2W3IA 1KIGH 1QGFA 5GJ4B 1TNIA 1W8BH 3PMHB 1UTQA 2Y5GA 4XDEA 4MTBA 3KCGH 1KLIH 2BVXH 1TQ0B 3A8CA 4I7YH 2WPKS 5A8XA 3MMGA 4GLYA 1OP0A 2YMSB 4CRAA 1YPLH 2HNTC 1ELGA 1GBHA 4D9RA 1G2MA 2F83A 4FVDA 1A5HA 1AI8H 1T7CA 4JZ1A 5AHGH 1BTWA 4AFUA 2PUQH 3SUDA 3UR9A 2CV3A 4BXWA 4GAWA 1ZSLA 5FCRA 2VIWA 2G5NA 3LH1A 1BTYA 4TPYA 5GCHF 1UK4A 3SGQE 3TH2H 5CE1A 3ITIA 1XVOA 1FIZA 2GT7A 3STIA 1PQ5A 1YGCH 4WMDA 3SUFA 1C5ZB 1BRUP 1W7GH 3SNEA 3ZZ4A 3V7TA 1LKBA 4I86A 1HFDA 3SORA 2Y80A 3RXIA 1OWKA 1MBMA 3SZEA 2FTMA 1AE5A 3GY4A 2QXHA 1TQ7B 5TCCA 1XVMA 3BTEE 1KDQA 1AUTC 1XX9A 1AWFH 3PMAB 1C2HA 3TK6A 2FESH 3RXVA 1GBIA 4OS4A 2QY0B 3RLWH 3RXRA 1TPPA 3VGCC 3W94A 3RXGA 1INCA 4NFFA 2SGFE 1GJ4H 1Y3VA 1ABJH 1VJ9U 3BF6H 3Q3YA 4KTSA 1B5GH 1IQJA 2HRVA 1HAPH 3TVJB 1C2GA 3BTWE 3RM0H 4UEHH 1VGCC 1ARBA 4Y8YA 2BQ7B 2OTVA 1GHAF 1NRSH 3F1SB 1SLVB 1HGTH 3BEIB 1TNLA 4WVPE 2WPLS 4JYVH 2A4OA 4B6EA 1P0SH 3UAIC 1VJAU 1ACBE 1ZJKA 1XUGA 1EQ9A 4MNWA 2K0QA 1PYTC 1IQLA 1ELTA 1V2LT 2BDCA 3GY6A 5C17A 1G37A 1THPB 4O97A 2ZQ1A 3SU3A 3A85A 1QQUA 1V2NT 1C5NH 3GCTG 4Y7BA 5HIZA 1T32A 4U2WA 1SG8B 2CXVA 2AGGX 1DANH 1C9PA 1S82A 3R0FA 2J95A 2WPHS 3MNCA 4A1VA 4BTUB 5A8ZA 2HLCA 1O2MA 1YYY1 2O8LA 5PTPA 2VGCC 6GCHF 3F9FA 3QDZB 3ZVBA 1ZHRA 1FMGA 3KL6A 1GBFA 3B23B 1N6YA 5EJ1A 3M7TA 3FP7E 2Q6FA 1HAGE 2VVCA 2PTNA 2CF9H 5BPEA 3F2HA 3KEEA 1H8DH 2BZ6H 1AFEH 2F9OA 4NSVA 1RGQA 1C2MA 1TA6A 2GP9B 2TGPZ 1LKAA 1BT7A 4CREA 3ZZ7A 2VJ1A 2EQNA 3ZVCA 1C5UA 1GHVH 2STBE 5C1YA 3SNAA 2BVSH 4AC9A 3A7YA 1CGHA 1T8NA 1EB1H 3BN9A 3PM3A 2AYWA 3P6ZB 4Y71A 1BOQA 1C2DA 4D76A 3URCA 2QC2A 2R0KA 4Y6DA 2GZ9A 1LPKB 1N1LA 3MWIU 1K1MA 2B5TB 3EYDA 2ZFSA 1GI9B 2ZFFH 1SGCA 2QF0A 3F2FA 3OSYA 2I6SA 4MG3A 3U8RH 8KME2
chains in the Genus database with same CATH topology
3IWMA 2GV6A 4NWKA 3UWJH 1O3CA 3A89A 3BTQE 3SGBE 1LVMA 4NIVA 1P04A 1O2QA 1TGNA 1W14U 2P3FH 3LOXA 3H5CB 1QRXA 2Q1JA 1HAYB 5DO4H 1IQIA 1EAUA 2FWWA 2J9NA 1J14A 4ZHLU 1ZHMA 2WUCA 2ZKSA 3F9EA 1ZHPA 3SJOA 3SUGA 4ESTE 2XCNA 3RXDA 4AGKA 1VITF 5DP9A 2IN2A 3LONA 3SGAE 2ODYB 3BEUA 3TPIZ 3SI3H 3DT0H 3ZV9A 4YZUA 3T5FH 2VWNA 2AGEX 1RTKA 1O2NA 5E2OA 1T31A 1RJXB 2ZF0H 1GGDC 1W0YH 2D2DA 4NA9H 1LHCH 2G8TA 4X6NA 2C8WB 1NRNH 4ABGA 2Z9GA 1HXFH 2ZFQH 3QGJA 2ZDNA 3P8OA 5HM9A 4CR9A 1HNEE 1B0FA 3SJIA 1QR3E 2BD7A 3F9HA 1EPTB 4XE4A 1A5IA 1OWJA 3EA8A 1O37A 3MFJA 2HOBA 4CHAB 3ODDA 1S85A 4AGJA 5JDUB 2BQWB 2CN0H 5T3HA 3RXHA 1PYTD 3M36A 1F7ZA 2AIQA 2C8XB 4MPVA 1ELCA 4YT7H 3ZZ8A 4CH2B 1LVOA 4BTIB 2O8TA 3I77A 1S83A 4DVAU 1FIWA 1ETTH 5JBAS 4RSPA 3ZZDA 2Y6TA 1NFUA 5EU8A 4RKJB 1V2KT 3PV4A 1P2JA 5EXNA 1IQGA 3MU4A 1AZZA 3UPEA 1LVYA 2SGEE 2TBSA 3MU1A 3K6YA 3VGCB 3UOPA 1HJAC 4NIYA 1BCUH 1YKTA 4OGYA 2A4GA 5I25A 2FS8A 1L0ZA 1UTNA 3BTDE 1P57B 1SGDE 3RXPA 3SQEE 1A0LA 3EA7A 4AYVB 3SI4H 3S9BA 1BTZA 2BYAX 3GCNA 1W12U 1XUKA 1P9UA 1ETSH 2OCVB 3RUOA 2SGQE 1SSXA 3BTKE 2A2QH 1BTPA 1P2NA 4WXIA 2F9BH 1BTHH 3UQVA 3GDSA 3SV7A 1Y3WA 4MPUA 1O2WA 1CO7E 1IQEA 3UQOA 1F5LA 3U8TH 2ZC9H 1RS0A 4ZUHA 1QA0A 2XBWA 4B1TA 1GMCG 5A0AE 3EGKH 4UDWH 2Z3EA 4NGAH 1BBRH 4NA8A 3QGNB 1ZOMA 2G55A 1C5OH 1FAXA 3SU6A 1CGJE 3HK6B 1GJBB 1GBDA 4DIIH 1QBVH 1GBMA 1BIOA 1DDJA 4LZ4B 4INKA 1LQDB 1CT4E 2TGAA 2XW9A 4DJZB 2ANWA 2RDLA 4FXGH 2QGRA 3U98H 3M61U 1OP8A 1GVZA 1W7XH 1K21H 1ZRBA 1IQMA 3QUMP 1CA8B 1U6QA 4U01A 1YPHE 1GHBG 1KLTA 1ZPZA 2BDHA 4ABBA 1BITA 2NU1E 3A8DA 2CHAB 1UVOA 3T28A 5EW2H 3NPSA 1RXPA 3MO9A 4OS7A 4ZHAA 2PWXA 1SQAA 2BMGB 1NT1A 1EZXC 3H7OA 1GMDG 3GISB 1SR5C 8ESTE 3TIUA 1CT0E 1L1NA 2ZHWH 1GMHF 2GGVB 3M35A 1F92A 1OSSA 1XUIA 4TYDA 4Y79A 1E37B 4YLUA 3OY6U 3RM2H 4Y11E 4UONA 4BNRA 4D7GA 3TH4H 2FOEA 2P16A 2XC0A 3PMBB 2YNAA 3Q3XA 3GY8A 3VB4A 3PO1C 1UTLM 2FX4A 1SOZA 4CR5A 1FNIA 1GI1A 2BX3A 3FZDA 2OBOA 1FLEE 1UTKA 1V3XA 1FAKH 5A2MH 1SGYE 2P59A 2W26A 1L1JA 2VNTA 4X2VA 3E90B 4WJG2 4B2CA 1XXFA 3V12A 1KYNA 1RIWC 1FY1A 3DFLA 4K1TA 1TMUH 2PTCE 3I78A 3E3TA 3A7VA 3VPKA 1NTPA 2DE9A 3KQCA 3PROA 1VCWA 3UFAA 5EPNA 1K28D 1WAYB 1DVAH 1NFXA 5GXPA 2ZHFH 4BOHA 3VB6A 3NKKA 4X1QU 1MU8B 1DT2A 2FOMB 5I46H 1PFXC 5BRRE 1TPSA 2CMYA 2OC8A 1F2SE 1CT2E 2R2WU 4I8JA 3RXSA 1CA0C 1O2VA 3U69H 1O36A 3SZNA 3EDXB 3UR6A 2GD4B 2PV9B 1GDUA 3E6PH 1XKAC 1QL7A 3M7UA 5CHAB 1PPBH 1QRZA 3NZIA 2A5KA 2P3UB 1C2FA 1BDAA 6LPRA 1TRMA 1MCVA 2HWLB 7GCHF 2BY9X 1RTFB 2R3YA 4K3JA 4FVBA 1G36A 1Y3XA 1V2TT 4CH8B 2JH6D 4AFSA 1SGQE 1MTNB 1YLDA 1K9OE 2NU3E 3ZVEA 3O8BA 3U1IB 1ZLRA 1S6FA 1WV7H 2FZZA 3DA9B 4FU9A 2XC5A 1JXPA 4NIWA 3RC5A 1A2CH 4VGCC 5IDKA 1DSUA 4J2YB 1TRYA 2FS9A 2VWMA 3UTUH 5ESBA 1MTVA 2TRMA 3P8FA 3RP2A 2SNVA 2V35A 2GCTC 4Y7AA 1GG6B 2BLWA 2ZQ2A 2ZU5A 4BAKB 1C1WH 1BTXA 1HAHH 1C9TA 2A45B 2BDIA 4FUDA 1P2IA 1O2IA 2UWLA 1NFWA 4BAHB 1C1MA 2Z9JA 3PTNA 1JOUB 2H5DA 3JZ1B 1O30A 1O2TA 4I31A 4I33A 2A1DB 2P95A 3RXOA 3A8AA 1O3EA 4I8KA 1L2EA 4NZLA 3T29A 4NZQA 1MKXH 1Q3XA 1YCPM 4MVNA 4JK6A 1F0UA 2SGPE 1V2OT 4IS5A 1O35A 3P95A 2BTCE 8GCHG 3SU2A 1KXCA 3RMLH 1EZUC 2AMQA 2Y5HA 1C5WB 1N8OB 1Q2WA 3GY2A 2ZNKH 2BQ6B 3AAVA 1M9UA 4K5ZA 2WPJS 5L2YH 1K1LA 3MO3A 1AB9B 4FUBA 1CBWC 1O3DA 3MU8A 3SNBA 2O9QA 1C1QA 2IOTA 6ESTA 3MNBA 1BHXF 2BDAA 3T2NA 1NRPH 2AFQB 1O3BA 1LVBA 1UHBB 2BM2A 5DP4A 3L3TA 4D8NA 2RA3A 2Z9LA 2ZGXH 1OXGA 1C5QA 2C4FH 2VWLA 1A46H 1OWDA 2A4QA 2J34A 4TY6A 5EXMA 2KAIB 1TIOA 1ZMJA 4B73A 4FU7A 2Z3DA 4JK5A 1WOFA 2W7SA 3QN7A 2NWNA 3TJUA 1ID5H 2D26C 3RC4A 3ZVAA 1DUEA 1P02A 1E38B 2UUKB 3TU7H 1EUFA 2H9HA 3FFGA 1YPKH 4UFGH 4F49A 3CENA 1UJ1A 1T8OA 2ZCLP 1LTOA 2GKVE 1SHHB 1JRSA 2G52A 4AOQA 1EX3A 4NWLA 1PPHE 2EI8A 1AFQB 1UTJA 4YT6H 2UUYA 1JMOH 3TJNA 3PLKA 2SFAA 1G9IE 1PQAA 3ENSB 3SU0A 1DXWA 1BMMH 1P9SA 4Z0KA 5GDSH 1EASA 1PPFE 1VCPA 4IBLH 3RMOH 3VB7A 3VB3A 2BDGA 3NWUA 2PFEA 4IN1A 1G3BA 1UHBA 1MKWK 1O2ZA 4YOIA 1LQEA 1AKSB 1EJAA 4K8BA 2C3SA 4ISOA 2FYRA 1C4V2 1SPJA 1Y3UA 3BEFB 3BTFE 5HYOA 1WTGH 1C1OA 4BANB 1C2LA 1VCQA 2P8OB 1BBRK 4TWYA 1ZSKA 3UWIA 4DG4A 2AEIH 1UCYK 2AS9A 3LU9B 4QT8C 1BHXB 3O8CA 2BD4A 1AVGH 1O33A 1RRKA 1AHTH 1TABE 5LH8A 1P10A 2ZI2H 1UK3A 1D6RA 1HAXB 1S0RA 1MH0A 3GCTF 3LGTA 2QYIA 1ZR0A 1GBLA 1GHYH 4X2YA 5DG6A 3TGJE 2DUCA 2ZDAH 5HMAA 4GSOA 2ZU1A 1XUJA 2A7JA 2ALPA 1OYTH 2PSXA 1WQSA 4CRDA 3CS7A 1TONA 1HDTH 1SI5H 3K2UA 4IC6A 2V3OH 2UWPA 3E8LA 1NU7B 3LGIA 1TA2A 1GJCB 1AUJA 1HAOH 4WMFA 1AKSA 4JZIA 2V0BA 4NSYA 1Q31A 2R2MB 2ZHDA 1TYNA 2A7CA 3GCHC 2JH0D 3KHVA 4FUCA 3G01A 1O39A 2ZDVH 4B2BA 3P92A 1OWIA 2AMDA 1FPHH 4ZH8A 2GCTB 4FUHA 1GCTC 2V6NA 3SJ8A 2SGAA 1ELBA 1XXDA 2PR3A 2RCEA 3SW2B 1C1RA 5C1UA 4OGXA 4DT7B 2HNTF 4IGDA 1O2OA 2A2XH 1LPGB 2PGBB 2GV7A 1KXDA 4FUJA 2W3KA 3SNCA 1P3EA 4MDSA 4K1EA 1IOEA 4TWWA 4XBCA 1QIXB 1IQKA 1EAIA 2QN5T 4Y10E 1ZRKA 1NZQH 2THFB 3MNXA 4JYTA 5K7RA 1A3EH 1TGBA 3B9FH 3P8NA 5JBTA 1V2ST 1K1OA 1O0DH 1TALA 1TBRH 2QXJA 3Q00A 4BXSA 2P93A 1AU8A 3OU0A 3RXFA 3R3GB 4WXVA 3M7QA 1F0RA 2Z9KA 1OX1A 3RU4E 3LDXH 4I32A 1BBRE 1JIRA 3M5OA 2BOKA 1UCYE 2BVRH 1SC8U 2GCHG 1UTMA 3BG4B 4X1SU 1GJDB 5AFZH 5EOKA 3GY5A 5DP6A 4WMEA 1GJ5H 2GMTB 1CBWB 5JYIA 4BAMB 1MD7A 2PW8H 2STAE 3NUMA 2J94A 2Y5FA 4ABJA 3PYHA 2HVXA 3TLOA 1O2UA 1ZJDA 2VB0A 3S7KB 1Y3YA 1A7SA 1ELEE 1BMAA 1ELVA 3U8OH 4A7IB 3A7XA 3TJOA 2OINA 2BY7X 3SU1A 2GDDA 1MTSA 1NRRH 3VXEH 2OBQA 2FOGA 1LHGH 1O3IA 1XUFA 2C93B 4TY7A 3M3TA 4F4OC 5TJXA 4GCHG 2OUAA 3FP6E 1FY5A 1O2SA 1CU1A 3W95A 4YOGA 2H9TH 1TNGA 4CRCA 2QAAA 3RXTA 1C1PA 1D3TB 1HV7A 3T27A 5DP8A 4X2XA 1BJVA 1FY3A 1RTLA 5L6NH 2M5TA 5F8TA 5FX6A 3MTYA 1O34A 2P3TB 4FUEA 1JBUH 2ZA5A 1BA8B 5A8YA 1K1JA 4IN2A 1P3CA 4H4FA 3SHAH 1HAZB 5EQQA 1GDNA 1TGSZ 3ZV8A 2AMPA 3K65B 4X8SH 5J4QA 3FZZA 1AY6H 3LKWA 1GVKB 5J4SA 1E34B 4DIHH 4K2YA 2A32A 1EP5A 4YOJA 1NU9A 1YM0A 1Z6JH 2UWOA 1A0JA 3EAJA 1HCGA 4UD9H 4JZFH 3LIWA 2PSYA 3A83A 2FEQH 3UOUA 1BJUA 2OC1A 1MTUA 1NC6A 3F6UH 1ZMLA 4ZHMU 2BY6X 3A86A 3BSQA 1S6HA 1AD8H 1J8AA 1EZQA 1LDTT 5E8EH 4B2AA 3E91A 4Q7YA 1O3JA 2Y81A 4ASHA 2P94A 2ZU4A 1Z1IA 4MNVA 1F5KU 1ZYOA 1O2GH 2W7UA 1O32A 1V2RT 1L1GA 1YP9A 1GI3A 1O2XA 3BTTE 2Z94A 3URDA 2ODQA 1VGCB 4INHA 1Y59T 3GOVB 1C1VH 1QHRB 3EE0B 3V0XA 4LOYH 1Z7KA 2Y7ZA 1SLWB 4Y0YE 1EPTA 2XWAA 3MH6A 2ZHQH 1MBQA 3T26A 6CHAC 1C5LH 1HB0B 2FLBH 4SGAE 2FOHA 2G4UA 3QZQA 1GHWH 1GI8B 1YPJH 2R9PA 5C2ZA 4AYYB 5HM2A 1HJ9A 4U30A 2VIPA 4X2WA 4PROA 1SGIB 2JETC 1RD3B 4ABDA 3BIVH 1V2QT 2VGCB 1GHBF 5GPIB 4AB9A 1OWHA 3RXLA 1HRTH 2ZZUH 2GZ8A 4A5TS 2ZP0H 1GCTB 1O3LA 1ANCA 3D23A 1BRAA 3SV6A 3M3SA 2EA3A 1TMBH 3LJJA 2FOFA 4GHQA 1Z6EA 4Y0ZE 2IJOB 3ZVDA 1HLTH 1GMDF 1TBZH 1AQ7A 2W5EA 4I8GA 1K1PA 4X8VH 2QXIA 4AORA 1JRTA 3K9XB 1C1UH 5LPRA 1GL0E 1MUEB 1P2OA 3ODFA 4FUGA 1C2KA 1YLCA 3GY7A 3GDUA 1YBWA 2RG3A 3LJOA 4ABFA 3QTVH 2ZTXA 2TIOA 2G81E 1O2YA 1ORFA 3OY5U 3SV8A 4IC5A 3QO6A 3RC6A 4O3TA 2ZDLA 3HKJB 4HTCH 4XBBA 1SQOA 4WF8A 4DURA 3V3MA 1K1NA 1W0ZU 1WSSH 1DWBH 2BHGA 3CS0A 3KNXA 1SGPE 3RXCA 1ZTKA 2GVFA 3S9CA 3SOSA 1GI4A 1C2EA 5DK1A 3EQ0H 3FP8E 4X6OA 2G51A 4YTAA 1K22H 3A84A 3ESTA 1MMJN 1TGCA 1MQ5A 2ODPA 3GDVA 1QBOA 3QWCH 2QV1A 1P06A 3UY9A 1V2PT 3Q3KA 2BXTH 1IQFA 1TX7A 1ZTJA 2ANYA 1H9HE 2B7DH 4IW4E 2WV5A 4KELA 3SV9A 1CHGA 3LC5A 2FYQA 3PLBA 4OS2A 2HGTH 1O31A 2ASUB 1H1BA 1BRBE 1ANDA 1C5XB 1DSTA 1GGDB 4MPWA 2ZCKP 3MH5A 1GVLA 3A88A 5T6FA 3QTOH 1HBTH 3MH4A 3ZZ6A 2J2UA 3QX5H 2Y7XA 3UNRA 2PKAB 4UFEH 1HAVB 1TMTH 3SHCH 4JZDH 1TFXA 4A92A 2H9EH 1A5GH 1DM4B 1SB1H 1KTSB 2AIPA 5G4BA 2FTLE 3AASA 1Y8TA 2HALA 1ANEA 1QJ6B 4ZKRU 4ABAA 1HIAB 3ATIA 1GBEA 5JB8S 5L30H 3RMNH 8LPRA 1EAWA 1LO6A 1TOMH 4HGCA 1ZPBA 4O9VA 2H5CA 3HK3B 2XBVA 1SGFA 3OX7U 1IQHA 2QIQA 3AW1A 3ZVFA 3A87A 4BAOB 3ZZBA 4X8UH 5FBEA 2PKSC 2EI6A 2TGDA 3BV9B 2FP7B 2H1UA 1TX6A 1MU6B 1C1NA 1WYKA 1FV9A 4OS5A 1L4DA 1D3PB 2FOCA 1H8IH 3S9AA 1LHDH 1GI7B 3BIUH 1HJAB 4BAQB 4J1YA 7ESTE 1O2RA 4ZXXH 1FY4A 3P17H 8GCHF 4JZEH 1H4WA 4NA7A 1K1IA 4AZ2B 2ILNA 2F91A 2PKAA