4R8TB

Structure of jev protease
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
141
structure length
141
Chain Sequence
TTTGVYRIMARGILGTYQAGVGVMYENVFHTLWHTTRGAAIMSGEGKLTPYWGSVKEDRIAYGGPWRFDRKWNGTDDVQVIVVEPGKAAVNIQTKPGVFKTPLGEVGAVSLDYPRGTSGSPILDSNGDIIGLYGNGVELGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fast native-SAD phasing for routine macromolecular structure determination.
pubmed doi rcsb
source organism Japanese encephalitis virus
molecule tags Hydrolase
molecule keywords Serine protease subunit NS2B
total genus 25
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4r8tB02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4r8tB01
3LH1A 4E7RG 1LTOA 1YP9A 3ZZAA 1IQJA 3STIA 5T1VA 2HPPH 3RXPA 2C90B 3LC3A 3BF6H 4BTTB 4I8HA 2CGAA 2F9BH 2Z6BD 1CHGA 3SJ9A 2O8TA 1SGQE 2BZ6H 1UVPA 2OTVA 5DP4A 3SBKA 1GBHA 1AIXH 1O34A 1O3BA 3M3TA 4QT8C 1FXYA 1CU1A 2LPRA 3BIUH 3GDSA 1HNEE 4DOQA 2CF8H 5HM9A 3UNRA 2VB0A 2VVCA 4WXVA 1IQHA 2BY6X 5LPRA 1UK2A 4GUXA 4DGJA 1BBRE 3F9GA 6LPRA 1O2PA 1AE8H 3QLPH 1BRAA 3TPIZ 3A7TA 1ELGA 4TY7A 4E06H 1TQ7B 1W7GH 1XM1A 2QV1A 1AU8A 2FMJA 2A0QB 1HDTH 3K9XB 2Z9JA 5EW2H 2PSYA 1VZQH 3BTFE 1OWDA 4K1TA 1FN8A 1P2IA 1T4UH 4D8NA 2ODQA 4MPUA 1UVTH 2BHGA 3SNDA 1HIAA 1N1LA 1D3QB 1UTPA 1QJ6B 2ANYA 5FX5A 1P3CA 3U8RH 1BMNH 3ATKA 1B0FA 2WYGA 2NU4E 1S83A 1SL3A 2C8ZB 1TB6H 5FBIA 1FPHH 5C1XA 1AUJA 1HB0B 4Q7XA 1O2XA 3GCHB 3DFLA 3SV9A 3T29A 1Q3XA 2ZHDA 1O2SA 1J9CH 3RMLH 3KL6A 1MAXA 2JETC 1HYLA 2UWOA 3TNTA 2WPJS 4X2WA 5AVDA 1V2RT 1RD3B 1TNHA 3T27A 2F91A 5ESTE 4AG2A 3FVFB 2Y80A 1YCPK 1AVWA 2V3HH 2PLXA 3ZV8A 1Y3WA 1W0ZU 3KQBA 1EPTB 3TJOA 3P8OA 3ATWA 2VVVA 1MTNB 3KQCA 5FHTA 3S69A 1HAHH 1UVOA 3SYJA 1IQMA 3IWMA 1QNJA 3I29A 1GL1A 4X2VA 3RXLA 3MU5A 1P11E 2XCNA 1KTTB 2QF3A 3VGCC 2ZTYA 5B6OA 3M5OA 2BQ6B 1CA8B 2Y5HA 4GPGA 4X8TH 3AAUA 2HRVA 4FUCA 1TFXA 1ANEA 3CS0A 2O9QA 5CE1A 2RA3A 1XXDA 1P3EA 2EI7A 3MFJA 3A8AA 1W10U 1FIZA 3V3MA 3U8TH 1W7XH 1EJNA 1ABIH 3UIRA 3IITA 4K8YA 2P16A 2IN2A 1HGTH 3SGAE 1TQ0B 4AOQA 5B6LA 1O3IA 4ZXYH 2ZU1A 3RXAA 2W26A 1C1QA 2O8MA 1C5SA 3LJOA 3M35A 3SV2H 1ORFA 2BZAA 1ELEE 1L2EA 2PKSC 3F6UH 1T32A 4NSVA 4DG4A 3EQ0H 1RS0A 2GZ8A 2UUFB 1NPMA 2FLBH 5FCKA 1EB1H 1AD8H 1Z6EA 2UUYA 1SGTA 4CHAC 1O30A 4TWWA 4U01A 1SOTA 4VGCB 2HGTH 4NWLA 1C2IA 4IC5A 2VBCA 1UK3A 2OQ5A 3TNSA 4GCHG 4JYTA 1A7SA 1T8LA 1DSTA 1VCPA 1SGRE 1K1PA 4TY6A 4F4OC 5DP7A 1UMAH 1ZHRA 1Z6JH 3LGVA 1O2TA 3ZZCA 3MU8A 1OX1A 3QK1A 1P09A 1DWCH 1TGBA 3BEUA 1E38B 1P0SH 2ZFRH 1BT7A 1TBQH 4LZ1H 1O33A 1CO7E 2Z7FE 3JZ1B 1KLJH 2PKAA 3S9BA 1HAVB 4X2XA 1TX8A 3TJUA 1ETSH 4A92A 2PKSB 1Y3VA 5A0AE 3IG6B 4JK5A 2BXTH 2ZPRA 1P05A 4CREA 1O2NA 2NU3E 1J17T 1GI2A 4NFFA 1BTZA 5I46H 8KME2 1C4U2 1G9IE 1ELDE 1HAXB 3PYHA 1V2JT 4LOYH 1KDQB 4ABDA 5FCRA 2WYJA 1E36B 3RMNH 1ZHMA 2GV7A 2XNIA 3P8NA 3LT3A 1GJ4H 1TA2A 2ZGCA 1GCTB 4INHA 2GX4A 3S9AA 8GCHG 4I7YH 2Z3CA 1IOEA 1UCYK 3A89A 2FOAA 1EXFA 1BB0B 3LGWA 1M9UA 4NA7A 3E6PH 1RRKA 1O2IA 3VGCB 5C20A 3A82A 2JH5D 5LGOA 3PMHB 3NKKA 3SJ8A 3H7OA 3OTJE 1NRPH 1WOFA 3UR9A 1HRTH 1V2MT 1THRH 3L6PA 3SU1A 1YPEH 3VB3A 1G30B 4X6NA 2GTBA 1JBUH 1AFEH 4ISHH 4Y8YA 2XYAA 1UO6A 3V13A 2A45B 1BUIA 2AGGX 3RXKA 1FY1A 3L33A 3LPRA 2VWNA 4BAOB 2A1DB 3PMAB 2J92A 3M7QA 2SGFE 5K0HA 1V2ST 1C2KA 1Y8TA 2VIVA 1FY4A 1F0RA 1QBNA 2GCHG 1RTLA 5EW1H 5F8ZA 3H7TA 3E16B 3A83A 1O3KA 3BTWE 1XXFA 1EP5A 2C8YB 3P70B 3LDXH 1T31A 1GHAG 3U98H 1S82A 3SUDA 4CRCA 1BHXB 3NK8A 1GHZA 1ANBA 1TE0A 3SU6A 1BDAA 4E05H 1NT1A 2WUBA 2GZ7A 4GVUA 4X6PA 2GDDA 2FI5E 3MNBA 3ODFA 1IHTH 1K1JA 1MD7A 2WV4A 1GHYH 3ZZ9A 5GCHG 1KLTA 3BTGE 1GI1A 5F8XA 1C5MD 1QRXA 4AZ2B 5F03A 1LPKB 1JOUB 3LGTA 1J16A 1OP8A 4B73A 2O8LA 2ZHWH 3Q3KA 2PFEA 3TGIE 2F83A 5HYOA 1EB2A 1NS3A 5G4BA 2J2UA 3V12A 3ESTA 1SHHB 4B2CA 4Y7BA 1IQIA 1O5EH 1K1MA 1TMUH 1HAYB 2CXVA 1O2RA 2V0BA 2WPMS 2SNWA 1ELBA 1GJDB 1MQ6A 3TVJB 1UTKA 3CENA 1C2GA 5DPAA 2PTCE 3QTVH 4YOJA 3PROA 2TGTA 1IQLA 1H9LB 2BDAA 1TPOA 1P2OA 2R3YA 1Z71A 3KQEA 1K1NA 1L1GA 1EUFA 2B8OH 1BTXA 1P8VC 2PW8H 3A8CA 3RXIA 1FI8A 1GHVH 2WPKS 1O2JA 1GBBA 3SHCH 2CJIA 2I6SA 1LCYA 1ELAA 5EU8A 2CMYA 4X6OA 2F9VA 3RXGA 1D3DB 1SGDE 3U8OH 1OWJA 1F2SE 2FLRH 1W11U 1O3CA 4JYVH 1O3MA 1GG6C 2BVXH 2BVRH 1ZSJA 1QY6A 1EAUA 3HKJB 3M61U 3P95A 4U2WA 4J1YA 4B1TA 1KYNA 1GWAA 1TGTA 3BIVH 3QZRA 2VH6A 3MMGA 1HJAC 3U9AH 3BTEE 1KXFA 4GCHF 1C2FA 4MG3A 3E0PB 1SBWA 3SV7A 1PQ8A 3OX7U 1MU6B 2OP9A 3ATMA 1BITA 3SOSA 1BJUA 3BTME 3RU4D 1GBFA 2EI6A 2HLCA 2J38A 1GJ8B 4VGCC 1SFIA 1H1BA 2Z94A 4WVPE 2TRMA 4MNXA 2VINA 4UONA 1K22H 4LXBH 2VIOA 1WQVH 2Z9GA 3BG4C 4TYDA 2SGEE 3RXCA 2DE8A 4NCYA 2VH0A 5JBBS 2ZIQH 4ABGA 3L3TA 4K8BA 4NZQA 3T2NA 1AQ7A 5H4IB 2IJOB 4K69A 2ULLA 1CT0E 5A8ZA 1CT2E 3VFEA 3KNXA 1P01A 1C2HA 2ZQ2A 4ZXXH 4ESTE 2ZDMA 1C5WB 2OUAA 4FUHA 3O8DA 4ZKOU 2ZDKA 4ZHMU 4WMFA 1TNGA 4AFSA 1HV7A 2QY0B 1O3NA 2C4FH 3ZYDA 3UY9A 1O3AA 1GHWH 4JK6A 4MLFB 4FUGA 1EOLA 2JH6D 4MNYA 4B76A 1ZPZA 1ZMJA 1QHRB 2OC0A 5EG4A 3UOUA 2H5CA 2ZFPH 3SZEA 1KXEA 1ETRH 5A09A 5AF9H 3E1XB 4YO9A 4YTAA 3A7XA 2SGPE 1TRNA 3TGKE 4X2YA 2D1JA 1S85A 1GJCB 4XBBA 3LGYA 1D4PB 3FP7E 1NFWA 2QCYA 1ZGIA 3PB1E 1C5ZB 1MTNC 3RXJA 1IQGA 2XBYA 1AZ8A 4Y71A 1HJ9A 2ZTXA 3MHWU 4BOHA 1AWFH 1EZSC 3S0NA 1PPEE 2QF0A 1L1NA 1O32A 1NFUA 4ABIA 4YT7H 3M36A 1YPHE 1HCGA 1S6FA 1TAWA 4A1VA 4ZHAA 4MPWA 1IQNA 3ZVFA 2JKHA 3RP2A 1QJ7B 3BG8A 1RXPA 2FIRH 2P3TB 4AFQA 2OC7A 1UTLM 2ZPQA 4AB8A 4THNH 1DICA 1P2QA 2PKAB 4X1NU 4AN7A 1DUEA 1OYTH 3MNSA 3SHAH 1C4Y2 1KXAA 1GBMA 2FOHA 2Q6GA 1TOCB 2WPLS 1YLDA 2P8OC 4NIWA 4M9FA 1SOZA 1LVOA 2O8UA 3UTUH 3VPKA 4CH8B 3MI4A 1JMOH 2Q1JA 3LH3A 5ESBA 1ZSKA 1CGHA 1ZZZA 1QQUA 4DVAU 3HGNA 2FYQA 3PLPA 2GCHF 2C8XB 5C1YA 4OS4A 3GDVA 3KN2A 3TGJE 4Y11E 2FI3E 1O3EA 1WV7H 5DK1A 1C2LA 1EX3A 4B74A 1GPZA 2OC8A 5T6GA 1L1JA 4RKOB 4KGAA 2B7DH 2FYRA 2ZHQH 1C1TA 1Y5BT 2FX6A 3S7KB 3VB4A 2J9NA 3D62A 2Z9LA 5EXLA 4SGAE 1V2NT 5JPMH 1LVMA 2WHXA 1NY22 3KHVA 2SFAA 3MH7A 1AY6H 2OK5A 4Y7AA 2VGCC 2PUQH 1WTHD 3T28A 1CE5A 1Z8RA 1GDQA 1UCYE 3UNSA 2K1QA 1A46H 4YT6H 1NROH 1WQSA 3RXBA 1DXWA 1G32B 5A0BA 4DW2U 1SGPE 4ZROA 1GJAB 1P2MA 1MZDA 2VJ1A 2ZECA 3MO6A 3T62A 1O37A 1Y5AT 4JZFH 4FUFA 4I33A 2H5DA 4YOIA 4B2AA 5DKMA 4IMZA 1EP6A 3QO6A 4KTCA 3GY5A 1UVSH 1YPJH 2VIPA 5JB8S 3ZVCA 3UFAA 1O35A 2HNTE 4IC6A 1TNKA 4BAKB 1GHXH 1A0HB 1GVLA 1ABJH 2FOBA 1GDNA 1GBJA 2FI4E 2EA3A 4OS1A 2BOHB 1GGDB 1GG6B 4CR5A 2Y5FA 4AYVB 4ABFA 3Q3XA 2BOKA 4X0WU 1E35B 2BDCA 1EQ9A 1TMBH 3OY6U 4WH8A 1LHFH 3AVZA 3TH4H 3Q00A 4MDSA 3EYDA 1HAOH 4OS6A 1IQKA 1YPGH 4ZMAH 2A7JA 3K2UA 1H9HE 3M3SA 1THSH 3PMJA 1SQAA 2VNTA 3SZNA 2PUXB 3HPTB 1QR3E 2WPHS 1FMGA 1GMCG 3GY8A 2STAE 1EZUC 1DWEH 1O2HA 4XE4A 1NESE 2FXRA 1VR1H 1S5SA 3A80A 3RU4E 1SGYE 2ZDAH 1CT4E 1GI7B 1SGFA 1DM4B 1L4DA 3QZQA 1QIXB 3RXVA 1FY3A 1GDUA 1HIAB 3GCNA 2AIQA 4FUJA 1KY9A 2D8WA 1O3DA 2TGPZ 5AFZH 1AFQC 1A0JA 2ZF0H 4J2YB 3VXEH 2QXGA 1BZXE 1PPGE 3OTPA 3A7VA 3CS7A 4JZDH 1LHEH 1ZYOA 3P17H 1HAVA 1SSXA 1PFXC 2XBXA 5IDKA 2RG3A 3I78A 4TPIZ 4CRAA 1GI5A 1SR5C 4FUEA 5EQQA 2XBVA 5EOKA 1WYKA 3SI4H 3U1JB 1S0RA 1P9UA 1ZRBA 2AERH 2Y5GA 1RJXB 3TITA 1RIWB 2QN5T 2IOTA 1KXCA 1XUJA 2RCEA 1P2JA 1Q2WA 2OC1A 1LVBA 4WY3A 1C1WH 2ZHFH 3GY6A 2ZO3H 4X8UH 3RXQA 1NC6A 1GBIA 1FY8E 1GJ5H 1F0UA 1O5AB 1DANH 1YCPH 5JB9S 1GI4A 5GIBA 5EXMA 1ZSLA 2ZDVH 3BEIB 2C93B 1Y3UA 3R3GB 1D6RA 1PPFE 3A7YA 1XUIA 4FUDA 2CN0H 1V2UT 4NFEA 2CHAB 2BY7X 2TBSA 1O2UA 1LHCH 2PSXA 3MNXA 5EPYA 5E8EH 2NU1E 4BTIB 1VCWA 2G5VA 5L2YH 2ZC9H 5DG6A 1O2VA 5FPYA 1TX7A 1F5KU 5TCAA 1FNIA 1TLDA 1JRSA 1YBWA 2Q6FA 1XKAC 1SLVB 3TU7H 1YKTA 4ASHA 2CV3A 4ZAEA 1GI0A 2AH4X 1FIWA 1WUNH 2G81E 1BTWA 5DP3A 3RXOA 2ZFFH 1GVZA 1W12U 1C1PA 2FPZA 2P3FH 1WCZA 1MCTA 1NRSH 1SVPA 3DD2H 1A5GH 3FFGA 2WUCA 3MH4A 2BD8A 1UTJA 3SO3A 1V2VT 1A0LA 1TRYA 3RXFA 3GY7A 5A8YA 1XVOA 1JWTA 1MBMA 3SU3A 3ZV9A 1O5GH 4UE7H 3SNCA 3GY4A 2BVSH 4NZLA 2QXIA 2ODPA 2OXSA 2WINI 1ID5H 3OU0A 3OY5U 2WV5A 4BAQB 5LH8A 5C5NA 3PTNA 4O03A 1JIRA 2C3SA 1W8BH 3A7ZA 1W3CA 2NU2E 4ZUHA 4MNWA 1DS2E 1MD8A 4BXWA 3SU0A 1YC0A 2FOGA 3AASA 1QURH 2A4RA 4X1QU 1PYTD 2Z9IA 1QA7A 1XUGA 2G5NA 2G4TA 1O3FA 1TPAE 4CR9A 4MPVA 1O5DH 3EA7A 2OQUA 2F9NA 1C4V2 1H8IH 3E91A 1MTUA 4OS5A 4KTSA 1F0SA 3QX5H 1TOMH 1BBRK 4WMDA 1G37A 1TNIA 4K3JA 2ODYB 1LKBA 4BXSA 1TGNA 1C5XB 1UJ1A 5I25A 3BTQE 3RMMH 3SU2A 4WJG2 2OBOA 9ESTA 1TNJA 1U6QA 4TPYA 3SUEA 2H9EH 1GMDG 4D76A 3TLOA 3SU5A 2XCFA 2V6NA 1YLCA 1BBRH 3KQDA 1C5VA 3SUFA 4D9RA 2ANWA 2JH0D 5FX6A 4E7NA 1PQ7A 1SI5H 1C1SA 5E2OA 1HJAB 4LK4A 5ABWA 5F6MA 1AB9C 1F7ZA 5L30H 2ZCKP 1ESBA 1OWEA 5DP8A 1NTPA 5GJ4B 3RU4T 1MTWA 2CF9H 4ISLA 1IQFA 2TIOA 3NPSA 1QFKH 3FAOA 1N8OC 3FANA 1DLEA 4I31A 2AFQB 1HBTH 3A7WA 4NG9H 3BV9B 4HI3A 2VVUA 1L0ZA 2P93A 1C5RA 2PGQB 2XWBI 2FS9A 3PM3A 1GI6A 2BDYA 1UTNA 1OPHB 3KIDU 4GAWA 1PQ5A 3C27B 2WZQA 3KF2A 1GJBB 4U32A 1SHYA 2Y7XA 1MZAA 2AMQA 3LC5A 3U1IB 1C2EA 4I8KA 4D9QA 4CRGA 4DIHH 1AGJA 1C9PA 4AGKA 4H42U 1O0DH 1Y59T 2ZFSA 3ENSB 4RN6A 3SNEA 8GCHF 1WTGH 2A4QA 3MU1A 1MMJN 2CHAC 3QGNB 5BPEA 3SJKA 1O3GA 1GMCF 1LHGH 3TH2H 4WXIA 1ANDA 1C5LH 2PHBA 2ZNKH 2FDAA 5E0JA 1EPTC 1GBCA 1A3EH 1GBAA 1NFXA 2GD4B 1ZJKA 4FUIA 3ZZ6A 2VIDA 4K5ZA 4ABBA 6CHAB 3U69H 5HGGA 4XDEA 4A1TA 2P95A 3O8RA 1TGSZ 1GMHF 1TMTH 4MVNA 5T6DA 1KSNA 3MWIU 1GMDF 4UD9H 3P92A 1MTVA 5C67A 4DIIH 1MBQA 4D7GA 1A2CH 1IQEA 2J94A 2BDIA 1D3TB 1DT2A 4UEHH 5FAHA 2GKVE 3RXEA 3P8FA 1ELTA 4JYUH 1FZZA 4Y79A 2BX4A 1S0QA 1HPGA 3C1KA 1HXFH 3QDZB 4DJZB 1SGEE 1HAPH 1L4ZA 3VB6A 1SGCA 1ZMLA 2BD5A 3UUZA 4R0IA 1GI3A 3HKIB 1P9SA 1GMHG 3BTDE 3DA9B 1EOJA 1D9IA 2A4OA 4BTUB 1K21H 1G2LA 2KAIB 2A32A 3AW1A 1O36A 3A88A 4KELA 1EAWA 3RXHA 3Q77A 1YPKH 4RKJB 1EKBB 1AVGH 2XXLA 4A5TS 1ARCA 4YZUA 3FZDA 4DY7B 2VU8E 2FEQH 2SGQE 2H9HA 1O39A 1G36A 3ATIA 3EA9A 4JCNA 5DP5A 2ZU3A 4CRBA 2XRCA 1K1IA 5C3NA 2Y82A 2G51A 1K9OE 5K7RA 1ELCA 3UQOA 4AORA 3OYPA 5L2ZH 2ZGHA 1BHXF 1BIOA 3QGJA 1K1LA 1RTFB 5GXPA 2ZWLH 3GICB 5CHAB 4HGCA 2FOFA 2ZCLP 2OD3B 4FVBA 3NUMA 2AYWA 4A1XA 1C9TA 1C1NA 1O2ZA 3Q3YA 4H4FA 3ZZ8A 1P02A 1SG8B 5E0HA 1GGDC 2Y81A 1IAUA 1YPMH 1FY5A 1SGNE 2AEIH 5E2PA 1BRUP 1TBZH 1Y3XA 1XMNB 3T25A 3E8LA 1UHBB 4OS7A 1FLEE 3TIUA 4K2YA 1KXBA 1TX6A 1ESTA 4TWYA 1YPLH 2J4IA 1OXGA 2ZFTA 3T5FH 3PV4A 1XUFA 3FP6E 1D6WA 2ZU5A 3SGBE 2BY5X 1Z8IB 2D26C 1VJAU 4CRFA 3PV5A 1P2NA 4DURA 4I8GA 4I8JA 1N8OB 1W0YH 1O5CB 1ZR0A 3ATLA 3SI3H 2W3IA 3PWBA 5A2MH 1IHSH 3F1SB 1INCA 1ZOMA 2AGIX 2ZEBA 4K1SA 3A81A 1SLUB 1O3HA 3CP7A 1QBVH 3HATH 4OM9A 1ZPBA 4AYYB 2VGCB 1QB1A 4NIXA 1WSSH 4ZKSU 3AK5A 5EODA 1CGIE 7ESTE 1O2GH 4FU8A 3UPEA 1C5YB 1GBDA 1H9IE 2ASUB 2GCTC 3NXPA 4WWYA 2P3UB 2Z3DA 2FS8A 2BB4A 3PO1C 4DCDA 5CHAC 4Y0YE 1XKBC 1OWKA 1LPGB 4Y0ZE 1T8MA 2ESTE 3M3VA 1LQEA 4ABJA 1JRTA 1QCPA 1GBKA 3ITIA 4BAHB 4BANB 2ZFQH 1AVXA 2ALPA 1BA8B 1V2KT 4CHAB 4IS5A 3TH3H 2FOMB 3UWIA 2ZU4A 2RDLA 1Z1JA 1H8DH 3GYLB 5DGJA 1CBWC 2BLOA 5JYIA 1DPOA 2OINA 3LIWA 4AFUA 3DFJA 1PJPA 4UFDH 1FN6A 5F8TA 2F9OA 4SGBE 3RC5A 4RSPA 1LVYA 4U30A 3SNBA 1QB6A 2H1UA 3EGKH 2ZZUH 1P2KA 3QWCH 4YOGA 1P57B 3WY8A 5GCHF 1PQAA 1TWXB 1HJ8A 2IPHA 5JDUB 1MUEB 5JBTA 3ZZ3A 2BD7A 2ZHEH 5SGAE 3N7OA 1LHDH 1AKSB 1V3XA 4ISIH 1V2PT 4O3TA 1OP0A 5C2ZA 3KEEA 4F49A 3OSYA 1KIGH 1THPB 1E37B 3VB7A 2ZI2H 2XC5A 3HGPA 2BLVA 2AMPA 2ZP0H 2BDGA 1MKXH 1T8NA 4KTUA 3RMOH 2P59A 1S6HA 2R2WU 2Y7ZA 3AW0A 1QL7A 4B75A 2XTTB 4Y8ZA 4RI0A 2P8OB 4AGJA 2GVFA 1QJ1B 2FTLE 2FTMA 5JBCS 4ZH8A 2GDEH 2HNTC 7LPRA 1DX5M 4GSOA 1MH0A 2VIWA 1MQ5A 1DLKB 5DJ7A 1GL0E 1PPZA 4CBOA 4INLA 2UWLA 3G01A 4YM9A 3ZZ4A 1TALA 2AIPA 3FP8E 4BNRA 1AE5A 1AUTC 2YNBA 1PPCE 3SGQE 2BMGB 1DY8A 1A61H 2A4GA 2BD4A 2J34A 4K1EA 3HK3B 1QBOA 3Q76A 1AI8H 2BD2A 4H6SB 4X6MA 1BRBE 3P8GA 1V2TT 1GHAF 1SPJA 1G3EA 3ZVAA 1VITG 2VWLA 2QAAA 1GJ7B 3ZZBA 3GCTG 4ISNA 3A8DA 2PGBB 2ZGXH 2ILNA 2SNVA 2FWWA 4M7GA 3V7TA 3EA8A 2A5AA 5FBEA 1YGCH 1GJ9B 2GMTB 3B23B 2GV6A 2GT8A 4FUBA 4X8SH 1Z8JB 1EZQA 2FODA 2BDHA 5AFYH 1GBEA 1NRRH 8ESTE 1A1RA 1YPHC 4OS2A 1WU1A 2BTCE 1TBRH 2UUKB 5CMXH 2HWLB 2FO9A 2XC0A 1OYQA 1CA0C 3ZZ7A 1VGCB 2H2ZA 6ESTA 1BMMH 1W13U 3UOPA 1UCYH 4IW4E 2XC4A 4WF8A 1O2MA 1FAKH 2A31A 3ZVEA 1NO9H 5FPSA 1MKWK 1NRQH 4Q7YA 5TJXA 3EDXB 4AG1A 4X1PU 1C1UH 1DUAA 3ZZ5A 3LGUA 1A5HA 2GCTB 2ZCHP 2V35A 1Y3YA 1NN6A 1TRMA 3M5MA 1DXPA 2ZDNA 3SQHE 1CBWB 1ESAA 3TK6A 5E0GA 1ZHPA 1A5IA 1CQQA 2NU0E 2FOCA 1P03A 3BG4B 4CBNA 2TGAA 1ZGVA 1NZQH 1S81A 1VITH 2GGVB 2ZDLA 2BD9A 2G4UA 1C5PA 4UFFH 2GP9B 4FVDA 3TK5A 3R0FA 3SN8A 1QTFA 4AB9A 1F92A 1MAYA 2QC2A 1QL9A 1AMHA 5A8XA 1UVUH 3RM0H 2B5TB 2OBQA 1MCVA 4O9VA 1ZTKA 4HFPB 4A7IB 5PTPA 2QXHA 4HZHA 3SJOA 1TIOA 3LGIA 2PV9B 3UR6A 3M7UA 5AHGH 5A0CA 1A3BH 2W5EA 3E90B 2B9LA 3BEFB 1EPTA 2QIQA 2Q6DA 1EASA 1BJVA 4GLYA 1NFYA 2C8WB 4IN1A 1O38A 4ISOA 3QTOH 1E34B 1NU7B 3LKWA 1P10A 4YLQH 3MU0A 3BSQA 3SNAA 1Z1IA 2AS9A 3RC4A 4O97A 4MTBA 2W3KA 1DOJA 1SMFE 4MPXA 5EXNA 2FM2A 9LPRA 1FONA 5TCCA 3STJA 5T3HA 3DT0H 2PTNA 3ZVGA 1K2I1 3MTYA 3PLBA 7GCHG 5J4SA 3GCTF 3SV8A 1CVWH 7GCHF 1OWHA 1X7AC 1V2QT 2SGDE 5EGMA 1VJ9U 2HOBA 3MYWA 1DSUA 1JXPA 2ANMH 1PYTC 1BOQA 1KDQA 3UREA 2G52A 5GWZA 3BTKE 2XWAA 4ZKNU 1TYNA 3URDA 3UNQA 3UQVA 5HXFA 2QXJA 3B9FH 1RFNA 4NIYA 1YYY1 6GCHG 4GHTA 1O5FH 1ANCA 1BTHH 3UWJH 2ALVA 3RXSA 1T7CA 1G3BA 2HVXA 1C1MA 4X1SU 2AMDA 4XBDA 2I6QA 1ZPCA 3RDZA 2R2MB 3GDUA 1NM6A 2YNAA 3DUXH 3A87A 5DP6A 1SLWB 1K28D 1T8OA 1SQTA 3RM2H 4NA9H 4Q7ZA 1QA0A 2STBE 1CSOE 2PR3A 4I8LA 1B5GH 1SFQB 2EEKA 2QA9E 3RLYH 4X1RU 1F5LA 1OSSA 1O5BB 1HAZB 2B0FA 2BXUH 4FU7A 3PLKA 1WXRA 1C5TA 4UFGH 3BTTE 1C5OH 1D3PB 2GT7A 2YOLA 3PTBA 1NRNH 1DFPA 1TNLA 1ARBA 1RGQA 1KXDA 2QGRA 1QQ4A 3URCA 1KTSB 2VWMA 1P12E 4JMYA 2BX3A 3A84A 3FZZA 1AWHB 3LU9B 3E3TA 3T26A 1LO6A 2G55A 3QUMP 3JZ2B 3TJVA 5ETXA 6CHAC 1GCTC 1GCDA 1N6XA 2THFB 4AX9H 1RTKA 1UHBA 8LPRA 1NU9A 2F9PA 2HALA 1KLIH 4K60A 2QYIA 4JZEH 1BCUH 2BM2A 4IGDA 4JZ1A 3SUGA 4ZHLU 4B71A 1HLTH 3MOCA 3RXRA 5C5OA 2G8TA 4DT7B 1HUTH 1FV9A 2ZGJA 3DHKH 1TABE 3ZVBA 1BMAA 1BMLA 4FXGH 1FJSA 2Z3EA 1ELVA 3GY3A 4IBLH 1G2MA 1Q31A 1UTMA 2A7HA 1DVAH 2R0KA 2ZQ1A 5HM2A 1V6DA 3D65E 4XSKU 2EC9H 3GCOA 1EJMA 3ZVDA 4Z0KA 2D2DA 1PPHE 2EI8A 2O8WA 2R0LA 2TGDA 3O8BA 1OOKB 1UK4A 5IYTA 1OKXA 4NSYA 1QRWA 5JBAS 5L6NH 2FZZA 2M5TA 4Y10E 1B7XB 2KAIA 2P94A 3D23A 2UWPA 1MU8B 2BYAX 1BTYA 1LPZB 2BLQA 4B6EA 1HXEH 1A4WH 3O8CA 1C5NH 1VITF 2H6MA 2FOEA 2ZPSA 2A5KA 1AKSA 1JIMA 4CRDA 1J15A 3TK9A 1EZXC 2W7UA 5DP9A 4INKA 3P6ZB 2F4LA 4MNVA 1FQ3A 4NIVA 4ZKRU 3LONA 3K6ZA 2A2XH 1YF4A 1XVMA 3MU4A 3SV6A 5FPTA 1F0TA 2VWOA 2BY9X 1AB9B 3M7TA 2PWXA 2WV9A 1SLXB 1GJ6A 1TGCA 4AFZA 2ZTZA 1ZLRA 4XBCA 3ZYEA 4KP0A 3F9HA 1Z8GA 1QGFA 1QRZA 4OGXA 1DY9A 4XOJA 2FP7B 2W7SA 4LZ4B 1Y5UT 1LMWB 4PROA 3EAJA 3S9CA 4OGYA 1UTOA 3KGPA 3GYMA 1XUHA 4JZIA 3PV2A 1VGCC 1CA0B 1VCQA 1BTUA 1O2YA 1PPBH 3VXFH 1O3OA 2SGAA 2ZKSA 2R3UA 1C1VH 3A8BA 3HK6B 3ZZDA 5J4QA 2RA0A 1V2WT 1LDTT 2HNTF 2BQWB 1ZTJA 4B6FA 4BAMB 3NZIA 5BRRE 1H4WA 5C1UA 1N6YA 2GMTC 1OP2A 3RXMA 1FPCH 3W94A 1C1RA 4XFQA 3PMBB 7KMEH 2IJD1 1J8AA 5GPIB 1J14A 3SW2B 1O2WA 3BN9A 3A85A 4Y6DA 4Y8XA 1ACBE 1HFDA 1QB9A 3RC6A 3RLWH 2G00A 1B0EA 4A6LA 2BLWA 2J95A 1FDPA 1WAYB 3LOXA 1V2OT 1ETTH 1DITH 4UDWH 1G3DA 1LKAA 3SJIA 1V2LT 1ZMNA 2JETB 1AZZA 1SQOA 2FESH 2ZU2A 4MQAA 4NGAH 4WMEA 4ABEA 1DDJA 3SORA 3GOVB 4FU9A 4YESB 1DWDH 1YCPM 1C5UA 4Q2KA 2A2QH 5LPEA 1TPSA 2TPIZ 5EQSA 1C2JA 1C2DA 3VEQB 3AAVA 1OS8A 1GHBG 3SU4A 2XW9A 3H5CB 3F9EA 1S84A 3NCLA 2BY8X 1XX9A 1Z7KA 1BTPA 1SB1H 3W95A 2NWNA 3RUOA 5GDSH 3K6YA 3B8JA 1O31A 2FX4A 6GCHF 1C1OA 4H6TA 1F5RA 3QN7A 1SGIB 5HMAA 2ANKH 2GZ9A 1O3JA 2F3CE 3D49H 2BDBA 1C5QA 2WPIS 3GCHC 1MKWH 1GHBF 2LNCA 4NA8A 2Y6TA 1SC8U 1TPPA 2UUJB 4Z6AH 3NWUA 4NWKA 2AGEX 1W2KH 2ZA5A 4Q80A 4I32A 2XBWA 1WBGB 3H09A 3M5LA 3A86A 1P06A 1AN1E 5DO4H 1DWBH 1QL8A 3LJJA 4YLUA 1O2QA 3MNCA 4ABAA 5LPFA 1GBTA 3RXDA 3E0NB 5GNDA 3GY2A 1TONA 1RIWC 1GVKB 1O2LA 5T6FA 1O2KA 5EQRA 3SQEE 1FUJA 4UFEH 2R9PA 1E0FD 1EAXA 2DE9A 3VB5A 1P04A 3M5NA 3EE0B 4HTCH 3ODDA 2BD3A 1TA6A 1AO5A 4GHQA 3S7HB 3MH5A 4O3UA 2OLGA 3GISB 1C2MA 3BTHE 2H9TH 3PO1B 1ELFA 4WH6A 1AFQB 1ZJDA 3K65B 1BQYA 1GBLA 3PWCA 4KKDA 3MO9A 3F9FA 4ABHA 4B2BA 1O2OA 3TJNA 1AHTH 5FXLA 1SGFG 2Z9KA 1G3CA 1HAIH 1O3PB 3I77A 3M37A 3RXUA 4Y76A 1FAXA 1O3LA 1BRCE 1GI8B 2HPQH 1CHOG 2OCVB 3F68H 1MTSA 1CHOF 1EAIA 1UTQA 4IMQA 3RXTA 3KCGH 3V0XA 1LQDB 4X8VH 2A5IA 1ZTLA 3ELAH 1EATA 1ZRKA 1YM0A 1W14U 2ZG0H 2V3OH 1EJAA 3MH6A 1T4VH 1HAGE 1DE7H 2BQ7B 1OWIA 4IN2A 4R8TB 4D7FA 1K1OA 4CH2B 5EPNA 2A7CA 3MO3A 1CGJE 1MKXK 2VIQA 2F9UA 1GI9B 2DUCA 2ZGBH 1XUKA
chains in the Genus database with same CATH superfamily
3LH1A 4E7RG 1LTOA 2KR7A 1YP9A 3ZZAA 1IQJA 3STIA 5T1VA 2KM0A 2HPPH 3RXPA 2C90B 3LC3A 3BF6H 4BTTB 4I8HA 2CGAA 2F9BH 2Z6BD 1CHGA 3SJ9A 2O8TA 1SGQE 2BZ6H 1UVPA 2OTVA 5DP4A 3SBKA 1GBHA 1AIXH 1O34A 1O3BA 2GJGA 3M3TA 4QT8C 1FXYA 1CU1A 2LPRA 3BIUH 3GDSA 1HNEE 4DOQA 5CHBA 2CF8H 5HM9A 3UNRA 3EE7A 2VB0A 2VVCA 4WXVA 1IQHA 2BY6X 5LPRA 1UK2A 4GUXA 4DGJA 3UB0A 2EY4C 1BBRE 3F9GA 6LPRA 1O2PA 1AE8H 3QLPH 1BRAA 3TPIZ 3A7TA 1ELGA 4TY7A 4E06H 1TQ7B 1W7GH 2EQNA 4AC9A 1XM1A 2QV1A 1AU8A 2FMJA 2A0QB 1HDTH 3K9XB 2Z9JA 3OAAD 5EW2H 2PSYA 1VZQH 3BTFE 3OE7D 1OWDA 4K1TA 1FN8A 1P2IA 1T4UH 4D8NA 2ODQA 4MPUA 1UVTH 2BHGA 3SNDA 1HIAA 1N1LA 1D3QB 1UTPA 1QJ6B 2ANYA 5FX5A 1P3CA 3U8RH 1BMNH 3ATKA 1B0FA 2WYGA 2NU4E 1S83A 1SL3A 2C8ZB 1TB6H 5FBIA 1FPHH 5C1XA 1AUJA 1HB0B 4Q7XA 1O2XA 3GCHB 3DFLA 3SV9A 3T29A 1Q3XA 2ZHDA 1O2SA 1J9CH 3RMLH 3KL6A 1MAXA 2JETC 1HYLA 2UWOA 3TNTA 2WPJS 4X2WA 2KFWA 5AVDA 1V2RT 1RD3B 1TNHA 3T27A 2F91A 5ESTE 4AG2A 3FVFB 2Y80A 1YCPK 1AVWA 2V3HH 2PLXA 3ZV8A 1Y3WA 1W0ZU 3KQBA 1EPTB 3TJOA 3P8OA 3ATWA 2VVVA 1MTNB 3KQCA 5FHTA 3S69A 1HAHH 1UVOA 3SYJA 1IQMA 3IWMA 1QNJA 3I29A 1GL1A 4X2VA 3RXLA 3MU5A 1P11E 2XCNA 1KTTB 5EJLA 2QF3A 3VGCC 2ZTYA 5B6OA 3M5OA 2BQ6B 1CA8B 2Y5HA 4GPGA 4X8TH 3AAUA 2HRVA 4FUCA 1E1QD 1TFXA 1ANEA 3CS0A 2O9QA 5CE1A 2RA3A 1XXDA 1P3EA 2EI7A 3MFJA 3A8AA 1W10U 1FIZA 3V3MA 3U8TH 1W7XH 1EJNA 1ABIH 3UIRA 3IITA 4K8YA 2P16A 2IN2A 1HGTH 3SGAE 1TQ0B 4AOQA 5B6LA 1O3IA 4ZXYH 2ZU1A 3RXAA 2W26A 1C1QA 2O8MA 1C5SA 3LJOA 3M35A 3SV2H 1ORFA 2BZAA 1ELEE 1L2EA 3F0OA 2PKSC 3F6UH 1T32A 4NSVA 4DG4A 3EQ0H 5EIYA 1RS0A 2GZ8A 2UUFB 1NPMA 2FLBH 5FCKA 3FO8D 1EB1H 1AD8H 1Z6EA 2UUYA 1SGTA 4CHAC 1O30A 4TWWA 4U01A 1SOTA 4VGCB 2HGTH 4NWLA 1C2IA 4IC5A 2VBCA 1UK3A 2OQ5A 3TNSA 4GCHG 4JYTA 1A7SA 1T8LA 1DSTA 1VCPA 1SGRE 1K1PA 4TY6A 4F4OC 5DP7A 1UMAH 1ZHRA 1Z6JH 3LGVA 1O2TA 3ZZCA 3MU8A 1OX1A 3QK1A 1P09A 1DWCH 1TGBA 3BEUA 1E38B 1WDIA 1P0SH 2ZFRH 1BT7A 1TBQH 4LZ1H 1O33A 1CO7E 2Z7FE 3JZ1B 1KLJH 3FOAA 2PKAA 3S9BA 1HAVB 4X2XA 1TX8A 3TJUA 1ETSH 4A92A 2PKSB 1Y3VA 5A0AE 3IG6B 4JK5A 2BXTH 2ZPRA 1P05A 5C94A 4CREA 1O2NA 2NU3E 1J17T 1GI2A 4NFFA 1BTZA 5I46H 8KME2 1C4U2 1G9IE 1ELDE 1HAXB 3PYHA 1V2JT 2WSSD 3DSGA 4LOYH 1KDQB 4ABDA 5FCRA 2WYJA 1E36B 3RMNH 1ZHMA 2GV7A 2XNIA 3P8NA 3LT3A 1GJ4H 1TA2A 2QF4A 2ZGCA 1GCTB 4INHA 2GX4A 3S9AA 8GCHG 4I7YH 2Z3CA 1IOEA 1UCYK 3A89A 2FOAA 1EXFA 1BB0B 3LGWA 1M9UA 4NA7A 3E6PH 1RRKA 1O2IA 3VGCB 2KX4A 5C20A 3A82A 2JH5D 5LGOA 3PMHB 3NKKA 3SJ8A 3H7OA 3OTJE 1NRPH 1H8ED 1WOFA 3UR9A 1HRTH 1V2MT 1THRH 3L6PA 3SU1A 1YPEH 3VB3A 1G30B 4X6NA 2GTBA 1JBUH 1AFEH 4ISHH 4Y8YA 2XYAA 1UO6A 3V13A 2A45B 1BUIA 2AGGX 3RXKA 1FY1A 3L33A 3LPRA 2VWNA 4BAOB 2A1DB 3PMAB 2J92A 3M7QA 2SGFE 5K0HA 1V2ST 1C2KA 1Y8TA 2VIVA 1FY4A 2CK3D 1F0RA 1QBNA 2GCHG 1RTLA 5EW1H 5F8ZA 3H7TA 3E16B 3A83A 1O3KA 3BTWE 1XXFA 1EP5A 2C8YB 3P70B 3LDXH 1T31A 1GHAG 3U98H 1S82A 3SUDA 4CRCA 1BHXB 3NK8A 1GHZA 1ANBA 1TE0A 3SU6A 1BDAA 4E05H 1NT1A 2WUBA 2GZ7A 4GVUA 4X6PA 3WW7A 2GDDA 2FI5E 3MNBA 3ODFA 1IHTH 1K1JA 1MD7A 2WV4A 1GHYH 3ZZ9A 2LP6A 5GCHG 1KLTA 3BTGE 5C0UA 1GI1A 5F8XA 1C5MD 1QRXA 4AZ2B 5F03A 1LPKB 1JOUB 3LGTA 1J16A 1OP8A 4B73A 2O8LA 2ZHWH 3Q3KA 2PFEA 3TGIE 4P00A 2F83A 5HYOA 1EB2A 1NS3A 5G4BA 2J2UA 3V12A 3ESTA 1SHHB 4B2CA 4Y7BA 1IQIA 3DSOA 1O5EH 1K1MA 1TMUH 1HAYB 2CXVA 1O2RA 2V0BA 2WPMS 2SNWA 1ELBA 1GJDB 1MQ6A 3TVJB 3KQ5A 1UTKA 3CENA 1C2GA 5DPAA 2PTCE 5DSFA 3QTVH 4F48B 1E79D 4YOJA 3PROA 2TGTA 1IQLA 1H9LB 2BDAA 1TPOA 1P2OA 2R3YA 1Z71A 3KQEA 1K1NA 1L1GA 1EUFA 2B8OH 1BTXA 1P8VC 2PW8H 3A8CA 3RXIA 1FI8A 1GHVH 2WPKS 1O2JA 1GBBA 3SHCH 2CJIA 2I6SA 1LCYA 1ELAA 5EU8A 2CMYA 4X6OA 2L74A 2F9VA 2YMSB 3RXGA 1D3DB 1SGDE 3U8OH 1OWJA 1F2SE 2FLRH 1W11U 1O3CA 4JYVH 1O3MA 1GG6C 2BVXH 2BVRH 1ZSJA 1QY6A 1EAUA 3HKJB 3M61U 3P95A 4U2WA 4J1YA 4B1TA 1KYNA 1GWAA 1TGTA 3BIVH 3QZRA 3WWBA 2LELA 2VH6A 3MMGA 1HJAC 3U9AH 3BTEE 1KXFA 4GCHF 1C2FA 4MG3A 3E0PB 1SBWA 3SV7A 1PQ8A 3OX7U 1MU6B 2OP9A 3ATMA 1BITA 3SOSA 1BJUA 3BTME 3RU4D 1GBFA 2EI6A 2HLCA 2J38A 1GJ8B 4VGCC 1SFIA 1H1BA 2Z94A 4WVPE 2TRMA 4MNXA 2VINA 4UONA 1K22H 4LXBH 2VIOA 1WQVH 2Z9GA 3BG4C 4TYDA 2SGEE 3RXCA 2DE8A 4NCYA 2VH0A 5JBBS 2ZIQH 4ABGA 1SQRA 3L3TA 4K8BA 4NZQA 3T2NA 1AQ7A 5H4IB 2IJOB 4K69A 2ULLA 1CT0E 5A8ZA 1CT2E 3VFEA 3KNXA 1P01A 1C2HA 2ZQ2A 4ZXXH 4ESTE 2ZDMA 3ZIAD 1C5WB 1QZ8A 2OUAA 4FUHA 3O8DA 4ZKOU 2ZDKA 4ZHMU 4WMFA 1TNGA 4AFSA 1HV7A 2QY0B 1O3NA 2C4FH 3ZYDA 5CDFE 3UY9A 1O3AA 1GHWH 4JK6A 4MLFB 4FUGA 1EOLA 2JH6D 4MNYA 4B76A 1ZPZA 1ZMJA 1QHRB 2OC0A 5EG4A 3UOUA 2H5CA 2ZFPH 3SZEA 1KXEA 1ETRH 5A09A 5AF9H 3E1XB 4YO9A 4YTAA 3A7XA 2SGPE 1TRNA 3TGKE 4X2YA 2D1JA 1S85A 1GJCB 4XBBA 3LGYA 1D4PB 4TSFD 3FP7E 1NFWA 2QCYA 1KMHB 1ZGIA 3PB1E 1FX0B 1C5ZB 1MTNC 3RXJA 1IQGA 2XBYA 1AZ8A 4Y71A 1HJ9A 2ZTXA 3MHWU 4BOHA 5KGOA 1AWFH 1EZSC 3S0NA 1PPEE 2QF0A 3MQKC 1L1NA 1O32A 1NFUA 4ABIA 4YT7H 3M36A 1YPHE 1HCGA 1S6FA 1TAWA 4A1VA 4ZHAA 4MPWA 1IQNA 3ZVFA 2JKHA 3RP2A 1QJ7B 3BG8A 1RXPA 2FIRH 2P3TB 4AFQA 2OC7A 1UTLM 2ZPQA 4AB8A 4THNH 1DICA 1P2QA 2PKAB 4X1NU 4AN7A 1DUEA 1OYTH 3MNSA 3SHAH 1C4Y2 1KXAA 1GBMA 2FOHA 2Q6GA 1TOCB 2WPLS 1NBME 1YLDA 2P8OC 4M9FA 4NIWA 1SOZA 1LVOA 2O8UA 3UTUH 3VPKA 4CH8B 3MI4A 1JMOH 2Q1JA 3LH3A 5ESBA 1ZSKA 1CGHA 1ZZZA 1QQUA 4DVAU 3HGNA 5KECA 2FYQA 3PLPA 2GCHF 2C8XB 5C1YA 4OS4A 3GDVA 4P02A 3KN2A 3TGJE 4Y11E 2FI3E 1O3EA 1WV7H 5DK1A 1C2LA 1EX3A 4B74A 1GPZA 2OC8A 1S6LA 5T6GA 1L1JA 4RKOB 4KGAA 2B7DH 2FYRA 2ZHQH 1C1TA 1Y5BT 2FX6A 3S7KB 3VB4A 2J9NA 3D62A 2Z9LA 5EXLA 4SGAE 1V2NT 5JPMH 1LVMA 2WHXA 1NY22 3KHVA 2SFAA 3MH7A 1AY6H 2OK5A 4Y7AA 2VGCC 2PUQH 1WTHD 3T28A 1CE5A 1Z8RA 1GDQA 1UCYE 3UNSA 2K1QA 1A46H 4YT6H 1NROH 1WQSA 3RXBA 1DXWA 1G32B 5A0BA 4DW2U 1SGPE 2JDID 4ZROA 1GJAB 1P2MA 1MZDA 2VJ1A 2ZECA 3MO6A 3T62A 1O37A 1Y5AT 4JZFH 4FUFA 4I33A 2H5DA 4YOIA 4B2AA 3CNRA 4IMZA 1EP6A 3QO6A 5DKMA 4KTCA 3GY5A 1UVSH 1YPJH 2VIPA 5JB8S 3ZVCA 3UFAA 1O35A 2HNTE 4IC6A 1TNKA 4BAKB 1GHXH 1A0HB 1GVLA 1ABJH 2FOBA 1GDNA 1GBJA 2FI4E 2EA3A 4OS1A 2BOHB 1GGDB 1GG6B 4CR5A 2Y5FA 4AYVB 1BMFD 4ABFA 3Q3XA 2BOKA 4X0WU 1E35B 2BDCA 1EQ9A 1TMBH 3OY6U 4WH8A 1LHFH 3AVZA 3TH4H 3Q00A 4MDSA 3EYDA 1HAOH 4OS6A 1IQKA 1YPGH 4ZMAH 2A7JA 3K2UA 1H9HE 3M3SA 1THSH 3PMJA 1SQAA 5DN6D 2VNTA 3SZNA 2PUXB 3HPTB 1QR3E 2WPHS 1FMGA 1OHHD 1GMCG 3GY8A 2STAE 1EZUC 1DWEH 1O2HA 4XE4A 1NESE 2FXRA 1VR1H 1S5SA 3A80A 3RU4E 1SGYE 2ZDAH 1CT4E 1GI7B 1SGFA 1DM4B 4TT3D 1L4DA 3QZQA 1QIXB 3F2GA 3RXVA 1FY3A 1GDUA 1MABB 1HIAB 3GCNA 2AIQA 4FUJA 1KY9A 2D8WA 1O3DA 2TGPZ 5AFZH 1AFQC 1A0JA 2ZF0H 4J2YB 3VXEH 2QXGA 1BZXE 1PPGE 3OTPA 3A7VA 3CS7A 4JZDH 1LHEH 1ZYOA 3P17H 1HAVA 1SSXA 1PFXC 2XBXA 5IDKA 2RG3A 3I78A 4TPIZ 4CRAA 1GI5A 1SR5C 4FUEA 5EQQA 2XBVA 5EOKA 1WYKA 3SI4H 3U1JB 5C0TA 1S0RA 1P9UA 1ZRBA 2AERH 2Y5GA 1RJXB 3TITA 1RIWB 2QN5T 2IOTA 2JJ1D 1KXCA 1XUJA 2RCEA 1P2JA 1Q2WA 2OC1A 1LVBA 4WY3A 1C1WH 2ZHFH 3GY6A 2ZO3H 4X8UH 3RXQA 1NC6A 1GBIA 1FY8E 1GJ5H 2J97A 1F0UA 1O5AB 1DANH 1YCPH 5JB9S 1GI4A 5GIBA 5EXMA 1ZSLA 2ZDVH 3BEIB 2C93B 1Y3UA 3R3GB 1D6RA 1PPFE 3A7YA 1XUIA 4FUDA 2CN0H 1V2UT 4NFEA 2CHAB 2BY7X 2TBSA 1O2UA 1LHCH 2PSXA 3MNXA 5EPYA 5E8EH 2NU1E 4BTIB 1VCWA 2G5VA 5L2YH 2ZC9H 5DG6A 1O2VA 5FPYA 1TX7A 1F5KU 5TCAA 1FNIA 1TLDA 1JRSA 1YBWA 2Q6FA 1XKAC 1SLVB 3TU7H 1YKTA 4DT4A 4ASHA 2CV3A 4ZAEA 1GI0A 2KZ4A 2AH4X 1FIWA 1WUNH 2G81E 1BTWA 2K8IA 5DP3A 3RXOA 2ZFFH 1GVZA 1W12U 1C1PA 2FPZA 2P3FH 1WCZA 1MCTA 1NRSH 1SVPA 3DD2H 1A5GH 3FFGA 2WUCA 3MH4A 2BD8A 1UTJA 3SO3A 1V2VT 1A0LA 1TRYA 3RXFA 3GY7A 5A8YA 1XVOA 1JWTA 1MBMA 3SU3A 3ZV9A 1O5GH 4UE7H 3SNCA 3GY4A 2BVSH 4NZLA 1K0HA 2QXIA 2ODPA 4RT1A 2OXSA 2WINI 1ID5H 3OU0A 3OY5U 2WV5A 4BAQB 5LH8A 5C5NA 3PTNA 4O03A 1JIRA 2C3SA 1W8BH 3A7ZA 4Q63A 1W3CA 2NU2E 4ZUHA 4MNWA 1DS2E 1MD8A 4BXWA 3SU0A 1YC0A 2FOGA 3AASA 1QURH 2A4RA 4X1QU 1PYTD 2AHME 2Z9IA 1QA7A 1XUGA 2G5NA 2G4TA 1O3FA 1TPAE 4CR9A 4MPVA 1O5DH 3EA7A 2OQUA 2F9NA 1C4V2 1H8IH 3E91A 1MTUA 4OS5A 4KTSA 1F0SA 3QX5H 1TOMH 1BBRK 4WMDA 1G37A 1TNIA 4K3JA 2ODYB 1LKBA 4BXSA 1TGNA 1C5XB 3F2FA 1UJ1A 5I25A 3BTQE 3RMMH 3SU2A 4WJG2 2OBOA 9ESTA 1TNJA 1U6QA 4TPYA 3SUEA 2H9EH 1E1RD 1GMDG 4D76A 3TLOA 3SU5A 2XCFA 2V6NA 1YLCA 1BBRH 3KQDA 1C5VA 3SUFA 4D9RA 2ANWA 2JH0D 5FX6A 4E7NA 1PQ7A 1SI5H 1C1SA 5E2OA 4FETA 1HJAB 4LK4A 5ABWA 5F6MA 1AB9C 1F7ZA 5L30H 2ZCKP 1ESBA 1OWEA 5DP8A 1NTPA 5GJ4B 3RU4T 1MTWA 2CF9H 2HVYB 4ZCNA 4ISLA 1IQFA 2RDEA 2TIOA 3NPSA 1QFKH 3FAOA 1N8OC 3FANA 1DLEA 4I31A 2AFQB 1HBTH 3A7WA 4NG9H 3BV9B 4HI3A 2VVUA 1L0ZA 2P93A 1C5RA 2PGQB 2XWBI 2FS9A 3PM3A 1GI6A 2BDYA 4FOUC 1UTNA 1OPHB 3KIDU 4GAWA 1PQ5A 2WZQA 3C27B 3KF2A 1GJBB 4U32A 1W0KD 1SHYA 2Y7XA 1MZAA 2AMQA 3LC5A 3U1IB 1C2EA 4I8KA 4D9QA 4CRGA 4DIHH 1AGJA 2L6OA 1C9PA 4AGKA 4H42U 1O0DH 1Y59T 2ZFSA 3ENSB 4RN6A 3SNEA 8GCHF 1WTGH 2A4QA 3MU1A 1MMJN 2CHAC 3QGNB 5BPEA 3SJKA 1O3GA 1GMCF 4XD7D 1LHGH 2XNDD 4WXIA 3TH2H 1ANDA 1C5LH 2PHBA 2ZNKH 2FDAA 5E0JA 1EPTC 1GBCA 1A3EH 1GBAA 1NFXA 2GD4B 1ZJKA 4FUIA 3ZZ6A 2VIDA 4K5ZA 1YWUA 4ABBA 5HIYA 6CHAB 3U69H 5HGGA 4XDEA 4A1TA 2P95A 3O8RA 1TGSZ 1GMHF 1TMTH 4MVNA 5T6DA 1KSNA 3MWIU 1GMDF 4UD9H 3P92A 1MTVA 5C67A 4DIIH 1MBQA 4D7GA 1A2CH 1IQEA 2J94A 2BDIA 1D3TB 1DT2A 4UEHH 4YXWD 5FAHA 2GKVE 3RXEA 2W6ID 3P8FA 1ELTA 4JYUH 1FZZA 4Y79A 2BX4A 1S0QA 1HPGA 3C1KA 1HXFH 3QDZB 4DJZB 1SGEE 1HAPH 1L4ZA 3VB6A 1SGCA 1ZMLA 2BD5A 3UUZA 4R0IA 1GI3A 3HKIB 1P9SA 1GMHG 3BTDE 3DA9B 1EOJA 1D9IA 2A4OA 4BTUB 1K21H 1G2LA 2KAIB 2A32A 3AW1A 1O36A 3A88A 4KELA 1EAWA 3RXHA 3Q77A 1YPKH 4RKJB 1EKBB 3OEHD 1AVGH 2XXLA 3OFND 4A5TS 1ARCA 4YZUA 3FZDA 4DY7B 2VU8E 2FEQH 2SGQE 2H9HA 1O39A 1G36A 3ATIA 3EA9A 4JCNA 5DP5A 2ZU3A 4CRBA 2XRCA 1K1IA 3N99A 5C3NA 2Y82A 2G51A 1K9OE 5K7RA 1ELCA 3UQOA 4AORA 3OYPA 5L2ZH 2ZGHA 1BHXF 1BIOA 3QGJA 1K1LA 1RTFB 2PP6A 2ZWLH 5GXPA 3GICB 5CHAB 4HGCA 2FOFA 2ZCLP 2OD3B 4FVBA 3NUMA 2AYWA 4A1XA 1C9TA 1C1NA 1O2ZA 3Q3YA 4H4FA 3ZZ8A 1P02A 1SG8B 5E0HA 1GGDC 2Y81A 1IAUA 1YPMH 1FY5A 1SGNE 2AEIH 5E2PA 1BRUP 1TBZH 1Y3XA 1XMNB 3T25A 3E8LA 1UHBB 4OS7A 1FLEE 3TIUA 3U28C 4K2YA 1KXBA 1TX6A 1ESTA 4TWYA 1YPLH 1EFRD 1OXGA 2J4IA 2ZFTA 3T5FH 3PV4A 3WWFA 1XUFA 3FP6E 1D6WA 2ZU5A 4Z1MD 3SGBE 2BY5X 1Z8IB 2D26C 1VJAU 4CRFA 3PV5A 1P2NA 4DURA 4I8GA 4I8JA 1N8OB 1W0YH 1O5CB 1ZR0A 3ATLA 3SI3H 2W3IA 3PWBA 5A2MH 1IHSH 3F1SB 1INCA 3OEED 1ZOMA 2AGIX 2ZEBA 4K1SA 4XRNA 3A81A 1SLUB 1O3HA 3CP7A 1QBVH 3HATH 4OM9A 1ZPBA 4AYYB 2VGCB 1QB1A 4NIXA 1WSSH 4ZKSU 3AK5A 5EODA 1CGIE 7ESTE 1O2GH 4FU8A 3UPEA 1C5YB 1GBDA 1H9IE 2ASUB 2GCTC 3NXPA 5F53A 4WWYA 2P3UB 2Z3DA 2FS8A 2BB4A 3PO1C 4DCDA 5CHAC 4Y0YE 1XKBC 1OWKA 1LPGB 4Y0ZE 1T8MA 2ESTE 3M3VA 1LQEA 4ABJA 1JRTA 2KCAA 1QCPA 1GBKA 3ITIA 4BAHB 4BANB 2ZFQH 1AVXA 2ALPA 1BA8B 1V2KT 4CHAB 4IS5A 3TH3H 2FOMB 3UWIA 2ZU4A 2RDLA 1Z1JA 1H8DH 3GYLB 5DGJA 1CBWC 2BLOA 5JYIA 1DPOA 2OINA 3LIWA 4AFUA 3DFJA 1PJPA 4UFDH 1FN6A 5F8TA 2F9OA 4SGBE 3RC5A 4RSPA 1LVYA 4U30A 3SNBA 1QB6A 2H1UA 3EGKH 2ZZUH 1P2KA 3QWCH 4YOGA 1P57B 3WY8A 5GCHF 1PQAA 1TWXB 1HJ8A 2IPHA 5JDUB 1MUEB 5JBTA 3ZZ3A 2BD7A 2ZHEH 5SGAE 3N7OA 1LHDH 1AKSB 1V3XA 4ISIH 1V2PT 4O3TA 1OP0A 5C2ZA 3KEEA 4F49A 3OSYA 1KIGH 1THPB 1E37B 3VB7A 2ZI2H 2XC5A 3HGPA 2BLVA 2AMPA 2ZP0H 2BDGA 1MKXH 1T8NA 4KTUA 3RMOH 2P59A 1S6HA 2R2WU 2Y7ZA 3AW0A 1QL7A 4B75A 2XTTB 4RI0A 4Y8ZA 2P8OB 4AGJA 2GVFA 1QJ1B 2FTLE 2FTMA 5JBCS 4ZH8A 2GDEH 2HNTC 7LPRA 1DX5M 4GSOA 1MH0A 2VIWA 1MQ5A 1DLKB 5DJ7A 1GL0E 1PPZA 4CBOA 4INLA 2UWLA 3G01A 4YM9A 4HG6A 3ZZ4A 3F3BA 1TALA 2AIPA 3FP8E 4BNRA 1AE5A 1AUTC 2YNBA 1PPCE 3SGQE 2BMGB 1DY8A 1A61H 3PRDA 2A4GA 2BD4A 2J34A 4K1EA 2W6JD 3HK3B 1QBOA 3Q76A 1AI8H 4ACAA 2BD2A 4H6SB 4X6MA 1BRBE 3P8GA 1V2TT 1GHAF 1SPJA 1G3EA 3ZVAA 1VITG 2VWLA 2QAAA 1GJ7B 3ZZBA 2KCOA 4F55A 3GCTG 4ISNA 3A8DA 2PGBB 2ZGXH 2ILNA 2SNVA 2FWWA 4M7GA 3V7TA 3EA8A 2A5AA 5FBEA 1YGCH 1GJ9B 2GMTB 3B23B 2GV6A 2GT8A 4FUBA 4X8SH 1Z8JB 1EZQA 2FODA 2BDHA 2M2AA 5AFYH 3W1EA 1GBEA 1NRRH 8ESTE 1A1RA 1YPHC 4OS2A 1WU1A 2BTCE 1TBRH 2UUKB 5CMXH 2HWLB 2FO9A 2XC0A 3KYGA 1OYQA 1CA0C 3ZZ7A 1VGCB 2H2ZA 6ESTA 1BMMH 1W13U 3UOPA 2QF5A 1UCYH 4IW4E 2XC4A 4WF8A 1O2MA 1H8HD 1FAKH 2A31A 3ZVEA 1NO9H 5FPSA 1MKWK 1NRQH 4Q7YA 5TJXA 3EDXB 4AG1A 4X1PU 1C1UH 1DUAA 3ZZ5A 3LGUA 1A5HA 2GCTB 2ZCHP 2V35A 1Y3YA 1NN6A 2KCYA 1TRMA 3M5MA 1DXPA 2ZDNA 3SQHE 1CBWB 1ESAA 3TK6A 5E0GA 1ZHPA 1A5IA 1CQQA 2FOCA 2NU0E 1P03A 3BG4B 4CBNA 2TGAA 1ZGVA 1NZQH 4RT0A 1S81A 1VITH 2GGVB 2ZDLA 2BD9A 2G4UA 1C5PA 4UFFH 2GP9B 4FVDA 3TK5A 3R0FA 3SN8A 1QTFA 5EJZA 4AB9A 1F92A 1MAYA 2QC2A 1QL9A 1AMHA 5A8XA 1UVUH 3RM0H 2B5TB 2OBQA 1MCVA 4O9VA 1ZTKA 4HFPB 4A7IB 5PTPA 2QXHA 4HZHA 3SJOA 1TIOA 4ACBA 3LGIA 2PV9B 3UR6A 3M7UA 5AHGH 5A0CA 1A3BH 2W5EA 3E90B 2B9LA 3BEFB 1EPTA 2QIQA 2Q6DA 1EASA 1BJVA 2YMSD 1NFYA 2C8WB 4GLYA 4IN1A 1O38A 4ISOA 3QTOH 1E34B 1NU7B 3LKWA 1P10A 4YLQH 3MU0A 3BSQA 3SNAA 1Z1IA 2AS9A 3RC4A 4O97A 4MTBA 2W3KA 1DOJA 1SMFE 4MPXA 5EXNA 2FM2A 9LPRA 1FONA 5TCCA 3STJA 5T3HA 3DT0H 2PTNA 3ZVGA 1K2I1 3MTYA 3PLBA 7GCHG 5J4SA 3GCTF 3SV8A 1CVWH 7GCHF 1OWHA 1X7AC 1V2QT 2SGDE 5EGMA 1VJ9U 2HOBA 3MYWA 1DSUA 1NBMD 2V7QD 1JXPA 2ANMH 1PYTC 1BOQA 1KDQA 3UREA 2G52A 5GWZA 2HLDD 3BTKE 2XWAA 4ZKNU 1TYNA 3URDA 3UNQA 3UQVA 5HXFA 2QXJA 3B9FH 1RFNA 4NIYA 1YYY1 6GCHG 3DCLA 1O5FH 4GHTA 1ANCA 1BTHH 3GS9A 3DSPA 3UWJH 2ALVA 3VG8A 3RXSA 1T7CA 1G3BA 2HVXA 1C1MA 4X1SU 2AMDA 4XBDA 2I6QA 1ZPCA 3RDZA 2R2MB 3GDUA 1NM6A 2YNAA 3DUXH 3A87A 5DP6A 5EJ1A 1SLWB 1K28D 1T8OA 3FN8A 1SQTA 2JJ2D 3RM2H 4NA9H 4Q7ZA 1QA0A 2STBE 1CSOE 2PR3A 4I8LA 1B5GH 1SFQB 2EEKA 2QA9E 3RLYH 4X1RU 1SKYE 1F5LA 1OSSA 1O5BB 1HAZB 3UAIC 2B0FA 2BXUH 4FU7A 3PLKA 4ASUD 1COWD 1WXRA 1C5TA 4UFGH 3BTTE 1C5OH 1D3PB 5HKKD 2GT7A 2YOLA 3PTBA 1NRNH 3F2HA 1DFPA 1TNLA 1VKYA 1ARBA 1RGQA 1KXDA 2QGRA 1QQ4A 3URCA 1KTSB 2VWMA 1P12E 4JMYA 2BX3A 3A84A 3FZZA 1AWHB 3LU9B 3E3TA 3T26A 1LO6A 2G55A 3QUMP 3JZ2B 3TJVA 5ETXA 6CHAC 2JIZD 1GCTC 1GCDA 5KEDA 1N6XA 2THFB 4AX9H 1RTKA 1UHBA 8LPRA 1NU9A 2F9PA 2HALA 2XOKD 1KLIH 4K60A 1W0JD 2QYIA 4JZEH 2J5UA 1BCUH 2BM2A 4IGDA 4JZ1A 3SUGA 4ZHLU 4B71A 1HLTH 3MOCA 4I86A 3RXRA 5C5OA 2G8TA 4DT7B 1HUTH 1FV9A 2ZGJA 3DHKH 1TABE 3ZVBA 1BMAA 1BMLA 4FXGH 1FJSA 2Z3EA 1ELVA 3GY3A 3PRBA 1G2MA 4IBLH 1Q31A 1UTMA 2A7HA 1DVAH 2R0KA 2ZQ1A 5HM2A 1V6DA 3D65E 4XSKU 2EC9H 3GCOA 1EJMA 3ZVDA 4Z0KA 2D2DA 1PPHE 2F43B 2EI8A 2O8WA 2R0LA 2TGDA 3O8BA 1OOKB 1UK4A 5IYTA 1OKXA 4NSYA 1QRWA 5JBAS 5L6NH 2FZZA 2M5TA 4Y10E 2J98B 1B7XB 2KAIA 2P94A 3D23A 2UWPA 1MU8B 2BYAX 1BTYA 1LPZB 2BLQA 4B6EA 1HXEH 1A4WH 3O8CA 1C5NH 1VITF 2H6MA 2FOEA 2ZPSA 2A5KA 1AKSA 1JIMA 4CRDA 1J15A 3TK9A 1EZXC 2W7UA 5DP9A 4INKA 3P6ZB 2F4LA 4MNVA 1FQ3A 4NIVA 4ZKRU 3LONA 3K6ZA 2A2XH 1YF4A 3NRLA 1XVMA 3MU4A 3SV6A 5FPTA 1F0TA 2VWOA 2BY9X 1AB9B 3M7TA 2PWXA 2WV9A 1SLXB 1GJ6A 1TGCA 4AFZA 2ZTZA 1ZLRA 4XBCA 3ZYEA 4KP0A 3F9HA 1Z8GA 1QGFA 2RFKC 1QRZA 4OGXA 1DY9A 4XOJA 2FP7B 2W7SA 4LZ4B 1Y5UT 1LMWB 3N7DA 4PROA 1YY3A 3EAJA 3S9CA 4OGYA 1UTOA 3KGPA 3GYMA 1XUHA 4JZIA 3PV2A 1VGCC 3N7EA 1CA0B 1VCQA 1BTUA 1O2YA 1PPBH 3VXFH 1O3OA 2SGAA 2ZKSA 2R3UA 1C1VH 3A8BA 5IK2D 3HK6B 3ZZDA 1UW7A 5J4QA 2RA0A 1V2WT 1LDTT 2HNTF 2BQWB 1ZTJA 4B6FA 4BAMB 3NZIA 5BRRE 1H4WA 5C1UA 1N6YA 2GMTC 1OP2A 3RXMA 1FPCH 3W94A 1C1RA 3F0PA 4XFQA 3PMBB 7KMEH 2IJD1 1J8AA 5GPIB 1J14A 3SW2B 1O2WA 3BN9A 3A85A 4Y6DA 4Y8XA 1ACBE 1HFDA 1QB9A 3RC6A 3RLWH 2G00A 1B0EA 4A6LA 2BLWA 2J95A 1FDPA 1WAYB 3LOXA 1V2OT 1ETTH 1DITH 4UDWH 1G3DA 1LKAA 3SJIA 1V2LT 1ZMNA 2JETB 1AZZA 1SQOA 2FESH 2ZU2A 4MQAA 4NGAH 4WMEA 4ABEA 1DDJA 3SORA 3GOVB 4FU9A 4YESB 1DWDH 1YCPM 1C5UA 4Q2KA 2A2QH 5LPEA 1TPSA 2TPIZ 5EQSA 1C2JA 1C2DA 3VEQB 3AAVA 3KYFA 1OS8A 1GHBG 3SU4A 2XW9A 3H5CB 3F9EA 1S84A 3NCLA 2BY8X 1XX9A 1Z7KA 1BTPA 3FKSD 1SB1H 3W95A 2NWNA 3RUOA 5GDSH 3K6YA 3B8JA 1O31A 2FX4A 6GCHF 1C1OA 4H6TA 1F5RA 3QN7A 1SGIB 5HMAA 2ANKH 2GZ9A 1O3JA 2F3CE 3D49H 2BDBA 1C5QA 2WPIS 3GCHC 1MKWH 1GHBF 2LNCA 4NA8A 2Y6TA 2V3MA 1SC8U 1TPPA 2UUJB 4Z6AH 3NWUA 4NWKA 2AGEX 1W2KH 2ZA5A 4Q80A 4I32A 2XBWA 1WBGB 3H09A 3M5LA 3A86A 1P06A 1AN1E 5DO4H 1DWBH 1QL8A 3LJJA 4YLUA 1O2QA 4Q4LA 3MNCA 4ABAA 5LPFA 1GBTA 3RXDA 3E0NB 5GNDA 3GY2A 1TONA 1RIWC 2IPQX 1GVKB 2J98A 1O2LA 5T6FA 1O2KA 5EQRA 3SQEE 1FUJA 4UFEH 2R9PA 1E0FD 1EAXA 2DE9A 3VB5A 1P04A 3M5NA 3EE0B 4HTCH 2WPDD 3ODDA 2BD3A 5FL7D 1TA6A 1AO5A 4GHQA 3S7HB 3MH5A 4O3UA 2OLGA 3GISB 1C2MA 3BTHE 2H9TH 3PO1B 1ELFA 4WH6A 5C17A 1AFQB 1ZJDA 3K65B 1BQYA 1GBLA 3PWCA 4KKDA 3MO9A 3F9FA 4ABHA 4B2BA 1O2OA 3TJNA 1AHTH 5FXLA 1SGFG 2Z9KA 1G3CA 1HAIH 1O3PB 3I77A 3M37A 3RXUA 4Y76A 1FAXA 1O3LA 1YLNA 1BRCE 1GI8B 2HPQH 5HIZA 1CHOG 2OCVB 3F68H 1MTSA 1CHOF 1EAIA 1UTQA 4IMQA 3RXTA 3KCGH 3V0XA 1LQDB 4X8VH 2YMSC 2A5IA 1ZTLA 3ELAH 1EATA 1ZRKA 1YM0A 1W14U 2ZG0H 2V3OH 1EJAA 3MH6A 1T4VH 1HAGE 1DE7H 2BQ7B 1OWIA 4IN2A 2QE7D 4R8TB 1K1OA 4CH2B 4D7FA 5EPNA 2A7CA 3MO3A 2KCPA 1CGJE 1MKXK 2VIQA 2F9UA 1GI9B 2DUCA 2ZGBH 2K0QA 1XUKA
chains in the Genus database with same CATH topology
3LH1A 4E7RG 1LTOA 2KR7A 1YP9A 3ZZAA 1IQJA 3STIA 5T1VA 2KM0A 2HPPH 3RXPA 2C90B 3LC3A 3BF6H 4BTTB 4I8HA 2CGAA 2F9BH 2Z6BD 1CHGA 3SJ9A 2O8TA 1SGQE 2BZ6H 1UVPA 2OTVA 5DP4A 3SBKA 1GBHA 1AIXH 1O34A 1O3BA 3M3TA 4QT8C 1FXYA 1CU1A 2LPRA 3BIUH 3GDSA 1HNEE 4DOQA 5CHBA 2CF8H 5HM9A 3UNRA 2VB0A 2VVCA 4WXVA 1IQHA 2BY6X 5LPRA 1UK2A 4GUXA 4DGJA 3UB0A 1BBRE 3F9GA 6LPRA 1O2PA 1AE8H 3QLPH 1BRAA 3TPIZ 3A7TA 1ELGA 4TY7A 4E06H 1TQ7B 1W7GH 1XM1A 2QV1A 1AU8A 2FMJA 2A0QB 1HDTH 3K9XB 2Z9JA 3OAAD 5EW2H 2PSYA 1VZQH 3BTFE 3OE7D 1OWDA 4K1TA 1FN8A 1P2IA 1T4UH 4D8NA 2ODQA 4MPUA 1UVTH 2BHGA 3SNDA 1HIAA 1N1LA 1D3QB 1UTPA 1QJ6B 2ANYA 5FX5A 1P3CA 3U8RH 1BMNH 3ATKA 1B0FA 2WYGA 2NU4E 1S83A 1SL3A 2C8ZB 1TB6H 5FBIA 1FPHH 5C1XA 1AUJA 1HB0B 4Q7XA 1O2XA 3GCHB 3DFLA 3SV9A 3T29A 1Q3XA 2ZHDA 1O2SA 1J9CH 3RMLH 3KL6A 1MAXA 2JETC 1HYLA 2UWOA 3TNTA 2WPJS 4X2WA 2KFWA 5AVDA 1V2RT 1RD3B 1TNHA 3T27A 2F91A 5ESTE 4AG2A 3FVFB 2Y80A 1YCPK 1AVWA 2V3HH 2PLXA 3ZV8A 1Y3WA 1W0ZU 3KQBA 1EPTB 3TJOA 3P8OA 3ATWA 2VVVA 1MTNB 3KQCA 5FHTA 3S69A 1HAHH 1UVOA 3SYJA 1IQMA 3IWMA 1QNJA 3I29A 1GL1A 4X2VA 3RXLA 3MU5A 1P11E 2XCNA 1KTTB 2QF3A 3VGCC 2ZTYA 5B6OA 3M5OA 2BQ6B 1CA8B 2Y5HA 4GPGA 4X8TH 3AAUA 2HRVA 4FUCA 1E1QD 1TFXA 1ANEA 3CS0A 2O9QA 5CE1A 2RA3A 1XXDA 1P3EA 2EI7A 3MFJA 3A8AA 1W10U 1FIZA 3V3MA 3U8TH 1W7XH 1EJNA 1ABIH 3UIRA 3IITA 4K8YA 2P16A 2IN2A 1HGTH 3SGAE 1TQ0B 4AOQA 5B6LA 1O3IA 4ZXYH 2ZU1A 3RXAA 2W26A 1C1QA 2O8MA 1C5SA 3LJOA 3M35A 3SV2H 1ORFA 2BZAA 1ELEE 1L2EA 3F0OA 2PKSC 3F6UH 1T32A 4NSVA 4DG4A 3EQ0H 1RS0A 2GZ8A 2UUFB 1NPMA 2FLBH 5FCKA 3FO8D 1EB1H 1AD8H 1Z6EA 2UUYA 1SGTA 4CHAC 1O30A 4TWWA 4U01A 1SOTA 4VGCB 2HGTH 4NWLA 1C2IA 4IC5A 2VBCA 1UK3A 2OQ5A 3TNSA 4GCHG 4JYTA 1A7SA 1T8LA 1DSTA 1VCPA 1SGRE 1K1PA 4TY6A 4F4OC 5DP7A 1UMAH 1ZHRA 1Z6JH 3LGVA 1O2TA 3ZZCA 3MU8A 1OX1A 3QK1A 1P09A 1DWCH 1TGBA 3BEUA 1E38B 1P0SH 2ZFRH 1BT7A 1TBQH 4LZ1H 1O33A 1CO7E 2Z7FE 3JZ1B 1KLJH 3FOAA 2PKAA 3S9BA 1HAVB 4X2XA 1TX8A 3TJUA 1ETSH 4A92A 2PKSB 1Y3VA 5A0AE 3IG6B 4JK5A 2BXTH 2ZPRA 1P05A 4CREA 1O2NA 2NU3E 1J17T 1GI2A 4NFFA 1BTZA 5I46H 8KME2 1C4U2 1G9IE 1ELDE 1HAXB 3PYHA 1V2JT 2WSSD 4LOYH 1KDQB 4ABDA 5FCRA 2WYJA 1E36B 3RMNH 1ZHMA 2GV7A 2XNIA 3P8NA 3LT3A 1GJ4H 1TA2A 2ZGCA 2QF4A 1GCTB 4INHA 2GX4A 3S9AA 8GCHG 4I7YH 2Z3CA 1IOEA 1UCYK 3A89A 2FOAA 1EXFA 1BB0B 3LGWA 1M9UA 4NA7A 3E6PH 1RRKA 1O2IA 3VGCB 5C20A 3A82A 2JH5D 5LGOA 3PMHB 3NKKA 3SJ8A 3H7OA 3OTJE 1NRPH 1WOFA 1H8ED 3UR9A 1HRTH 1V2MT 1THRH 3L6PA 3SU1A 1YPEH 3VB3A 1G30B 4X6NA 2GTBA 1JBUH 1AFEH 4ISHH 4Y8YA 2XYAA 1UO6A 3V13A 2A45B 1BUIA 2AGGX 3RXKA 1FY1A 3L33A 3LPRA 2VWNA 4BAOB 2A1DB 3PMAB 2J92A 3M7QA 2SGFE 5K0HA 1V2ST 1C2KA 1Y8TA 2VIVA 1FY4A 2CK3D 1F0RA 1QBNA 2GCHG 1RTLA 5EW1H 5F8ZA 3H7TA 3E16B 3A83A 1O3KA 3BTWE 1XXFA 1EP5A 2C8YB 3P70B 3LDXH 1T31A 1GHAG 3U98H 1S82A 3SUDA 4CRCA 1BHXB 3NK8A 1GHZA 1ANBA 1TE0A 3SU6A 1BDAA 4E05H 1NT1A 2WUBA 2GZ7A 4GVUA 4X6PA 3WW7A 2GDDA 2FI5E 3MNBA 3ODFA 1IHTH 1K1JA 1MD7A 2WV4A 1GHYH 3ZZ9A 5GCHG 1KLTA 3BTGE 5C0UA 1GI1A 5F8XA 1C5MD 1QRXA 4AZ2B 5F03A 1LPKB 1JOUB 3LGTA 1J16A 1OP8A 4B73A 2O8LA 2ZHWH 3Q3KA 2PFEA 3TGIE 2F83A 5HYOA 1EB2A 1NS3A 5G4BA 2J2UA 3V12A 3ESTA 1SHHB 4B2CA 4Y7BA 1IQIA 3DSOA 1O5EH 1K1MA 1TMUH 1HAYB 2CXVA 1O2RA 2V0BA 2WPMS 2SNWA 1ELBA 1GJDB 1MQ6A 3TVJB 1UTKA 3CENA 1C2GA 5DPAA 2PTCE 5DSFA 3QTVH 1E79D 4YOJA 3PROA 2TGTA 1IQLA 1H9LB 2BDAA 1TPOA 1P2OA 2R3YA 1Z71A 3KQEA 1K1NA 1L1GA 1EUFA 2B8OH 1BTXA 1P8VC 2PW8H 3A8CA 3RXIA 1FI8A 1GHVH 2WPKS 1O2JA 1GBBA 3SHCH 2CJIA 2I6SA 1LCYA 1ELAA 5EU8A 2CMYA 4X6OA 2F9VA 2YMSB 3RXGA 1D3DB 1SGDE 3U8OH 1OWJA 1F2SE 2FLRH 1W11U 1O3CA 4JYVH 1O3MA 1GG6C 2BVXH 2BVRH 1ZSJA 1QY6A 1EAUA 3HKJB 3M61U 3P95A 4U2WA 4J1YA 4B1TA 1KYNA 1GWAA 1TGTA 3BIVH 3QZRA 3WWBA 2VH6A 3MMGA 2LELA 1HJAC 3U9AH 3BTEE 1KXFA 4GCHF 1C2FA 4MG3A 3E0PB 1SBWA 3SV7A 1PQ8A 3OX7U 1MU6B 2OP9A 3ATMA 1BITA 3SOSA 1BJUA 3BTME 3RU4D 1GBFA 2EI6A 2HLCA 2J38A 1GJ8B 4VGCC 1SFIA 1H1BA 2Z94A 4WVPE 2TRMA 4MNXA 2VINA 4UONA 1K22H 4LXBH 2VIOA 1WQVH 2Z9GA 3BG4C 4TYDA 2SGEE 3RXCA 2DE8A 4NCYA 2VH0A 5JBBS 2ZIQH 4ABGA 3L3TA 4K8BA 4NZQA 3T2NA 1AQ7A 5H4IB 2IJOB 4K69A 2ULLA 1CT0E 5A8ZA 1CT2E 3VFEA 3KNXA 1P01A 1C2HA 2ZQ2A 4ZXXH 4ESTE 2ZDMA 3ZIAD 1C5WB 2OUAA 4FUHA 3O8DA 4ZKOU 2ZDKA 4ZHMU 4WMFA 1TNGA 4AFSA 1HV7A 2QY0B 1O3NA 2C4FH 3ZYDA 5CDFE 3UY9A 1O3AA 1GHWH 4JK6A 4MLFB 4FUGA 1EOLA 2JH6D 4MNYA 4B76A 1ZPZA 1ZMJA 1QHRB 2OC0A 5EG4A 3UOUA 2H5CA 2ZFPH 3SZEA 1KXEA 1ETRH 5A09A 5AF9H 3E1XB 4YO9A 4YTAA 3A7XA 2SGPE 1TRNA 3TGKE 4X2YA 2D1JA 1S85A 1GJCB 4XBBA 3LGYA 1D4PB 4TSFD 3FP7E 1NFWA 2QCYA 1ZGIA 1KMHB 3PB1E 1FX0B 1C5ZB 1MTNC 3RXJA 1IQGA 2XBYA 1AZ8A 4Y71A 1HJ9A 2ZTXA 3MHWU 4BOHA 1AWFH 1EZSC 3S0NA 1PPEE 2QF0A 1L1NA 1O32A 1NFUA 4ABIA 4YT7H 3M36A 1YPHE 1HCGA 1S6FA 1TAWA 4A1VA 4ZHAA 4MPWA 1IQNA 3ZVFA 2JKHA 3RP2A 1QJ7B 3BG8A 1RXPA 2FIRH 2P3TB 4AFQA 2OC7A 1UTLM 2ZPQA 4AB8A 4THNH 1DICA 1P2QA 2PKAB 4X1NU 4AN7A 1DUEA 1OYTH 3MNSA 3SHAH 1C4Y2 1KXAA 1GBMA 2FOHA 2Q6GA 1TOCB 2WPLS 1YLDA 2P8OC 4NIWA 1NBME 4M9FA 1SOZA 1LVOA 2O8UA 3UTUH 3VPKA 4CH8B 3MI4A 1JMOH 2Q1JA 3LH3A 5ESBA 1ZSKA 1CGHA 1ZZZA 1QQUA 4DVAU 3HGNA 2FYQA 3PLPA 2GCHF 2C8XB 5C1YA 4OS4A 3GDVA 3KN2A 3TGJE 4Y11E 2FI3E 1O3EA 1WV7H 5DK1A 1C2LA 1EX3A 4B74A 1GPZA 2OC8A 5T6GA 1S6LA 1L1JA 4RKOB 4KGAA 2B7DH 2FYRA 2ZHQH 1C1TA 1Y5BT 2FX6A 3S7KB 3VB4A 2J9NA 3D62A 2Z9LA 5EXLA 4SGAE 1V2NT 5JPMH 1LVMA 2WHXA 1NY22 3KHVA 2SFAA 3MH7A 1AY6H 2OK5A 4Y7AA 2VGCC 2PUQH 1WTHD 3T28A 1CE5A 1Z8RA 1GDQA 1UCYE 3UNSA 2K1QA 1A46H 4YT6H 1NROH 1WQSA 3RXBA 1DXWA 1G32B 5A0BA 4DW2U 1SGPE 2JDID 4ZROA 1GJAB 1P2MA 1MZDA 2VJ1A 2ZECA 3MO6A 3T62A 1O37A 1Y5AT 4JZFH 4FUFA 4I33A 2H5DA 4YOIA 4B2AA 5DKMA 4IMZA 1EP6A 3QO6A 4KTCA 3GY5A 1UVSH 1YPJH 2VIPA 5JB8S 3ZVCA 3UFAA 1O35A 2HNTE 4IC6A 1TNKA 4BAKB 1GHXH 1A0HB 1GVLA 1ABJH 2FOBA 1GDNA 1GBJA 2FI4E 2EA3A 4OS1A 2BOHB 1GGDB 1GG6B 4CR5A 2Y5FA 4AYVB 4ABFA 1BMFD 3Q3XA 2BOKA 4X0WU 1E35B 2BDCA 1EQ9A 1TMBH 3OY6U 4WH8A 1LHFH 3AVZA 3TH4H 3Q00A 4MDSA 3EYDA 1HAOH 4OS6A 1IQKA 1YPGH 4ZMAH 2A7JA 3K2UA 1H9HE 3M3SA 1THSH 3PMJA 1SQAA 5DN6D 2VNTA 3SZNA 2PUXB 3HPTB 1QR3E 2WPHS 1FMGA 1OHHD 1GMCG 3GY8A 2STAE 1EZUC 1DWEH 1O2HA 4XE4A 1NESE 2FXRA 1VR1H 1S5SA 3A80A 3RU4E 1SGYE 2ZDAH 1CT4E 1GI7B 1SGFA 1DM4B 4TT3D 1L4DA 3QZQA 1QIXB 3F2GA 3RXVA 1FY3A 1GDUA 1MABB 1HIAB 3GCNA 2AIQA 4FUJA 1KY9A 2D8WA 1O3DA 2TGPZ 5AFZH 1AFQC 1A0JA 2ZF0H 4J2YB 3VXEH 2QXGA 1BZXE 1PPGE 3OTPA 3A7VA 3CS7A 4JZDH 1LHEH 1ZYOA 3P17H 1HAVA 1SSXA 1PFXC 2XBXA 5IDKA 2RG3A 3I78A 4TPIZ 4CRAA 1GI5A 1SR5C 4FUEA 5EQQA 2XBVA 5EOKA 1WYKA 3SI4H 3U1JB 5C0TA 1S0RA 1P9UA 1ZRBA 2AERH 2Y5GA 1RJXB 3TITA 1RIWB 2QN5T 2IOTA 2JJ1D 1KXCA 1XUJA 2RCEA 1P2JA 1Q2WA 2OC1A 1LVBA 4WY3A 1C1WH 2ZHFH 3GY6A 2ZO3H 4X8UH 3RXQA 1NC6A 1GBIA 1FY8E 1GJ5H 1F0UA 1O5AB 1DANH 1YCPH 5JB9S 1GI4A 5GIBA 5EXMA 1ZSLA 2ZDVH 3BEIB 2C93B 1Y3UA 3R3GB 1D6RA 1PPFE 3A7YA 1XUIA 4FUDA 2CN0H 1V2UT 4NFEA 2CHAB 2BY7X 2TBSA 1O2UA 1LHCH 2PSXA 3MNXA 5EPYA 5E8EH 2NU1E 4BTIB 1VCWA 2G5VA 5L2YH 2ZC9H 5DG6A 1O2VA 5FPYA 1TX7A 1F5KU 5TCAA 1FNIA 1TLDA 1JRSA 1YBWA 2Q6FA 1XKAC 1SLVB 3TU7H 1YKTA 4DT4A 4ASHA 2CV3A 4ZAEA 1GI0A 2KZ4A 2AH4X 1FIWA 1WUNH 2G81E 1BTWA 2K8IA 5DP3A 3RXOA 2ZFFH 1GVZA 1W12U 1C1PA 2FPZA 2P3FH 1WCZA 1MCTA 1NRSH 1SVPA 3DD2H 1A5GH 3FFGA 2WUCA 3MH4A 2BD8A 1UTJA 3SO3A 1V2VT 1A0LA 1TRYA 3RXFA 3GY7A 5A8YA 1XVOA 1JWTA 1MBMA 3SU3A 3ZV9A 1O5GH 4UE7H 3SNCA 3GY4A 2BVSH 4NZLA 2QXIA 2ODPA 2OXSA 2WINI 1ID5H 3OU0A 3OY5U 2WV5A 4BAQB 5LH8A 5C5NA 3PTNA 4O03A 1JIRA 2C3SA 1W8BH 3A7ZA 4Q63A 1W3CA 2NU2E 4ZUHA 4MNWA 1DS2E 1MD8A 4BXWA 3SU0A 1YC0A 2FOGA 3AASA 1QURH 2A4RA 4X1QU 1PYTD 2AHME 2Z9IA 1QA7A 1XUGA 2G5NA 2G4TA 1O3FA 1TPAE 4CR9A 4MPVA 1O5DH 3EA7A 2OQUA 2F9NA 1C4V2 1H8IH 3E91A 1MTUA 4OS5A 4KTSA 1F0SA 3QX5H 1TOMH 1BBRK 4WMDA 1G37A 1TNIA 4K3JA 2ODYB 1LKBA 4BXSA 1TGNA 1C5XB 3F2FA 1UJ1A 5I25A 3BTQE 3RMMH