2QYIA

Crystal structure of a binary complex between an engineered trypsin inhibitor and bovine trypsin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Crystal structure of a binary complex between an engineered trypsin inhibitor and Bovine trypsin
rcsb
source organism Bos taurus
total genus 51
structure length 223
sequence length 223
chains with identical sequence C
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qyiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qyiA02
1S6FA 2QY0B 4A6LA 3SUDA 4NSYA 1C1NA 3FZZA 5J4QA 2NU2E 1C1PA 2GZ9A 4D7FA 1C2JA 2OTVA 1CT0E 2QXGA 2A7HA 2PKSC 4VGCC 1RD3B 1DLEA 1AO5A 1IQLA 2XNIA 4DG4A 2VVVA 1D6WA 4K1SA 3VGCC 2P93A 3GCOA 1DVAH 2XCFA 3L3TA 4X6PA 3RDZA 1FAKH 1FNIA 4CRGA 2WPMS 1P3EA 2XYAA 3RXDA 3L6PA 2ZGJA 3RU4T 1AWFH 1DXWA 2ZU5A 4WH8A 3JZ1B 5E8EH 1C5PA 3BN9A 1GJCB 3BTEE 3GCHC 4I32A 1GG6B 1QGFA 4X6NA 1DXPA 3URCA 1HAHH 2HNTE 2RA0A 2VB0A 2R0KA 2P59A 1O2WA 2SFAA 9ESTA 3I78A 1WTHD 2Q6GA 1W0YH 3ZVFA 1EUFA 4MTBA 3SGBE 3SU5A 1Z1IA 2RA3A 4DGJA 3LIWA 1TGSZ 1ACBE 3M37A 4WF8A 1ANEA 1TNKA 1W10U 3A81A 1DY8A 2PGBB 2ZHWH 5E0GA 4UDWH 2CF8H 1S85A 1L1NA 1K22H 1C5VA 1MCTA 3RXEA 1MTWA 2DE9A 1OXGA 2ZHQH 3ZV8A 3A8DA 5GXPA 4UD9H 2YNAA 1BCUH 4IC5A 3SUEA 1CGHA 1HUTH 2A0QB 5F8ZA 3HATH 1C5LH 2B9LA 4KTSA 4RN6A 2ZU3A 3R3GB 5DK1A 2V3HH 3A86A 4FVBA 4I8JA 4BAMB 1TGBA 1GCTB 3FAOA 1BOQA 3TK9A 2O8MA 4OGYA 2BD5A 2ZG0H 1G3CA 4O03A 4I8KA 1XUGA 3MTYA 4WXIA 1HNEE 1LHCH 2O8UA 2ZGXH 1IQJA 1LHDH 2BXUH 3RXTA 3TJOA 3GYMA 2XBWA 4NZLA 3BEFB 1LO6A 2FS8A 4AFUA 1DWCH 2BD4A 2K1QA 2J34A 1TLDA 1XVOA 4LOYH 4H4FA 1YLDA 1PPEE 3ZVEA 1TX7A 1MQ5A 1F7ZA 1GVKB 2ZDLA 2F9UA 1G2MA 1PFXC 1GBDA 2V0BA 1C2HA 1UCYE 5EGMA 4X1NU 4B2CA 1DLKB 3A7YA 1AGJA 3SNEA 1HCGA 1F5RA 1Z8GA 2ZTYA 2VIWA 1O3JA 1T8OA 1OP0A 1BHXB 1CQQA 2EI6A 4GAWA 1CBWB 1MMJN 2THFB 2XC5A 1A5HA 3PROA 1S84A 2C93B 1G36A 2ZFRH 4FU7A 2BZ6H 4Y71A 3LH3A 3MU5A 2ODYB 2V35A 1GI7B 3STIA 3ODFA 3FP6E 1DSTA 4OS5A 3T2NA 2BD7A 3ZZ8A 2BB4A 2ZU2A 1BBRE 2HNTF 2PUXB 2FOMB 1GI4A 1X7AC 1UHBA 1N8OC 2BD2A 1HJAB 1IQKA 3M5NA 1PPHE 1QL7A 5AHGH 1ZHRA 2Z3EA 1BMAA 3KQDA 3RXOA 4GSOA 1TNIA 3M5LA 4O3TA 2ZEBA 2Y7XA 4WMFA 1IAUA 1BRBE 3ZYDA 4ABEA 1BUIA 4D7GA 1DITH 2Q6DA 2VGCB 5J4SA 1YM0A 5IDKA 1KDQB 2HGTH 1NRNH 3RMOH 2FI3E 3U9AH 5FX5A 1GI1A 1L0ZA 1O3DA 1BMMH 1Q3XA 4A92A 2HLCA 1O5FH 1GBMA 3BTHE 1UTOA 2J92A 3BTME 1NFWA 1KXCA 1QB6A 2FM2A 4JZIA 1SMFE 4A1VA 4JCNA 4DY7B 1DOJA 1BIOA 3RXIA 2QAAA 4J1YA 1W7XH 1MTNC 1CHOF 1UVSH 2BLQA 1UVPA 2EI7A 5FBEA 4Q7ZA 1GPZA 2KAIA 1ETTH 1THSH 3V0XA 1A3BH 1K1NA 1UK2A 4DJZB 2UWLA 1OWHA 4UE7H 1H8DH 1QB1A 4B76A 1V2VT 5LPFA 2TGTA 1QQ4A 2J38A 3N7OA 5E0HA 5F6MA 3FZDA 4CRDA 1S82A 1EASA 3LU9B 1H1BA 2O8TA 2GCTC 1Y3VA 1YCPM 2D26C 1DE7H 3PWBA 3ATWA 1ZTLA 4BTIB 3UOUA 2AFQB 3TJNA 4HTCH 2Y7ZA 2OUAA 2C8ZB 1EOJA 3TNSA 3RXPA 3UQOA 2M5TA 1O2MA 1YLCA 1Z7KA 1V2QT 3JZ2B 1OP8A 1SGFG 1QIXB 1SGQE 1UTMA 1AY6H 1WSSH 2BQ6B 2VJ1A 1JIMA 5DKMA 2FO9A 3A7TA 1O5EH 3MU0A 3GY3A 2VU8E 2EI8A 1V2RT 1YPJH 3VB4A 3BTTE 2FI5E 1GBTA 2AGGX 3KHVA 3T27A 3ZV9A 5ETXA 1J8AA 1VCPA 2ZDMA 1MTVA 1L1GA 2XXLA 4U01A 2VIDA 4JYTA 1G3BA 2H1UA 4CR9A 2HVXA 1C4V2 2FXRA 2F9NA 1MQ6A 4K2YA 1C2LA 4LZ1H 1C2EA 1O2NA 3F9FA 1NY22 2BDCA 1AU8A 3EE0B 1TWXB 5LH8A 1AFEH 1TQ0B 1W2KH 4JZFH 1XMNB 1C2DA 1SGEE 1C5WB 2HPQH 3EA7A 4GCHG 3PO1B 1O3GA 1SI5H 1O5CB 3BF6H 1PYTD 4HGCA 1OX1A 3IWMA 5C1XA 1C2FA 3TK5A 5FXLA 4KTUA 4XBDA 3EDXB 1VCQA 3P70B 3BTDE 2ZCLP 4ZUHA 1P9SA 1A0LA 2WV4A 1QY6A 1PPFE 1OKXA 1C4Y2 4AOQA 5FBIA 1SL3A 2OLGA 1RFNA 3TNTA 3SNBA 1FPHH 2P16A 5A8XA 3S0NA 2TIOA 2BVRH 1JBUH 2ZCKP 1TNJA 4Y0ZE 1WV7H 5A0AE 2FEQH 3UREA 2FYQA 1CA0B 1TGNA 4MPUA 4JYVH 3HPTB 2GZ8A 1HYLA 3PV4A 1ARBA 4MLFB 3AW0A 3RC6A 3TK6A 1J9CH 5HXFA 3CS0A 4X2YA 1INCA 5EOKA 4ZXXH 1GBFA 1KSNA 4K69A 4OGXA 5TCCA 1OSSA 5L2ZH 4FVDA 5FPTA 1C2MA 2FX6A 1ZSJA 5T6DA 3MOCA 2Q1JA 4WMEA 2GD4B 1NN6A 4OS2A 1JOUB 2WPKS 4CHAB 3TPIZ 3GDUA 1D6RA 3LOXA 3PLBA 1EATA 1C1VH 4TWYA 3RXGA 2FPZA 1GJ4H 1SGFA 4YT7H 4U32A 4B1TA 4B74A 1YKTA 3FANA 1C4U2 3DA9B 1GCTC 2IPHA 5L6NH 1LKAA 4AB8A 2D8WA 1HAZB 1HXEH 1TABE 4FUFA 1G32B 1NT1A 1C2IA 1QA0A 2TGPZ 3NK8A 2VH6A 1YPGH 5PTPA 3SJIA 2JH5D 3T29A 1OWEA 3GYLB 1P03A 9LPRA 1D9IA 3MO9A 1BB0B 1UO6A 1XUKA 3LJJA 5A8ZA 1IQHA 4TYDA 3VXEH 3UQVA 1TE0A 4TPYA 4JMYA 3VFEA 1P11E 1SLUB 4K3JA 3OY6U 4DW2U 2FOGA 1K21H 1Z8RA 1RRKA 1CO7E 3U8OH 3UNRA 1JXPA 2SGDE 2GDDA 1GI9B 3D23A 3RLWH 1AQ7A 4OS7A 1UTLM 2BOHB 3W95A 1AB9B 1CBWC 3GOVB 1EB1H 2DE8A 2PTNA 4CH8B 1LPGB 2P8OB 1QJ6B 2PR3A 1FMGA 3HGNA 3UWJH 3VPKA 1BTZA 1AKSA 1TGCA 2GV6A 5JBCS 3VXFH 2WUBA 2FMJA 1CVWH 1NU9A 4AGJA 2FTLE 2W7SA 3S7HB 1SFQB 4A1XA 3TGKE 1FPCH 6LPRA 8KME2 2G4TA 3P8GA 2R0LA 1S6HA 1Y5AT 4IN2A 3IITA 5FCRA 1O3PB 1KTTB 4NIXA 2IOTA 2SGPE 5C5OA 3SJ9A 1EOLA 1A46H 1CT4E 3RXLA 4ZMAH 1DDJA 1SGIB 4LXBH 4WJG2 2VGCC 3M7UA 4O3UA 1ANDA 4Z6AH 1F0RA 3LC5A 3A7WA 2P95A 2Z3CA 2A5KA 2PSYA 4MNYA 1DFPA 3SU4A 5A09A 7LPRA 1ELCA 2H5CA 5DP7A 1L4DA 5E0JA 1KXBA 1J16A 1S5SA 6CHAB 2SNWA 1ID5H 2V3OH 5GIBA 5TCAA 2PHBA 6ESTA 1Z6JH 3RXCA 4BANB 2BXTH 3P95A 3D65E 2I6SA 1NU7B 4K1TA 1CA8B 3U8TH 1GHZA 3GCTF 2PKAA 5GDSH 2OBQA 2BY6X 1OWJA 1C5ZB 3GCTG 2ANMH 3SV2H 3M61U 3QTVH 3UY9A 1BTYA 2G81E 4FUCA 1V2KT 3A82A 3U8RH 5GJ4B 3DFJA 1OWIA 1C5YB 1GMHF 1GMHG 1MUEB 3SZNA 2ZGHA 2CF9H 2GTBA 2ZO3H 3FP8E 4WMDA 3RXHA 2ALVA 3C1KA 2HWLB 3WY8A 2TPIZ 4INLA 2GMTB 5JBAS 1MTSA 2B8OH 1O3FA 1EPTA 2BY7X 1HAXB 1SQTA 5EG4A 2BYAX 1MD8A 1SGRE 4DCDA 3KF2A 2EC9H 1O3MA 1SG8B 2VWNA 4BOHA 1MAYA 2FOEA 4NSVA 2HPPH 2BLVA 1QL8A 4X8UH 3TU7H 1EZQA 2Y81A 2JH0D 3I77A 5JB9S 1AHTH 2ZFTA 5IYTA 1TBQH 1O3EA 3LJOA 4HI3A 1UHBB 3RXKA 2AH4X 4UFFH 1NFYA 2F91A 4I8HA 3ZVAA 1A2CH 1ESBA 4B73A 2XWBI 1ARCA 5LPEA 3PMJA 1GBBA 1WCZA 2GKVE 1ZJKA 4NCYA 4MPWA 1UTPA 1ELBA 1CU1A 1F92A 3PWCA 3R0FA 1BTUA 2Y5GA 3A88A 3S9BA 1GMCF 3AASA 2ZECA 1C1OA 1FLEE 1A61H 1N6YA 4AB9A 2R3UA 1BITA 1YF4A 3LT3A 1NM6A 3AAVA 1GBHA 2BM2A 3RM0H 1P2NA 1LTOA 3F9HA 4PROA 3ITIA 1P2JA 1K1IA 4ABGA 1HAVA 3DT0H 1MBQA 3PO1C 2C8WB 1P8VC 4MVNA 1FIWA 1K2I1 2BDYA 2ZPRA 3A85A 1O39A 4ZKRU 3RXBA 3D49H 2J9NA 3GY2A 4DURA 1UVUH 1P06A 2KAIB 3RC5A 1UTKA 1V3XA 2LNCA 4CBOA 1VJAU 5FCKA 2GCHF 2W7UA 1H9LB 1UK4A 1EJAA 4IMZA 3MO6A 2GCHG 3SOSA 8GCHF 4D9RA 4BTTB 1LQEA 1B5GH 3RXFA 2WYJA 2ZFFH 1MKXK 3B9FH 4JZEH 2OC0A 2BOKA 2GZ7A 3TH4H 1O2QA 3MWIU 1O2YA 1ZGIA 1QTFA 2A2QH 1DPOA 1T8LA 1OPHB 2XC0A 1TPAE 3KQBA 2ZFSA 2FOAA 4A7IB 1B7XB 1GBJA 1KXEA 2JKHA 4KGAA 4MDSA 4Z0KA 1LHEH 4K5ZA 1G30B 1SLWB 3M3TA 3K65B 4E05H 3RXAA 1FY8E 1SC8U 1SQAA 2H9HA 3OYPA 4Y8XA 3SI3H 3MYWA 1O0DH 1BTHH 3GCNA 4I8GA 5DP4A 3H7TA 3ELAH 4CHAC 1ELFA 1YPHC 1NROH 1RTKA 2FODA 1SLVB 1TYNA 2XWAA 3Q3KA 1FAXA 1OYQA 1J14A 2P94A 1C2GA 2ZHFH 1ABJH 2A4GA 2SGFE 3HK6B 1GI0A 3UUZA 1EAXA 3NZIA 5EW2H 1HV7A 1G2LA 1ELTA 4I8LA 1AUTC 2A7CA 2UWPA 2ZIQH 2OBOA 3M3SA 4JYUH 4IW4E 3MHWU 3BEIB 3MNBA 3TH2H 3NPSA 5JBBS 3ZVDA 1ELAA 2H6MA 2Z9GA 1P2IA 1UVTH 3TGJE 4WVPE 3BG4B 4ZKNU 1MZDA 2PV9B 2Z94A 5C3NA 3CENA 5GWZA 3V13A 1CHGA 3QGJA 1MD7A 3TIUA 3AW1A 3E3TA 4NGAH 3STJA 1RS0A 1TPOA 1E34B 3P8FA 1HJ9A 2A5AA 2R2MB 5C1UA 1KIGH 4NWLA 1SGPE 1AUJA 2BDAA 3RXMA 1PQ7A 1QFKH 3ATMA 1GHXH 4FU9A 1GGDB 1AB9C 3RXUA 1RGQA 4MNVA 1T4VH 2ODPA 3ZZ3A 4NA9H 4NIVA 2PGQB 2P8OC 3HGPA 1LQDB 2BX3A 1PQAA 2A31A 4FUHA 3SHAH 3SJ8A 3E90B 2QC2A 4LK4A 2FOCA 2VVCA 1O3HA 2ZI2H 2ZZUH 1FDPA 1PYTC 2AS9A 3OTJE 2UUJB 1LKBA 4ZH8A 1EX3A 1JIRA 1ZGVA 1QQUA 1O31A 1FY3A 4RSPA 1P9UA 1O3LA 1UCYK 5GCHF 1BHXF 2G52A 4OS4A 2ZDNA 1CGIE 3M36A 4Y79A 3PLPA 1GI5A 3ZZBA 3S9CA 2NU4E 1G3DA 3A8CA 2CN0H 2O8WA 3EQ0H 3GICB 3SO3A 1ELDE 5FAHA 1KXDA 1NC6A 1O3IA 1UJ1A 2PW8H 1ETSH 3EAJA 3VEQB 1CHOG 3RXRA 3MMGA 4BAHB 2DUCA 5A8YA 3TGIE 1IQEA 1WUNH 1BBRK 2TRMA 1GHAF 1NRPH 3OSYA 2BTCE 5DP3A 1EAIA 1D3PB 2R3YA 6CHAC 4DOQA 2CJIA 2BY9X 5I46H 7GCHF 1LVBA 2F9BH 4XFQA 4BAQB 7GCHG 3SGAE 1V2LT 1AD8H 2F9PA 3S7KB 1IOEA 1C1QA 3TITA 3BSQA 1LCYA 3QWCH 1AE5A 3O8CA 1HB0B 2RCEA 1WYKA 5CE1A 1ZPBA 3GY5A 3PTNA 1CT2E 1V2ST 1HBTH 5DP5A 2GVFA 4Y8ZA 1J17T 1K28D 1ZPZA 4Q7YA 1IQFA 3SW2B 1P2MA 1C5XB 3PMHB 2FWWA 2PFEA 2TGAA 3E6PH 2OC1A 1LVMA 1ZTKA 5FHTA 2OINA 3SORA 1TNGA 2GMTC 3TH3H 5C5NA 4GVUA 4J2YB 1VZQH 1LHGH 3UIRA 1V2TT 1AKSB 1ZMLA 2CHAC 2J4IA 3SJOA 2EA3A 3MNXA 5EXMA 4ZHMU 2OC7A 2Y6TA 3O8BA 1EKBB 1C5TA 3P17H 1HLTH 1NZQH 1O5DH 1BT7A 1P04A 4HZHA 1KYNA 1GMDF 2O8LA 4OS1A 5EPNA 2FTMA 5EQRA 4H42U 4YT6H 3P8NA 2PKSB 1QL9A 1AMHA 1UTQA 4DIIH 1C5SA 1K1MA 1O2HA 1PJPA 2QXHA 3RMLH 1Z6EA 4YLQH 2A2XH 5HGGA 5L30H 1YPHE 1GBKA 1DM4B 2Z9JA 1P10A 1NTPA 1QJ1B 3MU1A 3A87A 2W5EA 1SHYA 5HYOA 2GP9B 4XE4A 1DY9A 1O2GH 3LGVA 1GJ7B 2QCYA 4GLYA 3F9EA 1ELGA 1W14U 2QXIA 1YCPK 3KGPA 1TMTH 2ILNA 4D76A 3GCHB 3SU1A 4KTCA 1GHBF 1IHSH 2FLRH 3ZZ4A 3A8BA 3ENSB 4AORA 2QIQA 1GG6C 4M7GA 1F2SE 1AI8H 2Z9IA 2SGQE 5F8XA 4CREA 1O2VA 1GCDA 1NFXA 1WU1A 4DVAU 1K1JA 3NKKA 2F3CE 4Y10E 3UOPA 3KNXA 4DIHH 3SUGA 3SU6A 1MU8B 2YOLA 3SV8A 2PKAB 1W3CA 4ZXYH 4ESTE 1ABIH 6GCHF 1A5GH 4X1QU 3SN8A 1QHRB 1EJMA 1CGJE 1SQOA 2VWMA 8LPRA 3A8AA 5JBTA 3U1JB 4ZKSU 1AN1E 4MNWA 5HMAA 1S81A 4AFQA 2WUCA 3URDA 5L2YH 2G51A 1HIAA 1Z1JA 1BJVA 3I29A 1NRQH 3T5FH 4DT7B 3O8DA 1YBWA 1IQGA 1EPTB 1ZHPA 3OY5U 4K1EA 1SGTA 3RLYH 4ABAA 4NZQA 7KMEH 1O35A 4IMQA 1TIOA 2R2WU 2ZHEH 1FY4A 3T25A 3TJVA 3VB3A 2FI4E 3T62A 3GY8A 2HRVA 4IS5A 2VIPA 1XX9A 1DWEH 4X8VH 5DO4H 2BD8A 2ZTZA 3E1XB 1Y5BT 1DSUA 3F9GA 1V2NT 1QA7A 1LDTT 1VCWA 3TLOA 5DPAA 4JZDH 3Q3XA 1MCVA 3KCGH 1RTFB 2AERH 8ESTE 2NU1E 1MAXA 1HXFH 5EXLA 4IBLH 2WPIS 1ZHMA 3LPRA 1LVOA 1U6QA 1HAPH 1QBNA 5AFYH 1OP2A 4KKDA 3SU3A 1GL1A 1UK3A 2Z3DA 4INHA 1TA6A 1L1JA 2ZCHP 2OCVB 4CH2B 1DX5M 1TNHA 1GJDB 5E2PA 3QTOH 1GBCA 2PSXA 1GWAA 2GT7A 1Q2WA 3FFGA 5T6FA 4THNH 1GJAB 2Z6BD 1QJ7B 5CMXH 1ZMJA 2P3TB 4E06H 1AZZA 1WQSA 3ZZCA 4YESB 1XXDA 4YLUA 4X1PU 4NG9H 1XXFA 1QBVH 3MH4A 3ZVGA 3A7ZA 1K1PA 1SGYE 1TRNA 3TJUA 1H4WA 2G55A 1O2IA 3GY4A 2G4UA 3QX5H 3W94A 2G5VA 1N8OB 3RXVA 3RU4D 3S9AA 3T28A 2ESTE 3F68H 1FV9A 4WXVA 4U30A 2UUKB 1GGDC 1HJAC 3MI4A 4FUGA 4B75A 1HAIH 1EZSC 1G37A 1GBEA 1ELEE 4AGKA 5AVDA 1A0JA 3P6ZB 4ABDA 2OC8A 5CHAB 3A80A 4FUEA 3TVJB 5DP6A 2QF0A 4YOJA 2CXVA 3KIDU 4RKOB 3U98H 4X1RU 3QLPH 5E2OA 4SGAE 1HJ8A 3VB6A 1EZUC 3GY6A 4Q7XA 4WH6A 2PUQH 2NU0E 5LPRA 1EP5A 3VB7A 1TRYA 4MNXA 1S0RA 1GHWH 3SQEE 1SOZA 4MPVA 1FJSA 1TX8A 1MTNB 1EAWA 2AEIH 1EJNA 1GJ8B 2QGRA 1TMUH 3UPEA 1BMLA 2QF3A 4ZAEA 1P0SH 1O2XA 4R8TB 4K8BA 3LDXH 5B6OA 3HKIB 2JETB 5ESBA 2VNTA 2C90B 4FXGH 2VIQA 1XUHA 1N1LA 1MU6B 4HFPB 2BVSH 4LZ4B 1TA2A 2ZA5A 2VVUA 2GCTB 1D4PB 1FY1A 3SJKA 3PMBB 1XUIA 3M3VA 5DP9A 3LONA 1GVZA 3UWIA 3GDSA 2ZF0H 3ATKA 1H9HE 5C67A 2ASUB 1BDAA 2XRCA 3RXSA 2AGEX 1A4WH 2FDAA 2SGEE 1P12E 4AYYB 3M7QA 1BMNH 3GY7A 4TPIZ 1GI6A 3NWUA 1C5QA 4F4OC 1YP9A 1O30A 3UTUH 3ZZ5A 4MQAA 3BTWE 1TGTA 2TGDA 5F8TA 4E7NA 1ETRH 2WV5A 1MBMA 1GI2A 1GI3A 1GL0E 1LPKB 1LPZB 1QRZA 4NA7A 3SNAA 1WBGB 2AYWA 1QRXA 1UTJA 1OOKB 1F5KU 4F49A 2XCNA 2ZU1A 1JWTA 1E37B 4KELA 2XW9A 1RTLA 3LKWA 1ESTA 2ZNKH 1NFUA 3BTQE 3KEEA 1M9UA 1S83A 2CV3A 1LMWB 1L2EA 4ISNA 1VGCB 1MKXH 2IJOB 2BMGB 2A32A 3B23B 1Y59T 4TY7A 1GMCG 5AF9H 3PB1E 3ATIA 4X1SU 3LGIA 1YYY1 1GDQA 2UUFB 1O3KA 1Y3YA 1QB9A 4X2VA 2BQ7B 3QZQA 4INKA 2TBSA 2ZGCA 1QCPA 1HFDA 1QR3E 3SU2A 1C1TA 2BDGA 3KQEA 3FVFB 4X8TH 3AVZA 1QRWA 1GBAA 1T32A 4BXSA 1BTWA 1C1WH 5FPSA 1OYTH 2ZDAH 2H2ZA 1QBOA 1PPBH 1O2RA 1TBRH 3CS7A 1XM1A 3V7TA 5H4IB 1TQ7B 1TPPA 2SGAA 1BA8B 5ABWA 1HRTH 1OWDA 4Q80A 4Y7AA 4AFZA 1O2KA 3E91A 3MH7A 1FIZA 1ZRKA 1FN8A 3GDVA 8GCHG 4IC6A 4ABHA 1K1LA 2WPJS 2H5DA 1O2TA 1CA0C 3ZZAA 3OU0A 3D62A 1K1OA 2PTCE 5EODA 3A7XA 5EQQA 4GHTA 2BLWA 1RIWB 5JYIA 3H5CB 2G8TA 4B2BA 3SHCH 1DICA 4Y11E 1W12U 2H9EH 2Y80A 3IG6B 1D3QB 1RXPA 4Y8YA 3K6ZA 3SV7A 1AWHB 4X6OA 3PMAB 1GVLA 1MTUA 1Y3WA 3AAUA 1DWDH 4I31A 1ZOMA 2Z7FE 2VIVA 3C27B 1W0ZU 1SGNE 4FUBA 1P02A 2FOBA 3PYHA 1FXYA 4D8NA 1O2OA 2VWOA 3LGYA 1FQ3A 2Y5FA 2EEKA 1GDUA 1CSOE 1IQMA 2ZQ1A 1C5MD 4X2WA 1C1SA 4H6SB 4OS6A 1EPTC 1E38B 2C4FH 3OX7U 1T31A 2HALA 2P3UB 1G9IE 1SGCA 2BDIA 4CRCA 1KLIH 3QN7A 1KXFA 4RKJB 2F9VA 1C5UA 1VITF 1KLTA 2FIRH 1VITG 3BTFE 2W3KA 3DUXH 1FI8A 4CRBA 3E16B 2ANYA 3DFLA 3E0NB 3GISB 2JH6D 1P57B 2VIOA 1A5IA 2ZHDA 5C20A 4AG2A 4CBNA 4AFSA 4Q2KA 1UCYH 3CP7A 3ZZ7A 1B0EA 1HGTH 5K7RA 3QUMP 4X0WU 1SGDE 2GX4A 1F5LA 4XSKU 3MH6A 4ZROA 1W13U 4ABIA 2Q6FA 1XUFA 3U69H 1O3OA 2A4QA 1ZZZA 1YGCH 5EQSA 4UFEH 1DANH 5ESTE 3MO3A 3H7OA 1AVXA 1NO9H 2FOFA 5AFZH 2FP7B 4CRAA 1BBRH 4KP0A 1Z71A 2ULLA 2ANKH 3UNQA 2CMYA 4AG1A 2A45B 2C3SA 1A3EH 2ZC9H 4ABJA 1F0TA 2ZGBH 1SR5C 3BTGE 2RDLA 2QYIA 3K2UA 3E0PB 3MH5A 3SQHE 1IQNA 1ZYOA 4Y7BA 1W11U 1GDNA 1VJ9U 4Y6DA 2PWXA 4ISLA 2HOBA 3V3MA 1EZXC 3RXJA 2W3IA 2B0FA 3SNCA 1AVGH 3BG8A 5HM2A 1O3AA 1C9TA 3KL6A 1C5NH 2LPRA 5FX6A 3KQCA 2SNVA 1MZAA 2GGVB 5GCHG 1AFQB 3T26A 5A2MH 2UUYA 1ZSLA 2A4OA 3S69A 1Q31A 5T6GA 1GHYH 3F1SB 1HIAB 4GHQA 4UONA 1BRCE 2STAE 3LH1A 2G5NA 1EQ9A 5CHAC 1WAYB 3BEUA 5C1YA 1B0FA 2J2UA 1SB1H 1ZMNA 1C5RA 1GJBB 1TPSA 5EU8A 3QGNB 4ISHH 2F9OA 1GHAG 1SOTA 2AMDA 1E0FD 1T8NA 1TAWA 2VWLA 4BNRA 3SGQE 4YOIA 1Y3UA 5EW1H 3RC4A 4AX9H 1TALA 2F83A 4BTUB 5BRRE 2WINI 3ZZ6A 2WYGA 1K9OE 1XVMA 1D3DB 3MFJA 1HAGE 1AIXH 2JETC 2D2DA 3P8OA 3M5OA 5A0CA 4XBCA 1P09A 3LGWA 2A7JA 5A0BA 1WOFA 3E8LA 4B2AA 1TRMA 2BHGA 2FOHA 2OQ5A 2ZPQA 2A4RA 1HAOH 1FUJA 2BDBA 1EAUA 5DG6A 1XKBC 1YPEH 2WPHS 2AMPA 1EP6A 1PQ5A 3Q77A 1YCPH 4A1TA 1HAYB 2IN2A 1O33A 1TOMH 2BX4A 3V12A 1A0HB 4FUJA 2OP9A 2Z9KA 1F0SA 4MG3A 1FZZA 5F03A 3L33A 1RJXB 2ZFPH 1KXAA 3A83A 5EPYA 1C5OH 3M5MA 3QK1A 1A7SA 1V6DA 2W26A 3QO6A 4XDEA 1BZXE 2UWOA 1ZJDA 1ELVA 1GBIA 1DUEA 5G4BA 2G00A 1P3CA 3PM3A 1GMDG 4FU8A 2R9PA 4VGCB 1ANCA 4NFFA 2BLOA 3Q3YA 3VGCB 4ISOA 3RP2A 3A7VA 4Y0YE 1W7GH 3SNDA 1C1RA 1O3NA 4AYVB 1IHTH 1XKAC 1LHFH 3NCLA 2QN5T 5JB8S 2BQWB 1VGCC 3RM2H 1FY5A 1TX6A 1V2PT 3ESTA 4H6TA 1T4UH 5I25A 1AVWA 1D3TB 4Y76A 1ZR0A 3ZVCA 2A5IA 1JRTA 1GHBG 1C1UH 4GCHF 4JK6A 1WQVH 7ESTE 5K0HA 5HM9A 3MU4A 5LGOA 2A1DB 2QXJA 3EGKH 2VH0A 2ZKSA 3B8JA 2XBYA 4MPXA 1C9PA 3A84A 2NU3E 4X2XA 1UVOA 2ZU4A 2OXSA 4UFDH 2C8YB 2J94A 1OWKA 1P2KA 1E36B 1KLJH 2AIPA 4GPGA 3HKJB 6GCHG 1SFIA 4ZHAA 3SV6A 1O5AB 4GUXA 1V2OT 3K6YA 5DJ7A 4AZ2B 2BD9A 3MNCA 5GPIB 2ZPSA 3LC3A 4K8YA 2FLBH 1BJUA 1P2QA 3DHKH 3A89A 1PPGE 1NRSH 2ANWA 1AE8H 3SUFA 2ZDKA 2C8XB 1O2JA 3EA8A 2BVXH 1LVYA 3M7TA 5DGJA 1H9IE 1KDQA 1YPLH 1MKWH 4BAOB 4ABFA 1RIWC 3DD2H 1KY9A 1ZSKA 4FUDA 4K60A 4B71A 5JPMH 4TY6A 2ZTXA 2ALPA 2FS9A 2FZZA 3RUOA 3ZYEA 5FPYA 1P2OA 1Y3XA 3ZZDA 2CGAA 1ORFA 1YC0A 1UTNA 3F6UH 4ASHA 4NIYA 1DT2A 4YO9A 3U1IB 1O34A 1TB6H 1L4ZA 3M35A 3BIUH 2I6QA 2WPLS 2FYRA 4AN7A 1O3CA 2BD3A 4UEHH 1TOCB 3ODDA 2AGIX 4U2WA 3UR6A 2STBE 1SVPA 1A1RA 1P01A 2D1JA 1ESAA 3K9XB 1O2SA 1C1MA 1P05A 4JZ1A 4SGBE 2HNTC 3ATLA 2NWNA 2OD3B 1BTXA 3ZVBA 1O3BA 5BPEA 1NPMA 5C2ZA 3BV9B 1MKWK 1GJ9B 1O2PA 1V2UT 1GJ5H 3EA9A 3BG4C 3PTBA 4IN1A 4WY3A 4XBBA 1HAVB 1EXFA 2V6NA 3Q76A 3UR9A 1BTPA 5TJXA 1JRSA 2YNBA 1VR1H 2O9QA 3UNSA 1THRH 2Y5HA 1GI8B 4JK5A 4O97A 1TBZH 2AIQA 3O8RA 2ZQ2A 4QT8C 3EYDA 3MU8A 2ZWLH 3SU0A 1ZLRA 3PLKA 1G3EA 2VINA 1O5GH 1SBWA 1V2JT 4XOJA 4FUIA 1F0UA 4YOGA 3LGTA 4NWKA 1FONA 1PPZA 4E7RG 2ZDVH 2Z9LA 1DUAA 1O2ZA 1NRRH 1V2WT 3ZZ9A 3BTKE 1O2UA 1ZTJA 2BZAA 4BXWA 1YPKH 3RMNH 1SPJA 1GJ6A 1ZPCA 1H8IH 3MNSA 1T7CA 1ANBA 1Y5UT 5EXNA 1E35B 1SHHB 1YPMH 1O38A 2OQUA 4BAKB 2PLXA 1PQ8A 1TONA 4A5TS 1NS3A 1CE5A 4WWYA 2B5TB 3UFAA 4D9QA 1BQYA 1AFQC 1EB2A 4YTAA 1FN6A 4UFGH 4I7YH 5SGAE 2GT8A 1OS8A 2ZP0H 4YZUA 1W8BH 4NA8A 2H9TH 2BY5X 1QNJA 1PPCE 3SI4H 2J95A 4X6MA 1O32A 3SV9A 1HDTH 2QV1A 1IQIA 1UMAH 2Y82A 3Q00A 4ZHLU 2AMQA 1N6XA 1J15A 1S0QA 1THPB 3QZRA 5JDUB 3BIVH 1GBLA 2B7DH 2XBVA 3KN2A 3LGUA 2P3FH 1Z8JB 2XTTB 2GDEH 3RMMH 1NESE 1JMOH 1BRAA 4YM9A 1Y8TA 2RG3A 1QURH 4R0IA 3RU4E 2FX4A 1SLXB 1DWBH 1TMBH 1TNLA 1O36A 4X8SH 1Z8IB 1ZRBA 5DP8A 4CR5A 4CRFA 1HPGA 2XBXA 3RXQA 1SSXA 1O2LA 1O5BB 1V2MT 2QA9E 3FP7E 1MH0A 2ZFQH 3G01A 2GV7A 2BY8X 4I33A 2FESH 1DS2E 2ODQA 1TFXA 3VB5A 4NFEA 4ABBA 1GHVH 1O37A 4ZKOU 2XC4A 1AZ8A 3NXPA 1WTGH 4IGDA 5T3HA 2BDHA 4O9VA 3P92A 1BRUP 2CHAB 1KTSB 4NIWA 1VITH 3NUMA 4ISIH 1C2KA 3SBKA 3HK3B 3QDZB 1T8MA 1XUJA 4TWWA
chains in the Genus database with same CATH superfamily
1S6FA 2QY0B 4A6LA 3SUDA 4NSYA 3F2HA 1C1NA 3FZZA 5J4QA 2KCOA 2NU2E 1C1PA 2GZ9A 4D7FA 1C2JA 2OTVA 1CT0E 2QXGA 3F2GA 2A7HA 2PKSC 4VGCC 1RD3B 1DLEA 1AO5A 1IQLA 2XNIA 4DG4A 2VVVA 1D6WA 4K1SA 3VGCC 2P93A 3GCOA 2KR7A 1DVAH 2XCFA 3L3TA 4X6PA 3RDZA 1FAKH 1FNIA 4CRGA 2WPMS 1P3EA 2XYAA 3RXDA 3L6PA 2ZGJA 3RU4T 4ZCNA 1AWFH 1DXWA 2ZU5A 4WH8A 3JZ1B 5E8EH 1C5PA 4RI0A 3BN9A 1GJCB 3BTEE 3GCHC 4I32A 1GG6B 1QGFA 4X6NA 1DXPA 3URCA 1HAHH 2HNTE 2RA0A 2VB0A 2R0KA 2P59A 1O2WA 2SFAA 9ESTA 3I78A 1WTHD 3DCLA 2YMSB 2Q6GA 1W0YH 3ZVFA 1EUFA 4MTBA 3SGBE 3SU5A 1Z1IA 2RA3A 2EY4C 4DGJA 3LIWA 3U28C 1TGSZ 1ACBE 3M37A 4WF8A 1ANEA 1TNKA 1W10U 2V7QD 3A81A 1DY8A 2PGBB 2ZHWH 5E0GA 4UDWH 2CF8H 1S85A 1L1NA 1K22H 1C5VA 1MCTA 3RXEA 1MTWA 2DE9A 1OXGA 2ZHQH 3ZV8A 3A8DA 5GXPA 4UD9H 2YNAA 1BCUH 4IC5A 3SUEA 1CGHA 1HUTH 2A0QB 5F8ZA 3HATH 1C5LH 1E79D 2B9LA 4KTSA 4RN6A 2ZU3A 3R3GB 5DK1A 2V3HH 3A86A 2L74A 4FVBA 4I8JA 4BAMB 1TGBA 1GCTB 3FAOA 1BOQA 3TK9A 2O8MA 4OGYA 2BD5A 2L6OA 2ZG0H 1G3CA 4O03A 4I8KA 1XUGA 3MTYA 4WXIA 1HNEE 1LHCH 2O8UA 2ZGXH 1IQJA 1LHDH 2BXUH 3RXTA 3TJOA 3GYMA 2XBWA 4NZLA 3BEFB 1LO6A 2FS8A 4AFUA 1DWCH 2BD4A 2K1QA 2J34A 1TLDA 1XVOA 2OK5A 4LOYH 4H4FA 1YLDA 1PPEE 3ZVEA 1TX7A 1MQ5A 1F7ZA 1GVKB 2ZDLA 2F9UA 1G2MA 1PFXC 1GBDA 2V0BA 1C2HA 1UCYE 5KGOA 5EGMA 4X1NU 4B2CA 1DLKB 3A7YA 1AGJA 3SNEA 1HCGA 3PRDA 1F5RA 2KCPA 1Z8GA 2ZTYA 2VIWA 1O3JA 1T8OA 3F0OA 1OP0A 1BHXB 4FOUC 1COWD 1CQQA 2EI6A 4GAWA 1CBWB 1MMJN 2THFB 2HVYB 2XC5A 1A5HA 3PROA 1S84A 2C93B 1G36A 2ZFRH 4FU7A 2BZ6H 4Y71A 3LH3A 3MU5A 2ODYB 3OFND 2V35A 1GI7B 3STIA 3ODFA 3FP6E 1DSTA 4OS5A 3T2NA 2BD7A 3ZZ8A 2BB4A 2ZU2A 3PRBA 1BBRE 2HNTF 2PUXB 3FO8D 2FOMB 1GI4A 1X7AC 1UHBA 1N8OC 2BD2A 1HJAB 1IQKA 3M5NA 1PPHE 1QL7A 5AHGH 1ZHRA 2Z3EA 1BMAA 3KQDA 3RXOA 4GSOA 1TNIA 3M5LA 4O3TA 2ZEBA 2Y7XA 4WMFA 1IAUA 1BRBE 3ZYDA 4ABEA 1BUIA 4D7GA 1DITH 2Q6DA 2VGCB 5J4SA 1YM0A 5IDKA 1KDQB 2HGTH 1NRNH 3RMOH 2FI3E 3U9AH 5FX5A 1GI1A 1L0ZA 1O3DA 1BMMH 1Q3XA 4A92A 2HLCA 1O5FH 1GBMA 3BTHE 4DT4A 1UTOA 2J92A 3BTME 1NFWA 1KXCA 1QB6A 2FM2A 4JZIA 1SMFE 4A1VA 3CNRA 4JCNA 4DY7B 1DOJA 1BIOA 3RXIA 2QAAA 4J1YA 1W7XH 1H8HD 1MTNC 1CHOF 1UVSH 2BLQA 1UVPA 2EI7A 5FBEA 4Q7ZA 1GPZA 2KAIA 1ETTH 1THSH 3V0XA 1A3BH 1K1NA 1UK2A 4DJZB 2UWLA 1OWHA 4UE7H 1H8DH 1QB1A 4B76A 1V2VT 5LPFA 2TGTA 1QQ4A 2J38A 3N7OA 5E0HA 5F6MA 3FZDA 4CRDA 1S82A 1EASA 3LU9B 1H1BA 2O8TA 2GCTC 1Y3VA 1YCPM 2D26C 1DE7H 3PWBA 3ATWA 1ZTLA 4BTIB 3UOUA 2AFQB 3TJNA 4HTCH 2Y7ZA 2OUAA 2C8ZB 1EOJA 3TNSA 3RXPA 3UQOA 2KFWA 2M5TA 1O2MA 1YLCA 1Z7KA 1V2QT 2J98B 2EQNA 3JZ2B 1OP8A 1SGFG 1QIXB 1SGQE 1UTMA 1AY6H 1WSSH 2BQ6B 2VJ1A 1JIMA 5DKMA 2FO9A 3A7TA 1O5EH 3MU0A 3GY3A 2VU8E 2EI8A 1V2RT 1YPJH 3VB4A 3BTTE 2FI5E 1GBTA 2AGGX 3KHVA 3T27A 3ZV9A 5ETXA 1J8AA 1VCPA 2ZDMA 1MTVA 1L1GA 2XXLA 4U01A 2VIDA 4JYTA 1G3BA 2H1UA 4CR9A 3OAAD 2HVXA 1C4V2 2FXRA 2F9NA 1MQ6A 4K2YA 1C2LA 4LZ1H 1C2EA 1O2NA 3F9FA 1NY22 2BDCA 1AU8A 3EE0B 1E1QD 1TWXB 5LH8A 1AFEH 1TQ0B 1W2KH 4JZFH 1XMNB 1C2DA 1SGEE 1C5WB 2HPQH 3EA7A 4GCHG 3PO1B 1O3GA 1SI5H 1O5CB 3BF6H 1PYTD 4HGCA 1OX1A 3IWMA 5C1XA 1C2FA 3TK5A 5FXLA 4KTUA 4XBDA 3EDXB 1VCQA 3P70B 3BTDE 3PV5A 2ZCLP 4ZUHA 1P9SA 1A0LA 2WV4A 1QY6A 1PPFE 1OKXA 1C4Y2 4AOQA 5FBIA 1SL3A 2OLGA 1RFNA 3TNTA 3SNBA 1FPHH 2P16A 5A8XA 3S0NA 2TIOA 2BVRH 1JBUH 2ZCKP 1TNJA 4Y0ZE 1WV7H 5A0AE 2FEQH 3UREA 2FYQA 1CA0B 1TGNA 4MPUA 2YMSC 4JYVH 3HPTB 2GZ8A 1HYLA 2VBCA 3F3BA 3PV4A 1ARBA 4MLFB 3AW0A 3RC6A 3TK6A 1J9CH 5HXFA 3CS0A 4X2YA 1INCA 5EOKA 4ZXXH 1GBFA 1KSNA 4K69A 4OGXA 5TCCA 1OSSA 5L2ZH 4FVDA 5FPTA 1C2MA 2FX6A 1ZSJA 5F53A 5T6DA 3MOCA 2Q1JA 4WMEA 2GD4B 1NN6A 4OS2A 1JOUB 2WPKS 4CHAB 3PV2A 3TPIZ 3GDUA 1D6RA 3LOXA 3PLBA 1EATA 1C1VH 4TWYA 4Z1MD 3RXGA 2FPZA 1GJ4H 1SGFA 4YT7H 4U32A 4B1TA 4B74A 1YKTA 3FANA 1C4U2 3DA9B 1GCTC 2IPHA 5L6NH 1LKAA 4AB8A 2D8WA 1HAZB 1HXEH 1TABE 4FUFA 1G32B 1NT1A 1C2IA 1QA0A 2TGPZ 3NK8A 3KYGA 2VH6A 1YPGH 5PTPA 3SJIA 2JH5D 3T29A 1OWEA 3GYLB 1P03A 9LPRA 1D9IA 3MO9A 1BB0B 1UO6A 1XUKA 3LJJA 5A8ZA 1IQHA 4TYDA 3VXEH 3UQVA 1TE0A 2XNDD 4TPYA 4JMYA 3VFEA 1P11E 1SLUB 4K3JA 3OY6U 4DW2U 2FOGA 1K21H 1Z8RA 1RRKA 1CO7E 3U8OH 3UNRA 1JXPA 2SGDE 2GDDA 1GI9B 3D23A 3RLWH 1AQ7A 4OS7A 1UTLM 2BOHB 3W95A 2IPQX 5HIZA 1AB9B 1CBWC 3GOVB 1EB1H 2DE8A 2PTNA 4CH8B 1LPGB 2P8OB 1QJ6B 2PR3A 1FMGA 3HGNA 3UWJH 3VPKA 1BTZA 1AKSA 1FX0B 1TGCA 2GV6A 5JBCS 3DSPA 3VXFH 2WUBA 2FMJA 1CVWH 1NU9A 4AGJA 2FTLE 2W7SA 3S7HB 1SFQB 4A1XA 3TGKE 1FPCH 6LPRA 8KME2 2G4TA 3P8GA 2R0LA 1S6HA 1Y5AT 2K8IA 4IN2A 3IITA 5FCRA 1O3PB 1KTTB 4NIXA 2IOTA 2SGPE 5C5OA 3SJ9A 1EOLA 1A46H 1CT4E 3RXLA 4ZMAH 1DDJA 1SGIB 4LXBH 4WJG2 2VGCC 3M7UA 4O3UA 1ANDA 1EFRD 4Z6AH 1F0RA 3LC5A 3A7WA 2P95A 2Z3CA 2A5KA 2PSYA 4MNYA 1DFPA 3SU4A 5A09A 7LPRA 1ELCA 2H5CA 5C94A 5DP7A 1L4DA 5E0JA 1KXBA 1J16A 1S5SA 6CHAB 2SNWA 1ID5H 2V3OH 5GIBA 5TCAA 2PHBA 6ESTA 1Z6JH 3RXCA 4BANB 2BXTH 3P95A 3D65E 2I6SA 1NU7B 4K1TA 1CA8B 3U8TH 1GHZA 3GCTF 2PKAA 5GDSH 2OBQA 2BY6X 1OWJA 1C5ZB 3GCTG 1SQRA 3N7DA 2CK3D 2ANMH 3SV2H 3M61U 3QTVH 3UY9A 1BTYA 2G81E 4FUCA 1V2KT 3A82A 3U8RH 5GJ4B 3DFJA 1OWIA 1C5YB 1GMHF 1GMHG 1MUEB 3SZNA 2ZGHA 2CF9H 2GTBA 2ZO3H 3FP8E 4WMDA 3RXHA 2ALVA 3C1KA 2HWLB 3WY8A 2TPIZ 4INLA 2GMTB 5JBAS 1MTSA 2JJ1D 2B8OH 1O3FA 1EPTA 4ACAA 2BY7X 1HAXB 1SQTA 5EG4A 2BYAX 1MD8A 1SGRE 4DCDA 3KF2A 2EC9H 1O3MA 1SG8B 2VWNA 4BOHA 1MAYA 2FOEA 4NSVA 2HPPH 2JDID 2BLVA 1QL8A 4X8UH 3TU7H 1EZQA 2Y81A 5C17A 2JH0D 3I77A 5JB9S 1AHTH 1UW7A 2ZFTA 5IYTA 1TBQH 1O3EA 1YLNA 3LJOA 1H8ED 4HI3A 1UHBB 3RXKA 2AH4X 4UFFH 1NFYA 2F91A 4I8HA 3ZVAA 1A2CH 1ESBA 4B73A 2XWBI 1ARCA 5LPEA 3PMJA 1GBBA 1WCZA 2GKVE 1ZJKA 4NCYA 4MPWA 1UTPA 1ELBA 1CU1A 1F92A 3PWCA 3R0FA 1BTUA 2Y5GA 3A88A 3S9BA 1GMCF 3AASA 2ZECA 1C1OA 1FLEE 1A61H 1NBME 1N6YA 4AB9A 2R3UA 1BITA 1YF4A 3LT3A 1NM6A 3AAVA 2WSSD 1GBHA 2BM2A 3RM0H 1P2NA 1LTOA 3F9HA 3N99A 4PROA 3ITIA 1P2JA 4F48B 1K1IA 4ABGA 1HAVA 3DT0H 1MBQA 3PO1C 2C8WB 1P8VC 4MVNA 1FIWA 3EE7A 1K2I1 2BDYA 2ZPRA 3MQKC 3A85A 1O39A 4ZKRU 3RXBA 3D49H 2J9NA 3GY2A 4DURA 1UVUH 1P06A 2KAIB 3RC5A 1UTKA 1V3XA 2LNCA 4CBOA 1VJAU 5FCKA 2GCHF 2W7UA 1H9LB 1UK4A 1EJAA 4IMZA 3MO6A 2GCHG 3SOSA 8GCHF 4D9RA 4BTTB 1LQEA 1B5GH 3RXFA 2WYJA 2ZFFH 1MKXK 3B9FH 4JZEH 2OC0A 2BOKA 2GZ7A 3TH4H 1O2QA 3MWIU 1O2YA 4ASUD 1ZGIA 1WXRA 1QTFA 2A2QH 1DPOA 1T8LA 1OPHB 2XC0A 1TPAE 3KQBA 2ZFSA 2FOAA 4A7IB 2RDEA 1B7XB 1GBJA 1KXEA 2JKHA 4KGAA 5CDFE 4MDSA 4Z0KA 1LHEH 4K5ZA 1G30B 1SLWB 3M3TA 3K65B 4E05H 3RXAA 1FY8E 1SC8U 1SQAA 2IJD1 2H9HA 1YY3A 3OYPA 4Y8XA 3SI3H 3MYWA 1O0DH 1BTHH 3GCNA 4I8GA 5DP4A 3H7TA 3ELAH 4CHAC 1ELFA 1YPHC 1NROH 1RTKA 2FODA 1SLVB 1TYNA 2XWAA 3Q3KA 1SKYE 1FAXA 1OYQA 1J14A 2P94A 1C2GA 2ZHFH 1ABJH 2A4GA 2SGFE 3HK6B 1GI0A 3UUZA 1EAXA 3NZIA 5EW2H 1HV7A 1G2LA 1ELTA 4I8LA 1AUTC 2A7CA 2UWPA 2ZIQH 2OBOA 3M3SA 4JYUH 4IW4E 3MHWU 3BEIB 3MNBA 5KECA 3TH2H 3NPSA 5JBBS 3ZVDA 1ELAA 2H6MA 2Z9GA 1P2IA 1UVTH 3TGJE 4WVPE 3BG4B 4ZKNU 1MZDA 2PV9B 2Z94A 5C3NA 3CENA 5GWZA 3V13A 1CHGA 3QGJA 1MD7A 3TIUA 3AW1A 3E3TA 4NGAH 3STJA 1RS0A 1TPOA 1E34B 3P8FA 1HJ9A 2KX4A 2A5AA 2R2MB 3OEHD 5C1UA 1KIGH 4NWLA 1SGPE 1AUJA 2BDAA 3RXMA 1PQ7A 1QFKH 3ATMA 1GHXH 4FU9A 1GGDB 1AB9C 3RXUA 1RGQA 4MNVA 1T4VH 2ODPA 3ZZ3A 4NA9H 4NIVA 2PGQB 2P8OC 3HGPA 1LQDB 2BX3A 1PQAA 2A31A 2W6ID 4FUHA 3SHAH 3SJ8A 3E90B 2QC2A 4LK4A 2FOCA 2VVCA 1O3HA 2ZI2H 2ZZUH 1FDPA 1PYTC 3W1EA 2AS9A 3OTJE 2UUJB 1LKBA 4ZH8A 1EX3A 1JIRA 1ZGVA 1QQUA 3ZIAD 1O31A 5EJZA 1FY3A 4RSPA 1P9UA 1O3LA 1UCYK 5GCHF 1BHXF 2G52A 4OS4A 2ZDNA 1CGIE 3M36A 4Y79A 3PLPA 1GI5A 3ZZBA 3S9CA 2NU4E 1G3DA 3A8CA 2CN0H 2O8WA 3EQ0H 3GICB 3SO3A 1ELDE 5FAHA 1KXDA 1NC6A 1O3IA 1UJ1A 2PW8H 1ETSH 3EAJA 3VEQB 1CHOG 3RXRA 3MMGA 4BAHB 2DUCA 5A8YA 3TGIE 1IQEA 1WUNH 1BBRK 2TRMA 5EIYA 1GHAF 1NRPH 3OSYA 2BTCE 5DP3A 1EAIA 1D3PB 2R3YA 6CHAC 4DOQA 2CJIA 2BY9X 5KEDA 5I46H 7GCHF 1LVBA 2F9BH 4XFQA 4BAQB 7GCHG 3SGAE 1V2LT 1AD8H 2F9PA 3S7KB 1IOEA 1C1QA 3TITA 2RFKC 3BSQA 1LCYA 3QWCH 1AE5A 3O8CA 1HB0B 2RCEA 1WYKA 5CE1A 1ZPBA 2WZQA 3GY5A 3PTNA 1CT2E 1V2ST 1HBTH 5DP5A 2GVFA 4Y8ZA 1J17T 1K28D 1ZPZA 4Q7YA 1IQFA 3SW2B 1P2MA 1C5XB 3PMHB 2FWWA 2PFEA 2TGAA 3E6PH 2OC1A 1LVMA 1ZTKA 5FHTA 1S6LA 2OINA 3SORA 1TNGA 2GMTC 3TH3H 5C5NA 4GVUA 4J2YB 1VZQH 1LHGH 3UIRA 1V2TT 1AKSB 1ZMLA 2CHAC 2J4IA 3SJOA 2EA3A 3MNXA 5EXMA 4ZHMU 2OC7A 2Y6TA 3O8BA 1EKBB 1C5TA 3P17H 1HLTH 1NZQH 1O5DH 1BT7A 1P04A 4HZHA 1KYNA 1GMDF 2O8LA 4OS1A 5EPNA 2FTMA 5EQRA 4H42U 4YT6H 3P8NA 2PKSB 1QL9A 1AMHA 1UTQA 4DIIH 1C5SA 1K1MA 1O2HA 1PJPA 2QXHA 3RMLH 1Z6EA 4YLQH 2A2XH 5HGGA 5L30H 1YPHE 1GBKA 1DM4B 2LP6A 2Z9JA 1P10A 2KCYA 1NTPA 1QJ1B 3MU1A 3A87A 2W5EA 1SHYA 5HYOA 2GP9B 4XE4A 1DY9A 1O2GH 3LGVA 1GJ7B 4YXWD 2QCYA 4GLYA 3F9EA 1ELGA 1W14U 2QXIA 1YCPK 3KGPA 1TMTH 2ILNA 4D76A 3GCHB 3SU1A 4KTCA 1GHBF 1IHSH 2FLRH 3ZZ4A 3A8BA 3ENSB 4AORA 2QIQA 1GG6C 4M7GA 1F2SE 1AI8H 2Z9IA 2SGQE 4F55A 5F8XA 4CREA 1O2VA 1GCDA 1NFXA 1WU1A 4DVAU 1K1JA 3NKKA 2F3CE 4Y10E 3UOPA 3KNXA 4DIHH 3SUGA 3SU6A 1MU8B 2YOLA 3SV8A 2PKAB 1W3CA 4ZXYH 4ESTE 1ABIH 6GCHF 1A5GH 4X1QU 1OHHD 3SN8A 1QHRB 1EJMA 1CGJE 1SQOA 2VWMA 8LPRA 3A8AA 5JBTA 3U1JB 4ZKSU 1AN1E 4MNWA 5HMAA 1S81A 4AFQA 5B6LA 2WUCA 3URDA 4RT1A 5L2YH 2G51A 1HIAA 1Z1JA 1BJVA 3I29A 1NRQH 3T5FH 4DT7B 3O8DA 1YBWA 1IQGA 1EPTB 1ZHPA 3OY5U 4K1EA 1SGTA 3RLYH 4ABAA 4NZQA 7KMEH 1O35A 4IMQA 1TIOA 2R2WU 2ZHEH 1FY4A 3T25A 3TJVA 3VB3A 2FI4E 3T62A 3GY8A 2HRVA 4IS5A 2VIPA 1XX9A 1DWEH 4X8VH 5DO4H 2BD8A 2ZTZA 3E1XB 1Y5BT 3DSOA 1DSUA 3F9GA 1V2NT 1QA7A 1LDTT 1VCWA 3TLOA 5DPAA 4JZDH 4Q4LA 3Q3XA 1MCVA 3KCGH 1RTFB 2AERH 8ESTE 2NU1E 1MAXA 1HXFH 5EXLA 4IBLH 2WPIS 1ZHMA 3LPRA 1LVOA 1U6QA 1HAPH 1QBNA 5AFYH 1OP2A 4KKDA 3SU3A 1GL1A 1UK3A 2Z3DA 4INHA 1TA6A 2J5UA 1L1JA 2ZCHP 2OCVB 4CH2B 1DX5M 1TNHA 5GNDA 1GJDB 5E2PA 3QTOH 1GBCA 2PSXA 1GWAA 2GT7A 1Q2WA 3FFGA 5T6FA 4THNH 3SZEA 1GJAB 2Z6BD 1QJ7B 5CMXH 1ZMJA 2P3TB 4E06H 1AZZA 1WQSA 4P00A 3ZZCA 4Q63A 4YESB 1XXDA 4YLUA 4X1PU 4NG9H 1XXFA 1QBVH 3MH4A 3ZVGA 3A7ZA 1K1PA 1SGYE 1TRNA 3TJUA 1H4WA 2G55A 1O2IA 3GY4A 2G4UA 3QX5H 3W94A 4XD7D 2G5VA 1N8OB 3RXVA 3RU4D 3S9AA 3T28A 2ESTE 3F68H 1FV9A 4WXVA 4U30A 2UUKB 1GGDC 1HJAC 3MI4A 4FUGA 4B75A 1HAIH 3NRLA 1EZSC 1G37A 3VG8A 1GBEA 1ELEE 4AGKA 5AVDA 1A0JA 2QE7D 3P6ZB 4ABDA 2OC8A 5CHAB 3A80A 4FUEA 3TVJB 5DP6A 2QF0A 4YOJA 2CXVA 3KIDU 4RKOB 3U98H 4X1RU 3QLPH 5E2OA 4SGAE 1HJ8A 3VB6A 1EZUC 3GY6A 4Q7XA 4WH6A 2PUQH 2NU0E 3N7EA 2XOKD 5LPRA 1EP5A 3VB7A 4OM9A 1TRYA 4MNXA 1S0RA 1GHWH 3SQEE 1SOZA 4MPVA 1FJSA 1TX8A 1MTNB 1EAWA 2AEIH 1EJNA 1GJ8B 2QGRA 1TMUH 3UPEA 1BMLA 2QF3A 4ZAEA 1P0SH 1O2XA 4R8TB 4K8BA 3LDXH 5B6OA 3HKIB 2JETB 5ESBA 2VNTA 2C90B 4FXGH 2VIQA 1XUHA 1N1LA 1MU6B 4HFPB 2BVSH 4LZ4B 1TA2A 2ZA5A 2VVUA 2GCTB 1D4PB 1FY1A 3SJKA 3PMBB 1XUIA 3M3VA 5DP9A 3LONA 1GVZA 3UWIA 3GDSA 2ZF0H 3ATKA 1H9HE 5C67A 2ASUB 1BDAA 2XRCA 3RXSA 2AGEX 1A4WH 2FDAA 2SGEE 1P12E 3WWFA 4AYYB 3M7QA 1BMNH 3GY7A 4TPIZ 1GI6A 3NWUA 1C5QA 4F4OC 1YP9A 1O30A 3UTUH 3ZZ5A 4MQAA 3BTWE 1TGTA 2TGDA 5F8TA 4E7NA 1ETRH 2WV5A 1MBMA 3OEED 1GI2A 1GI3A 1GL0E 2HLDD 1LPKB 1LPZB 1QRZA 4NA7A 3SNAA 1WBGB 2AYWA 1QRXA 1UTJA 1OOKB 1F5KU 4F49A 2XCNA 2ZU1A 1JWTA 1E37B 4KELA 2WV9A 2XW9A 2PP6A 1RTLA 1BMFD 3LKWA 1ESTA 2ZNKH 1NFUA 3BTQE 3KEEA 1M9UA 1S83A 2CV3A 1LMWB 1L2EA 4ISNA 1VGCB 1MKXH 2IJOB 2BMGB 2A32A 3B23B 1Y59T 4TY7A 1GMCG 5AF9H 3PB1E 3ATIA 4X1SU 3LGIA 1YYY1 1GDQA 2UUFB 1O3KA 1Y3YA 1QB9A 4X2VA 2BQ7B 3QZQA 4INKA 2TBSA 2ZGCA 1QCPA 1HFDA 3F0PA 1QR3E 3SU2A 1C1TA 2BDGA 3KQEA 3OE7D 3FVFB 4X8TH 3AVZA 1QRWA 1GBAA 1T32A 4BXSA 1BTWA 1C1WH 5FPSA 1OYTH 2ZDAH 2H2ZA 1QBOA 2J97A 1PPBH 1O2RA 1TBRH 3CS7A 1XM1A 3V7TA 5H4IB 1TQ7B 1TPPA 2SGAA 1BA8B 5ABWA 1HRTH 1OWDA 4Q80A 4Y7AA 4AFZA 4FETA 1O2KA 3E91A 3MH7A 1FIZA 5EJ1A 1ZRKA 1FN8A 3GDVA 8GCHG 4IC6A 4ABHA 1K1LA 2WPJS 2H5DA 3FN8A 1O2TA 1CA0C 3ZZAA 3UAIC 4M9FA 3OU0A 3D62A 3WWBA 1K1OA 2PTCE 5EODA 3A7XA 5EQQA 4GHTA 2BLWA 3WW7A 1RIWB 5JYIA 3H5CB 2G8TA 4B2BA 3SHCH 1DICA 4Y11E 1W12U 2H9EH 2Y80A 3IG6B 1D3QB 1RXPA 4Y8YA 3K6ZA 3SV7A 1AWHB 4X6OA 3PMAB 1GVLA 1MTUA 1Y3WA 3AAUA 1DWDH 4I31A 1ZOMA 2Z7FE 2VIVA 3C27B 1W0ZU 1SGNE 4FUBA 1P02A 2FOBA 3PYHA 1FXYA 4D8NA 1O2OA 2VWOA 3LGYA 1FQ3A 2Y5FA 2EEKA 1GDUA 1CSOE 1IQMA 2M2AA 1C5MD 2ZQ1A 4X2WA 1C1SA 4H6SB 4OS6A 4TSFD 1EPTC 3SYJA 1E38B 2C4FH 3OX7U 1T31A 2HALA 2P3UB 1G9IE 1SGCA 2BDIA 4CRCA 1KLIH 3QN7A 1KXFA 4RKJB 2F9VA 1C5UA 1VITF 1KLTA 2FIRH 1VITG 3BTFE 2W3KA 3DUXH 1FI8A 4CRBA 3E16B 2ANYA 3DFLA 3E0NB 3GISB 2JH6D 1P57B 2VIOA 1A5IA 2ZHDA 4HG6A 5C20A 4AG2A 4CBNA 4AFSA 4Q2KA 1UCYH 3CP7A 3ZZ7A 3KQ5A 1B0EA 1HGTH 5K7RA 3QUMP 4X0WU 1SGDE 2GX4A 1F5LA 4XSKU 3MH6A 4ZROA 1W13U 4ABIA 2Q6FA 1XUFA 3U69H 1O3OA 2WHXA 2KZ4A 3F2FA 3FKSD 2A4QA 1ZZZA 1YGCH 5EQSA 4UFEH 4B6FA 1DANH 5ESTE 3MO3A 3H7OA 1AVXA 1NO9H 1W0KD 2FOFA 5AFZH 2FP7B 4CRAA 1BBRH 4KP0A 5FL7D 1Z71A 2ULLA 2ANKH 3UNQA 2CMYA 4AG1A 2A45B 2C3SA 1A3EH 2ZC9H 4ABJA 1F0TA 2ZGBH 1SR5C 3DSGA 1KMHB 3BTGE 2RDLA 2QYIA 3K2UA 3E0PB 2F4LA 3MH5A 3SQHE 1IQNA 1ZYOA 4Y7BA 1W11U 1GDNA 1VJ9U 4Y6DA 2PWXA 4ISLA 2HOBA 3V3MA 1EZXC 3RXJA 2W3IA 2B0FA 3SNCA 1AVGH 3BG8A 5HM2A 1O3AA 1C9TA 3KL6A 1C5NH 2LPRA 5T1VA 5FX6A 3KQCA 2SNVA 1MZAA 2GGVB 5GCHG 1AFQB 3T26A 5A2MH 2UUYA 1ZSLA 2A4OA 3S69A 1Q31A 5T6GA 1GHYH 3GS9A 3F1SB 1HIAB 4GHQA 3UB0A 4UONA 1BRCE 2STAE 3LH1A 2G5NA 1EQ9A 5CHAC 5HKKD 1QZ8A 1WAYB 3BEUA 5C1YA 1B0FA 2J2UA 1SB1H 2JJ2D 1ZMNA 1C5RA 1GJBB 4P02A 1TPSA 4RT0A 5EU8A 3QGNB 4ISHH 2F9OA 1GHAG 1SOTA 2AMDA 1E0FD 1T8NA 1TAWA 2VWLA 4BNRA 3SGQE 4YOIA 1Y3UA 5EW1H 3RC4A 4AX9H 1TALA 2F83A 4BTUB 5BRRE 2WINI 3ZZ6A 2WYGA 1K9OE 1XVMA 1D3DB 3MFJA 1HAGE 1AIXH 2JETC 2D2DA 3P8OA 3M5OA 5A0CA 4XBCA 1P09A 3LGWA 2A7JA 5A0BA 1WOFA 3E8LA 4B2AA 1TRMA 2BHGA 2FOHA 2OQ5A 2ZPQA 2A4RA 1HAOH 1FUJA 2BDBA 4ACBA 1EAUA 5DG6A 1XKBC 1YPEH 2WPHS 2AMPA 1EP6A 1PQ5A 3Q77A 1YCPH 4A1TA 1HAYB 2IN2A 1O33A 1TOMH 2BX4A 3V12A 1A0HB 4FUJA 2OP9A 2Z9KA 1F0SA 4MG3A 1FZZA 1MABB 5F03A 3L33A 1RJXB 2ZFPH 1KXAA 3A83A 4XRNA 5EPYA 1C5OH 3H09A 3M5MA 3QK1A 2GJGA 1YWUA 1A7SA 5CHBA 1V6DA 2W26A 3QO6A 4XDEA 1BZXE 2UWOA 1ZJDA 1ELVA 1GBIA 1DUEA 5G4BA 2G00A 1P3CA 3PM3A 1GMDG 4I86A 4FU8A 2R9PA 4VGCB 1ANCA 2QF5A 2JIZD 4NFFA 2BLOA 3Q3YA 3VGCB 4ISOA 3RP2A 3A7VA 4Y0YE 1W7GH 3SNDA 1C1RA 1O3NA 4AYVB 1IHTH 1XKAC 1LHFH 3NCLA 2QN5T 5JB8S 2BQWB 1VGCC 3RM2H 5EJLA 1FY5A 1TX6A 1V2PT 3ESTA 4H6TA 1T4UH 5I25A 1AVWA 1D3TB 4Y76A 1ZR0A 3ZVCA 2A5IA 1JRTA 1GHBG 1C1UH 4GCHF 4JK6A 1WQVH 7ESTE 5K0HA 5HM9A 3MU4A 5LGOA 2A1DB 2QXJA 3EGKH 2VH0A 2ZKSA 3B8JA 2XBYA 4MPXA 1C9PA 3A84A 2NU3E 4X2XA 1UVOA 2ZU4A 3AK5A 2OXSA 4UFDH 2C8YB 2J94A 1OWKA 1P2KA 4B6EA 1E36B 1KLJH 2AIPA 4GPGA 3HKJB 6GCHG 1SFIA 4ZHAA 3SV6A 1O5AB 4GUXA 1V2OT 3K6YA 5DJ7A 4AZ2B 2BD9A 3MNCA 5GPIB 2ZPSA 3LC3A 4K8YA 2FLBH 1BJUA 1P2QA 3DHKH 3A89A 1PPGE 5C0TA 1NRSH 2ANWA 1AE8H 3SUFA 2ZDKA 2C8XB 1O2JA 3EA8A 2BVXH 1LVYA 3M7TA 5DGJA 1E1RD 1H9IE 1KDQA 1YPLH 1MKWH 4BAOB 4ABFA 1RIWC 3DD2H 1KY9A 2F43B 1ZSKA 4FUDA 4K60A 4B71A 5JPMH 4TY6A 2ZTXA 2ALPA 2FS9A 2FZZA 3RUOA 3ZYEA 5FPYA 1P2OA 1Y3XA 3ZZDA 2CGAA 1ORFA 1YC0A 1UTNA 3F6UH 4ASHA 4NIYA 1DT2A 2LELA 4YO9A 3U1IB 1O34A 1TB6H 1L4ZA 2KCAA 3M35A 3BIUH 2I6QA 2WPLS 2FYRA 4AN7A 1O3CA 2BD3A 4UEHH 1TOCB 3ODDA 2AGIX 4U2WA 3UR6A 2STBE 1SVPA 1A1RA 1P01A 2D1JA 1ESAA 3K9XB 1O2SA 1C1MA 1P05A 4JZ1A 4SGBE 2HNTC 3ATLA 2NWNA 2OD3B 1BTXA 3ZVBA 1O3BA 5BPEA 1NPMA 5C2ZA 3BV9B 5DSFA 1MKWK 1GJ9B 1O2PA 1V2UT 1GJ5H 3EA9A 5DN6D 3BG4C 3PTBA 4IN1A 4WY3A 4XBBA 1HAVB 1EXFA 2V6NA 3Q76A 3UR9A 1BTPA 2J98A 5TJXA 1JRSA 2YNBA 1VR1H 2O9QA 3UNSA 1THRH 2Y5HA 1GI8B 3OTPA 4JK5A 4O97A 1TBZH 2AIQA 2K0QA 2ZQ2A 4QT8C 3EYDA 3MU8A 3O8RA 2ZWLH 3SU0A 1ZLRA 3PLKA 1G3EA 2VINA 1O5GH 1SBWA 1V2JT 4XOJA 4FUIA 1F0UA 4YOGA 3LGTA 1VKYA 4NWKA 1FONA 1PPZA 4E7RG 2ZDVH 5IK2D 2Z9LA 1DUAA 1O2ZA 1NRRH 1V2WT 3ZZ9A 3BTKE 1O2UA 1ZTJA 2BZAA 4BXWA 1YPKH 3RMNH 1SPJA 1GJ6A 1ZPCA 1H8IH 3MNSA 1T7CA 1ANBA 1Y5UT 5EXNA 1W0JD 2YMSD 5C0UA 1E35B 1SHHB 1YPMH 1O38A 2OQUA 4BAKB 2PLXA 1PQ8A 1TONA 4A5TS 1NS3A 1CE5A 4WWYA 2B5TB 3UFAA 4D9QA 1BQYA 1AFQC 1EB2A 4YTAA 1FN6A 4UFGH 4I7YH 5SGAE 2GT8A 1OS8A 2ZP0H 3KYFA 1W8BH 4YZUA 4NA8A 2H9TH 2BY5X 1QNJA 1PPCE 3SI4H 2J95A 2KM0A 4X6MA 1O32A 3SV9A 1HDTH 2V3MA 2QV1A 1IQIA 1UMAH 2AHME 2Y82A 3Q00A 4ZHLU 2AMQA 1N6XA 1J15A 1S0QA 1THPB 3QZRA 5JDUB 3BIVH 1GBLA 2B7DH 2XBVA 3KN2A 3LGUA 2P3FH 1K0HA 1Z8JB 2XTTB 2GDEH 3RMMH 1NESE 3FOAA 4AC9A 1JMOH 1BRAA 4YM9A 1Y8TA 2RG3A 1QURH 4R0IA 1NBMD 3RU4E 2FX4A 1WDIA 1SLXB 1DWBH 1TMBH 1TNLA 1O36A 4X8SH 1Z8IB 1ZRBA 5DP8A 4CR5A 4CRFA 1HPGA 2XBXA 3RXQA 1SSXA 1O2LA 1O5BB 1V2MT 2QA9E 3FP7E 1MH0A 2ZFQH 3G01A 2GV7A 2BY8X 4I33A 2WPDD 2FESH 1DS2E 2ODQA 1TFXA 3VB5A 4NFEA 4ABBA 1GHVH 1O37A 2QF4A 4ZKOU 2XC4A 1AZ8A 3NXPA 1WTGH 4IGDA 5T3HA 2BDHA 4O9VA 3P92A 2W6JD 1BRUP 4TT3D 2CHAB 5HIYA 1KTSB 4NIWA 1VITH 3NUMA 4ISIH 1C2KA 3SBKA 3HK3B 3QDZB 1T8MA 1XUJA 4TWWA
chains in the Genus database with same CATH topology
1S6FA 2QY0B 4A6LA 3SUDA 4NSYA 1C1NA 3FZZA 5J4QA 2NU2E 1C1PA 2GZ9A 4D7FA 1C2JA 2OTVA 1CT0E 2QXGA 2A7HA 2PKSC 4VGCC 1RD3B 1DLEA 1AO5A 1IQLA 2XNIA 4DG4A 2VVVA 1D6WA 4K1SA 3VGCC 2P93A 3GCOA 1DVAH 2XCFA 3L3TA 4X6PA 3RDZA 1FAKH 1FNIA 4CRGA 2WPMS 1P3EA 2XYAA 3RXDA 3L6PA 2ZGJA 3RU4T 1AWFH 1DXWA 2ZU5A 4WH8A 3JZ1B 5E8EH 1C5PA 3BN9A 1GJCB 3BTEE 3GCHC 4I32A 1GG6B 1QGFA 4X6NA 1DXPA 3URCA 1HAHH 2HNTE 2RA0A 2VB0A 2R0KA 2P59A 1O2WA 2SFAA 9ESTA 3I78A 1WTHD 2Q6GA 1W0YH 3ZVFA 1EUFA 4MTBA 3SGBE 3SU5A 1Z1IA 2RA3A 4DGJA 3LIWA 1TGSZ 1ACBE 3M37A 4WF8A 1ANEA 1TNKA 1W10U 3A81A 1DY8A 2PGBB 2ZHWH 5E0GA 4UDWH 2CF8H 1S85A 1L1NA 1K22H 1C5VA 1MCTA 3RXEA 1MTWA 2DE9A 1OXGA 2ZHQH 3ZV8A 3A8DA 5GXPA 4UD9H 2YNAA 1BCUH 4IC5A 3SUEA 1CGHA 1HUTH 2A0QB 5F8ZA 3HATH 1C5LH 2B9LA 4KTSA 4RN6A 2ZU3A 3R3GB 5DK1A 2V3HH 3A86A 4FVBA 4I8JA 4BAMB 1TGBA 1GCTB 3FAOA 1BOQA 3TK9A 2O8MA 4OGYA 2BD5A 2ZG0H 1G3CA 4O03A 4I8KA 1XUGA 3MTYA 4WXIA 1HNEE 1LHCH 2O8UA 2ZGXH 1IQJA 1LHDH 2BXUH 3RXTA 3TJOA 3GYMA 2XBWA 4NZLA 3BEFB 1LO6A 2FS8A 4AFUA 1DWCH 2BD4A 2K1QA 2J34A 1TLDA 1XVOA 4LOYH 4H4FA 1YLDA 1PPEE 3ZVEA 1TX7A 1MQ5A 1F7ZA 1GVKB 2ZDLA 2F9UA 1G2MA 1PFXC 1GBDA 2V0BA 1C2HA 1UCYE 5EGMA 4X1NU 4B2CA 1DLKB 3A7YA 1AGJA 3SNEA 1HCGA 1F5RA 1Z8GA 2ZTYA 2VIWA 1O3JA 1T8OA 1OP0A 1BHXB 1CQQA 2EI6A 4GAWA 1CBWB 1MMJN 2THFB 2XC5A 1A5HA 3PROA 1S84A 2C93B 1G36A 2ZFRH 4FU7A 2BZ6H 4Y71A 3LH3A 3MU5A 2ODYB 2V35A 1GI7B 3STIA 3ODFA 3FP6E 1DSTA 4OS5A 3T2NA 2BD7A 3ZZ8A 2BB4A 2ZU2A 1BBRE 2HNTF 2PUXB 2FOMB 1GI4A 1X7AC 1UHBA 1N8OC 2BD2A 1HJAB 1IQKA 3M5NA 1PPHE 1QL7A 5AHGH 1ZHRA 2Z3EA 1BMAA 3KQDA 3RXOA 4GSOA 1TNIA 3M5LA 4O3TA 2ZEBA 2Y7XA 4WMFA 1IAUA 1BRBE 3ZYDA 4ABEA 1BUIA 4D7GA 1DITH 2Q6DA 2VGCB 5J4SA 1YM0A 5IDKA 1KDQB 2HGTH 1NRNH 3RMOH 2FI3E 3U9AH 5FX5A 1GI1A 1L0ZA 1O3DA 1BMMH 1Q3XA 4A92A 2HLCA 1O5FH 1GBMA 3BTHE 1UTOA 2J92A 3BTME 1NFWA 1KXCA 1QB6A 2FM2A 4JZIA 1SMFE 4A1VA 4JCNA 4DY7B 1DOJA 1BIOA 3RXIA 2QAAA 4J1YA 1W7XH 1MTNC 1CHOF 1UVSH 2BLQA 1UVPA 2EI7A 5FBEA 4Q7ZA 1GPZA 2KAIA 1ETTH 1THSH 3V0XA 1A3BH 1K1NA 1UK2A 4DJZB 2UWLA 1OWHA 4UE7H 1H8DH 1QB1A 4B76A 1V2VT 5LPFA 2TGTA 1QQ4A 2J38A 3N7OA 5E0HA 5F6MA 3FZDA 4CRDA 1S82A 1EASA 3LU9B 1H1BA 2O8TA 2GCTC 1Y3VA 1YCPM 2D26C 1DE7H 3PWBA 3ATWA 1ZTLA 4BTIB 3UOUA 2AFQB 3TJNA 4HTCH 2Y7ZA 2OUAA 2C8ZB 1EOJA 3TNSA 3RXPA 3UQOA 2M5TA 1O2MA 1YLCA 1Z7KA 1V2QT 3JZ2B 1OP8A 1SGFG 1QIXB 1SGQE 1UTMA 1AY6H 1WSSH 2BQ6B 2VJ1A 1JIMA 5DKMA 2FO9A 3A7TA 1O5EH 3MU0A 3GY3A 2VU8E 2EI8A 1V2RT 1YPJH 3VB4A 3BTTE 2FI5E 1GBTA 2AGGX 3KHVA 3T27A 3ZV9A 5ETXA 1J8AA 1VCPA 2ZDMA 1MTVA 1L1GA 2XXLA 4U01A 2VIDA 4JYTA 1G3BA 2H1UA 4CR9A 2HVXA 1C4V2 2FXRA 2F9NA 1MQ6A 4K2YA 1C2LA 4LZ1H 1C2EA 1O2NA 3F9FA 1NY22 2BDCA 1AU8A 3EE0B 1TWXB 5LH8A 1AFEH 1TQ0B 1W2KH 4JZFH 1XMNB 1C2DA 1SGEE 1C5WB 2HPQH 3EA7A 4GCHG 3PO1B 1O3GA 1SI5H 1O5CB 3BF6H 1PYTD 4HGCA 1OX1A 3IWMA 5C1XA 1C2FA 3TK5A 5FXLA 4KTUA 4XBDA 3EDXB 1VCQA 3P70B 3BTDE 2ZCLP 4ZUHA 1P9SA 1A0LA 2WV4A 1QY6A 1PPFE 1OKXA 1C4Y2 4AOQA 5FBIA 1SL3A 2OLGA 1RFNA 3TNTA 3SNBA 1FPHH 2P16A 5A8XA 3S0NA 2TIOA 2BVRH 1JBUH 2ZCKP 1TNJA 4Y0ZE 1WV7H 5A0AE 2FEQH 3UREA 2FYQA 1CA0B 1TGNA 4MPUA 4JYVH 3HPTB 2GZ8A 1HYLA 3PV4A 1ARBA 4MLFB 3AW0A 3RC6A 3TK6A 1J9CH 5HXFA 3CS0A 4X2YA 1INCA 5EOKA 4ZXXH 1GBFA 1KSNA 4K69A 4OGXA 5TCCA 1OSSA 5L2ZH 4FVDA 5FPTA 1C2MA 2FX6A 1ZSJA 5T6DA 3MOCA 2Q1JA 4WMEA 2GD4B 1NN6A 4OS2A 1JOUB 2WPKS 4CHAB 3TPIZ 3GDUA 1D6RA 3LOXA 3PLBA 1EATA 1C1VH 4TWYA 3RXGA 2FPZA 1GJ4H 1SGFA 4YT7H 4U32A 4B1TA 4B74A 1YKTA 3FANA 1C4U2 3DA9B 1GCTC 2IPHA 5L6NH 1LKAA 4AB8A 2D8WA 1HAZB 1HXEH 1TABE 4FUFA 1G32B 1NT1A 1C2IA 1QA0A 2TGPZ 3NK8A 2VH6A 1YPGH 5PTPA 3SJIA 2JH5D 3T29A 1OWEA 3GYLB 1P03A 9LPRA 1D9IA 3MO9A 1BB0B 1UO6A 1XUKA 3LJJA 5A8ZA 1IQHA 4TYDA 3VXEH 3UQVA 1TE0A 4TPYA 4JMYA 3VFEA 1P11E 1SLUB 4K3JA 3OY6U 4DW2U 2FOGA 1K21H 1Z8RA 1RRKA 1CO7E 3U8OH 3UNRA 1JXPA 2SGDE 2GDDA 1GI9B 3D23A 3RLWH 1AQ7A 4OS7A 1UTLM 2BOHB 3W95A 1AB9B 1CBWC 3GOVB 1EB1H 2DE8A 2PTNA 4CH8B 1LPGB 2P8OB 1QJ6B 2PR3A 1FMGA 3HGNA 3UWJH 3VPKA 1BTZA 1AKSA 1TGCA 2GV6A 5JBCS 3VXFH 2WUBA 2FMJA 1CVWH 1NU9A 4AGJA 2FTLE 2W7SA 3S7HB 1SFQB 4A1XA 3TGKE 1FPCH 6LPRA 8KME2 2G4TA 3P8GA 2R0LA 1S6HA 1Y5AT 4IN2A 3IITA 5FCRA 1O3PB 1KTTB 4NIXA 2IOTA 2SGPE 5C5OA 3SJ9A 1EOLA 1A46H 1CT4E 3RXLA 4ZMAH 1DDJA 1SGIB 4LXBH 4WJG2 2VGCC 3M7UA 4O3UA 1ANDA 4Z6AH 1F0RA 3LC5A 3A7WA 2P95A 2Z3CA 2A5KA 2PSYA 4MNYA 1DFPA 3SU4A 5A09A 7LPRA 1ELCA 2H5CA 5DP7A 1L4DA 5E0JA 1KXBA 1J16A 1S5SA 6CHAB 2SNWA 1ID5H 2V3OH 5GIBA 5TCAA 2PHBA 6ESTA 1Z6JH 3RXCA 4BANB 2BXTH 3P95A 3D65E 2I6SA 1NU7B 4K1TA 1CA8B 3U8TH 1GHZA 3GCTF 2PKAA 5GDSH 2OBQA 2BY6X 1OWJA 1C5ZB 3GCTG 2ANMH 3SV2H 3M61U 3QTVH 3UY9A 1BTYA 2G81E 4FUCA 1V2KT 3A82A 3U8RH 5GJ4B 3DFJA 1OWIA 1C5YB 1GMHF 1GMHG 1MUEB 3SZNA 2ZGHA 2CF9H 2GTBA 2ZO3H 3FP8E 4WMDA 3RXHA 2ALVA 3C1KA 2HWLB 3WY8A 2TPIZ 4INLA 2GMTB 5JBAS 1MTSA 2B8OH 1O3FA 1EPTA 2BY7X 1HAXB 1SQTA 5EG4A 2BYAX 1MD8A 1SGRE 4DCDA 3KF2A 2EC9H 1O3MA 1SG8B 2VWNA 4BOHA 1MAYA 2FOEA 4NSVA 2HPPH 2BLVA 1QL8A 4X8UH 3TU7H 1EZQA 2Y81A 2JH0D 3I77A 5JB9S 1AHTH 2ZFTA 5IYTA 1TBQH 1O3EA 3LJOA 4HI3A 1UHBB 3RXKA 2AH4X 4UFFH 1NFYA 2F91A 4I8HA 3ZVAA 1A2CH 1ESBA 4B73A 2XWBI 1ARCA 5LPEA 3PMJA 1GBBA 1WCZA 2GKVE 1ZJKA 4NCYA 4MPWA 1UTPA 1ELBA 1CU1A 1F92A 3PWCA 3R0FA 1BTUA 2Y5GA 3A88A 3S9BA 1GMCF 3AASA 2ZECA 1C1OA 1FLEE 1A61H 1N6YA 4AB9A 2R3UA 1BITA 1YF4A 3LT3A 1NM6A 3AAVA 1GBHA 2BM2A 3RM0H 1P2NA 1LTOA 3F9HA 4PROA 3ITIA 1P2JA 1K1IA 4ABGA 1HAVA 3DT0H 1MBQA 3PO1C 2C8WB 1P8VC 4MVNA 1FIWA 1K2I1 2BDYA 2ZPRA 3A85A 1O39A 4ZKRU 3RXBA 3D49H 2J9NA 3GY2A 4DURA 1UVUH 1P06A 2KAIB 3RC5A 1UTKA 1V3XA 2LNCA 4CBOA 1VJAU 5FCKA 2GCHF 2W7UA 1H9LB 1UK4A 1EJAA 4IMZA 3MO6A 2GCHG 3SOSA 8GCHF 4D9RA 4BTTB 1LQEA 1B5GH 3RXFA 2WYJA 2ZFFH 1MKXK 3B9FH 4JZEH 2OC0A 2BOKA 2GZ7A 3TH4H 1O2QA 3MWIU 1O2YA 1ZGIA 1QTFA 2A2QH 1DPOA 1T8LA 1OPHB 2XC0A 1TPAE 3KQBA 2ZFSA 2FOAA 4A7IB 1B7XB 1GBJA 1KXEA 2JKHA 4KGAA 4MDSA 4Z0KA 1LHEH 4K5ZA 1G30B 1SLWB 3M3TA 3K65B 4E05H 3RXAA 1FY8E 1SC8U 1SQAA 2H9HA 3OYPA 4Y8XA 3SI3H 3MYWA 1O0DH 1BTHH 3GCNA 4I8GA 5DP4A 3H7TA 3ELAH 4CHAC 1ELFA 1YPHC 1NROH 1RTKA 2FODA 1SLVB 1TYNA 2XWAA 3Q3KA 1FAXA 1OYQA 1J14A 2P94A 1C2GA 2ZHFH 1ABJH 2A4GA 2SGFE 3HK6B 1GI0A 3UUZA 1EAXA 3NZIA 5EW2H 1HV7A 1G2LA 1ELTA 4I8LA 1AUTC 2A7CA 2UWPA 2ZIQH 2OBOA 3M3SA 4JYUH 4IW4E 3MHWU 3BEIB 3MNBA 3TH2H 3NPSA 5JBBS 3ZVDA 1ELAA 2H6MA 2Z9GA 1P2IA 1UVTH 3TGJE 4WVPE 3BG4B 4ZKNU 1MZDA 2PV9B 2Z94A 5C3NA 3CENA 5GWZA 3V13A 1CHGA 3QGJA 1MD7A 3TIUA 3AW1A 3E3TA 4NGAH 3STJA 1RS0A 1TPOA 1E34B 3P8FA 1HJ9A 2A5AA 2R2MB 5C1UA 1KIGH 4NWLA 1SGPE 1AUJA 2BDAA 3RXMA 1PQ7A 1QFKH 3ATMA 1GHXH 4FU9A 1GGDB 1AB9C 3RXUA 1RGQA 4MNVA 1T4VH 2ODPA 3ZZ3A 4NA9H 4NIVA 2PGQB 2P8OC 3HGPA 1LQDB 2BX3A 1PQAA 2A31A 4FUHA 3SHAH 3SJ8A 3E90B 2QC2A 4LK4A 2FOCA 2VVCA 1O3HA 2ZI2H 2ZZUH 1FDPA 1PYTC 2AS9A 3OTJE 2UUJB 1LKBA 4ZH8A 1EX3A 1JIRA 1ZGVA 1QQUA 1O31A 1FY3A 4RSPA 1P9UA 1O3LA 1UCYK 5GCHF 1BHXF 2G52A 4OS4A 2ZDNA 1CGIE 3M36A 4Y79A 3PLPA 1GI5A 3ZZBA 3S9CA 2NU4E 1G3DA 3A8CA 2CN0H 2O8WA 3EQ0H 3GICB 3SO3A 1ELDE 5FAHA 1KXDA 1NC6A 1O3IA 1UJ1A 2PW8H 1ETSH 3EAJA 3VEQB 1CHOG 3RXRA 3MMGA 4BAHB 2DUCA 5A8YA 3TGIE 1IQEA 1WUNH 1BBRK 2TRMA 1GHAF 1NRPH 3OSYA 2BTCE 5DP3A 1EAIA 1D3PB 2R3YA 6CHAC 4DOQA 2CJIA 2BY9X 5I46H 7GCHF 1LVBA 2F9BH 4XFQA 4BAQB 7GCHG 3SGAE 1V2LT 1AD8H 2F9PA 3S7KB 1IOEA 1C1QA 3TITA 3BSQA 1LCYA 3QWCH 1AE5A 3O8CA 1HB0B 2RCEA 1WYKA 5CE1A 1ZPBA 3GY5A 3PTNA 1CT2E 1V2ST 1HBTH 5DP5A 2GVFA 4Y8ZA 1J17T 1K28D 1ZPZA 4Q7YA 1IQFA 3SW2B 1P2MA 1C5XB 3PMHB 2FWWA 2PFEA 2TGAA 3E6PH 2OC1A 1LVMA 1ZTKA 5FHTA 2OINA 3SORA 1TNGA 2GMTC 3TH3H 5C5NA 4GVUA 4J2YB 1VZQH 1LHGH 3UIRA 1V2TT 1AKSB 1ZMLA 2CHAC 2J4IA 3SJOA 2EA3A 3MNXA 5EXMA 4ZHMU 2OC7A 2Y6TA 3O8BA 1EKBB 1C5TA 3P17H 1HLTH 1NZQH 1O5DH 1BT7A 1P04A 4HZHA 1KYNA 1GMDF 2O8LA 4OS1A 5EPNA 2FTMA 5EQRA 4H42U 4YT6H 3P8NA 2PKSB 1QL9A 1AMHA 1UTQA 4DIIH 1C5SA 1K1MA 1O2HA 1PJPA 2QXHA 3RMLH 1Z6EA 4YLQH 2A2XH