3GYMA

Structure of prostasin in complex with aprotinin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
241
structure length
241
Chain Sequence
ITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPISLPAAQASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNSLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostasin
publication title Active site conformational changes of prostasin provide a new mechanism of protease regulation by divalent cations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/inhibitor
total genus 43
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gymA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gymA01
1TPPA 1UTNA 2JH0D 2ZECA 2ODPA 3GCNA 2SNWA 2ZFPH 1QY6A 1C2KA 4B2BA 2W5EA 1DUEA 3O8RA 1E34B 2WPJS 3MO9A 5FPSA 2VH0A 1CT0E 3T29A 1EKBB 4MPXA 3LJJA 3MU1A 2G81E 3MNXA 1TRMA 1OX1A 4AGJA 4JZFH 2B8OH 1TIOA 3Q3KA 1CGHA 2ZHFH 6CHAC 1O2OA 5EW2H 1HJ8A 3T5FH 1SQOA 2SGQE 2ZDAH 1O3MA 1VCWA 2EI8A 2EI7A 2NU3E 1AKSB 3GCHC 2ZI2H 5G4BA 1BT7A 1A4WH 4MQAA 2BY9X 4ISOA 1ABIH 1F0TA 2J95A 4F49A 3T2NA 3LGWA 4Y7AA 4E7NA 1RRKA 3BG8A 3QZQA 3ZZBA 4AFSA 1C1UH 1BTYA 4FUJA 1THPB 2THFB 3I77A 1AVWA 1UTKA 2ALPA 1ZJKA 3BG4B 3DUXH 1GBAA 4CBOA 4AG2A 4A5TS 4SGAE 1EJAA 4BTUB 3GY4A 2PR3A 2QF3A 2H6MA 3GDVA 1TALA 4O97A 1O33A 1AY6H 1AO5A 1CU1A 1T32A 2ASUB 3QUMP 1Y5AT 1EAUA 1EXFA 3NK8A 1XUKA 1IQLA 1YPJH 4K5ZA 1DWCH 2PUQH 3NKKA 2BXUH 4WH6A 2ZHWH 4ZKNU 9LPRA 3MH7A 2YNAA 1J16A 1GI7B 3ZVBA 4ISIH 1YPHE 3RXOA 4NG9H 3T26A 1CT4E 1BJUA 2P3TB 4NA8A 4GCHG 1SLXB 3SNDA 2PGBB 1SL3A 2C3SA 2VIQA 3A7XA 3OY6U 2H9HA 1AIXH 1C2DA 1CHOG 2BX4A 3LGIA 1C5RA 1MTUA 1GI9B 1KDQB 3BTTE 1EPTB 2FI5E 1C5SA 2WPKS 2QIQA 3UWIA 4AZ2B 1E36B 1V2JT 2PW8H 1QRZA 1ELCA 3BV9B 2AIPA 8KME2 4MNYA 1EB1H 1MZDA 1ELBA 4HZHA 2OC7A 2QXGA 1P11E 2FOBA 1O2TA 2F9NA 3TU7H 2BD8A 4THNH 1QQ4A 3BSQA 4JK6A 1HAOH 4Y76A 1GBCA 2P93A 4OS5A 3A7VA 3AAUA 3DD2H 3F9EA 5H4IB 1KXBA 4J1YA 1P02A 2HRVA 4HFPB 1AVGH 1O2SA 2ZA5A 4CRCA 1A0HB 1EATA 1SLWB 3RMMH 1SI5H 2JH5D 2FOAA 1RS0A 2OCVB 2GCHG 1A0LA 3FP8E 1XUFA 1G3CA 2H2ZA 1GMCG 3LGYA 4D7GA 3IG6B 1WQSA 1GHVH 4Q2KA 1JWTA 4YESB 1GBLA 2BXTH 3K6ZA 3M37A 5FPTA 1KXCA 5HXFA 1GHZA 4J2YB 2BDCA 1VJAU 1NT1A 1PQ8A 1LVBA 1NFXA 1T8LA 1NZQH 1HBTH 1O0DH 4IN2A 3RLYH 3M35A 1QURH 4FVBA 3BN9A 4Y10E 2ZTYA 2AGEX 1WTHD 3A7TA 1NRPH 1DWEH 2QXIA 5FPYA 1YCPK 4ABBA 3MU4A 3BTGE 3RXMA 2WV5A 5CHAC 2GMTC 3S69A 4YTAA 2TRMA 3LC3A 4CRGA 1HAVB 1ZGVA 2P8OB 1TYNA 5GWZA 4BAQB 3HK3B 5FCRA 1SGFG 1GCDA 3EA8A 5GCHG 1UTQA 1BUIA 1O2HA 3RXLA 2GDDA 1DM4B 2FI4E 4FUEA 2VVVA 2ZCKP 3FFGA 3PYHA 1GVKB 4U32A 5ABWA 1G30B 1GJ7B 2Q1JA 4RKJB 3FP6E 1IOEA 1FONA 3RXSA 3NCLA 4XBBA 1RFNA 3RU4E 1K21H 1HLTH 4KGAA 2B0FA 1AZZA 2O8WA 1DPOA 1XUHA 2FXRA 3LC5A 1KLJH 1KXDA 3RMOH 2P94A 1F5LA 3L3TA 3E1XB 3ZZ5A 4X6OA 3ITIA 3NPSA 2Y5GA 1O5EH 3ATMA 3U8OH 2BDAA 1L4ZA 1YM0A 4AFQA 1DSUA 1Z71A 1L2EA 2AIQA 2QCYA 2TIOA 1C1MA 2Z9GA 1ZMJA 5JBCS 1DX5M 1FPCH 1HAXB 3K65B 4TWYA 4PROA 3TVJB 1LPKB 1W2KH 2CF8H 3M61U 2Z9KA 3GICB 3KHVA 1E35B 2ZF0H 4YM9A 1MMJN 3F9FA 4NIYA 1MQ6A 1O3DA 2ZDVH 3KCGH 1JRTA 1TMUH 1IQEA 2ZNKH 5E0JA 1GGDC 2OC0A 2ANMH 2H5DA 3LT3A 1NS3A 4H4FA 2WPHS 2GKVE 2PKSB 5DJ7A 4BOHA 1ELEE 3VGCC 1GVZA 3SNCA 1SG8B 4IMZA 5EXMA 3LGTA 2NU2E 4SGBE 3LGVA 1C1TA 1BITA 1DUAA 1D6RA 1S85A 1FY5A 2YOLA 1LQDB 3KIDU 3UNQA 2G4UA 1C1SA 5C5OA 1AMHA 1WQVH 4WMFA 5JDUB 2AS9A 2FWWA 2FOCA 1FDPA 2BLOA 1H4WA 2R3UA 3A84A 4YLQH 1LCYA 1TNIA 1GI8B 2FO9A 2ODYB 3RC6A 1O2YA 5JPMH 2F9OA 1C5XB 1AQ7A 3EAJA 1A5HA 2HPPH 4Y7BA 1O31A 1FXYA 4RN6A 4WXIA 3A88A 4YT6H 3U9AH 1N8OB 1V2RT 4IN1A 2Y80A 1Y3WA 1YPGH 4OS6A 2EC9H 1UTPA 4FU7A 1KSNA 1AWHB 3URCA 5T6GA 1HAYB 2XCNA 3ZV9A 3SZNA 3UQVA 3D23A 1HIAA 1FNIA 3SU3A 1F5RA 1GJCB 1TPAE 1C2EA 1HAGE 1K22H 1GWAA 2R3YA 3BTME 4MDSA 4Y8XA 1EZSC 3RXEA 1AFEH 2ZTZA 3K2UA 1FY3A 1HJAB 5EODA 3PMBB 2A7CA 1QIXB 2VIVA 2ZGJA 2FYRA 3S7KB 1AI8H 1LVMA 1SMFE 1C2JA 2BLQA 3S9CA 9ESTA 2A5IA 5DP5A 3STIA 5HMAA 1BTUA 3R3GB 1FZZA 2BLWA 2BQ7B 1L1GA 1ZJDA 1C1OA 3A8CA 4X1SU 2ESTE 2J2UA 1NRQH 1GI2A 5EU8A 4BAHB 3D62A 1WTGH 3MYWA 1ESBA 1GMHF 2GZ9A 4K1SA 3LH3A 4LK4A 3PROA 3A81A 4MTBA 1DXWA 2GCTC 1Z6EA 1F7ZA 1JBUH 1O32A 1OWEA 4IGDA 5F8XA 2FODA 5F8ZA 1CGIE 1FJSA 2ZDNA 5IYTA 1VGCC 1YBWA 3QZRA 3LOXA 3Q3YA 1Z7KA 1O2PA 3A7ZA 2ZHDA 1TGSZ 4AGKA 4BANB 2F9PA 1SGQE 3P8OA 3A83A 2D8WA 1ANCA 2Q6GA 1F0SA 1MTSA 1NU7B 1AB9C 1GBEA 1H8DH 3BTDE 4IW4E 4NA9H 1UK4A 3PWBA 2ANKH 1K2I1 1P06A 5DO4H 1FAXA 2IJOB 4I8HA 1ZLRA 1N1LA 1NC6A 1GJ9B 2V3OH 1PQ5A 1XUGA 2VWNA 2FLBH 3HKIB 4INKA 1NU9A 3CS7A 2P59A 5TCCA 4D9QA 4XSKU 1GJBB 1SLVB 1Q31A 4Y71A 3SU2A 2FX6A 2FLRH 3MOCA 1GJ8B 4DURA 2OP9A 3ZZDA 1O3HA 1DT2A 3D65E 4ZH8A 1QA7A 1TNJA 2ZQ2A 1V2WT 1BQYA 4Q7YA 3P6ZB 4MG3A 3TPIZ 4KELA 1ARCA 1O2WA 1CBWB 1IAUA 1QJ1B 3TIUA 4NGAH 2AGGX 3M3SA 2ZDLA 1GHWH 4O3TA 5E8EH 1QBOA 2IOTA 4K2YA 5JBBS 3SJOA 2H9TH 2KAIA 4X1QU 1TB6H 1FY4A 1FI8A 1OYTH 3PMAB 3SU6A 1P12E 3N7OA 3SGQE 1ZHRA 4ZMAH 2FOMB 4UFDH 1XUIA 1P10A 1FPHH 1GPZA 2ZGHA 1OWKA 1PQAA 2OQUA 1F2SE 3QGJA 1S5SA 2ZHEH 4TPYA 3BG4C 3SNAA 1MAYA 2HNTC 3KL6A 2FOHA 1U6QA 2JETB 3SBKA 3SV9A 5ETXA 3ESTA 1EJNA 1ZTJA 3U69H 3GYLB 5A0BA 4A92A 4D9RA 3PLPA 1O3CA 1MCVA 1GI4A 4JYTA 1UVUH 1O5GH 2ZP0H 3ZV8A 2OC1A 3V3MA 1YKTA 2FOFA 4OS7A 4BXWA 4MNWA 3BTQE 4UDWH 2O8TA 4BTTB 2ZWLH 4AFZA 2FMJA 1CA0B 1VITH 2BTCE 3O8DA 1P57B 2XXLA 1A0JA 1HB0B 1LDTT 1F0RA 1GCTB 3SQEE 2FDAA 4MNVA 3BIVH 1G3DA 3BTWE 1BOQA 1UCYE 1C1QA 4X2XA 2B9LA 3Q3XA 5ESBA 2XWBI 1C5TA 4GHQA 1Y3YA 1ZHPA 1L0ZA 1O2ZA 1C5LH 1EPTC 1VJ9U 2STAE 4NFFA 1MBMA 2R0KA 1G3EA 5FXLA 1O2UA 2GT7A 3SU0A 5GIBA 1DICA 1DWBH 1GHBF 3GY3A 1V2PT 1GBHA 4ABGA 1Y8TA 3DHKH 1Y5BT 1S0RA 3I78A 3MFJA 3ZVFA 4DGJA 2DE8A 3UY9A 1LPGB 1LHFH 1TRNA 1NFWA 2J34A 1MH0A 1O5DH 1K1PA 2P95A 4BAOB 3SW2B 2PSYA 4KTSA 1TFXA 4TY7A 2O9QA 1WUNH 1ZZZA 4D7FA 4GCHF 1OXGA 4I8GA 4UD9H 1O2GH 2OC8A 1EZQA 2I6QA 1MBQA 2VWMA 3SHCH 1YLCA 1DXPA 1Z6JH 2BY5X 1Q3XA 3U1IB 3QX5H 1A3BH 1BA8B 1CHOF 1GI3A 1HRTH 3SOSA 5BPEA 2PKAB 3GCTG 1VITG 5C1UA 1P05A 5E0HA 4ZHAA 1UTJA 3SV7A 5A0AE 2F9BH 2GZ7A 4ASHA 3M36A 1QHRB 5C20A 1RIWB 2GZ8A 1TGBA 5AVDA 1W13U 1ZTLA 2W26A 1MKWK 4K8YA 5AF9H 3RU4D 1J17T 3KNXA 2HLCA 2P8OC 3SU1A 3SU5A 3F1SB 4AX9H 3SUGA 3OYPA 4WH8A 1QL8A 1WAYB 4NFEA 2G51A 2AH4X 4GLYA 4OGXA 4Z0KA 3VB6A 1C2FA 1JMOH 2ZDMA 1O3JA 2SGPE 7LPRA 5K0HA 3O8BA 2GCHF 2Z7FE 3FZZA 2OBQA 1UHBA 3UR9A 1IHSH 1GMCF 1TNGA 4ZAEA 4Y8ZA 1FY8E 3RLWH 3HGPA 2UUJB 4X6NA 1NPMA 1C5QA 3CS0A 4X8UH 3SHAH 2TGPZ 4RSPA 1A1RA 3RXBA 4DCDA 3MNBA 2BY8X 4YT7H 1GBDA 5J4SA 2O8MA 4B74A 4NWLA 2C8WB 2J9NA 3A8AA 4QT8C 2ILNA 3RMNH 1Z8RA 2Z3EA 1QNJA 3LU9B 4TYDA 1UK3A 3LIWA 1GHBG 1C2IA 2A2XH 3GY6A 1D3TB 1AFQB 1P09A 1BRUP 1SQAA 1GG6B 1SLUB 1O5FH 4X8VH 1AE8H 1EOJA 1DVAH 1AUJA 3LGUA 1LMWB 1BJVA 3CP7A 4ABFA 5GCHF 2UUFB 1SGTA 2BDYA 1OPHB 3KN2A 5LPFA 1K1JA 4DT7B 3GOVB 3K6YA 2Z3DA 1P3CA 3EYDA 3DFJA 1S82A 2FTLE 4ABIA 3E0PB 5C3NA 2CGAA 3VXEH 1RGQA 1O3GA 4X8TH 4IMQA 2TGAA 5I25A 4JZ1A 2FS8A 5EQQA 2PKSC 1P2NA 1ANBA 4GSOA 4U30A 3EQ0H 4X1RU 3LONA 2FYQA 1V2VT 1GHXH 1NRNH 4XOJA 4NA7A 4ESTE 3FP7E 4X2VA 3UNSA 2V6NA 1C9TA 3B23B 4A1XA 1DLKB 2Z9LA 1O38A 4JYUH 1KLTA 3ZZAA 1PPZA 5DP7A 1ANEA 1SOZA 2A31A 2FP7B 3D49H 1DY9A 2A5KA 3TITA 1QA0A 1B0FA 4NZQA 1P0SH 2NU1E 3MWIU 4K69A 1FAKH 4KP0A 3T28A 2ZGBH 3M7TA 1K1IA 1OWJA 1C2GA 1ELDE 3RXCA 1OP0A 4I8LA 3U1JB 1O3AA 1FQ3A 1GI5A 1ETRH 5T6DA 1C5YB 1UTMA 4FUDA 4FUCA 3MU8A 1F92A 1QJ7B 1GJ5H 2LPRA 3UREA 6ESTA 4AG1A 3UPEA 4K60A 1N8OC 3QK1A 1MTNB 2OXSA 1JXPA 3EE0B 3V12A 3A85A 4IC5A 1C1NA 2A0QB 1TX6A 1XVOA 4FUBA 2BM2A 2ZHQH 5L30H 2RA3A 3OSYA 1BTXA 4ABDA 2NWNA 1JIMA 1E38B 1O5BB 3AAVA 3A86A 2YNBA 2ZFQH 1TA2A 2J38A 1IQHA 4CR5A 3MO6A 3G01A 3P17H 1HJAC 3PTBA 1N6YA 3TJOA 2JKHA 1P01A 4NSYA 1JIRA 4OGYA 2PTCE 1Z8IB 7GCHG 4X6PA 1F5KU 1O2JA 4ISNA 4B2AA 3KEEA 1SGEE 1P03A 6CHAB 1MAXA 1K1NA 4MPUA 5FHTA 2FS9A 2XBVA 3FAOA 5JBAS 5EOKA 2UWPA 3EA7A 1BMNH 2AERH 1T31A 4YOGA 3CENA 2AYWA 4NIWA 1AD8H 1TPSA 1WV7H 3GYMA 3GCHB 1T4UH 2A2QH 2W3KA 2O8UA 5DP3A 4UONA 1Z8GA 2WPLS 1SGIB 4E05H 3GISB 1TRYA 1DDJA 4I32A 1PPCE 1QR3E 3MNCA 3E8LA 3QDZB 3DA9B 4A7IB 2AMQA 4NIVA 5C5NA 1TMTH 3MH4A 3MTYA 1GL1A 1UMAH 1EAWA 1HNEE 4XBDA 2VWOA 2BVRH 2BY6X 4CRFA 1V2MT 1SGYE 3U8RH 1TBQH 5EGMA 2ANYA 2QGRA 3RC4A 1GMDG 2BYAX 3TGJE 1GBTA 3SGBE 3SV6A 1S0QA 2FM2A 4B2CA 1ELVA 5HM9A 1HGTH 1O30A 1OSSA 4I7YH 1AU8A 1YP9A 3P70B 5ESTE 1W11U 2PLXA 2OLGA 4YLUA 2Q6FA 3VB4A 1YPLH 2WUCA 3RXIA 1QRWA 4TWWA 3TK5A 3TLOA 1GBKA 4U01A 1BB0B 3NWUA 3V7TA 3ZZ9A 1BRCE 1KIGH 2ZU2A 2FESH 2H5CA 5EQSA 3RXHA 4UE7H 1Q2WA 3RXTA 3GY8A 1LO6A 2RG3A 2WUBA 1W0YH 2HVXA 1CBWC 1GHAG 2PHBA 1IQKA 3AW0A 1LVYA 1O2QA 3URDA 1SPJA 2A1DB 3C27B 2J4IA 3UTUH 3BEFB 1C1VH 4BNRA 1L4DA 1KTSB 1SGFA 1C5NH 1AKSA 1DANH 2XBXA 1L1JA 1W14U 1YPKH 3SJ8A 2ZC9H 5EQRA 2P3UB 1KLIH 4JZIA 5HGGA 1O37A 3TJUA 1H1BA 1AVXA 2QYIA 1GHYH 1SGPE 1IQIA 1HXFH 2GT8A 3EGKH 3HPTB 2ZU1A 4BAKB 1K1LA 2BOHB 1T4VH 4K3JA 4DVAU 1HPGA 3ZVEA 1D3QB 5SGAE 1TGNA 2JETC 1DWDH 4NSVA 1EP5A 2XC5A 1BTHH 1G2MA 2QAAA 2VU8E 5C67A 1UTOA 2HNTE 5FBEA 1TLDA 2ZU4A 4JMYA 5EPYA 3F6UH 5A2MH 3ATWA 1ZSKA 3M7UA 1CA0C 2Y6TA 3NXPA 3Q00A 2VH6A 2WPIS 1XUJA 3A89A 1P2QA 3DT0H 2OQ5A 4H6TA 1MTWA 3TH3H 1S6HA 1GCTC 3ATLA 3E90B 3E6PH 3SUEA 1GBFA 2G55A 2F91A 1TX7A 3BTHE 5E2OA 4DJZB 2ZQ1A 1P2IA 1Z8JB 3IITA 3PLBA 5A0CA 1QB9A 1UCYH 1P2KA 1PYTD 1ETTH 3E0NB 1AHTH 4OS4A 4X0WU 4YZUA 1QB6A 3ZVCA 5FX6A 1O3IA 1C5VA 4FXGH 1RTLA 4MLFB 4FU8A 8GCHG 3PMJA 4RKOB 1BBRK 5DP8A 1XXDA 4Y0YE 1SHHB 5CHAB 1V2KT 1SBWA 3M3TA 1XVMA 1Y3UA 1DE7H 3A80A 4AFUA 2A4QA 1O2XA 1YCPH 1K1OA 1KDQA 5EXLA 1EPTA 1OWDA 1TE0A 1S6FA 4ABAA 1BRAA 3OY5U 2AFQB 3F68H 2BD9A 1Y5UT 1FIWA 4ZHMU 1PQ7A 1HFDA 1BTPA 1TX8A 3M5OA 1ELFA 3JZ1B 3RXDA 1HAHH 2BDIA 3A8DA 5E2PA 1P04A 2ZPSA 6LPRA 3U98H 3ENSB 1C1WH 2O8LA 1J9CH 2VVCA 1K9OE 4JCNA 2Z6BD 2BQWB 1BMLA 1C2MA 2J94A 5FX5A 3MH6A 2ZCLP 3TH2H 4DG4A 4NWKA 5TJXA 1GBBA 2F9UA 1C4Y2 3H7OA 1RTFB 3BTKE 1S84A 2PFEA 2CN0H 3KQEA 1MUEB 3M5LA 2I6SA 2D2DA 1G37A 8LPRA 4YOIA 2ZFSA 4WF8A 1CGJE 3V13A 3RXJA 1D4PB 2G00A 5IDKA 2OINA 1UJ1A 1EP6A 1A7SA 2QC2A 3E91A 1LHGH 1ZPCA 1P3EA 1JOUB 2VIOA 2R2MB 4Y79A 1MKXH 4Y6DA 1T7CA 1TBZH 1MD8A 1ZOMA 2QV1A 4GVUA 2G52A 3PO1B 3RXRA 1ETSH 2FZZA 4UEHH 3MH5A 1V2QT 5I46H 2XRCA 4A1TA 1OYQA 5T6FA 4A1VA 1B5GH 1HAVA 4ZXXH 4NCYA 3SI3H 4ISHH 3BEUA 2A4OA 1DLEA 4UFEH 5DP6A 3V0XA 3RXPA 5F6MA 2AMPA 3JZ2B 2BY7X 4ZXYH 3ZVDA 1NO9H 2CMYA 1XMNB 2PWXA 4Q7ZA 1DSTA 3SORA 5LPRA 1ELGA 4I8JA 1O2RA 2FOGA 2P3FH 4IBLH 1CO7E 3GCTF 4CHAB 1VITF 3KQBA 1HAIH 1PPBH 1O3NA 1THRH 1BIOA 2BB4A 1LPZB 1TOCB 1NRSH 1K1MA 1G36A 1O2VA 2XW9A 1AFQC 3QWCH 4D76A 2F3CE 1GG6C 1A2CH 2R2WU 2UUYA 3EA9A 4CRDA 1DOJA 5GDSH 2QF0A 2R0LA 4KKDA 3ZVAA 3UUZA 3H7TA 2GP9B 1H8IH 2UUKB 1FMGA 7ESTE 4AB8A 1EQ9A 1Y3VA 2FI3E 1HV7A 2LNCA 1W0ZU 1UVOA 1VR1H 3GY5A 3QO6A 1O3LA 5A8YA 2ODQA 5LPEA 1AWFH 1UTLM 2BD7A 2Z9IA 2VIDA 3MU5A 4B75A 4FUIA 3BTFE 1EAIA 1V3XA 2UWOA 1JRSA 4WMDA 2ZO3H 1O3FA 3RC5A 1SGNE 1V2TT 5GXPA 1INCA 1QL9A 2WV4A 1SOTA 2D26C 1LVOA 4ZKRU 1BMAA 1NROH 3A7YA 2SNVA 2FEQH 4HTCH 4WXVA 1A46H 3P8FA 3QLPH 4CRAA 1QL7A 1W7XH 1TBRH 1BRBE 4NZLA 3GCOA 4TY6A 1NY22 4KTUA 3SQHE 1OP8A 1O3EA 2SGDE 1QB1A 3VB3A 4X6MA 1J8AA 2D1JA 4CBNA 1D6WA 3ZZCA 1G2LA 3PTNA 2ZZUH 2VGCB 1TGCA 4Y8YA 2QXJA 1C1RA 4VGCB 4FUHA 1E37B 1HXEH 1RJXB 1VCPA 2BZAA 4KTCA 2W7SA 1TABE 2IN2A 3B9FH 4ISLA 2NU4E 1GI1A 2SGEE 1YPEH 3L33A 1MTNC 4ZUHA 1CA8B 2Y7XA 4FVDA 3AASA 4INHA 2BOKA 3EDXB 3MU0A 4ZKOU 3PM3A 2A32A 3KQCA 4AN7A 2HPQH 1IQMA 2ZIQH 3SGAE 2CJIA 3BIUH 1QJ6B 2BD2A 3S7HB 1P2JA 1EUFA 2OD3B 1TNLA 5GPIB 2J92A 1ZMNA 3OX7U 1GI0A 2G4TA 2BMGB 3GY2A 3SUDA 3L6PA 1V2NT 2BD3A 4DW2U 1FN8A 5J4QA 1GI6A 2BDGA 1Y3XA 2ZGCA 2C8YB 3T62A 1GBMA 1CVWH 1ESTA 1O3PB 5AHGH 4H6SB 1D9IA 1O5CB 2QN5T 3KGPA 1HYLA 4LZ4B 3SO3A 3UOUA 4I8KA 1IQNA 4ABEA 2BQ6B 1O2KA 2BDHA 1A61H 5JYIA 2RA0A 1T8NA 4XE4A 3VB5A 1TGTA 1V2LT 2W7UA 2XCFA 3ELAH 1TNHA 1ZRBA 8ESTE 1ZPBA 1S83A 1C5WB 1HAZB 1GDUA 1O2IA 2CHAB 2HOBA 3RXUA 5A09A 1BDAA 1X7AC 1SVPA 3SJ9A 1SB1H 1IHTH 4CH2B 4Z6AH 2QA9E 7GCHF 2WYGA 1PPGE 1MQ5A 3ZZ8A 4HI3A 4YO9A 1MD7A 1HIAB 2C8ZB 1TQ0B 5F03A 2QY0B 2FTMA 3A8BA 4R8TB 1BTZA 4HGCA 5EG4A 5TCAA 4X1PU 1DITH 1ZPZA 1C4V2 1TONA 2AMDA 2FPZA 3SUFA 1AUTC 2A7HA 3F9HA 4CR9A 1CQQA 1WU1A 1UO6A 1VZQH 2XBYA 6GCHG 1QGFA 1AE5A 3HGNA 5FBIA 3NUMA 1RD3B 4UFFH 2ZDKA 3AW1A 1W12U 3SJKA 1GMDF 1V2UT 1LKBA 1PYTC 1B7XB 1FV9A 5C2ZA 1BBRE 1UVPA 2GX4A 2HNTF 4XBCA 1XXFA 2ZPRA 1QCPA 1F0UA 1TPOA 3TJVA 1C2HA 2K1QA 1EOLA 4B73A 1P2OA 1D3PB 2PSXA 1FIZA 1OS8A 3OU0A 3UR6A 3MI4A 3NZIA 4JZEH 1W10U 2RCEA 1UK2A 1N6XA 1GDNA 2Y82A 1T8OA 3UNRA 2EA3A 4ZKSU 1PPFE 2ZTXA 3DFLA 4Q80A 1SR5C 3RUOA 3UQOA 1GHAF 3S9AA 3UWJH 1FN6A 1M9UA 1O2NA 3KF2A 2F83A 1K28D 1QFKH 4FU9A 3RXVA 2AEIH 2PTNA 3VFEA 5DGJA 4E06H 1W3CA 2VWLA 2P16A 2CXVA 1UCYK 7KMEH 1C5PA 1P2MA 3VEQB 1C4U2 1ZGIA 2A45B 1WBGB 2NU0E 1TOMH 3RM2H 3ZYEA 2ZFFH 2DUCA 2ZCHP 5CMXH 2A4GA 1LKAA 3HK6B 3ZZ6A 1YLDA 1HDTH 5EPNA 1FUJA 4DY7B 4BXSA 3RXFA 3TK6A 2Z3CA 2KAIB 1IQFA 3TGIE 1FY1A 1ANDA 1PPHE 1HJ9A 2ALVA 2C4FH 5BRRE 3SNEA 1MKWH 2VB0A 3ODFA 1OWHA 3S0NA 1O3OA 1NESE 2VVUA 1H9HE 1NRRH 4LXBH 4CRBA 5C1YA 3T25A 1DY8A 3ATIA 4I33A 1XM1A 1LHDH 5A8ZA 4BTIB 1YGCH 1MU8B 2WPMS 2BD5A 4OS1A 2Q6DA 1ACBE 1V6DA 1QRXA 3MHWU 1TA6A 2PUXB 1ZSLA 1L1NA 2HGTH 1BCUH 4WY3A 2ULLA 1J14A 1G32B 3PWCA 3TJNA 1SGCA 1CE5A 4TPIZ 1P9UA 1GJDB 2Z9JA 3RXAA 3SI4H 4K1TA 2ANWA 4WJG2 5F8TA 3W94A 5DP9A 8GCHF 2B7DH 1SSXA 2XBWA 3TNTA 3BF6H 1CHGA 2SGAA 1QQUA 3RP2A 3SN8A 3F9GA 1SGRE 3TK9A 1MKXK 2Z94A 1QBVH 1YPHC 1DS2E 1GVLA 1NM6A 2PKAA 1BZXE 2TGDA 5FCKA 1S81A 2GD4B 1HCGA 4NIXA 1LHCH 1TNKA 1BTWA 3QTOH 5GJ4B 4ZHLU 1SC8U 3PMHB 3QN7A 1W7GH 2G5NA 5DK1A 3M5MA 1A3EH 3PO1C 1ARBA 1RTKA 2Y7ZA 4GHTA 1AZ8A 2ZPQA 2ZGXH 1B0EA 2V35A 4Y0ZE 2M5TA 3OTJE 1ELAA 2ZU3A 1NFUA 1MZAA 1A5IA 2VJ1A 1TMBH 1ID5H 1O2MA 4Y11E 2DE9A 1W8BH 1C1PA 2H9EH 4B71A 5DP4A 4UFGH 5C1XA 3S9BA 1GJ6A 2TGTA 3LDXH 1QTFA 2G5VA 3T27A 3FZDA 3ZZ7A 2XNIA 1SFQB 4CHAC 3FANA 3MNSA 1ZRKA 4M7GA 2FX4A 1IQJA 1ZHMA 4X2YA 3U8TH 3TH4H 2C8XB 3UFAA 5DG6A 2EEKA 3WY8A 1C9PA 4X8SH 3TNSA 2VINA 1EASA 4XDEA 4JK5A 2BDBA 1H9LB 1EX3A 2C90B 2GV7A 5DPAA 1UVTH 3ATKA 4A6LA 1O34A 3HATH 3SV8A 3RXGA 4D8NA 3M5NA 4I31A 1SHYA 1VCQA 2JH6D 3ODDA 1EJMA 4K8BA 4AYYB 2CF9H 5B6OA 3A7WA 2TBSA 2QXHA 4IS5A 2VIWA 3ZYDA 2WINI 1RXPA 1TAWA 3M3VA 2GDEH 2B5TB 4WWYA 2PV9B 4LZ1H 4O03A 4CREA 3E16B 4U2WA 3R0FA 4GAWA 2GMTB 1EZUC 1KYNA 5JB9S 2XYAA 3RM0H 1E0FD 1G3BA 1SQTA 3BEIB 1EAXA 1C5UA 2C93B 5LH8A 3MMGA 4ZROA 1UHBB 5A8XA 1O5AB 5EW1H 4E7RG 2XC0A 1LTOA 2A4RA 4OS2A 1FLEE 1Y59T 2STBE 3BTEE 4FUFA 1XKBC 3VPKA 1XKAC 1OKXA 3P8GA 1DFPA 1H9IE 3HKJB 1O39A 1YF4A 1T8MA 5HM2A 1P8VC 2Y5HA 2VGCC 1QBNA 1LHEH 3VXFH 3E3TA 3MO3A 4VGCC 4X1NU 3M7QA 5PTPA 2PGQB 3STJA 2R9PA 1Z1IA 4B1TA 1GL0E 4LOYH 1GJ4H 1WOFA 4YOJA 1HAPH 3LPRA 3IWMA 1Z1JA 2ZU5A 1P9SA 3GY7A 3UOPA 3SU4A 5CE1A 3QGNB 1KXAA 1NTPA 5K7RA 1O3BA 5E0GA 3QTVH 2G8TA 2BVXH 3LJOA 2BX3A 2V0BA 1RIWC 3GDSA 3PB1E 4ABJA 5HYOA 3VB7A 2CV3A 1OWIA 1TQ7B 2H1UA 5AFYH 5EXNA 1KY9A 3A87A 2F9VA 1YC0A 4AB9A 1EZXC 3O8CA 2Y81A 1GGDB 1WSSH 1KXEA 2BVSH 2UWLA 1C2LA 3VGCB 3LH1A 5AFZH 1XX9A 3KQDA 2GV6A 2RDLA 1PPEE 4K1EA 2ZEBA 4DIIH 1AN1E 4O9VA 3LKWA 3SJIA 2XTTB 3RXQA 1ZMLA 3PV4A 2HALA 2ZFRH 2IPHA 3Q77A 2VIPA 1WYKA 1PJPA 1ELTA 2W3IA 3Q76A 3SNBA 1KXFA 5DKMA 1GBIA 1KTTB 1SFIA 3C1KA 1ZYOA 1GDQA 4R0IA 3RDZA 2SFAA 1C5ZB 1G9IE 2BD4A 2FOEA 4CH8B 5FAHA 2AGIX 1EB2A 2HWLB 1MCTA 2CHAC 1GMHG 1GBJA 3K9XB 1ESAA 1C5OH 5L6NH 1BHXB 1GJAB 4ABHA 4MPWA 1PFXC 2XWAA 2ZKSA 4WMEA 1D3DB 3ZVGA 1HUTH 3AVZA 3P8NA 4H42U 2GVFA 1O36A 3GDUA 4MVNA 1IQGA 1O35A 2OTVA 2V3HH 2VNTA 2ZFTA 2Y5FA 3RMLH 3SV2H 3TGKE 5T3HA 1CSOE 1ABJH 1NFYA 5JBTA 1BMMH 4GPGA 4AOQA 3W95A 4FUGA 2ZG0H 1WCZA 1LQEA 2A5AA 2XC4A 2OBOA 3P92A 4DIHH 1TWXB 3RXKA 4Q7XA 5L2YH 2BZ6H 5LGOA 1OOKB 3PLKA 4IC6A 1THSH 1ZTKA 1ORFA 1ZR0A 1AGJA 2OUAA 4GUXA 4DOQA 1SGDE 2GCTB 3ZZ4A 1OP2A 2TPIZ 2BHGA 1BBRH 4JZDH 1YYY1 1CT2E 3UIRA 1V2OT 4MNXA 4INLA 4WVPE 1O2LA 3B8JA 2EI6A 3P95A 4AYVB 2FIRH 2BLVA 4X2WA 1YCPM 1BHXF 1VGCB 1O3KA 3A82A 4O3UA 3H5CB 4AORA 5JB8S 4MPVA 1YPMH 1J15A 2GTBA 1NN6A 4JYVH 2WYJA 1MTVA 3I29A 1C5MD 4BAMB 1AB9B 1MU6B 3ZZ3A 1A5GH 4XFQA 2A7JA 3FVFB 2SGFE 3RU4T 1UVSH 4B76A 1V2ST 6GCHF 1ZSJA 4F4OC 2GGVB 5L2ZH
chains in the Genus database with same CATH superfamily
4AC9A 1TPPA 4I86A 1UTNA 2EY4C 2JH0D 2ZECA 2ODPA 3GCNA 2SNWA 2ZFPH 1QY6A 1C2KA 4B2BA 2W5EA 1DUEA 2OK5A 3O8RA 1E34B 2WPJS 3MO9A 5FPSA 2VH0A 1CT0E 3T29A 1EKBB 4MPXA 3LJJA 3MU1A 2G81E 3MNXA 1TRMA 1OX1A 4AGJA 4JZFH 2B8OH 2YMSB 1TIOA 3Q3KA 1CGHA 2ZHFH 3U28C 6CHAC 1O2OA 5EW2H 1HJ8A 3T5FH 1SQOA 5CDFE 2SGQE 2ZDAH 1O3MA 1VCWA 2EI8A 2EI7A 2NU3E 1AKSB 3GCHC 2ZI2H 5G4BA 2EQNA 1BT7A 2IPQX 1A4WH 4MQAA 2BY9X 4ISOA 1ABIH 1F0TA 2J95A 4F49A 3T2NA 3LGWA 3FO8D 4Y7AA 4E7NA 1RRKA 3BG8A 3QZQA 3ZZBA 4AFSA 4ACBA 1C1UH 1BTYA 4FUJA 1THPB 2THFB 3I77A 1AVWA 1UTKA 2ALPA 1ZJKA 3BG4B 3DUXH 5DN6D 1GBAA 4CBOA 4AG2A 4A5TS 4SGAE 1EJAA 4BTUB 3GY4A 2PR3A 2QF3A 2H6MA 3GDVA 1TALA 4O97A 1O33A 1AY6H 1AO5A 1CU1A 1T32A 2ASUB 5EJ1A 3QUMP 1Y5AT 1EAUA 1EXFA 3NK8A 1XUKA 1IQLA 1YPJH 4K5ZA 1DWCH 2PUQH 3NKKA 2BXUH 4WH6A 2ZHWH 4ZKNU 9LPRA 3MH7A 2YNAA 1J16A 1GI7B 3ZVBA 3FN8A 4ISIH 1YPHE 3RXOA 4NG9H 3T26A 2XNDD 1CT4E 1BJUA 2P3TB 4NA8A 4GCHG 1SLXB 3SNDA 2KR7A 2PGBB 1SL3A 2K8IA 2C3SA 2VIQA 3A7XA 3OY6U 4XRNA 2H9HA 1AIXH 1C2DA 1CHOG 2BX4A 3LGIA 1C5RA 1MTUA 1GI9B 1KDQB 3BTTE 1EPTB 2FI5E 1C5SA 2WPKS 2QIQA 3UWIA 4AZ2B 1E36B 1V2JT 1FX0B 2PW8H 1QRZA 1ELCA 3BV9B 2AIPA 8KME2 4MNYA 1EB1H 1MZDA 1ELBA 4HZHA 2OC7A 2QXGA 1KMHB 1P11E 2FOBA 1O2TA 2F9NA 3TU7H 2BD8A 3PRDA 4THNH 1QQ4A 3BSQA 4JK6A 1HAOH 4Y76A 1GBCA 2P93A 4OS5A 3A7VA 3AAUA 3DD2H 3F9EA 5H4IB 1KXBA 4J1YA 1P02A 2HRVA 4HFPB 1AVGH 1O2SA 2ZA5A 4CRCA 1A0HB 1EATA 1SLWB 3RMMH 3MQKC 1SI5H 2JH5D 2FOAA 1RS0A 2OCVB 2GCHG 1A0LA 3FP8E 1XUFA 1G3CA 4P02A 2H2ZA 1GMCG 3LGYA 4D7GA 3IG6B 1WQSA 1GHVH 4Q2KA 1JWTA 4YESB 1GBLA 1W0KD 2BXTH 3K6ZA 3M37A 5FPTA 1KXCA 5HXFA 1GHZA 4J2YB 2BDCA 1VJAU 1NT1A 1PQ8A 1LVBA 1NFXA 1T8LA 1NZQH 1HBTH 1O0DH 4IN2A 3RLYH 3M35A 1QURH 4FVBA 3BN9A 4Y10E 2ZTYA 2AGEX 1WTHD 3A7TA 1NRPH 4B6FA 1DWEH 2QXIA 5FPYA 1YCPK 4ABBA 3MU4A 3BTGE 3RXMA 2WV5A 5CHAC 2GMTC 3S69A 4YTAA 2QE7D 2TRMA 3LC3A 4CRGA 1HAVB 1ZGVA 2P8OB 1TYNA 5GWZA 4BAQB 3HK3B 5FCRA 1SGFG 1GCDA 3EA8A 5GCHG 1UTQA 1BUIA 5HIYA 1O2HA 3RXLA 4RI0A 2GDDA 1DM4B 2FI4E 4FUEA 2VVVA 2ZCKP 3FFGA 3PYHA 1GVKB 4U32A 5ABWA 1G30B 1GJ7B 2Q1JA 4RKJB 3FP6E 1IOEA 1FONA 3RXSA 3NCLA 4XBBA 1RFNA 1WXRA 3RU4E 1K21H 1HLTH 4KGAA 2B0FA 1AZZA 2O8WA 2F4LA 1DPOA 1XUHA 2FXRA 3LC5A 1KLJH 1KXDA 3RMOH 2P94A 1F5LA 3F3BA 3E1XB 3L3TA 3ZZ5A 4X6OA 3ITIA 3NPSA 2Y5GA 1O5EH 3ATMA 3U8OH 2BDAA 1L4ZA 1YM0A 4AFQA 1DSUA 1Z71A 1L2EA 2AIQA 2QCYA 2TIOA 1C1MA 2Z9GA 5KGOA 1ZMJA 5JBCS 1DX5M 1FPCH 1HAXB 3K65B 4TWYA 4PROA 3TVJB 1LPKB 1W2KH 2CF8H 3M61U 2Z9KA 3GICB 3KHVA 1E35B 5IK2D 2ZF0H 4YM9A 1MMJN 3F9FA 4NIYA 1MQ6A 1O3DA 2ZDVH 3KCGH 1JRTA 1TMUH 3SZEA 1IQEA 2ZNKH 5E0JA 1GGDC 2OC0A 2ANMH 2H5DA 3LT3A 1NS3A 4H4FA 2WPHS 2GKVE 2PKSB 3H09A 5DJ7A 4BOHA 1ELEE 3VGCC 1GVZA 3SNCA 1SG8B 4IMZA 5EXMA 3LGTA 2NU2E 4SGBE 5FL7D 3LGVA 1C1TA 1BITA 1DUAA 1D6RA 1S85A 1FY5A 2YOLA 1LQDB 3KIDU 3UNQA 2G4UA 1C1SA 5C5OA 1AMHA 1WQVH 4WMFA 5JDUB 3CNRA 2AS9A 2FWWA 2FOCA 1FDPA 2BLOA 2F43B 1H4WA 2R3UA 3A84A 3FOAA 4YLQH 1LCYA 1TNIA 2JDID 1GI8B 2FO9A 2ODYB 3RC6A 1O2YA 5JPMH 2F9OA 1C5XB 1AQ7A 3EAJA 1A5HA 2HPPH 4Y7BA 1O31A 1FXYA 4RN6A 4WXIA 3A88A 4YT6H 3U9AH 1N8OB 1V2RT 4IN1A 2Y80A 1Y3WA 1YPGH 4OS6A 2EC9H 1UTPA 4FU7A 1KSNA 1AWHB 3URCA 5T6GA 1HAYB 2XCNA 3ZV9A 3SZNA 3UQVA 3D23A 1HIAA 1FNIA 3SU3A 1F5RA 1GJCB 1TPAE 1C2EA 1HAGE 1K22H 1GWAA 2R3YA 3BTME 4MDSA 4Y8XA 1EZSC 3RXEA 1AFEH 2ZTZA 3K2UA 1FY3A 1HJAB 5EODA 3PMBB 2A7CA 1QIXB 2VIVA 2ZGJA 2FYRA 3S7KB 1AI8H 1LVMA 1SMFE 1C2JA 2BLQA 3S9CA 3OAAD 2XOKD 9ESTA 3F0PA 2A5IA 5DP5A 3STIA 5HMAA 1BTUA 3R3GB 1FZZA 2BLWA 2BQ7B 1L1GA 1ZJDA 1C1OA 3A8CA 4X1SU 2ESTE 2J2UA 1NRQH 1GI2A 5EU8A 4BAHB 3D62A 1WTGH 2IJD1 3MYWA 1ESBA 1GMHF 2GZ9A 4K1SA 3LH3A 4LK4A 3PROA 3A81A 4MTBA 1DXWA 2GCTC 1Z6EA 1F7ZA 1JBUH 2K0QA 1O32A 1OWEA 4IGDA 5F8XA 2FODA 5F8ZA 1CGIE 1FJSA 2ZDNA 5IYTA 1VGCC 1YBWA 3QZRA 3LOXA 3Q3YA 1Z7KA 1O2PA 3A7ZA 2ZHDA 1TGSZ 4AGKA 4BANB 4ACAA 2F9PA 1SGQE 3P8OA 3A83A 2D8WA 1ANCA 2Q6GA 1F0SA 1MTSA 1NU7B 1AB9C 1GBEA 1H8DH 3BTDE 4IW4E 4NA9H 1UK4A 3PWBA 1WDIA 2VBCA 2ANKH 1K2I1 1P06A 5DO4H 1FAXA 2IJOB 4I8HA 1ZLRA 1N1LA 1NC6A 1GJ9B 2V3OH 1PQ5A 1XUGA 2VWNA 2FLBH 3HKIB 4INKA 1NU9A 3CS7A 2P59A 5TCCA 4D9QA 4XSKU 1GJBB 1SLVB 1Q31A 4Y71A 3SU2A 2FX6A 2FLRH 3MOCA 1GJ8B 4DURA 2OP9A 3ZZDA 1O3HA 2HLDD 1DT2A 3D65E 4ZH8A 2YMSC 1QA7A 1TNJA 2ZQ2A 1V2WT 1BQYA 4Q7YA 3P6ZB 4MG3A 3TPIZ 4KELA 1ARCA 1O2WA 3F0OA 1CBWB 1IAUA 1QJ1B 3TIUA 4NGAH 2AGGX 3M3SA 2ZDLA 1GHWH 4O3TA 5E8EH 1QBOA 2IOTA 4K2YA 5JBBS 3SJOA 2H9TH 2KAIA 4X1QU 4F55A 1TB6H 1FY4A 1FI8A 1OYTH 3PMAB 3SU6A 1P12E 3N7OA 3SGQE 1ZHRA 4ZMAH 2FOMB 4UFDH 1XUIA 1P10A 1FPHH 1GPZA 2ZGHA 1OWKA 1PQAA 2OQUA 1F2SE 3QGJA 1S5SA 2ZHEH 4TPYA 3BG4C 3SNAA 4Q4LA 1MAYA 2HNTC 3KL6A 2FOHA 1U6QA 2JETB 3SBKA 3SV9A 5ETXA 3ESTA 1EJNA 1ZTJA 3U69H 3GYLB 5A0BA 2AHME 4A92A 4D9RA 3PLPA 1O3CA 1MCVA 1GI4A 4JYTA 1UVUH 1O5GH 2ZP0H 3ZV8A 1E1RD 2OC1A 3V3MA 1YKTA 2FOFA 4OS7A 4BXWA 4MNWA 3BTQE 4UDWH 2O8TA 4BTTB 2ZWLH 4AFZA 2FMJA 1CA0B 1VITH 2BTCE 3O8DA 1P57B 2XXLA 1A0JA 1HB0B 1LDTT 2KCAA 1F0RA 1GCTB 3SQEE 2FDAA 3GS9A 4MNVA 3BIVH 3EE7A 1G3DA 3BTWE 5GNDA 1BOQA 1UCYE 1C1QA 4X2XA 5C0UA 2B9LA 3Q3XA 5ESBA 2XWBI 1C5TA 4GHQA 1Y3YA 1ZHPA 1L0ZA 1S6LA 1O2ZA 1C5LH 1EPTC 1VJ9U 2STAE 2KCYA 4NFFA 1MBMA 2R0KA 1G3EA 5FXLA 1O2UA 2GT7A 3SU0A 5GIBA 1DICA 1DWBH 1GHBF 3GY3A 1V2PT 1VKYA 1GBHA 3OFND 4ABGA 1Y8TA 3DHKH 1Y5BT 1S0RA 3I78A 3MFJA 3ZVFA 4DGJA 2DE8A 2J5UA 3UY9A 1LPGB 1LHFH 1TRNA 1NFWA 2J34A 1MH0A 1O5DH 1K1PA 2P95A 4BAOB 3SW2B 2PSYA 4KTSA 1TFXA 4TY7A 2O9QA 1WUNH 1ZZZA 4D7FA 4GCHF 1OXGA 4I8GA 3WWFA 4UD9H 1O2GH 2OC8A 1EZQA 2I6QA 1MBQA 2VWMA 3SHCH 1YLCA 1DXPA 1Z6JH 2BY5X 1Q3XA 3U1IB 3QX5H 1A3BH 1BA8B 1CHOF 1GI3A 1HRTH 3SOSA 5BPEA 2PKAB 3GCTG 1VITG 5C1UA 1P05A 5E0HA 4ZHAA 1UTJA 3SV7A 5A0AE 2F9BH 2GZ7A 4ASHA 3M36A 1QHRB 5C20A 1RIWB 2GZ8A 1TGBA 5AVDA 1W13U 1ZTLA 2W26A 1MKWK 4K8YA 5AF9H 5F53A 3RU4D 1J17T 3KNXA 2HLCA 2P8OC 3SU1A 3SU5A 3F1SB 4AX9H 3SUGA 3OYPA 4WH8A 1QL8A 1WAYB 4NFEA 2G51A 2AH4X 4GLYA 4OGXA 4Z0KA 2LELA 4P00A 1C2FA 3VB6A 1JMOH 2ZDMA 5C0TA 1O3JA 2SGPE 7LPRA 5K0HA 3O8BA 2GCHF 2Z7FE 3FZZA 2OBQA 1UHBA 3UR9A 1IHSH 1GMCF 1TNGA 4ZAEA 4Y8ZA 1FY8E 3RLWH 3HGPA 2UUJB 4X6NA 1NPMA 1C5QA 3CS0A 4X8UH 3SHAH 2TGPZ 4RSPA 1A1RA 3RXBA 4DCDA 3MNBA 2BY8X 4YT7H 1GBDA 5J4SA 2O8MA 4B74A 4NWLA 2C8WB 2J9NA 3A8AA 4QT8C 2ILNA 3RMNH 1Z8RA 2Z3EA 1QNJA 3LU9B 4TYDA 1UK3A 3LIWA 1GHBG 1C2IA 2A2XH 3GY6A 3PRBA 1D3TB 1AFQB 1P09A 1BRUP 1YWUA 1SQAA 1GG6B 1SLUB 1O5FH 4X8VH 1AE8H 1EOJA 1DVAH 1AUJA 3LGUA 1LMWB 1BJVA 3CP7A 4ABFA 5GCHF 2UUFB 1SGTA 2BDYA 1OPHB 3KN2A 5LPFA 1K1JA 4DT7B 1MABB 3GOVB 3K6YA 2Z3DA 1P3CA 3EYDA 1W0JD 3DFJA 1S82A 2FTLE 4ABIA 3E0PB 5C3NA 2CGAA 3VXEH 1RGQA 1O3GA 4X8TH 4IMQA 2TGAA 5I25A 4JZ1A 2FS8A 5EQQA 2PKSC 1P2NA 1ANBA 4GSOA 4U30A 3EQ0H 4X1RU 3LONA 2FYQA 1V2VT 1GHXH 1NRNH 4XOJA 4NA7A 4ESTE 3FP7E 4X2VA 3UNSA 2J98B 2V6NA 1C9TA 3B23B 4A1XA 1DLKB 2Z9LA 1O38A 4JYUH 1KLTA 3ZZAA 1PPZA 5DP7A 1ANEA 1SOZA 2A31A 2FP7B 2HVYB 3D49H 1DY9A 2A5KA 3N99A 3TITA 2WHXA 1QA0A 1B0FA 4NZQA 1P0SH 2NU1E 3MWIU 4K69A 1FAKH 4KP0A 3T28A 2ZGBH 3M7TA 1K1IA 1OWJA 1C2GA 1ELDE 3RXCA 1OP0A 4I8LA 3KYFA 3U1JB 1O3AA 1FQ3A 1GI5A 1ETRH 5T6DA 1C5YB 1UTMA 4FUDA 4FUCA 3MU8A 1F92A 1QJ7B 1GJ5H 2LPRA 3UREA 6ESTA 4AG1A 3UPEA 4K60A 1N8OC 3QK1A 1MTNB 2OXSA 1JXPA 3EE0B 3V12A 3A85A 4RT0A 4IC5A 1C1NA 5B6LA 2A0QB 1TX6A 1XVOA 4FUBA 2BM2A 2ZHQH 5L30H 2RA3A 3OSYA 1BTXA 4ABDA 2NWNA 1JIMA 1E38B 1O5BB 3AAVA 3A86A 2YNBA 2ZFQH 1TA2A 3W1EA 2J38A 1IQHA 4CR5A 3MO6A 3G01A 3P17H 1HJAC 3PTBA 1N6YA 3TJOA 2JKHA 1P01A 4NSYA 3PV5A 1JIRA 5T1VA 5C17A 4OGYA 2PTCE 1Z8IB 7GCHG 4X6PA 1F5KU 1O2JA 4ISNA 4B2AA 3KEEA 1SGEE 1P03A 6CHAB 1MAXA 3OE7D 1K1NA 2CK3D 4MPUA 5FHTA 2FS9A 2XBVA 3FAOA 3WWBA 5JBAS 5EOKA 2UWPA 3EA7A 1BMNH 2AERH 1T31A 4YOGA 3CENA 2AYWA 4NIWA 1AD8H 1TPSA 1WV7H 3GYMA 3GCHB 1T4UH 2A2QH 2W3KA 2O8UA 5DP3A 4UONA 1Z8GA 2WPLS 1SGIB 4E05H 3GISB 1TRYA 1DDJA 4I32A 1PPCE 1QR3E 3MNCA 3E8LA 3QDZB 3DA9B 4A7IB 2AMQA 4NIVA 5C5NA 1TMTH 3MH4A 3MTYA 1GL1A 1UMAH 1EAWA 1HNEE 4XBDA 2VWOA 2BVRH 2BY6X 4CRFA 1V2MT 3DCLA 1SGYE 5C94A 3U8RH 1TBQH 5EGMA 2ANYA 2QGRA 3RC4A 1GMDG 2BYAX 3TGJE 1GBTA 3SGBE 3SV6A 1S0QA 2FM2A 2PP6A 4B2CA 1ELVA 5HM9A 1HGTH 1O30A 1OSSA 4I7YH 1AU8A 1YP9A 3P70B 5ESTE 1W11U 2PLXA 2OLGA 4YLUA 2Q6FA 3VB4A 1YPLH 2KZ4A 2WUCA 3RXIA 1QRWA 4TWWA 3TK5A 3TLOA 1GBKA 5KEDA 4U01A 1BB0B 3NWUA 3V7TA 3ZZ9A 1BRCE 1KIGH 2ZU2A 2FESH 2H5CA 5EQSA 3RXHA 4UE7H 1Q2WA 3RXTA 3GY8A 1LO6A 2RG3A 2WUBA 1W0YH 2HVXA 1CBWC 1GHAG 2PHBA 1IQKA 3AW0A 1LVYA 1O2QA 3URDA 1SPJA 2A1DB 3C27B 2J4IA 3UTUH 4F48B 3BEFB 4RT1A 1C1VH 4BNRA 1L4DA 1KTSB 1SGFA 1C5NH 1AKSA 1DANH 2XBXA 1L1JA 1W14U 1YPKH 3SJ8A 2ZC9H 5EQRA 2P3UB 1KLIH 4JZIA 5HGGA 1O37A 3TJUA 1H1BA 1AVXA 2QYIA 1GHYH 1SGPE 1IQIA 1HXFH 2GT8A 3EGKH 3HPTB 2ZU1A 4BAKB 1H8HD 1K1LA 2BOHB 1T4VH 4K3JA 4DVAU 1HPGA 3ZVEA 1D3QB 5SGAE 1TGNA 2JETC 1DWDH 4NSVA 1EP5A 2XC5A 1BTHH 1G2MA 2QAAA 2VU8E 5C67A 1UTOA 2HNTE 5FBEA 1TLDA 2ZU4A 4JMYA 5EPYA 3F6UH 5A2MH 3ATWA 1ZSKA 3M7UA 1CA0C 2Y6TA 3NXPA 3Q00A 2VH6A 2WPIS 3DSGA 1XUJA 3A89A 1P2QA 3DT0H 2JJ1D 2OQ5A 4H6TA 1OHHD 1MTWA 3TH3H 1S6HA 1GCTC 3ATLA 3E90B 3E6PH 3SUEA 1GBFA 2G55A 2F91A 1TX7A 2QF5A 3BTHE 5E2OA 4DJZB 2ZQ1A 2GJGA 1P2IA 1Z8JB 3IITA 3PLBA 5A0CA 1QB9A 1UCYH 1P2KA 1PYTD 1ETTH 3E0NB 1AHTH 4OS4A 4X0WU 1SKYE 4YZUA 1QB6A 1QZ8A 5FX6A 3ZVCA 1O3IA 1C5VA 4FXGH 3OEED 1RTLA 4MLFB 4FU8A 8GCHG 3PMJA 4RKOB 1BBRK 5DP8A 1XXDA 4Y0YE 1SHHB 5CHAB 1V2KT 1SBWA 3M3TA 1XVMA 1Y3UA 1YY3A 1DE7H 3A80A 4AFUA 2A4QA 1O2XA 1YCPH 1K1OA 1KDQA 5EXLA 1EPTA 1OWDA 1TE0A 1S6FA 4ABAA 1BRAA 2KM0A 3OY5U 2AFQB 3F68H 2BD9A 1Y5UT 1FIWA 4ZHMU 1PQ7A 1HFDA 1BTPA 1TX8A 3M5OA 1ELFA 3JZ1B 3RXDA 1HAHH 2BDIA 3A8DA 5E2PA 1P04A 2ZPSA 6LPRA 3U98H 3ENSB 1C1WH 2O8LA 1J9CH 2VVCA 1K9OE 4JCNA 2Z6BD 1NBME 2BQWB 1BMLA 1C2MA 2J94A 5FX5A 3MH6A 2ZCLP 3TH2H 4DG4A 4NWKA 5TJXA 1GBBA 2F9UA 1C4Y2 3H7OA 1RTFB 3BTKE 1S84A 2CN0H 2PFEA 3KQEA 1MUEB 3M5LA 2I6SA 2D2DA 1G37A 8LPRA 4YOIA 2ZFSA 4WF8A 1CGJE 3V13A 3RXJA 4XD7D 1D4PB 2G00A 5IDKA 2OINA 1UJ1A 1EP6A 1A7SA 2QC2A 3E91A 1LHGH 1ZPCA 1P3EA 1K0HA 1JOUB 2VIOA 2R2MB 4Y79A 1MKXH 4Y6DA 1T7CA 1TBZH 1MD8A 1ZOMA 2QV1A 4GVUA 2G52A 3PO1B 3RXRA 1ETSH 2FZZA 4UEHH 3MH5A 1V2QT 5I46H 2L6OA 2XRCA 4A1TA 1OYQA 5T6FA 4A1VA 1B5GH 1HAVA 4ZXXH 4NCYA 3SI3H 4ISHH 3BEUA 2A4OA 1DLEA 4UFEH 5DP6A 3V0XA 3RXPA 5F6MA 2AMPA 3JZ2B 2BY7X 4ZXYH 3ZVDA 1NO9H 2CMYA 1XMNB 2PWXA 4Q7ZA 1DSTA 3SORA 5LPRA 1ELGA 4I8JA 1O2RA 2FOGA 2P3FH 4IBLH 1CO7E 3GCTF 4CHAB 1VITF 3KQBA 1HAIH 3F2HA 1PPBH 1O3NA 1THRH 1BIOA 2LP6A 2RFKC 2BB4A 1LPZB 1TOCB 1NRSH 1K1MA 1G36A 1O2VA 2XW9A 2JJ2D 1AFQC 3QWCH 4D76A 2F3CE 1GG6C 1A2CH 2R2WU 2UUYA 3EA9A 4CRDA 1DOJA 5GDSH 2QF0A 2R0LA 4KKDA 3ZVAA 3UUZA 3AK5A 3H7TA 2GP9B 1H8IH 2UUKB 1FMGA 4ASUD 7ESTE 4AB8A 1EQ9A 1Y3VA 2FI3E 1HV7A 2LNCA 1W0ZU 1UVOA 1E79D 1VR1H 3GY5A 3QO6A 1O3LA 5A8YA 2ODQA 5LPEA 1AWFH 1UTLM 2BD7A 2Z9IA 2VIDA 3MU5A 4B75A 4FUIA 3BTFE 1EAIA 1V3XA 2UWOA 1JRSA 2V7QD 4WMDA 2ZO3H 1O3FA 3RC5A 1SGNE 1V2TT 5GXPA 1INCA 1QL9A 2WV4A 1SOTA 2D26C 1LVOA 4ZKRU 1BMAA 1NROH 3A7YA 2SNVA 2FEQH 4HTCH 4WXVA 1A46H 3P8FA 3QLPH 4M9FA 4CRAA 1QL7A 1W7XH 3UAIC 1TBRH 1BRBE 4NZLA 3GCOA 4TY6A 1NY22 4KTUA 3SQHE 1OP8A 1O3EA 2SGDE 1QB1A 3VB3A 4X6MA 3F2FA 1J8AA 2D1JA 4CBNA 1D6WA 3ZZCA 1G2LA 3PTNA 2ZZUH 2VGCB 1TGCA 4Y8YA 2QXJA 1C1RA 4VGCB 4FUHA 1E37B 1HXEH 1RJXB 1VCPA 2BZAA 4KTCA 2W7SA 1TABE 2IN2A 3B9FH 4ISLA 2NU4E 1GI1A 2SGEE 1YPEH 3L33A 1MTNC 4ZUHA 1CA8B 2L74A 2Y7XA 4FVDA 1EFRD 3AASA 4INHA 2BOKA 3EDXB 3MU0A 1BMFD 4ZKOU 4ZCNA 3PM3A 2A32A 3KQCA 4AN7A 2HPQH 1IQMA 2ZIQH 3SGAE 3KQ5A 5CHBA 2CJIA 3BIUH 1QJ6B 2BD2A 3S7HB 1P2JA 1EUFA 2OD3B 1TNLA 5GPIB 2J92A 1ZMNA 3OX7U 1GI0A 2G4TA 2BMGB 3GY2A 3SUDA 3L6PA 1V2NT 2BD3A 4DW2U 1FN8A 5J4QA 3VG8A 1GI6A 2BDGA 2WPDD 1Y3XA 2ZGCA 4HG6A 2C8YB 3T62A 1GBMA 1CVWH 1ESTA 1O3PB 5AHGH 5EJZA 4H6SB 1D9IA 1O5CB 2QN5T 3KGPA 1HYLA 4LZ4B 3SO3A 3UOUA 4I8KA 1IQNA 4ABEA 2BQ6B 1O2KA 2BDHA 1A61H 5JYIA 2RA0A 1T8NA 4XE4A 3VB5A 1TGTA 1V2LT 2W7UA 2XCFA 3ELAH 1TNHA 1ZRBA 2WZQA 1ZPBA 8ESTE 1S83A 1C5WB 1HAZB 1GDUA 1O2IA 2CHAB 2HOBA 3RXUA 5A09A 1BDAA 1X7AC 1SVPA 3SJ9A 1SB1H 1IHTH 4CH2B 4Z6AH 2QA9E 2YMSD 7GCHF 2WYGA 1PPGE 1MQ5A 3ZZ8A 4HI3A 4YO9A 1MD7A 1HIAB 2C8ZB 1TQ0B 5KECA 5F03A 2QY0B 2FTMA 3A8BA 4R8TB 1BTZA 4HGCA 5EG4A 2QF4A 5TCAA 3F2GA 4X1PU 1DITH 1ZPZA 1C4V2 1TONA 2AMDA 2FPZA 3SUFA 1AUTC 2A7HA 3F9HA 4CR9A 1CQQA 1WU1A 1UO6A 1VZQH 2XBYA 6GCHG 1QGFA 1AE5A 3HGNA 5FBIA 3NUMA 1RD3B 4UFFH 2ZDKA 3AW1A 1W12U 3SJKA 1GMDF 4B6EA 1V2UT 1LKBA 1PYTC 1B7XB 1FV9A 5C2ZA 1BBRE 1UVPA 2GX4A 2HNTF 4XBCA 1XXFA 2ZPRA 1QCPA 1F0UA 1TPOA 3TJVA 1C2HA 2K1QA 1EOLA 2KX4A 4B73A 3DSPA 1P2OA 1D3PB 2PSXA 1FIZA 1OS8A 3OU0A 3UR6A 3MI4A 3NZIA 4JZEH 1W10U 2RCEA 1UK2A 1E1QD 1N6XA 1GDNA 2Y82A 3N7EA 1T8OA 3UNRA 2EA3A 4ZKSU 1PPFE 2ZTXA 3DFLA 4Q80A 1SR5C 2KFWA 3RUOA 3UQOA 1GHAF 3S9AA 3PV2A 3UWJH 1FN6A 1M9UA 1O2NA 3KF2A 2F83A 1K28D 1QFKH 4FU9A 3RXVA 2AEIH 2PTNA 3VFEA 5DGJA 4E06H 1W3CA 2VWLA 2P16A 2CXVA 1UCYK 7KMEH 1C5PA 1P2MA 2WSSD 3VEQB 1C4U2 1ZGIA 2A45B 1WBGB 2NU0E 1TOMH 3RM2H 3ZYEA 2ZFFH 2DUCA 2ZCHP 5CMXH 2A4GA 1LKAA 3HK6B 3ZZ6A 1YLDA 1HDTH 5EPNA 1FUJA 4DY7B 4YXWD 4TSFD 4BXSA 3RXFA 3TK6A 2Z3CA 2KAIB 1IQFA 3TGIE 1FY1A 1ANDA 1PPHE 1HJ9A 2ALVA 5EJLA 2C4FH 5BRRE 1NBMD 5DSFA 3SNEA 1MKWH 2VB0A 3ODFA 1OWHA 3S0NA 1O3OA 1NESE 2VVUA 1H9HE 1NRRH 4LXBH 4CRBA 5C1YA 3T25A 1DY8A 3ATIA 4I33A 1XM1A 1LHDH 5A8ZA 4BTIB 1YGCH 1MU8B 2WPMS 1UW7A 2BD5A 4OS1A 2Q6DA 3DSOA 1ACBE 2KCPA 1V6DA 1QRXA 3MHWU 1TA6A 2PUXB 1ZSLA 1L1NA 2HGTH 1BCUH 4WY3A 2J97A 2JIZD 2ULLA 1J14A 1G32B 3PWCA 3TJNA 1SGCA 1CE5A 4TPIZ 1P9UA 1GJDB 2Z9JA 3RXAA 3SI4H 4K1TA 2ANWA 4WJG2 5F8TA 3W94A 5DP9A 8GCHF 4DT4A 2B7DH 2RDEA 1SSXA 2XBWA 3TNTA 3BF6H 1CHGA 2SGAA 1QQUA 3RP2A 3SN8A 3F9GA 1SGRE 3TK9A 1MKXK 2Z94A 1QBVH 1YPHC 1DS2E 1GVLA 1NM6A 2PKAA 1BZXE 2TGDA 5FCKA 1S81A 2GD4B 1HCGA 4NIXA 1LHCH 1TNKA 4OM9A 1BTWA 3QTOH 5GJ4B 4ZHLU 1SC8U 3PMHB 3QN7A 1W7GH 2G5NA 5DK1A 3M5MA 1A3EH 3PO1C 1ARBA 1RTKA 2Y7ZA 4GHTA 1AZ8A 2ZPQA 2ZGXH 1B0EA 2V35A 4Y0ZE 2M5TA 3OTJE 1ELAA 2ZU3A 1NFUA 1MZAA 1A5IA 2VJ1A 1TMBH 1ID5H 1O2MA 4Y11E 2DE9A 1W8BH 1C1PA 2H9EH 4B71A 5DP4A 1YLNA 4UFGH 5C1XA 3S9BA 1GJ6A 2TGTA 3LDXH 1QTFA 2G5VA 3T27A 3FZDA 3ZZ7A 2XNIA 1SFQB 4CHAC 3FANA 3MNSA 1ZRKA 4M7GA 2FX4A 1IQJA 1ZHMA 4X2YA 3U8TH 3TH4H 1SQRA 2C8XB 3UFAA 5DG6A 2EEKA 3WY8A 1C9PA 4X8SH 3TNSA 2VINA 5HKKD 1EASA 4XDEA 4JK5A 2BDBA 1H9LB 1EX3A 2C90B 2GV7A 5DPAA 1UVTH 3ATKA 4A6LA 1O34A 3HATH 3SV8A 3RXGA 4D8NA 3M5NA 4I31A 1SHYA 1VCQA 2JH6D 3ODDA 4FOUC 4TT3D 1EJMA 4K8BA 1H8ED 4AYYB 2CF9H 5B6OA 3A7WA 2TBSA 2QXHA 2W6ID 4IS5A 2VIWA 3ZYDA 2WINI 1RXPA 1TAWA 3M3VA 2GDEH 2B5TB 4WWYA 2PV9B 4LZ1H 4O03A 4CREA 3E16B 4U2WA 3R0FA 4GAWA 2GMTB 1EZUC 1KYNA 5JB9S 2XYAA 3RM0H 1E0FD 1G3BA 1SQTA 3BEIB 1EAXA 1C5UA 2C93B 5LH8A 3ZIAD 3MMGA 4ZROA 1UHBB 2J98A 5A8XA 1O5AB 5EW1H 4E7RG 2XC0A 1LTOA 2A4RA 3WW7A 4OS2A 1FLEE 1Y59T 2STBE 4Z1MD 2W6JD 3BTEE 4FUFA 1XKBC 3VPKA 1XKAC 1OKXA 3P8GA 1DFPA 1H9IE 3HKJB 1O39A 1YF4A 1T8MA 5HM2A 1P8VC 2Y5HA 2VGCC 1QBNA 1LHEH 3VXFH 3E3TA 3MO3A 4VGCC 4X1NU 3M7QA 5PTPA 2PGQB 3STJA 2R9PA 1Z1IA 4B1TA 1GL0E 4LOYH 1GJ4H 1WOFA 4YOJA 1HAPH 3LPRA 3IWMA 1Z1JA 2ZU5A 1P9SA 3GY7A 3UOPA 3SU4A 5CE1A 3QGNB 1KXAA 1NTPA 5K7RA 1O3BA 5E0GA 3QTVH 2G8TA 2BVXH 3LJOA 2BX3A 2V0BA 1RIWC 3GDSA 4FETA 3PB1E 4ABJA 5HYOA 3VB7A 2CV3A 1OWIA 1TQ7B 2H1UA 5AFYH 5EXNA 1KY9A 3A87A 2F9VA 1YC0A 4AB9A 5HIZA 1EZXC 3O8CA 2Y81A 1GGDB 1WSSH 1KXEA 2BVSH 2UWLA 1C2LA 3VGCB 3LH1A 5AFZH 1XX9A 3KYGA 3KQDA 2GV6A 2RDLA 1PPEE 4K1EA 2ZEBA 4DIIH 1AN1E 4O9VA 3LKWA 3SJIA 2XTTB 3RXQA 1ZMLA 3PV4A 2HALA 2ZFRH 2IPHA 3Q77A 2VIPA 2KCOA 1WYKA 1PJPA 1ELTA 2W3IA 1COWD 2M2AA 3Q76A 1KXFA 5DKMA 3SNBA 1GBIA 1KTTB 1SFIA 3C1KA 4Q63A 1ZYOA 1GDQA 4R0IA 3RDZA 2SFAA 1C5ZB 1G9IE 2BD4A 2FOEA 4CH8B 5FAHA 2AGIX 1EB2A 2HWLB 1MCTA 2CHAC 1GMHG 1GBJA 3K9XB 1ESAA 1C5OH 5L6NH 1BHXB 1GJAB 4ABHA 4MPWA 1PFXC 2XWAA 2ZKSA 4WMEA 1D3DB 3OTPA 3ZVGA 1HUTH 3AVZA 3P8NA 4H42U 2GVFA 1O36A 3GDUA 4MVNA 1IQGA 1O35A 2OTVA 2V3HH 2VNTA 2ZFTA 2Y5FA 3RMLH 3SV2H 3TGKE 5T3HA 1CSOE 1ABJH 1NFYA 5JBTA 1BMMH 4GPGA 4AOQA 3W95A 4FUGA 2ZG0H 3N7DA 1WCZA 3FKSD 1LQEA 2A5AA 2XC4A 2OBOA 3P92A 4DIHH 1TWXB 3RXKA 4Q7XA 5L2YH 2BZ6H 5LGOA 1OOKB 3PLKA 4IC6A 1THSH 1ZTKA 1ORFA 1ZR0A 1AGJA 3SYJA 2OUAA 4GUXA 5EIYA 4DOQA 1SGDE 2GCTB 3ZZ4A 1OP2A 3NRLA 2TPIZ 2BHGA 1BBRH 4JZDH 1YYY1 1CT2E 3UIRA 1V2OT 4MNXA 4INLA 4WVPE 1O2LA 3B8JA 2EI6A 3P95A 4AYVB 2FIRH 2BLVA 4X2WA 1YCPM 1BHXF 2V3MA 1VGCB 1O3KA 3A82A 4O3UA 3H5CB 4AORA 5JB8S 4MPVA 1YPMH 1J15A 2GTBA 1NN6A 4JYVH 3UB0A 2WYJA 1MTVA 3I29A 1C5MD 4BAMB 1AB9B 1MU6B 3ZZ3A 1A5GH 4XFQA 2A7JA 3FVFB 2SGFE 3RU4T 1UVSH 4B76A 3OEHD 1V2ST 6GCHF 2WV9A 1ZSJA 4F4OC 2GGVB 5L2ZH
chains in the Genus database with same CATH topology
1TPPA 1UTNA 2JH0D 2ZECA 2ODPA 3GCNA 2SNWA 2ZFPH 1QY6A 1C2KA 4B2BA 2W5EA 1DUEA 3O8RA 1E34B 2WPJS 3MO9A 5FPSA 2VH0A 1CT0E 3T29A 1EKBB 4MPXA 3LJJA 3MU1A 2G81E 3MNXA 1TRMA 1OX1A 4AGJA 4JZFH 2B8OH 1TIOA 3Q3KA 1CGHA 2ZHFH 6CHAC 1O2OA 5EW2H 1HJ8A 3T5FH 1SQOA 2SGQE 2ZDAH 1O3MA 1VCWA 2EI8A 2EI7A 2NU3E 1AKSB 3GCHC 2ZI2H 5G4BA 1BT7A 1A4WH 4MQAA 2BY9X 4ISOA 1ABIH 1F0TA 2J95A 4F49A 3T2NA 3LGWA 4Y7AA 4E7NA 1RRKA 3BG8A 3QZQA 3ZZBA 4AFSA 1C1UH 1BTYA 4FUJA 1THPB 2THFB 3I77A 1AVWA 1UTKA 2ALPA 1ZJKA 3BG4B 3DUXH 1GBAA 4CBOA 4AG2A 4A5TS 4SGAE 1EJAA 4BTUB 3GY4A 2PR3A 2QF3A 2H6MA 3GDVA 1TALA 4O97A 1O33A 1AY6H 1AO5A 1CU1A 1T32A 2ASUB 3QUMP 1Y5AT 1EAUA 1EXFA 3NK8A 1XUKA 1IQLA 1YPJH 4K5ZA 1DWCH 2PUQH 3NKKA 2BXUH 4WH6A 2ZHWH 4ZKNU 9LPRA 3MH7A 2YNAA 1J16A 1GI7B 3ZVBA 4ISIH 1YPHE 3RXOA 4NG9H 3T26A 1CT4E 1BJUA 2P3TB 4NA8A 4GCHG 1SLXB 3SNDA 2PGBB 1SL3A 2C3SA 2VIQA 3A7XA 3OY6U 2H9HA 1AIXH 1C2DA 1CHOG 2BX4A 3LGIA 1C5RA 1MTUA 1GI9B 1KDQB 3BTTE 1EPTB 2FI5E 1C5SA 2WPKS 2QIQA 3UWIA 4AZ2B 1E36B 1V2JT 2PW8H 1QRZA 1ELCA 3BV9B 2AIPA 8KME2 4MNYA 1EB1H 1MZDA 1ELBA 4HZHA 2OC7A 2QXGA 1P11E 2FOBA 1O2TA 2F9NA 3TU7H 2BD8A 4THNH 1QQ4A 3BSQA 4JK6A 1HAOH 4Y76A 1GBCA 2P93A 4OS5A 3A7VA 3AAUA 3DD2H 3F9EA 5H4IB 1KXBA 4J1YA 1P02A 2HRVA 4HFPB 1AVGH 1O2SA 2ZA5A 4CRCA 1A0HB 1EATA 1SLWB 3RMMH 1SI5H 2JH5D 2FOAA 1RS0A 2OCVB 2GCHG 1A0LA 3FP8E 1XUFA 1G3CA 2H2ZA 1GMCG 3LGYA 4D7GA 3IG6B 1WQSA 1GHVH 4Q2KA 1JWTA 4YESB 1GBLA 2BXTH 3K6ZA 3M37A 5FPTA 1KXCA 5HXFA 1GHZA 4J2YB 2BDCA 1VJAU 1NT1A 1PQ8A 1LVBA 1NFXA 1T8LA 1NZQH 1HBTH 1O0DH 4IN2A 3RLYH 3M35A 1QURH 4FVBA 3BN9A 4Y10E 2ZTYA 2AGEX 1WTHD 3A7TA 1NRPH 1DWEH 2QXIA 5FPYA 1YCPK 4ABBA 3MU4A 3BTGE 3RXMA 2WV5A 5CHAC 2GMTC 3S69A 4YTAA 2TRMA 3LC3A 4CRGA 1HAVB 1ZGVA 2P8OB 1TYNA 5GWZA 4BAQB 3HK3B 5FCRA 1SGFG 1GCDA 3EA8A 5GCHG 1UTQA 1BUIA 1O2HA 3RXLA 2GDDA 1DM4B 2FI4E 4FUEA 2VVVA 2ZCKP 3FFGA 3PYHA 1GVKB 4U32A 5ABWA 1G30B 1GJ7B 2Q1JA 4RKJB 3FP6E 1IOEA 1FONA 3RXSA 3NCLA 4XBBA 1RFNA 3RU4E 1K21H 1HLTH 4KGAA 2B0FA 1AZZA 2O8WA 1DPOA 1XUHA 2FXRA 3LC5A 1KLJH 1KXDA 3RMOH 2P94A 1F5LA 3L3TA 3E1XB 3ZZ5A 4X6OA 3ITIA 3NPSA 2Y5GA 1O5EH 3ATMA 3U8OH 2BDAA 1L4ZA 1YM0A 4AFQA 1DSUA 1Z71A 1L2EA 2AIQA 2QCYA 2TIOA 1C1MA 2Z9GA 1ZMJA 5JBCS 1DX5M 1FPCH 1HAXB 3K65B 4TWYA 4PROA 3TVJB 1LPKB 1W2KH 2CF8H 3M61U 2Z9KA 3GICB 3KHVA 1E35B 2ZF0H 4YM9A 1MMJN 3F9FA 4NIYA 1MQ6A 1O3DA 2ZDVH 3KCGH 1JRTA 1TMUH 1IQEA 2ZNKH 5E0JA 1GGDC 2OC0A 2ANMH 2H5DA 3LT3A 1NS3A 4H4FA 2WPHS 2GKVE 2PKSB 5DJ7A 4BOHA 1ELEE 3VGCC 1GVZA 3SNCA 1SG8B 4IMZA 5EXMA 3LGTA 2NU2E 4SGBE 3LGVA 1C1TA 1BITA 1DUAA 1D6RA 1S85A 1FY5A 2YOLA 1LQDB 3KIDU 3UNQA 2G4UA 1C1SA 5C5OA 1AMHA 1WQVH 4WMFA 5JDUB 2AS9A 2FWWA 2FOCA 1FDPA 2BLOA 1H4WA 2R3UA 3A84A 4YLQH 1LCYA 1TNIA 1GI8B 2FO9A 2ODYB 3RC6A 1O2YA 5JPMH 2F9OA 1C5XB 1AQ7A 3EAJA 1A5HA 2HPPH 4Y7BA 1O31A 1FXYA 4RN6A 4WXIA 3A88A 4YT6H 3U9AH 1N8OB 1V2RT 4IN1A 2Y80A 1Y3WA 1YPGH 4OS6A 2EC9H 1UTPA 4FU7A 1KSNA 1AWHB 3URCA 5T6GA 1HAYB 2XCNA 3ZV9A 3SZNA 3UQVA 3D23A 1HIAA 1FNIA 3SU3A 1F5RA 1GJCB 1TPAE 1C2EA 1HAGE 1K22H 1GWAA 2R3YA 3BTME 4MDSA 4Y8XA 1EZSC 3RXEA 1AFEH 2ZTZA 3K2UA 1FY3A 1HJAB 5EODA 3PMBB 2A7CA 1QIXB 2VIVA 2ZGJA 2FYRA 3S7KB 1AI8H 1LVMA 1SMFE 1C2JA 2BLQA 3S9CA 9ESTA 2A5IA 5DP5A 3STIA 5HMAA 1BTUA 3R3GB 1FZZA 2BLWA 2BQ7B 1L1GA 1ZJDA 1C1OA 3A8CA 4X1SU 2ESTE 2J2UA 1NRQH 1GI2A 5EU8A 4BAHB 3D62A 1WTGH 3MYWA 1ESBA 1GMHF 2GZ9A 4K1SA 3LH3A 4LK4A 3PROA 3A81A 4MTBA 1DXWA 2GCTC 1Z6EA 1F7ZA 1JBUH 1O32A 1OWEA 4IGDA 5F8XA 2FODA 5F8ZA 1CGIE 1FJSA 2ZDNA 5IYTA 1VGCC 1YBWA 3QZRA 3LOXA 3Q3YA 1Z7KA 1O2PA 3A7ZA 2ZHDA 1TGSZ 4AGKA 4BANB 2F9PA 1SGQE 3P8OA 3A83A 2D8WA 1ANCA 2Q6GA 1F0SA 1MTSA 1NU7B 1AB9C 1GBEA 1H8DH 3BTDE 4IW4E 4NA9H 1UK4A 3PWBA 2ANKH 1K2I1 1P06A 5DO4H 1FAXA 2IJOB 4I8HA 1ZLRA 1N1LA 1NC6A 1GJ9B 2V3OH 1PQ5A 1XUGA 2VWNA 2FLBH 3HKIB 4INKA 1NU9A 3CS7A 2P59A 5TCCA 4D9QA 4XSKU 1GJBB 1SLVB 1Q31A 4Y71A 3SU2A 2FX6A 2FLRH 3MOCA 1GJ8B 4DURA 2OP9A 3ZZDA 1O3HA 1DT2A 3D65E 4ZH8A 1QA7A 1TNJA 2ZQ2A 1V2WT 1BQYA 4Q7YA 3P6ZB 4MG3A 3TPIZ 4KELA 1ARCA 1O2WA 1CBWB 1IAUA 1QJ1B 3TIUA 4NGAH 2AGGX 3M3SA 2ZDLA 1GHWH 4O3TA 5E8EH 1QBOA 2IOTA 4K2YA 5JBBS 3SJOA 2H9TH 2KAIA 4X1QU 1TB6H 1FY4A 1FI8A 1OYTH 3PMAB 3SU6A 1P12E 3N7OA 3SGQE 1ZHRA 4ZMAH 2FOMB 4UFDH 1XUIA 1P10A 1FPHH 1GPZA 2ZGHA 1OWKA 1PQAA 2OQUA 1F2SE 3QGJA 1S5SA 2ZHEH 4TPYA 3BG4C 3SNAA 1MAYA 2HNTC 3KL6A 2FOHA 1U6QA 2JETB 3SBKA 3SV9A 5ETXA 3ESTA 1EJNA 1ZTJA 3U69H 3GYLB 5A0BA 4A92A 4D9RA 3PLPA 1O3CA 1MCVA 1GI4A 4JYTA 1UVUH 1O5GH 2ZP0H 3ZV8A 2OC1A 3V3MA 1YKTA 2FOFA 4OS7A 4BXWA 4MNWA 3BTQE 4UDWH 2O8TA 4BTTB 2ZWLH 4AFZA 2FMJA 1CA0B 1VITH 2BTCE 3O8DA 1P57B 2XXLA 1A0JA 1HB0B 1LDTT 1F0RA 1GCTB 3SQEE 2FDAA 4MNVA 3BIVH 1G3DA 3BTWE 1BOQA 1UCYE 1C1QA 4X2XA 2B9LA 3Q3XA 5ESBA 2XWBI 1C5TA 4GHQA 1Y3YA 1ZHPA 1L0ZA 1O2ZA 1C5LH 1EPTC 1VJ9U 2STAE 4NFFA 1MBMA 2R0KA 1G3EA 5FXLA 1O2UA 2GT7A 3SU0A 5GIBA 1DICA 1DWBH 1GHBF 3GY3A 1V2PT 1GBHA 4ABGA 1Y8TA 3DHKH 1Y5BT 1S0RA 3I78A 3MFJA 3ZVFA 4DGJA 2DE8A 3UY9A 1LPGB 1LHFH 1TRNA 1NFWA 2J34A 1MH0A 1O5DH 1K1PA 2P95A 4BAOB 3SW2B 2PSYA 4KTSA 1TFXA 4TY7A 2O9QA 1WUNH 1ZZZA 4D7FA 4GCHF 1OXGA 4I8GA 4UD9H 1O2GH 2OC8A 1EZQA 2I6QA 1MBQA 2VWMA 3SHCH 1YLCA 1DXPA 1Z6JH 2BY5X 1Q3XA 3U1IB 3QX5H 1A3BH 1BA8B 1CHOF 1GI3A 1HRTH 3SOSA 5BPEA 2PKAB 3GCTG 1VITG 5C1UA 1P05A 5E0HA 4ZHAA 1UTJA 3SV7A 5A0AE 2F9BH 2GZ7A 4ASHA 3M36A 1QHRB 5C20A 1RIWB 2GZ8A 1TGBA 5AVDA 1W13U 1ZTLA 2W26A 1MKWK 4K8YA 5AF9H 3RU4D 1J17T 3KNXA 2HLCA 2P8OC 3SU1A 3SU5A 3F1SB 4AX9H 3SUGA 3OYPA 4WH8A 1QL8A 1WAYB 4NFEA 2G51A 2AH4X 4GLYA 4OGXA 4Z0KA 3VB6A 1C2FA 1JMOH 2ZDMA 1O3JA 2SGPE 7LPRA 5K0HA 3O8BA 2GCHF 2Z7FE 3FZZA 2OBQA 1UHBA 3UR9A 1IHSH 1GMCF 1TNGA 4ZAEA 4Y8ZA 1FY8E 3RLWH 3HGPA 2UUJB 4X6NA 1NPMA 1C5QA 3CS0A 4X8UH 3SHAH 2TGPZ 4RSPA 1A1RA 3RXBA 4DCDA 3MNBA 2BY8X 4YT7H 1GBDA 5J4SA 2O8MA 4B74A 4NWLA 2C8WB 2J9NA 3A8AA 4QT8C 2ILNA 3RMNH 1Z8RA 2Z3EA 1QNJA 3LU9B 4TYDA 1UK3A 3LIWA 1GHBG 1C2IA 2A2XH 3GY6A 1D3TB 1AFQB 1P09A 1BRUP 1SQAA 1GG6B 1SLUB 1O5FH 4X8VH 1AE8H 1EOJA 1DVAH 1AUJA 3LGUA 1LMWB 1BJVA 3CP7A 4ABFA 5GCHF 2UUFB 1SGTA 2BDYA 1OPHB 3KN2A 5LPFA 1K1JA 4DT7B 3GOVB 3K6YA 2Z3DA 1P3CA 3EYDA 3DFJA 1S82A 2FTLE 4ABIA 3E0PB 5C3NA 2CGAA 3VXEH 1RGQA 1O3GA 4X8TH 4IMQA 2TGAA 5I25A 4JZ1A 2FS8A 5EQQA 2PKSC 1P2NA 1ANBA 4GSOA 4U30A 3EQ0H 4X1RU 3LONA 2FYQA 1V2VT 1GHXH 1NRNH 4XOJA 4NA7A 4ESTE 3FP7E 4X2VA 3UNSA 2V6NA 1C9TA 3B23B 4A1XA 1DLKB 2Z9LA 1O38A 4JYUH 1KLTA 3ZZAA 1PPZA 5DP7A 1ANEA 1SOZA 2A31A 2FP7B 3D49H 1DY9A 2A5KA 3TITA 1QA0A 1B0FA 4NZQA 1P0SH 2NU1E 3MWIU 4K69A 1FAKH 4KP0A 3T28A 2ZGBH 3M7TA 1K1IA 1OWJA 1C2GA 1ELDE 3RXCA 1OP0A 4I8LA 3U1JB 1O3AA 1FQ3A 1GI5A 1ETRH 5T6DA 1C5YB 1UTMA 4FUDA 4FUCA 3MU8A 1F92A 1QJ7B 1GJ5H 2LPRA 3UREA 6ESTA 4AG1A 3UPEA 4K60A 1N8OC 3QK1A 1MTNB 2OXSA 1JXPA 3EE0B 3V12A 3A85A 4IC5A 1C1NA 2A0QB 1TX6A 1XVOA 4FUBA 2BM2A 2ZHQH 5L30H 2RA3A 3OSYA 1BTXA 4ABDA 2NWNA 1JIMA 1E38B 1O5BB 3AAVA 3A86A 2YNBA 2ZFQH 1TA2A 2J38A 1IQHA 4CR5A 3MO6A 3G01A 3P17H 1HJAC 3PTBA 1N6YA 3TJOA 2JKHA 1P01A 4NSYA 1JIRA 4OGYA 2PTCE 1Z8IB 7GCHG 4X6PA 1F5KU 1O2JA 4ISNA 4B2AA 3KEEA 1SGEE 1P03A 6CHAB 1MAXA 1K1NA 4MPUA 5FHTA 2FS9A 2XBVA 3FAOA 5JBAS 5EOKA 2UWPA 3EA7A 1BMNH 2AERH 1T31A 4YOGA 3CENA 2AYWA 4NIWA 1AD8H 1TPSA 1WV7H 3GYMA 3GCHB 1T4UH 2A2QH 2W3KA 2O8UA 5DP3A 4UONA 1Z8GA 2WPLS 1SGIB 4E05H 3GISB 1TRYA 1DDJA 4I32A 1PPCE 1QR3E 3MNCA 3E8LA 3QDZB 3DA9B 4A7IB 2AMQA 4NIVA 5C5NA 1TMTH 3MH4A 3MTYA 1GL1A 1UMAH 1EAWA 1HNEE 4XBDA 2VWOA 2BVRH 2BY6X 4CRFA 1V2MT 1SGYE 3U8RH 1TBQH 5EGMA 2ANYA 2QGRA 3RC4A 1GMDG 2BYAX 3TGJE 1GBTA 3SGBE 3SV6A 1S0QA 2FM2A 4B2CA 1ELVA 5HM9A 1HGTH 1O30A 1OSSA 4I7YH 1AU8A 1YP9A 3P70B 5ESTE 1W11U 2PLXA 2OLGA 4YLUA 2Q6FA 3VB4A 1YPLH 2WUCA 3RXIA 1QRWA 4TWWA 3TK5A 3TLOA 1GBKA 4U01A 1BB0B 3NWUA 3V7TA 3ZZ9A 1BRCE 1KIGH 2ZU2A 2FESH 2H5CA 5EQSA 3RXHA 4UE7H 1Q2WA 3RXTA 3GY8A 1LO6A 2RG3A 2WUBA 1W0YH 2HVXA 1CBWC 1GHAG 2PHBA 1IQKA 3AW0A