3O8DA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase
molecule keywords HCV NS3 protease/helicase
total genus 207
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8dA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8dA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8dA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8dA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8dA03
4CT4B 2A7QA 3VR6A 2BM0A 3TRFA 2GZ8A 4LZZA 4ZCIA 3RVBA 1Z8FA 2AEIH 1WYKA 2W83A 4LYHA 3O8CA 4HDQB 1V2JT 1KLTA 5KYKA 3QBTA 1HAYB 1JRTA 2FPZA 1J16A 4K1SA 1EWQA 3BTKE 3RXKA 1WUNH 3QBVA 3ZVLA 5J4LA 5EJEA 5FH9A 1PV4A 1RRFA 2PKSC 4QKQA 5EE9A 1JQLB 2REBA 1TWXB 4AN7A 1A4RA 4JBWA 3HGNA 3GLFA 1QG4A 3RS0A 2J9NA 3SORA 2DHRA 2ZU3A 2J0VA 1TQDA 2EW1A 1EFCA 3SNCA 4Q4AB 5KDOA 5HKKD 2CXVA 1TU4A 2A4GA 4BAKB 2DFLA 3QUSA 4KBGA 1MUEB 5DO4H 2R6CA 2XTMA 3B1ZA 1T0JB 2QMOA 2ZS9A 2Y82A 1AKSB 1ETSH 4Q47A 2WMNB 1GSIA 3TMKA 4LPKA 3BTME 3ATIA 2JA1A 1EXFA 4A1VA 1FMGA 2GHIA 3TGIE 3U3MA 1IXRC 2ZJYA 2AMDA 2H1LA 1HDTH 4ZHLU 1NBMA 1XUJA 1SLXB 2ZRBA 5JBAS 2X2FA 1S96A 2BDHA 2HPPH 3QJYA 4C0KA 2NZ8A 2GXUA 3Q7PA 4UQOA 2WKQA 3P6ZB 1SOTA 1G6HA 3E1XB 5HYOA 1NMZA 4QRHA 3O8DA 1SULA 3R8FA 1OYYA 1NY22 1SGTA 1C1MA 1GG6B 1W46A 1VCMA 4MQBA 4K60A 3RC4A 3BEIB 4IDQA 3KHVA 2V8OA 1NT1A 3A7XA 3VGCB 3ICQB 1N25A 5DP4A 3SFZA 1C1PA 4IDOA 1GJ8B 3AKEA 4TWZA 1CJTC 5JWHA 4DBLC 1V2QT 1UBGA 2FYQA 4X8SH 2ZIQH 4Q01A 1XNJA 1GJ7B 2IYRA 4X1NU 3Q8XB 4KVAA 1QGFA 2JDID 3UR9A 1E79D 1J14A 1O0DH 3C14C 2ZGHA 5A5GA 2FXRA 4BAOB 1QIXB 1Z2CA 3S7HB 3Q3XA 4DLZA 1MQ5A 2VLIA 4MITA 1XPOA 4TLDA 3EZ6A 1C2IA 1EKBB 1NBMD 1H65A 3MNXA 4BGDA 1GKYA 5HCIA 4IMZA 4B75A 4DW2U 2WMOB 3N5CA 4C3ZA 3MD0A 3LQQA 2WTUA 1C5WB 3K70D 3M7QA 5KHOC 2HUPA 3TGPA 1G8HA 1C1VH 2CVFA 2IEYA 1OT3A 1O30A 3GP8A 1W10U 4XIGS 2KAIA 2O8BA 2HEIA 1GL6A 3FMIA 1F92A 4LJYA 1S84A 3WBKA 2HJGA 1XZQA 4NPHA 1HYLA 2QQEA 1YPMH 1THRH 4ABAA 2BQ7B 1SPJA 3IQXA 2ZCHP 3BB4A 3UG7A 2JASA 2D2DA 4A92A 2H92A 2SHKA 1E9AA 1S2MA 1MKXK 4ESVA 4Q19A 2MMGA 4LCBA 3NDBB 4CDGA 5EQQA 4UNQA 2F9OA 1KJWA 1FY8E 1P61B 1KXAA 5C2ZA 1SLVB 5EQSA 1DOAA 2G9NA 1PQ7A 5TARA 1ZTJA 3QDZB 5L3QA 1CXZA 1UCYK 2FWRA 3U7FB 3ZS9A 4D76A 1P7CA 4CH8B 1AUTC 3MFJA 3ADKA 1G8YA 1BB0B 4URWR 1D2MA 1RIWC 1SL3A 3RXLA 2VP2A 3L8YA 1GI9B 2GMTB 4HB4A 1F0UA 4PHTA 3THWB 2GZHA 4MYUA 4B32A 2R3YA 3QPWA 2VINA 3KJGA 5JBQA 3GLIE 3ADCA 5HKKA 3AM1A 4B2IA 3RSOA 1CBUA 4A0HA 2ODYB 2HXYA 1AFQB 5LDDC 2PT5A 2LCFA 3KJIA 4NCHA 1HE1C 3M7TA 3GJ7A 4WXPA 3MHWU 2G6BA 5ESTE 4A1XA 4G3XA 1GBBA 5DP9A 2ZROA 1X86B 1O2HA 2OCPA 5JS8A 3SBEA 3V9PA 4ZPXA 1W0YH 1LY1A 1F0SA 2BXTH 2VWMA 5E8EH 4FUFA 4O2LA 4LHZA 1T7CA 1Z28A 1C1RA 2OXSA 3VHLB 3VX4A 1T3HA 3PEYA 2WAYA 3BTTE 1UCYE 4B3XA 3S0NA 2EQBA 3JVVA 1DICA 2A4OA 1DXWA 1S82A 4RI0A 1HT2E 4Y8ZA 4P0TA 5E2PA 2TMKA 1SVSA 3PCRB 1BBRK 3D62A 4GP7A 2BVSH 1VZQH 4TMXA 2WPDA 3CIOA 4WOPA 3GLIA 3P17H 1Q22A 4QBGB 2GJSA 3WY9A 2JH6D 5B6LA 1VHTA 1ZM9A 1DAGA 3KTAA 1BDAA 2HNTE 3NIBA 1AKEA 3BTDE 3KQCA 4X8MA 2W7SA 1RFNA 2VIOA 1DS2E 1RS0A 1Z07A 1XTIA 2QBYA 3UXMA 2F1JA 4IOJA 2ODNA 2DYKA 1E9BA 2ZU0C 2GCTC 2DFNA 3QXHA 2VP5A 3ZZTA 2P5TB 2ZTXA 1MO6A 3V13A 3MH7A 2Z9JA 1J8YF 1C1WH 4K1TA 1Q44A 4B48A 3PB1E 1EUFA 1CRQA 1YP9A 4IVPA 5F9HA 3RSLA 2ZI3A 5EXLA 3ZVGA 3IEVA 1T8OA 4PO1A 3K1JA 5KO2A 3WHLA 1L4ZA 2ZRMA 3LOXA 1C5QA 1VYVA 3TIUA 1TNIA 4DHEA 1Z3IX 2OP9A 1H8IH 1HTWA 3C15C 4HLUA 3DKVA 3BFKA 2F9BH 4TTQA 1ZTLA 4C30A 4TZ0A 1KXEA 3NWUA 4JBYA 3CRW1 4ERNA 3L8ZA 3FFAA 2P6NA 1UHBA 1KHTA 1HV8A 2RKOA 2FFBA 2UUJB 3LAWA 1ETRH 1GI6A 1COWA 4TZ6A 5EPYA 2ZWLH 3U4QA 4MKGA 4XD7D 3BB3A 1CA0C 1O3NA 4JLOA 2OINA 4PZZA 1BTXA 5F6MA 2G4TA 1HLTH 1E2KA 2R8RA 2PKSB 5DP3A 3K0AA 1GJAB 1K2I1 1CA8B 2XWAA 2X2EA 2H18A 1P9SA 2JETC 1FN6A 4DSOA 3RXDA 4CEIB 1HRTH 4EPRA 5FPTA 4NBSA 4LBVA 3TH4H 1DVAH 2XBYA 3RWOA 3MYWA 2WBLC 4GDFA 1GMHG 1GIAA 4AD8A 1DITH 1WP9A 1N6RA 2GVFA 4QGHA 1D9XA 1TAGA 3UIEA 1AS0A 4ZKDA 5I46H 1KIMA 3LBIA 3PG5A 2H1UA 4AFSA 2JJ2D 2CF8H 2PKAB 3LGVA 1OFUX 3NC0C 4Q7XA 3CZPA 4GPGA 4UFEH 1TE0A 1NIJA 1QA7A 2BY5X 1SVIA 1EAXA 5DKMA 9LPRA 4VGCB 3UWIA 2ODPA 2ZS7A 2RAPA 5DI3B 5DN6A 4BLOA 3KJHA 1OWDA 2A5JA 3FPAA 1IY0A 4EAQA 4JZKA 1FFHA 4QJ3A 1NNEA 4LBZA 3ATKA 1E2JA 2I4IA 3EG5A 1E0AA 1CHOG 3H0KA 4IC6A 3B6EA 2F91A 1KJYA 2P6RA 3HPRA 1XVOA 1X6VA 1ACBE 4ZI3A 3SJKA 4GMDA 8GCHG 3QIAA 2ZRHA 3PV5A 1IN5A 1E2IA 4OYHA 1OH5A 2YJTD 2AGIX 1BTPA 2X19A 3U98H 3C5CA 4RKOB 1RRGA 4V03A 1PLLA 3HK6B 1UVUH 4DEXA 3U4QB 3VGCC 1XZPA 4WIAA 2OBOA 5L6NH 4WH6A 1BA8B 1C9PA 2AWNA 421PA 3ZVRA 5IDVA 3RU4E 3A85A 1SGRE 1J15A 1A61H 3Q85A 2ANBA 3GY2A 2P16A 4TLBA 2R2AA 3CP7A 2SFAA 5HXFA 3T2NA 4R98A 1II8A 1MT0A 1IY1A 2N42A 2IXGA 6ESTA 1KY2A 3C5HA 1O3EA 4Q7KA 2VVUA 1SXJD 4JSYA 3PUZA 1JB1A 3M3VA 1MAXA 2JLYA 1E34B 2HF9A 2H17A 4TYYA 3LU9B 1JR3E 1ARBA 1BJUA 1QHGA 3EGKH 2NU3E 1KMHB 4DJZB 4YQFA 1E3MA 2XB2A 3ZVFA 3QXXA 5G40A 2FS9A 3UQOA 1R0ZA 4URYR 4TLCA 2NQ2C 2G83A 2Q3HA 4PPGA 3QXCA 4JMPA 5TVKA 5JI2E 5FFMA 3UATA 1A1VA 2FDAA 3FHOA 2CV3A 3AKYA 1KTVA 2QXJA 2BVRH 3ZYDA 1Q1BA 4YLQH 1IQHA 4AX9H 1GRQA 2BDAA 5F03A 4Q00A 1OKKA 3LV8A 4JLKA 4OHYA 3PO1C 1WBBA 3UK6A 3VAAA 2FOFA 3FHCB 4WXIA 1N0WA 2W5EA 2XCFA 1W13U 2FJUA 1FTSA 3BEFB 5L3VA 2O8DA 1A5TA 4AGJA 1FY1A 4U00A 1DE7H 1E35B 1DAKA 2GXAA 1V3XA 4JSTA 5FTLA 4BZXA 4R0IA 5CLLA 1HJ9A 3VB7A 1DAFA 1KXFA 3Q3JB 2GZ9A 3TVTA 3TH3H 1PPZA 1ZTKA 1XEXB 1TNGA 4Z8XA 4BFTA 3RMOH 5P21A 3W9YA 3QK1A 1XJQA 3SGAE 5JDUB 1GHVH 5J47A 1LQEA 2V7QD 4PQFA 3F1SB 2F1IA 1O3PB 1DANH 2FPKA 1IN6A 2GKSA 2R6GA 5HE9A 3SJBA 4Q1CA 2BJWA 1NRNH 4UXIA 2MSEB 2VWLA 3TH2H 2WYJA 3OEHA 2FV8A 1AKSA 4OHWA 1GDQA 1ONBA 4CBNA 4D26A 2FN4A 5CK5A 4E5UA 4RZXA 1NRPH 4GMXA 2AHOA 5EP3A 1U9IA 3ZVDA 1C5ZB 3UR6A 4Z1MA 1NFWA 4DIEA 2DE9A 1TPAE 3FMFA 1QJ1B 1ESAA 2F43B 1IN7A 1II0A 1PPFE 2GTBA 1T8UA 1GHXH 1KKMA 1MABB 4XH9B 1K28D 1G19A 3RC3A 1SXJE 2ZE8A 4JKIA 1W12U 2XW9A 4HZHA 1P8VC 4A8JC 3A6PC 2WPDD 4AFQA 1MBMA 2ZGXH 5ESBA 1N5LA 4LJ6A 3SBKA 1NM6A 4TYQA 1ELVA 4WXRA 3KQLA 4PROA 1IM2A 3DKPA 1DEKA 1S8FA 2VB0A 1TX4B 2CJIA 3BG4C 2J0UB 3ASYA 4X2VA 2PMDA 3I61A 3ZYEA 2VF7A 1EOJA 3PJRA 1S6FA 1YR6A 5CLQA 4GCHG 1AGRA 3RXUA 1OSSA 4DLXA 3NC1C 2BD4A 1XEXA 1XXHA 5GJ4B 1UKZA 2OM2A 3RNLA 4R71A 2F83A 1V2ST 1U98A 2J7PA 4B3DA 1WCZA 2WWFA 2CLDX 1ZIOA 2GCTB 4A9AA 2OFWA 1KI1A 2IYTA 2AIPA 1KLIH 5FPKA 1L2EA 1JXPA 4ZXYH 3RDZA 3K0FB 4V0ME 2J95A 2OBQA 1JECA 4ZDWA 5LD2C 2QEQA 3RRYA 1Q0UA 3UQVA 4YMUA 4M2LA 1TADA 3AVZA 4F92B 4Y0AA 3BEUA 3FDIA 2FDCA 1AN1E 2RGXA 3VU9B 5BWMA 1M7BA 4K5ZA 1K8RA 3FWYA 4YLGA 4GSOA 4B44A 2Q3MA 1O3BA 4MNXA 5KTYA 2ZU1A 3IHLA 2A2ZA 3BV9B 1GITA 1YM0A 1HAVA 2G1JA 4HLUC 3W94A 4LJ5A 1Q1ZA 3KUDA 4TY7A 1HNEE 3WXMA 3Q7QA 1DOJA 4EUNA 3QGNB 3MRSA 4A6XA 1OPXA 2J41A 3SNDA 4Q9LA 1AWHB 2VNTA 4FXPA 5CM9C 4DLVA 3CPEA 1IQMA 1SGEE 2VBCA 1SQAA 3A1VA 5C4MA 5PTPA 4LJ8A 1KZ7B 3LC5A 2LKDA 1ZUNB 3NH6A 2JJ1D 1R7RA 2IWHA 3BB1A 3KQDA 4PC6A 5J4HA 6CHAB 5K7RA 1LHDH 1SGFA 1H8EA 1E32A 2OCBA 1BHXB 3DFLA 4ISLA 4Q7JB 3D7MA 3UIRA 1UJ1A 4Q1DA 1GBIA 5DIFA 5CIWA 2PGQB 3P8NA 6GCHF 2IYWA 4MPXA 3EA9A 4DDWA 4RVCA 4UNSA 2HLDD 1T32A 1P2UA 2R2MB 2HJVA 3LLUA 1O3CA 2AYWA 2BQ6B 3A4MA 4LK4A 4FVBA 4NL4H 2BLWA 1GBAA 1G20E 3M6AA 4Q02A 1IQEA 3E91A 3P95A 3M35A 5FBQB 4JKYA 4S35A 3HU3A 4ITRC 1C5TA 2ZDNA 1IQLA 4JBXA 4C0SA 2NOAA 4DT1B 1PFXC 1FY3A 1AS2A 3BSQA 3K9LA 4XWOA 1SGWA 4B76A 2J2UA 1GCTB 3SDZA 1NN3A 1KI9A 1HQYE 1XX9A 3B60A 1H1BA 1G1MA 2IF0A 3KKQA 3GDSA 3EXAA 4L15A 4DCVA 2AKYA 1KO8A 1GBEA 2BZ6H 3SU2A 3ZYCA 2GJAA 2WSMA 4OK5A 1OWIA 3CF6R 1Z8IB 1KI8A 1DUAA 1GG2A 3RLWH 4R8TB 1FPHH 4Y76A 1EFHA 4DDTA 1F48A 3S1AB 4AKGA 1GI8B 1F0RA 3V4FA 4EPVA 3RXEA 2F55A 7LPRA 3ZQ6A 1P2JA 2V3OH 1O2IA 3T34A 1Y3AA 2RGBA 3ATMA 4LJ9A 1P5ZB 5AFZH 1E9DA 5CITA 5K8IA 2WSSD 2QNRA 2VL7A 1RJ9A 2A7CA 2OD3B 1E2GA 3HYRA 1NRSH 3K65B 1DT2A 5A0CA 4BQSA 2IX3A 1JAIA 2V3CC 1SLWB 4LOAA 3A7YA 5FOVA 1TB6H 3ZIAA 1Z8RA 2QG6A 2XBXA 1O37A 1MCTA 2ZU4A 3KQKA 4KGAA 1O5EH 5FBIA 1V2LT 4WH8A 2R6AA 1EX3A 1OYWA 1PLKA 4HSEA 3A8TA 2ZCKP 1N6YA 2OFXA 3SNBA 1E38B 1BYUA 2GVDC 3UANA 2WPMS 3GJXC 1XKAC 2Z3CA 3T1TA 2C99A 4G5SA 3CKLA 1BBRE 5DNYB 2HYIC 1AU8A 1NN5A 3CUEF 3NTUA 4AC9A 3MO9A 3M5MA 1M6NA 1A7SA 1A2KC 1GJ6A 1F5NA 1KYIA 3A7ZA 1KK1A 1QZXA 5EGMA 5H1YA 3OHMA 1FTNA 4D4KA 2D3WA 4E22A 1S0UA 1E0JA 1YZNA 5L3SB 2A2XH 3NWJA 3TLXA 2B8TA 3N2IA 5BW8A 3K09C 3BFVA 1MBQA 1LO6A 3C4JA 3KQHA 1CSOE 2HPQH 2GV7A 5H8WA 1G2LA 3HR7A 4BAMB 2WYGA 5HTKA 2ZYWX 1P2VA 1MABA 2WSSA 1SVWA 3R3GB 3EA5A 1RJ9B 3MO3A 2R65A 5JSZA 3B9PA 1GOTA 3EQ0H 2YWHA 1CT4E 1DSUA 2IJOB 2JGNA 2ODQA 2A31A 4II7A 1GVZA 4EFNA 3SU6A 3MUFA 1FW6A 1DLKB 2G81E 3FP6E 1CHOF 5JJLA 3TH5A 2RA3A 2BDIA 3JZ1B 1G64A 2XGJA 2WOJA 1EFRD 1DELA 2QE7A 1THPB 2QY0B 1E69A 2R3UA 4QBHA 1G8FA 5KSZA 2LKCA 2KI5A 3FMPB 5B30A 2AD1A 1UEIA 1P9RA 1NS3A 3GLGE 1E9SA 1MO3A 1QHYA 1LVYA 1NFYA 1GBJA 3THXA 4ARZA 1Y3YA 2FGJA 4Y71A 4MUBA 3PMAB 2V35A 3RXIA 2JIZA 1KO1A 4NDZA 5EOKA 2CGAA 1AZSC 3LNCA 1G291 5JCPA 4EIWA 2ZJ5A 4QGFA 4O3TA 2GEDA 2W2XA 3WBJA 3ZDQA 821PA 3BBPA 1FV9A 3TUJC 3ECCA 5HR5A 1KI6B 4JT2A 5JYIA 1U6QA 2KB0A 1ZMLA 4FMCF 3RXBA 5SZJA 3QKTA 3MLEA 4RZ2A 3E16B 4Q7MB 1ZD9A 3AF0A 2C98A 2ZI2H 3RAPR 1C1SA 1TPPA 3GOVB 4AYXA 1ELAA 4DIIH 1MD7A 2O8CA 2FX3A 5IK2D 3CRMA 1N6IA 3KZ1E 2VGCC 3QXJA 5FX6A 4LV6A 1O3LA 1HAHH 2ZJZA 4TYDA 4R2IA 2KJQA 2FOAA 3AF3A 2WJVA 3THYB 1O87A 2VIDA 4MH0R 4TMWA 3QZRA 4LRWA 3CZQA 5EW1H 2F43A 2ZI4A 2HLDA 4PQYA 4KFTA 3K9HA 5KDDA 1CTQA 5DO9A 4F7WA 4PPNA 3T1VA 1NLYA 1GJCB 1JEEA 4Q7YA 1DBSA 1FLEE 521PA 1TRNA 1GBLA 1VMAA 4AG6A 2WM9B 3SYNA 1KK2A 3PUWA 4DWJA 1ANBA 3TNTA 2O9QA 3ZZ4A 5FCRA 3WYFA 3REGA 1OXUA 4BZQA 2WWGA 4ASUD 1AFEH 1BS1A 3AP2A 2ORIA 4Q4JA 5CE1A 2OSBA 3JZMA 3G0HA 5EODA 1AUJA 4Q66C 3BJIC 4PPQA 2WJHA 4Q9JA 4KYUA 1ZINA 1NVVR 3QKRA 3A36A 1E94E 3SU8A 4EQ6A 1EZUC 3C41J 5SZIA 1YZUA 3RS3A 4DCSA 1V2TT 3KX2A 4HI0E 4TT3D 2B92A 3BTHE 2P59A 5AJVB 1SSXA 1DPFA 3CH4B 4X6OA 2EI7A 1ZHMA 4M4SA 1PYTD 5A4JA 1YPKH 1UAAA 4JIMA 4M8NE 4KFSA 3PROA 3AASA 4I81A 2CN0H 1GMCG 2BMGB 4X6NA 1F2UB 1IY2A 3EZFA 3P26A 4RY2A 3TUZC 3VU9A 3V12A 1X8LA 3WYAA 1VPLA 1XCPA 4BTTB 4BFUA 4RJLA 1HGTH 3SU3A 5FOXA 4O9VA 4TMKA 3RXOA 2H7VA 4DLRA 4YC7A 3AUXA 1DO2A 4UD9H 1OFIA 3GCNA 4NYMQ 3LW7A 3EE0B 1H8ED 2GEVA 1E2MA 5AVDA 2OLJA 1P10A 4BFZA 4PFSA 2F9LA 2QQ0A 3CW2A 2HWLB 1ZC3A 2RGNA 5L3RA 1K1NA 1P2QA 3GICB 1QHHA 4GLYA 2Y5FA 1C2KA 1K1LA 1E37B 2BC9A 5LBIA 3F8TA 1TX7A 2Y7ZA 3SI4H 4AYWA 5IYTA 4B3BA 3OFND 4BRUA 4YESB 2FX4A 4AYYB 2KWIA 3OZXA 2ZRLA 5DGJA 5ANRB 4INKA 2AK3A 4ACBA 2V4ZA 2WKPA 4URUR 1QCPA 1VIAA 1QQUA 1XUKA 1C4OA 2GDDA 4QGAA 4TPYA 4V02A 2JH5D 2BQWB 2QE7D 4ZKRU 3NK8A 2ZRAA 5KSPA 1QDEA 1SZPA 2A9KA 4Z6AH 1J70A 3OAAA 1EJNA 2NU0E 1OYTH 1G8GA 1R5BA 1GZSA 4PSKA 4DC9A 1YRBA 1Q1EA 5SGAE 4KU4A 1CJMA 5LPEA 4MGZR 4Q4LA 2HYDA 3S9CA 1JXOA 1S1MA 1J8MF 1JXMA 2UUFB 2JLUA 1RIFA 4YT6H 5KUTA 1KAGA 2J7PD 1QNJA 3AP1A 2RGEA 2FSFA 5JRZA 1TNLA 1AA9A 3TGJE 2GXQA 2UUKB 2QN5T 3TR0A 2EWVA 4CEJB 2ORWA 3MG9A 5JB9S 4KFUA 2QBYB 1W0KD 2C95A 3H5CB 1ORFA 4JYBA 1P4SA 1LKBA 1VCQA 3LDXH 4Q18A 2GBLA 1OV4A 4A6PA 4TN1A 4C0AC 4GP6A 1ZC4A 1ELOA 1SVLA 4F49A 2WWIA 4QHYA 1WTHD 1N6OA 3P4XA 4BLSA 1GHAF 1Q20A 2IYUA 3ETLA 4ABBA 3EZ2A 4QFMA 2PSXA 4DLUA 3BS4A 1SVMA 3NXSA 4HLQB 1KTTB 5CK4A 2X77A 1SHZA 1DX5M 2FF7A 2RGAA 3IO3A 4YMSA 4JLVA 3EASA 2ZXUA 3A1SA 3SNEA 1ODFA 4MDEA 3ZD7A 2YOLA 2ZPSA 2AD5A 5HMAA 4ESTE 3SE0A 2O8DB 4LXBH 1HAOH 3W34A 2NG1A 5F8TA 2NO0A 4TMZA 4OGXA 5EW2H 2VPPA 2G55A 1G3UA 4DURA 4DZZA 4WVFA 5EUQB 2IK8A 4LY6A 5G4BA 3WY8A 5FR2A 1O38A 2ZHEH 1ZU5A 1C2MA 3SV7A 1S81A 1Q21A 3A8CA 1KK3A 3NHBA 2Z3EA 1D6WA 1HQCA 4CEJA 3GJ5A 5TY0A 1WQVH 4EPYA 1U94A 1XWIA 1W5TA 1NVWQ 1C2GA 1NG9A 5E95A 2PUQH 1MCVA 3QKSA 2ZQ5A 2SNVA 4TL9A 3PMHB 3HR8A 1E2EA 1T4VH 4FMCB 3SBDA 1CE5A 221PA 5J4YA 2GXSA 1WDTA 5TMPA 1GGDC 4Y0YE 4D6PA 3EC2A 2WIBA 3ZZBA 1Q57A 1S4QA 2WVJA 1AY6H 1GWAA 3G5UA 4B33A 3L0SA 4FXGH 3WRXC 3M5OA 1M7GA 4Q80A 3N2EA 4ISIH 2GF0A 3EA0A 4XWAA 1AGPA 2G5VA 4FD2A 2P8OB 3HKIB 4L9SA 2BHGA 4AYVB 2R9PA 4H4FA 4AZ2B 1G37A 4ZH8A 2EFCB 4WWYA 4PHGA 4LYJA 2XB4A 1ZUHA 4YMWA 3VR2A 4RKFA 1G3EA 4HZUB 1INCA 1NRRH 1P60A 3QGJA 2CBZA 1UBEA 4JL5A 1NP6A 1FP7A 1KSGA 2IOTA 5J4SA 3UTUH 3CONA 1GVLA 1DY8A 3BN9A 1KJZA 3PMBB 2W6ID 3KNXA 2AFHE 1BIOA 5A0BA 5A8ZA 2HV8A 1BJVA 3BORA 2G5NA 1A0JA 1MO4A 1A3BH 4KSCA 5GPIB 3CPHA 2XZPA 2Q6TA 5KNCA 1G21E 4DVGA 2JAQA 2W58A 3QQ5A 3THXB 4JYTA 4HAXA 1GI3A 2C8ZB 1O3OA 2EWWA 3TK1A 4X1RU 4JZDH 1GM5A 4TSFA 5F8XA 1KNQA 1QL9A 3NG1A 4US0R 3KGPA 3KQUA 1EZXC 2A78A 2GT8A 3U3KA 2MSCB 4M7GA 4F91B 4B71A 3UNRA 1QL7A 4LZ4B 2RMKA 2ZE6A 4N0DA 1DM4B 4FUEA 3TW4A 2F9MA 1LVOA 1JMOH 2Q9AA 1RW4A 1OXVA 2GTPA 3VFDA 4R7ZA 3CWZA 1KMHA 1PPBH 1S6HA 4KJZA 1C4Y2 1A82A 1VCWA 4XBDA 1ZSLA 1TQ2A 2ZSBA 4NCYA 2F3CE 3DFJA 2XC4A 1YPJH 1YPLH 3RP2A 3FZZA 4U5XA 2V9PA 1J7KA 5FR1A 1A3EH 2FOGA 2BM1A 2F7SA 1GJBB 1NLZA 2PBRA 2W6IA 3EX7C 1Z6TA 4KTUA 1AZ8A 1GJ4H 2BOHB 1P11E 4MGIR 2XTTB 2CHVA 2GK6A 1G3QA 4FCVA 1BH2A 1KO5A 2VIWA 1TFXA 2FA9A 2BKUA 3NBXX 3P8GA 5DPAA 1Q3HA 2BMFA 3NZIA 1P06A 3QUMP 2TGTA 1LPKB 2PZEA 2EFEB 3M36A 5LGOA 3KIDU 2R6FA 3HJNA 1XPUA 2H2ZA 3E1SA 1GI2A 4LHVA 4Q5IA 5GCHF 3PUVA 1DAIA 1CHGA 5FUXA 2ALPA 4H1VA 3H2YA 4LJ4A 3BH6A 1L8QA 2QV1A 1JIMA 1GVNB 4XJXA 4YZUA 2OC1A 4ABYA 1Z5ZA 4D25A 3GLFE 5EP4A 5FPSA 2STAE 2CLCX 4PSAA 4G5QA 1OWEA 2A30A 3C7KA 4GOKA 1P3CA 1OXGA 1XCGB 5J40A 3MFYA 2Q21A 1XXHE 1S85A 2PLRA 3ICEA 2RDLA 2A45B 2ZRPA 1HE8B 4JZIA 1V2NT 5C1YA 2B7DH 3W3ZB 3F3YA 4AB9A 3U60B 3SNAA 4X1QU 3U61B 4O3UA 3K53A 2J1LA 3NBZC 5KNDA 3B1XA 1T8MA 2CHGA 4I8HA 4E7RG 4ZCMA 3MOCA 1AB9B 3FAOA 3K9GA 3AGPA 4FI3C 1MV5A 4Z1MD 3OTJE 2QTVB 2SGEE 4NA9H 2QSYA 1GCTC 1T6NA 1GMCF 2VWOA 1R5NA 3NCLA 3GQBA 1P3JA 4OI1A 5L8VA 1GBMA 2BVXH 2LNCA 5ABWA 4MKIA 3CX8A 3VKHA 1DXPA 3BIUH 2FPMA 1ABIH 1OOKB 721PA 1CLUA 4M9QA 4RKEA 3AW1A 4C0HA 2SGQE 3S69A 1UVSH 3RXHA 4F93B 3IBYA 3AAUA 2UKDA 1EPTA 4IC5A 3C16C 1N3BA 4QNMA 2Y6TA 2FEMA 1XP8A 1D2EA 3OIVA 1GAJA 4NHOA 1I2MA 1VITF 4GOXA 2ZR7A 1IOEA 4JLNA 4KVGA 4UNRA 1T9HA 2XITA 1SKQA 2QA9E 1N6LA 1GI4A 2B0FA 1W7AA 1Z22A 3GCGA 2ZKSA 3GJ3A 3IIJA 1KAOA 2QY9A 4IDPA 4QHSA 2WJGA 3HPTB 2VA8A 2Z9IA 2IF2A 2VHQA 1QBOA 1JJVA 5A8XA 3FB4A 4EPTA 1QBKC 3LY5A 4LZ1H 4E7NA 4QL3A 4MYHA 1M74A 1ZP6A 1BTZA 3AQ4A 2P95A 4B6FA 1GNPA 2Z0MA 4I8GA 2IJD1 3K8YA 5E7IA 2XXAB 4B73A 4EJSC 4C2TA 1O5FH 1KDRA 4WJG2 3RXSA 2RHDA 1UCYH 1HIAA 5D3MB 1QJ7B 3TJVA 3RXRA 1T5IA 3PXGA 5F9FA 1Z6YA 2ESTE 3W5JA 1FJSA 3T12A 6Q21A 2EU8A 2VHCA 5B58C 2OE2A 2ZFRH 2GCPA 2CDNA 4LJAA 1XMNB 3TU7H 2W00A 1E0KA 1LS6A 2QI9C 1YQTA 3B1YA 1SGFG 1LTOA 1TA6A 2VP0A 3DPUA 1CR0A 3QTOH 2BLQA 1P2OA 3AVXA 3LGTA 4ZUHA 1S5SA 1W14U 4UNPA 1W0JD 1S0QA 3UNQA 4ZAEA 3TGKE 4BRWA 5E7JA 1WF3A 3S9BA 4TWWA 3X2SA 4YMTA 1PPGE 1ZM7A 1A5IA 2OQUA 3EPHA 4AK9A 5F98A 4FUGA 3U69H 2ZFQH 1NMYA 1D4PB 1K5DA 4DXAA 5AFYH 3AV0B 2AERH 1S3GA 2PTCE 4I7YH 3DL0A 2R62A 4XBCA 1QVAA 1ZR0A 5CIQA 2QMUA 2VP4A 2THFB 3EIHA 4JL6A 3GDVA 1XF9A 3TE6A 4Q1AA 4KBFA 1OIXA 1OE0A 1Y3WA 5EQRA 2ZUBA 2O8FB 4TL6A 3U3RA 2OZEA 1AD8H 4GHTA 1XUIA 1GPZA 2DWOA 2QGZA 4PAMA 4NIXA 1XD2A 3SV2H 4ZCLA 3K0EA 3LA6A 3ZZ8A 4OHZA 3T62A 3CF2A 4BOHA 4XBBA 4A15A 4B2AA 3ZZCA 5C4GB 4JYUH 3DMDA 3LX5A 5A0FA 1G3MA 1MQ6A 4IS5A 2PUXB 3ZIAD 5FBWB 2BDGA 5LB4A 1ID5H 3KJEA 3CENA 1G17A 1FUKA 4PC3A 3ZVMA 2G88A 3DM5A 2O0HA 4PXAA 1KDTA 1KLJH 2CK3A 2QAGA 2AGEX 4MUAA 2ULLA 3UMSA 1UVTH 1U0LA 1V2MT 4JLPA 1GWNA 3BGWA 1OH7A 1TALA 1FZQA 2OUAA 4IGDA 4MGKR 2AXPA 2DPXA 2I6QA 5K8UA 1IAQA 1F7ZA 2WJYA 1B0EA 2A7HA 5DI3A 1D8TA 2IXEA 2O5VA 1CBWC 2GJ9A 4JLAA 3SYLA 1W11U 3UWJH 4X0WU 4TLAA 1RTKA 1GL7A 4TYWA 5FPYA 1TBQH 3RXVA 1OWKA 5TV2A 1JJ7A 5HM9A 1FDPA 5DG6A 1P12E 4G01B 4BFSA 2H5CA 2PJRA 1UM8A 1G9XA 1A46H 1QHSA 3MH6A 4G0NA 2V7QA 4I1VA 4FMDB 1Z6AA 3E2IA 4NKRA 2JLXA 5B57C 2IXFA 1ZD8A 2NPIA 3SQWA 3IDQA 3QENA 2ILNA 5C18A 3OTPA 1MO5A 1P9UA 2EEKA 1P9WA 1ZNZA 4GBMA 1OB5A 1VG9B 1XRJA 2NO9A 1RYHA 2DUCA 4O25A 3Q76A 1ZMXA 3H4MA 2O52A 4DUGD 1OB2A 4LGMA 2O8FA 1FUUA 3IITA 2BKEA 3HYTA 4CRGA 3BAFA 1N1LA 3MNSA 4MNVA 2IYSA 4YXWA 4OS1A 1BMNH 1O5GH 5G3ZA 4JCNA 5K8TA 1Z06A 4JZFH 1C5YB 1O5BB 4DCTA 5AHGH 4GCHF 2OQ5A 1PJRA 4Y79A 1FIWA 1DE0A 1R2QA 4BE7B 3MNBA 2D06A 4GSYA 1C9KA 2Y5GA 2GDJA 4Q1FA 2Z94A 2Q9CA 5DHAA 1SG8B 4ABFA 3SUDA 4HAUA 3U2QA 5T6DA 1RKBA 3SR0A 3G01A 4B1TA 1P0SH 2PW8H 1XJCA 2EFDB 4Y6DA 5KU1A 3U5ZB 1NLFA 3MMGA 5BQ5A 4L5BA 1EQ9A 5FTKA 2OO7A 1GILA 1IJEA 1VCOA 5CB6A 4K69A 2PH1A 1G36A 4I8LA 4KLNA 1TRYA 1MKYA 1XCMA 4CYMA 4ZKOU 2FFQA 1GHAG 1X3SA 3TK9A 4RZUA 1T4UH 2WPHS 2P65A 3SZNA 2DWQA 2XXLA 1SGPE 1OP2A 1CEEA 3TIFA 1WTGH 4Z51A 1EFRA 3L2OB 3LIWA 1GL1A 1NTPA 4DDUA 3NPSA 1E2HA 2Q1JA 2JJ8A 3K0SA 3IHWA 1EX7A 4ABHA 1FOEB 2H9TH 2Q6FA 2CJWB 4IW3B 3LONA 2I1VB 4NCIA 2ZI6A 3L6PA 2NWNA 1GNRA 4OL0A 5FXLA 1G16A 4MGYR 1ELCA 4DDVA 5FUWA 4TQUS 4TY6A 3SS8A 1WV7H 2VH0A 3BG8A 2P6UA 4UNNA 3C1KA 3NEYA 2ANKH 2ZGJA 4CF7A 1D9IA 2Y80A 4HB2A 3RC5A 3K0CC 4H1UA 2IWRA 1TGBA 1GI0A 2A5DA 3SYJA 3SI7A 2ZSEA 2ZJ8A 3SZEA 2IYLD 1I4LD 5TXGA 1LNZA 4SGAE 4GAWA 1IXSB 1CRPA 4NGAH 4ZDIA 1AIXH 2NU1E 3T61A 2ZVQX 1BMFD 4IMQA 3R8CA 4MNWA 4CRCA 4ZMAH 5FOSA 2Z83A 1P09A 4DLTA 1E2DA 4AG1A 3P20A 3ATLA 2ZJAA 2VIPA 2BDBA 1XUFA 5FPHA 4NG9H 2G51A 3EYDA 2BMJA 1OPHB 2SGFE 4A2PA 4GVUA 3EZ9A 1QHIA 3ZJYA 1AVXA 1IQJA 4YDSA 2FNAA 3A1UA 1PQ8A 2RA0A 3D65E 4TTPA 4BZPA 2ZCLP 2XAUA 2JH0D 1OHHD 1W49A 4EJSA 3D3QA 4I4LA 4HFPB 2WINI 1C4U2 2C9CA 1GMDF 3QF7A 3OU0A 1Z6EA 5EPNA 2ZJBA 1T31A 4MYTA 4HUQB 3TQCA 1NVVQ 1TONA 3JVUA 3K70B 3RRZA 5GJBA 2AR7A 1BCUH 4MTBA 1LVMA 1LTQA 1II9A 4X6PA 1KY9A 2Z3DA 1E9CA 2Y5HA 2FZLA 5AJXA 4PZYA 1GL0E 1F2TB 3V00A 2AGGX 4WW0A 5AJZA 3I77A 5JB8S 1CJVC 1V2WT 1C4V2 1O2UA 1UFQA 2BD8A 3KQBA 1NKTA 1V6DA 4ASHA 3MWKA 2QF3A 2J46A 2ORVA 4HB3A 1ETUA 8LPRA 2HF8A 2C04A 2P3UB 4D8NA 1C2HA 3IPYA 2XTZA 1SGIB 3TSWA 4TYNA 5EE5B 1W36C 1US8B 1LPZB 3B1VA 3M37A 1NG1A 5B64A 4N3NA 2GP9B 1C2LA 2CMYA 4KTSA 4C4PA 1KXCA 1OP0A 4KITB 3T29A 3OE7A 1HB0B 2ZM5A 4FCWA 2V1XA 2ANWA 3FKQA 5GDSH 1UTJA 4IJMA 1E6CA 2ONKA 5JZVA 1O3YA 3UPEA 1P73A 1L0ZA 3VHXA 1C2JA 5GWZA 2VEDA 1JR3D 2F1RA 1LF0A 2YV5A 5BXQC 1SVOA 2OBNA 3THOA 1NL3A 2W0SA 3LGYA 1P2MA 2O8EB 4JLJA 2WZQA 2JATA 1HAIH 3BXZA 1S1CA 2ZUDA 1TNDA 1W48A 1O36A 4IXNA 2OESA 3WRYC 2XC0A 3KL6A 4FUCA 4MLFB 4M53A 1GGDB 5FOWA 4NIWA 1H9LB 1ZPCA 3GY4A 2RCEA 2J87A 1ESMA 1KSJA 1NN6A 2AIQA 2GZ7A 1Y5AT 1F60A 1GI1A 2ZANA 3F9FA 3W6NA 4EFLA 2XX3A 4MYCA 1TNHA 1S9DA 2QN6A 3KKMA 2QU8A 2C90B 1GJ9B 1WQ1R 3L43A 1Q1QA 1VHLA 2X8AA 1H9IE 2DCUA 1ELFA 1R10A 3URCA 1KZGB 1L1GA 3U7GA 5G41A 3UOPA 2GV6A 1E1RD 1US8A 1G5RA 4ISHH 4Y7BA 1XJ0A 3BG4B 1RTLA 2C3SA 1LMWB 4YMVA 1OJLA 1F3OA 1NZQH 4AB8A 1MTSA 3MWLA 3RXFA 4HDCA 3EA7A 3AVQA 1TEXA 1MRSA 2G00A 2OILA 4IRUB 4IVRA 4V0NA 2WOOA 1BRCE 2ZRIA 1PLJA 2AN9A 2YNAA 4X8TH 3LGIA 4IOLA 1G7TA 2OLGA 4YONB 5DGXA 2GZDA 1C5NH 1WA5A 1V5WA 5DYGA 4NFEA 1O3MA 5CM8B 1R0XA 3LO5A 2XRCA 4ZDKA 1YYY1 2FI4E 4M1TA 4YOJA 5DH9A 3GLGB 1ZJDA 2WJIA 3AKDA 2VRWA 3A83A 3C8UA 3VKWA 3BTQE 5GADl 3ZGXA 3LDAA 1RD3B 6GCHG 3KKPA 1AB9C 2FH5B 4TT3A 2J59A 3BE4A 3KCGH 3RS5A 1FN8A 1G6OA 1E2PA 1XUGA 3GCOA 4E05H 2BWJA 4ABGA 2WWXA 2ZU2A 4LV5B 3SU0A 5C5NA 1BTYA 1RYFA 3X1DA 4RFSA 5EXPA 2ALVA 3HU1A 2J0UA 3I8XA 2P3TB 1UVPA 3K0AB 4O97A 3CX6A 2CJWA 3QF4A 3L33A 3EAJA 1J8AA 3NBFA 5CMXH 1YPHC 1ZIPA 2ZGBH 5HZKA 1C2FA 1ELTA 1C1TA 1ZHPA 4DY7B 2ZS8A 3DHWC 1NRQH 1W3CA 2J0QA 4A8JB 4IXMA 4KAXA 2VP6A 4HUTA 1SVKA 5GJWC 1P04A 3EDXB 4KYIB 3K0FA 1Z6XA 1GCDA 3EPLA 3VQTA 1PQAA 3LX8A 2WV5A 4C0LA 4HB0A 3SUEA 3MMPA 2OHFA 5H4IB 2L0XA 4DRZA 3PIRA 2FOCA 4B3GA 2WWWA 1QB9A 2OLKA 1MKWK 1C5RA 1P02A 2GZAA 3RXPA 3RS4A 2FG5A 2QRNA 4ABEA 3PUYA 2W2TA 3B2EA 4LDJA 1RC8A 1D3DB 1TF7A 3PUXA 3TK5A 1SKYE 1XUHA 5CJPA 1N6PA 1D9ZA 2XOKA 4HAVA 5IHPA 1T3SA 1C5PA 3AVOA 5C1UA 2K5UA 1NF3A 3L0OA 3MI4A 2YNBA 3EAQA 3RM0H 4BAHB 2BHRA 1O2JA 1ZCAA 3SO3A 1Y3UA 4K8BA 3L0IB 1KK0A 1SXJB 2NU4E 2IBMA 5DE3A 4X8VH 1CGHA 1FMLA 8OHMA 2IUSA 1FP6A 2CL6X 4I1UA 2IYYA 2FLRH 3SUGA 3W90A 8ESTE 2ZC9H 1YBWA 4B3FX 4CREA 3QEOA 2NZJA 1EAWA 5HM2A 2ZG0H 3QLPH 2HRVA 1QY6A 4PO8A 4X8LA 1TU3A 2P67A 2BLOA 3GEIA 2BVNA 1B0FA 4BLTA 3N7OA 1T3LA 3K9XB 4KFRA 1RVDA 5AF9H 4HZIA 4FUJA 5EXSA 2NIPA 1WBDA 3FE2A 4NCJA 1XMIA 2O8BB 2XYAA 3ZV9A 3U1JB 4EDHA 4U7DA 1QR3E 2P3SA 2ZJ2A 3PO1B 3ZVAA 1J90A 5EG4A 4LWZA 1XEWY 1TUEA 1TOCB 1UTLM 2VHTA 4F4CA 4BLRA 1FX0A 1EJAA 2KAIB 1WE2A 3E0PB 4BFXA 4FUIA 4LSGA 4Q2KA 3BH7A 4PC7A 2H5DA 4NWLA 3QXSA 1IQPA 4OS6A 2ZSFA 1R0WA 4U2WA 3EA8A 3PQCA 5IRCD 2JLZA 1KSFX 1MZDA 3L3TA 1TGCA 2GJKA 3QZQA 1G3IA 4QGGA 5JFGA 1HXFH 1O2LA 4FU7A 3I5XA 1P2SA 2TGAA 3GFTA 1SMFE 4BANB 4O0MA 1Z0IA 5C3NA 1CU1A 5JPMH 2XJ4A 1DAEA 2BLVA 1S83A 5BRRE 1P3EA 2JLWA 1C5XB 5B2ZA 2QMHA 5C46F 5FAHA 3LGWA 1CVWH 5H68A 5LPFA 4PAOA 1RTFB 5UKDA 5CHAC 5DJ7A 4RD3A 3SW2B 1Z7KA 2EYUA 3AUYA 2Z6BD 2OFOA 3H7TA 4Y10E 4FCTA 1EGAA 5C67A 1OW3B 3SN8A 3EPJA 5L30H 1W2GA 1YZQA 3X1WA 3RWMB 4WA7A 3DT0H 1HY3A 3LXXA 3Q77A 2PWXA 1YPHE 5ETXA 4WMDA 2H9HA 2CVHA 3GYLB 4NYJR 2OV2A 1KNXA 1Y3VA 4FWIB 1DWEH 1WBGB 3P70B 1U8YA 5DISB 1NY6A 3CRQA 3QKRB 2Y8EA 1YZGA 1ZSKA 1P57B 1CBWB 3I3SR 1QRZA 1Y3XA 2YC4C 1NI3A 4G1UC 1G3BA 2HLCA 3AKCA 1C9TA 2H8KA 1XMVA 4NCNA 4CRBA 2ZP0H 3K6ZA 1C5SA 4ZKSU 4K2YA 4XE4A 4P32A 1NBME 3GLHB 1LS1A 3DEFA 2PHBA 4L4UA 2PTNA 1NU9A 1TBZH 3GJ4A 2V6NA 2G0TA 4IVQA 4P4SA 4ZKEA 1XX6A 2VSOA 2XOKD 2R2WU 1ELEE 4A0GA 2FMJA 3EIQA 1RFLA 2ZJOA 1OP8A 1E36B 5GIBA 2RGDA 1ELGA 1DFPA 3RLYH 1FNNA 3RXTA 3F5FA 2DWPA 3KL4A 3JZAA 1G7CA 1VJAU 2QRZA 2CCGA 2CHAC 5C1BA 4FUDA 2V3HH 1NPMA 2JKHA 2HT1A 1P01A 2ZVPX 4HAWA 5FUYA 1TMUH 1OKKD 2HCJB 1NFXA 1YLCA 4GI7A 3ODDA 4AURA 1HXEH 1W7XH 3KB1A 3KEEA 1HAXB 1OS8A 2FLBH 2J9RA 3NVAA 4ZI2A 1NN0A 2FOLA 4JYVH 2LWIA 3IEUA 1BYIA 2R0LA 3JZ2B 5DP7A 3GEHA 2DFKB 1R6BX 4B2BA 1GBKA 2J92A 2ZE5A 1XMJA 5A8YA 4NU0A 1SB1H 1HBTH 2GESA 2PLFA 3OAAD 1AWFH 3VX3A 3H1TA 3OIWA 1AS3A 1ZNXA 2G4UA 3QNUA 4YLUA 1E79A 2ZDLA 2A32A 1OXSC 3I62A 3PEWA 1GI5A 4LYFA 1N8OC 2CK3D 2AS9A 1T8NA 2ZPTX 4QM7A 3P92A 3MCAA 3OEEA 1DWBH 1D5CA 2FFAA 2JCSA 1GJ5H 2C8YB 4PR0A 1ZD1A 3I72A 4K8OA 3SQXA 4KI0A 1OYQA 4UDWH 1FY5A 1O2SA 5TCAA 2VWNA 4J1YA 1KGDA 3CPJB 2BIFA 3BTWE 3B23B 2XEXA 1CQQA 4GL2A 4XTCS 1UKVY 4NFFA 1YC0A 3RHFA 3KKNA 3WP0A 1JBKA 1P2IA 3RRNA 2QA5A 2N46A 4QNRA 3AVWA 5EZ5A 2BY7X 3QO6A 4CR5A 2C2HA 4Q48A 1OXXK 1YE8A 1O3KA 3H09A 1ZGIA 4PX9A 3Q5EA 2CXXA 4TQ9A 4OQNA 1VYUA 1QF9A 1ESTA 4QBFA 1QBVH 4Q7ZA 1G8PA 2WV9A 4ZDJA 3K09A 4FMDF 2VTKA 3UUZA 1N6NA 2ZFFH 3LBHA 3CNLA 4XFQA 2RCNA 2A1DB 1NVUQ 4RCYA 3F9GA 2ZO3H 2FOHA 4U01A 2JJ2A 1K9OE 1GDDA 1BMAA 3I8SA 1E2LA 4UFGH 2D2FA 1KI2A 1ZW6A 2MSDB 1SVPA 3GFPA 2G1KA 1KO4A 2ZECA 2H16A 2J38A 1K22H 4A1TA 3UWKA 5TDHA 2XBVA 1RE0A 1KTSB 4PC1A 1SC8U 4J2YB 3BTFE 3B9FH 2OC8A 1QURH 3LFUA 5FL3A 4QJ4A 1A7JA 2HNTC 1R8SA 2ZTYA 4TTRA 3S7KB 2O8EA 1CJKC 4RD1A 2VJ1A 3R9WA 3GY6A 5FTMA 2LPRA 3BERA 4KLZA 2KE5A 5FL7D 2O8WA 4JS0A 3STJA 1F6BA 3E5HA 1GBTA 1G3DA 4M1KA 4JLBA 3R7WB 3TSOA 4IBLH 3LQRA 2C78A 1Z0AA 1OH6A 1QFKH 4FU8A 2ECKA 4DJTA 4DCDA 2ONJA 4P3YA 3T26A 1SI5H 1VR1H 3EWSA 2IN2A 3IWMA 3RXGA 1D2NA 5JBCS 5AUNB 1DPOA 1E9RA 4UFDH 1JI0A 1KDOA 4ZKNU 1IQIA 5E3HA 5A2MH 3KXKA 1Z63A 4ZO4A 1AGJA 1TQ4A 1A1RA 1V2UT 1F2SE 3T06B 1TNJA 1ZGVA 3KFVA 4JLDA 4U30A 3H7OA 1YPEH 3SHFA 4H6SB 1NMXA 3QEJA 5DI9A 1WB9A 3SJIA 3VR3A 5SZKB 1LHCH 3RLFA 1Y5BT 1JR3A 7KMEH 1HPGA 3ZQJA 4D81A 4B2PA 3U8OH 3ZZDA 3H84A 4DIDA 5CYPA 2TBSA 4KP0A 5JRJA 3LH1A 4JVLA 3DZDA 1O2PA 2J3EA 1ZVQA 4UKDA 2CL0X 1XFAA 4IN1A 1C1NA 2BOVA 3QVUA 1QB1A 1M8PA 1NC6A 5FBEA 2F9PA 3N70A 1XXHB 1SQ5A 4X8OA 4LV8B 3U6BA 2YWFA 1SOZA 1SHHB 2ZHQH 3MU8A 3E8LA 1Q2WA 2QT0A 4OJQA 2R0KA 4CBOA 2OAQ1 2ANYA 1MTNB 2IYXA 2EFHB 3D23A 4A8JA 1N2CE 3I5YA 2VIIA 2XBWA 4O3MA 1FQKA 1Z0KA 4MRVA 3PWBA 2FSIA 1U0HC 4D82A 2YOGA 3DVLA 4TYPA 1TF5A 4A6LA 2RHMA 1G5TA 1AMHA 2ZHWH 1ZJ6A 3DO6A 3TW8B 4XOIA 4P31A 4Q9KA 4Z0KA 1AZZA 3ZZUA 1QRAA 3ZVNA 4WBSA 3A8AA 4MKHA 4JJKA 1S9HA 1E96A 2ZQ2A 4P33A 1TA2A 1WAYB 2YOFA 1XBTA 1ZRBA 5E0JA 1P62B 2M5TA 1W4AA 3M7UA 3CRVA 5JLJA 4XSGA 1HAGE 1D6RA 2XNDA 3OESA 1AK2A 5FL7A 2GCOB 4V0OA 4Y0VA 1AHTH 4QJ5A 2FOMB 2C8WB 3WHKA 2A5AA 3LGUA 4ZIRB 5AUQA 1XVMA 4M1YA 1IBRA 4JZEH 1XTSA 1V2OT 1XTKA 1TMKA 2QORA 1XPRA 4NZQA 2ASUB 4A1FA 3IBGA 4EPXA 1BMMH 1TX8A 2QGNA 1YZLA 1V2PT 3CLVA 3HKJB 1Z08A 2XZOA 1UADA 3KF2A 3HP1A 4HZUA 3BH0A 2ASEA 4Z8YA 1O3DA 3DOEA 1A5GH 4IFBA 4PPFA 2QXGA 1KXBA 1LW7A 2GT7A 4RD2A 1LQDB 2W26A 2D7CA 3A1WA 2V0BA 3X1YA 2VF8A 1W0JA 2IC5A 1C1QA 1KKLA 2OXRA 1DWCH 5CYOA 2ZPRA 3U1IB 3TAUA 3CM0A 4HAYA 2A2QH 1NIPA 1TPZA 4OHVA 5J4VA 2BX3A 4X8UH 4B6EA 2IYVA 3HGPA 1HIAB 5D3MA 1E1RA 4BUJA 2C5LA 1Z1JA 3IO5A 3SV6A 2ZDVH 5HE8A 3I78A 3T5DA 1QJ6B 2V1UA 1O2NA 1EB2A 2CF9H 3KTAB 1AI8H 3GLHA 4PQRA 1O2YA 4UONA 3AEZA 4X1SU 1HJAC 3VXEH 3TJZA 3GJ8A 1J9CH 2UUYA 5C1XA 4KCGA 3P27A 5BN5A 4M1SA 2A3RA 1YR9A 1HYQA 3VNVA 4D0GA 1YKTA 2C93B 1Q3XA 5CDFE 3IIKA 2G77B 1Z8JB 4ISOA 3R20A 2BV3A 4M22A 3Q9LA 1O35A 1UPTA 3BRWD 4CHAC 1EK0A 2BDCA 2YWGA 1ARCA 1NY5A 1THSH 1T8TA 3CF0A 2F4LA 2IUUA 3GCHB 3S1AA 1IONA 1L2TA 2W2VA 4IDHA 1GDNA 1N8OB 5FTJA 2J4IA 4BTUB 4UJ5A 3T5FH 3SV8A 4OQMA 1P2KA 5BPEA 4H6TA 4R9UC 4XVRA 1EZQA 1Z0DA 2QM7A 2BD3A 3A8DA 1ELBA 1IHUA 5LB2A 3ZVCA 2TIOA 3AVVA 1UO6A 4RN6A 1VGCB 3R9XA 3OY5U 4X6MA 4B2LA 2GNOA 4PAQA 3V7TA 4I1SA 3HDTA 1SHYA 2Y81A 2BM2A 3SJZA 1Y5UT 3LLMA 5J4QA 2D4HA 5HPYB 3LJJA 1YJ5A 1O3IA 3OY6U 1KSHA 4D4MA 1OWJA 4QC2A 3ND8A 1ANDA 2TRMA 3I73A 1RIWB 3EIEA 3PM3A 1W4CA 1R5OA 1C1OA 2CCKA 3RU4D 5JBTA 7ESTE 3GPLA 2PT7A 3TJOA 1IHTH 2VSXA 2B21A 4NZYA 2ZR9A 1FI8A 2G52A 3PLPA 2ODBA 1FQ3A 4RSPA 4U02A 1ZPBA 2FIRH 2HNTF 4A0RA 1DARA 3FGNA 4UFFH 1B0UA 1E9FA 4NIVA 4B3CA 2FSHA 1D3PB 5F2EA 5FOTA 2FP7B 1LDTT 3CS0A 2KBEA 2PKAA 2D8WA 3PV0A 1O2MA 3NDPA 4HAZA 1TGSZ 2FX6A 2ZRDA 4LC1A 3A8BA 1EASA 5L3QB 1WMSA 5DP6A 1R8QA 2P2LA 4OS5A 3RXQA 2ANMH 3A84A 1X7AC 4UJ3A 3QVVA 1XTJA 4AGKA 2AX4A 1K1JA 1MMJN 2OBLA 2IW3A 4N0EA 3RRMA 1O3JA 7GCHG 4S2EA 3SUFA 3CWQA 4A7IB 1VIYA 2GA8A 2FU5C 4IOKA 1UJ2A 3TVDA 4Y7AA 1O5DH 2PX0A 2BJVA 3WNBA 2AKAB 5SZHB 4KO8A 3P1JA 5JBBS 3CRRA 4BFWA 2FO9A 3NUMA 3U44B 1CULC 4JVMA 4I1OA 1C1YA 3U6KA 4Q7LA 2BOKA 2NTYC 2PZFA 3QKUA 3STIA 4D80A 1FY4A 4OQFA 4ABDA 4FUHA 1DAMA 3SZRA 3GY5A 1V43A 2BY6X 1GDUA 3SC3A 3TSZA 2ZDMA 2XNDD 2QUZA 2Q6DA 2QZ4A 5KDLA 1A5HA 3U8TH 2IS2A 4IEIA 2RGGA 4ZV4A 1IQGA 3D49H 4DT1A 2O0JA 4HUQA 4U32A 1NJGA 4BFYA 1PUJA 4AG2A 3T28A 3DOFA 5L2YH 1YCPM 1E1QD 5LH8A 2A5FA 2ZRKA 4Q1EA 2JEOA 1MR3F 2OEPA 1F5KU 2BBTA 3A58B 1GBFA 2G3YA 1HV7A 2A4RA 2QP3A 1XD2B 3RXCA 3DA9B 5JJIA 1G3CA 4QT8C 3M4YA 2PSYA 4VGCC 1V2RT 3FYHA 4OBEA 1KI4A 4JL8A 1HAVB 1ZCBA 4LUCA 5H70A 1CT2E 3A1TA 4X2YA 2EYQA 1KOFA 2AMPA 2PL3A 1QRWA 1FAXA 1GUAA 3A4LA 3SJCA 4RSGA 3PVSA 3M5LA 4A5TS 2QP9X 4A82A 3NKKA 1E2FA 5DK1A 1VCNA 4WF8A 1RXPA 3PLKA 4BNRA 1O3GA 3B78A 4NCKA 3SJ8A 4IOMA 2OT3B 2CNWD 4HEJA 1EESA 8KME2 1CGJE 2O8CB 1IAUA 2R44A 2QMEA 4QHTA 4Q4HB 1FUJA 3QN7A 4WY3A 1O2VA 2CNWA 3P32A 1LV7A 3EARA 2VH5R 2XNIA 5F3WB 3ZZ7A 2CEAA 3SN6A 1ZHRA 1O2ZA 1RPZA 1S0RA 3EPKA 1Z6JH 2R6DA 4P4TA 1O2KA 1QB6A 2ZZUH 2YKGA 1NRJB 1U8AA 2GAOA 1SGNE 4A2QA 2GCNA 3IILA 3GLFB 1W44A 4C0JA 3W6PA 2XZLA 5J4KA 4XDEA 2W3KA 1NN1A 4NONA 1GI7B 2CHAB 2PR3A 8GCHF 1JRSA 2ZRJA 5JCZA 1HUQA 5GVSA 2ZTSA 1CT0E 1PQ5A 3BTEE 4NYIR 1FNIA 5GVRA 1AO5A 3PWCA 3AP3A 1U99A 1QRXA 2A7JA 2B9LA 3B1WA 1AVGH 1JEDA 3MU4A 1BRAA 2RG3A 4XSKU 1G5PA 3UWOA 2DBYA 1N5IA 1OHHA 3RM2H 3T5GA 4CR9A 3B85A 5GCHG 4THNH 3GD7A 4EKDA 1YZTA 4OI0A 4K1EA 2ERXA 1K5GA 3DD2H 1T0HB 1WQSA 3KB2A 4Q03A 2FS8A 5J5CA 1GHBF 3A88A 3LH3A 1YCPK 2W7UA 3I92A 2W6JD 4GT1A 3BIVH 3W8NA 1KO7A 2PCLA 1C5MD 1D3QB 4DG4A 1XMSA 4BLQA 3EZ7A 1Z8GA 3OSYA 1PZNA 1Z83A 2DFTA 3LBNA 5T6GA 1FZZA 4Y11E 3PLBA 4OKSA 4POAA 3QPVA 1XTRA 4AKIA 2VIVA 1WOFA 3ZS8A 1P6XA 2BBWA 4D0NA 1MOZA 4I99A 4M1OA 1TLDA 1BHXF 1P05A 2QSZA 1K1IA 1FPMA 1XTQA 4XWKA 4BXWA 1GHBG 3J81k 3GFOA 4OJKA 1Z0FA 2NPFA 1OIWA 1TF2A 4MPWA 4KV9A 5AWFC 1O32A 1YF4A 1W47A 4NE2A 5E0GA 1QTFA 1ESNA 1DG1G 2Z4RA 4LHWA 2DE8A 1DLEA 3BTGE 4AG5A 4JMYA 1VITG 1TOMH 4KTCA 2WIAA 2GAAA 2PEYA 4Q21A 2GCHG 4B34A 1I2DA 4RZ3A 3GLIB 2A5GA 1AM4D 3SQEE 1P2TA 3REFA 2GDEH 1II8B 2VHUA 5JEEA 3MU0A 1EZSC 2JLQA 1N5KA 3OEED 3Q5DA 1G4AE 4H9GA 2ZHFH 3QWCH 3UPUA 4F4OC 1EX6A 2VYFA 2BY8X 2J0SA 1XEFA 2NO1A 2VVCA 4LC0A 3I29A 4CEIA 4FW9A 1ELDE 1YKSA 3A82A 2J94A 1L4YA 2GCOA 2YOHA 1TGNA 1C5VA 1Z29A 2Z4SA 4I31A 2FPLA 1YU9A 1SFQB 5HZHA 3K2UA 3AVUA 1CGIE 1CJUC 5AJWA 1A2BA 2NMVA 5E2OA 1BOQA 4GRAA 1B5GH 4LI0A 2JETB 1KSNA 3TNSA 1YZKA 2ZGCA 1OFTA 2G0NA 2QC2A 4GZLA 3RS2A 3SHWA 2QXHA 4GOJA 2ZYUX 1IN4A 5GNDA 3HU2A 2XSZD 1ZYUA 4ZIRA 1UBCA 2IS1A 1ZOMA 4M9XA 4B47A 3IQWA 3PITA 1MTUA 1EB1H 1BT7A 3B13B 1UDXA 5LPNA 4KELA 2UWLA 2KBFA 1BIFA 2A5YB 3FVFB 1X8JA 2J7KA 1OSNA 4NYIQ 1ETTH 3DHKH 1J17T 3D31A 1MH1A 3T15A 4NYJQ 1AQYA 1OIVA 4X2XA 1GRRA 4NSVA 2FESH 3UKDA 4YM9A 4ZHMU 3S9AA 3ZLJA 3DUXH 4MRPA 3SU5A 3PV2A 1Y8TA 4RD4A 4AI6A 1C5LH 2ATVA 4BPBA 1Q12A 1ZNWA 3RS7A 2ZE7A 4XD7A 1O39A 3F0TA 1ZMJA 4D4LA 4AOQA 1Z71A 2ZRFA 3X1ZA 1S3SA 1G9IE 1SLUB 2H9EH 3GY3A 1N6XA 4YT7H 2UWOA 2GKVE 4DSNA 3MTYA 1PPCE 1GHZA 1KXDA 4PZLA 3QSYA 3P8OA 2ZIAA 3GDUA 1P75A 4JVNA 4RKJB 2Z9LA 1HURA 3VFEA 2BDYA 6CHAC 2J45A 2GF9A 3B5JA 1M2OB 3AGQA 2RH5A 1YRAA 3D8BA 1Q3TA 3V3MA 2WJJA 2IPHA 3KKOA 3THYA 1QHRB 1CA0B 2FOEA 4ESHA 4IEEA 5EP1A 3HK3B 2IHYA 3DMNA 2F9NA 1O5CB 3OIYA 1GMHF 3QKSB 2B7BA 4TLEA 1WU1A 4K3JA 4CW7A 5JS7A 2ZYTX 2XNSA 2DR3A 2FYRA 4M21A 1TPOA 4MVNA 4EJSB 3BD9A 3PTBA 4GPTA 2W3IA 1D6JA 3AF2A 2V6IA 3QOFA 2OCVB 2GRJA 1C5UA 3TVJB 2GILA 3O47A 2D7DA 3VB4A 2HVXA 1BZXE 3W6OA 1G41A 3SJOA 4Q9IA 4NYMR 3CO5A 4AWXA 3MH5A 2FODA 2C77A 3B8JA 4FINA 2P0EA 3RMNH 4W5WA 3P8FA 1SBWA 2QP4A 4DB2A 1U9IC 2ZAOA 4FMBB 3OX7U 4GFDA 4HLDA 5KNBA 1TAWA 3AW0A 1YGCH 1HA3A 1NVXQ 5I25A 1UDWA 2QAGC 3C27B 2OK5A 1JPNA 1FIZA 3F9HA 1M7HA 3AVPA 1DY9A 1P2NA 4QBIA 4KHZA 3NHAA 2RB4A 1SGDE 1FL9A 5EZ6B 5FBVB 2H57A 1DVRA 1U2RA 2JJ1A 4JLMA 1KI6A 5E0HA 4FUBA 2IA5A 1NSFA 2G8TA 3E3TA 5IDKA 3T35A 1TBRH 4TPIZ 3T25A 1TUIA 1ZM2A 1NESE 2GD4B 1TGTA 1ZLRA 4DT7B 5DHFA 2YNMA 3ELAH 4BLPA 4CEHB 2BY9X 4BAQB 1KIGH 3ZZ6A 1LHFH 1XEWX 4X2WA 1JWTA 5BYJA 3CNOA 4TL7A 1ZZZA 1ZMNA 5L2ZH 1BTHH 3AF4A 3G82C 4MDFA 4UXHA 1O3FA 2ZREA 2ZA5A 1A2CH 3K70C 1BOFA 4MA4A 4G5GA 1GJDB 4US1R 1F5RA 4QM6A 4EPWA 1P03A 3O8BA 4JVSB 3AVTA 4KKDA 4C7OA 3TR5A 3MJHA 4US2R 3ND9A 1GBHA 3QX5H 2O8TA 1O2XA 3B8HA 4PHFA 4WMEA 3TJNA 5AK0A 2YHSA 3CNNA 3ZH9B 1TRMA 4LK2A 2ODWA 2YVUA 1VG0B 1TNKA 1JPJA 2VO1A 1F5LA 4YTAA 2CMKA 4D7FA 4F38A 2WPJS 2C9OA 2QIQA 4CIDA 2ZYVX 2QM8A 3FKSA 2JDIA 1VCPA 1BITA 2IYZA 4OK3A 3GEEA 3O8RA 5M04A 4A4DA 1ANEA 3ASZA 2KSQA 2GX4A 3W8RA 3PEUA 3OEHD 2HGTH 1ZPZA 1TEVA 1LHEH 1L1JA 1O33A 2PV9B 3Q3YA 3TPIZ 2CCJA 4EFMA 1IJFA 4N1AA 4CEHA 2DY1A 1JBUH 3ZZ3A 2RGNC 2VVVA 2J5XA 3TJUA 1IXZA 4V0LA 2X1VA 1BRUP 3M61U 1TL7C 1CF4A 3FKSD 3LRPA 1W4RA 3MH4A 1K1OA 1UF9A 2QL6A 4NIYA 1TABE 2OCYC 3BC1A 4Y0ZE 3AH8A 1UTKA 4DCUA 5L3SA 3QE0A 2FI3E 1GL9B 3A87A 5DSZA 2ZSDA 4NZLA 2ZRCA 2F3RA 5LD2B 1AN0A 3VR1A 3AAVA 2QPAA 3RMLH 3B7GA 4XVQA 5CB8A 5JI3E 2BD9A 4URVR 1QL8A 4YOIA 3ZVBA 2WPKS 1LFDB 3M0EA 4OHXA 3GY8A 1DAHA 1ZSJA 2WAXA 5C5OA 1FMJA 4NMMA 5G3YA 3K0CA 4TMTA 3SYKA 1UEJA 4DVAU 2E1RA 3PEVA 4DIHH 2WICA 3L82B 1Z0JA 4YOGA 1HCGA 4GHQA 5FI0B 1EOLA 1VG1A 3MSXA 2P5SA 1FONA 5EUMA 5JMTA 4Q4HA 4L8GA 5FCKA 2C8VA 4LYAA 1L4UA 3ZZAA 2JLRA 3MWJA 2ATXA 4F4JA 1TQ7B 3GLGA 1WXRA 1MAYA 2NGRA 3M5NA 3BF6H 4CHAB 1YR7A 3QF4B 1GKUB 2PGBB 1VKJA 4Y8YA 3RXMA 2MMCA 3P4YA 1AE5A 1I4DD 4RFSB 4FU9A 3PTNA 4ASUA 1W36B 2IHBA 2C03A 3IUYA 3GCHC 3PMJA 2BCGY 4HGCA 3A89A 3AVYA 3F9EA 3HWSA 2GBLC 1VTKA 2QAAA 2ZFPH 2AWOA 2C8XB 3UFAA 2ZEBA 1VCIA 3IKJA 1VG8A 1GP2A 1BUIA 1LB1B 4ACAA 3U8RH 1VGCC 3IIMA 2WWHA 3EC1A 3VB5A 2OG2A 2FTLE 4E09A 2BEKA 4EQ6B 4OS2A 4Y8XA 2XWBI 2EVWX 1FPCH 1NO9H 3U9AH 4OS7A 1O2WA 3A81A 3WP1B 1G7RA 2BBOA 1SR5C 3LWNA 1EPTC 2EI6A 3CH5A 3RU4T 1EAIA 1SGQE 1E98A 1UTMA 2XCNA 3GYMA 2ZDAH 2FOBA 3BOSA 2ZQ1A 5JHHB 3QTVH 2VQSA 4M9ZA 4NSYA 1QBNA 1SXJA 4BEJA 5LPRA 1K1PA 2FMXA 3Q72A 1MRNA 4DLWA 4KSBA 4I8KA 4HYYA 1LF5A 3FFBA 1H4WA 1QHHB 3U3JA 1MZAA 5DYIA 2D2EA 2ZNKH 3TITA 5EP2A 3TBKA 5JEDA 4E03A 3ADDA 2AFQB 1BO6A 1AJEA 1ZJKA 2QPOA 3NKVA 2REXB 1XKBC 2VU8E 3TK6A 4DEYA 1OF1A 3LXRA 2AH4X 1UTPA 4TL8A 2H6MA 4M9SA 1KDPA 2E87A 1Z1IA 1TTTA 4IN2A 3A86A 1UHBB 3DZ8A 3B82A 4TSFD 5IK2A 1P72A 4OI4A 2BBSA 4MPVA 4HI3A 4HTCH 4LBWA 3WNDA 2EA3A 2BB4A 1U81A 2FSGA 1UK4A 4LHXA 1OKXA 3RXJA 2PFEA 4C0QC 2A5IA 4IFEA 1L7VC 4BWYA 1TIOA 1C5OH 1HAPH 4CVNA 1TQ6A 2VGCB 4E07A 2GWHA 2SGAA 4AORA 2FFHA 1R4AA 3CB4A 1BRBE 5HCNA 4BEBA 2ANCA 3CR7A 4UXJA 1O3HA 1RRCA 1W5SA 1ZM3A 1Q31A 3QY0A 5C20A 3SU4A 2ZHDA 4WZ6A 4AFUA 3CBQA 4ZROA 3A37A 3KXIA 3ZZ0A 1UTOA 4DGJA 3LH5A 5KPJA 1O2OA 1UK3A 1D3TB 3MWYW 1RJXB 1DTSA 2YC2C 4L9WA 3IG6B 3IPXA 5EXXA 4QG7A 2REOA 1O3AA 3NBYC 3NXPA 6LPRA 2GEUA 1UMAH 1Z6GA 5DP8A 3OF5A 2Z7FE 2TGPZ 2BD5A 3DM9B 1O2GH 2B8OH 5FOUA 2YINC 3PV4A 1VITH 3M3TA 3VEQB 2F9VA 2ZFSA 1DS6A 2GGVB 4AYTA 1E4VA 2ZF0H 3E70C 1LHGH 2IS6A 2Z9KA 1E0SA 1WCV1 5G53C 3VB6A 1VDZA 3K6YA 4OQLA 5CDFA 3SU1A 1KY3A 1PJPA 2GJ8A 4WZAE 1SQOA 4QXAA 4JJZA 1O2RA 2I3BA 2ZI9A 4OS4A 4CT5A 2N1BA 1A0LA 3GLHE 4OI2A 1F0TA 5DLQC 1MD8A 4RFVA 3GJ6A 3ZZ9A 1BKDR 4HDOB 1ANCA 2I6SA 1Y59T 1YPGH 3KQEA 5EXMA 2CL7X 1XB2A 2OC0A 3LJOA 2ZTZA 2IL1A 2Z6VA 5EQTA 1KYNA 1OXTA 1VJ9U 4ABJA 3WMFA 4DSUA 3GY7A 3R9IA 3ODFA 1X8KA 3BWDD 1YHNA 3FOZA 1W8BH 5B6OA 2QF0A 3X1XA 1W36D 4D7GA 5ELXA 2UZ3A 2E9SA 1GFIA 1IQFA 1TPSA 5FI1B 2YYZA 1OFHA 2BTCE 2ZSAA 5E4FA 2EC9H 4BECA 1SHKA 4RCZA 5AJYA 1FXYA 3BK7A 1XD8A 5FHTA 1JQJC 1HEIA 1XD9A 3SHAH 1RGQA 4PO9A 3MWIU 1F2UA 5EE1A 2C96A 4P4SB 3HATH 1P9NA 2CHQA 1ZRHA 3KN2A 3VMFA 4E06H 3KUCA 2H5EA 4LBYA 1CIPA 4BASA 3SOSA 5K0HA 1ZM4A 1LPGB 2BD2A 4G5OA 2PMKA 4AIIA 2BMEA 1SGCA 1ZYOA 4JT4A 4W5JA 3SQHE 3A7VA 1HH4A 2QPTA 2BXUH 2Q9BA 4LHYA 1EAUA 3FANA 1LVGA 5JSZB 3ZD6A 2Y7XA 1GBCA 3UY9A 4DOQA 3MO6A 4IHQA 4AKHA 3PFIA 1O31A 2HALA 2C9YA 4I32A 4MQAA 3R0FA 3I32A 1MU6B 3WMGA 5AUOB 1IOZA 1W7GH 2ZRNA 1SGYE 2WHXA 5EXNA 1UVOA 2ZU5A 1GKIA 1CR2A 3MU1A 4CRWB 1ANKA 3VR5A 1EFTA 2O0KA 1UTQA 1J99A 4NA8A 3IGFA 1TMBH 2O8MA 1ABJH 1IN8A 1O2QA 4URZR 2FTMA 4NP6A 3E0NB 4CRFA 1WXQA 4FVDA 2ZUCA 1GG6C 2RGCA 3EWAA 3KFXA 4MRRA 1H8HA 1KI3A 2JIZD 1BBRH 3OIUA 1W0KA 3GCTG 1KDQA 1COWD 1E0FD 3RMMH 2ZRGA 4NWKA 5JWOA 3F6UH 3RANA 3KQNA 1FAKH 1XU4A 4BTIB 2V54A 3NH9A 1KDQB 1BQYA 1O5AB 1JAHA 2OXCA 2WUCA 2R9VA 4JK5A 1IHSH 4UEHH 1HT1E 2D26C 5AUPB 1H9HE 4DB4A 5GJVC 5BN3A 4Q9HA 3SFVA 3OYPA 4DLYA 2OUKA 2QCYA 1W2KH 2D1JA 3T1OA 1CP2A 2Q3FA 121PA 1HUTH 2IEZA 4OK6A 1XXDA 3NEJA 3GJ0A 5AR1A 1R0YA 3MGCA 4DKXA 3ITIA 1U8ZA 4B74A 1RRKA 2UWPA 3UG6A 1OX1A 1AQ7A 5HGGA 1GBDA 3MNCA 5TCCA 1NKSA 2FE4A 3W3AA 1G18A 2ODEA 2QTFA 2XSZA 4UE7H 2YWEA 2VIQA 2IUTA 2STBE 5BN4A 1HJ8A 1M34E 2B6HA 2CE7A 621PA 1XDBA 4XVUA 4B43A 2Q0HA 1PVOA 5TB5A 1M1YE 4WZBE 1QHXA 4H42U 3ZV8A 1PPEE 1XXFA 3QI2A 2PCJA 2IS4A 3K9NA 1KMQA 4YDHB 3ESTA 4TWYA 4TQAA 2JLVA 2ZU6A 2OAP1 2Z43A 2HOBA 1G3RA 1G4UR 3GMTA 4JZ1A 3A7TA 2WPLS 4X1PU 2P93A 5T6FA 3F68H 2Z5FA 3ZVEA 4G5RA 4J0QA 1U0JA 5T1VA 1HFDA 3UMFA 4YXWD 4LPSA 2YZ2A 3LVRE 1JR6A 2P94A 1T8LA 3SV9A 3RYTC 1ZUIA 2HXSA 2PJZA 2EI8A 2FZ4A 1SXJC 2QROA 2AL7A 4M1WA 2Q6GA 4YO9A 4DUGA 4WMFA 2BEJA 4DSTA 5JECA 1EATA 3A7WA 3VKGA 1DDJA 1A0HB 3FHTA 2AFIE 1SQTA 2BDTA 3PYHA 4QOSA 1V2KT 1AZTA 4LX0A 2TGDA 3L0PA 2PEZA 5FBLB 2J34A 3VPKA 3TKLA 1SFIA 2QAGB 2P8OC 1X1RA 4W9MC 4WXVA 3ADBA 3MU5A 1GNQA 4URXR 5BYKA 1N0UA 4INHA 1IQNA 4GNKA 3ATWA 5TJXA 1Y63A 3LPRA 1OLOA 4GZMA 5E7MA 2PLXA 1BTWA 2W0MA 4FWTA 3MAAC 2AK2A 4ON9A 1BTUA 1UTNA 4D2IA 3SHCH 4FN5A 4B35A 1C1UH 4O2RA 1MTVA 3LD9A 1GRNA 2FM2A 3QG5A 2W6JA 1QQ4A 1MKWH 1FQJA 4MPUA 2WV4A 2FWWA 3B9QA 1NROH 3TAHA 3URDA 1EP5A 1UK2A 4CRAA 2WWYA 1CO7E 2C4FH 5C2JB 3TNFA 1AIPA 5FTNA 2AMQA 2DB3A 1PYTC 5GJCA 2B8WA 1H8HD 2ZETA 3SGQE 3E6PH 5FBRB 4F4IA 5KSYA 2PZGA 2FGKA 1DADA 4A0FA 1JALA 1TMTH 1VECA 3A80A 1RRPA 2BMDA 4Z54A 1AKYA 2QYIA 2VHJA 4M0LA 3DDCA 1A4WH 4PHHA 4XOJA 3W5IA 4CGZA 1DG3A 4R2HA 5KSOA 3WNCA 2TPIZ 4D9QA 2HDNB 5JHGB 9ESTA 1AVWA 4D0LB 1YVDA 1GHWH 3U7HB 1MTWA 1LKAA 3PENA 1JIRA 1V2VT 1MU8B 2D74A 4JK6A 1PUIA 2NO6A 4M1MA 1XM1A 4XSHA 2GCHF 2AXNA 3FFGA 1J2JA 5EXTA 3LC3A 1ZRKA 3LVQE 1C2DA 3VTKA 3CR8A 1CKEA 1GMDG 2BD7A 4C2UA 2QGRA 4P4UA 4MG3A 4IKEA 2ERYA 3W95A 2JLSA 2A0QB 4NH0A 4DLSA 3AF1A 2D62A 4TMVA 1OWHA 2FEQH 4PTLA 1AQUA 3SNHA 4ABIA 4AY2A 3V0XA 1EG7A 2BZAA 4V0MA 3LKWA 3OE7D 1NSTA 1CR1A 1NU7B 3FP8E 1AE8H 1YLDA 4D4JA 4CH2B 3CX7A 2FI5E 3VXFH 2BYAX 1QVRA 5A0AE 2ZDKA 5D3QA 3A4NA 1BMFA 2GETA 1WSSH 3VR4A 2OCAA 3FVQA 2F3TA 1MH0A 1G30B 3I1FA 4O03A 1KI7A 1OH8A 2NU2E 4K8YA 1G7SA 3PR1A 3HPQA 3ENSB 4NA7A 2I1QA 4ISNA 4HLCA 5IT5A 4B2CA 3LT3A 1AFQC 3ONWA 1YCPH 1I4TD 2K1QA 1GHYH 3SJ9A 2ZFTA 3QPUA 5CHAB 1TYNA 1C2EA 2PX3A 4I8JA 3UREA 4IDNA 1N0VC 1E9EA 3VB3A 2SNWA 5JWRA 2FZZA 5FUVA 1E1QA 3AB3A 3WMEA 4MRSA 5A09A 1O34A 4FIDA 3FZDA 5EE0A 1K1MA 3BFXA 5IF9A 4BXSA 1UBFA 2GK7A 5T3HA 4AFZA 1RZ3A 5K8LA 2A5KA 4OM9A 3RC8A 1N6KA 2CLSA 1YR8A 2ZPQA 3TUIC 2XJ9A 1LCYA 3TLOA 2Z9GA 3T27A 1B23P 2UZIR 4NTZA 2IYQA 2HCBA 1SKYB 4XTRA 3SEAA 1MKXH 2A4QA 1U90A 3FP7E 4JYCA 1M9UA 4Q1BA 1EP6A 1EFUA 4I33A 4M9FA 2QTHA 1HAZB 2F6RA 4RD0A 2V6JA 2OBMA 2B7CA 4WAUA 3U3OA 1NJFA 3U44A 4GUXA 3M3SA 3MJRA 3THWA 1QG2A 1E99A 3QG1A 4C0BA 5EU8A 4AKEA 1Z47A 3TQFA 1MTNC 5CJ2A 1X1SA 4SGBE 3SGBE 3SI3H 4ZHAA 4C7OB 4CRDA 2XC5A 5JJKA 4ZXXH 4INLA 4OGYA 3RUOA 4KODA 2GMTC 1HJAB 4LJ7A 1TX6A 1F2TA 4A36A 2B5TB 3GISB 1W1WA 3V4RA 1PPHE 2ZR0A 1DUEA 2F9UA 2QENA 2QAJA 4MDSA 1BMLA 1LVBA 1T91A 2SGDE 1L1NA 3GCTF 1H8DH 3U7EB 2BX4A 2WKRA 3M1IA 3AK5A 1UKYA 4OQXA 1FX0B 1EWRA 2O8UA 3RDPA 1NFUA 4LOYH 4BFVA 2CE2X 2BCJQ 1W4BA 2HT6A 3SOPA 5GXPA 4IW4E 1ZU4A 2FEOA 3VNUA 3ZZ5A 3BIFA 4V0KA 4K81B 1JOUB 2UVQA 3T1QA 4CZ2A 1E2NA 2P3FH 5EE3A 1E4YA 1JNYA 1CR4A 1QA0A 3I4LA 3RABA 4MRNA 4W7SA 1WRBA 1DSTA 3FMOB 4K46A 1ZBDA 1O2TA 3D6TB 4PANA 2XXAA 2WUBA 2ZITA 1L4DA 1N6HA 2QXIA 1EXMA 5FX5A 4Q4AA 3RC6A 1Z2AA 4A2WA 3EW9A 2VP9A 1TQ0B 3KDSE 1VYTA 2F1HA 5F8ZA 2OC7A 1G2MA 1UKEA 2SGPE 4W5HA 4ILEA 1EPTB 3SJAA 5KPDA 4ARZB 4KXFB 4Q4JB 1DWDH 4D9RA 1K21H 2VSFA 1FNMA 3KXLA 2ZAMA 4MNYA 1B7XB 1K6MA 1DO0A 4X8HA 4PC2A 4WVPE 2VH6A 1GVKB 3E90B 1QHNA 1T4GA 1ZAKA 4DCNA 1ESBA 2EFGA 3H86A 3UNSA 3R7WA 2O8LA 3Q3KA 2XTNA 2OTVA 1W2HA 2IT1A 2NO7A 4HATA 4C9BA 3RXAA 5KOYA 3UOUA 7GCHF 1IQKA 1E2QA 1GTVA 2V55B 3Q00A 1G32B 2WPIS 2ZI5A 2ZI7A 1ZNYA 1N5JA 2ZEJA 5DN6D 4L16A 4RD6A 3LW8A 2GVZC 1T5LA 3UMRA 1W0ZU 3WYGA 5DP5A 3OFNA 3CS7A 1CS4C 1EJMA 4MKFA 3FTQA 2QT1A 4PSVA
chains in the Genus database with same CATH superfamily
2GBGA 3HBMA 1KEWA 4CT4B 3LUFA 2A7QA 3BHJA 3VR6A 2HHHB 4UVGA 2BM0A 1GEEA 1OA1A 5E2AA 1BZYA 3TRFA 2GZ8A 1SBCA 1YB5A 3L05A 4LZZA 4A91A 4ZCIA 2UZAA 2D1SA 3RVBA 2AMVA 1Z8FA 2AEIH 1WYKA 1UBKS 2W83A 3OSUA 4LYHA 3SIWA 3O8CA 3GJRA 4HDQB 1V2JT 1KLTA 1N2SA 4F8YA 3D2BA 1RQPA 3A3KA 1XXLA 2D1TA 1ZOLA 5KYKA 3UMYA 3BTOA 3P97A 4GQIA 4IWXA 5LYJF 3DOJA 4TGLA 4RSMA 4EHDA 3QBTA 1XR3A 1HAYB 4UAGA 5CA1F 2XT0A 4N39A 1I5OA 1JRTA 5B2FA 2FPZA 1J16A 1HYGA 4K1SA 1YRLA 1SJ9A 2XIJA 4L6IA 4EG6A 2PX4A 3Q87B 1UK9A 1IATA 1DWPA 4P93A 2Q5IA 2GWRA 3BTKE 3BWYA 4RPGA 5DTEA 4F72A 2H7YA 4G81A 1EWQA 4O1MA 3RXKA 1WUNH 1KEEB 3HZHA 1ULUA 4LXHA 4PTZA 3QBVA 3ZVLA 3HUFA 3UW3A 2B20A 5J4LA 1H4VB 3NW9A 1COZA 2G5TA 5EJEA 1TZKA 1NT4A 1P5RA 2OOKA 1RRFA 1YC5A 2X9GA 2EC5A 4HHEA 3ZU6A 4EHAA 9ABPA 1PV4A 1STOA 4ZEVA 1OI2A 2PKSC 4PGMA 4QKQA 1VPDA 1FDRA 1JQLB 2Q6VA 2REBA 3DTVA 3L07A 1TWXB 4K7JA 4J0FA 4LN1A 1YS1X 1SELA 2K4MA 2Y0PA 4G9GA 4O63O 3R7FA 4M8SA 4RDXA 5ECYA 1HSZA 4BQOA 4AN7A 1UDAA 3VVMA 2Y1WA 1A4RA 3ODPA 4JBWA 3U7IA 4C4SA 4KH0A 4JI2B 1O03A 4BP1A 3HGNA 4INPA 5AVQA 3GLFA 5FKJA 2BZ0A 1F8FA 1QG4A 1ZEMA 3RS0A 2J9NA 1ICEA 4WK0B 1PYDA 3SORA 1ND5A 1ZH0A 2DHRA 4XCXA 2ZU3A 4IWYA 2G80A 2J0VA 3DZKA 4QA9A 1ACMA 2FZWA 1TQDA 2EW1A 2X0IA 4FFPA 4ZO8A 1YQWA 1HLGA 1MC8A 2ALJA 2VCEA 2JFQA 1C9DB 1EFCA 3SNCA 1QYWA 1MX9A 3FJOA 3QVTA 4Q4AB 2IOFA 4AO8A 4EECA 3N8NA 5KDOA 5HKKD 2CXVA 1W93A 5TX7A 1Y1PA 2LD4A 2XYQA 1TU4A 3KUKA 3MELA 5LR6A 3SZOA 2HC9A 4OUDB 3RIHA 2A4GA 4BAKB 2DFLA 2V7VA 2XCSB 4RMNA 3VU0A 3QUSA 1OWNA 1ISMA 4WZZA 4MR7B 5A2GA 3KSBC 2XA9A 3L5OA 4HSGA 3ZWPA 1C8LA 1FVOA 1XQ9A 3I09A 4WVLA 3RSQA 4KBGA 3RC9A 1MOSA 4HJXA 3PXDA 1I3KA 1XYGA 1MUEB 5DO4H 2XY4A 2ZT7A 1VFPA 1WNTA 1L1EA 3WIDA 2QE6A 4BB9A 2R6CA 1FXWA 2XTMA 3B1ZA 3M6MD 1KJQA 1T0JB 1YU6A 3IE0A 2HFJA 5D3KA 2QMOA 5FRDA 3RHSA 2ZS9A 2Y82A 1AKSB 1ETSH 4Q47A 2WMNB 1ZHOA 1GSIA 5HCUA 3DEYX 3TMKA 5T67A 3GGDA 2QTGA 4LC9A 4LPKA 3BTME 3ATIA 2JA1A 3FUTA 1Q84A 1EXFA 4A1VA 1QP7A 4ZAFA 1DWQA 1FMGA 2BFCA 5CB4B 2GHIA 3N5KA 4LGVA 5G0TA 2KCOA 1X13A 4LHSA 4BMYA 5LN1A 3TGIE 2FK7A 4MQFB 3U3MA 2XB8A 1W4ZA 4RGVA 1IXRC 2ZJYA 2AMDA 1QX3A 1DIGA 3GPLA 1YZHA 1EBBA 1YD7A 2H1LA 1HDTH 4ZHLU 2WUVA 2ZIZA 3H1PA 2R2GA 3PPIA 1I30A 1NBMA 2CW5A 1FDTA