3GYMA

Structure of prostasin in complex with aprotinin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
241
structure length
241
Chain Sequence
ITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPISLPAAQASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNSLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/inhibitor
molecule keywords Prostasin
publication title Active site conformational changes of prostasin provide a new mechanism of protease regulation by divalent cations.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gymA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gymA01
3RMMH 1J8AA 2WPKS 4AGKA 4D8NA 1HAPH 1IAUA 1EZXC 1J16A 1TBRH 1VR1H 8ESTE 1NFXA 1TOCB 1EAUA 3S9CA 2FWWA 4GHTA 4JMYA 1Z1JA 4AYVB 3ZVCA 5EGMA 1O2KA 3K6YA 1LHEH 1K2I1 1BIOA 1SI5H 1C5WB 2JETB 1ID5H 1ZTLA 3BG4B 4LZ1H 2H9TH 1HIAB 4HGCA 3PWBA 3D49H 1QURH 4A7IB 1XVOA 2CMYA 3O8CA 2ZU3A 2R9PA 4I33A 2H5CA 1UHBA 2Y82A 2GKVE 3RMOH 3BTTE 2XW9A 3AAUA 1L1GA 1Z8JB 1S85A 1Z8IB 3BV9B 1A5GH 2BY6X 1TMBH 1ZJKA 1V2TT 2J2UA 5DJ7A 3S9BA 3M3TA 3EYDA 1SHHB 1GI7B 1AKSB 3NPSA 1WOFA 3MFJA 1KXCA 1WCZA 3OY6U 1NY22 5DKMA 2AGEX 4X1RU 1BZXE 1GJ7B 1QQUA 1VITF 2CN0H 2ALVA 1FV9A 1IQLA 1A0HB 2BDYA 1UTNA 1EOJA 4K2YA 1QNJA 4MTBA 1LVMA 2P3UB 1QRXA 3DT0H 2PGQB 2YOLA 1LPZB 3MO9A 2WUCA 4A1VA 4I32A 1AFEH 2PKAB 3D62A 1EZQA 3MNBA 1HXEH 4KTCA 3VPKA 1HJAC 3A7VA 1QJ6B 5E2OA 4X6NA 1HAZB 1D4PB 2FOAA 1ANCA 3P6ZB 4E7NA 1BRBE 1C5YB 1GMHF 4OS7A 1KTTB 1YF4A 1C2EA 2ZQ1A 1PPEE 1WV7H 3SU5A 3SU4A 5GJ4B 1C5VA 1LPGB 2FESH 3UUZA 1WSSH 3MH5A 1SSXA 3Q76A 4ZHMU 4DT7B 3GDVA 4A5TS 3HGNA 3ZZBA 1OP0A 1GJ8B 1DLEA 2PFEA 4ZROA 2RCEA 3SU6A 4PROA 2XBVA 1QR3E 1THPB 1MTUA 1SLUB 4H6TA 1FLEE 1QQ4A 4JZFH 4MPXA 1CGIE 2XNIA 4Y8ZA 2AEIH 6LPRA 1AD8H 1DT2A 1C2FA 3ZZDA 1NFWA 2H6MA 2XBYA 4YT6H 3MNCA 2FOFA 1P57B 1ZMLA 4BAMB 4TYDA 1OWIA 1W2KH 2YNBA 1DWDH 1GI4A 1C1UH 1HGTH 1O5FH 1SVPA 3UPEA 3MWIU 3QZRA 1GHXH 1PPHE 3PROA 2LNCA 4UEHH 3SNBA 2QXJA 1GBLA 3RXCA 2G00A 3UWJH 4K5ZA 2A45B 2K1QA 3PLBA 1O3CA 3ZVFA 2Y5HA 4YLUA 4X1SU 1P04A 3U1JB 1CA0B 2VIQA 1GJBB 2ZDVH 1QB6A 5CMXH 3MO6A 3Q3KA 1FIWA 4ZUHA 1EUFA 2FOBA 1UTPA 2C8XB 1EAIA 1Y3WA 5FPSA 1YGCH 4Y71A 2RA3A 3MU8A 1MU6B 3ZVBA 1TE0A 2O8TA 2WPMS 2C8WB 3RLWH 1T8OA 1MUEB 2ZA5A 1HJAB 2HPPH 4OS5A 2ZWLH 2BLOA 1A0LA 4O97A 1DDJA 5C1XA 1YPJH 3VB7A 6GCHG 3RXPA 5EPYA 4D7GA 4ZXXH 1D3DB 3T5FH 2XWBI 4XBDA 4NCYA 1ZSLA 1UTKA 1RD3B 3GCOA 3QTOH 4JCNA 3MOCA 1V2MT 2ZKSA 5EQSA 5EPNA 4ZKNU 1YM0A 1O2QA 1O33A 1VCQA 1MKXH 4FUGA 3K9XB 2AS9A 4YTAA 1RTLA 2GP9B 1XUGA 1FAKH 2W7SA 4I31A 3QGNB 3B23B 1F0TA 1O2YA 3SBKA 2ZDAH 1TYNA 5BRRE 2ZHFH 4ZAEA 5ESBA 1H9HE 4MPUA 1TMUH 3ZVGA 1VJAU 3F68H 1O36A 1TB6H 1A5IA 2ZGHA 3SV2H 1FI8A 4Y7AA 1G30B 2CV3A 2TPIZ 3SV7A 1UK2A 3Q3XA 2UWPA 2H9HA 2TRMA 3A83A 1L1NA 3EE0B 3ZZ6A 4Z6AH 1SGRE 2P3TB 2J95A 3E91A 3SN8A 1CBWB 4BAOB 2G81E 3UNRA 1O2PA 1HLTH 1P05A 1GBBA 3PLPA 1N8OB 1BRCE 4CRFA 3L33A 2UWLA 1ZTJA 2G5NA 4U2WA 6CHAC 2PLXA 2QC2A 5E2PA 5EXLA 1H1BA 1HV7A 1O2MA 2ANWA 1ACBE 2FPZA 3SNAA 1SGFA 3ZZ4A 1C2KA 1KXDA 3H5CB 1DOJA 4FVDA 3E1XB 3ATMA 3A80A 3M5MA 5C1UA 3SGAE 2A7JA 2Q1JA 3HK3B 3SJIA 1LVOA 1TGSZ 1SGYE 4LZ4B 1GCTC 4Y6DA 4MNWA 4FXGH 1SLVB 3M7UA 3ZYEA 1GHVH 3E3TA 4NIXA 3L3TA 1X7AC 1AGJA 2GGVB 1DS2E 1TNLA 1L2EA 1P06A 3EA7A 1ZOMA 1AI8H 2GDEH 1TBQH 2C8YB 4NWLA 2ZQ2A 3BF6H 3M5OA 2Y5FA 1RFNA 3KQCA 4X1PU 1TX7A 1QL7A 2F83A 4I8JA 1O2UA 5FBIA 1W12U 3ZZ7A 2AGIX 2CXVA 1CHOF 4U01A 1ELEE 3SUGA 1S0QA 1SC8U 2PUXB 4AFSA 5E0JA 1J15A 1P12E 1DY9A 1ETTH 2GDDA 3DD2H 1SGIB 4NSYA 3K6ZA 2W7UA 3BG8A 1OX1A 1BDAA 2XCNA 2ZIQH 1KLTA 1VGCB 1NTPA 1GJ9B 4IMQA 3LH3A 2F9VA 2AH4X 3UNSA 1EAXA 7KMEH 1YYY1 4JZ1A 5A8XA 4ZH8A 1O3KA 4FUEA 1DANH 1G2MA 4MNVA 4ZXYH 2A5KA 3CP7A 1YPGH 2H2ZA 4BTTB 1EASA 2B5TB 3KQBA 2O9QA 1Z8GA 2BXUH 2BQWB 4D9RA 4NWKA 1SOTA 5B6OA 5HMAA 1C1RA 2OC0A 3PTNA 4X2XA 3TGJE 4GVUA 4OS6A 2VGCC 3SHAH 3TK5A 2HNTF 4IN1A 3MNSA 1SQAA 2XWAA 1C1VH 4CRDA 1ELCA 1LHGH 1C2DA 4H6SB 3SQEE 1DXPA 1FPHH 4FU7A 4K8YA 3RM2H 1C5QA 1BMMH 1GL0E 3C1KA 2BYAX 1D3TB 1MAXA 3A84A 3P17H 5DK1A 1C5TA 1QHRB 1RXPA 1AQ7A 1TWXB 1SL3A 1WTHD 1KLJH 1O35A 5HGGA 2P16A 3MU4A 5I46H 2P3FH 3BEFB 1XXDA 1VCPA 1W10U 1TPSA 3SNEA 2GCHG 2XTTB 2H5DA 1C1PA 1CHGA 1KDQB 4BOHA 4DG4A 1KXFA 7LPRA 1KXBA 3LH1A 2R0KA 3MU5A 1HDTH 5LPEA 3CENA 2P94A 2VVUA 2F9OA 2GD4B 2QF0A 4SGAE 1DSUA 8GCHG 1LCYA 3GY6A 5GCHG 2IPHA 1O3AA 1QL8A 2AIPA 3AVZA 1O2XA 3DUXH 1GJAB 1K1IA 3PMJA 2XC0A 1HCGA 3IWMA 4ABJA 2PSXA 1GJ6A 3SZNA 3CS0A 1SGNE 2HNTE 2AMPA 5DP7A 4FUCA 2FO9A 4D76A 1GHAG 3M7TA 1XX9A 4O9VA 3SJ9A 1UCYE 5HYOA 1BBRH 2V3HH 2BTCE 1KYNA 2VH6A 3TH2H 3AW0A 1QBNA 2OP9A 1V2ST 3URDA 1ARCA 2FTMA 1KXAA 1HFDA 4ZHLU 3OTJE 1W7XH 1GHBG 2ZGXH 2YNAA 3GY4A 5JBCS 3RMNH 1UVTH 4I8GA 1PQ7A 2FLBH 1C2GA 2IOTA 5T3HA 4B2AA 4YT7H 1TBZH 3VGCC 3P8NA 3MI4A 2VWOA 2F9NA 2GMTC 1DITH 3SJKA 2Y6TA 2JKHA 2TIOA 3M5NA 4ISIH 4NA9H 2OLGA 1O37A 1T7CA 5A2MH 1SLXB 1BTZA 2BDIA 4WXVA 1W11U 1AFQB 1JBUH 1NO9H 2G51A 2C90B 4WMFA 4FUHA 1K9OE 2VIPA 3ODDA 1ZHMA 2VWMA 2BDBA 2FODA 2OC7A 1P2JA 4WH8A 4LXBH 3MH4A 3PMHB 8KME2 1RTKA 3LONA 2SFAA 1XXFA 3MU0A 1C5OH 1C4V2 3SU3A 1PQ8A 2EI8A 3IG6B 4X8UH 3SW2B 3UTUH 1YPLH 1GMCG 1TGNA 3AASA 1S83A 3MYWA 1NRPH 1Q3XA 2HALA 1CU1A 3GCNA 1MQ5A 1TALA 1H4WA 1Y5UT 2BM2A 4BANB 5FCKA 3ELAH 1DWBH 1S6HA 3STJA 1TRNA 3SU1A 3NZIA 2R0LA 1J14A 1LQDB 3E0PB 4BTIB 2BHGA 2QN5T 1PYTD 2A32A 1FXYA 3RXQA 1EATA 4TY7A 4Y76A 3SQHE 4AG2A 5LGOA 2IJOB 2A4QA 4OGXA 3WY8A 2GCTC 4K60A 5EXMA 2TGPZ 3BTGE 1KY9A 1TABE 1P2OA 4I8HA 1C2JA 2P8OC 3RXFA 3VXEH 3RXVA 1BRUP 1UVOA 1KIGH 2Q6FA 1AZ8A 2XC5A 3TVJB 1DVAH 4NSVA 1UTQA 4ISOA 5AF9H 4ABFA 5C5OA 3A86A 4RKOB 1Q2WA 3C27B 1G37A 5CHAC 1C2HA 4NZLA 3RXOA 1F0RA 2BQ7B 2QY0B 2Y80A 3VB4A 1AB9C 1AIXH 2SNWA 4Y0YE 3UR9A 3UQVA 1QBOA 2ZPRA 2ZDMA 1L4ZA 1H9LB 2WPHS 3LGTA 3T2NA 1AU8A 4F49A 4IC5A 3UREA 2GMTB 5JDUB 1O2JA 2PTCE 1W13U 2STAE 3ZZ8A 3UFAA 1P2MA 4NIYA 1SGTA 2WV5A 1HAIH 3H7OA 2WPIS 4K69A 1CQQA 5DP8A 3T62A 3PMAB 1SPJA 2ZFTA 1NRRH 5K0HA 3GY8A 2J92A 4DOQA 1Y59T 1FIZA 1GBDA 2PUQH 4INLA 3LGIA 1H8IH 2WYGA 2FOEA 3RXUA 1FMGA 2OBQA 1J17T 3KIDU 1AMHA 2O8MA 4CH2B 1PPZA 2P95A 3S7HB 3RXBA 1BHXB 1C1WH 1WUNH 2SGAA 5F8XA 1BMLA 1A1RA 4GAWA 3VXFH 1CGJE 3LC5A 5PTPA 1O3GA 1TGTA 4ABEA 2ZFFH 4UFGH 2BX3A 3W94A 1TPOA 3GY2A 2HOBA 1IHSH 4DVAU 3PM3A 4WH6A 3RDZA 3GY3A 1UVSH 2LPRA 1TA2A 4Q7YA 4X0WU 1EOLA 4QT8C 4X2YA 1FAXA 1A4WH 5JB8S 2GZ8A 2ANMH 4JK5A 5FPYA 1D6WA 3ZVAA 4CHAC 1UTJA 3SJOA 3P95A 1QBVH 2VB0A 5IYTA 4Y7BA 1O5BB 5FAHA 3E6PH 4IS5A 3RC5A 2BD3A 5C5NA 4FU8A 5F6MA 3A7TA 4KELA 2ESTE 4Y8XA 1T31A 2B9LA 1P2IA 1NU9A 3MH7A 1HPGA 1GMDF 5DGJA 5TJXA 3E8LA 3GCTF 1O5AB 2FEQH 5EQRA 1ZJDA 1TNIA 1PQAA 1P0SH 1TA6A 1TQ7B 5HM9A 1O3PB 3PO1B 1HJ8A 1SR5C 2UUKB 1S6FA 1V6DA 5GXPA 4AYYB 1ZYOA 2D2DA 1G32B 1QY6A 3MMGA 1QTFA 1FN8A 1C4U2 2OC8A 1FNIA 5F8ZA 2TGDA 1HRTH 1BMNH 5JPMH 2TBSA 5FX6A 3VEQB 2BOKA 4UFEH 2A7CA 1HIAA 1AVWA 1UTMA 1L0ZA 2HWLB 1YPHC 1F5LA 4GSOA 2A7HA 1O3MA 2BOHB 5LPRA 3RXIA 2ZCKP 4HFPB 3RMLH 3SJ8A 2A2QH 1N6YA 5H4IB 3MO3A 1QJ1B 4JK6A 1JOUB 2Y7ZA 2VIDA 1NM6A 1TPPA 4X8VH 1AKSA 4YZUA 2FLRH 3FFGA 3TH3H 4U32A 1TX8A 1Z6EA 1EB1H 3UOPA 3T25A 4VGCC 4AFUA 2ZTXA 1Z1IA 1CA8B 1O2OA 1LMWB 2HVXA 3LT3A 2CJIA 1ELGA 4MPVA 4X6MA 2ZHEH 3QDZB 1HNEE 3ATWA 3M37A 4BNRA 4CBOA 1ESAA 5FXLA 3MH6A 1W3CA 1B7XB 4OS2A 1F2SE 1O2ZA 2PKAA 2KAIB 3F9FA 4MLFB 3UY9A 3FAOA 5DP4A 1C2MA 1O2SA 4MG3A 4NFFA 4CR9A 2VWLA 2XXLA 1S0RA 5ETXA 1BTXA 4Y10E 2OINA 1GVKB 1NS3A 3RXAA 3RXRA 3L6PA 4IC6A 1G3CA 1K28D 1SFQB 3U98H 3TJUA 3A8BA 5SGAE 1Y3YA 1EQ9A 3ATKA 2V6NA 4YOJA 1GBCA 1E35B 1OP2A 1A0JA 4Q7XA 2ZU4A 1ZZZA 1PPCE 1TRYA 3Q77A 5E0GA 1NU7B 5AVDA 1ZRKA 2R2MB 1NRQH 4XBBA 1P3EA 4FUDA 4NA7A 1BCUH 5F03A 4DIHH 1BTYA 1ELDE 1SHYA 3GISB 2ZZUH 3BIUH 1O2RA 2Z6BD 4J1YA 3RXKA 3P8GA 1LVBA 3A87A 1YBWA 1CT0E 2AFQB 2ZCHP 3RUOA 3U9AH 1FZZA 4X8SH 1SLWB 2FOHA 1MKXK 7GCHF 2J94A 1UVPA 4R0IA 3K2UA 1GJ4H 2J4IA 1HYLA 1VITH 1B5GH 1Y5BT 4AORA 1ANDA 1XUJA 4XDEA 3ATIA 1QRWA 4MNYA 3ZVDA 2FMJA 3HKJB 4A92A 3SI3H 1AVGH 1O2GH 1FY1A 4KGAA 1BQYA 1WBGB 3PYHA 1LDTT 3V0XA 3OYPA 2KAIA 1TFXA 3GCHC 4NG9H 1KTSB 1F0SA 1C1QA 1C2IA 3HATH 4AFZA 4WVPE 1ESTA 1RIWC 3RXLA 4M7GA 2ILNA 1OWKA 1CSOE 1P01A 1O3OA 1FQ3A 1MTSA 3E90B 2ZC9H 4ISHH 1L4DA 2EI7A 3A85A 1UMAH 1JRSA 4IN2A 4JYUH 3LOXA 2AMQA 2ASUB 3W95A 1XUFA 3S69A 4KP0A 2C3SA 5A8ZA 2ZDLA 2BB4A 1O38A 1Y5AT 3TNSA 4KTUA 2A1DB 1O2TA 1DPOA 3JZ1B 1ZHRA 3QLPH 2VVVA 3QX5H 1BITA 4X8TH 5J4SA 4IBLH 5GPIB 3VB5A 4AGJA 4X6OA 3T29A 3ZZ3A 1ELFA 1GI0A 3JZ2B 4O3UA 3SU2A 2CF8H 4LK4A 1UK3A 2FDAA 3SV6A 2UUJB 1RRKA 2BD2A 2G4TA 2PKSC 3HGPA 1GPZA 4HZHA 4BXSA 3M5LA 4YO9A 4YOIA 1S5SA 1HAXB 1K1NA 4WY3A 3RU4D 2FZZA 3OY5U 2CHAC 2W26A 1GVZA 1T32A 1AZZA 1W0YH 1DSTA 3E0NB 2QF3A 1C9PA 4WF8A 2B0FA 2ZG0H 2GZ7A 1O39A 3GDSA 1TRMA 2BXTH 3FP8E 4FUBA 3URCA 1TPAE 1XKAC 1W14U 3M36A 1CGHA 1AWHB 6CHAB 5FX5A 1UTLM 1GG6C 3EAJA 1D3QB 2BD9A 4AN7A 4HTCH 2ZGBH 1IQGA 3TITA 1AE5A 5A09A 1EX3A 2Y5GA 1XUKA 3RC6A 3A88A 2J38A 1NN6A 5C3NA 1K1OA 3U1IB 2A0QB 2FI4E 2FOMB 3SHCH 2VH0A 3ENSB 1GCTB 1ZPZA 3A82A 1ABJH 1ZHPA 1H8DH 3SOSA 5A0AE 3NKKA 2JH5D 1HAVB 4ABAA 1AUTC 4IMZA 1TOMH 3RXMA 1OWEA 4NZQA 1QA7A 4AG1A 1C5SA 1V2JT 1GVLA 1G3BA 3BTKE 4ASHA 3QZQA 4Q2KA 5L2ZH 1QCPA 1V2OT 4X2VA 3BSQA 2DUCA 4IW4E 6ESTA 2BD7A 2Z3CA 4UONA 3LGVA 5JBTA 3DA9B 3GYLB 2R3UA 1JRTA 5JYIA 1MZAA 1EKBB 3R3GB 2NU4E 4I8KA 1CO7E 1YC0A 3OX7U 1AHTH 2OUAA 1M9UA 2FS9A 2ALPA 4RN6A 1TLDA 1IQEA 1K1JA 1GDNA 4NGAH 1V2VT 4ISNA 3LKWA 3NCLA 1DLKB 2UUYA 1EPTC 4B76A 4Y11E 2BX4A 1O31A 2ZFQH 3QK1A 2ZU2A 1U6QA 1N6XA 1ELTA 2QGRA 1KSNA 1SG8B 5A0BA 3OSYA 2ZHDA 1YCPH 4GHQA 3TGIE 3FANA 5GIBA 1IQKA 3MHWU 1O0DH 1P03A 3SNCA 1OS8A 1ELVA 4XBCA 3SV8A 1O3HA 4MNXA 2NU1E 1HBTH 1O5DH 2VWNA 4BAQB 5AFZH 4K1SA 2HGTH 3SI4H 3UR6A 1TMTH 1GG6B 2DE9A 2Z9GA 1YCPK 2OXSA 2VINA 4NA8A 1O3LA 1MD8A 1DFPA 3NK8A 4AB8A 1G3DA 1GI2A 4INKA 3PB1E 5TCCA 3U8RH 1A7SA 4B74A 1MTNC 1RS0A 5EODA 1DWCH 1NESE 3T27A 1G36A 1D6RA 2NWNA 2VGCB 4H42U 1P2QA 2XCFA 1C5PA 4ABGA 1BBRK 2GV7A 3A7ZA 2BVRH 2QXIA 3F9GA 3BTEE 1NC6A 1T4VH 1XUHA 2BVXH 9LPRA 3KL6A 1JIRA 1SOZA 4FU9A 4GLYA 2GT8A 4BTUB 2BLWA 3GDUA 1OWDA 3BEUA 2G55A 1KDQA 2QIQA 3D65E 3RLYH 3AW1A 1NFUA 2UUFB 2A31A 3O8DA 3Q00A 2ZU1A 5DP9A 1LKBA 2FI5E 2VVCA 3RXJA 2ODQA 1SBWA 1GBAA 1BTWA 1BTPA 3KQDA 3GICB 1OYTH 4FUFA 4DW2U 3SU0A 2ZPQA 1W0ZU 3VB3A 2AMDA 2SGQE 2FOCA 2J34A 1SGEE 2PHBA 1T8LA 2GCHF 1ZPBA 1FN6A 2GTBA 3O8BA 1GBTA 1W7GH 5K7RA 4NFEA 5GWZA 2BMGB 3BTQE 2WPJS 1HJ9A 1YP9A 1LKAA 2CGAA 2PW8H 1V2PT 4OGYA 4X6PA 4AX9H 4D9QA 1MU8B 2UWOA 2HPQH 1V2NT 8GCHF 5GCHF 2Y7XA 1QB1A 2ULLA 1A2CH 3BG4C 2ZFSA 4CH8B 1MBQA 2VU8E 2ZHQH 5EU8A 2H1UA 1TQ0B 3OU0A 3MNXA 3BTME 1P09A 2FTLE 2A4RA 1K22H 1UCYH 3ZV8A 2FX4A 1Z8RA 3BTHE 1GHAF 3FZDA 5DP6A 1LTOA 1WTGH 1VITG 4OS1A 1ANEA 2A2XH 3DFJA 1ZGIA 2FIRH 3LPRA 3BEIB 1C5NH 3ZZCA 1PJPA 1CVWH 1SFIA 4MDSA 1MTNB 1UHBB 2OBOA 5C2ZA 3VGCB 1E36B 1GHBF 2TGTA 1A3EH 2FM2A 3LC3A 4YLQH 5AHGH 3A7WA 1GMHG 1NT1A 1OYQA 1JXPA 3TH4H 1O3BA 3NXPA 1FONA 3ITIA 1BA8B 2SGDE 2XBXA 1LO6A 3KHVA 1JIMA 4B2BA 4X1NU 3CS7A 3VB6A 4BXWA 2PWXA 1UK4A 2QYIA 3V7TA 2G52A 4HI3A 1C5RA 2EC9H 1Y3VA 1ZSJA 2V35A 1O3NA 1G3EA 1O3FA 1O3JA 3I78A 5T6GA 1LVYA 3DFLA 1N1LA 3F6UH 1IQMA 2Z9KA 1AE8H 1O2WA 1XKBC 4ZMAH 3M3SA 1TGCA 4TWYA 1TX6A 1DUAA 1SGQE 3F9HA 1GMCF 3AAVA 4WJG2 3RU4T 4B75A 2JH6D 4DCDA 2TGAA 4GCHF 1ARBA 4ISLA 2F3CE 1O2NA 1WQVH 1V2LT 3P8OA 4WXIA 4H4FA 4D7FA 2C93B 2ODPA 1UTOA 2ANYA 5EOKA 2WPLS 4ZKSU 3EQ0H 2GCTB 5DPAA 1ZPCA 2BVSH 2OQ5A 1VZQH 3SGQE 2P8OB 4A6LA 5JBBS 1CT2E 1MTVA 2OTVA 2HRVA 1QJ7B 1MH0A 4ABDA 1GHZA 1WU1A 1T4UH 4CRBA 3ESTA 5CHAB 1O32A 2Z94A 5J4QA 1S81A 3BIVH 1MQ6A 5I25A 2GT7A 4XSKU 3M35A 1AB9B 3EA9A 2B8OH 2I6QA 3ZV9A 5C67A 5FHTA 3M7QA 2AERH 1GBFA 1MTWA 1CA0C 4BAKB 1OOKB 2BDAA 1OP8A 1V2WT 1EP6A 4TPYA 5E0HA 2QAAA 3T26A 4NIVA 1MZDA 4CREA 1D9IA 2V3OH 1SQTA 2Z9LA 3FVFB 1MCTA 2FP7B 1C5ZB 2BY8X 2VJ1A 1DX5M 1ZR0A 3U8OH 4XFQA 2BD8A 3TIUA 1HAOH 1A3BH 2ODYB 3F9EA 1SGPE 5A0CA 3B9FH 2SGPE 3A7XA 1SGDE 1BTHH 1ANBA 4DGJA 3QUMP 4K1EA 1RGQA 1THSH 3BN9A 1IQNA 1EJNA 4B71A 1MKWH 1Z6JH 4B1TA 1O34A 1BHXF 4AOQA 1BUIA 7GCHG 2P59A 1P8VC 4X1QU 3U69H 1RTFB 2BZ6H 1YPMH 2GX4A 3UQOA 2ANKH 1ABIH 2H9EH 4B2CA 1MKWK 1Z7KA 1AN1E 1OWHA 5ESTE 4CHAB 1QA0A 2F9PA 1F0UA 4IGDA 4XE4A 1CBWC 2OCVB 1GWAA 1SGCA 5EQQA 1O3IA 1N8OC 2RDLA 2D8WA 1P10A 2Z9IA 3PTBA 3T28A 2ZFPH 1ETRH 2O8WA 1TNGA 2XC4A 4CR5A 2OQUA 1BJVA 1GDQA 1T8MA 2AIQA 3E16B 4WWYA 1O5EH 5DO4H 1GJ5H 1C1NA 1O2VA 1HAYB 4R8TB 1IQIA 2HNTC 4BAHB 1SGFG 1MD7A 1IQFA 5T6DA 1O2LA 2EEKA 3DHKH 2BDHA 2ZGJA 3RXDA 1DWEH 1HUTH 1C9TA 2BY7X 3TJVA 4ABBA 1S84A 1IQHA 1Y8TA 3V12A 4GPGA 4Y79A 4U30A 2ZDNA 1E37B 4ABIA 1C5MD 1Y3XA 1EB2A 4I7YH 2ZCLP 3STIA 1CHOG 5BPEA 4YESB 5JBAS 4XOJA 2SGEE 1GI5A 3ZVEA 4CBNA 1JWTA 1XVMA 2ZDKA 2F9BH 1PPGE 5G4BA 1GBKA 2SGFE 2WUBA 1P3CA 1OKXA 4E06H 1IQJA 2C4FH 1B0FA 3ODFA 3TNTA 1PFXC 3I29A 1GHWH 1GCDA 3RXHA 1CE5A 1XUIA 1P11E 1VCWA 4Y0ZE 7ESTE 1OSSA 3TJNA 1KLIH 3LDXH 1LPKB 1EJAA 1O5GH 1HXFH 1GI8B 2G4UA 3KF2A 3R0FA 4VGCB 4K3JA 1A5HA 1VGCC 3H7TA 1V3XA 2GV6A 1FY8E 1T8NA 1EJMA 1KXEA 1XMNB 1K1MA 2AYWA 1C5UA 2ZTYA 2RA0A 4I8LA 3D23A 1VJ9U 1P9UA 2BD4A 3KN2A 5HM2A 3F1SB 1O3DA 1TNKA 1AVXA 4ESTE 1BJUA 4TWWA 2G8TA 1GDUA 3PLKA 1BMAA 3HPTB 3FZZA 1WQSA 1GBMA 1FY5A 4AFQA 2AGGX 3PWCA 3BTDE 1TNJA 5IDKA 1TGBA 2GVFA 4K1TA 1LHCH 2BY9X 4CRCA 3KEEA 2FS8A 2PGBB 2ZHWH 2XBWA 4GUXA 3I77A 1C1SA 3QWCH 1ZRBA 2OD3B 1EXFA 3QGJA 2D26C 3V13A 8LPRA 1K1LA 2FI3E 4UFFH 5HXFA 3ZYDA 3IITA 6GCHF 2B7DH 1FY3A 3SO3A 4J2YB 2NU2E 1PPFE 1PYTC 2Z9JA 1ZMJA 3GOVB 1NFYA 2ZNKH 3LGYA 4CRGA 4E7RG 3VFEA 5EW2H 4THNH 1EZSC 1Q31A 2XYAA 3PMBB 3RXGA 2VIVA 2ZECA 1DUEA 2DE8A 2ZF0H 4CRAA 2PV9B 3LGWA 3KCGH 1FPCH 2A4OA 2Q6DA 1INCA 1O5CB 4E05H 3SORA 3P8FA 3RU4E 2ZFRH 1FUJA 1NZQH 2CF9H 2M5TA 1ETSH 1LHFH 3SNDA 4LOYH 2WV4A 4Y8YA 1G2LA 1TNHA 3UNQA 3S0NA 1OPHB 2O8UA 3SV9A 1GI1A 1YPKH 4A1XA 3EA8A 2HLCA 1YLDA 3GCHB 4ZKOU 3EGKH 2BDCA 1MMJN 3GYMA 2EA3A 2W3KA 2XRCA 1YCPM 5EW1H 2J9NA 4JYTA 1RIWB 2FXRA 4ZHAA 2Q6GA 5A8YA 2ZGCA 1GBJA 3UOUA 2QCYA 2ZEBA 1C1MA 1BBRE 5CE1A 3ZZ9A 4A1TA 1H9IE 2FYQA 2IN2A 2ZI2H 5EXNA 3LJJA 4AB9A 3K65B 2STBE 5LH8A 3A8AA 4YM9A 3KQEA 1J9CH 1FDPA 5T6FA 1E38B 3A8CA 3P70B 3RM0H 3TJOA 1C5LH 2QV1A 4ZKRU 1YPHE 1UVUH 3KNXA 3UIRA 1UO6A 3A8DA 4MQAA 2BDGA 4OS4A 1NRNH 1EAWA 1V2QT 5F8TA 2THFB 1OXGA 1P2NA 1HAHH 1A46H 4UE7H 3RC4A 1MAYA 5L6NH 1AFQC 2PKSB 2A5IA 3QTVH 4UDWH 4K8BA 3A81A 1ELBA 2QA9E 1DY8A 2NU0E 3ATLA 1UJ1A 2R2WU 1D3PB 2BD5A 1WYKA 2OC1A 3V3MA 5FPTA 1O2IA 1SQOA 1AWFH 2CHAB 5LPFA 4Z0KA 1L1JA 1C1TA 1K21H 4FVBA 1BT7A 3G01A 1B0EA 1NPMA 1EP5A 2QXGA 3M3VA 3N7OA 1WAYB 4JZIA 1Y3UA 1MCVA 2PR3A 4FUJA 5ABWA 1TAWA 2GZ9A 5C20A 3A7YA 4F4OC 1A61H 1E0FD 5DP5A 1XM1A 1ZGVA 1S82A 2F9UA 2O8LA 1GI9B 2PTNA 1OWJA 4KKDA 3LU9B 2QXHA 1GI3A 1F7ZA 3U8TH 4UFDH 4MPWA 2BQ6B 3NWUA 5FCRA 3B8JA 2ZTZA 3LGUA 1DICA 1LQEA 1GBHA 1ZMNA 2W3IA 1C1OA 2FOGA 1LHDH 1HAVA 1C4Y2 4FUIA 3TGKE 1ESBA 1GGDC 4O3TA 3LJOA 3A89A 1GL1A 1C5XB 4UD9H 2Z3EA 5C1YA 4NIWA 3KGPA 5AFYH 5E8EH 3RXSA 1RJXB 2BLVA 5DG6A 2Z3DA 3O8RA 5L30H 4ABHA 1GBEA 3P92A 4MVNA 4INHA 2G5VA 1F92A 3SGBE 2FYRA 4JZDH 4Q7ZA 1FJSA 1HB0B 1QGFA 3NUMA 5L2YH 2BY5X 3MTYA 5EG4A 2I6SA 4DY7B 3MU1A 2W5EA 4TPIZ 1G9IE 1GJCB 2Y81A 2P93A 1YLCA 1ORFA 1GI6A 1IHTH 1K1PA 1ZLRA 1DXWA 2Z7FE 1C2LA 2NU3E 3TLOA 1BTUA 3GY5A 3S7KB 1PQ5A 4YOGA 1SB1H 1P02A 4DJZB 1V2RT 1EPTB 1PPBH 2C8ZB 4WMEA 2EI6A 2VIOA 1EZUC 3FP6E 2ZU5A 9ESTA 3TPIZ 3HKIB 2WYJA 4B73A 1YKTA 4TY6A 1QB9A 3TU7H 1IOEA 1W8BH 2VNTA 4RSPA 3M61U 3PV4A 4GCHG 1YPEH 2JETC 1O3EA 2VIWA 2WINI 3FP7E 1DM4B 1CT4E 1THRH 4WMDA 2BZAA 3RXTA 4RKJB 3BTFE 2BLQA 3ZZAA 2R3YA 4DURA 1F5RA 1QL9A 1F5KU 1AO5A 2RG3A 1ZSKA 1DE7H 2A4GA 4SGBE 2FX6A 5DP3A 1JMOH 3ZZ5A 2F91A 3SUEA 1ELAA 1V2KT 1O30A 1V2UT 1BB0B 2ZO3H 3EDXB 1GBIA 1BRAA 4Q80A 5TCAA 2ZPSA 1GGDB 3QN7A 2JH0D 3S9AA 3SUFA 1GMDG 1UCYK 2SNVA 3GCTG 3TK9A 1GHYH 4JZEH 1TIOA 1QRZA 3HK6B 3QO6A 1P9SA 1NROH 3UWIA 4AZ2B 4O03A 1FY4A 1Z71A 1BOQA 2D1JA 3RP2A 1HAGE 1GJDB 4JYVH 1AY6H 1MBMA 3BTWE 3LIWA 2ZP0H 5JB9S 2PSYA 2A5AA 3PO1C 1SMFE 4X2WA 4KTSA 3Q3YA 1ZTKA 1O2HA 1E34B 1EPTA 1AUJA 4DIIH 5GDSH 1TONA 3GY7A 5FBEA 1QFKH 3TK6A 1QIXB 3RXEA 2V0BA 1P2KA 1NRSH 3SUDA
chains in the Genus database with same CATH superfamily
3RMMH 1NBME 1J8AA 2WPKS 4AGKA 4D8NA 1HAPH 1IAUA 1EZXC 1J16A 1TBRH 1VR1H 8ESTE 1NFXA 1TOCB 1EAUA 3S9CA 2FWWA 4GHTA 4JMYA 1Z1JA 2HLDD 4AYVB 3ZVCA 5EGMA 1O2KA 3K6YA 1LHEH 1K2I1 1BIOA 1SI5H 1C5WB 2JETB 1ID5H 1ZTLA 3BG4B 4LZ1H 2H9TH 1HIAB 4HGCA 3PWBA 3D49H 1QURH 4A7IB 1XVOA 2CMYA 3O8CA 2ZU3A 5C0UA 2R9PA 4I33A 2H5CA 1UHBA 2Y82A 2GKVE 5HIZA 4F55A 3RMOH 3BTTE 2XW9A 3AAUA 3SYJA 1L1GA 1Z8JB 1S85A 1Z8IB 3BV9B 1A5GH 2CK3D 2BY6X 1TMBH 1ZJKA 1V2TT 2J2UA 5DJ7A 3S9BA 3M3TA 3EYDA 1SHHB 1GI7B 1AKSB 3NPSA 1WOFA 3MFJA 1KXCA 1WCZA 3OY6U 3UAIC 1NY22 5DKMA 2AGEX 4X1RU 1BZXE 1GJ7B 1QQUA 1VITF 2CN0H 2ALVA 1FV9A 3F2GA 1IQLA 1A0HB 2BDYA 1UTNA 1EOJA 4K2YA 1QNJA 4MTBA 1LVMA 2P3UB 1QRXA 3DT0H 2PGQB 2YOLA 1LPZB 3MO9A 2WUCA 4A1VA 4I32A 1AFEH 2PKAB 3D62A 1EZQA 3MNBA 1HXEH 4KTCA 3VPKA 1HJAC 3A7VA 1QJ6B 5E2OA 4X6NA 1HAZB 1D4PB 2FOAA 1ANCA 3P6ZB 4E7NA 1BRBE 1C5YB 1GMHF 4OS7A 1KTTB 1YF4A 1C2EA 2ZQ1A 1PPEE 1WV7H 3SU5A 2F43B 3SU4A 5GJ4B 1C5VA 1LPGB 2FESH 3UUZA 1WSSH 3MH5A 1SSXA 3Q76A 4ZHMU 4DT7B 3GDVA 4A5TS 3HGNA 3ZZBA 1OP0A 5HKKD 1GJ8B 1DLEA 2PFEA 4ZROA 3MQKC 2RCEA 3SU6A 4PROA 2XBVA 1QR3E 1THPB 1MTUA 1SLUB 4H6TA 1FLEE 2KCOA 1QQ4A 4JZFH 3WWFA 4MPXA 2KCPA 1CGIE 2XNIA 4Y8ZA 2AEIH 6LPRA 1AD8H 1DT2A 1C2FA 3ZZDA 1NFWA 2H6MA 2XBYA 4YT6H 3MNCA 2FOFA 1P57B 1ZMLA 4BAMB 4TYDA 1OWIA 1W2KH 2YNBA 1DWDH 1GI4A 1C1UH 1HGTH 1O5FH 1SVPA 3UPEA 3MWIU 5C17A 3QZRA 1GHXH 1PPHE 3PROA 2LNCA 4UEHH 3SNBA 2QXJA 1GBLA 3RXCA 2G00A 3UWJH 4K5ZA 2A45B 2K1QA 3PLBA 1O3CA 3ZVFA 2Y5HA 4YLUA 4X1SU 1P04A 3U1JB 1CA0B 2VIQA 1GJBB 2ZDVH 1QB6A 5CMXH 3MO6A 3Q3KA 3FN8A 1FIWA 4ZUHA 1EUFA 2FOBA 1UTPA 2C8XB 1EAIA 1Y3WA 5FPSA 1YGCH 4Y71A 2RA3A 3MU8A 1MU6B 3ZVBA 1TE0A 2O8TA 2WPMS 2C8WB 3RLWH 1T8OA 1MUEB 2ZA5A 1HJAB 2HPPH 4OS5A 2ZWLH 2BLOA 1A0LA 4O97A 1DDJA 5C1XA 1YPJH 3UB0A 2EY4C 3VB7A 6GCHG 3RXPA 5EPYA 4ACBA 4D7GA 4ZXXH 1D3DB 3T5FH 2XWBI 4XBDA 4NCYA 1ZSLA 1UTKA 1RD3B 3GCOA 3QTOH 4JCNA 4Q4LA 3MOCA 1V2MT 2ZKSA 5EQSA 5EPNA 4ZKNU 1YM0A 1O2QA 1O33A 1VCQA 1MKXH 4FUGA 3K9XB 2AS9A 4YTAA 1RTLA 2GP9B 1XUGA 5T1VA 1FAKH 2W7SA 4I31A 3QGNB 3B23B 1F0TA 1O2YA 3SBKA 2ZDAH 1TYNA 5BRRE 2ZHFH 4ZAEA 5ESBA 1H9HE 4MPUA 1TMUH 2VBCA 3ZVGA 1VJAU 3F68H 1O36A 1TB6H 1A5IA 2ZGHA 3SV2H 1FI8A 4Y7AA 1G30B 2CV3A 2F4LA 2TPIZ 3SV7A 1UK2A 3Q3XA 2UWPA 2H9HA 2TRMA 2HVYB 3A83A 1L1NA 3EE0B 3ZZ6A 4Z6AH 1SGRE 2P3TB 2J95A 3E91A 3SN8A 1CBWB 4BAOB 2G81E 3UNRA 1O2PA 1HLTH 1P05A 1GBBA 3PLPA 1N8OB 1BRCE 4CRFA 3L33A 2UWLA 1ZTJA 2G5NA 4U2WA 5GNDA 6CHAC 2PLXA 3W1EA 2QC2A 5E2PA 5EXLA 1H1BA 1HV7A 1O2MA 2ANWA 1ACBE 2FPZA 3SNAA 1SGFA 3ZZ4A 2RFKC 1C2KA 1KXDA 3H5CB 1DOJA 4FVDA 3E1XB 3ATMA 3A80A 3M5MA 5C1UA 3SGAE 2A7JA 2Q1JA 3HK3B 2K8IA 3SJIA 1LVOA 1TGSZ 1SGYE 4LZ4B 1GCTC 4Y6DA 4MNWA 3DCLA 4FXGH 1SLVB 3M7UA 3ZYEA 1GHVH 3E3TA 4NIXA 3L3TA 1X7AC 1AGJA 2GGVB 1DS2E 1TNLA 1L2EA 1P06A 3EA7A 1ZOMA 1AI8H 2GDEH 1TBQH 2C8YB 4NWLA 2ZQ2A 3BF6H 3M5OA 2Y5FA 1RFNA 3KQCA 4X1PU 1TX7A 1QL7A 2F83A 4I8JA 1O2UA 5FBIA 1W12U 3ZZ7A 2AGIX 2CXVA 1CHOF 4U01A 1ELEE 3SUGA 1S0QA 1SC8U 2PUXB 4AFSA 5E0JA 1J15A 1P12E 3PRBA 1DY9A 1ETTH 2GDDA 3DD2H 1SGIB 4NSYA 3K6ZA 2W7UA 3BG8A 1OX1A 1BDAA 2XCNA 2ZIQH 1KLTA 1VGCB 1NTPA 1GJ9B 4IMQA 3LH3A 2F9VA 2AH4X 3UNSA 1EAXA 7KMEH 3WW7A 1YYY1 4JZ1A 5A8XA 4ZH8A 1O3KA 4FUEA 1DANH 1G2MA 4MNVA 4ZXYH 2A5KA 3CP7A 1YPGH 2H2ZA 1K0HA 4BTTB 1EASA 2B5TB 2QF4A 3KQBA 2O9QA 4HG6A 1Z8GA 2BXUH 2BQWB 4D9RA 4NWKA 1SOTA 5B6OA 5HMAA 1C1RA 2OC0A 3PTNA 5EIYA 4X2XA 3TGJE 4GVUA 4OS6A 2VGCC 3SHAH 3TK5A 2HNTF 4IN1A 3MNSA 1SQAA 2XWAA 1C1VH 4CRDA 1ELCA 1LHGH 1C2DA 4H6SB 3SQEE 1DXPA 1FPHH 4FU7A 4K8YA 3RM2H 1C5QA 1BMMH 1GL0E 3C1KA 2J97A 2BYAX 1D3TB 1MAXA 3A84A 3P17H 5DK1A 1C5TA 1QHRB 1RXPA 1AQ7A 1TWXB 1SL3A 1WTHD 1KLJH 1O35A 5HGGA 2P16A 3MU4A 5I46H 2P3FH 3BEFB 1XXDA 1VCPA 1W10U 1TPSA 3SNEA 2GCHG 2XTTB 2H5DA 1C1PA 1CHGA 1KDQB 4BOHA 4DG4A 1KXFA 7LPRA 1KXBA 3LH1A 2R0KA 3MU5A 1HDTH 5LPEA 3CENA 2P94A 2VVUA 2F9OA 2GD4B 2QF0A 4SGAE 1DSUA 8GCHG 2KFWA 1LCYA 3GY6A 5GCHG 2IPHA 1O3AA 1QL8A 2AIPA 3AVZA 1O2XA 3DUXH 1GJAB 1K1IA 3PMJA 2XC0A 1HCGA 3IWMA 4ABJA 2PSXA 1GJ6A 3SZNA 3CS0A 1SGNE 2HNTE 2AMPA 5DP7A 4FUCA 2FO9A 4D76A 1GHAG 3M7TA 1XX9A 4O9VA 3SJ9A 1UCYE 5HYOA 1BBRH 2V3HH 2BTCE 1KYNA 2VH6A 3TH2H 3AW0A 1QBNA 2OP9A 1V2ST 3URDA 1ARCA 2FTMA 1KXAA 1HFDA 4ZHLU 3OTJE 1W7XH 1GHBG 2ZGXH 2YNAA 3GY4A 5JBCS 3RMNH 1UVTH 4I8GA 1PQ7A 2FLBH 1C2GA 2IOTA 5T3HA 4B2AA 4YT7H 1TBZH 3VGCC 4OM9A 3P8NA 3MI4A 2VWOA 2F9NA 2GMTC 1DITH 3SJKA 2Y6TA 2JKHA 2K0QA 2TIOA 3M5NA 4ISIH 4NA9H 2OLGA 1O37A 1T7CA 5A2MH 1SLXB 1BTZA 2GJGA 2BDIA 4WXVA 1W11U 1AFQB 1JBUH 1NO9H 2G51A 2C90B 5KGOA 4WMFA 4B6EA 4FUHA 1K9OE 2VIPA 3ODDA 1ZHMA 2VWMA 2BDBA 2FODA 2OC7A 1P2JA 4WH8A 4LXBH 3MH4A 3PMHB 8KME2 1RTKA 3LONA 2SFAA 1XXFA 3MU0A 1C5OH 1C4V2 3SU3A 1PQ8A 2EI8A 5EJ1A 3IG6B 4X8UH 3SW2B 3UTUH 1YPLH 1GMCG 1TGNA 3AASA 3PV5A 1S83A 3MYWA 1NRPH 1Q3XA 2HALA 1CU1A 3GCNA 1MQ5A 2WSSD 1TALA 3OTPA 1H4WA 1Y5UT 2BM2A 4BANB 5FCKA 3ELAH 1DWBH 2KCYA 1S6HA 3STJA 1TRNA 3SU1A 3NZIA 2W6JD 2R0LA 1J14A 1LQDB 3E0PB 4BTIB 3NRLA 2BHGA 2QN5T 1PYTD 2A32A 1FXYA 3RXQA 1EATA 4TY7A 4Y76A 3SQHE 4AG2A 5LGOA 2IJOB 2A4QA 4OGXA 3WY8A 2GCTC 4K60A 5EXMA 2TGPZ 3BTGE 1KY9A 1TABE 1P2OA 4I8HA 1C2JA 2L74A 2P8OC 3RXFA 3VXEH 3RXVA 1BRUP 1UVOA 1KIGH 2Q6FA 1AZ8A 2XC5A 3TVJB 5KECA 1DVAH 4NSVA 1UTQA 4ISOA 5AF9H 4ABFA 5C5OA 3A86A 4RKOB 1Q2WA 3C27B 1G37A 5CHAC 2W6ID 1C2HA 4NZLA 3RXOA 1F0RA 2BQ7B 2QY0B 2Y80A 3VB4A 1AB9C 1AIXH 2SNWA 4Y0YE 3UR9A 3UQVA 1QBOA 2ZPRA 2ZDMA 1L4ZA 1H9LB 2WPHS 3LGTA 3T2NA 1AU8A 4F49A 4IC5A 3UREA 2WPDD 2GMTB 5JDUB 1O2JA 2PTCE 1W13U 2STAE 3ZZ8A 3UFAA 1P2MA 4NIYA 1SGTA 2WV5A 1HAIH 3H7OA 2WPIS 4K69A 1CQQA 5DP8A 3T62A 2RDEA 3PMAB 1SPJA 2ZFTA 1NRRH 5K0HA 3GY8A 2J92A 4DOQA 1Y59T 1FIZA 1GBDA 2PUQH 4INLA 3LGIA 1H8IH 2WYGA 2FOEA 3RXUA 1FMGA 2OBQA 1J17T 3KIDU 1AMHA 2O8MA 4CH2B 1PPZA 2P95A 3S7HB 3RXBA 1BHXB 1C1WH 1WUNH 2SGAA 5F8XA 1BMLA 1A1RA 4GAWA 3VXFH 1CGJE 3AK5A 3LC5A 5PTPA 1O3GA 1TGTA 4ABEA 2ZFFH 4UFGH 2BX3A 3W94A 1TPOA 3GY2A 2HOBA 1IHSH 4DVAU 3PM3A 4WH6A 3RDZA 3GY3A 1UVSH 2LPRA 1TA2A 2J98A 4Q7YA 4X0WU 1EOLA 4QT8C 4X2YA 1FAXA 1A4WH 5JB8S 2GZ8A 2ANMH 4JK5A 5FPYA 1D6WA 3ZVAA 4CHAC 1UTJA 3SJOA 3P95A 4TT3D 1QBVH 2VB0A 5IYTA 4Y7BA 1O5BB 5FAHA 3E6PH 4IS5A 3RC5A 2BD3A 5C5NA 4FU8A 3F2HA 5F6MA 3VG8A 4I86A 3A7TA 4KELA 2ESTE 4Y8XA 1T31A 2B9LA 1P2IA 1NU9A 3MH7A 1HPGA 1GMDF 5DGJA 5TJXA 3E8LA 3GCTF 1O5AB 2FEQH 5EQRA 1ZJDA 1H8HD 1YWUA 1TNIA 1PQAA 1P0SH 5C0TA 1TA6A 1TQ7B 5HM9A 1O3PB 3PO1B 1HJ8A 1SR5C 2UUKB 1S6FA 1V6DA 5GXPA 2WHXA 4AYYB 1ZYOA 2D2DA 1G32B 1QY6A 3MMGA 1QTFA 1FN8A 1C4U2 2OC8A 1FNIA 5F8ZA 2TGDA 3KYGA 1HRTH 1BMNH 4B6FA 5JPMH 2TBSA 5FX6A 3VEQB 2BOKA 4UFEH 2A7CA 1HIAA 1AVWA 1UTMA 3OAAD 1L0ZA 2HWLB 1YPHC 1F5LA 4GSOA 2A7HA 1O3MA 2BOHB 5LPRA 3RXIA 2ZCKP 4HFPB 3RMLH 3SJ8A 2A2QH 1N6YA 5H4IB 3MO3A 1QJ1B 4JK6A 1JOUB 2JJ2D 2Y7ZA 2VIDA 1NM6A 1TPPA 4X8VH 1AKSA 4YZUA 2FLRH 4P00A 3FFGA 3TH3H 4U32A 1TX8A 1Z6EA 1EB1H 3UOPA 3T25A 4VGCC 5HIYA 4AFUA 2ZTXA 1Z1IA 1CA8B 1O2OA 1LMWB 2HVXA 3LT3A 2CJIA 1ELGA 4MPVA 4X6MA 2ZHEH 3QDZB 1HNEE 3ATWA 3M37A 4BNRA 4CBOA 1ESAA 2KM0A 5FXLA 3MH6A 1W3CA 1B7XB 4OS2A 1F2SE 1O2ZA 2PKAA 2KAIB 3F9FA 4MLFB 3UY9A 3FAOA 5DP4A 1C2MA 1O2SA 4MG3A 4NFFA 4CR9A 2VWLA 2XXLA 1S0RA 5ETXA 1BTXA 4Y10E 2OINA 1GVKB 1NS3A 3RXAA 3RXRA 3L6PA 4IC6A 1G3CA 1K28D 1SFQB 3U98H 3TJUA 3A8BA 5SGAE 1Y3YA 1EQ9A 3ATKA 2V6NA 4YOJA 1GBCA 1E35B 1OP2A 1A0JA 4Q7XA 2ZU4A 1ZZZA 1PPCE 1TRYA 3Q77A 5E0GA 1NU7B 5AVDA 1ZRKA 2R2MB 1NRQH 1W0JD 4XBBA 1P3EA 2J5UA 4FUDA 4NA7A 2OK5A 1BCUH 5F03A 4DIHH 1BTYA 1ELDE 1SHYA 3GISB 3WWBA 2ZZUH 3BIUH 1O2RA 2Z6BD 4J1YA 1UW7A 3RXKA 3P8GA 1LVBA 3A87A 1YBWA 1CT0E 2AFQB 2ZCHP 3RUOA 3U9AH 1FZZA 4X8SH 1SLWB 2FOHA 1MKXK 7GCHF 2J94A 1UVPA 4R0IA 3K2UA 1GJ4H 2J4IA 1HYLA 1VITH 1B5GH 1Y5BT 4AORA 1ANDA 1XUJA 4XDEA 3ATIA 1QRWA 4MNYA 3ZVDA 2FMJA 3HKJB 4A92A 3SI3H 1AVGH 1O2GH 1FY1A 4KGAA 1BQYA 2QF5A 1WBGB 3PYHA 1LDTT 3V0XA 3OYPA 2KAIA 1TFXA 3GCHC 4NG9H 1KTSB 1COWD 1F0SA 1C1QA 1C2IA 3HATH 4AFZA 4WVPE 1ESTA 4P02A 1RIWC 3RXLA 4M7GA 2ILNA 1OWKA 1CSOE 1P01A 1O3OA 1FQ3A 1MTSA 3E90B 2ZC9H 4ISHH 1L4DA 2EI7A 3A85A 1UMAH 1JRSA 4IN2A 4JYUH 3LOXA 2AMQA 5KEDA 2ASUB 3W95A 1XUFA 3S69A 4KP0A 2C3SA 5A8ZA 2ZDLA 3H09A 2BB4A 1FX0B 1O38A 1Y5AT 3TNSA 4KTUA 2A1DB 1O2TA 1DPOA 3JZ1B 4XRNA 1ZHRA 3QLPH 2VVVA 3QX5H 1BITA 4X8TH 5J4SA 4IBLH 5GPIB 3VB5A 4AGJA 4X6OA 3T29A 3ZZ3A 1ELFA 1GI0A 3JZ2B 4O3UA 3SU2A 2CF8H 4LK4A 1UK3A 2FDAA 3SV6A 2UUJB 1RRKA 2BD2A 2G4TA 2PKSC 3HGPA 1GPZA 4HZHA 4BXSA 3M5LA 4YO9A 4YOIA 1S5SA 1HAXB 1K1NA 5IK2D 4WY3A 3RU4D 2FZZA 3OY5U 2CHAC 2W26A 1GVZA 1T32A 1AZZA 1W0YH 1DSTA 3E0NB 2QF3A 1C9PA 4WF8A 2B0FA 2ZG0H 2GZ7A 1O39A 3GDSA 1TRMA 2BXTH 3FP8E 2L6OA 4FUBA 3URCA 1TPAE 1XKAC 1W14U 3M36A 1CGHA 1AWHB 6CHAB 3N99A 5FX5A 1UTLM 1GG6C 3EAJA 5C94A 1D3QB 2BD9A 4AN7A 4HTCH 2ZGBH 1IQGA 3TITA 1AE5A 5A09A 1EX3A 2Y5GA 1QZ8A 1XUKA 3RC6A 3ZIAD 3A88A 2J38A 1NN6A 5C3NA 1K1OA 3U1IB 2A0QB 2FI4E 2AHME 2FOMB 3SHCH 2VH0A 3ENSB 1GCTB 1ZPZA 3A82A 1ABJH 1ZHPA 1H8DH 3SOSA 5A0AE 3NKKA 2JH5D 1HAVB 4ABAA 1AUTC 4IMZA 1TOMH 3RXMA 1OWEA 4NZQA 1QA7A 4AG1A 1C5SA 1V2JT 1GVLA 1G3BA 3BTKE 4ASHA 3QZQA 4Q2KA 5L2ZH 1QCPA 1V2OT 4X2VA 5CDFE 3BSQA 2DUCA 4IW4E 6ESTA 2BD7A 2Z3CA 4UONA 3LGVA 5JBTA 3DA9B 3GYLB 2R3UA 1YLNA 1JRTA 5JYIA 1MZAA 1EKBB 3R3GB 2NU4E 4I8KA 1CO7E 1YC0A 3OX7U 1AHTH 2OUAA 1M9UA 2FS9A 2ALPA 4RN6A 1E1RD 1TLDA 1IQEA 1K1JA 1GDNA 4NGAH 1V2VT 2YMSC 4ISNA 3LKWA 3NCLA 1DLKB 2UUYA 1EPTC 4B76A 4Y11E 2BX4A 1O31A 2ZFQH 3OE7D 3QK1A 2ZU2A 1U6QA 1N6XA 1ELTA 2QGRA 1KSNA 1SG8B 5A0BA 3OSYA 2ZHDA 1YCPH 4GHQA 3TGIE 3FANA 1EFRD 5GIBA 1IQKA 3MHWU 5EJZA 1O0DH 1P03A 3SNCA 1OS8A 1ELVA 2JDID 4XBCA 3SV8A 2KX4A 2V3MA 1O3HA 4MNXA 2NU1E 1HBTH 1O5DH 2VWNA 4BAQB 5AFZH 4K1SA 2HGTH 3SI4H 3UR6A 1TMTH 1GG6B 2DE9A 3CNRA 2Z9GA 1YCPK 2OXSA 2VINA 4NA8A 1O3LA 4YXWD 1MD8A 1DFPA 3NK8A 4AB8A 1G3DA 1GI2A 4INKA 3PB1E 5TCCA 3U8RH 1A7SA 4B74A 1MTNC 1RS0A 5EODA 1DWCH 1NESE 3T27A 1G36A 1D6RA 2NWNA 2VGCB 4H42U 1P2QA 2XCFA 1C5PA 4ABGA 1BBRK 2GV7A 3A7ZA 2BVRH 3F3BA 2QXIA 3F9GA 3BTEE 1NC6A 2WZQA 1T4VH 1XUHA 2BVXH 9LPRA 3KL6A 1JIRA 1SOZA 4FU9A 4GLYA 2GT8A 4BTUB 2BLWA 3GDUA 1OWDA 3BEUA 2G55A 1KDQA 1WDIA 2QIQA 3D65E 3RLYH 3AW1A 1NFUA 2UUFB 2A31A 3O8DA 3Q00A 2ZU1A 5DP9A 1LKBA 2FI5E 2VVCA 3RXJA 2ODQA 1SBWA 1GBAA 1BTWA 1BTPA 3KQDA 3GICB 1OYTH 4FUFA 4DW2U 3SU0A 2ZPQA 1W0ZU 3VB3A 2AMDA 2SGQE 2FOCA 2J34A 1SGEE 2PHBA 1T8LA 2GCHF 1ZPBA 1FN6A 2GTBA 3O8BA 1GBTA 1W7GH 2IJD1 5K7RA 4NFEA 5GWZA 2BMGB 2KR7A 3BTQE 2WPJS 1HJ9A 1YP9A 1LKAA 2CGAA 2PW8H 1V2PT 4OGYA 4X6PA 4AX9H 4D9QA 1MU8B 2UWOA 2HPQH 1V2NT 2V7QD 8GCHF 3U28C 5GCHF 2Y7XA 1QB1A 2ULLA 1A2CH 3BG4C 2ZFSA 4CH8B 1MBQA 2VU8E 2ZHQH 5EU8A 2H1UA 1TQ0B 3OU0A 3MNXA 3BTME 1P09A 2FTLE 2A4RA 1K22H 1UCYH 3ZV8A 2FX4A 1Z8RA 3BTHE 1GHAF 3FZDA 5DP6A 1LTOA 1WTGH 1VITG 4OS1A 1ANEA 2A2XH 3DFJA 1ZGIA 2FIRH 3LPRA 3BEIB 1C5NH 3ZZCA 1PJPA 1CVWH 1SFIA 4MDSA 1MTNB 3OEHD 1UHBB 2OBOA 5F53A 5C2ZA 4RT1A 3VGCB 1E36B 1GHBF 2TGTA 1A3EH 2FM2A 3LC3A 4YLQH 1SQRA 4M9FA 1E79D 5AHGH 3A7WA 1GMHG 1NT1A 1OYQA 1JXPA 3TH4H 1O3BA 3NXPA 1FONA 3ITIA 1BA8B 2SGDE 2XBXA 1NBMD 1LO6A 3KHVA 1JIMA 4B2BA 4X1NU 3CS7A 4ACAA 2WV9A 3VB6A 4BXWA 2PWXA 1UK4A 2QYIA 3V7TA 2G52A 4HI3A 1C5RA 2EC9H 1Y3VA 1ZSJA 2V35A 1O3NA 1G3EA 1O3FA 1O3JA 3I78A 5T6GA 1LVYA 3DFLA 1N1LA 3F6UH 1KMHB 1IQMA 2Z9KA 1AE8H 1O2WA 1XKBC 4ZMAH 3M3SA 1TGCA 4TWYA 1TX6A 1DUAA 1SGQE 3F9HA 1GMCF 3AAVA 4WJG2 3RU4T 4B75A 2JH6D 4DCDA 2TGAA 4GCHF 1ARBA 4ISLA 2F3CE 1O2NA 5B6LA 1WQVH 1V2LT 3P8OA 4WXIA 4H4FA 4D7FA 2C93B 2ODPA 1UTOA 2ANYA 5EOKA 2JIZD 2WPLS 4ZKSU 3EQ0H 2GCTB 5DPAA 1ZPCA 2BVSH 2OQ5A 1VZQH 3SGQE 2P8OB 4A6LA 5JBBS 1CT2E 1MTVA 2OTVA 2HRVA 1QJ7B 1MH0A 4ABDA 1GHZA 1WU1A 1T4UH 4CRBA 3ESTA 2LELA 5CHAB 1O32A 2Z94A 5J4QA 1S81A 3BIVH 1MQ6A 5I25A 2GT7A 2YMSD 4XSKU 3M35A 1AB9B 3EA9A 2B8OH 2I6QA 3ZV9A 3PRDA 5C67A 5FHTA 3M7QA 2AERH 1GBFA 1MTWA 1CA0C 4BAKB 1OOKB 2BDAA 1OP8A 1V2WT 1EP6A 4TPYA 5E0HA 5EJLA 2QAAA 3T26A 3SZEA 4NIVA 1MZDA 4CREA 1D9IA 2V3OH 1SQTA 2Z9LA 3FVFB 1MCTA 2FP7B 1C5ZB 4ZCNA 2BY8X 2VJ1A 1DX5M 1ZR0A 3U8OH 4XFQA 2BD8A 3TIUA 3FKSD 1HAOH 1A3BH 2ODYB 3F9EA 1SGPE 5A0CA 3B9FH 2SGPE 3A7XA 1SGDE 1SKYE 1BTHH 1ANBA 4DGJA 3QUMP 4K1EA 1RGQA 1THSH 3BN9A 1IQNA 1EJNA 4B71A 1MKWH 1Z6JH 4B1TA 1O34A 1BHXF 4AOQA 1BUIA 7GCHG 2P59A 1P8VC 4X1QU 3U69H 1H8ED 1RTFB 2BZ6H 1E1QD 1YPMH 2GX4A 3UQOA 2ANKH 3EE7A 1ABIH 2H9EH 4B2CA 1MKWK 1Z7KA 3F0OA 1AN1E 1OWHA 5ESTE 4CHAB 1QA0A 2F9PA 1F0UA 4IGDA 4XE4A 1CBWC 3OFND 2OCVB 1GWAA 1SGCA 5EQQA 1O3IA 1N8OC 2RDLA 2D8WA 1P10A 2Z9IA 3PTBA 3T28A 2ZFPH 1ETRH 2O8WA 1TNGA 2XC4A 4CR5A 2OQUA 1BJVA 1GDQA 1T8MA 2AIQA 3E16B 4WWYA 1O5EH 5DO4H 1GJ5H 1C1NA 1O2VA 1HAYB 4R8TB 1IQIA 2HNTC 5CHBA 4BAHB 1SGFG 1MD7A 1IQFA 5T6DA 1O2LA 2EEKA 3DHKH 2BDHA 2ZGJA 3RXDA 1DWEH 1HUTH 1C9TA 2BY7X 4RT0A 3TJVA 4ABBA 1S84A 1IQHA 1Y8TA 3V12A 4GPGA 4Y79A 4U30A 2ZDNA 1E37B 4ABIA 1C5MD 3N7EA 1Y3XA 1EB2A 4I7YH 2IPQX 1MABB 2ZCLP 3STIA 1CHOG 5BPEA 4YESB 5JBAS 1VKYA 4XOJA 2SGEE 1GI5A 3ZVEA 4CBNA 1JWTA 1XVMA 2ZDKA 2F9BH 1PPGE 5G4BA 1GBKA 2SGFE 2WUBA 1P3CA 1OKXA 4E06H 1IQJA 2C4FH 1B0FA 3ODFA 3TNTA 1PFXC 3I29A 1GHWH 1GCDA 3RXHA 1CE5A 1XUIA 1P11E 1VCWA 4XD7D 4Y0ZE 2EQNA 7ESTE 1OSSA 3TJNA 1KLIH 3LDXH 1LPKB 1EJAA 1O5GH 1HXFH 1GI8B 2G4UA 3KF2A 3R0FA 4VGCB 4K3JA 1A5HA 1VGCC 3H7TA 1V3XA 2GV6A 1FY8E 3KYFA 3PV2A 1T8NA 1EJMA 1KXEA 1XMNB 1K1MA 2AYWA 1C5UA 2XOKD 2ZTYA 2RA0A 4I8LA 3D23A 1VJ9U 1P9UA 2BD4A 3KN2A 5HM2A 3F1SB 1O3DA 1TNKA 1AVXA 4ESTE 1BJUA 4TWWA 2G8TA 1GDUA 3PLKA 1BMAA 3HPTB 3FZZA 1WQSA 1GBMA 1FY5A 4AFQA 2AGGX 2M2AA 3BTDE 3PWCA 1TNJA 5IDKA 1TGBA 2GVFA 4K1TA 1LHCH 2BY9X 4CRCA 3KEEA 2FS8A 2PGBB 2ZHWH 2XBWA 4GUXA 4F48B 3I77A 4ASUD 1C1SA 3QWCH 1ZRBA 2OD3B 1EXFA 3QGJA 2D26C 3V13A 8LPRA 1K1LA 2FI3E 4UFFH 5HXFA 3ZYDA 3IITA 6GCHF 2B7DH 1FY3A 3SO3A 4J2YB 2NU2E 1PPFE 1PYTC 5FL7D 2Z9JA 1ZMJA 3GOVB 1NFYA 2ZNKH 3LGYA 4CRGA 4E7RG 3VFEA 5EW2H 4THNH 1EZSC 1Q31A 2XYAA 3PMBB 3FO8D 3RXGA 2VIVA 2ZECA 1DUEA 2DE8A 2ZF0H 4CRAA 2PV9B 3LGWA 3KCGH 1FPCH 2A4OA 2Q6DA 1INCA 1O5CB 1YY3A 4E05H 3SORA 3P8FA 3RU4E 2ZFRH 1FUJA 1NZQH 2CF9H 5DN6D 2M5TA 1ETSH 1LHFH 3SNDA 4LOYH 2WV4A 4Y8YA 1G2LA 1TNHA 3UNQA 3S0NA 1OPHB 2O8UA 3SV9A 1GI1A 1YPKH 4A1XA 3EA8A 2HLCA 2KCAA 1YLDA 3GCHB 3GS9A 3EGKH 2BDCA 4ZKOU 1MMJN 3GYMA 2EA3A 2W3KA 2XRCA 1YCPM 5EW1H 2J9NA 4JYTA 1RIWB 2FXRA 4ZHAA 2Q6GA 5A8YA 2ZGCA 1GBJA 3UOUA 2QCYA 2ZEBA 1C1MA 1BBRE 5CE1A 3DSGA 3ZZ9A 3N7DA 4A1TA 1H9IE 2FYQA 2IN2A 2ZI2H 5DSFA 5EXNA 3LJJA 4AB9A 3K65B 2STBE 5LH8A 3A8AA 4YM9A 3KQEA 1J9CH 1FDPA 5T6FA 1E38B 3OEED 3A8CA 3P70B 3RM0H 3TJOA 1C5LH 2QV1A 4ZKRU 1YPHE 1UVUH 4AC9A 3KNXA 3UIRA 1UO6A 3A8DA 4MQAA 2BDGA 4OS4A 1NRNH 1EAWA 1V2QT 5F8TA 2THFB 1OXGA 1P2NA 1HAHH 1A46H 4UE7H 3RC4A 1MAYA 5L6NH 1AFQC 2PKSB 2A5IA 3QTVH 4UDWH 4K8BA 3A81A 1ELBA 2QA9E 1DY8A 2NU0E 3ATLA 1UJ1A 2R2WU 1D3PB 2BD5A 1WYKA 2OC1A 3V3MA 5FPTA 1O2IA 4Z1MD 1SQOA 1AWFH 2CHAB 5LPFA 4Z0KA 1L1JA 1C1TA 2PP6A 1K21H 4FVBA 1BT7A 3G01A 1B0EA 1NPMA 1EP5A 2QXGA 3M3VA 3N7OA 4RI0A 1WAYB 4JZIA 1Y3UA 1MCVA 2PR3A 4FUJA 5ABWA 1TAWA 2GZ9A 5C20A 3A7YA 4F4OC 1A61H 1E0FD 5DP5A 1XM1A 1ZGVA 1S82A 2F9UA 2O8LA 1GI9B 2PTNA 1WXRA 1OWJA 4KKDA 3LU9B 2QXHA 1GI3A 1F7ZA 3U8TH 4UFDH 4MPWA 2BQ6B 3NWUA 5FCRA 3B8JA 2ZTZA 3LGUA 1DICA 1LQEA 1GBHA 1ZMNA 2XNDD 2W3IA 1C1OA 2FOGA 4Q63A 1LHDH 1HAVA 1C4Y2 4FUIA 3TGKE 1ESBA 1GGDC 4O3TA 4FETA 3LJOA 3A89A 1GL1A 1C5XB 4UD9H 2Z3EA 5C1YA 4NIWA 3KGPA 5AFYH 5E8EH 3RXSA 1RJXB 2BLVA 5DG6A 2Z3DA 3O8RA 5L30H 4ABHA 1GBEA 3P92A 4MVNA 4INHA 2G5VA 1F92A 3SGBE 2FYRA 4DT4A 4JZDH 4Q7ZA 1FJSA 1HB0B 1QGFA 3NUMA 5L2YH 2BY5X 3MTYA 5EG4A 2I6SA 4DY7B 1BMFD 3MU1A 2W5EA 4TPIZ 1G9IE 1GJCB 2Y81A 3F2FA 2P93A 1OHHD 1YLCA 1ORFA 1GI6A 1IHTH 1K1PA 1ZLRA 1DXWA 2Z7FE 2QE7D 1C2LA 2NU3E 3TLOA 1BTUA 3GY5A 3S7KB 1PQ5A 2YMSB 4YOGA 1SB1H 1P02A 4DJZB 1V2RT 1EPTB 1PPBH 2C8ZB 4WMEA 1W0KD 2EI6A 2VIOA 1EZUC 3FP6E 2ZU5A 9ESTA 3TPIZ 3HKIB 2WYJA 4B73A 1YKTA 4TSFD 4TY6A 1QB9A 3TU7H 1IOEA 1W8BH 2VNTA 4RSPA 3M61U 3PV4A 4GCHG 1YPEH 2JETC 1O3EA 2VIWA 2WINI 3FP7E 1DM4B 1CT4E 1THRH 4WMDA 2BZAA 3F0PA 4RKJB 3RXTA 2JJ1D 3BTFE 2BLQA 1S6LA 3ZZAA 2R3YA 4DURA 1F5RA 1QL9A 1F5KU 1AO5A 2RG3A 2LP6A 1ZSKA 1DE7H 2A4GA 4SGBE 2FX6A 5DP3A 1JMOH 3ZZ5A 2F91A 3SUEA 3DSOA 1ELAA 1V2KT 1O30A 1V2UT 1BB0B 2ZO3H 3EDXB 1GBIA 1BRAA 4Q80A 5TCAA 2ZPSA 1GGDB 3QN7A 2JH0D 3S9AA 3SUFA 1GMDG 1UCYK 2J98B 2SNVA 3GCTG 3TK9A 1GHYH 4FOUC 4JZEH 1TIOA 1QRZA 3HK6B 3QO6A 1P9SA 1NROH 3UWIA 4AZ2B 4O03A 1FY4A 1Z71A 1BOQA 2D1JA 3RP2A 3KQ5A 1HAGE 1GJDB 4JYVH 1AY6H 1MBMA 3BTWE 3LIWA 3FOAA 2ZP0H 3DSPA 5JB9S 2PSYA 2A5AA 3PO1C 1SMFE 4X2WA 4KTSA 3Q3YA 1ZTKA 1O2HA 1E34B 1EPTA 1AUJA 4DIIH 5GDSH 1TONA 3GY7A 5FBEA 2KZ4A 1QFKH 3TK6A 1QIXB 3RXEA 2V0BA 1P2KA 1NRSH 3SUDA
chains in the Genus database with same CATH topology
3RMMH 1J8AA 2WPKS 4AGKA 4D8NA 1HAPH 1IAUA 1EZXC 1J16A 1TBRH 1VR1H 8ESTE 1NFXA 1TOCB 1EAUA 3S9CA 2FWWA 4GHTA 4JMYA 1Z1JA 4AYVB 3ZVCA 5EGMA 1O2KA 3K6YA 1LHEH 1K2I1 1BIOA 1SI5H 1C5WB 2JETB 1ID5H 1ZTLA 3BG4B 4LZ1H 2H9TH 1HIAB 4HGCA 3PWBA 3D49H 1QURH 4A7IB 1XVOA 2CMYA 3O8CA 2ZU3A 2R9PA 4I33A 2H5CA 1UHBA 2Y82A 2GKVE 3RMOH 3BTTE 2XW9A 3AAUA 1L1GA 1Z8JB 1S85A 1Z8IB 3BV9B 1A5GH 2BY6X 1TMBH 1ZJKA 1V2TT 2J2UA 5DJ7A 3S9BA 3M3TA 3EYDA 1SHHB 1GI7B 1AKSB 3NPSA 1WOFA 3MFJA 1KXCA 1WCZA 3OY6U 1NY22 5DKMA 2AGEX 4X1RU 1BZXE 1GJ7B 1QQUA 1VITF 2CN0H 2ALVA 1FV9A 1IQLA 1A0HB 2BDYA 1UTNA 1EOJA 4K2YA 1QNJA 4MTBA 1LVMA 2P3UB 1QRXA 3DT0H 2PGQB 2YOLA 1LPZB 3MO9A 2WUCA 4A1VA 4I32A 1AFEH 2PKAB 3D62A 1EZQA 3MNBA 1HXEH 4KTCA 3VPKA 1HJAC 3A7VA 1QJ6B 5E2OA 4X6NA 1HAZB 1D4PB 2FOAA 1ANCA 3P6ZB 4E7NA 1BRBE 1C5YB 1GMHF 4OS7A 1KTTB 1YF4A 1C2EA 2ZQ1A 1PPEE 1WV7H 3SU5A 3SU4A 5GJ4B 1C5VA 1LPGB 2FESH 3UUZA 1WSSH 3MH5A 1SSXA 3Q76A 4ZHMU 4DT7B 3GDVA 4A5TS 3HGNA 3ZZBA 1OP0A 1GJ8B 1DLEA 2PFEA 4ZROA 2RCEA 3SU6A 4PROA 2XBVA 1QR3E 1THPB 1MTUA 1SLUB 4H6TA 1FLEE 1QQ4A 4JZFH 4MPXA 1CGIE 2XNIA 4Y8ZA 2AEIH 6LPRA 1AD8H 1DT2A 1C2FA 3ZZDA 1NFWA 2H6MA 2XBYA 4YT6H 3MNCA 2FOFA 1P57B 1ZMLA 4BAMB 4TYDA 1OWIA 1W2KH 2YNBA 1DWDH 1GI4A 1C1UH 1HGTH 1O5FH 1SVPA 3UPEA 3MWIU 3QZRA 1GHXH 1PPHE 3PROA 2LNCA 4UEHH 3SNBA 2QXJA 1GBLA 3RXCA 2G00A 3UWJH 4K5ZA 2A45B 2K1QA 3PLBA 1O3CA 3ZVFA 2Y5HA 4YLUA 4X1SU 1P04A 3U1JB 1CA0B 2VIQA 1GJBB 2ZDVH 1QB6A 5CMXH 3MO6A 3Q3KA 1FIWA 4ZUHA 1EUFA 2FOBA 1UTPA 2C8XB 1EAIA 1Y3WA 5FPSA 1YGCH 4Y71A 2RA3A 3MU8A 1MU6B 3ZVBA 1TE0A 2O8TA 2WPMS 2C8WB 3RLWH 1T8OA 1MUEB 2ZA5A 1HJAB 2HPPH 4OS5A 2ZWLH 2BLOA 1A0LA 4O97A 1DDJA 5C1XA 1YPJH 3VB7A 6GCHG 3RXPA 5EPYA 4D7GA 4ZXXH 1D3DB 3T5FH 2XWBI 4XBDA 4NCYA 1ZSLA 1UTKA 1RD3B 3GCOA 3QTOH 4JCNA 3MOCA 1V2MT 2ZKSA 5EQSA 5EPNA 4ZKNU 1YM0A 1O2QA 1O33A 1VCQA 1MKXH 4FUGA 3K9XB 2AS9A 4YTAA 1RTLA 2GP9B 1XUGA 1FAKH 2W7SA 4I31A 3QGNB 3B23B 1F0TA 1O2YA 3SBKA 2ZDAH 1TYNA 5BRRE 2ZHFH 4ZAEA 5ESBA 1H9HE 4MPUA 1TMUH 3ZVGA 1VJAU 3F68H 1O36A 1TB6H 1A5IA 2ZGHA 3SV2H 1FI8A 4Y7AA 1G30B 2CV3A 2TPIZ 3SV7A 1UK2A 3Q3XA 2UWPA 2H9HA 2TRMA 3A83A 1L1NA 3EE0B 3ZZ6A 4Z6AH 1SGRE 2P3TB 2J95A 3E91A 3SN8A 1CBWB 4BAOB 2G81E 3UNRA 1O2PA 1HLTH 1P05A 1GBBA 3PLPA 1N8OB 1BRCE 4CRFA 3L33A 2UWLA 1ZTJA 2G5NA 4U2WA 6CHAC 2PLXA 2QC2A 5E2PA 5EXLA 1H1BA 1HV7A 1O2MA 2ANWA 1ACBE 2FPZA 3SNAA 1SGFA 3ZZ4A 1C2KA 1KXDA 3H5CB 1DOJA 4FVDA 3E1XB 3ATMA 3A80A 3M5MA 5C1UA 3SGAE 2A7JA 2Q1JA 3HK3B 3SJIA 1LVOA 1TGSZ 1SGYE 4LZ4B 1GCTC 4Y6DA 4MNWA 4FXGH 1SLVB 3M7UA 3ZYEA 1GHVH 3E3TA 4NIXA 3L3TA 1X7AC 1AGJA 2GGVB 1DS2E 1TNLA 1L2EA 1P06A 3EA7A 1ZOMA 1AI8H 2GDEH 1TBQH 2C8YB 4NWLA 2ZQ2A 3BF6H 3M5OA 2Y5FA 1RFNA 3KQCA 4X1PU 1TX7A 1QL7A 2F83A 4I8JA 1O2UA 5FBIA 1W12U 3ZZ7A 2AGIX 2CXVA 1CHOF 4U01A 1ELEE 3SUGA 1S0QA 1SC8U 2PUXB 4AFSA 5E0JA 1J15A 1P12E 1DY9A 1ETTH 2GDDA 3DD2H 1SGIB 4NSYA 3K6ZA 2W7UA 3BG8A 1OX1A 1BDAA 2XCNA 2ZIQH 1KLTA 1VGCB 1NTPA 1GJ9B 4IMQA 3LH3A 2F9VA 2AH4X 3UNSA 1EAXA 7KMEH 1YYY1 4JZ1A 5A8XA 4ZH8A 1O3KA 4FUEA 1DANH 1G2MA 4MNVA 4ZXYH 2A5KA 3CP7A 1YPGH 2H2ZA 4BTTB 1EASA 2B5TB 3KQBA 2O9QA 1Z8GA 2BXUH 2BQWB 4D9RA 4NWKA 1SOTA 5B6OA 5HMAA 1C1RA 2OC0A 3PTNA 4X2XA 3TGJE 4GVUA 4OS6A 2VGCC 3SHAH 3TK5A 2HNTF 4IN1A 3MNSA 1SQAA 2XWAA 1C1VH 4CRDA 1ELCA 1LHGH 1C2DA 4H6SB 3SQEE 1DXPA 1FPHH 4FU7A 4K8YA 3RM2H 1C5QA 1BMMH 1GL0E 3C1KA 2BYAX 1D3TB 1MAXA 3A84A 3P17H 5DK1A 1C5TA 1QHRB 1RXPA 1AQ7A 1TWXB 1SL3A 1WTHD 1KLJH 1O35A 5HGGA 2P16A 3MU4A 5I46H 2P3FH 3BEFB 1XXDA 1VCPA 1W10U 1TPSA 3SNEA 2GCHG 2XTTB 2H5DA 1C1PA 1CHGA 1KDQB 4BOHA 4DG4A 1KXFA 7LPRA 1KXBA 3LH1A 2R0KA 3MU5A 1HDTH 5LPEA 3CENA 2P94A 2VVUA 2F9OA 2GD4B 2QF0A 4SGAE 1DSUA 8GCHG 1LCYA 3GY6A 5GCHG 2IPHA 1O3AA 1QL8A 2AIPA 3AVZA 1O2XA 3DUXH 1GJAB 1K1IA 3PMJA 2XC0A 1HCGA 3IWMA 4ABJA 2PSXA 1GJ6A 3SZNA 3CS0A 1SGNE 2HNTE 2AMPA 5DP7A 4FUCA 2FO9A 4D76A 1GHAG 3M7TA 1XX9A 4O9VA 3SJ9A 1UCYE 5HYOA 1BBRH 2V3HH 2BTCE 1KYNA 2VH6A 3TH2H 3AW0A 1QBNA 2OP9A 1V2ST 3URDA 1ARCA 2FTMA 1KXAA 1HFDA 4ZHLU 3OTJE 1W7XH 1GHBG 2ZGXH 2YNAA 3GY4A 5JBCS 3RMNH 1UVTH 4I8GA 1PQ7A 2FLBH 1C2GA 2IOTA 5T3HA 4B2AA 4YT7H 1TBZH 3VGCC 3P8NA 3MI4A 2VWOA 2F9NA 2GMTC 1DITH 3SJKA 2Y6TA 2JKHA 2TIOA 3M5NA 4ISIH 4NA9H 2OLGA 1O37A 1T7CA 5A2MH 1SLXB 1BTZA 2BDIA 4WXVA 1W11U 1AFQB 1JBUH 1NO9H 2G51A 2C90B 4WMFA 4FUHA 1K9OE 2VIPA 3ODDA 1ZHMA 2VWMA 2BDBA 2FODA 2OC7A 1P2JA 4WH8A 4LXBH 3MH4A 3PMHB 8KME2 1RTKA 3LONA 2SFAA 1XXFA 3MU0A 1C5OH 1C4V2 3SU3A 1PQ8A 2EI8A 3IG6B 4X8UH 3SW2B 3UTUH 1YPLH 1GMCG 1TGNA 3AASA 1S83A 3MYWA 1NRPH 1Q3XA 2HALA 1CU1A 3GCNA 1MQ5A 1TALA 1H4WA 1Y5UT 2BM2A 4BANB 5FCKA 3ELAH 1DWBH 1S6HA 3STJA 1TRNA 3SU1A 3NZIA 2R0LA 1J14A 1LQDB 3E0PB 4BTIB 2BHGA 2QN5T 1PYTD 2A32A 1FXYA 3RXQA 1EATA 4TY7A 4Y76A 3SQHE 4AG2A 5LGOA 2IJOB 2A4QA 4OGXA 3WY8A 2GCTC 4K60A 5EXMA 2TGPZ 3BTGE 1KY9A 1TABE 1P2OA 4I8HA 1C2JA 2P8OC 3RXFA 3VXEH 3RXVA 1BRUP 1UVOA 1KIGH 2Q6FA 1AZ8A 2XC5A 3TVJB 1DVAH 4NSVA 1UTQA 4ISOA 5AF9H 4ABFA 5C5OA 3A86A 4RKOB 1Q2WA 3C27B 1G37A 5CHAC 1C2HA 4NZLA 3RXOA 1F0RA 2BQ7B 2QY0B 2Y80A 3VB4A 1AB9C 1AIXH 2SNWA 4Y0YE 3UR9A 3UQVA 1QBOA 2ZPRA 2ZDMA 1L4ZA 1H9LB 2WPHS 3LGTA 3T2NA 1AU8A 4F49A 4IC5A 3UREA 2GMTB 5JDUB 1O2JA 2PTCE 1W13U 2STAE 3ZZ8A 3UFAA 1P2MA 4NIYA 1SGTA 2WV5A 1HAIH 3H7OA 2WPIS 4K69A 1CQQA 5DP8A 3T62A 3PMAB 1SPJA 2ZFTA 1NRRH 5K0HA 3GY8A 2J92A 4DOQA 1Y59T 1FIZA 1GBDA 2PUQH 4INLA 3LGIA 1H8IH 2WYGA 2FOEA 3RXUA 1FMGA 2OBQA 1J17T 3KIDU 1AMHA 2O8MA 4CH2B 1PPZA 2P95A 3S7HB 3RXBA 1BHXB 1C1WH 1WUNH 2SGAA 5F8XA 1BMLA 1A1RA 4GAWA 3VXFH 1CGJE 3LC5A 5PTPA 1O3GA 1TGTA 4ABEA 2ZFFH 4UFGH 2BX3A 3W94A 1TPOA 3GY2A 2HOBA 1IHSH 4DVAU 3PM3A 4WH6A 3RDZA 3GY3A 1UVSH 2LPRA 1TA2A 4Q7YA 4X0WU 1EOLA 4QT8C 4X2YA 1FAXA 1A4WH 5JB8S 2GZ8A 2ANMH 4JK5A 5FPYA 1D6WA 3ZVAA 4CHAC 1UTJA 3SJOA 3P95A 1QBVH 2VB0A 5IYTA 4Y7BA 1O5BB 5FAHA 3E6PH 4IS5A 3RC5A 2BD3A 5C5NA 4FU8A 5F6MA 3A7TA 4KELA 2ESTE 4Y8XA 1T31A 2B9LA 1P2IA 1NU9A 3MH7A 1HPGA 1GMDF 5DGJA 5TJXA 3E8LA 3GCTF 1O5AB 2FEQH 5EQRA 1ZJDA 1TNIA 1PQAA 1P0SH 1TA6A 1TQ7B 5HM9A 1O3PB 3PO1B 1HJ8A 1SR5C 2UUKB 1S6FA 1V6DA 5GXPA 4AYYB 1ZYOA 2D2DA 1G32B 1QY6A 3MMGA 1QTFA 1FN8A 1C4U2 2OC8A 1FNIA 5F8ZA 2TGDA 1HRTH 1BMNH 5JPMH 2TBSA 5FX6A 3VEQB 2BOKA 4UFEH 2A7CA 1HIAA 1AVWA 1UTMA 1L0ZA 2HWLB 1YPHC 1F5LA 4GSOA 2A7HA 1O3MA 2BOHB 5LPRA 3RXIA 2ZCKP 4HFPB 3RMLH 3SJ8A 2A2QH 1N6YA 5H4IB 3MO3A 1QJ1B 4JK6A 1JOUB 2Y7ZA 2VIDA 1NM6A 1TPPA 4X8VH 1AKSA 4YZUA 2FLRH 3FFGA 3TH3H 4U32A 1TX8A 1Z6EA 1EB1H 3UOPA 3T25A 4VGCC 4AFUA 2ZTXA 1Z1IA 1CA8B 1O2OA 1LMWB 2HVXA 3LT3A 2CJIA 1ELGA 4MPVA 4X6MA 2ZHEH 3QDZB 1HNEE 3ATWA 3M37A 4BNRA 4CBOA 1ESAA 5FXLA 3MH6A 1W3CA 1B7XB 4OS2A 1F2SE 1O2ZA 2PKAA 2KAIB 3F9FA 4MLFB 3UY9A 3FAOA 5DP4A 1C2MA 1O2SA 4MG3A 4NFFA 4CR9A 2VWLA 2XXLA 1S0RA 5ETXA 1BTXA 4Y10E 2OINA 1GVKB 1NS3A 3RXAA 3RXRA 3L6PA 4IC6A 1G3CA 1K28D 1SFQB 3U98H 3TJUA 3A8BA 5SGAE 1Y3YA 1EQ9A 3ATKA 2V6NA 4YOJA 1GBCA 1E35B 1OP2A 1A0JA 4Q7XA 2ZU4A 1ZZZA 1PPCE 1TRYA 3Q77A 5E0GA 1NU7B 5AVDA 1ZRKA 2R2MB 1NRQH 4XBBA 1P3EA 4FUDA 4NA7A 1BCUH 5F03A 4DIHH 1BTYA 1ELDE 1SHYA 3GISB 2ZZUH 3BIUH 1O2RA 2Z6BD 4J1YA 3RXKA 3P8GA 1LVBA 3A87A 1YBWA 1CT0E 2AFQB 2ZCHP 3RUOA 3U9AH 1FZZA 4X8SH 1SLWB 2FOHA 1MKXK 7GCHF 2J94A 1UVPA 4R0IA 3K2UA 1GJ4H 2J4IA 1HYLA 1VITH 1B5GH 1Y5BT 4AORA 1ANDA 1XUJA 4XDEA 3ATIA 1QRWA 4MNYA 3ZVDA 2FMJA 3HKJB 4A92A 3SI3H 1AVGH 1O2GH 1FY1A 4KGAA 1BQYA 1WBGB 3PYHA 1LDTT 3V0XA 3OYPA 2KAIA 1TFXA 3GCHC 4NG9H 1KTSB 1F0SA 1C1QA 1C2IA 3HATH 4AFZA 4WVPE 1ESTA 1RIWC 3RXLA 4M7GA 2ILNA 1OWKA 1CSOE 1P01A 1O3OA 1FQ3A 1MTSA 3E90B 2ZC9H 4ISHH 1L4DA 2EI7A 3A85A 1UMAH 1JRSA 4IN2A 4JYUH 3LOXA 2AMQA 2ASUB 3W95A 1XUFA 3S69A 4KP0A 2C3SA 5A8ZA 2ZDLA 2BB4A 1O38A 1Y5AT 3TNSA 4KTUA 2A1DB 1O2TA 1DPOA 3JZ1B 1ZHRA 3QLPH 2VVVA 3QX5H 1BITA 4X8TH 5J4SA 4IBLH 5GPIB 3VB5A 4AGJA 4X6OA 3T29A 3ZZ3A 1ELFA 1GI0A 3JZ2B 4O3UA 3SU2A 2CF8H 4LK4A 1UK3A 2FDAA 3SV6A 2UUJB 1RRKA 2BD2