4R8TB

Structure of jev protease
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
141
structure length
141
Chain Sequence
TTTGVYRIMARGILGTYQAGVGVMYENVFHTLWHTTRGAAIMSGEGKLTPYWGSVKEDRIAYGGPWRFDRKWNGTDDVQVIVVEPGKAAVNIQTKPGVFKTPLGEVGAVSLDYPRGTSGSPILDSNGDIIGLYGNGVELGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine protease subunit NS2B
publication title Fast native-SAD phasing for routine macromolecular structure determination.
pubmed doi rcsb
source organism Japanese encephalitis virus
total genus 25
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4r8tB02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4r8tB01
1Y3VA 1YP9A 2BD8A 2VWOA 3PMJA 3T5FH 5EPYA 3PV4A 4Y0ZE 1F5RA 2QA9E 3L6PA 1GDNA 5LPFA 2YNBA 3RXGA 1ZHRA 4JZDH 3ZVGA 1D3DB 2YNAA 4MNVA 3RXAA 3UQVA 4JZEH 2GDEH 1AB9B 1TABE 2F91A 3ZZ5A 3LGUA 5JDUB 2RCEA 1TNGA 2B7DH 1IAUA 3P8GA 1MZDA 3JZ1B 1O2TA 1SOTA 1J9CH 4B2CA 1PJPA 2QF3A 2V3HH 1F0SA 4AFZA 1DWCH 1O2PA 1MBQA 1P03A 1LPKB 1PQ5A 1SGPE 3PB1E 3ITIA 4OS5A 1VITG 4Y76A 3TK6A 3SYJA 1OWEA 1GJCB 1HXEH 4CREA 1ANCA 3MU8A 3FP7E 5CHAC 1ZRBA 4B73A 4AFSA 2O8UA 1O2YA 1CA0C 3UR6A 1CHOF 1DSTA 1EB1H 1S5SA 3UR9A 1HJ9A 1T4VH 4U32A 1BTYA 1O2XA 4GPGA 4ZAEA 4FUHA 4JYTA 1MZAA 5E0JA 1BUIA 3T28A 1DLEA 1KXCA 2FTMA 3PTNA 3SV2H 3QZQA 4AN7A 4NGAH 1HPGA 3LH3A 1XMNB 2PFEA 2WPJS 1O3JA 4UD9H 1NRRH 5C1UA 3I29A 1YYY1 3SU5A 4OS7A 3PO1B 2FZZA 1FQ3A 5FBEA 3A83A 2R2MB 5GIBA 1QA7A 3P6ZB 1C4U2 3LIWA 1ZGIA 1WTGH 2WPIS 4CR5A 5JBCS 2BDGA 2ZDVH 1Z6JH 1NRSH 3IG6B 2OBOA 4X1NU 4I8LA 3ZZ6A 2OXSA 2WYGA 4BTIB 1D9IA 2SNVA 2ZFFH 5ESBA 3ZYDA 2GMTB 1HCGA 1Y5AT 2J4IA 3ATLA 2AIPA 4MPWA 1AO5A 1K1IA 2BXTH 1KLJH 1P2JA 1V6DA 2Y6TA 1TBZH 4UFDH 4F49A 4YLQH 1C5RA 3FZZA 5CE1A 1IQJA 5FPTA 1TPAE 2ZF0H 1TPSA 1ZR0A 2BY7X 1DANH 2A31A 2I6SA 2FOHA 7LPRA 1V2KT 4RKOB 1KYNA 1V2LT 3NKKA 4I33A 2C8WB 4TYDA 1G2MA 1SOZA 3UTUH 1ARBA 4TY7A 1UVUH 1THPB 2NU4E 3KNXA 1CA8B 1O39A 3RMOH 1ZTKA 4ISNA 3SQHE 4A92A 3VXEH 2AYWA 1XVMA 1QRXA 1GJ5H 3ZVCA 3ZZ8A 4E06H 1G9IE 3E1XB 1XUKA 1LHGH 1O2ZA 1A2CH 4Y7AA 1J15A 4B74A 1RTLA 4HTCH 3L33A 2J2UA 2XCNA 1W0ZU 3A85A 5PTPA 1D4PB 3TGIE 2A2XH 2BHGA 1AHTH 2HNTE 3RXKA 1QTFA 2CN0H 3AW0A 5L2ZH 1OWIA 1O3KA 3QZRA 2ZU3A 5T6DA 1GI7B 4XSKU 2IJD1 1O2HA 2NWNA 3A86A 4HZHA 4GVUA 1BQYA 1TQ7B 2FI3E 1OYQA 1HXFH 2WZQA 4AZ2B 4DIHH 2A4QA 3BTKE 1UK3A 2ANMH 2P95A 1YCPK 5F8XA 2TGPZ 1VZQH 5HGGA 1BITA 2G00A 1P2NA 1GHXH 3QK1A 1W7GH 4NIXA 3LJJA 2QN5T 1NU7B 3MH4A 1ELEE 2G5VA 4GHTA 3KCGH 4DOQA 1O2NA 2GV6A 4B76A 1O30A 4X6NA 3ZZDA 3GCHB 4B71A 2ZFPH 3LT3A 1NZQH 3D49H 3MH5A 4CHAB 4K5ZA 5A0CA 2FPZA 1CBWC 3P70B 4X6MA 4MNWA 1QRWA 4MTBA 3EA8A 1WYKA 1GHWH 3MTYA 2UWPA 1GMDF 1Z8RA 2BY8X 1LVYA 3NWUA 5TJXA 1W7XH 1WU1A 1DX5M 2Y5GA 4CRAA 1DUEA 1VJAU 5C1XA 1V2VT 2HGTH 1KXFA 1NS3A 5AVDA 3QX5H 2STBE 3MI4A 1YPEH 3ZZ3A 1HIAA 1P06A 4FVDA 3F1SB 2FOCA 3BTME 1YCPH 4E7RG 2PUQH 3LGIA 4CRBA 1AIXH 3RUOA 3F9HA 1YPGH 1Z7KA 2GZ9A 1GMCF 2XRCA 1TIOA 1SGFA 4UFGH 1W8BH 5H4IB 2AS9A 5E2PA 1AN1E 2J92A 2ZTZA 3EGKH 1ETSH 3SU1A 1O2KA 1W0YH 3RXFA 1MH0A 2V3OH 3DD2H 1T7CA 3URCA 4FUCA 4IC5A 1TGTA 4B6FA 1NY22 3KF2A 3M5LA 5FBIA 3VXFH 1QJ7B 1HB0B 1WTHD 1E38B 1T8NA 3FP6E 1O3LA 3SU3A 2ESTE 2BDBA 2ZDKA 3BIUH 8LPRA 6GCHG 1RS0A 1E37B 4K1SA 4WH8A 4BOHA 3B23B 1HAXB 1ZPCA 4UFEH 1GHVH 3BEFB 3ELAH 2PKSC 4AFUA 3RMNH 1A4WH 3MNBA 1QY6A 1MKXK 1LCYA 3O8CA 4KP0A 1ABJH 2M5TA 4ZHMU 2CHAC 4J1YA 1K28D 1MD7A 3RXBA 5IDKA 3B8JA 2FMJA 2ZPSA 4KELA 1O2IA 1UCYK 3SJIA 5HYOA 2D1JA 4BAQB 4INKA 4MPVA 1ZJKA 2QIQA 2GCHG 3ZVEA 2QY0B 1K1MA 1YPJH 2EI6A 4D9QA 1GBBA 2BLQA 2JKHA 5A8XA 2ZU5A 4D76A 1D6RA 3HKJB 9LPRA 1GJ8B 1S0QA 4NIYA 2FLBH 2C93B 1AFQB 3ATMA 2AGIX 2OP9A 1FPCH 2CV3A 1BTHH 3KQCA 2OQUA 1SHHB 1ZZZA 3BF6H 3BTGE 1AQ7A 1UTJA 1V2NT 2Q6DA 4U01A 1PPFE 3BG8A 3DA9B 2ZGHA 2WPHS 2BTCE 3UOPA 1DM4B 3SUGA 1ETTH 3HATH 3D65E 3ATWA 1U6QA 4JYVH 4ABBA 1SGIB 1AMHA 1WQSA 2NU0E 2G81E 4DVAU 1BBRE 1L4ZA 3Q3XA 3SJ8A 4ISLA 4QT8C 4Y79A 2VJ1A 1UCYH 1A0HB 1O3AA 3A89A 2W26A 3GY8A 1BIOA 4FVBA 1C5XB 4H4FA 2HPQH 4DGJA 2ZI2H 1E35B 1V2ST 3PMAB 1A5HA 1VGCC 4H42U 5EXNA 2OLGA 4CR9A 1C5OH 2BD4A 1GWAA 1GVKB 1O38A 2ZGCA 2ZU1A 1RXPA 1XUJA 1BDAA 3C1KA 1UTKA 3LH1A 2ZDNA 3HGNA 1QBVH 3K6ZA 1OWDA 3PROA 1AE5A 1DICA 4M7GA 3FFGA 1N8OB 2VIWA 3SV8A 3M7UA 4B6EA 4I7YH 1G3EA 4O3UA 3A7TA 1O2GH 2QXIA 3CS7A 3E0NB 2SNWA 7ESTE 1LVMA 1RIWC 1C2LA 5G4BA 1MQ5A 1IQLA 1UTNA 1AWFH 1E34B 1ELAA 4Q2KA 1O2RA 1SBWA 1OWKA 3QGJA 2BY6X 1SQTA 2P3UB 4OM9A 5ESTE 2XBYA 5EQRA 3A80A 3S9BA 1O2JA 1ESAA 2FI4E 3VB3A 1EZSC 1SB1H 4O3TA 1CT4E 3MNSA 1O2SA 1SGTA 1GBEA 1BRUP 2H1UA 1O3MA 1UJ1A 3RXJA 1UO6A 4K2YA 1SGNE 1TALA 2QAAA 4D8NA 2VGCC 1TRNA 2HOBA 2Z9GA 2Z9IA 4MPUA 2LNCA 4DCDA 1XM1A 3V0XA 3E6PH 4KTUA 1O5BB 3T2NA 2BDCA 1H1BA 1A1RA 1SLWB 3MH7A 1PYTD 1DY8A 1VITF 1LHFH 3GDSA 1ZHMA 4H6SB 3M5MA 4YT6H 4AGJA 2BQ7B 3NPSA 3MWIU 1XUFA 5A8ZA 1J17T 1JXPA 1C1WH 1GBJA 3LPRA 4WMEA 2GX4A 3OYPA 1NROH 2GKVE 4BXWA 4B2AA 1CE5A 1IHSH 4FUDA 3ZVFA 1P57B 1QB1A 1W11U 1QIXB 3PTBA 2DUCA 5I46H 1DSUA 5T3HA 1O33A 4R8TB 1CVWH 1C1UH 4Q7ZA 1BTZA 5DK1A 4GUXA 2WPMS 2JETB 2VNTA 3S9AA 3RXHA 1VJ9U 2VIPA 3ZVAA 1P0SH 4MG3A 3SNAA 3SNEA 1AZ8A 3PLBA 1FAKH 2BD7A 2FLRH 1G32B 2FEQH 4X1PU 3JZ2B 3RLWH 4DG4A 3MO9A 1DXPA 5A0AE 3M37A 1Z71A 2ALVA 1HDTH 4GCHG 4CH2B 4O03A 3RXDA 1T8LA 3VPKA 1LHEH 3U8RH 3P8OA 3TJNA 1GGDC 4NA9H 2UWLA 1BTXA 1PQ7A 1KSNA 2Q6GA 1ZYOA 2FS8A 5C1YA 3UPEA 3GDUA 4KTSA 1XKAC 3P17H 2VVUA 5JBTA 2R0KA 2AMDA 1FY3A 1KXAA 2F3CE 3BIVH 1ZLRA 3LOXA 3OY5U 1QGFA 4VGCC 4WY3A 3TJOA 1P02A 1LHDH 3PM3A 3RXRA 2ZCKP 3T26A 1GG6B 1SQOA 2BOKA 4KTCA 3RM0H 3NCLA 5DG6A 1C1QA 2BZAA 1G36A 4JCNA 3GOVB 1O3PB 1C4Y2 1K22H 1EZQA 1K1PA 2DE9A 1Z6EA 5CMXH 1O5GH 2G51A 1J14A 1O5CB 5HM2A 4YTAA 5GDSH 5EW1H 2FM2A 2GZ7A 1Y3WA 2GT8A 2JETC 3KIDU 4WXVA 1AUTC 4IBLH 1OKXA 2EC9H 1K2I1 4D7FA 1O3FA 5F6MA 3LJOA 2ODQA 2YOLA 3V7TA 3KQBA 1YPHC 4NSYA 1CO7E 2OINA 2ZTXA 4IC6A 3TH4H 1Z8GA 4JYUH 1D3PB 4Q7YA 1GBDA 1HRTH 1N6XA 2XBVA 1V2OT 2C8XB 1C2EA 1FIZA 4B1TA 1TA2A 3RM2H 5EXMA 3A84A 1OOKB 2ZHQH 2IOTA 3HK6B 1EPTA 1JRTA 2A45B 1YF4A 1SVPA 1A46H 2BDYA 2ZDLA 2ZU2A 1ANDA 1BOQA 3SV7A 3LU9B 4ZUHA 2A4GA 1YLCA 2EEKA 4BXSA 1LQDB 1C1NA 1DT2A 4SGBE 5JBBS 1TGCA 2BVSH 1DDJA 2XXLA 4B2BA 2ZU4A 3KEEA 3QUMP 3SJ9A 2G52A 1EAXA 4AB8A 1KLIH 5J4SA 2BM2A 3LC3A 1OWJA 1GG6C 1LMWB 1ABIH 3EYDA 2A2QH 3M7QA 4XDEA 1TBQH 3SQEE 2VWNA 3SUFA 1NM6A 1CGJE 1TBRH 2C4FH 2ZDAH 1WCZA 1GBLA 3PMHB 4UE7H 1CT0E 3RU4E 1PPZA 5HM9A 1P2KA 3M7TA 3LDXH 2RA3A 4O97A 1J8AA 1XVOA 1C1MA 4FXGH 1HNEE 1LQEA 3AK5A 4CBOA 1KXEA 5EXLA 4JMYA 4O9VA 4WVPE 1P12E 4NA8A 1G30B 1AB9C 8KME2 1O3CA 2Y81A 1ZTLA 1LTOA 4NZQA 1PPEE 1CT2E 1WOFA 1DS2E 5L30H 1EQ9A 2EI7A 2OCVB 1K1JA 1TAWA 1EXFA 3OSYA 1S84A 4D7GA 3HPTB 1GI0A 4OS4A 5JBAS 4X2VA 4YT7H 2CF9H 2VBCA 1H8IH 1FUJA 4WMFA 1JWTA 1NU9A 4J2YB 4TY6A 2NU1E 2WINI 5GCHG 1VCWA 4A1XA 4WF8A 1FAXA 5HMAA 1HJAB 3ATIA 1EP6A 1HIAB 3RXOA 4MQAA 7KMEH 2ZO3H 1CU1A 1JMOH 3ZVDA 3SI4H 3FAOA 5FCRA 4A1VA 1P3CA 4ZKOU 1AU8A 1W14U 2HNTF 6GCHF 1FI8A 1PQAA 1FONA 1QBOA 4LZ1H 3DHKH 2C90B 1MUEB 3PO1C 1RFNA 5JB9S 2UUYA 2ZIQH 3OX7U 3GCNA 3Q3KA 1C2JA 2A1DB 3LONA 1FXYA 1LO6A 5HXFA 2HVXA 1MD8A 1GJBB 1L1NA 1PFXC 2FP7B 1GJDB 1EOJA 2ZZUH 3T62A 1UTPA 1Q31A 1Y3UA 3TITA 3CS0A 1SL3A 1MTSA 1PPGE 2GCHF 2WUCA 5T1VA 3RXPA 1ESBA 1ORFA 2GMTC 1DPOA 3M35A 1C2GA 4Z0KA 4YESB 2RA0A 3M3SA 2P3FH 2QCYA 4ZHLU 3A88A 2BD5A 2JH5D 4HFPB 3CP7A 5C5NA 2ZNKH 2Z9JA 5DGJA 1HBTH 3PV5A 1XKBC 2FWWA 1YGCH 4ABDA 3FP8E 4X0WU 1P10A 1Y5UT 4OS1A 5L2YH 2GVFA 3FANA 1HJAC 3EDXB 1MAYA 2PSYA 1P09A 1GI5A 1FNIA 1MTNB 1P05A 1C5LH 6CHAB 1K1OA 3PMBB 1W12U 3P95A 1O37A 3EA7A 4CRGA 4NCYA 1B0FA 2NU3E 3VGCB 3F68H 5F8ZA 4Z6AH 4ISOA 3UIRA 1TGBA 4AX9H 2WPKS 2FOFA 1BB0B 2D26C 3STJA 2BMGB 1XUGA 1YCPM 1TNIA 3UQOA 1O2QA 1BTWA 1Q2WA 1GI2A 1DE7H 1ZMNA 3KQDA 4LK4A 2BVXH 2ZQ2A 3K2UA 2PV9B 5FPYA 3SNBA 4Y71A 2O8MA 2FS9A 1TX8A 3MU5A 1FJSA 4Y8XA 1C5YB 1O3EA 2I6QA 2HWLB 4I31A 1DITH 1UK2A 5AFZH 5C3NA 2Q6FA 2FTLE 2A4RA 3RXSA 1TGNA 1VR1H 2G5NA 1V2RT 4I32A 1A0LA 2ZTYA 3EAJA 1C5VA 4IN2A 1QBNA 1OWHA 2PKAA 2XC0A 1CSOE 3A81A 4UEHH 1C9TA 1UTLM 2HLCA 2BX4A 1O2VA 2UUKB 5A8YA 3RXCA 2JH0D 1SQAA 3GCHC 4WWYA 3URDA 2BDAA 2VVVA 1O3HA 7GCHG 1IQFA 1ZTJA 1HAGE 3UY9A 4CHAC 1NRNH 1SLUB 1H9LB 3GISB 4B75A 5T6GA 1GBAA 3VGCC 5DO4H 1BMLA 1GBMA 1GCTB 4A7IB 3BV9B 4FU7A 2BYAX 1L4DA 4AFQA 3MU4A 3OTPA 1O2MA 1XUHA 1T8MA 2ZFQH 1NRQH 1TOMH 2H5CA 2FDAA 3Q00A 4Q7XA 1GBKA 4K3JA 2WV9A 1AD8H 2CGAA 4ZXYH 1O3NA 1BHXF 3A8CA 1TLDA 4MPXA 1C2IA 4AG2A 3ATKA 3BTTE 2DE8A 2PTCE 3SJKA 5A2MH 2WUBA 2ZGXH 1IQNA 3TK9A 4X8UH 1TYNA 1O0DH 3IITA 1S0RA 1QL8A 1FPHH 1WQVH 2ZHFH 1AY6H 1KDQA 1OP8A 2FOGA 5FX6A 5EQQA 1O35A 2XYAA 2ZFRH 2CXVA 1KLTA 2Y5FA 1BA8B 3SHAH 3RLYH 2UWOA 2W5EA 2BVRH 2FIRH 4TWWA 3SZEA 1UCYE 3Q77A 2BQWB 1CQQA 2BLVA 5AF9H 3MO3A 2Z9KA 3AAUA 4YM9A 3RMMH 3GYMA 1VCQA 3MH6A 2ZP0H 2GDDA 1D3QB 1P04A 1UTMA 1HYLA 3SU0A 2PGQB 1FY8E 5TCCA 3RXVA 3VB7A 2P8OB 1SC8U 2ZGJA 3VB6A 1NO9H 2O8WA 1W3CA 3A7WA 1C2DA 4XFQA 2OBQA 5EPNA 4X2XA 1F2SE 3ZZ9A 1Z1IA 1S6FA 3RXQA 2R3UA 2V0BA 1AWHB 1P2IA 1TNKA 3FVFB 1XUIA 1JBUH 2WV5A 5E0GA 1ZMLA 4GCHF 4YO9A 3E91A 2AFQB 3U8TH 2AH4X 3MU0A 4IGDA 4CRDA 3KN2A 3UOUA 3EE0B 3GY7A 1GJ4H 1ANEA 1SI5H 1G3CA 3SW2B 5E2OA 4BNRA 4AGKA 2F9PA 4BAOB 1KXDA 2BDHA 2A5KA 1EASA 3S0NA 4U2WA 4BAHB 1WV7H 1RD3B 1UVPA 4K1EA 5L6NH 2D2DA 3ENSB 1QL7A 1FY1A 2Z7FE 1LPZB 4IW4E 4X8VH 2CMYA 1UVTH 1E0FD 1AFQC 1T31A 2VWLA 4RKJB 1V2PT 8GCHF 4I8JA 2F83A 1FMGA 2BD3A 4AYVB 4AG1A 1SFIA 3SN8A 3GY6A 3SHCH 1SLVB 1F0UA 2CJIA 3SNDA 1O3BA 1C5PA 1YPLH 1UTQA 4CRFA 3QGNB 3BG4B 1AI8H 3T25A 3M5OA 3KL6A 3RXIA 1AGJA 4NFEA 2ANWA 3MNCA 4FUJA 1GJ6A 1ZSJA 2GCTB 3KHVA 4AOQA 3SORA 1UTOA 1OSSA 4X8TH 4YOJA 2VWMA 1Y3XA 4A5TS 1EAWA 1K21H 2BD9A 4LXBH 1V2MT 1ZRKA 4NA7A 1DVAH 2CF8H 4Y0YE 3ZZAA 2WPLS 3EQ0H 3SV9A 1INCA 2FYQA 2TRMA 4INLA 2VIOA 4ABIA 3BEIB 2XBWA 3TNSA 1IQKA 1FV9A 5JYIA 1LDTT 4LZ4B 1LVBA 5DP8A 3SU2A 1W13U 1Y59T 1ELBA 5EODA 1F0TA 5EOKA 5F8TA 1FIWA 1GBCA 3TGJE 2P3TB 1EP5A 1L1JA 2KAIA 4MVNA 1F0RA 2W3KA 5FHTA 3UREA 3MFJA 2AGGX 2BY9X 1JIRA 2HALA 5C20A 1A7SA 3VEQB 1C2HA 2BX3A 2H6MA 1V2UT 1N8OC 1TMBH 1BMMH 2XBXA 5J4QA 1MTVA 2NU2E 1P3EA 5ABWA 2ZQ1A 5K7RA 1J16A 1UK4A 2ZC9H 3BG4C 1JIMA 1DWDH 2BY5X 2F9VA 3A7ZA 4OGXA 2A5AA 5DP7A 1MKWK 1TX7A 2V35A 2XW9A 3GY4A 1HAVA 1QA0A 3SI3H 1S83A 3SU6A 1YPHE 2H9TH 1Z8IB 3GDVA 1QQ4A 3SUDA 3RC5A 4LOYH 5ETXA 4BTUB 2V6NA 2Z6BD 3HKIB 3SGAE 2ZPQA 1AKSB 2JH6D 1GI6A 1FLEE 1QNJA 3UUZA 2GTBA 4RN6A 3A7YA 4Y8ZA 3K9XB 3RU4D 1SGCA 1TMUH 1C2MA 1MMJN 4ABJA 1EPTB 5E8EH 1O31A 2EI8A 1HLTH 1C1OA 4YOIA 1P01A 1ETRH 2WV4A 4IS5A 1VITH 4ASHA 3AASA 2Y7XA 1C5QA 3QO6A 3SGBE 1NFUA 1O5AB 2Q1JA 1HAOH 3U8OH 2ZCHP 3C27B 2H2ZA 3N7OA 1RJXB 2BOHB 3PWBA 1D3TB 1UMAH 2ZFSA 1Z8JB 2AGEX 3SJOA 5EGMA 1RGQA 2THFB 4DW2U 1RTKA 2VH0A 3GICB 2C3SA 5C5OA 2A7CA 5GCHF 2UUFB 3TH2H 4ABHA 1MKWH 5DP6A 4K1TA 1GBIA 8GCHG 2OD3B 1PQ8A 1DLKB 3L3TA 2UUJB 3MMGA 1BMAA 2QF0A 1C4V2 3A8DA 1FZZA 3LGWA 2RDLA 2SGFE 1EAUA 5GWZA 2VIQA 3ZZCA 5CHAB 3TJVA 2VU8E 3RXEA 4ZMAH 3GCTF 1V2WT 5T6FA 1S82A 1GCDA 2IN2A 1B7XB 1CA0B 1XX9A 1BRAA 1C1SA 1T32A 1GL1A 2A0QB 1QJ1B 3TK5A 4FUFA 4AYYB 2EA3A 1QQUA 3GY2A 2SFAA 3LKWA 4CBNA 4M9FA 1NPMA 3LC5A 1IQGA 4GHQA 3K6YA 1MTUA 6LPRA 1CGHA 1ZGVA 1BRCE 1K9OE 1LPGB 3E16B 3ZV9A 1AZZA 1O5DH 3S69A 4HI3A 1GI8B 1P2QA 1MTWA 1V3XA 4ZKSU 2ASUB 3SBKA 3ODFA 4XBBA 1EJNA 4ISHH 2OUAA 5AHGH 1GHAG 2OK5A 1AKSA 2K1QA 3STIA 2XCFA 4WH6A 1GBFA 2F4LA 2O8LA 5I25A 1F92A 4K69A 1ANBA 1T4UH 1AVXA 3P8NA 1M9UA 1AVWA 1D6WA 1WBGB 1EJMA 3O8DA 3BEUA 1EATA 1FY5A 3H7OA 4GLYA 4ABFA 1C5SA 1S6HA 1ZSKA 2B8OH 1GI3A 3S7HB 3F6UH 3A82A 1K1NA 3DFLA 1NRPH 3A7VA 1GMHG 1ESTA 1GJ7B 1GVZA 2GD4B 4K60A 1MU6B 2FI5E 3ZVBA 1A3BH 2BZ6H 2H9EH 1A61H 5DJ7A 4BAKB 1GHBF 4NG9H 2B5TB 1NN6A 2G55A 1BTPA 1O3IA 1O2WA 2TPIZ 1HAPH 2XC5A 3U69H 1ARCA 1G37A 2AIQA 3UNRA 1O2UA 2AMPA 2FODA 2GP9B 1C1TA 1GHYH 1N1LA 3GYLB 1GVLA 4ZXXH 2FOBA 3WY8A 3F9GA 1THRH 1PPBH 3MU1A 1O3GA 1L0ZA 1QL9A 1XXDA 5LH8A 2IJOB 2VH6A 8ESTE 1GBHA 2PTNA 1WAYB 2BQ6B 1V2QT 2BDIA 1GI9B 2W3IA 3TU7H 2BLWA 1MCVA 1UHBA 2P93A 1ID5H 2ODYB 1BTUA 1EZXC 1BZXE 3ODDA 1ACBE 1V2TT 4BAMB 3B9FH 1L2EA 2PLXA 4FUGA 1ELTA 5IYTA 3ZYEA 3U1IB 1HGTH 4Y10E 4I8GA 1O3OA 1MU8B 1H9HE 1B0EA 2XNIA 3P92A 4ZH8A 4Y6DA 7GCHF 1EZUC 2QV1A 1IHTH 4H6TA 2QXJA 3V13A 3GCTG 2ANKH 2SGQE 2Y80A 1Y8TA 1PYTC 3NXPA 1QJ6B 1OYTH 3ZZ4A 1Q3XA 2G4TA 1C1RA 3TH3H 1G3DA 5FXLA 3GCOA 3SV6A 2PKAB 1C2FA 3QWCH 4JK5A 4JZFH 1CBWB 2VB0A 4JZIA 2P16A 4WMDA 3U9AH 5GXPA 3M3TA 3DFJA 1WUNH 3NK8A 4IMQA 4CRCA 2P94A 4JZ1A 1FY4A 1L1GA 4SGAE 3VB4A 2FOMB 4IN1A 3Q3YA 1P8VC 1A5IA 1TPPA 1H9IE 4BANB 1C5MD 4NIVA 5EW2H 2OC8A 1MBMA 1OPHB 1YBWA 2XTTB 3TLOA 1SR5C 4UONA 1KTTB 5AFYH 3ZZBA 5C67A 1NC6A 1B5GH 1RTFB 3TVJB 5DP5A 1A0JA 1N6YA 2Y82A 4NWKA 1TOCB 3KGPA 1DY9A 1GJ9B 4NZLA 1OX1A 6ESTA 1WXRA 1MCTA 1W10U 3IWMA 2ZHEH 2W7SA 2GV7A 3P8FA 1K1LA 3UNSA 2BXUH 1HJ8A 2F9BH 1KDQB 2BB4A 3LGYA 1CHOG 1SFQB 1GPZA 2AERH 2PGBB 1GBTA 1SMFE 1F7ZA 1GHBG 1SHYA 2J95A 2Y5HA 3S7KB 1JRSA 5FCKA 2FYRA 2PR3A 1O2LA 3RXMA 5LGOA 1GI1A 3HGPA 1ZHPA 4GAWA 1AUJA 5DPAA 2ZECA 3RP2A 3H5CB 1LVOA 2WYJA 1UVOA 1VCPA 2GGVB 1DXWA 4X8SH 1DUAA 2PKSB 1HV7A 2QXHA 2ZGBH 1SGEE 3VFEA 2ZCLP 5JPMH 1EUFA 1X7AC 1EOLA 1BJVA 1C5NH 1XXFA 3SO3A 3R3GB 2CHAB 2OC0A 2F9OA 2Z9LA 3QLPH 1ELDE 2OQ5A 3OTJE 4BTTB 3NZIA 5DP9A 1AE8H 1QRZA 2F9UA 3PLKA 1ELFA 1SGFG 2J38A 3TJUA 1BCUH 3NUMA 1NFXA 3RXLA 4DJZB 3I78A 5JB8S 2FXRA 1TB6H 3A8AA 1CHGA 2HNTC 1YLDA 1Z1JA 1O5EH 1GDUA 2OC1A 1C5WB 1RRKA 1ZPBA 2O9QA 3MO6A 4MNYA 4DIIH 4OS6A 4NSVA 2QC2A 1C5UA 1MTNC 2SGPE 2Z3CA 1ZPZA 3RMLH 3SGQE 4E7NA 1YKTA 2FOEA 6CHAC 2ODPA 4ABAA 1SPJA 3OU0A 3W95A 5F03A 1C2KA 3M61U 4OS2A 5FX5A 1H8DH 3TPIZ 1CGIE 4YZUA 5C2ZA 5FPSA 2PSXA 1GHZA 2W7UA 4YOGA 3BSQA 5EQSA 3BTDE 2PW8H 1O5FH 2P59A 4XBCA 2ZA5A 3MNXA 5GNDA 1MQ6A 3UFAA 1HFDA 3S9CA 1TMTH 2VIDA 2PWXA 1NFYA 4Y8YA 3PV2A 3GY5A 1FDPA 1TNHA 2J9NA 1HAZB 2QYIA 3FZDA 4NIWA 1AVGH 2R0LA 2ALPA 1AFEH 2OTVA 1KIGH 2GZ8A 1DFPA 1VGCB 1O2OA 4FUBA 1HUTH 1YC0A 2Z94A 2WHXA 3PWCA 1TONA 4DY7B 3E8LA 1S81A 1DWBH 3BTQE 3K65B 3V3MA 4FUIA 2TGTA 1FN6A 2B0FA 4DURA 2XWAA 3DUXH 1C1PA 3M36A 1BBRK 1IQIA 1TA6A 2F9NA 3QN7A 1C9PA 5BRRE 3T27A 1PPCE 1HAHH 2IPHA 1IOEA 3Q76A 2R9PA 1YM0A 2KAIB 1BHXB 3HK3B 2SGEE 3OY6U 2LPRA 1GCTC 5B6OA 2ZWLH 1P2OA 1RIWB 2ZG0H 3R0FA 2TBSA 4D9RA 2ANYA 3SUEA 1OXGA 5EU8A 2ZEBA 1OP2A 1QCPA 1F5KU 3DT0H 1P2MA 3W94A 4PROA 1MKXH 1SGDE 3EA9A 3I77A 1QHRB 1GL0E 1W2KH 3E90B 1TX6A 5TCAA 1ZOMA 2VINA 4ISIH 1HAVB 1BMNH 4TWYA 4X1RU 1GMDG 1YPMH 1UVSH 1TRMA 1KTSB 2TGAA 3SZNA 1O34A 2G4UA 4WJG2 3RXTA 1BJUA 1G3BA 2H9HA 2VGCB 2R2WU 3TNTA 1P9UA 4X6PA 1EJAA 1GI4A 1WSSH 1BT7A 1THSH 1OS8A 1TNLA 5LPRA 4Q80A 2Z3EA 3RU4T 1TFXA 1ELCA 3H09A 3ZV8A 1Y3YA 3SOSA 1NFWA 1IQMA 2STAE 3VB5A 3AW1A 1HAIH 1BBRH 1TE0A 2AMQA 1O36A 4FU9A 1O32A 4ZKRU 1G2LA 1NT1A 5EG4A 5LPEA 2QXGA 4RI0A 1GMCG 4KGAA 3V12A 2C8YB 4HGCA 3SU4A 1NESE 4K8YA 2A4OA 3CENA 3RC4A 1GDQA 1F5LA 3M5NA 3BTWE 4DT7B 2P8OC 2B9LA 2QGRA 3PYHA 4JK6A 1DWEH 1FN8A 4XOJA 2H5DA 3MYWA 1V2JT 3T29A 1DOJA 4ESTE 1MAXA 4UFFH 1JOUB 2ZPRA 1GJAB 1SG8B 4YLUA 2Y7ZA 3ESTA 1QB9A 4MLFB 1QB6A 4X1QU 5FAHA 2XWBI 2HPPH 3BN9A 4WXIA 1TWXB 4INHA 3H7TA 1EB2A 3UWIA 1TRYA 2SGAA 2PUXB 2A7HA 1SGQE 4TPIZ 4ZKNU 2FX4A 1S85A 1GHAF 1ZJDA 4X2WA 4THNH 1IQEA 3AAVA 3BTEE 4Y11E 1Y5BT 4MDSA 2PHBA 1OP0A 4TPYA 2J34A 2ULLA 2ZKSA 5DP3A 1EAIA 4AB9A 1KXBA 2Z3DA 2VVCA 1YPKH 3GY3A 2D8WA 4AORA 5K0HA 2A32A 3KQEA 3RDZA 5A0BA 1A3EH 1HAYB 3UWJH 1EKBB 1KY9A 3O8RA 9ESTA 1GGDB 3PLPA 2AEIH 4FUEA 4ZHAA 1LKBA 1IQHA 1EX3A 1GMHF 1TNJA 3E3TA 1P11E 2XC4A 4RSPA 5SGAE 3RXUA 2GCTC 3UNQA 3M3VA 1SSXA 5BPEA 2C8ZB 4A6LA 4VGCB 4KKDA 3D23A 5GPIB 2O8TA 4K8BA 4XBDA 3QTVH 3BTFE 4I8KA 2TGDA 2ZHWH 2ZFTA 3G01A 3QDZB 4FU8A 3QTOH 3U98H 4ABGA 4GSOA 2VIVA 2FO9A 4ZROA 1P9SA 2GT7A 1C5ZB 1SGRE 4U30A 3TGKE 2OC7A 2BD2A 1C1VH 2J94A 1SLXB 1LKAA 4ABEA 5E0HA 1ZSLA 5A09A 1NTPA 1TPOA 3RC6A 1PPHE 2G8TA 1ZMJA 3E0PB 2FOAA 1BRBE 4NFFA 3AVZA 4Y7BA 1ELVA 4IMZA 5GJ4B 1LHCH 2TIOA 1TQ0B 4OGYA 3SNCA 3BTHE 3U1JB 1QR3E 2A7JA 4X1SU 5DKMA 2R3YA 3LGTA 4R0IA 4XE4A 4I8HA 3A7XA 4MNXA 4X6OA 2FESH 4F4OC 2RG3A 3F9EA 1T8OA 3MHWU 2ILNA 1O3DA 1E36B 1ELGA 3LGVA 1TGSZ 4X2YA 2BLOA 4UDWH 4E05H 1QURH 1QFKH 5B6LA 2A5IA 5DP4A 4A1TA 3A8BA 1SGYE 1UHBB 3ZZ7A 3D62A 4NWLA 3TIUA 3O8BA 2ZHDA 3A87A 2SGDE 2FX6A 1EPTC 2ZDMA 1H4WA 3MOCA 1C5TA 1A5GH 4CH8B 3F9FA 2HRVA
chains in the Genus database with same CATH superfamily
1Y3VA 1YP9A 2BD8A 2VWOA 3MQKC 3PMJA 3T5FH 5EPYA 3PV4A 4Y0ZE 1F5RA 2QA9E 3L6PA 1GDNA 5LPFA 2YNBA 3RXGA 1ZHRA 4JZDH 3ZVGA 1D3DB 2YNAA 4MNVA 3RXAA 3U28C 4JZEH 3UQVA 2GDEH 1AB9B 1TABE 2F91A 3ZZ5A 3LGUA 5JDUB 2RCEA 1TNGA 2B7DH 1IAUA 3P8GA 1MZDA 3JZ1B 1O2TA 1SOTA 1J9CH 4B2CA 1PJPA 2QF3A 2V3HH 1F0SA 4AFZA 1DWCH 1O2PA 1MBQA 1P03A 1LPKB 1PQ5A 2K8IA 1SGPE 3PB1E 2EY4C 3ITIA 4OS5A 1VITG 4Y76A 3TK6A 3SYJA 1OWEA 1GJCB 1HXEH 4CREA 1ANCA 3MU8A 3FP7E 5CHAC 1ZRBA 4B73A 3UUZA 4AFSA 2O8UA 1O2YA 4AC9A 1CA0C 3UR6A 1CHOF 1DSTA 1NBMD 1EB1H 1S5SA 3UR9A 1HJ9A 1T4VH 4U32A 1BTYA 1O2XA 4GPGA 4ZAEA 4P02A 4FUHA 4JYTA 1MZAA 5E0JA 1BUIA 3T28A 1DLEA 1KXCA 2FTMA 3PTNA 3SV2H 3QZQA 4AN7A 4NGAH 1HPGA 3LH3A 1XMNB 2PFEA 2WPJS 1O3JA 4UD9H 1NRRH 5C1UA 3I29A 1YYY1 3SU5A 2KCPA 4OS7A 5CHBA 3PO1B 2FZZA 1FQ3A 5FBEA 3A83A 2R2MB 5GIBA 1QA7A 3P6ZB 1C4U2 3LIWA 1ZGIA 1WTGH 2WPIS 4CR5A 5JBCS 2BDGA 2ZDVH 1Z6JH 1NRSH 3IG6B 2OBOA 4X1NU 4I8LA 3ZZ6A 2OXSA 2WYGA 4BTIB 1D9IA 2SNVA 2ZFFH 5ESBA 3ZYDA 2GMTB 1HCGA 1Y5AT 2J4IA 2F43B 3ATLA 2AIPA 4MPWA 1AO5A 1K1IA 2BXTH 1KLJH 1P2JA 1V6DA 2Y6TA 1TBZH 4UFDH 4F49A 4YLQH 1C5RA 3FZZA 5CE1A 1IQJA 5FPTA 1TPAE 2ZF0H 1TPSA 1ZR0A 2BY7X 1DANH 2A31A 2I6SA 2FOHA 7LPRA 1V2KT 4RKOB 1KYNA 1V2LT 3NKKA 4I33A 2C8WB 4TYDA 1G2MA 1SOZA 3UTUH 1ARBA 4TY7A 1UVUH 1THPB 2NU4E 3KNXA 1CA8B 1O39A 3RMOH 1ZTKA 4ISNA 3SQHE 4A92A 3VXEH 2AYWA 1XVMA 1QRXA 1GJ5H 3ZVCA 3ZZ8A 4E06H 1G9IE 3E1XB 1XUKA 1LHGH 1O2ZA 1A2CH 4Y7AA 1J15A 4B74A 1RTLA 4HTCH 3L33A 2J2UA 2XCNA 5C17A 1W0ZU 3A85A 5PTPA 1D4PB 3TGIE 2A2XH 2BHGA 1AHTH 2HNTE 3N99A 3RXKA 1QTFA 2CN0H 3AW0A 5L2ZH 1OWIA 1O3KA 3QZRA 2ZU3A 5T6DA 1GI7B 4XSKU 2IJD1 1O2HA 2NWNA 3A86A 4HZHA 4GVUA 1YWUA 1BQYA 1TQ7B 2FI3E 1OYQA 1HXFH 2WZQA 4AZ2B 4DIHH 2A4QA 3BTKE 1UK3A 2ANMH 2P95A 1YCPK 5F8XA 2TGPZ 1VZQH 2WPDD 5HGGA 1BITA 2G00A 1P2NA 3WWBA 1GHXH 3QK1A 1W7GH 1NBME 4NIXA 3VG8A 3LJJA 2QN5T 1NU7B 3MH4A 1ELEE 2G5VA 4GHTA 3KCGH 4DOQA 1O2NA 2GV6A 4B76A 1O30A 4X6NA 3ZZDA 3GCHB 4B71A 2ZFPH 3LT3A 1NZQH 3D49H 2EQNA 3MH5A 4CHAB 4K5ZA 5A0CA 2FPZA 1CBWC 2KZ4A 3P70B 4X6MA 2KCYA 4MNWA 1QRWA 4MTBA 3EA8A 1WYKA 1GHWH 3MTYA 2AHME 2UWPA 1GMDF 1Z8RA 2BY8X 1LVYA 3NWUA 5TJXA 2CK3D 1W7XH 1WU1A 1DX5M 2Y5GA 4CRAA 1DUEA 1VJAU 5C1XA 1V2VT 2HGTH 1KXFA 1NS3A 5AVDA 3QX5H 2STBE 3MI4A 1YPEH 3ZZ3A 1HIAA 1P06A 4FVDA 3F1SB 2FOCA 3BTME 1YCPH 4E7RG 2PUQH 3LGIA 4CRBA 1AIXH 3RUOA 4F48B 3F9HA 1YPGH 1Z7KA 2GZ9A 1GMCF 2XRCA 3OE7D 1TIOA 1SGFA 4UFGH 1W8BH 5H4IB 2AS9A 5E2PA 1AN1E 2J92A 2ZTZA 3EGKH 1ETSH 3SU1A 1O2KA 3DSPA 1W0YH 5C0TA 3RXFA 1MH0A 2V3OH 3DD2H 1T7CA 3URCA 4FUCA 4IC5A 1TGTA 4B6FA 1YLNA 1NY22 3KF2A 3M5LA 5FBIA 3VXFH 1QJ7B 1HB0B 1WTHD 1E38B 1T8NA 3FP6E 1O3LA 3SU3A 2ESTE 2BDBA 2ZDKA 3BIUH 8LPRA 6GCHG 1RS0A 1E37B 4K1SA 4WH8A 4BOHA 3B23B 1HAXB 1ZPCA 4UFEH 1GHVH 3BEFB 3ELAH 2PKSC 3OAAD 4AFUA 3RMNH 1A4WH 3MNBA 1QY6A 1MKXK 1LCYA 3W1EA 3O8CA 4KP0A 1ABJH 2M5TA 4ZHMU 2CHAC 4J1YA 1K28D 1MD7A 3RXBA 5IDKA 3B8JA 2FMJA 2ZPSA 4KELA 1O2IA 1UCYK 3SJIA 5HYOA 2D1JA 4BAQB 4INKA 4MPVA 1ZJKA 2QIQA 2GCHG 3ZVEA 2KR7A 2QY0B 1K1MA 1YPJH 2EI6A 4D9QA 1GBBA 2BLQA 2JKHA 5A8XA 2ZU5A 4D76A 1D6RA 3HKJB 9LPRA 1GJ8B 1S0QA 1YY3A 4NIYA 2FLBH 2C93B 1AFQB 3ATMA 2AGIX 1FPCH 2OP9A 2CV3A 1BTHH 3KQCA 2OQUA 1SHHB 1ZZZA 3BF6H 3BTGE 1AQ7A 1UTJA 3KQ5A 1V2NT 2Q6DA 4U01A 1PPFE 3BG8A 3DA9B 2ZGHA 2WPHS 2BTCE 3UOPA 1DM4B 3SUGA 1ETTH 3HATH 3D65E 3ATWA 1U6QA 4JYVH 4ABBA 1SGIB 1AMHA 1WQSA 4FOUC 2NU0E 2G81E 4DVAU 1BBRE 1L4ZA 3Q3XA 5HIYA 3SJ8A 4ISLA 4QT8C 4Y79A 4ACBA 1BMFD 2VJ1A 1UCYH 4XD7D 1A0HB 1O3AA 3A89A 2W26A 3CNRA 3GY8A 1BIOA 4FVBA 1C5XB 4H4FA 2HPQH 4DGJA 2ZI2H 1E35B 1V2ST 3PMAB 1A5HA 1VGCC 4H42U 5EXNA 2OLGA 4CR9A 1C5OH 2BD4A 1GWAA 1GVKB 1O38A 2ZGCA 2ZU1A 1RXPA 1XUJA 1BDAA 3C1KA 1UTKA 3LH1A 2ZDNA 3HGNA 1QBVH 3K6ZA 1OWDA 3PROA 1AE5A 1DICA 4M7GA 3FFGA 1N8OB 2VIWA 3SV8A 3M7UA 4B6EA 4I7YH 1G3EA 4O3UA 3A7TA 1O2GH 2QXIA 3CS7A 3E0NB 2SNWA 7ESTE 1LVMA 1RIWC 1C2LA 5G4BA 1MQ5A 1IQLA 1UTNA 1AWFH 1E34B 1ELAA 4Q2KA 1O2RA 1SBWA 1OWKA 3QGJA 2BY6X 1SQTA 2P3UB 4OM9A 5ESTE 2XBYA 5EQRA 3A80A 2QF5A 3S9BA 1O2JA 1ESAA 2FI4E 3VB3A 1EZSC 1SB1H 2RDEA 4O3TA 1CT4E 1FX0B 3MNSA 1O2SA 1SGTA 1GBEA 5EIYA 1BRUP 2H1UA 1O3MA 1UJ1A 2LELA 3RXJA 3GS9A 1UO6A 4K2YA 1SGNE 1TALA 2QAAA 4D8NA 2VGCC 1TRNA 2HOBA 2Z9GA 2Z9IA 4MPUA 2LNCA 4DCDA 1XM1A 3V0XA 3E6PH 4KTUA 1O5BB 4TSFD 3T2NA 2BDCA 1H1BA 1A1RA 1SLWB 3MH7A 5C94A 1PYTD 1DY8A 1VITF 1LHFH 3GDSA 1ZHMA 4H6SB 3M5MA 4YT6H 4AGJA 2BQ7B 2JJ1D 3NPSA 3MWIU 1XUFA 5A8ZA 1J17T 1JXPA 1C1WH 1GBJA 3LPRA 4WMEA 2GX4A 3OYPA 1NROH 2GKVE 4BXWA 4B2AA 1CE5A 1IHSH 4FUDA 3ZVFA 1P57B 1QB1A 1W11U 5KGOA 1QIXB 2KM0A 3PTBA 2DUCA 5I46H 1DSUA 5T3HA 2M2AA 1O33A 4R8TB 1CVWH 1C1UH 4Q7ZA 1BTZA 5DK1A 4GUXA 2WPMS 2JETB 2VNTA 3S9AA 3RXHA 1VJ9U 2VIPA 3ZVAA 4RT1A 1P0SH 4MG3A 3SNAA 2KX4A 3SNEA 1AZ8A 3PLBA 1UW7A 1FAKH 2BD7A 2FLRH 1G32B 2FEQH 4X1PU 3JZ2B 3RLWH 4DG4A 3MO9A 1DXPA 5A0AE 3M37A 1Z71A 2ALVA 1HDTH 4GCHG 4CH2B 4O03A 3RXDA 2XNDD 1T8LA 3VPKA 1LHEH 3U8RH 3P8OA 3TJNA 1GGDC 4NA9H 2UWLA 1BTXA 1PQ7A 1KSNA 2Q6GA 1ZYOA 2FS8A 5C1YA 3UPEA 3GDUA 4KTSA 1XKAC 3P17H 2VVUA 5JBTA 2R0KA 2AMDA 1FY3A 1KXAA 2F3CE 3BIVH 1ZLRA 3LOXA 3OY5U 1QGFA 4VGCC 4WY3A 3TJOA 1P02A 1LHDH 3PM3A 3RXRA 3DSOA 2ZCKP 3T26A 1GG6B 1SQOA 2BOKA 4Q4LA 4KTCA 3RM0H 3NCLA 5DG6A 1C1QA 2BZAA 1G36A 4JCNA 3GOVB 1O3PB 1C4Y2 1K22H 1EZQA 1K1PA 2DE9A 1Z6EA 5CMXH 1O5GH 2G51A 1J14A 1O5CB 5HM2A 4YTAA 5GDSH 5EW1H 2FM2A 2GZ7A 1Y3WA 2GT8A 2JETC 3KIDU 4WXVA 1AUTC 4IBLH 1OKXA 2EC9H 1K2I1 4D7FA 1O3FA 5F6MA 3LJOA 2ODQA 2YOLA 3V7TA 3KQBA 1YPHC 4NSYA 1CO7E 2OINA 2ZTXA 4IC6A 5DN6D 3TH4H 1Z8GA 4JYUH 1D3PB 4Q7YA 1GBDA 1HRTH 1N6XA 2XBVA 1V2OT 2C8XB 1C2EA 1FIZA 4B1TA 5EJ1A 1TA2A 3RM2H 3F2HA 5EXMA 3A84A 1OOKB 2ZHQH 2IOTA 3HK6B 1EPTA 1JRTA 2A45B 1YF4A 1SVPA 1A46H 2BDYA 2ZDLA 2ZU2A 1ANDA 1BOQA 3SV7A 3LU9B 4ZUHA 2A4GA 1YLCA 2EEKA 4BXSA 1LQDB 1C1NA 1DT2A 4SGBE 5JBBS 1TGCA 2BVSH 1DDJA 2XXLA 3OEED 2ZU4A 3KEEA 3QUMP 3SJ9A 4B2BA 2G52A 1EAXA 4AB8A 1KLIH 5J4SA 2BM2A 3LC3A 1OWJA 1GG6C 1LMWB 1ABIH 3EYDA 2A2QH 3M7QA 4XDEA 1TBQH 3SQEE 2VWNA 3SUFA 1NM6A 1CGJE 1TBRH 2C4FH 2ZDAH 1WCZA 1GBLA 3PMHB 4UE7H 1CT0E 3RU4E 1PPZA 5HM9A 1P2KA 3M7TA 3F2FA 2RA3A 3LDXH 1J8AA 1XVOA 4O97A 1C1MA 4FXGH 1HNEE 1LQEA 3AK5A 4CBOA 1KXEA 5EXLA 4JMYA 4O9VA 4WVPE 1P12E 4NA8A 1G30B 1AB9C 8KME2 3EE7A 1O3CA 2Y81A 1ZTLA 1LTOA 4NZQA 1PPEE 5F53A 1CT2E 1WOFA 1DS2E 5L30H 2J97A 1EQ9A 2EI7A 2OCVB 1K1JA 1TAWA 3F2GA 1EXFA 3OSYA 1S84A 4D7GA 3HPTB 1GI0A 4OS4A 4I86A 5JBAS 4X2VA 4YT7H 2CF9H 2VBCA 1H8IH 1FUJA 3KYFA 4WMFA 1JWTA 1NU9A 4J2YB 3FOAA 4TY6A 2NU1E 2WINI 5GCHG 1VCWA 4A1XA 4WF8A 1FAXA 5HMAA 1HJAB 3ATIA 1EP6A 1HIAB 3RXOA 4MQAA 7KMEH 2ZO3H 1CU1A 1JMOH 3ZVDA 3SI4H 3FAOA 5FCRA 4A1VA 1P3CA 4ZKOU 1AU8A 1W14U 2HNTF 6GCHF 1FI8A 1PQAA 1FONA 1QBOA 4LZ1H 3DHKH 2C90B 1MUEB 3PO1C 1RFNA 2XOKD 5JB9S 2UUYA 2ZIQH 3OX7U 3GCNA 3Q3KA 1C2JA 2A1DB 3LONA 1FXYA 1LO6A 5HXFA 2HVXA 1MD8A 1GJBB 1L1NA 1PFXC 2FP7B 1GJDB 1EOJA 2ZZUH 3T62A 1UTPA 1Q31A 1Y3UA 3TITA 3CS0A 1SL3A 1MTSA 1PPGE 2GCHF 2WUCA 5T1VA 3RXPA 1ESBA 1ORFA 2GMTC 2YMSD 1DPOA 3M35A 3DCLA 1C2GA 4Z0KA 4YESB 2RA0A 3M3SA 2P3FH 2QCYA 4ZHLU 3A88A 2BD5A 2JH5D 4HFPB 3CP7A 5C5NA 2ZNKH 2Z9JA 5DGJA 1HBTH 1VKYA 3PV5A 1XKBC 2FWWA 1YGCH 4ABDA 1OHHD 3FP8E 4X0WU 1P10A 1Y5UT 4OS1A 5L2YH 2GVFA 3FANA 1HJAC 3EDXB 1MAYA 2PSYA 1P09A 1GI5A 1FNIA 1MTNB 1P05A 1C5LH 6CHAB 1K1OA 3PMBB 1W12U 3P95A 1O37A 2J5UA 3EA7A 4CRGA 4NCYA 1B0FA 2NU3E 3VGCB 3F68H 5F8ZA 4Z6AH 3WWFA 4ISOA 3UIRA 1TGBA 4AX9H 2WPKS 2FOFA 2HVYB 1BB0B 2D26C 3STJA 2BMGB 1XUGA 1YCPM 1TNIA 3UQOA 1O2QA 1BTWA 1Q2WA 1GI2A 2WSSD 1DE7H 1ZMNA 3FN8A 3KQDA 4LK4A 2BVXH 2ZQ2A 3K2UA 2PV9B 5FPYA 2KCOA 3SNBA 4Y71A 2O8MA 2FS9A 1TX8A 3MU5A 1FJSA 4Y8XA 1C5YB 1O3EA 2I6QA 1W0JD 2HWLB 4XRNA 4I31A 1DITH 1UK2A 5AFZH 5C3NA 2Q6FA 2FTLE 2A4RA 3RXSA 1TGNA 1VR1H 2G5NA 1V2RT 4I32A 1A0LA 2ZTYA 3EAJA 1C5VA 4IN2A 1QBNA 1OWHA 2PKAA 2XC0A 1CSOE 3A81A 4UEHH 1C9TA 1UTLM 2HLCA 2BX4A 1O2VA 2UUKB 5A8YA 3RXCA 2JH0D 1SQAA 3GCHC 4WWYA 3URDA 2BDAA 2VVVA 1O3HA 7GCHG 2V7QD 1IQFA 1ZTJA 1HAGE 3UY9A 4CHAC 1NRNH 1SLUB 1H9LB 2QE7D 3GISB 4B75A 5T6GA 1GBAA 3VGCC 5DO4H 1BMLA 1GBMA 1GCTB 4A7IB 3BV9B 4FU7A 2BYAX 1L4DA 4AFQA 3MU4A 3OTPA 5KECA 1O2MA 1XUHA 2LP6A 1T8MA 2ZFQH 1NRQH 1TOMH 2H5CA 2FDAA 3Q00A 4Q7XA 1GBKA 2WV9A 4K3JA 1AD8H 2CGAA 4ZXYH 1O3NA 1BHXF 3A8CA 1TLDA 3F0PA 4MPXA 1C2IA 4AG2A 3ATKA 3BTTE 2DE8A 2PTCE 3SJKA 5A2MH 2WUBA 2ZGXH 1IQNA 3TK9A 4X8UH 1TYNA 1O0DH 3IITA 1S0RA 1QL8A 1FPHH 1WQVH 2ZHFH 1AY6H 1KDQA 1OP8A 2FOGA 5FX6A 5EQQA 1O35A 2XYAA 2ZFRH 2CXVA 1KLTA 2Y5FA 1BA8B 3SHAH 3RLYH 2UWOA 2W5EA 2BVRH 2FIRH 4TWWA 3SZEA 2V3MA 1UCYE 3Q77A 2BQWB 1CQQA 2BLVA 5AF9H 3MO3A 2Z9KA 3AAUA 4YM9A 3RMMH 3GYMA 1VCQA 3MH6A 2ZP0H 2GDDA 1D3QB 1P04A 1UTMA 1HYLA 3SU0A 2PGQB 1FY8E 5TCCA 3RXVA 3VB7A 2P8OB 1SC8U 1H8HD 2ZGJA 3VB6A 1NO9H 2O8WA 1W3CA 3A7WA 1C2DA 4XFQA 2OBQA 2YMSB 5EPNA 4X2XA 1F2SE 3ZZ9A 1Z1IA 1S6FA 3RXQA 2R3UA 2V0BA 1AWHB 1P2IA 1TNKA 3FVFB 1WDIA 1XUIA 1JBUH 2WV5A 5E0GA 1ZMLA 4GCHF 4YO9A 3E91A 2AFQB 3U8TH 2AH4X 3MU0A 4IGDA 4CRDA 3KN2A 3UOUA 3EE0B 3GY7A 1GJ4H 1ANEA 1SI5H 1G3CA 3SW2B 5E2OA 4BNRA 4AGKA 2F9PA 4BAOB 1KXDA 2BDHA 2A5KA 1EASA 3S0NA 4U2WA 4BAHB 1WV7H 1RD3B 1UVPA 4K1EA 5L6NH 2D2DA 3ENSB 1QL7A 1FY1A 2Z7FE 1LPZB 4IW4E 4X8VH 2CMYA 1UVTH 1E0FD 1AFQC 1T31A 2VWLA 4RKJB 1V2PT 8GCHF 4I8JA 2F83A 1FMGA 2BD3A 4AYVB 4AG1A 1SFIA 3SN8A 3GY6A 3SHCH 1SLVB 1F0UA 2CJIA 3SNDA 1O3BA 1C5PA 1YPLH 1UTQA 4CRFA 3QGNB 3BG4B 1AI8H 3T25A 3M5OA 3KL6A 3RXIA 1AGJA 4NFEA 2ANWA 3MNCA 4FUJA 1GJ6A 1ZSJA 2GCTB 3KHVA 4AOQA 3SORA 1UTOA 1OSSA 4X8TH 2KFWA 4YOJA 2VWMA 1Y3XA 4A5TS 1EAWA 1K21H 2BD9A 4LXBH 1V2MT 1ZRKA 4NA7A 1DVAH 2CF8H 4Y0YE 3ZZAA 2WPLS 3EQ0H 3SV9A 1INCA 2FYQA 3N7EA 2TRMA 4INLA 3KYGA 2VIOA 4ABIA 3BEIB 2XBWA 3TNSA 1IQKA 1FV9A 5JYIA 1LDTT 2JDID 4LZ4B 1LVBA 5DP8A 3SU2A 1W13U 1Y59T 3NRLA 1ELBA 5EODA 1F0TA 4F55A 2J98A 5EOKA 5F8TA 1FIWA 1GBCA 3TGJE 2P3TB 1EP5A 1L1JA 2KAIA 4MVNA 1F0RA 2W3KA 5FHTA 3UREA 3MFJA 2AGGX 2BY9X 1JIRA 2HALA 5C20A 1A7SA 3VEQB 1C2HA 2BX3A 2H6MA 1V2UT 1N8OC 1TMBH 4Q63A 1BMMH 2XBXA 5J4QA 1MTVA 2NU2E 1P3EA 5DSFA 5ABWA 2ZQ1A 5K7RA 1J16A 1UK4A 2ZC9H 3BG4C 1JIMA 1DWDH 2BY5X 2F9VA 5CDFE 3A7ZA 4OGXA 2A5AA 5DP7A 1MKWK 1TX7A 2V35A 2XW9A 3GY4A 1HAVA 1QA0A 3SI3H 1S83A 3SU6A 1YPHE 2H9TH 1Z8IB 3GDVA 1QQ4A 3SUDA 3RC5A 4LOYH 5ETXA 4BTUB 2V6NA 2Z6BD 3HKIB 4TT3D 2ZPQA 1AKSB 2JH6D 1GI6A 1FLEE 1QNJA 3SGAE 2GTBA 4RN6A 3A7YA 4Y8ZA 3K9XB 3RU4D 1SGCA 1TMUH 1C2MA 1MMJN 4ABJA 3UAIC 1EPTB 5E8EH 1O31A 2EI8A 1HLTH 1C1OA 4YOIA 2PP6A 1P01A 1ETRH 2WV4A 4IS5A 1VITH 4ASHA 3AASA 2Y7XA 1C5QA 3QO6A 3SGBE 1NFUA 1O5AB 1SQRA 2Q1JA 1HAOH 3U8OH 2ZCHP 3C27B 5IK2D 2H2ZA 3N7OA 4RT0A 1RJXB 2BOHB 3PWBA 1D3TB 1UMAH 2ZFSA 1Z8JB 2AGEX 3SJOA 3FO8D 5EGMA 1RGQA 2THFB 4DW2U 1RTKA 1EFRD 2VH0A 3GICB 2C3SA 5C5OA 2A7CA 5GCHF 2UUFB 3TH2H 4ABHA 1MKWH 5DP6A 4K1TA 4Z1MD 1GBIA 8GCHG 2OD3B 1PQ8A 1DLKB 3L3TA 2UUJB 3FKSD 3MMGA 1BMAA 2QF0A 1C4V2 5KEDA 3A8DA 1FZZA 3LGWA 2RDLA 2SGFE 1EAUA 5GWZA 1COWD 2VIQA 3ZZCA 5CHAB 3TJVA 2VU8E 3RXEA 4ZMAH 3GCTF 1V2WT 5HIZA 1MABB 5T6FA 1S82A 1GCDA 2IN2A 1B7XB 1CA0B 1XX9A 1BRAA 1C1SA 1T32A 1GL1A 2A0QB 1QJ1B 3TK5A 4FUFA 2QF4A 4AYYB 1SKYE 1QQUA 2EA3A 2SFAA 3GY2A 3LKWA 4P00A 4CBNA 4M9FA 1NPMA 3LC5A 1IQGA 4GHQA 3K6YA 1MTUA 6LPRA 1CGHA 1ZGVA 1BRCE 1K9OE 3OEHD 1LPGB 3E16B 3ZV9A 1AZZA 1O5DH 3S69A 4HI3A 1GI8B 1P2QA 1MTWA 1V3XA 4ZKSU 2ASUB 3SBKA 3ODFA 4XBBA 1E79D 1EJNA 4ISHH 2OUAA 5AHGH 1GHAG 2OK5A 1AKSA 2K1QA 3STIA 2XCFA 4WH6A 1GBFA 2F4LA 2O8LA 1H8ED 5I25A 4FETA 1F92A 4K69A 1ANBA 1T4UH 1AVXA 3P8NA 1M9UA 1AVWA 1D6WA 1WBGB 1EJMA 3O8DA 3BEUA 1EATA 1FY5A 3H7OA 4GLYA 4ABFA 1C5SA 1S6HA 1ZSKA 2B8OH 1GI3A 3S7HB 3F6UH 3A82A 1K1NA 3DFLA 1NRPH 3A7VA 1GMHG 1ESTA 1GJ7B 2W6JD 1GVZA 2GD4B 4K60A 2K0QA 1MU6B 2FI5E 3ZVBA 1A3BH 2BZ6H 2H9EH 1A61H 5DJ7A 4BAKB 1GHBF 4NG9H 2B5TB 1NN6A 2G55A 1BTPA 1O3IA 1O2WA 2TPIZ 1HAPH 2XC5A 3U69H 1ARCA 1G37A 2AIQA 3UNRA 1O2UA 2AMPA 2FODA 2GP9B 1QZ8A 1C1TA 1GHYH 1N1LA 3GYLB 1GVLA 4ZXXH 2FOBA 3WY8A 3F9GA 1THRH 1PPBH 3OFND 3MU1A 1O3GA 1L0ZA 1QL9A 1XXDA 5LH8A 2IJOB 2VH6A 8ESTE 1GBHA 2PTNA 1WAYB 3F0OA 2BQ6B 1V2QT 2BDIA 1GI9B 2W3IA 4YXWD 3TU7H 2BLWA 1MCVA 1UHBA 2P93A 1ID5H 4DT4A 2ODYB 1BTUA 1EZXC 1BZXE 3ODDA 1ACBE 1V2TT 4BAMB 3B9FH 1L2EA 2PLXA 4FUGA 1ELTA 5IYTA 3ZYEA 3U1IB 1HGTH 4Y10E 4I8GA 1O3OA 1MU8B 1H9HE 1B0EA 2XNIA 3P92A 4ZH8A 4Y6DA 7GCHF 1EZUC 2QV1A 1IHTH 4H6TA 2QXJA 3V13A 3GCTG 2ANKH 4HG6A 2SGQE 2Y80A 1Y8TA 1K0HA 1PYTC 3NXPA 1QJ6B 1OYTH 2HLDD 3ZZ4A 1Q3XA 2G4TA 1C1RA 3TH3H 1G3DA 5FXLA 3GCOA 3SV6A 2PKAB 1C2FA 3QWCH 4JK5A 4JZFH 1CBWB 2VB0A 4JZIA 2P16A 4WMDA 3U9AH 5GXPA 3M3TA 3DFJA 1WUNH 3NK8A 4IMQA 4ASUD 2IPQX 4CRCA 2P94A 3PRBA 4JZ1A 1FY4A 1L1GA 4SGAE 3VB4A 2FOMB 4IN1A 3Q3YA 1P8VC 1A5IA 1TPPA 1H9IE 4BANB 1C5MD 4NIVA 5EW2H 2GJGA 2OC8A 1MBMA 1OPHB 1YBWA 2XTTB 3TLOA 1SR5C 4UONA 1KTTB 5AFYH 1E1RD 3ZZBA 1NC6A 5C67A 1B5GH 1RTFB 3TVJB 5DP5A 1A0JA 1N6YA 2Y82A 4NWKA 1TOCB 3KGPA 1DY9A 1GJ9B 4NZLA 1OX1A 6ESTA 1WXRA 1MCTA 1W10U 3IWMA 2ZHEH 2W7SA 2GV7A 3P8FA 1K1LA 3UNSA 2BXUH 1HJ8A 2F9BH 1KDQB 2BB4A 3LGYA 1CHOG 3UB0A 1SFQB 1GPZA 2AERH 2PGBB 1GBTA 1SMFE 1F7ZA 1GHBG 1SHYA 2J95A 2Y5HA 3S7KB 1JRSA 5FCKA 2FYRA 2PR3A 1O2LA 3RXMA 5LGOA 1GI1A 3HGPA 1ZHPA 5HKKD 4GAWA 1AUJA 5DPAA 2ZECA 3RP2A 3H5CB 1LVOA 2WYJA 1UVOA 1VCPA 2GGVB 1DXWA 4X8SH 1DUAA 2PKSB 1HV7A 2QXHA 2ZGBH 1SGEE 3VFEA 2ZCLP 5JPMH 1EUFA 1X7AC 1EOLA 1BJVA 1C5NH 1XXFA 3SO3A 3R3GB 2CHAB 2OC0A 2F9OA 2Z9LA 3QLPH 1ELDE 2OQ5A 3OTJE 4BTTB 3NZIA 5DP9A 1AE8H 1QRZA 2F9UA 3PLKA 1ELFA 1SGFG 2J38A 3TJUA 1BCUH 1KMHB 1NFXA 3NUMA 3RXLA 4DJZB 3I78A 5JB8S 2FXRA 1TB6H 3A8AA 1CHGA 2HNTC 1YLDA 1Z1JA 1O5EH 1GDUA 2OC1A 1C5WB 1RRKA 1ZPBA 2O9QA 3MO6A 4MNYA 4DIIH 4OS6A 4NSVA 2QC2A 1C5UA 1MTNC 2SGPE 2Z3CA 1ZPZA 3RMLH 3SGQE 4E7NA 1YKTA 2FOEA 6CHAC 2ODPA 4ABAA 1SPJA 3OU0A 3W95A 5F03A 1C2KA 3M61U 4OS2A 5FX5A 1H8DH 3TPIZ 1CGIE 4YZUA 5C2ZA 5FPSA 2PSXA 2L74A 1GHZA 2W7UA 4YOGA 3BSQA 5EQSA 3BTDE 2PW8H 1O5FH 2P59A 4XBCA 2ZA5A 3MNXA 5GNDA 1MQ6A 3UFAA 1HFDA 3S9CA 1TMTH 2VIDA 2PWXA 1NFYA 4Y8YA 3PV2A 3GY5A 5C0UA 1FDPA 1TNHA 2J9NA 1HAZB 2QYIA 3FZDA 4NIWA 1AVGH 2R0LA 2ALPA 1AFEH 2OTVA 1KIGH 2GZ8A 1DFPA 1VGCB 1O2OA 4FUBA 1HUTH 1YC0A 2Z94A 2WHXA 3PWCA 1W0KD 1TONA 5FL7D 4DY7B 3E8LA 1S81A 1DWBH 3BTQE 3K65B 3V3MA 4FUIA 2TGTA 1FN6A 2B0FA 4DURA 2XWAA 1S6LA 3DUXH 1C1PA 3M36A 1BBRK 1IQIA 2J98B 1TA6A 2F9NA 3QN7A 1C9PA 5BRRE 3T27A 1PPCE 1HAHH 2IPHA 1IOEA 3Q76A 2R9PA 1YM0A 2KAIB 1BHXB 3HK3B 2KCAA 2SGEE 3OY6U 2LPRA 1GCTC 5B6OA 2ZWLH 1P2OA 1RIWB 2ZG0H 3R0FA 2TBSA 4D9RA 2ANYA 3SUEA 1OXGA 5EU8A 2ZEBA 1OP2A 1QCPA 1F5KU 3DT0H 1P2MA 3W94A 4PROA 1MKXH 1SGDE 3EA9A 3I77A 1QHRB 1GL0E 1W2KH 3E90B 1TX6A 5TCAA 1ZOMA 2VINA 4ISIH 1HAVB 1BMNH 4TWYA 4X1RU 1GMDG 1YPMH 1UVSH 1TRMA 1KTSB 2TGAA 3SZNA 1O34A 2G4UA 4WJG2 3RXTA 1BJUA 1G3BA 2H9HA 2VGCB 2R2WU 3TNTA 1P9UA 4X6PA 1EJAA 1GI4A 1WSSH 1BT7A 1THSH 1OS8A 1TNLA 5LPRA 4Q80A 2Z3EA 3RU4T 1TFXA 1ELCA 3H09A 3ZV8A 1Y3YA 3SOSA 1NFWA 1IQMA 2STAE 3VB5A 3AW1A 1HAIH 1BBRH 3F3BA 1TE0A 2AMQA 1O36A 4FU9A 1O32A 4ZKRU 1G2LA 1NT1A 5EG4A 5LPEA 2QXGA 4RI0A 1GMCG 4KGAA 3V12A 2C8YB 4HGCA 3SU4A 1NESE 4K8YA 2A4OA 3CENA 3RC4A 1GDQA 1F5LA 3M5NA 3PRDA 3BTWE 4DT7B 2P8OC 3DSGA 2B9LA 2QGRA 3PYHA 4JK6A 1DWEH 2YMSC 1FN8A 4XOJA 2H5DA 3MYWA 1V2JT 3T29A 1DOJA 4ESTE 1MAXA 4UFFH 1JOUB 2ZPRA 1GJAB 1SG8B 4YLUA 2Y7ZA 3ESTA 1QB9A 4MLFB 1QB6A 4X1QU 2JJ2D 5FAHA 2XWBI 2HPPH 3BN9A 4WXIA 1TWXB 4INHA 3H7TA 1EB2A 3UWIA 1TRYA 2SGAA 2PUXB 2A7HA 1SGQE 3ZIAD 4TPIZ 4ZKNU 2FX4A 1S85A 1GHAF 3WW7A 1ZJDA 4X2WA 4THNH 1IQEA 3AAVA 3BTEE 4Y11E 1Y5BT 4MDSA 2PHBA 1OP0A 4TPYA 2J34A 2ULLA 2ZKSA 5DP3A 1EAIA 4AB9A 1KXBA 2Z3DA 2VVCA 1YPKH 3GY3A 2D8WA 4AORA 5K0HA 2A32A 3KQEA 3RDZA 5A0BA 1A3EH 1HAYB 3UWJH 1EKBB 1KY9A 3N7DA 9ESTA 3O8RA 1GGDB 1E1QD 3PLPA 2AEIH 4FUEA 4ZHAA 1LKBA 1IQHA 1EX3A 1GMHF 1TNJA 3E3TA 1P11E 2XC4A 4RSPA 5SGAE 3RXUA 2GCTC 3UNQA 3M3VA 1SSXA 5BPEA 2C8ZB 4A6LA 4VGCB 4KKDA 3D23A 5GPIB 2O8TA 4K8BA 4XBDA 3QTVH 4ZCNA 3BTFE 4I8KA 2TGDA 2ZHWH 2ZFTA 3G01A 3QDZB 4FU8A 3QTOH 3U98H 4ABGA 4GSOA 2VIVA 2FO9A 5EJLA 4ZROA 1P9SA 2GT7A 1C5ZB 1SGRE 4U30A 3TGKE 2OC7A 2BD2A 1C1VH 2J94A 1SLXB 1LKAA 4ABEA 5E0HA 1ZSLA 4ACAA 5A09A 1NTPA 1TPOA 3RC6A 1PPHE 2G8TA 1ZMJA 3E0PB 2FOAA 1BRBE 4NFFA 3AVZA 4Y7BA 1ELVA 4IMZA 5GJ4B 1LHCH 2TIOA 1TQ0B 4OGYA 3SNCA 3BTHE 3U1JB 1QR3E 2A7JA 4X1SU 5DKMA 2R3YA 5EJZA 3LGTA 4R0IA 4XE4A 2W6ID 4I8HA 3A7XA 4MNXA 4X6OA 2FESH 4F4OC 2RG3A 3F9EA 1T8OA 3MHWU 2ILNA 1O3DA 1E36B 1ELGA 3LGVA 1TGSZ 4X2YA 2BLOA 4UDWH 4E05H 1QURH 1QFKH 5B6LA 2A5IA 5DP4A 4A1TA 3A8BA 1SGYE 1UHBB 3ZZ7A 3D62A 4NWLA 3TIUA 3O8BA 2ZHDA 3A87A 2SGDE 2FX6A 1EPTC 2ZDMA 1H4WA 3MOCA 1C5TA 1A5GH 4CH8B 2JIZD 3F9FA 2L6OA 2RFKC 2HRVA
chains in the Genus database with same CATH topology
1Y3VA 1YP9A 2BD8A 2VWOA 3PMJA 3T5FH 5EPYA 3PV4A 4Y0ZE 1F5RA 2QA9E 3L6PA 1GDNA 5LPFA 2YNBA 3RXGA 1ZHRA 4JZDH 3ZVGA 1D3DB 2YNAA 4MNVA 3RXAA 3UQVA 4JZEH 2GDEH 1AB9B 1TABE 2F91A 3ZZ5A 3LGUA 5JDUB 2RCEA 1TNGA 2B7DH 1IAUA 3P8GA 1MZDA 3JZ1B 1O2TA 1SOTA 1J9CH 4B2CA 1PJPA 2QF3A 2V3HH 1F0SA 4AFZA 1DWCH 1O2PA 1MBQA 1P03A 1LPKB 1PQ5A 2K8IA 1SGPE 3PB1E 3ITIA 4OS5A 1VITG 4Y76A 3TK6A 3SYJA 1OWEA 1GJCB 1HXEH 4CREA 1ANCA 3MU8A 3FP7E 5CHAC 1ZRBA 4B73A 4AFSA 2O8UA 1O2YA 1CA0C 3UR6A 1CHOF 1DSTA 1NBMD 1EB1H 1S5SA 3UR9A 1HJ9A 1T4VH 4U32A 1BTYA 1O2XA 4GPGA 4ZAEA 4FUHA 4JYTA 1MZAA 5E0JA 1BUIA 3T28A 1DLEA 1KXCA 2FTMA 3PTNA 3SV2H 3QZQA 4AN7A 4NGAH 1HPGA 3LH3A 1XMNB 2PFEA 2WPJS 1O3JA 4UD9H 1NRRH 5C1UA 3I29A 1YYY1 3SU5A 2KCPA 4OS7A 5CHBA 3PO1B 2FZZA 1FQ3A 5FBEA 3A83A 2R2MB 5GIBA 1QA7A 3P6ZB 1C4U2 3LIWA 1ZGIA 1WTGH 2WPIS 4CR5A 5JBCS 2BDGA 2ZDVH 1Z6JH 1NRSH 3IG6B 2OBOA 4X1NU 4I8LA 3ZZ6A 2OXSA 2WYGA 4BTIB 1D9IA 2SNVA 2ZFFH 5ESBA 3ZYDA 2GMTB 1HCGA 1Y5AT 2J4IA 2F43B 3ATLA 2AIPA 4MPWA 1AO5A 1K1IA 2BXTH 1KLJH 1P2JA 1V6DA 2Y6TA 1TBZH 4UFDH 4F49A 4YLQH 1C5RA 3FZZA 5CE1A 1IQJA 5FPTA 1TPAE 2ZF0H 1TPSA 1ZR0A 2BY7X 1DANH 2A31A 2I6SA 2FOHA 7LPRA 1V2KT 4RKOB 1KYNA 1V2LT 3NKKA 4I33A 2C8WB 4TYDA 1G2MA 1SOZA 3UTUH 1ARBA 4TY7A 1UVUH 1THPB 2NU4E 3KNXA 1CA8B 1O39A 3RMOH 1ZTKA 4ISNA 3SQHE 4A92A 3VXEH 2AYWA 1XVMA 1QRXA 1GJ5H 3ZVCA 3ZZ8A 4E06H 1G9IE 3E1XB 1XUKA 1LHGH 1O2ZA 1A2CH 4Y7AA 1J15A 4B74A 1RTLA 4HTCH 3L33A 2J2UA 2XCNA 5C17A 1W0ZU 3A85A 5PTPA 1D4PB 3TGIE 2A2XH 2BHGA 1AHTH 2HNTE 3RXKA 3N99A 1QTFA 2CN0H 3AW0A 5L2ZH 1OWIA 1O3KA 3QZRA 2ZU3A 5T6DA 1GI7B 4XSKU 2IJD1 1O2HA 2NWNA 3A86A 4HZHA 4GVUA 1BQYA 1TQ7B 2FI3E 1OYQA 1HXFH 2WZQA 4AZ2B 4DIHH 2A4QA 3BTKE 1UK3A 2ANMH 2P95A 1YCPK 5F8XA 2TGPZ 1VZQH 2WPDD 5HGGA 1BITA 2G00A 1P2NA 3WWBA 1GHXH 3QK1A 1W7GH 1NBME 4NIXA 3VG8A 3LJJA 2QN5T 1NU7B 3MH4A 1ELEE 2G5VA 4GHTA 3KCGH 4DOQA 1O2NA 2GV6A 4B76A 1O30A 4X6NA 3ZZDA 3GCHB 4B71A 2ZFPH 3LT3A 1NZQH 3D49H 3MH5A 4CHAB 4K5ZA 5A0CA 2FPZA 1CBWC 2KZ4A 3P70B 4X6MA 2KCYA 4MNWA 1QRWA 4MTBA 3EA8A 1WYKA 1GHWH 3MTYA 2AHME 2UWPA 1GMDF 1Z8RA 2BY8X 1LVYA 3NWUA 5TJXA 2CK3D 1W7XH 1WU1A 1DX5M 2Y5GA 4CRAA 1DUEA 1VJAU 5C1XA 1V2VT 2HGTH 1KXFA 1NS3A 5AVDA 3QX5H 2STBE 3MI4A 1YPEH 3ZZ3A 1HIAA 1P06A 4FVDA 3F1SB 2FOCA 3BTME 1YCPH 4E7RG 2PUQH 3LGIA 4CRBA 1AIXH 3RUOA 3F9HA 1YPGH 1Z7KA 2GZ9A 1GMCF 2XRCA 3OE7D 1TIOA 1SGFA 4UFGH 1W8BH 5H4IB 2AS9A 5E2PA 1AN1E 2J92A 2ZTZA 3EGKH 1ETSH 3SU1A 1O2KA 3DSPA 1W0YH 5C0TA 3RXFA 1MH0A 2V3OH 3DD2H 1T7CA 3URCA 4FUCA 4IC5A 1TGTA 4B6FA 1NY22 3KF2A 3M5LA 5FBIA 3VXFH 1QJ7B 1HB0B 1WTHD 1E38B 1T8NA 3FP6E 1O3LA 3SU3A 2ESTE 2BDBA 2ZDKA 3BIUH 8LPRA 6GCHG 1RS0A 1E37B 4K1SA 4WH8A 4BOHA 3B23B 1HAXB 1ZPCA 4UFEH 1GHVH 3BEFB 3ELAH 2PKSC 4AFUA 3OAAD 3RMNH 1A4WH 3MNBA 1QY6A 1MKXK 1LCYA 3W1EA 3O8CA 4KP0A 1ABJH 2M5TA 4ZHMU 2CHAC 4J1YA 1K28D 1MD7A 3RXBA 5IDKA 3B8JA 2FMJA 2ZPSA 4KELA 1O2IA 1UCYK 3SJIA 5HYOA 2D1JA 4BAQB 4INKA 4MPVA 1ZJKA 2QIQA 2GCHG 3ZVEA 2QY0B 2KR7A 1K1MA 1YPJH 2EI6A 4D9QA 1GBBA 2BLQA 2JKHA 5A8XA 2ZU5A 4D76A 1D6RA 3HKJB 9LPRA 1GJ8B 1S0QA 4NIYA 2FLBH 2C93B 1AFQB 3ATMA 2AGIX 2OP9A 1FPCH 2CV3A 1BTHH 3KQCA 2OQUA 1SHHB 1ZZZA 3BF6H 3BTGE 1AQ7A 1UTJA 1V2NT 2Q6DA 4U01A 1PPFE 3BG8A 3DA9B 2ZGHA 2WPHS 2BTCE 3UOPA 1DM4B 3SUGA 1ETTH 3HATH 3D65E 3ATWA 1U6QA 4JYVH 4ABBA 1SGIB 1AMHA 1WQSA 2NU0E 2G81E 4DVAU 1BBRE 1L4ZA 3Q3XA 3SJ8A 4ISLA 4QT8C 4Y79A 1BMFD 2VJ1A 1UCYH 4XD7D 1A0HB 1O3AA 3A89A 2W26A 3GY8A 1BIOA 4FVBA 1C5XB 4H4FA 2HPQH 4DGJA 2ZI2H 1E35B 1V2ST 3PMAB 1A5HA 1VGCC 4H42U 5EXNA 2OLGA 4CR9A 1C5OH 2BD4A 1GWAA 1GVKB 1O38A 2ZGCA 2ZU1A 1RXPA 1XUJA 1BDAA 3C1KA 1UTKA 3LH1A 2ZDNA 3HGNA 1QBVH 3K6ZA 1OWDA 3PROA 1AE5A 1DICA 4M7GA 3FFGA 1N8OB 2VIWA 3SV8A 3M7UA 4B6EA 4I7YH 1G3EA 4O3UA 3A7TA 1O2GH 2QXIA 3CS7A 3E0NB 2SNWA 7ESTE 1LVMA 1RIWC 1C2LA 5G4BA 1MQ5A 1IQLA 1UTNA 1AWFH 1E34B 1ELAA 4Q2KA 1O2RA 1SBWA 1OWKA 3QGJA 2BY6X 1SQTA 2P3UB 4OM9A 5ESTE 2XBYA 5EQRA 3A80A 2QF5A 3S9BA 1O2JA 1ESAA 2FI4E 3VB3A 1EZSC 1SB1H 4O3TA 1CT4E 1FX0B 3MNSA 1O2SA 1SGTA 1GBEA 1BRUP 2H1UA 1O3MA 1UJ1A 3RXJA 2LELA 3GS9A 1UO6A 4K2YA 1SGNE 1TALA 2QAAA 4D8NA 2VGCC 1TRNA 2HOBA 2Z9GA 2Z9IA 4MPUA 2LNCA 4DCDA 1XM1A 3V0XA 3E6PH 4KTUA 1O5BB 4TSFD 3T2NA 2BDCA 1H1BA 1A1RA 1SLWB 3MH7A 1PYTD 1DY8A 1VITF 1LHFH 3GDSA 1ZHMA 4H6SB 3M5MA 4YT6H 4AGJA 2BQ7B 2JJ1D 3NPSA 3MWIU 1XUFA 5A8ZA 1J17T 1JXPA 1C1WH 1GBJA 3LPRA 4WMEA 2GX4A 3OYPA 1NROH 2GKVE 4BXWA 4B2AA 1CE5A 1IHSH 4FUDA 3ZVFA 1P57B 1QB1A 1W11U 1QIXB 2KM0A 3PTBA 2DUCA 5I46H 1DSUA 5T3HA 2M2AA 1O33A 4R8TB 1CVWH 1C1UH 4Q7ZA 1BTZA 5DK1A 4GUXA 2WPMS 2JETB 2VNTA 3S9AA 3RXHA 1VJ9U 2VIPA 3ZVAA 1P0SH 4MG3A 3SNAA 3SNEA 1AZ8A 3PLBA 1FAKH 2BD7A 2FLRH 1G32B 2FEQH 4X1PU 3JZ2B 3RLWH 4DG4A 3MO9A 1DXPA 5A0AE 3M37A 1Z71A 2ALVA 1HDTH 4GCHG 4CH2B 4O03A 3RXDA 2XNDD 1T8LA 3VPKA 1LHEH 3U8RH 3P8OA 3TJNA 1GGDC 4NA9H 2UWLA 1BTXA 1PQ7A 1KSNA 2Q6GA 1ZYOA 2FS8A 5C1YA 3UPEA 3GDUA 4KTSA 1XKAC 3P17H 2VVUA 5JBTA 2R0KA 2AMDA 1FY3A 1KXAA 2F3CE 3BIVH 1ZLRA 3LOXA 3OY5U 1QGFA 4VGCC 4WY3A 3TJOA 1P02A 1LHDH 3PM3A 3RXRA 3DSOA 2ZCKP 3T26A 1GG6B 1SQOA 2BOKA 4Q4LA 4KTCA 3RM0H 3NCLA 5DG6A 1C1QA 2BZAA 1G36A 4JCNA 3GOVB 1O3PB 1C4Y2 1K22H 1EZQA 1K1PA 2DE9A 1Z6EA 5CMXH 1O5GH 2G51A 1J14A 1O5CB 5HM2A 4YTAA 5GDSH 5EW1H 2FM2A 2GZ7A 1Y3WA 2GT8A 2JETC 3KIDU 4WXVA 1AUTC 4IBLH 1OKXA 2EC9H 1K2I1 4D7FA 1O3FA 5F6MA 3LJOA 2ODQA 2YOLA 3V7TA 3KQBA 1YPHC 4NSYA 1CO7E 2OINA 2ZTXA 4IC6A 5DN6D 3TH4H 1Z8GA 4JYUH 1D3PB 4Q7YA 1GBDA 1HRTH 1N6XA 2XBVA 1V2OT 2C8XB 1C2EA 1FIZA 4B1TA 1TA2A 3RM2H 3F2HA 5EXMA 3A84A 1OOKB 2ZHQH 2IOTA 3HK6B 1EPTA 1JRTA 2A45B 1YF4A 1SVPA 1A46H 2BDYA 2ZDLA 2ZU2A 1ANDA 1BOQA 3SV7A 3LU9B 4ZUHA 2A4GA 1YLCA 2EEKA 4BXSA 1LQDB 1C1NA 1DT2A 4SGBE 5JBBS 1TGCA 2BVSH 1DDJA 2XXLA 4B2BA 2ZU4A 3KEEA 3QUMP 3SJ9A 3OEED 2G52A 1EAXA 4AB8A 1KLIH 5J4SA 2BM2A 3LC3A 1OWJA 1GG6C 1LMWB 1ABIH 3EYDA 2A2QH 3M7QA 4XDEA 1TBQH 3SQEE 2VWNA 3SUFA 1NM6A 1CGJE 1TBRH 2C4FH 2ZDAH 1WCZA 1GBLA 3PMHB 4UE7H 1CT0E 3RU4E 1PPZA 5HM9A 1P2KA 3M7TA 3LDXH 2RA3A 4O97A 1J8AA 1XVOA 3F2FA 1C1MA 4FXGH 1HNEE 1LQEA 3AK5A 4CBOA 1KXEA 5EXLA 4JMYA 4O9VA 4WVPE 1P12E 4NA8A 1G30B 1AB9C 8KME2 1O3CA 2Y81A 1ZTLA 1LTOA 4NZQA 1PPEE 5F53A 1CT2E 1WOFA 1DS2E 5L30H 1EQ9A 2EI7A 2OCVB 1K1JA 1TAWA 3F2GA 1EXFA 3OSYA 1S84A 4D7GA 3HPTB 1GI0A 4OS4A 5JBAS 4X2VA 4YT7H 2CF9H 2VBCA 1H8IH 1FUJA 4WMFA 1JWTA 1NU9A 4J2YB 3FOAA 4TY6A 2NU1E 2WINI 5GCHG 1VCWA 4A1XA 4WF8A 1FAXA 5HMAA 1HJAB 3ATIA 1EP6A 1HIAB 3RXOA 4MQAA 7KMEH 2ZO3H 1CU1A 1JMOH 3ZVDA 3SI4H 3FAOA 5FCRA 4A1VA 1P3CA 4ZKOU 1AU8A 1W14U 2HNTF 6GCHF 1FI8A 1PQAA 1FONA 1QBOA 4LZ1H 3DHKH 2C90B 1MUEB 3PO1C 1RFNA 2XOKD 5JB9S 2UUYA 2ZIQH 3OX7U 3GCNA 3Q3KA 1C2JA 2A1DB 3LONA 1FXYA 1LO6A 5HXFA 2HVXA 1MD8A 1GJBB 1L1NA 1PFXC 2FP7B 1GJDB 1EOJA 2ZZUH 3T62A 1UTPA 1Q31A 1Y3UA 3TITA 3CS0A 1SL3A 1MTSA 1PPGE 2GCHF 2WUCA 5T1VA 3RXPA 1ESBA 1ORFA 2GMTC 2YMSD 1DPOA 3M35A 3DCLA 1C2GA 4Z0KA 4YESB 2RA0A 3M3SA 2P3FH 2QCYA 4ZHLU 3A88A 2BD5A 2JH5D 4HFPB 3CP7A 5C5NA 2ZNKH 2Z9JA 5DGJA 1HBTH 3PV5A 1XKBC 2FWWA 1YGCH 4ABDA 1OHHD 3FP8E 4X0WU 1P10A 1Y5UT 4OS1A 5L2YH 2GVFA 3FANA 1HJAC 3EDXB 1MAYA 2PSYA 1P09A 1GI5A 1FNIA 1MTNB 1P05A 1C5LH 6CHAB 1K1OA 3PMBB 1W12U 3P95A 1O37A 2J5UA 3EA7A 4CRGA 4NCYA 1B0FA 2NU3E 3VGCB 3F68H 5F8ZA 4Z6AH 3WWFA 4ISOA 3UIRA 1TGBA 4AX9H 2WPKS 2FOFA 1BB0B 2D26C 3STJA 2BMGB 1XUGA 1YCPM 1TNIA 3UQOA 1O2QA 1BTWA 1Q2WA 1GI2A 2WSSD 1DE7H 1ZMNA 3FN8A 3KQDA 4LK4A 2BVXH 2ZQ2A 3K2UA 2PV9B 5FPYA 3SNBA 2KCOA 4Y71A 2O8MA 2FS9A 1TX8A 3MU5A 1FJSA 4Y8XA 1C5YB 1O3EA 2I6QA 2HWLB 1W0JD 4I31A 1DITH 1UK2A 5AFZH 5C3NA 2Q6FA 2FTLE 2A4RA 3RXSA 1TGNA 1VR1H 2G5NA 1V2RT 4I32A 1A0LA 2ZTYA 3EAJA 1C5VA 4IN2A 1QBNA 1OWHA 2PKAA 2XC0A 1CSOE 3A81A 4UEHH 1C9TA 1UTLM 2HLCA 2BX4A 1O2VA 2UUKB 5A8YA 3RXCA 2JH0D 1SQAA 3GCHC 4WWYA 3URDA 2BDAA 2VVVA 1O3HA 7GCHG 2V7QD