3O8DA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase
molecule keywords HCV NS3 protease/helicase
total genus 207
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8dA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8dA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8dA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8dA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8dA03
3A8BA 2ZRNA 2IS6A 1OW3B 4LBYA 2RGEA 5HE8A 4A8JC 1G30B 1YPHC 3UFAA 2NU1E 1C1OA 3MMGA 4M21A 5JEDA 3A1UA 4RZ2A 2F3RA 2G77B 3DFLA 3GCOA 5J5CA 2GAOA 3ASZA 1J99A 2FP7B 3TAHA 5E3HA 5J47A 1XJQA 3CRVA 2Q6GA 3BJIC 4X1PU 3GCTF 3ATIA 4Q21A 1XXHB 2V7QA 3MMPA 4MYHA 2NG1A 3RC4A 1TNLA 1G6HA 3PQCA 1EJNA 1SGFA 3PCRB 2WPIS 3FP7E 2Z43A 3QSYA 3DKPA 3KZ1E 2P3TB 1QBOA 2W2XA 1G3DA 4A2QA 2BB4A 2ZM5A 1H9LB 121PA 1GDQA 3IBGA 1TMTH 1J8AA 2BBOA 2HLDA 4XOIA 2CBZA 3SJOA 4URWR 4D76A 1COWD 2QP4A 3CNNA 2FFHA 4FU7A 2PZEA 4ZDJA 3SJAA 1PPZA 2CLCX 1C1MA 2ZVPX 1FIWA 1HDTH 1FTSA 2RG3A 1OWIA 3ATLA 4N3NA 4DY7B 2VIOA 4JZEH 1FP6A 2FNAA 3IWMA 4LV8B 2WV5A 3V3MA 2OAP1 4GI7A 4GP7A 3EZ2A 5DP6A 2G0TA 3ZS8A 4D0NA 4B3BA 4BQSA 1N8OC 3W8RA 5A8YA 1UKVY 4LHYA 1OB5A 4ASHA 5A0CA 3HU3A 1H9IE 2MSCB 3SO3A 3TGKE 4PHGA 1QJ6B 4ZKOU 3PUWA 1MUEB 2ZCLP 1AQYA 5AUQA 3DEFA 2JLYA 3RM2H 3FDIA 1G8FA 2AIPA 2GXSA 2VSFA 1UK2A 2BLQA 2GZDA 5J40A 4CDGA 1VJ9U 1UPTA 2F1HA 4DEXA 3GY4A 4EQ6B 3LV8A 1ZZZA 1F0SA 4X8MA 2ZSDA 3M37A 4J1YA 1SGPE 1TRMA 3KNXA 1KDTA 2ZU0C 2TBSA 5EODA 1C5ZB 2YOFA 1UBCA 1V2RT 2J45A 4PC6A 1ODFA 2A4RA 3B60A 4NYMQ 3VNVA 2ZGXH 1XMJA 1KMQA 4WXRA 1Y59T 1MTWA 2IOTA 3OAAA 2BDTA 1G5RA 2KAIA 3MUFA 1BMMH 2QBYA 2BOVA 4UNQA 1PPGE 3T5FH 1S6FA 3RMOH 2PEZA 1MO3A 4OK5A 4AZ2B 2ZDVH 4PPQA 1PQ7A 2O8WA 1ZPZA 1K5GA 4M1TA 5B57C 3NH6A 1EX3A 4X8VH 2G6BA 2RA0A 4JL6A 2JAQA 1ZMNA 2BM0A 2CL7X 1NTPA 5A5GA 1VIAA 1IY1A 1AD8H 1ESNA 1LCYA 3SU2A 1QHHA 3TSOA 1GILA 1PQAA 1CU1A 4A1FA 4JLPA 1DFPA 2BY7X 1GJ4H 1GJ6A 4G01B 2BVXH 3BD9A 2W2VA 2CCJA 2AWNA 5FAHA 2FLRH 5L3RA 1T32A 1TPOA 2UZ3A 2NPFA 3NEJA 1GI3A 2C78A 1P2VA 1SHKA 2YC2C 1LHEH 1WXQA 1C2LA 2NU0E 1CR0A 2ZJ8A 3KJGA 1C2GA 1Q1BA 5K8IA 1ARCA 4ZUHA 2Y5FA 4TMWA 1NL3A 4YONB 1GAJA 2UUFB 3OE7D 3U3OA 1E2JA 1MTNC 2GXQA 4IC6A 2IUUA 5FPTA 721PA 4KCGA 1W3CA 1GKUB 2H57A 1A0HB 1E0SA 3K6ZA 2DHRA 2EWVA 1P75A 3QPUA 1X1RA 3SZEA 5DP5A 2CE7A 1WUNH 2W7UA 1NY22 1WCZA 2AMQA 1C1TA 3T06B 1E9EA 2OUKA 1HTWA 1L2TA 1FNMA 3FPAA 5JMTA 1KJZA 5E95A 1GI0A 3AF4A 2CNWA 4MGKR 3R9WA 5T6DA 4ASUA 4MPVA 5AK0A 3SU4A 3BIUH 3SJ9A 3GCGA 4EDHA 2UKDA 3SZRA 3A8CA 3RXOA 1ZCBA 1EFHA 3AP1A 2WSMA 3VHLB 4NH0A 1SGQE 3U1IB 3ZYDA 4WA7A 1LS1A 2GDEH 1D9IA 1DANH 4OK6A 1SHHB 1F2UB 2BD7A 1P2UA 1U0HC 3TPIZ 1HA3A 3UREA 3M5LA 5AUOB 4NCIA 1QGFA 2AHOA 2RGAA 4FMDF 3ZZ0A 2ZFPH 5FPKA 2WZQA 3NKKA 5HZKA 2QT0A 1F2SE 3AP2A 4PTLA 1O0DH 3TR0A 5TCCA 1V43A 1KI4A 4XFQA 1XVMA 2G5NA 4PO9A 1GG2A 3VGCC 2CE2X 4RKEA 2GEDA 1HCGA 1O2TA 3C5HA 2BBWA 3W90A 4Y8YA 1C5UA 2BQWB 4UE7H 2FDCA 2JLXA 2EFDB 6LPRA 4RCYA 4GUXA 1P01A 3OU0A 2CL0X 4F4CA 4BEJA 4E07A 3L8ZA 5FBVB 5DIFA 3A80A 3N2IA 3P95A 2R65A 4NHOA 2D74A 1A2BA 1ELGA 4DSNA 2OCBA 1E6CA 2P3UB 1VYUA 2PSXA 4UXHA 4K60A 1ZM9A 4Q66C 4KTCA 5KU1A 4LCBA 4ZO4A 3L0SA 5EQSA 2QAAA 2ZHFH 1V3XA 2OZEA 3ZGXA 5E0GA 2GZAA 3BB1A 1Q1EA 4X8UH 1QFKH 3UOUA 1BQYA 1EZQA 2OV2A 4IDHA 2WPKS 2AD5A 2B8WA 1TUIA 5FL7D 3QIAA 3WNBA 4D4LA 3U6BA 1TBQH 1XEWX 1NBMA 1VPLA 3U3MA 1VECA 3F68H 4NZQA 2ORIA 3QEOA 3KUDA 221PA 1XKBC 1ELBA 4D4JA 4KTSA 5H4IB 5HKKD 4G5RA 1VTKA 2QTFA 1Z71A 2P3SA 2AEIH 1O2JA 1GNRA 2IF0A 3UPUA 2EI8A 2VP9A 2YJTD 1U9IC 4I8HA 4DCVA 2BY6X 4H1UA 1UM8A 5FPYA 4KYIB 1IN5A 3BG4B 2FIRH 4A6PA 2IWRA 3AUYA 3SEAA 1JECA 5JS7A 2XNDD 3BTHE 1O87A 4AB8A 2B6HA 1P2JA 9ESTA 3NDBB 4JCNA 3LONA 1K2I1 3VX3A 3PJRA 2W00A 2A3RA 3THXA 4TQ9A 1ZLRA 1FNIA 2C95A 2FE4A 2HXSA 4GSOA 1V2MT 1W0JD 1UVPA 3AW0A 3MRSA 1ZC4A 1OYTH 2EYUA 2BDBA 1BMFA 2PLFA 4XVRA 3SQHE 3W6NA 2QBYB 3SUEA 1T0HB 1YPJH 3ZLJA 3KUCA 1F2UA 1E2LA 3LGWA 4LV6A 2ZO3H 5EZ5A 2JCSA 3MNBA 2FXRA 1F5KU 2PLXA 2VPPA 1WU1A 3K6YA 5JJIA 4C0HA 3HDTA 3BF6H 4X2YA 3UWJH 2P93A 4HFPB 3RRYA 1SKYE 1O3NA 2ZZUH 1U6QA 2GZ7A 1QA0A 3U1JB 5B64A 1G32B 5CM8B 1WCV1 2Y82A 1WTGH 3M4YA 5DHAA 7GCHG 2GETA 1DEKA 1GMDF 1GNQA 3KHVA 1C9PA 3TE6A 4QJ5A 1YR6A 4PC7A 3EA5A 5DN6D 3OE7A 4ZCLA 4BAHB 1KTVA 5GIBA 4PAMA 3LLMA 1BB0B 5L3QB 1U94A 2AWOA 1ZSLA 4CEHB 3THXB 1U81A 2ANBA 1P9WA 3UPEA 4M8NE 3W94A 3TUZC 4QC2A 1TX7A 5CHAB 1I4LD 2BZAA 3RXUA 3G5UA 1FAXA 3L0PA 2XOKA 3B8JA 3P92A 1ARBA 2F83A 3L8YA 1L2EA 1P4SA 3GLGA 4EFLA 1YR9A 5E7MA 5JB8S 2FODA 2C3SA 1XM1A 3UR6A 1P3CA 2AGEX 4DKXA 4ZHAA 4Y8XA 1NU7B 4NYJR 2YHSA 1O38A 3BS4A 2FV8A 1KJYA 3CPEA 4AD8A 1P0SH 5JB9S 1PYTC 2FPZA 1OT3A 3PV0A 1G17A 2ZE8A 3GLGB 1L0ZA 1GL9B 8GCHG 4UKDA 4AB9A 2EYQA 3TIFA 1AY6H 1DBSA 2GZHA 4X1SU 4ARZB 1UTNA 4QJ3A 1V2JT 1XEXB 1FOEB 2ZXUA 4K2YA 2QQEA 2V35A 1NY6A 5JYIA 1SPJA 1AVWA 2OFXA 4UONA 1QQUA 4YLUA 3L2OB 1T9HA 1K1IA 1E96A 4NCNA 1TX6A 4BFYA 2WV9A 1XXHE 1VCOA 2J0UA 2A4QA 1O5BB 3TSWA 2KAIB 4HUQA 5FI0B 3A87A 3THOA 4HATA 2VO1A 4GFDA 1IBRA 4INKA 3LJJA 3THWA 2ZFRH 4Q1DA 1V2NT 1FLEE 5SZIA 4PR0A 4HLUC 1RTFB 1UJ2A 1KK1A 2GVDC 1FZQA 3Q5EA 1JEDA 1SXJB 1SC8U 1XTKA 4IDPA 1SVLA 5KDOA 1JALA 5CIQA 2VL7A 1ZR0A 1SGRE 3P20A 1FNNA 2Q9AA 1M6NA 4OHYA 1O2VA 2GJ8A 1OSSA 2WWXA 1E1RA 4TTQA 3M7TA 3E1SA 5LB2A 2F55A 3OEED 1W11U 4JBYA 2FYQA 3SJCA 2QMUA 4B71A 3WP1B 2WMNB 2ORVA 1TPAE 1LS6A 2JH6D 3F9GA 1PQ8A 2FO9A 4CGZA 4P4SB 5E7IA 3RAPR 4D9QA 5HZHA 3I5XA 3M3VA 1TGCA 4YLQH 1L8QA 2OD3B 3B2EA 5FTJA 4M1KA 4FMBB 1QG2A 1GMHF 2YWEA 4FWTA 3U4QB 3P27A 2B92A 5H8WA 3RXPA 1Y3YA 1E9SA 3QK1A 3SJZA 2WWGA 4TYPA 4UXJA 5CLLA 1ZJKA 1FN6A 4HZUA 2PSYA 1HAXB 2ZP0H 1KI7A 4X2XA 1CR4A 3BOSA 2FX4A 1R5OA 2QY0B 2PUXB 3TJUA 1TQ0B 4L4UA 2V4ZA 1UTKA 1DAHA 3G01A 4DCDA 3BFXA 3T5DA 4IOJA 1GL6A 4KSCA 4TMZA 3FMIA 4IGDA 1W1WA 1TIOA 2DCUA 4RKJB 4GSYA 5F6MA 2W58A 5M04A 2Z3DA 3W5JA 1CGHA 5CJPA 2BDYA 2FOEA 1TX8A 3GDUA 4Q1BA 3VR3A 3E0NB 3BSQA 4NA9H 1FZZA 4FU9A 2DWQA 1DWCH 1GDNA 1UADA 3TK1A 4BLRA 4ZV4A 3THYB 3A7XA 1Z2CA 1FP7A 3FMFA 5TCAA 2J46A 3SV2H 3UIRA 3CNLA 1D3PB 3NBFA 4SGAE 3RU4E 2VHQA 2EC9H 1X7AC 1EFUA 1D2NA 3FMPB 1JR6A 1Q3HA 5DJ7A 1T5LA 2ZFQH 2LPRA 1AZSC 3GQBA 5C3NA 3RU4D 3NH9A 3GP8A 1K6MA 1YZGA 1SQOA 2C8VA 4CEIA 4WZ6A 4KO8A 2CVFA 2ODPA 1ABJH 1KSJA 2GBLC 1TALA 3U3JA 1GBFA 2ZEBA 2ZDAH 1KXFA 3GDVA 5KPJA 2IJD1 3A85A 2C8YB 1RIFA 1EAWA 3MFJA 5JHHB 1C2EA 3ZVNA 2A9KA 5DK1A 3D49H 1Q12A 3TVDA 3ZZCA 1C5WB 4B1TA 2ZRCA 2WPDA 4ZIRB 3SJ8A 5DI9A 2ECKA 1P03A 1NS3A 3RXCA 1CE5A 1KSHA 1W36B 3QKRB 2UWLA 3NXPA 1KI6A 1QRXA 3A81A 3T5GA 3SBDA 1LHGH 1S1MA 4DSTA 3ICQB 3MU1A 4PZLA 2H1LA 3MNCA 2QE7D 5KSPA 1YRAA 4BRUA 4Z1MA 1F5NA 4GOJA 2WOOA 4CREA 4DDTA 2FEQH 2D8WA 4OKSA 1W14U 1VCNA 4EPWA 4MDFA 1AS2A 4D0LB 2P6UA 2PX0A 3F6UH 3AK5A 1MAXA 1L1JA 3BK7A 3KQCA 2JGNA 4PO8A 1AS3A 4A0FA 4WH6A 4Y0VA 3ZV9A 4MUBA 4UQOA 3CPHA 2NGRA 3M1IA 4WMDA 2VH5R 1HH4A 4HZUB 3LIWA 2F9MA 4LOYH 2JLUA 1MT0A 1XXHA 2A5YB 1YZNA 1JMOH 1N25A 5DP4A 2JIZA 4KXFB 3KGPA 2VYFA 3GLIA 1C5OH 4YLGA 4A4DA 3ESTA 1IJFA 4NBSA 2XTZA 1LQDB 1OOKB 4Q9LA 5EXSA 2BY8X 1SG8B 3TMKA 1D4PB 2AXPA 3SOPA 2ZPSA 1NROH 4DWJA 3KB1A 3OEHD 2EFHB 2Y7ZA 4NPHA 4YC7A 1M1YE 1O2KA 2PTCE 5HR5A 3ZZ9A 1KNXA 2BDCA 1XUGA 4FUHA 3X1XA 5A8ZA 3EWSA 2GCPA 3CZQA 2DBYA 1CP2A 4DGJA 4BAOB 1C2IA 2REOA 4PPNA 4IN2A 3S9AA 1SVIA 1P60A 3CWZA 4LDJA 1G18A 4Q03A 5KHOC 1IN4A 5CYPA 4VGCC 4Z8YA 4NDZA 1UO6A 1SHYA 3UWKA 2H6MA 4Z54A 1TU4A 2OBLA 2UWOA 3CONA 2QY9A 1W7AA 2GV7A 1NN6A 1G21E 1CHOG 5F8XA 5C4GB 1EAUA 2G4UA 2BBSA 4AX9H 3A8DA 1KDQA 4FU8A 4X8LA 4KBFA 2O8BA 1NRJB 1B0EA 3NPSA 1OB2A 4CBOA 1GCDA 1NSTA 3ATMA 4LJAA 3AVXA 2PCLA 3QUSA 1GRQA 2FZ4A 5JBQA 3I78A 2FMJA 1NY5A 2F9NA 2ZRHA 2FESH 3LA6A 5E2OA 3TSZA 4IJMA 1G3RA 5TV2A 3PUVA 1C1PA 4ZDWA 3QKRA 2ODNA 1E0KA 2NZ8A 4TZ0A 4GCHF 5J4SA 4DT1B 1R0ZA 1UBGA 4INLA 4A82A 1OS8A 1P10A 2QA5A 1NF3A 1A4WH 4QGFA 3A4MA 3GJ4A 5FX6A 2F9OA 2FWWA 4URZR 4LJ6A 3A8AA 1G3IA 3ITIA 5JCZA 3SJIA 1O32A 1T7CA 3BIFA 1C1RA 2NO1A 2H17A 1E1QD 1YPKH 2FZLA 2CK3D 2OK5A 1BBRH 3TU7H 3Q3XA 1FY4A 2IUSA 2GEUA 4ZCMA 1ZNYA 4V0NA 5DISB 4JLBA 3K09A 4MRNA 4FUIA 5AJYA 5DP7A 3PITA 4KKDA 1G8PA 1DAEA 4HAVA 2RCNA 1HAIH 2QI9C 2ZGHA 1PUJA 4TTPA 5FTNA 5HCIA 2BQ6B 3OZXA 3IHWA 3SOSA 2ZU2A 2CF9H 4AFQA 3K1JA 4LYFA 4RFSB 4Y7AA 1O3JA 1P57B 2QZ4A 1NVWQ 1AU8A 3N5CA 4MKIA 4ABGA 1ETSH 1FUJA 5C1UA 2VHCA 1XTRA 2P8OC 1GI6A 5I25A 5AF9H 3AF0A 3PEWA 2ZKSA 1O2SA 2YWGA 2Z4SA 1V2UT 2VQSA 3ZZ4A 1ZOMA 2FOFA 1PPHE 2O8FA 4B75A 3OEEA 8OHMA 4R7ZA 2SHKA 2OE2A 1MABA 3JZMA 4EFNA 1SXJA 2ZEJA 2QXJA 2PJZA 3SNDA 5EXXA 5FL3A 4E5UA 4HEJA 1ZVQA 1JPJA 1GUAA 1VDZA 2QTVB 3RXQA 4R98A 1H8DH 4LZZA 4G0NA 1G2MA 2WWYA 2XSZD 4R2HA 3HPTB 3TVTA 3CO5A 3LX8A 4HUQB 4GHTA 1GCTB 2YNMA 1E38B 2YNBA 4NIYA 1HAVB 5TMPA 4F38A 1Q2WA 3M3TA 1A5HA 1ZJ6A 1XEFA 3R8CA 5DO9A 1N6LA 1ZM7A 1M9UA 1P9RA 3IUYA 1LY1A 4OHXA 4XDEA 4DSOA 1ZM2A 1C1SA 4Q02A 3WNDA 3LBHA 3A1VA 1GWNA 1QHXA 2PJRA 3ETLA 3P26A 1SLXB 1US8B 1XD2A 3FFGA 1KIGH 4ARZA 4CEJB 3SBEA 5FR1A 1NFXA 1DE7H 2HPQH 4QT8C 3KDSE 5HXFA 1HQCA 2J87A 1C9KA 4RZUA 3SU6A 1MH0A 3Q8XB 1AQ7A 2CHAC 1I4TD 4DBLC 5FUVA 3PMBB 4HAWA 4BXSA 3UOPA 3V0XA 3QG1A 1S1CA 1E94E 4TMTA 2WINI 4FWIB 1NVVR 4KLZA 3I5YA 1DUEA 1US8A 1M7GA 1AMHA 1J7KA 3KQLA 2AR7A 4QHYA 3MH4A 2W26A 3THYA 3SJBA 1N6IA 2WKRA 5CK4A 4WXIA 4QG7A 2A30A 2GA8A 1GHZA 3VNUA 4TLEA 1J8MF 5KDDA 2WWIA 4P4TA 3U44B 1OXGA 1ZRKA 3GFPA 1SKYB 1ZUNB 1ZC3A 2JJ2A 1RPZA 1G5TA 1XPUA 3B9PA 2A78A 2IK8A 4LUCA 3PLPA 2ZWLH 4N1AA 3TNTA 1MO4A 3FHCB 1NJFA 3ZIAD 3NK8A 2O52A 5J4QA 2F1RA 1GI8B 1GBKA 1LO6A 1NIPA 1OIWA 2QG6A 2CHVA 2Y5GA 2WWHA 2VIWA 3ONWA 2ZVQX 4IMZA 1XKAC 3NEYA 1GIAA 1GL1A 3SZNA 3RXHA 4DCTA 1Y5BT 3ZZ7A 3KF2A 4MPWA 4GZMA 3N70A 3SHFA 2R0KA 2G3YA 3KJEA 1G36A 1ONBA 4UDWH 4MRPA 5CM9C 3C1KA 3PTNA 5FOXA 1RTKA 1PYTD 1QL7A 3DMDA 4EAQA 5JI3E 1U0LA 2X77A 1FPMA 5EE1A 4ZKRU 4OL0A 4PHHA 3TUIC 4RCZA 2A7JA 4G5QA 3EG5A 1GBLA 1Z0FA 1GI4A 4LHVA 2ZAMA 1OKXA 2JLWA 3ZVDA 3HR8A 1P02A 1QHYA 1D3TB 621PA 1BZXE 3T1VA 1KY3A 2GT8A 1NC6A 2R8RA 3BFVA 4AYTA 2CVHA 4FINA 3GY3A 2JJ2D 1PPCE 2BV3A 1SGCA 3BTWE 4F7WA 3RXTA 4K69A 4A6LA 2N1BA 3QENA 1L1GA 1W12U 1THRH 3SGBE 1H9HE 4FI3C 3MG9A 4W9MC 4B34A 3QDZB 3TLOA 1N0VC 4Z51A 4A7IB 1CHOF 4UNPA 4TY7A 3B1WA 4G5OA 4D80A 5F8ZA 1GVZA 2FN4A 2WPHS 4D0GA 1O34A 3BEIB 4MDEA 1RC8A 1ZSKA 3WXMA 1A0JA 1OPHB 1Y3AA 2FJUA 2XW9A 4NYMR 4GL2A 2XBYA 3REGA 4WMEA 1A82A 2XZPA 2IC5A 1YYY1 1YPHE 3ZQ6A 1YVDA 1IY0A 5FCKA 6GCHF 1TYNA 1KO7A 2IHYA 3PMAB 3V4FA 1YPGH 2R2AA 2BXUH 5T1VA 2X19A 3KL6A 3K9HA 2TPIZ 4UNRA 2A5KA 4BGDA 2ZJ2A 1U90A 1Z0JA 2X1VA 4XD7D 3GLFB 3K53A 2XZLA 4XWAA 5J4HA 2CXVA 4XH9B 4AFUA 3VQTA 4CRDA 2GMTC 2GJAA 1OFHA 4DDVA 1E2NA 2BKEA 2ZU4A 2SFAA 4UNSA 2GBLA 1E2EA 1DDJA 3U44A 5FX5A 1NO9H 2GVFA 2YYZA 2DUCA 1T3SA 4PZZA 2Q21A 3DD2H 1E37B 4IXNA 2ILNA 2XC4A 1TL7C 3HP1A 2JEOA 3S9BA 5A09A 4XBCA 1VZQH 2K1QA 4Q4HB 3OEHA 1AKYA 1XPOA 1RJ9B 2GT7A 5DYGA 4ISNA 1MR3F 3OY6U 1XX9A 3WP0A 1MBMA 1R8QA 2NZJA 2O0HA 4ZMAH 4OBEA 1DXWA 3R7WA 1BTXA 5CITA 4LPSA 4Q4AB 1G6OA 1SQTA 3UTUH 4FMCF 1C5LH 2ZU6A 4MITA 3S1AB 1CGJE 3SC3A 1KIMA 2F4LA 3OAAD 1BIFA 5C4MA 3SHCH 3OIWA 1BRCE 1Z6JH 1FY8E 1R0XA 1YPLH 1A5IA 4ZKNU 4EPVA 4OQFA 1ESAA 1G7CA 4FXGH 4HLCA 1QVRA 1OH8A 2QPTA 2Q1JA 4JMYA 3WHLA 2QCYA 1GWAA 2WICA 5JDUB 2P6NA 2GCOA 1ETTH 1Z8RA 3HYTA 1XUKA 2P5TB 4X1RU 2D1JA 1A0LA 4M1MA 1V2TT 2O8LA 4TT3D 4JLJA 1Y5AT 1BMLA 4KFRA 1H8IH 2J9NA 1ZU5A 2PTNA 1KK2A 3DOEA 4NFFA 3VGCB 3WY8A 3ZVBA 3FFBA 1HQYE 1B23P 3F5FA 2XGJA 4JYVH 4FUFA 2HT1A 4NCJA 2K5UA 3DHWC 5EXLA 4I1SA 2QT1A 4CRAA 5JZVA 1FAKH 1KKMA 4ZAEA 3LGVA 2EU8A 1GFIA 1O2WA 4Q7LA 4NSYA 1AKEA 4OS4A 1Q31A 4PSAA 3LXRA 2BJVA 1RKBA 4F49A 4L9WA 1L4UA 1E35B 1GRNA 2QSYA 4LJ4A 1EX7A 1ZPCA 1MD8A 1FUKA 4MNYA 4Z6AH 1W5SA 4O97A 1DSTA 1FY5A 3HATH 2PT5A 3NUMA 4GNKA 1SVMA 3FTQA 4I99A 5T6FA 4A0GA 1E36B 3QWCH 2KBEA 1ZINA 1J70A 1TNDA 1JIRA 4RSGA 2C8WB 2ZC9H 4JSYA 1XUHA 3QLPH 3ICEA 1CLUA 3QQ5A 1W7XH 1C1NA 4F92B 1IQEA 3OTJE 2ZIQH 4K1EA 2F9PA 1WDTA 1M7HA 3SI4H 5JBTA 4LPKA 3LH1A 1G9IE 1O2QA 1SLVB 4AWXA 4D81A 1GOTA 2G0NA 4V02A 3EPLA 3TLXA 4ABJA 1HE1C 2O5VA 3D23A 5A0BA 4DUGA 4Q1AA 4I8GA 3IEVA 2ZYTX 4AFSA 4GCHG 5FL7A 1E9BA 2F7SA 3RXMA 3T12A 4L5BA 1GMCG 1EQ9A 3D6TB 2PX3A 3KL4A 2OBQA 1F2TA 1MCVA 1YKSA 2R6FA 1WAYB 2J38A 5JBBS 1II0A 1PJRA 1E3MA 1O3PB 2Y80A 4D8NA 2AKYA 3RC5A 2QPAA 4C0LA 1HJ8A 4LWZA 1Y3UA 3AVPA 2HV8A 4NIWA 4WMFA 1KK3A 4AYWA 3LKWA 3EGKH 4BFZA 3IPYA 3IQWA 3GD7A 1AWHB 3K9NA 4O9VA 2IUTA 4W5WA 2H9HA 1SI5H 1EOLA 3Q00A 3R3GB 4LJ8A 1XFAA 2NTYC 3T2NA 4X1QU 1LB1B 2Y6TA 2BMJA 5IRCD 3PYHA 2XB4A 1G3MA 2CCGA 4G5SA 2Q6DA 2FOMB 3WHKA 2HCJB 1II8A 4B33A 2R3YA 1ZD1A 3RXAA 1DOJA 3A58B 1ZGVA 4DDWA 1FMGA 2SGPE 4HB0A 5HYOA 2PFEA 2AKAB 5KSOA 3K70B 2BCGY 1OLOA 3WNCA 1D9XA 5EW1H 1H65A 2Q0HA 1ZRBA 1VYTA 4ZH8A 4L8GA 3GJ5A 4HLQB 1TNHA 5KNDA 3QKSB 2W3IA 3FVQA 1HAHH 4M1SA 2ULLA 5GDSH 4JBXA 2AFIE 1ZW6A 1RJXB 4TYQA 4AFZA 2XXAA 2ANWA 1EK0A 1CS4C 1S6HA 2V1UA 1UDXA 3CWQA 2HWLB 4MYTA 1BTYA 2BM1A 1AO5A 1XUJA 2BTCE 5HM2A 1AA9A 3R9XA 4ZHLU 3DL0A 5H1YA 3X1ZA 3A1SA 2BD4A 1EAXA 1VJAU 3DOFA 4ISIH 3UNSA 3RS7A 5FPHA 3VXEH 2WV4A 2Z4RA 4ZKSU 3M61U 4OJKA 3M5MA 1EESA 4C7OB 2G81E 1EPTA 5G41A 2B7CA 4TYYA 4F4OC 2OM2A 3UMSA 1ZNZA 1P73A 4D6PA 1CIPA 2ZI4A 2IF2A 4MRSA 2QGZA 3P1JA 4YTAA 1DAMA 2QXHA 1XEWY 1MTNB 4M53A 3FKSA 1P61B 3H09A 1GBMA 1EPTC 2HF8A 3JZAA 2VP2A 1Z8GA 2SNVA 2Z9JA 1CHGA 2O8UA 2IYUA 3PUZA 3PM3A 1C1UH 1YR7A 3UWOA 2WHXA 3E8LA 3A37A 4I4LA 4HLDA 3PO1C 1UKZA 4B3GA 3BTQE 4EJSC 4U30A 2ZSBA 4MVNA 1ESMA 4KVAA 3QZRA 4KU4A 2R6AA 1DWEH 1G3EA 7GCHF 1YGCH 2ZU3A 4IC5A 4EFMA 5FBIA 1E9AA 5J4LA 4ZI2A 4UEHH 2PUQH 2IYZA 3RC8A 5EE9A 5F9FA 1QL9A 2ZGBH 3RXJA 1DM4B 1XD9A 2Y7XA 2SGQE 2HYDA 2WWWA 2LKCA 4NGAH 3LGYA 1HAOH 3RU4T 3KKPA 1TMUH 4IBLH 2DR3A 1X1SA 1CVWH 3PEYA 2GCHG 3MWJA 3TR5A 1JNYA 1QTFA 2I4IA 1K21H 1EGAA 4LYHA 2GVZC 3I73A 3KKNA 1OWEA 1HEIA 2XEXA 1C2HA 5EXMA 2PR3A 1NESE 1GHVH 1SOZA 3GLFE 4HZHA 2WYGA 1GBBA 4DG4A 2ZFTA 3SORA 4B6EA 1CJKC 3ATKA 4WXPA 1RFLA 3VKHA 1SHZA 4KELA 1G4UR 1QR3E 3C16C 2IYSA 1Z8IB 1E2QA 1W46A 3ZZUA 5GPIB 1A1VA 3HU2A 1QBVH 1MTVA 3X1DA 3PIRA 4TWZA 4LOAA 1R5NA 4IN1A 2VGCC 4TYNA 4WJG2 1I4DD 1PZNA 1HURA 3U5ZB 1KKLA 3D31A 4JKIA 4Y11E 1FUUA 3KQUA 4A15A 3FFAA 4IOMA 1Z0KA 1YKTA 3JZ2B 3LU9B 1GP2A 4Y7BA 2D4HA 1ORFA 5HM9A 5H68A 4Q7MB 3I72A 2V6NA 3TJNA 5EU8A 3NCLA 3E3TA 4CYMA 3LGTA 4BLSA 2FI5E 4DUGD 5GADl 1FN8A 2J5XA 1H8HD 4RSPA 4MYUA 2FM2A 3K0EA 4NCKA 2UZIR 3W34A 4BXWA 3W8NA 4PAOA 2ZIAA 1TLDA 4K1SA 1CXZA 4Q7JB 4GOXA 3F9FA 2YOGA 4LX0A 2IYQA 3VEQB 5JI2E 2G52A 4K1TA 2A5FA 1FI8A 4FXPA 1DPOA 1Z07A 2ZRMA 1GJ9B 2O8BB 2BWJA 2O8DA 5AJXA 1S8FA 4IXMA 5LD2B 4A0HA 5DHFA 1Q21A 1W4AA 1THPB 2G8TA 3QY0A 4PHTA 1LHDH 4EPRA 3F1SB 4X8SH 4CR5A 1EATA 2PKAB 4KV9A 1C5QA 1EWQA 4AGKA 2C90B 3SNAA 3W9YA 5CK5A 1N5LA 3HGNA 3RS5A 4DSUA 4LI0A 1Y3XA 1FW6A 3KQBA 4X0WU 2VBCA 2FS8A 2FFAA 3B1ZA 2ZTZA 1S83A 3QG5A 2XNSA 5HCNA 1BBRE 2TGDA 1XTQA 2RGCA 2MMCA 3CZPA 1VCQA 1W0YH 4WZAE 2XSZA 4QBHA 4M9XA 3K0SA 2QYIA 3PVSA 1O3KA 3OSYA 2ONKA 2KB0A 3T61A 1HJAB 2RAPA 1E1RD 3VB4A 1MBQA 3KCGH 2ZRLA 1J8YF 2YC4C 4YMVA 1JQJC 3ZDQA 2HPPH 1UHBB 1AGRA 1ZSJA 2L0XA 4R71A 3NC0C 3MOCA 3MD0A 1NFUA 2REBA 4D4KA 3SYNA 4ZKDA 1GMHG 4NONA 1KI2A 1VG8A 3LBIA 2QU8A 1MH1A 3C14C 1G3BA 1W4CA 3TW4A 4WIAA 1A5GH 2V9PA 3A7YA 4ZDIA 1GHBG 5GCHG 2GKSA 4B47A 1NRSH 2RGXA 3GLHA 4U01A 1RJ9A 3ND8A 3SI7A 2OXRA 3KKMA 1QURH 3RLFA 2CHGA 2PCJA 3E2IA 1SBWA 4RZXA 2C4FH 1P2SA 4KODA 3RHFA 1GJDB 2CMKA 3LRPA 2VIIA 1F7ZA 2FOCA 5SZHB 4MGZR 4GZLA 1E0FD 3K09C 5AVDA 2XOKD 1EZSC 2LKDA 2CN0H 4A5TS 2IW3A 2RGDA 3SN6A 2G5VA 4Q7ZA 2RGGA 1E2IA 2VTKA 2VHUA 2OEPA 1O3LA 3NIBA 4IVQA 5GVRA 3EIEA 4E7RG 3PEUA 5FTLA 1DVRA 1JOUB 1RW4A 4BRWA 3QTOH 2R9PA 2PKSB 3AVZA 1P3EA 1UFQA 4JJKA 1J17T 3QNUA 2VWNA 1FIZA 4FUBA 1W36D 1C5PA 2W6JA 3T28A 3MH5A 1H8EA 1GI1A 3EE0B 4IOKA 3RRMA 3EQ0H 3FB4A 2OC1A 3B78A 4JVSB 5KO2A 1KK0A 3AVVA 3M5OA 2OCPA 1HE8B 1Z47A 4FVBA 1Z22A 3LOXA 4HLUA 3L82B 1S0RA 4TMVA 3L43A 1YZQA 1X8JA 2IYWA 4X2VA 1GI9B 2JKHA 3TGJE 4DW2U 4JYTA 4G5GA 3B23B 1O5FH 5C2JB 5L6NH 3URCA 3FE2A 4EIWA 4DIDA 3K9LA 5ESBA 1K1LA 3QXXA 5KYKA 7KMEH 1SSXA 4U2WA 3TJVA 2EWWA 2B7BA 4P32A 1BJUA 4ABBA 3K9XB 2ZHEH 2ZRDA 2FTMA 1O3BA 1GITA 2HCBA 2VWOA 1KTSB 4GLYA 1U0JA 3ELAH 1XU4A 3GY6A 1Q44A 4QFMA 1QA7A 5ELXA 1GBAA 1NLZA 1AUTC 1WRBA 1NVXQ 3C5CA 1CJUC 2IS1A 3SNBA 3GY8A 1T8NA 3O8CA 3AVTA 1OYYA 4GOKA 3TNSA 4NP6A 3MWYW 3PMJA 1GI2A 2HLDD 1P62B 1OWKA 2QIQA 4TMKA 4C0JA 3VPKA 4HB4A 1EXMA 2A5GA 2ZUDA 1AGJA 2ONJA 1SMFE 2HRVA 3UUZA 3RNLA 1UMAH 1E1QA 1PV4A 1QDEA 5FBEA 4Q7KA 4QGHA 2YWHA 1N1LA 1BOFA 4WBSA 4RZ3A 2XYAA 2R2WU 3EWAA 3QVUA 4AKGA 1OH6A 1D3DB 3SFZA 2GESA 1P06A 1JI0A 3BRWD 2C04A 4JZFH 1OF1A 3ZVMA 1A61H 3ADCA 1BDAA 4II7A 3FZZA 1PFXC 1MAYA 3WMFA 4WXVA 3AVQA 3R0FA 4UXIA 3GFOA 2VP4A 3GOVB 1JAIA 3PXGA 1E32A 2E87A 3M3SA 4E22A 3LXXA 1T91A 5JWOA 8KME2 4W5JA 1HBTH 3VB7A 4E03A 3B8HA 5EP1A 4LV5B 2B8OH 3BG4C 1YLDA 3TGPA 4CHAB 2PT7A 1O3AA 3GICB 3RXIA 2FX3A 3OTPA 3T1OA 5CYOA 3CF2A 4O2RA 3NHBA 3T35A 1GGDB 3LVQE 2JH0D 1CT0E 3LH3A 2GK6A 1GHYH 2VH6A 2RGNC 4MG3A 2FOBA 1QHNA 5C46F 1AN0A 2OBMA 4ABEA 3BIVH 4BOHA 2EFGA 4EUNA 2TGAA 3C15C 3KN2A 1QG4A 4EQ6A 1BTHH 5J4YA 1J2JA 1VITG 2G51A 3AEZA 5IDVA 2NU4E 1RYHA 3OFND 1OJLA 2ZUCA 3I29A 3PV2A 5HTKA 4OI2A 2CJIA 2FZZA 4YO9A 3QEJA 2ZI3A 1G19A 3A7WA 4FUJA 4KFTA 4JJZA 1EKBB 1LVBA 5FOWA 2WJGA 1UCYH 4E05H 4F4JA 1OP2A 1S0QA 4TLDA 3T15A 4Q9JA 1B0FA 4URXR 5TARA 1QHRB 1G41A 1WA5A 2Z6VA 4O25A 3H4MA 4N0EA 4JYCA 3HU1A 2BDHA 4QOSA 3PLKA 2V7QD 2ZHDA 1T0JB 1C5VA 1ACBE 3V13A 1KSNA 5PTPA 3ZD7A 2ZG0H 2OC8A 1NN3A 2ZFFH 1W7GH 1DXPA 4MQAA 1ZUHA 1A1RA 1OWDA 1TGTA 3P17H 2CNWD 3IHLA 2XNDA 4WW0A 2ZJYA 3AGQA 5BN3A 1KDRA 4OHWA 2WJVA 3A36A 1XXFA 1NP6A 1KI3A 1ZTJA 1PLJA 1V6DA 1XRJA 4IRUB 3HKJB 1DPFA 3LDAA 2AN9A 2QAJA 3CR7A 1KO8A 2QSZA 4XD7A 1YP9A 1TF5A 2ZANA 1KI6B 1WYKA 1KYIA 2WJJA 4HGCA 3MU5A 2ZDKA 1SGTA 4US1R 2WWFA 4MUAA 2O8TA 3UIEA 2WAYA 1EZUC 4UFFH 3RSOA 4K46A 2WKQA 2GV6A 2IYYA 4IFEA 2GRJA 1ZU4A 2FPLA 2J92A 1OXXK 3BTFE 1S5SA 1K28D 1C4V2 4A2WA 2W6IA 3ZVLA 3B1VA 3K65B 1F3OA 4Y0ZE 4YOJA 1N2CE 3JVUA 1UTPA 2F1IA 1S96A 4TTRA 4UJ3A 2W6ID 3M6AA 2J9RA 1ELCA 4JLAA 2VVVA 1TONA 2O8CB 5KTYA 5AUPB 3W95A 1O2GH 4V0LA 3QI2A 3SU1A 2FA9A 3LW7A 1CBWC 3R7WB 3E6PH 1FJSA 4AURA 3EYDA 1ELEE 5T3HA 1OH5A 3LBNA 4XIGS 3KX2A 3LW8A 3SV9A 2JLSA 3RMLH 3BEUA 1XTIA 2ZE6A 4DC9A 1GHWH 1NN0A 1XJ0A 3B9FH 2CCKA 3EZFA 4UJ5A 1NMYA 2AL7A 4CHAC 4YQFA 4ZROA 4I1VA 3EA9A 2J4IA 1UEJA 3ODDA 5E8EH 4Q4LA 1HXEH 4Y0AA 1I2DA 1DOAA 2C9YA 1CA0C 3I77A 1WP9A 4CRFA 3FZDA 3AVUA 4BFUA 4ESTE 5FBRB 1GBEA 3LLUA 5LPNA 2A2XH 4RD0A 3CKLA 2OC7A 3DMNA 3ZVAA 3ZZ8A 4KAXA 1HJ9A 4DLRA 4YMUA 1EPTB 1OSNA 1S9HA 1Z1JA 4D4MA 5GCHF 4AIIA 1XTJA 5B2ZA 2WUCA 3CNOA 2F43B 2HT6A 2Z9GA 1N0WA 2LCFA 4ITRC 2TMKA 4PSVA 3KXLA 1GJ5H 1W2KH 3D3QA 1DAIA 4AOQA 1IHTH 2B9LA 2YOLA 1OHHD 3W3ZB 1Y3VA 3B5JA 3UG7A 3KQEA 4DLWA 1CTQA 4O3MA 2A7QA 2Q3FA 1IM2A 4X8HA 2H18A 1QBKC 2ERXA 3U7FB 2PMKA 2Z3CA 2IXEA 1VKJA 2IXGA 1N0UA 4EJSA 4B3XA 4Q2KA 1RRKA 1WQSA 4YM9A 1LV7A 1D6JA 3AB3A 2ZJAA 2X2FA 3QN7A 2GMTB 3RMMH 4QNRA 1A2KC 1G8HA 1QRWA 1QB9A 1KDPA 4Q4HA 2HF9A 3Q5DA 1MRNA 5GWZA 1VG1A 1BHXB 1E9FA 3CB4A 1AKSB 4D7FA 1QHGA 2F3CE 1LQEA 1NRQH 1N5IA 2XNIA 1E4YA 3VU9A 1GBTA 2RH5A 4Y10E 1II8B 3OIVA 2EEKA 3MFYA 1E0AA 2A1DB 3VHXA 3LO5A 4QBGB 3TVJB 1IONA 1NMZA 1HUTH 1NFYA 2JJ1D 2V55B 1AKSA 3U61B 5KNBA 4H6SB 1RRGA 4PC1A 1LFDB 2A0QB 4Q18A 4D26A 1XXDA 2BX3A 4A2PA 4NE2A 1A7SA 3M36A 3ASYA 1AJEA 3PEVA 1BMNH 3KFXA 2I6QA 1JIMA 4PQFA 1OPXA 4JLNA 821PA 3O8RA 1U8AA 2J59A 3EPJA 1YHNA 4WVFA 4KFSA 3Q9LA 1NKSA 3ZZ5A 2XTMA 1KXEA 3ZZ6A 4RJLA 3NBXX 5B6LA 5T6GA 4R0IA 2P0EA 5CDFA 5KPDA 4ESVA 3WRXC 2XWAA 2RGNA 4X6NA 2IYVA 1HUQA 1JJVA 3BC1A 4BE7B 3IO5A 4U7DA 2UVQA 2F9UA 5BW8A 4I33A 2CGAA 1QJ1B 4A1XA 3ZYCA 2IXFA 3TQFA 1LKAA 3VB6A 4XSGA 2ZI9A 3QOFA 1N6KA 3TQCA 5DYIA 1YQTA 5BXQC 3H84A 3NG1A 1WB9A 3OYPA 4CH8B 3K8YA 1TQ7B 1S9DA 3KTAB 5ESTE 5HE9A 3MNSA 2JJ1A 1HY3A 3STIA 2HNTC 2PKSC 4AG1A 1FY1A 4XWOA 1GDUA 5JFGA 3ATWA 2Q3MA 4AG5A 1LHFH 3BB4A 2PMDA 2FLBH 3L0OA 1GJBB 5JSZB 5JPMH 3S7KB 3DVLA 1IQLA 1TADA 2ZU5A 3HYRA 4AY2A 4RD1A 3ZVCA 1FX0B 4Q1EA 1RYFA 2O0KA 2FOLA 2P59A 1J14A 3N7OA 1GL0E 2O0JA 3DA9B 2F9BH 4LHXA 1ZRHA 4RFSA 2VEDA 1XTSA 4MNXA 1DY9A 2WJYA 4C0KA 1TPPA 1VR1H 2VF7A 3CS7A 1DAKA 1SQAA 1FQKA 2QUZA 2KE5A 1W5TA 3RWOA 2CHAB 4INHA 3RXSA 5FTKA 5JCPA 4QJ4A 4QHTA 1U8ZA 3THWB 4TZ6A 4HI0E 1MTSA 3A4NA 4M0LA 4ABHA 3RXEA 1DG1G 3I92A 1AE5A 1UK3A 4W5HA 1XMSA 3E16B 1DG3A 1ID5H 3F3YA 1PLLA 2OBNA 1XEXA 1C4OA 5LPRA 1KO4A 2BM2A 1KLJH 1WV7H 4P33A 1C2FA 5LB4A 5DI3A 2DE8A 2J0QA 4LHWA 4C4PA 3VB3A 3HK3B 3M35A 3GDSA 1E2GA 3GEIA 1CRPA 1Z1IA 2VWMA 2BY5X 4JZDH 4BAMB 2BD3A 2ZGJA 1II9A 4A36A 1QZXA 1SGNE 2ANKH 9LPRA 3AGPA 2B21A 3SE0A 1QJ7B 5FI1B 2I6SA 2ZREA 3SHAH 2VLIA 2WIBA 2QRNA 2SNWA 2P65A 3UANA 1JWTA 4AYXA 1O2ZA 2FTLE 2TRMA 1IOZA 3ZJYA 2OLGA 2H5EA 4UFDH 2GNOA 2GHIA 2Z9LA 3D7MA 4KFUA 4K81B 1O2RA 2ODBA 6CHAB 4GAWA 3FHTA 1JXOA 4JIMA 2IX3A 3AKEA 3B7GA 5EP3A 4A8JB 3N2EA 3GLHB 5TXGA 2FU5C 3QXCA 2KBFA 3U60B 1MKYA 4JS0A 3UG6A 1W4BA 1XCMA 1MZAA 1ZYUA 4HB2A 4D82A 1MU6B 2GEVA 4CEIB 3RXRA 3EZ7A 3HPRA 1WE2A 5HMAA 2BMDA 5JWRA 1GPZA 5GVSA 5IT5A 1ZHRA 3GCHC 1GNPA 1NN5A 2XC5A 4BTTB 1Q3TA 3EPKA 4YT6H 2BD2A 1G64A 2OC0A 4ZDKA 4JLVA 5EUQB 5E0JA 1HAVA 3OIYA 3B85A 5DLQC 5FUWA 3NZIA 3RDPA 3UWIA 2J0UB 3FP8E 2P16A 4B2CA 5EQRA 4RKOB 2W6JD 1IAUA 2OHFA 4DB2A 3D8BA 4OI4A 1PQ5A 2FOHA 2QC2A 1BOQA 1M2OB 3QGJA 2B7DH 1OP0A 1LVYA 1P72A 4OS5A 4S35A 3VFDA 1P04A 1A7JA 1CR2A 4Q7XA 3SYLA 1KZ7B 1BMFD 1UTOA 1SFQB 1KMHB 1MABB 2Z9KA 1GGDC 3U3RA 4GT1A 3PLBA 2AFHE 3F0TA 1YCPM 1L4YA 3B1YA 1QIXB 4DVAU 4I1OA 2ZFSA 1GI7B 4I32A 4ACBA 4G3XA 1SLWB 3QTVH 4TL8A 4YMTA 4VGCB 1A3BH 4B3DA 4JKYA 2OFWA 5JJKA 1L4DA 2MSDB 4M4SA 5GJWC 1ZD8A 3UNQA 4QL3A 5CDFE 5FOSA 4B3FX 1WSSH 1N6PA 2VIQA 4LXBH 421PA 1BBRK 1OXVA 1PLKA 1KTTB 1BIOA 4CR9A 1CJTC 3UQVA 1SXJE 3DZ8A 1P2IA 3E90B 5IK2D 1THSH 5G4BA 4XSKU 1UHBA 1WBDA 2NPIA 3VAAA 5CLQA 1SULA 1GI5A 5JBCS 3I32A 1R6BX 4CF7A 4JT4A 1SVKA 4JBWA 1K1PA 1W13U 2Z83A 2UUJB 1NKTA 3F8TA 1DO2A 3KB2A 3KQHA 1DADA 1FMJA 2ZRFA 1O31A 3RS2A 4DVGA 3UXMA 2OESA 4MKFA 4C2UA 3U69H 3IO3A 2QXIA 1OXTA 3TITA 4MDSA 4JLMA 2ZR7A 2J41A 3QO6A 1EZXC 3IBYA 5IHPA 2WBLC 5JEEA 4HB3A 4LBVA 1E2HA 3G82C 1BTPA 3WYGA 2OLJA 2NWNA 4WH8A 1BYUA 1KNQA 3KQKA 2D3WA 2B0FA 3DFJA 5IF9A 2CHQA 4Y71A 3LY5A 3U6KA 4QNMA 4BAQB 1XD8A 2A4GA 1B7XB 1NI3A 3EZ6A 2SGAA 4JMPA 5B6OA 1Z5ZA 3ZVEA 3GLHE 2WPJS 3AW1A 3PTBA 3SU3A 3AVOA 2JLQA 2ZCHP 2DY1A 1AVXA 2CDNA 5EG4A 1SVPA 5A0FA 3V9PA 2QAGC 2WSSA 3RXFA 2J95A 1XUIA 1R0YA 3MO9A 4IVRA 3TH5A 4OQNA 2WMOB 1GHAF 5B58C 2ZRKA 1Z8FA 1T5IA 3X2SA 4LC0A 3SGQE 5JECA 3VXFH 4MRVA 3C7KA 1TWXB 4BEBA 4MPUA 2XWBI 1TRYA 5F98A 1FFHA 3FWYA 4F91B 2ZRIA 4NU0A 1N6XA 1G3QA 4AC9A 1KAGA 5CHAC 3AKDA 4HI3A 4YMSA 5E7JA 5AWFC 2ZR0A 3PROA 2OCAA 4ASUD 3ZZ3A 1UAAA 1Z6AA 1ZJDA 4XE4A 1D2MA 2H2ZA 3BG8A 4PZYA 3TUJC 1RVDA 1G8GA 2VWLA 5L2YH 1D6WA 2GJSA 1SKQA 4R9UC 1U98A 5DE3A 4CEHA 4NTZA 5C2ZA 1BJVA 4P4SA 2BLWA 3FKSD 1ZIPA 1FQJA 2ZROA 4DZZA 1FONA 1DUAA 2WIAA 4C7OA 5D3MB 3U7HB 1P6XA 2FFBA 2QXGA 1KDQB 2IJOB 3LPRA 2O8EA 1BT7A 3AVWA 3RABA 1PPEE 4NKRA 4U00A 1UDWA 1QCPA 1MV5A 2ZYVX 4B2PA 2D06A 1AQUA 2ODWA 1Z63A 2ALVA 1ZTLA 4U5XA 3MO6A 1YZLA 2ZTXA 2ODEA 2J7KA 2PWXA 4RD2A 5EUMA 1LMWB 2ZQ2A 1DWBH 3AM1A 4RKFA 3W6OA 2Y81A 1GVNB 5L30H 2H92A 1XF9A 1TQ4A 2PLRA 4MTBA 2CJWB 2WVJA 1O36A 1SGIB 4WVPE 4Z0KA 1UBFA 3C8UA 2G83A 2XBVA 2XBXA 2VF8A 4A92A 4PPFA 2NOAA 2A2QH 4GRAA 2MMGA 2O8EB 1O2HA 1G7TA 1KY2A 2GILA 2W3KA 1NBMD 1PPFE 2VIVA 2QNRA 1RTLA 1R4AA 3RP2A 3RC6A 4GPTA 2QM8A 3CPJB 2GK7A 3I4LA 3OF5A 2ODQA 3SW2B 1KZGB 3HK6B 2ESTE 1C1VH 1O5EH 4TSFA 3SV6A 2GXAA 5FBWB 1MD7A 1LF5A 1UCYK 3LDXH 2F9VA 3GFTA 1TNGA 3DT0H 4CRGA 2F6RA 4ZI3A 5FBLB 3RXVA 2CEAA 2EW1A 4AG6A 3Q76A 2BVNA 1NVVQ 1Q57A 3GJ0A 3RS3A 1AZ8A 1IHUA 1Q1ZA 1ZGIA 2I1VB 1LF0A 4TL9A 5KSZA 1UJ1A 2GCTC 2DFNA 3QGNB 1DAFA 4XSHA 3SJKA 4CRCA 1DARA 6ESTA 4AYVB 1AHTH 1Z06A 5H70A 3RMNH 3E0PB 2LWIA 5EE0A 5GNDA 1W0JA 4HAUA 4BFWA 4NWLA 1IQJA 4ILEA 3R9IA 1OX1A 3RXGA 1YR8A 3UNRA 1S2MA 4IW4E 2RCEA 4ABDA 2DE9A 4LY6A 3P8FA 3EA8A 3S1AA 4WOPA 4JLOA 2NMVA 4C0QC 1KO5A 1FDPA 2Q9CA 3H7TA 1O3YA 1TUEA 5HKKA 1HLTH 2W7SA 1K5DA 2FH5B 1CGIE 4A9AA 4Q19A 3R8FA 3ZH9B 3IITA 1V2PT 2OCYC 2Q6TA 1AB9B 1QB6A 2FSHA 4CH2B 3K70D 1EP5A 3BH7A 3A7ZA 1VIYA 3SFVA 1R5BA 1E2PA 2R44A 1TRNA 4O03A 1M34E 5JWHA 2ZETA 3E5HA 2P2LA 3RS0A 1T8UA 4ABYA 3TJZA 2QF0A 5BYJA 4C3ZA 2GF0A 5JLJA 4LC1A 2HJVA 1ESTA 1GMCF 3SI3H 1QHSA 2HUPA 4PQYA 1UVUH 5DPAA 1ZCAA 1C1YA 1MKWH 2DFKB 3X1WA 4IEIA 3LT3A 4MNVA 4V0ME 1W4RA 3RWMB 4YESB 3SGAE 1N3BA 1QHHB 2QRZA 2GGVB 3CS0A 2R6CA 3BE4A 2A5JA 5FOTA 1TNKA 1DWDH 1GG6B 3PWCA 2J34A 4DCNA 4EKDA 3FP6E 3KQDA 4KI0A 2CF8H 4ISLA 1HT1E 1HPGA 5KDLA 3ZYEA 1TAWA 3CM0A 1KSFX 3BTGE 1OFTA 3ZZBA 2Z9IA 2ZGCA 2DWOA 2J7PA 2ZUBA 4IDQA 4Q7YA 1ZHPA 1D5CA 3UY9A 1O3MA 4ZPXA 1K1OA 1V2OT 4K3JA 3WYFA 4TPIZ 5A2MH 2DWPA 5A8XA 1C5TA 1DE0A 3RXLA 4ERNA 2FOGA 4P3YA 4L9SA 2JDIA 2C77A 2DFLA 4R2IA 4E06H 4MPXA 2IA5A 3Q77A 2FFQA 3LX5A 1O2IA 1P2MA 1TPZA 2NO7A 3FGNA 3K0FA 4GMDA 5UKDA 3HPQA 1TF7A 2OCVB 1GZSA 4Q9IA 3QE0A 1NT1A 1J90A 3Q7PA 4KITB 2ZPQA 1TBZH 2ODYB 3SUFA 3AASA 2ZYUX 3VB5A 2ZCKP 1KY9A 5TY0A 4X8OA 1FL9A 4AGJA 1MZDA 2OBOA 2FF7A 1MRSA 1RD3B 1R2QA 2BKUA 4Q9KA 5K7RA 3GCNA 3W5IA 4TY6A 4D2IA 1HV8A 1QBNA 5L3SA 4O3UA 3A84A 2AERH 2W2TA 4FD2A 2XXLA 2PZGA 3SNHA 2VSXA 2A32A 2ZTYA 2VU8E 1TAGA 3HWSA 1P8VC 2UUYA 3ZZAA 4BLTA 4PXAA 4DLTA 1ELVA 4B3CA 3TIUA 5A4JA 2Y8EA 5LGOA 1ZM4A 1IQFA 1F5RA 2F91A 4XTRA 4NWKA 2P5SA 1C1WH 5FCRA 3E1XB 5AJZA 3DKVA 4MA4A 5D3MA 521PA 3PR1A 1NPMA 1AE8H 1BCUH 4XOJA 2OXCA 4B74A 4F4IA 1O2YA 1DVAH 1ANKA 1GKYA 1CA0B 4UFEH 4I8JA 1VCPA 2PZFA 3MWKA 1SGEE 4BZQA 1LW7A 4ABAA 2TGTA 4CT5A 3RANA 3VKWA 3AF2A 1JJ7A 1WXRA 4TWWA 5FR2A 1BS1A 1HNEE 1FPHH 3NWJA 1C4Y2 5L3SB 1IXRC 5AFZH 3CF6R 1Z8JB 1BUIA 4UD9H 2WSSD 4OS2A 4MQBA 1CA8B 4X6MA 1J15A 1W2HA 2FDAA 3OIUA 3DM5A 3GEEA 5BN5A 2PGBB 3WMGA 1G4AE 3ADDA 3KIDU 3FYHA 2ZYWX 4OM9A 5AHGH 3AUXA 4DCUA 2JETB 1LPZB 1O35A 3UKDA 1IJEA 5D3QA 2NO0A 4PC3A 1EJMA 1GBHA 5DP3A 1G37A 1XCGB 1MU8B 3C41J 4TWYA 4ZXXH 5DH9A 4LZ1H 2CL6X 5FBQB 3CF0A 1K22H 1O5CB 2PGQB 3PENA 2HNTF 2BLOA 1GHBF 3STJA 3VR5A 1SR5C 3PFIA 1VGCC 1E79D 3V12A 4NZYA 2BYAX 4MKGA 1W0ZU 4IS5A 2A2ZA 1YZTA 2ZJ5A 3QPWA 4BFSA 3QUMP 1UK4A 3O8DA 2BD9A 3VU9B 3A83A 5EGMA 1GG6C 1KMHA 3WBJA 3A86A 4KGAA 1V2KT 1R7RA 4IHQA 5BQ5A 3VR1A 1E34B 5CIWA 5EW2H 2ATXA 5EPNA 2NIPA 3U7EB 4NCHA 2XCNA 4JL8A 4LHZA 1G291 3BGWA 3L0IB 5IDKA 1DLKB 2BDGA 2AXNA 3CIOA 1Y5UT 1T8LA 2C9CA 3GJ7A 1QVAA 2C93B 1E2FA 1TQ2A 3F9HA 5C5NA 1T3HA 1O2OA 1C2DA 2GXUA 1V2QT 5DI3B 1E79A 3ZVGA 2ZRGA 3FMOB 1HXFH 1SL3A 2P8OB 4XVUA 1YCPK 3TKLA 2AIQA 3ZZTA 1EASA 1V5WA 2IBMA 1W10U 2EI6A 4LBZA 2GP9B 4V03A 2OILA 1CO7E 4OI1A 1YJ5A 1QHIA 4S2EA 4WAUA 4WZBE 3AAUA 4C0AC 4LSGA 4YOGA 1MKWK 1S0UA 2A4OA 3T29A 2GZ9A 2V1XA 2A5DA 3EARA 1T31A 3PWBA 2REXB 3JVVA 2D2DA 4LBWA 2CV3A 3QXSA 1BO6A 4M9QA 1GTVA 3BEFB 1DLEA 2ZAOA 1SGFG 5DP9A 1MCTA 1AVGH 4A6XA 4US0R 2VP5A 4C0BA 4PFSA 1VMAA 1O5AB 1O2MA 4LJ9A 1MQ6A 4DCSA 1I2MA 5BPEA 3CX8A 4RY2A 4OQMA 1S3GA 2BQ7B 3NC1C 3IDQA 5E4FA 2ZTSA 4PC2A 3S9CA 3P4YA 2JJ8A 3IIMA 5B30A 2FEOA 1XMVA 3CENA 2AMPA 2WTUA 2A7CA 4XJXA 1ZPBA 3A82A 5LPFA 1K8RA 2BVSH 2V3HH 4TL7A 1C5SA 1SOTA 3BTEE 2I1QA 3Q72A 4DHEA 2J3EA 4FUDA 1OWJA 1CEEA 1MKXH 1CT4E 3KKQA 2BY9X 4PSKA 2AFQB 3MU0A 3H86A 3BXZA 3EPHA 5FUYA 2FPMA 2Z7FE 3EXAA 1WBGB 3NBYC 3EDXB 4AKEA 2YKGA 3OX7U 2H16A 2WPMS 2W83A 3QBTA 3M7QA 2UUKB 1L1NA 1VGCB 4XWKA 4GHQA 2BD8A 4I81A 2F43A 1A3EH 3HGPA 3LNCA 2FI4E 2Z0MA 4CW7A 2ZR9A 2IL1A 3RSLA 2XC0A 2HVXA 2IS2A 3EASA 3FKQA 3FOZA 4O0MA 5DKMA 1X8LA 4LJ7A 4GDFA 1RXPA 2AYWA 1C5XB 4OS1A 5IK2A 1SXJC 5P21A 2QENA 3MSXA 1KI9A 2R9VA 1Z83A 4TLAA 1RRFA 4OQXA 1XB2A 3VKGA 4DLYA 5BN4A 4FIDA 4X2WA 1AFEH 1T8MA 5DSZA 1HRTH 2AGIX 5EJEA 1MOZA 1BRBE 1F60A 4P0TA 2GCOB 3PUXA 2VIPA 4KTUA 1LVGA 3QPVA 4XVQA 1YE8A 1BMAA 3TNFA 4HUTA 2OSBA 2ZPTX 4NYIQ 3MWLA 3ZQJA 1D9ZA 2GAAA 2QMEA 2A5IA 2KWIA 4LRWA 1KSGA 1E9RA 3QF7A 1O3IA 1P9NA 4E09A 1OV4A 5E0HA 1CRQA 2VJ1A 4DLUA 4FCVA 4AI6A 3QKTA 1H4WA 1PPBH 1N6YA 4K8BA 1W0KD 3I61A 1YPEH 3MH6A 2P94A 3GLIB 2HLCA 4BLPA 3U3KA 1KI8A 4AORA 3I3SR 4A8JA 2OG2A 1Q1QA 1QRAA 1N5KA 3Q3YA 5FTMA 1EFTA 1FY3A 3T25A 4FUCA 1GVLA 2Z6BD 1VG0B 1NMXA 1EB1H 4MH0R 2FGKA 1BYIA 3PMHB 2THFB 1KJWA 4OGXA 1RZ3A 2D7DA 2IYRA 1AB9C 2BMFA 1CJVC 1CQQA 2D62A 5F3WB 1NBME 3DM9B 1ZMXA 2O8FB 1B0UA 1W48A 4IMQA 1RIWC 1XVOA 1DS2E 3DDCA 5ANRB 3GISB 2ATVA 2RMKA 2WKPA 1P2OA 2FX6A 2G1JA 1W47A 2UWPA 2VRWA 3A88A 2AS9A 3DO6A 1C5RA 1Q3XA 3H0KA 4JK6A 1XZQA 3RC3A 4P31A 3K0AB 4YDSA 2C98A 3PV4A 1K9OE 2CK3A 4H1VA 4Y79A 3WRYC 1QRZA 1ETRH 1G9XA 2ASEA 4HDCA 2B5TB 2XZOA 4I1UA 1GJ7B 2Z5FA 2ANYA 3HJNA 3W3AA 1O2XA 5DNYB 1C5NH 1JAHA 1M7BA 4PAQA 3NHAA 1Z2AA 4C2TA 5K8TA 3ODFA 3GYMA 4LK2A 1Z3IX 1GHAG 3BAFA 3SV7A 1NG1A 1O3CA 2JLVA 3SR0A 1Z6TA 3WMEA 1PVOA 1JRTA 4DOQA 1AZTA 2H8KA 4LJYA 3P8GA 3CX6A 4ZIRA 3I8SA 2QGNA 5LH8A 1BH2A 4JT2A 1UEIA 1IQPA 1BTWA 1EOJA 1O3EA 3SYJA 5J4VA 4RD3A 3D65E 3W6PA 1OIXA 2HOBA 2O8MA 1N5JA 3VX4A 5CMXH 1TGNA 2X8AA 4IKEA 2H7VA 1AIPA 3KEEA 1C4U2 1GBJA 1FTNA 1EWRA 4JVMA 1ZIOA 1E4VA 2QTHA 4TSFD 8ESTE 5I46H 1NSFA 1MO5A 4B35A 2P95A 1SGWA 1TEVA 2O9QA 2J94A 3PUYA 3QKUA 4PROA 1ZP6A 3LD9A 2WPDD 3B1XA 3MYWA 4QHSA 1U8YA 1V2ST 4F93B 5JHGB 3U9AH 3KXKA 5FFMA 2FPKA 3BTKE 4OS6A 4DLZA 2IYXA 2OAQ1 2W5EA 3P32A 1NLYA 2GDDA 1D6RA 1O2PA 5L3QA 2QP9X 3ND9A 2DYKA 1IY2A 2HYIC 1ELFA 5EE3A 3D62A 4H42U 3SS8A 4GPGA 1C2KA 4BASA 3EIQA 4DURA 2YWFA 3B82A 4QKQA 4FW9A 1XDBA 1N6HA 1BRUP 1RIWB 3SBKA 4QBFA 2ZPRA 5ABWA 2BJWA 4NA7A 4RN6A 3MI4A 2Q6FA 4KYUA 1OHHA 1MMJN 2F1JA 4RI0A 3V4RA 4ZKEA 1G7RA 5EPYA 1SVWA 4DXAA 3IGFA 3ZIAA 4HAYA 4IEEA 3REFA 3A1TA 1AS0A 2G00A 2JA1A 2ZSFA 5JSZA 2C8XB 3U4QA 3QF4B 3RS4A 1UTMA 2FWRA 2YNAA 2ZE5A 5JJLA 1SLUB 5LD2C 1YZKA 1HIAA 1HYQA 4D25A 1ELAA 5SZKB 3KKOA 3NXSA 4G1UC 3SDZA 2WM9B 1A46H 1YC0A 1FV9A 1E2KA 4TQAA 4FMCB 2H1UA 1TMBH 2R6DA 3IEUA 3PO1B 2VNTA 1HGTH 1B5GH 1V2VT 1Z0DA 4TN1A 4GVUA 1GBIA 2GJ9A 2ZDMA 1C2MA 1CBUA 4DIHH 4Y0YE 2ZRJA 5AR1A 2V6IA 3EA0A 2BC9A 2VB0A 3DZDA 4BTUB 1IQKA 3SNEA 1KGDA 4IW3B 3GLFA 4IDOA 4BZXA 2VVCA 3BB3A 4Z8XA 3V7TA 4ON9A 4IDNA 4DEYA 1WF3A 4FN5A 1K1MA 1Z0IA 2R2MB 3RYTC 2JH5D 2ZHWH 1BA8B 1C5MD 3PG5A 1INCA 2BXTH 1SZPA 2QV1A 1AIXH 2BMEA 5EP4A 1IN8A 3RRNA 1LDTT 2ASUB 2H9TH 2QA9E 5FPSA 2P3FH 3IG6B 4PPGA 2IPHA 1G3UA 2C2HA 1WBBA 2BOHB 3KFVA 1CULC 5K0HA 1NNEA 3MJHA 3O8BA 2ORWA 1PUIA 1HYLA 3U2QA 5DP8A 1Y63A 3IIJA 1BRAA 1QL8A 3BH6A 2CLSA 1JQLB 4HSEA 1IQGA 1AI8H 1ZMJA 2VP6A 2JASA 1LVMA 2A31A 2V3CC 4UFGH 3GCTG 3DHKH 1GSIA 1E99A 3BH0A 3SUDA 1UCYE 3BN9A 1HAYB 3T1TA 3LAWA 1DS6A 2C8ZB 5AFYH 4YXWA 3LVRE 5FHTA 4YT7H 2CLDX 4H9GA 1T6NA 2QN5T 4V0OA 1TTTA 1WTHD 4BFXA 1TU3A 3QX5H 4WWYA 2SGEE 3VR4A 2N42A 1E69A 1A2CH 1DTSA 1U9IA 1ZHMA 5FOVA 3BTTE 1F0UA 3Q3KA 1EJAA 3K0AA 1NG9A 3IQXA 4Q01A 1Z28A 3BTME 2V3OH 5F03A 4BLOA 4KVGA 3X1YA 3FANA 5GXPA 2O8DB 5G3ZA 4JZ1A 2QL6A 4HAXA 3AF3A 4NL4H 3J81k 2EQBA 4QXAA 5AUNB 1EP6A 2HGTH 4X6PA 2ZI6A 1IXZA 1WOFA 1ANEA 2XJ4A 3GY2A 1EB2A 1FX0A 2STAE 3AKCA 2FI3E 2LNCA 3B13B 3SQEE 4JZKA 2X2EA 2QE7A 2OQ5A 1YM0A 3QXHA 1W2GA 2VVUA 1O2NA 4I8KA 2VHJA 3LWNA 2JLZA 1SFIA 1TNJA 2GX4A 3LC3A 4KSBA 2A5AA 4K8YA 2HXYA 1GKIA 3C27B 2CMYA 3MWIU 1GRRA 5FUXA 1KLIH 1W8BH 4OHVA 5G40A 3RRZA 4FVDA 1AGPA 4X8TH 4DJTA 2XJ9A 3EW9A 4JYUH 1PJPA 3UMFA 4JVNA 2FS9A 2IN2A 2GKVE 3AKYA 3A4LA 5DO4H 1FQ3A 1C1QA 1Z0AA 2J7PD 1P7CA 5SZJA 2BVRH 2D7CA 4MGYR 3CBQA 5G53C 1O30A 1ABIH 3CP7A 2QN6A 4A0RA 1NU9A 3TH2H 5C1BA 4TMXA 1MTUA 5BWMA 4PX9A 2RGBA 4TLBA 4XBDA 1W36C 4B2BA 1DT2A 3BTDE 1KDOA 1IHSH 1ETUA 2PKAA 3Q7QA 5L8VA 3S7HB 1KO1A 1IXSB 4B2IA 1AFQC 4URUR 2C5LA 1VG9B 2VHTA 1IQIA 3MNXA 1AZZA 4MGIR 3MH7A 2BZ6H 4Y8ZA 3GJ3A 1T4VH 1JBKA 2EFEB 1Z08A 1E9DA 3TK9A 1W44A 5CB6A 4DJZB 1J9CH 3GLGE 1OXSC 3EAQA 5DN6A 1YCPH 5F9HA 3A89A 2C9OA 1P5ZB 4FCWA 4PANA 1P2KA 3BV9B 2P67A 2QMHA 2ZECA 1D3QB 5F2EA 8LPRA 2EVWX 3KTAA 1MO6A 1Z29A 3ZV8A 5DGJA 4RD6A 3M5NA 1KXDA 2AK2A 1E9CA 3GCHB 1YF4A 1UF9A 5J4KA 1N8OB 1IQNA 4TL6A 4WY3A 3MJRA 4PQRA 2ZJZA 3MU8A 2QP3A 1C2JA 4U02A 1QY6A 2QQ0A 3GMTA 1IQHA 1HAZB 5KOYA 3AVYA 4EPXA 3AH8A 4JZIA 5EOKA 3EX7C 2ZRBA 4XTCS 4B44A 1H1BA 2BDIA 1XJCA 3LFUA 1NRNH 1QNJA 4XBBA 2RHDA 3Q85A 1GDDA 1G3CA 2Q9BA 1D2EA 2BCJQ 5DG6A 4M2LA 3NVAA 2PBRA 5GJCA 4MKHA 1E98A 1NM6A 3EC2A 3TK5A 2RA3A 1R0WA 2H9EH 1HJAC 2RDLA 4P4UA 4A1VA 3QF4A 4KLNA 5K8LA 1TX4B 3RM0H 2BEJA 4NG9H 2JLRA 2ZI7A 4H6TA 4B43A 1F5LA 4JL5A 4BANB 4QRHA 3H2YA 1OFIA 1P11E 4D9RA 3F9EA 1S85A 4HDOB 3RXKA 2N46A 2QORA 4BWYA 2ZRAA 2OP9A 2ZI5A 2Z94A 1CSOE 3K2UA 4I8LA 1KLTA 1EXFA 2PH1A 4POAA 3NKVA 1X8KA 1SGYE 2ZF0H 2O8CA 4M9ZA 3GY7A 5GJBA 2YOHA 4Q5IA 4CEJA 2YZ2A 2QPOA 1TE0A 2XX3A 4Q00A 4CIDA 1S84A 1O3FA 3U8TH 4O2LA 4DIEA 1DAGA 2WPLS 1BKDR 3ZD6A 2H5DA 1HIAB 2KSQA 3RXBA 3ZZDA 4JK5A 4GP6A 1M74A 2JDID 1GM5A 3A6PC 2DPXA 4LYJA 4NA8A 3O47A 2FGJA 1W49A 1T3LA 3U98H 2IEYA 1S82A 1XNJA 1EG7A 1L4ZA 1NVUQ 4AKIA 2BLVA 3KJIA 4X6OA 1ELOA 4AN7A 1GBCA 1R8SA 4NFEA 2WJHA 3ZVRA 4C0SA 3MCAA 2V54A 4AK9A 1UVOA 1OWHA 4TYDA 1ZM3A 1G8YA 3UK6A 1TNIA 4C9BA 3VMFA 4D7GA 1RRCA 3EA7A 1VITF 1O39A 1GCTC 5EZ6B 4ZHMU 1HV7A 1Y3WA 3M0EA 1AM4D 3RLYH 1OFUX 2VA8A 1FXYA 3RVBA 2F3TA 4DDUA 3CH5A 4BPBA 1X86B 3LJOA 3SU8A 4TQUS 2VH0A 1ZBDA 4YOIA 3BFKA 1C9TA 1VCWA 1F92A 4NCYA 2NQ2C 3ADBA 3T27A 3SQXA 1TGBA 1TQ6A 2YVUA 1DX5M 3R20A 1RE0A 5EXPA 1ZNXA 4EPTA 2IHBA 2QGRA 1A4RA 1OKKD 1ZMLA 4FMDB 4PHFA 3ADKA 1DITH 1X6VA 3KJHA 1Q20A 3JZ1B 3GPLA 4Q48A 2GD4B 3UATA 2VP0A 4U32A 3U8RH 1TEXA 3A7VA 2BDAA 1TABE 2ANMH 1VCMA 1Y8TA 2BBTA 5EXTA 2XB2A 5KSYA 4BNRA 3LQRA 1UVTH 3I1FA 4UNNA 3MAAC 3P8OA 1DO0A 5LDDC 1F0RA 3SU0A 4Q4JB 4NMMA 3H5CB 3TW8B 1UKYA 1HAPH 3I8XA 3FAOA 4AKHA 1NJGA 1UTJA 1D8TA 1JR3E 2AH4X 1P09A 1M8PA 1AN1E 5BRRE 4J2YB 2XITA 3T62A 3CLVA 2ZJBA 2QF3A 3NDPA 5FH9A 3G0HA 2AD1A 1IAQA 1G16A 2XRCA 4KHZA 3OHMA 1TGSZ 2IWHA 2V8OA 2EFCB 1K1NA 3E91A 1G7SA 4GMXA 1P2TA 4K5ZA 4RVCA 3UMRA 1F2TB 4EJSB 1EAIA 2G4TA 3AP3A 2QAGA 4AG2A 4MNWA 1SVOA 2PW8H 2VGCB 4ESHA 4NYJQ 2AMDA 3MTYA 4DT1A 4B76A 1IN6A 1A5TA 4O3TA 2GTBA 1GJCB 3LC5A 4NIXA 3CRRA 5EQTA 5JBAS 5SGAE 1JEEA 1RRPA 4IVPA 4Q1FA 4Q4JA 5E2PA 1P3JA 2QMOA 1CKEA 4OS7A 3GJXC 1LKBA 1KXAA 1O3HA 4M9SA 4JVLA 1UTQA 2JATA 3EIHA 4CRBA 1TOMH 1L7VC 5C1XA 4ABFA 2WJIA 2MSEB 4LJ5A 2ZDLA 4I31A 4GBMA 1C5YB 3P70B 2ZA5A 2F9LA 2HALA 1TFXA 3SUGA 1ZAKA 2ZITA 3K9GA 1YPMH 2PV9B 3K70C 3BWDD 3NBZC 1P9UA 3VR6A 1ANDA 2KI5A 3EAJA 4BECA 1HT2E 4OJQA 1O3OA 2GCHF 1YZUA 2FMXA 3C4JA 4QGGA 1NN1A 3QXJA 1F6BA 2ZS7A 3GJ6A 4DIIH 2XXAB 1JB1A 3B9QA 3GLIE 2Q3HA 3AV0B 1KOFA 1RFNA 3B6EA 4CRWB 2FYRA 1MQ5A 2BEKA 5LPEA 3CRQA 3RDZA 4KBGA 1K1JA 1Z6XA 3P8NA 3SYKA 1DY8A 2FOAA 2DB3A 3IIKA 3SV8A 1SVSA 3S0NA 2OINA 3M7UA 5EXNA 1BITA 2G9NA 4CT4B 6GCHG 3HKIB 2ZS8A 2M5TA 3V00A 1U2RA 2ZI2H 1P9SA 7ESTE 1YLCA 5DGXA 3L3TA 3CRMA 2IEZA 3PB1E 1OH7A 3AAVA 4RFVA 3LQQA 2Z3EA 5HGGA 4J0QA 2I3BA 3IPXA 4B73A 2C99A 1Z6EA 4KP0A 3FVFB 4Q80A 5KNCA 5TDHA 1J16A 1GMDG 3AF1A 3UR9A 2XBWA 3GY5A 2WOJA 4B32A 2RKOA 4TT3A 5L2ZH 5TVKA 3RXDA 2G55A 1O3DA 2NO9A 3LH5A 4WF8A 2W0SA 4B2AA 1JR3A 2STBE 4DB4A 1UKEA 1ZTKA 2KJQA 1OXUA 1SXJD 2G88A 1TA6A 4OI0A 2BMGB 2J0VA 1NFWA 3ECCA 1GL7A 2GCTB 3E70C 1EFCA 4Q4AA 4V0KA 3L33A 1TMKA 4JLKA 2XTTB 1KHTA 1XMIA 1N6NA 1DICA 4MLFB 1ZYOA 1VITH 6Q21A 4B48A 2QEQA 3ENSB 1UBEA 2QROA 1XP8A 2XAUA 1VHLA 1COWA 1O5GH 3WY9A 2VSOA 1E0JA 4JLDA 1TPSA 4RD4A 5A0AE 2ZE7A 1JPNA 5TB5A 1O5DH 3LGUA 1E2DA 1VHTA 3EZ9A 3RLWH 2IS4A 2ZS9A 1LTOA 4ISHH 2JIZD 3TJOA 2NU3E 1GJAB 1LPKB 2NU2E 3GYLB 1BHXF 4B2LA 2Y5HA 3S69A 2GCNA 1TBRH 2TIOA 5JRZA 5C18A 1ELDE 1XWIA 1F48A 3MGCA 3Q3JB 1EUFA 1AWFH 4BZPA 1KYNA 1TB6H 1LTQA 1Q0UA 1XPRA 1T8OA 5KUTA 4BFVA 2GJKA 1GVKB 1WQ1R 3PV5A 2OO7A 4HDQB 2R62A 3BORA 3SN8A 5AJVB 4ACAA 1WMSA 4HZIA 3A1WA 4OHZA 2ZQ1A 1SGDE 1P2NA 2IT1A 1G2LA 1QQ4A 2HDNB 3RUOA 5AJWA 2OXSA 2RHMA 4OQLA 4QBIA 1P05A 2PHBA 1IOEA 1LHCH 2FSFA 4DLSA 1NZQH 1ZUIA 4Z1MD 3BERA 2BIFA 1ZD9A 5CE1A 2XTNA 2BX4A 2V6JA 3VTKA 2SGFE 3SQWA 4BTIB 1S3SA 1TQDA 3URDA 2ZSEA 5C1YA 5F8TA 4HAZA 1OYQA 1OP8A 2HJGA 1KI1A 1XZPA 2E9SA 1TF2A 2YV5A 3CRW1 5K8UA 1AK2A 4B6FA 5G3YA 5FXLA 3CW2A 1H8HA 4DT7B 1ZNWA 5EE5B 4Q1CA 2OLKA 1UVSH 1DELA 2J1LA 2GWHA 2A7HA 1XX6A 4EPYA 2RB4A 1DSUA 3CR8A 2WAXA 1KXBA 3GEHA 2HEIA 3H7OA 1O2UA 5CB8A 4Y6DA 1NLFA 4THNH 4OGYA 2ZJOA 4SGBE 3T26A 4QGAA 2J2UA 1Z7KA 4E7NA 3EC1A 1G5PA 4HYYA 4YDHB 2CJWA 3VR2A 4M1WA 3L6PA 1RS0A 3QZQA 4MYCA 2C03A 4I7YH 3U7GA 1OKKA 1H8ED 3QKSA 4FUEA 4CZ2A 2OQUA 2ZRPA 1AFQB 2ALPA 7LPRA 1QB1A 1VCIA 2E1RA 3TRFA 3MO3A 4Q9HA 1G1MA 1GHXH 1Z6YA 2CXXA 2QM7A 2GTPA 2AX4A 1N6OA 1XBTA 2ANCA 4BAKB 4KJZA 2ZSAA 2ZU1A 5TJXA 4PO1A 1NRPH 1S81A 2ZQ5A 3QVVA 1OE0A 3HR7A 2A45B 3DPUA 3TGIE 1YU9A 3K0FB 4DRZA 3A8TA 1Z6GA 4IOLA 3CH4B 1V2LT 4NIVA 4YMWA 1VYVA 1JXMA 2FSIA 4MRRA 4OYHA 4URYR 3I62A 1LVOA 3U8OH 5L3VA 4LK4A 1N6RA 1TA2A 1Q22A 4IFBA 2QAGB 1IQMA 2BHRA 4YXWD 1O2LA 1JXPA 2TGPZ 2BD5A 4NYIR 4Q47A 1GJ8B 1CF4A 4AYYB 4BFTA 2HNTE 2GZ8A 2VINA 2OUAA 1G20E 4BUJA 1XUFA 2W0MA 3TBKA 1MKXK 3MHWU 1JRSA 4TLCA 2G1KA 1V2WT 3TK6A 1JR3D 1LNZA 3K0CA 1SB1H 4BLQA 4ISOA 4CBNA 1O33A 3GJ8A 3MU4A 3SU5A 1ANCA 1P2QA 2WUBA 3K0CC 4JYBA 3T34A 5JRJA 3IILA 4L15A 1BTUA 2EA3A 4V0MA 4M9FA 1IN7A 5LBIA 2IYLD 4LYAA 1TOCB 2FEMA 3FHOA 2EI7A 1ELTA 1GBDA 4QM7A 1XMNB 4NSVA 2SGDE 2ZHQH 1R10A 5EQQA 2AK3A 3MLEA 1EFRD 2ERYA 3SHWA 3TH4H 4URVR 1W0KA 3KQNA 1HAGE 3DUXH 3LGIA 1NIJA 2BHGA 1EX6A 4YZUA 5JS8A 1OIVA 3A7TA 4ABIA 2B8TA 1UTLM 4OK3A 1QF9A 4TYWA 1ANBA 2R3UA 1OYWA 3T1QA 4R8TB 2C96A 2D2EA 1KXCA 3KXIA 1CR1A 2BOKA 4A1TA 4M22A 2GDJA 4ZCIA 3CX7A 3NTUA 1XD2B 2PL3A 3TAUA 1T8TA 5C67A 5GJ4B 4FCTA 4DLVA 1S4QA 2ZNKH 2WYJA 4Y76A 4FUGA 4TPYA 3AQ4A 4LGMA 4ZXYH 3P4XA 2NO6A 4NZLA 1HFDA 1P12E 5FOUA 1RGQA 1U99A 5CJ2A 1FPCH 5ETXA 4JSTA 1ESBA 4M1OA 2J0SA 3QBVA 2PEYA 3WYAA 1AUJA 3WBKA 5C20A 1O3GA 1YBWA 2AGGX 2D26C 2R0LA 1O37A 4C30A 1XCPA 3NWUA 1CBWB 3ZS9A 3IKJA 3CUEF 2JETC 2OTVA 4M7GA 4M1YA 5IYTA 1CT2E 1EFRA 3QJYA 2OFOA 3P6ZB 3H1TA 1LPGB 1WQVH 4N0DA 3SNCA 2D2FA 4H4FA 3OESA 5C5OA 2H5CA 8GCHF 2IYTA 2P6RA 1E2MA 2OT3B 3ZVFA 4X1NU 4K8OA 1T4UH 3BBPA 2R6GA 6CHAC 5EP2A 4LZ4B 4CVNA 1X3SA 4HTCH 1NRRH 2YINC 4QM6A 3TH3H 4US2R 4DLXA 1YRBA 1JBUH 3VFEA 1F0TA 2V0BA 1BTZA 2FSGA 2FG5A 3UQOA 2GF9A 1HB0B 5GJVC 2XCFA 4L16A 5BYKA 1CJMA 1FMLA 2DFTA 1T4GA 2ZDNA 3OY5U 2VIDA 1SQ5A 4W7SA 5HPYB 3OFNA 1KAOA
chains in the Genus database with same CATH superfamily
1WDWB 2Z58A 3QUTA 4A10A 2IY8A 1F8FA 1K7FB 3OPNA 4XIYA 3A8BA 1LA2A 2ZRNA 2EKQA 2ZUUA 3FUCA 3MIIA 5I7EA 1O8CA 3T38A 1OW3B 2O3UA 3NV7A 1B3RA 2AZTA 4YO8A 5DX8A 4BO9A 2SKCA 4LBYA 2RGEA 5BNWA 3N6XA 5HE8A 3E03A 1G30B 1JHAA 1M2HA 3IURA 3AFMA 3GLKA 4G4JA 1YPHC 3UFAA 2NU1E 5J1SB 2PXXA 1C1OA 5DMHA 1VLJA 4XUEA 1X7YA 1C0LA 2XT0A 2CVQA 3TL6A 4B8WA 5BR7A 5JAIA 2CZCA 3FUUA 3RVNA 3ME5A 3MMGA 4M21A 3LPMA 3A1UA 5JEDA 4RZ2A 2F3RA 3OJXA 3KYFA 2G77B 3FWKA 4HV4A 1ZWKA 3EY4A 3WWDA 4R8KA 4HWPA 4HGYA 4MWOA 1J1IA 4AS2A 1CUDA 5EXDA 4BAZA 4D9GA 4CIBA 3DFLA 3GCOA 3S5JA 3ZX5A 5J5CA 5LKRA 1MEJA 4IIVA 1GCUA 1RDFA 2GAOA 4FE7A 4Z2AA 3REQB 3ICPA 5AK6A 4MYSA 3FN8A 1IY9A 5ESXA 4FETA 2VJCA 2WE7A 3W0LB 2FSVA 1J99A 2D1RA 2HDWA 3ASZA 2WR8A 4I9UA 2FP7B 4UU8A 1A96A 3V1KA 3VTZA 3TAHA 4JT8A 3D4IA 3TMAA 4TXJA 5E3HA 4ZFNA 3SS7X 5HKOA 1XJQA 3KQVA 5J47A 2NUTB 1OILA 2Q6GA 2ZIGA 3CRVA 4YHBA 2D2XA 3BJIC 3PCXA 2HSWA 4EF4A 4X1PU 3N0WA 4D3DA 3GCTF 4O2BF 5FA5A 5J5VA 3JASB 2X7JA 2M6LA 3ATIA 4Q21A 1XXHB 1H1DA 2ID8A 2EHJA 2QN1A 2V7QA 3IOEA 2PV7A 3MMPA 4WN3A 4Y1EA 2ZP1A 1Y4AE 4MYHA 5AKIA 5C53B 4OUDA 2NG1A 3RC4A 2OLEA 1TNLA 2HA0A 2RC6A 1VJ1A 1G6HA 2HADA 1DIRA 1IY8A 3NFRA 3QU4A 3CPSA 3PQCA 1MW9X 3V1MA 3NHUA 1EJNA 1SGFA 3PCRB 4IGKA 2WPIS 4K9RA 3FP7E 2Z43A 3MTQA 4LDQA 3QSYA 1UINA 4ZK6A 1KAHA 2P90A 4Y2HA 3DKPA 3KZ1E 2CHFA 3ZJTA 2P3TB 1WS6A 4JGGA 1E9VA 5DM60 5ICCA 1QBOA 2W2XA 1WUHS 1G3DA 4IIYA 1KVUA 3GLRA 5F1KA 5DTEA 1GG9A 2BB4A 5TQVA 4A2QA 5BN3B 1H9LB 1RJFA 5JXIA 2ZM5A 121PA 1GDQA 2J3HA 3IBGA 4Y6OA 1TMTH 3BWVA 3G7NA 4QYMA 2VN8A 1J8AA 1CZKA 2BBOA 4BFCA 1CZRA 2HLDA 2GPAA 1C9YA 4XOIA 1C1HA 2CBZA 3SJOA 1QLWA 1KPHA 1Z12A 5H0IA 4JEMA 4P3NA 1Z73A 5HFNA 5FXMA 1KRHA 4Q93A 3U17A 1YJAA 3RADC 3PNVA 2JCBA 3CE6A 4URWR 4YPVA 2J31A 3RVDA 1YY3A 4TWJA 4D76A 1COWD 1XU7A 2QP4A 2FFHA 3CNNA 3JQBA 1YACA 2VDMB 1VJRA 1TYZA 4LXQA 5I4CA 4FU7A 2PZEA 4HZGA 4ZDJA 3DONA 3QIVA 3KLPX 1PK7A 3SJAA 5HMLA 7MDHA 2HI0A 5LR6A 2IYPA 1KYZA 1NW8A 3DDNA 1PPZA 2CLCX 5EZQA 2PMWB 3OQPA 1C1MA 4MV7A 4CQJA 1Y81A 1YMUA 2QF5A 2ECOA 2JI8A 2XBUA 2GUWA 2FZKA 1TVMA 2EX4A 2F3UA 1JT9A 3FJ1A 2ZVPX 4MVXA 1FIWA 1HDTH 1FTSA 3ESYA 2RG3A 3RAFC 2GAFA 2WK1A 3V2HA 1PSZA 3ZCSA 4WE3A 1CQWA 5BMVF 2UXCB 1QU3A 2AFIB 1OWIA 1QONA