3O8DA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase
molecule keywords HCV NS3 protease/helicase
total genus 207
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8dA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8dA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8dA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8dA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8dA03
4IGDA 3U7FB 3WY8A 4FMCB 2GEUA 4LZ4B 3AK5A 2GNOA 1KLJH 3IIJA 2XNDD 1GDQA 1AI8H 2G55A 2CHQA 5J4HA 2FEOA 3I92A 3IQXA 2CVHA 2AIQA 2P93A 2CLDX 2QF3A 3BV9B 4IVPA 4FCTA 1C2HA 3GISB 3H4MA 5TB5A 4QGFA 3WNCA 4BLPA 1O5EH 3KUCA 4AGKA 1R0WA 3KL4A 5J40A 3EA0A 5IHPA 1EATA 3ZVEA 3OX7U 1UHBA 3P95A 2FGJA 2HGTH 3R0FA 3CF2A 1HJAB 1E36B 5EGMA 5HGGA 1E79A 4B6FA 4FUJA 1G3BA 2OXRA 4FUCA 1Y63A 2GP9B 2XTZA 1ZAKA 1DPFA 4CBNA 1IM2A 4LV5B 1TMTH 3W6PA 5GJVC 2ZRFA 3GMTA 4HYYA 1LHFH 4TYQA 2V6JA 1NIJA 4OS5A 4Q1FA 4MRSA 4UXIA 4A4DA 1GUAA 2RMKA 1AQUA 1SXJD 1LHDH 4E7NA 2G52A 3M3VA 3OTPA 1TE0A 3QBVA 4DDWA 2QIQA 1DAMA 1NJFA 3KJEA 1J8MF 3QGJA 4CGZA 1O5FH 3SZEA 4EPXA 4BFSA 1ONBA 1ZINA 5BN5A 4LUCA 1FQKA 4MKGA 1XKBC 1MTUA 2CEAA 1CR2A 2O9QA 1SI5H 4B33A 4MH0R 4ZDJA 1QBOA 4PX9A 2JLSA 1TQ2A 1XUGA 2REBA 1TAGA 3AVOA 1AZZA 2CHAB 1W14U 1ZGVA 4IOKA 4MYHA 2V35A 3MWYW 4RKOB 9ESTA 2B7DH 4XBCA 1GMCF 2H9TH 4KI0A 3LWNA 3RRYA 3ZZAA 5JI2E 1DXWA 4TQAA 1DO0A 1UK2A 3R7WB 1W49A 1HDTH 2WICA 4A92A 5D3QA 2D06A 4BECA 5A8ZA 1KLIH 1Z6EA 4WH6A 4IHQA 1JAIA 1CHOG 3ZZUA 5GXPA 5JRZA 1Y3WA 4XD7A 2V7QD 3VTKA 1WB9A 1KSNA 1SL3A 3MH5A 3SHCH 5CE1A 3B1YA 1DO2A 1D3DB 5ESBA 2ZJAA 4CVNA 3GLHB 1BRUP 3AW0A 2QSZA 2RGNA 2X77A 4PZZA 4BFYA 3DM5A 3PTNA 3B60A 2NMVA 2F91A 3P26A 4U7DA 1TPZA 1JALA 3M5LA 2YYZA 4KODA 4URWR 2PGBB 3F5FA 2RGGA 4LBYA 3FKSD 2WZQA 1Z5ZA 4L8GA 4KYUA 3I77A 4CEIA 3SV2H 1MD7A 1E9RA 1N5IA 1R4AA 3X1ZA 1P2TA 3KKNA 1N0WA 1II9A 3KX2A 1O36A 2ODWA 4M8NE 1EAWA 1VG9B 1QB6A 1BOFA 3NH6A 3A81A 3SU1A 3SZNA 2WIBA 3RRNA 3IBGA 2ZVPX 5JRJA 3IGFA 1S0RA 1A2BA 1MKYA 4CH2B 1AK2A 1DY9A 8GCHF 1KIGH 1C5UA 4A1XA 3WP0A 3W6NA 2Y82A 4DT7B 4P4SA 1T8LA 4W5WA 4TZ6A 3FB4A 3Q8XB 1ZBDA 1QTFA 3SNCA 1FMGA 2WSSD 1W0KD 3KJGA 1XUIA 2WVJA 4F7WA 3G0HA 2GK6A 1E9FA 3FFAA 1LPGB 4WZBE 1SHHB 1OIWA 4R8TB 4HB0A 1GZSA 4IEIA 3PJRA 1OKXA 2OFXA 3MU5A 2KE5A 1NKTA 1VJAU 1EX6A 1LPKB 2FG5A 2GESA 1TX8A 4DB2A 5JMTA 1CE5A 3QJYA 3LAWA 4TY6A 2O8FB 5AFZH 1EAUA 4W5HA 1Q57A 4RFSB 2OFWA 5EE3A 4VGCC 4C7OB 4II7A 1MKXK 4DURA 2EYQA 4XE4A 3ENSB 1IQHA 2XXAA 1VG0B 1W5TA 2VVUA 1OSSA 3MO9A 1PPFE 3HR8A 1KLTA 1F2TA 3TNTA 1PLLA 1D3QB 1MAXA 1P3EA 2OUAA 4A1VA 4ZV4A 4F4OC 2J92A 1BT7A 1DTSA 3BFXA 1BMMH 1HPGA 2W7UA 4EKDA 3UPUA 2FSGA 1DSTA 4BQSA 2NO6A 4BLRA 1KI7A 1O3KA 2BB4A 5KTYA 2EFCB 5E0HA 5HM2A 3RAPR 5EE9A 4DY7B 5C18A 4OHWA 4HLCA 1O2LA 1GKIA 2ZI7A 2XZOA 4GVUA 5E7JA 2P67A 4MRPA 4FVDA 1RJ9A 4Q9JA 3CWQA 4U32A 5F8XA 5DISB 1C5PA 1NKSA 3W95A 2BDHA 1C1RA 3P70B 1O32A 4FW9A 2QT0A 5H70A 2O8WA 3PLKA 3MAAC 3GFTA 2O8BA 3OY5U 3SNDA 1G3MA 2JLWA 4I1UA 4A0GA 1UCYH 3GLFE 2C8YB 1NFYA 1VCIA 1DLEA 1ZOMA 5FOVA 3LXRA 2WOOA 2A2XH 1ETRH 1FY4A 3GLHA 4QOSA 3VU9B 3MSXA 1DANH 1G291 2CHGA 1U6QA 1SC8U 1KK3A 3RSOA 2DFLA 2WPJS 3HR7A 4KFTA 4DUGD 5GDSH 1J9CH 2VYFA 1O2NA 3P8OA 3LH1A 4ESVA 5KPDA 2FX4A 2AKYA 2UWOA 4B48A 3G82C 4B34A 1CP2A 4DJTA 2VH6A 1RW4A 3B82A 3VPKA 3TR5A 3H0KA 5FL7D 2FDAA 3TAUA 4WXIA 2HDNB 1DWDH 4G5QA 4DIDA 2W58A 4LJYA 3OE7A 3PUWA 3PM3A 3U3MA 2R0LA 1W0JA 1YPMH 4JYTA 1KDPA 2A2ZA 2R6CA 1XUHA 4BWYA 1ESAA 2D2FA 4M1MA 2H7VA 2OBNA 3SW2B 1GMDG 4FN5A 1N0VC 1A4WH 5GWZA 5HM9A 2PZFA 1ELFA 3GY4A 3MNBA 3RC4A 2JLYA 4DLVA 1UVTH 1T31A 4GHQA 4D0NA 3CRMA 3SUDA 2XAUA 1JAHA 3RU4T 1JPJA 4NA9H 2FSHA 3R8CA 4QJ3A 2QQEA 2PKSC 1CVWH 4WW0A 5JI3E 4M9FA 4YMTA 4XOIA 3QPUA 4RSGA 1HRTH 4QM7A 1LS1A 2O8FA 1HNEE 2ANCA 2DWOA 3HPTB 1XTIA 3ATMA 4MQAA 1DAFA 3VXFH 1A5IA 2QAGA 5IK2D 1UDXA 1LDTT 3NZIA 3PMAB 1O5AB 2R2MB 1A3EH 5JWRA 1GGDC 2CVFA 4PZYA 4BLQA 1SOZA 2NPFA 4EJSB 1F7ZA 1FQ3A 5EXTA 3THWB 4AK9A 4DT1B 2FGKA 1O3PB 2YZ2A 3K0AA 4A15A 4JLMA 3UATA 4PO9A 3N7OA 4ZKOU 1II0A 4O03A 3DD2H 2ZAOA 4MRVA 1OYYA 1M6NA 1W48A 1C1SA 3FAOA 1C4U2 3T1VA 5E3HA 1HAXB 3FFBA 4M53A 4Y71A 3LLMA 2OXSA 2OAP1 3JZ2B 2BMDA 1XX9A 3JZ1B 7LPRA 4IDHA 1OV4A 1RJ9B 3H7TA 4R71A 3STJA 3A80A 5EPYA 2BHRA 1AIPA 3NPSA 3EAQA 1QA0A 5EE0A 1QHIA 2WBLC 2VH0A 5CB6A 1AS2A 1ZR0A 4EQ6A 2P3SA 3VKGA 3KDSE 3JZMA 3UXMA 4PO8A 1GJ5H 2GZAA 1W2KH 4CEHB 2J45A 1KY9A 3OE7D 1V6DA 2F83A 2H6MA 1Z22A 1IQLA 3UY9A 3ZGXA 2FFQA 2D74A 4INLA 5JPMH 2JA1A 1YPHC 3Q76A 2PBRA 4OGYA 3BGWA 2GVZC 2FOMB 1ZJKA 3CRW1 1TB6H 1W8BH 3A8BA 4MYUA 1KDQA 1CU1A 5FUXA 1V2VT 1IY1A 3SQXA 1Z8FA 4MDFA 1CKEA 1N6KA 4J0QA 5KDLA 1BTZA 1GBKA 4BOHA 1QCPA 2C77A 2HXSA 2OD3B 3QGNB 4MYTA 1AD8H 3LDXH 2QYIA 3HK3B 4B1TA 1F0SA 1JOUB 4Q18A 1KI2A 1BTWA 1N8OB 3QTOH 1NVVQ 1VECA 2CDNA 2W26A 2A5DA 4CR9A 3U4QA 5JECA 1NBMD 3SJKA 1KSHA 3S0NA 2VP6A 1YPLH 5AUQA 1A5GH 2O8TA 4YMSA 5DLQC 1WBBA 3BTTE 4AYWA 4F92B 3IO3A 3ZIAD 3OHMA 1IBRA 1ANEA 3RXVA 5JWOA 3K0SA 2ZJZA 4XDEA 3L8ZA 2F9NA 2ZHFH 2OFOA 2FOBA 4FUFA 4I1VA 3CRRA 3F8TA 2BZAA 2B5TB 3JVVA 2NG1A 3ZDQA 5CK4A 3E0NB 3VEQB 4UDWH 3NDPA 4JZDH 3A84A 5K0HA 2PGQB 2OESA 5AJYA 2VHQA 3BTME 4Q7ZA 2EYUA 2R6DA 3RUOA 3E16B 4ABBA 2F3RA 1RD3B 3UKDA 3VHXA 1T3HA 3ZQJA 2BMJA 1OWJA 2A31A 5E7MA 1F5RA 1Y3UA 2ZANA 2RGNC 1WTHD 5F8ZA 4IDQA 3P92A 2PJRA 3R9XA 4FD2A 1N3BA 4A0RA 2HEIA 3ZVDA 4TMXA 2QAGB 2VGCC 1BJUA 2PT5A 2XNIA 1OHHA 3ZVNA 2ALPA 4BXSA 3LT3A 1VMAA 2BBOA 1NO9H 1X1RA 2A5GA 2WSSA 3K0AB 1EB1H 4IOLA 2F3CE 1ZM2A 2HCJB 4UNPA 2PCLA 1WBGB 1CT2E 2BY7X 3UWOA 5EJEA 4G5GA 2WV9A 2QMOA 2CLCX 5GADl 1GM5A 4TMTA 1ESTA 1GCDA 3CR7A 3HYTA 3ZVRA 2GCTC 1GG2A 3BTGE 4BLSA 3W8NA 1M7HA 3OEHD 2IWHA 2A9KA 3LX5A 2RGXA 1N6IA 2X2EA 2UUKB 5FTJA 5HPYB 3S1AB 1CRQA 2H1UA 4KO8A 1L1JA 2WWXA 2SNWA 1D3PB 2BX4A 2FV8A 1HAPH 2AMQA 3KZ1E 1AB9C 1D5CA 2BDIA 4US1R 3PWCA 2A4RA 1K1IA 4CRFA 1QB1A 2ZIQH 5C20A 2C9OA 4C0KA 5F9HA 4NFEA 3ZYDA 4M1OA 1NFUA 3A8DA 5SGAE 5AF9H 5FUWA 5F98A 3BH7A 3UK6A 3SU6A 1BIOA 4QT8C 2QMUA 5FX6A 1S82A 3ADDA 4AG5A 2GZ7A 3UREA 2AH4X 1UKYA 4XSHA 2BD7A 5H1YA 2FOFA 4O9VA 1WMSA 1YPKH 1JXMA 1AFQB 4PC2A 1GHXH 2DUCA 1P7CA 4Z51A 1TNJA 2QN6A 1AHTH 2IF0A 1OYWA 4CEIB 3B78A 3SUGA 4Y6DA 3STIA 2QNRA 4HZUB 4EJSC 3K9NA 2ZWLH 3ZZ7A 3RWMB 3E91A 3MO6A 1XEXA 1ODFA 1VGCC 1NBME 1S2MA 1EPTB 3FTQA 2DFTA 4CF7A 3VNUA 5AK0A 1KSGA 1P12E 3NCLA 3EGKH 1O3JA 1GAJA 5EQTA 2GTBA 2CNWA 4P4SB 1LHEH 2GF9A 1J8AA 1AFQC 4NBSA 3OIWA 5J4SA 3F9EA 1YGCH 1UTOA 3GLIE 1HAOH 2HLDD 1DAKA 5JLJA 1JR6A 1A4RA 2GBLA 2HF9A 1BZXE 4DLTA 4H6TA 2ZCLP 1TX7A 1QY6A 1EFHA 4HTCH 3L43A 1NS3A 1CA8B 1XMSA 1YCPH 4IMZA 3OEHA 3P20A 4CT4B 1OT3A 4WH8A 2XCFA 1TBZH 4OQLA 3T27A 1C1VH 4O2RA 3A1VA 4HLUC 1ELVA 4HEJA 3BG4B 4XIGS 2FZLA 5J4YA 2O8CA 1XMVA 2HNTC 3RXGA 3U6KA 3RXOA 1SMFE 3GPLA 1YKSA 3GQBA 4C9BA 2UUYA 3D62A 1XWIA 2A4QA 5E0JA 4LZZA 3QPWA 2FEQH 4H6SB 4M4SA 4DCUA 1GHYH 1WE2A 1RJXB 3IWMA 3QEJA 1P10A 4TWWA 4URUR 3HU3A 1YU9A 1Z06A 4KBGA 1GJ8B 3FDIA 1WA5A 1FNMA 2ESTE 1HAGE 2WINI 3SNBA 2NTYC 4H1UA 1YZLA 5L2ZH 2BJVA 2B8TA 1HE8B 1OHHD 4P4UA 4JKIA 1T91A 4HAYA 2ZPTX 4E22A 4DIEA 3QLPH 3RMLH 3S1AA 1YZUA 8OHMA 2QA5A 1E9CA 4UNSA 4C3ZA 5KO2A 1GMHG 2M5TA 2MMGA 3NC1C 1W0JD 4OHYA 2F1IA 1RYHA 3GY8A 2G0NA 2WYGA 2JJ2A 3NHBA 2NU1E 4RY2A 4NYMR 1SVKA 3GJXC 4Y8ZA 2IYQA 3UMFA 3FPAA 1M8PA 5E8EH 3D3QA 3P8FA 1P5ZB 3RABA 3LLUA 1HA3A 3OU0A 1ESMA 1Q20A 1D6RA 1M2OB 3CS0A 4QHYA 3GFOA 4QBGB 5H8WA 3UMRA 1S85A 1W0KA 3VU9A 4UFGH 2PZGA 3T34A 1U8YA 1BRBE 2OK5A 4ACBA 3AP3A 5LD2B 4UNNA 3F1SB 2A7JA 1THSH 2QUZA 3OSYA 4GZLA 3SZRA 1R5NA 1AN0A 4TL8A 1V2UT 4NWKA 1TGTA 4LWZA 2ZECA 3ECCA 1VCOA 1GJ4H 2FODA 1XCMA 2PWXA 4NYIR 2KB0A 4JZKA 3R7WA 4LCBA 4TTPA 2FTLE 4MGIR 4O3TA 1P9SA 2P3FH 5F3WB 4K1TA 3ZZ9A 4IW4E 3RXDA 5FOXA 1Y5AT 4XWAA 1RTFB 4MLFB 3L3TA 4Q7JB 3SI3H 3FKSA 4KFSA 4ZKNU 4TYWA 3QENA 3L0PA 3EW9A 1EQ9A 3AVTA 1NY22 1DG1G 3B1WA 3RM2H 2GK7A 1T0HB 1CXZA 5B6OA 3URCA 4UXJA 5CK5A 1H9IE 2HF8A 4K1SA 1C9KA 3CWZA 3V7TA 821PA 2R9VA 1GJCB 1MBMA 3RDZA 4W9MC 1BTPA 4K5ZA 3KQNA 1K28D 3W3AA 4MNVA 1BMFD 5GIBA 1EXFA 4P3YA 5L3QA 2PMDA 5BN3A 3ZZ0A 2W83A 4ABIA 1JEEA 3AP1A 4HAXA 3TE6A 2KAIB 2AR7A 5FTMA 1NESE 3LOXA 4BRUA 3TLOA 1CJMA 1TMBH 3C15C 4ARZA 5E2OA 5FBLB 3MWJA 4U30A 1ZRBA 2AERH 4YOGA 2HJGA 2W2XA 4XTRA 2PSXA 1G6HA 4LYFA 3GOVB 4LHZA 1N0UA 1Q1BA 4BZPA 1KJWA 1G17A 2WHXA 3QSYA 4ASHA 3LVQE 1XP8A 1PPHE 3QXJA 3TH2H 5IRCD 1IN7A 1BRCE 2Z4SA 2VNTA 4G5RA 1GNPA 3IHWA 2BKUA 4RSPA 5J4KA 3QO6A 2C8VA 4AB8A 4DOQA 1FP6A 1OE0A 1WXRA 9LPRA 2IF2A 4DEXA 2ZGCA 1Z8JB 4TL6A 5DSZA 2OC8A 3LA6A 1HV8A 2MSEB 3BAFA 2ULLA 2BEKA 2ASUB 3SU4A 2ZSBA 3THOA 1O3NA 4NHOA 3M36A 1I2MA 2FOGA 2ZRAA 1VR1H 1IQNA 3PLPA 4S2EA 4TWYA 4Q4HB 1LF5A 4AD8A 2I6QA 5BW8A 1I4TD 2YKGA 3JZAA 1VYTA 1GJDB 1FY1A 2CN0H 3D31A 4XVUA 1SVMA 3GP8A 4AGJA 2CBZA 2V54A 3IITA 3SV7A 3PROA 2GJ8A 3LQQA 1FN6A 1WYKA 1F5KU 3SU0A 4NMMA 2ZITA 2WPDD 4D4LA 4Q7KA 2XTMA 1UFQA 1OF1A 2CMKA 3PV5A 3PMHB 1GVNB 1N2CE 2BLQA 1RRKA 4FU7A 1YHNA 1YPHE 3SFVA 1DELA 4ZPXA 4OQNA 1KK1A 2CV3A 2G4TA 1A5TA 4UQOA 3A86A 1KTSB 4WBSA 1GCTC 1Z47A 2WM9B 3KQEA 4C0SA 2V6IA 1NRNH 3S69A 2CL6X 2J0VA 4QJ4A 4Q47A 3F0TA 2VEDA 3CX8A 2FFBA 1ETTH 2OCYC 3UIRA 2GKSA 4LRWA 1K22H 3MD0A 1BCUH 1UTMA 2X19A 1WOFA 5B57C 1XJCA 3FOZA 2GKVE 2ANWA 1ESNA 4OK6A 4AN7A 4Y0AA 3RS3A 4TT3D 1BQYA 3U1JB 1ZM9A 1QVRA 2ZE8A 2OSBA 2A5FA 4BE7B 4K46A 2G4UA 2WAXA 4MNXA 3X2SA 2O8LA 2FNAA 5EP2A 4TWZA 2N42A 2HOBA 5FPKA 1JBKA 2OQUA 4AORA 1YLCA 4X0WU 1YR7A 2F43A 4A8JB 1P2UA 1RIFA 4KLNA 3OY6U 2ATXA 1MRNA 2GZDA 1TNHA 2QT1A 4X6OA 2FPMA 2ZF0H 5KSPA 1D3TB 4JLOA 2ZTYA 1Z0DA 3RXHA 3ZQ6A 4B3BA 1DVAH 2EWVA 4Q1BA 2D1JA 1YP9A 4B76A 1QL9A 1O3AA 3UIEA 1C9PA 1XPRA 1GDUA 421PA 2OG2A 4DCTA 2A32A 2BM1A 1IN5A 1GHBG 1BO6A 5DK1A 2A4GA 3GLGE 1FN8A 2QE7D 4OI0A 4DZZA 2PX3A 3FP6E 3X1XA 2BD2A 2QY0B 4YLGA 2ZSAA 4IC6A 1GBMA 1ELEE 4ESTE 2ZYVX 2ERYA 1FQJA 3ADCA 3KTAB 3NDBB 1AVGH 1C5OH 1A1RA 3HK6B 1DFPA 3QN7A 3SNHA 4NCIA 1KDOA 1UADA 3K6YA 2FESH 2BVXH 1DS6A 5ETXA 1GGDB 3K9GA 4ISOA 4UFDH 1IY2A 4PROA 4JZEH 1CQQA 4OQFA 1NJGA 1HXFH 4JLNA 1NVVR 1T4VH 1BKDR 2WJGA 2TGDA 4AKHA 2CCKA 2Y7ZA 4EPYA 4IVQA 3PENA 3ZJYA 4CRWB 2VIDA 4RCZA 3D65E 3TBKA 1KDRA 1HUTH 2GCHG 3CF6R 2GVDC 4ABAA 1KAGA 3M6AA 1KXFA 3U3OA 3BE4A 3GLFA 1XDBA 5JS7A 3GJ6A 1UVOA 3I62A 5FOTA 4RFVA 1ETSH 4NDZA 2BOHB 4AFZA 2FZZA 3V3MA 2QCYA 1TOMH 1GFIA 1P0SH 2LPRA 4DHEA 1E1QD 4EFNA 2N1BA 3Q7QA 3BD9A 3Q72A 2A0QB 1FPCH 1E9EA 4H4FA 4EQ6B 1BRAA 2OBLA 3BIVH 1RRGA 4NKRA 1Q31A 4X2XA 3B1VA 4F91B 2AWOA 4E05H 1IAQA 2O8MA 4HZUA 3CNOA 2YJTD 3GCNA 3OIUA 1DXPA 8KME2 5LPEA 1U94A 1D8TA 4B32A 1E96A 4BLOA 2C8WB 4X1RU 3T5DA 1SPJA 1E1QA 1OB5A 2GEVA 1D9ZA 2HJVA 1UTJA 1PLJA 3SOPA 3A7YA 4Q9LA 4GBMA 2WMNB 1GHWH 1Z6XA 1EASA 2V7QA 1GVLA 3NXPA 4CRDA 2W6JA 3UNSA 4URXR 5HCIA 4LBVA 1V2ST 1IAUA 3E0PB 5FTKA 2Z9IA 4NYIQ 3C7KA 3MFJA 2GAAA 1T8TA 2I3BA 4ILEA 1WAYB 4Q19A 1NN0A 3KB2A 1ARCA 6LPRA 5FUYA 1MD8A 4DSNA 1O2QA 3UQOA 3K1JA 1ZNYA 1O2OA 3HU2A 3T1OA 2C2HA 1JNYA 2OLKA 5G41A 3KKMA 1TA6A 2VIPA 1B0FA 1GBJA 1XD8A 1XF9A 2FWRA 2QRNA 5KYKA 1UEIA 4MNWA 4F38A 1AZ8A 4BASA 5A0FA 1O31A 1GI8B 1DWEH 2W5EA 1KDTA 2J3EA 4Q4JB 1FMJA 3AH8A 3IUYA 3BB1A 2G77B 2BYAX 4OS2A 2ZJBA 2QM8A 1AGJA 1HE1C 5JSZB 5DGJA 1KNXA 1E0SA 4D82A 1G16A 1XJ0A 2H1LA 4IJMA 1B7XB 1W4BA 5HE9A 1SXJA 4G3XA 1A46H 5CMXH 3L0SA 2XYAA 3CH4B 3SV8A 1NLFA 1IN4A 1OH7A 1OXVA 3DVLA 4HZIA 4ABYA 1W4RA 4GCHG 3ZS8A 2O52A 1GILA 1R0ZA 3I32A 3QG5A 1JBUH 1H8HD 4CT5A 3E3TA 2FFHA 3A36A 2XC0A 2DFNA 3ZIAA 2ZQ1A 4JK6A 4BAMB 4TZ0A 2Z3CA 2IS6A 1WBDA 2YWGA 1O2PA 2EC9H 1V5WA 2EEKA 1X8JA 4IOMA 4X2YA 4JBWA 3RXSA 1GJ6A 2J2UA 1F2TB 1US8A 2HYIC 5FTLA 1ELTA 1GHAF 2EI7A 2Y6TA 3ZVLA 1Y59T 4LHYA 1S1MA 1VCQA 1G3RA 1F2UA 2J4IA 4JMYA 3EXAA 2IXEA 1U8AA 2O8DB 2Q6TA 3Q5EA 7GCHG 2IN2A 3AF4A 2D2EA 3HWSA 3BXZA 1GBEA 3VR3A 1JIMA 4LV8B 2QF0A 3QQ5A 2Z6BD 4FVBA 1AKSB 3RRZA 2VSFA 2R65A 3ZD6A 4V0ME 2UKDA 4AYYB 2FE4A 1UTKA 3MU0A 1TL7C 1IQKA 1CA0B 1T8UA 2GT8A 1XTRA 1GI1A 3CNNA 4L9SA 3CRVA 4LX0A 3M4YA 3VNVA 1W0ZU 4RKEA 1QQ4A 2JDIA 4IS5A 3I4LA 2PLFA 3GY2A 1V3XA 4MKHA 1XRJA 3KCGH 4X2WA 2JLUA 1FIZA 2ZJYA 1V2QT 4ISIH 4JYUH 2ZSFA 4AKIA 1T5IA 1VCWA 2JETB 2FSIA 1P57B 1O30A 3SYNA 1TNDA 2AEIH 4CEJA 2ZJOA 1II8A 4NA8A 2GTPA 3SI4H 3SN6A 2GZ8A 3RNLA 1KJYA 3LGVA 2C99A 2HXYA 1QL7A 4B6EA 4JK5A 1AS3A 1VJ9U 2OTVA 3VQTA 3AGQA 1EZXC 1W3CA 5EG4A 2RHDA 1J16A 2FOHA 5EODA 4FU8A 4RFSA 1XU4A 4PTLA 2ORVA 1V2OT 2H16A 3GLHE 2N46A 1N6HA 2PUQH 1U90A 2ZROA 2GCNA 1G19A 5HYOA 3LIWA 1Z3IX 2P6NA 3MRSA 3DA9B 3O8RA 5DG6A 1EJAA 1X86B 4X8MA 4Q4LA 4HAWA 2IS1A 1Q1EA 4K81B 1RYFA 2W3IA 1HBTH 4OS7A 2VWLA 3AV0B 4M1WA 3LNCA 2PKAA 2XNDA 2DB3A 3ZVCA 3QK1A 3UANA 4IFBA 1GWNA 5I25A 1OXXK 3H86A 3TIUA 1DG3A 2UZIR 2ZNKH 3T29A 2ZUCA 3WNBA 2OILA 5K7RA 3LU9B 3LGIA 5CYPA 2ZETA 4KJZA 2ZU6A 1FZQA 4XFQA 4Q9IA 2QTFA 3NBZC 1XKAC 2R44A 5HTKA 3ZLJA 1VYUA 1ZIOA 2I1QA 1T0JB 1KI6B 4RN6A 1FPHH 1ZVQA 5DH9A 2BV3A 4MNYA 3P4YA 2CHAC 4P32A 1N6PA 2A5AA 2FMJA 4D9RA 4Z0KA 1C2LA 2ZE7A 5DI3B 2AGIX 3F3YA 4HSEA 3BERA 5EQQA 3AUXA 3AKYA 3MWIU 2FTMA 4X8VH 4HI0E 2P8OB 1GG6C 2AXNA 1ID5H 2PL3A 2GXQA 2ZTZA 2FS8A 1MO3A 4BZQA 4DVGA 1MKWK 3OIVA 2SNVA 3AF0A 3KKQA 1E0AA 3SQWA 4Q7YA 1HT2E 5DIFA 5FTNA 2OCPA 5B64A 3SDZA 2W6IA 3O8BA 4XTCS 2A7CA 2DE8A 1TUEA 3K0FA 1O3HA 5KSYA 1E2FA 3QIAA 1QRXA 2WAYA 5L30H 2HPQH 2BTCE 2EFHB 1DAHA 1J90A 4NG9H 1YCPK 1GHVH 5FBVB 1UKZA 1MR3F 1DICA 2RA0A 2WJYA 3KEEA 2AFQB 3QVVA 3RLYH 1XZQA 2WKQA 1LHCH 3VB7A 4BAQB 1TTTA 1ZP6A 3P32A 4EAQA 5DP6A 1N6XA 1NSTA 4IRUB 1VCMA 1A7SA 3ZS9A 3AVXA 3CLVA 2WWGA 4HLDA 4BAOB 3BWDD 2FLRH 2CL7X 1MH1A 4Y8XA 2A45B 3MWLA 3HDTA 4Q7XA 3A4MA 5C46F 4YDSA 3RXUA 4GHTA 1QHHA 3W90A 3LGUA 5EP3A 1XXDA 1ANDA 1KO4A 1N6NA 2J41A 3QKSB 1C5TA 3VX4A 3RXBA 3SJOA 2GJ9A 1V2WT 1EOJA 4B35A 5A8XA 1Z8IB 3ZZBA 4TLEA 2VP5A 4HATA 5DNYB 1Z63A 4KTCA 3KQBA 1YR8A 5G3ZA 2GEDA 3OEEA 3BTEE 3U6BA 1OH6A 1GBCA 4DJZB 5BRRE 1X7AC 3GYLB 3BTQE 4A8JC 1MMJN 1ZCBA 4JS0A 4EIWA 1P2OA 1YCPM 2IYRA 3P6ZB 1JECA 6ESTA 2Z94A 3UWJH 1C1MA 4WMFA 3LGTA 1UK4A 3WMFA 1E2NA 2NZ8A 1S0QA 5JBCS 2XC4A 5FPYA 2H5CA 4MGYR 3H1TA 3U61B 3GJ4A 2HV8A 4IEEA 2JJ8A 2FOCA 4C0LA 1T9HA 2J0UB 2ZHWH 3NXSA 3V12A 1FLEE 2QBYA 4NWLA 4MG3A 4TTRA 1MH0A 1TNGA 2TGAA 4IBLH 3NEYA 1E4VA 3RWOA 2GGVB 2EA3A 2ZM5A 3K65B 3SHAH 3LXXA 3IO5A 3MUFA 3RXLA 2ILNA 4BTIB 1ZTJA 1ZUNB 4UJ5A 1J17T 4THNH 1NN5A 3Q3YA 1CJUC 3C14C 1WP9A 1T5LA 2X8AA 4LPKA 2ZRMA 4F93B 2VP4A 3RXFA 2NOAA 4UNRA 3MG9A 4Y0ZE 1OWIA 1C5YB 1NI3A 1XVMA 4I1OA 3T62A 1Y3AA 1SGQE 4HLQB 1MABB 4Y79A 3ZD7A 2CHVA 4POAA 5DN6A 2V8OA 1IXZA 3MWKA 5HKKA 4RD3A 2V3HH 1NN6A 3BIUH 5HZHA 3U4QB 3NWUA 2NO0A 3PEYA 3DL0A 5H68A 1TMUH 1C1UH 2NO9A 1DARA 4CZ2A 2AN9A 2QI9C 4NTZA 3QXSA 4A1TA 4YO9A 3D49H 1FX0B 4NP6A 3NUMA 3CH5A 4H42U 1WF3A 2ZU3A 2A5KA 2VHUA 1QVAA 1G2MA 3M7UA 3K0CC 4L15A 2YINC 4YZUA 5FBWB 4ASUA 1TNLA 2NGRA 1O5GH 2IT1A 2J94A 1KO8A 5LPRA 1ZMNA 1SLUB 3OESA 3H7OA 3BEUA 1J8YF 4V0OA 1P3JA 2GZ9A 4ABHA 2BBTA 2ZXUA 5SZHB 1GI7B 1W7GH 5EUMA 4DC9A 3EA9A 3M5NA 4FMCF 4E7RG 4UJ3A 3FANA 2Y7XA 2J34A 1BTUA 4Q02A 3TPIZ 1OKKA 4QBIA 1SULA 1K1JA 1XD2A 1PV4A 2GV6A 2ZRPA 3QE0A 4MPWA 3FVFB 2ZYTX 2OO7A 1PQ8A 3IEUA 2C95A 5B6LA 3CS7A 2PTNA 3BOSA 5DYIA 4BGDA 3SBKA 3TAHA 3DPUA 1ZMJA 3G5UA 1M74A 1EPTA 3C5CA 1PJRA 1BBRH 2HNTE 4C7OA 3TJUA 2IL1A 4I81A 5B58C 2I4IA 2BLWA 4IFEA 1XJQA 3QOFA 2OCVB 4ZI3A 1Q22A 1DOJA 2RCEA 2G1KA 1BIFA 1FFHA 5TXGA 4B2BA 4ITRC 3GEEA 2FI5E 3E90B 5FPTA 1GSIA 4NCKA 2TRMA 3FMFA 2WV5A 2OEPA 1SSXA 2F43B 2GDJA 1GI5A 3CPJB 4GZMA 1I4DD 4QHSA 1FP7A 4GCHF 1G1MA 1LVMA 2ZQ5A 4B2IA 3UMSA 2JAQA 3N2IA 2A7HA 1KZ7B 3CRQA 4PSVA 2AGGX 5CDFA 5FBQB 3WP1B 3IIMA 4GP7A 1ELOA 4WXPA 1KSJA 2GCOA 2G3YA 3GCHC 4QGAA 5ELXA 3LDAA 1KI3A 6GCHF 5J4QA 4DG4A 3URDA 4ISLA 3MH4A 4KFUA 1U98A 1FZZA 3RXJA 4JLDA 2C04A 2PCJA 6CHAB 1FY3A 1LKAA 1MRSA 3GDVA 1MTNC 2CXXA 1S9HA 4Y7AA 3GCGA 1OP8A 4ESHA 1HV7A 1K2I1 2C9YA 1P62B 1E2DA 3VB3A 2QGZA 2QEQA 3SI7A 2BMFA 3M5MA 3SORA 5GJBA 4MTBA 3PEVA 2FI4E 4M2LA 2VU8E 1TU3A 1ELBA 2O8EB 3GDSA 1EAXA 3S7HB 3LFUA 3ONWA 4NCJA 2F9LA 3T26A 3THYB 4HAVA 5EP4A 1AKSA 2OQ5A 3FWYA 3PUYA 4D26A 2F1HA 3MO3A 1KMQA 3SU8A 5T6GA 1GJ9B 1ZJDA 1NROH 3CONA 8LPRA 1OXGA 2G6BA 4LI0A 1PYTC 4BUJA 1RTKA 1JQJC 1TMKA 5CIWA 2P95A 4PZLA 1T6NA 3QF4B 3WY9A 3CKLA 5EE5B 4PFSA 3NBYC 2B6HA 4LDJA 4WWYA 2XSZD 3KQDA 2OBOA 1JRSA 4PC7A 1W12U 4ZH8A 4XD7D 1D9IA 1VDZA 3IPYA 1Z1IA 1OOKB 3SJAA 1EZQA 2FIRH 1GBDA 1EFRA 5G53C 1CJTC 1HAZB 1QRWA 1ZZZA 1Z83A 3A7VA 5H4IB 3WNDA 1AKYA 2O5VA 1SLXB 4TYNA 4K1EA 4X8TH 4KITB 4WMEA 3I1FA 3ZH9B 1CGHA 2ZU2A 1IOEA 4N3NA 2XTNA 3A85A 5DN6D 1BBRK 3LJOA 2CK3A 3QUMP 4RZ3A 1GHBF 4HAUA 1WQ1R 8ESTE 1AQYA 4ISNA 1MCVA 1ETUA 1AUTC 5KOYA 3VX3A 3LX8A 5CJPA 3EAJA 3PO1B 1P9NA 4D4MA 2Q3MA 1U9IA 4M22A 2QXGA 4PHFA 2UVQA 1CHOF 2QSYA 3SU2A 3V4FA 2Z4RA 1E9SA 1E0KA 2Z9LA 2B7CA 1IQIA 5CB8A 1SVPA 4DEYA 1ZU4A 3P17H 4LK4A 2IYWA 3VB4A 2QGNA 1G20E 5AUOB 2FZ4A 4LHVA 4YQFA 5JHHB 2IS2A 2YVUA 3DM9B 4PHHA 4JL8A 1D2NA 3ZVBA 1O34A 2XNSA 1UTQA 1ZYUA 5L3QB 3FHCB 1G9XA 5G4BA 1E79D 5HR5A 2WKPA 3VR5A 2ZVQX 3TVJB 2ZGJA 4JLBA 2HT6A 1A82A 3CX7A 1O5DH 1F48A 4V0NA 1G3DA 3R8FA 1FW6A 3K9LA 4SGAE 1H8HA 4JBXA 4KHZA 1E32A 3RS2A 4YTAA 3EDXB 1JPNA 3T25A 4BTUB 2SHKA 4OYHA 1CGIE 1A3BH 2XOKA 2UWLA 1XBTA 1BBRE 3PV4A 1X6VA 5F9FA 1TEVA 3PG5A 1WRBA 4NSVA 1K21H 2YV5A 4JZFH 4LGMA 2HWLB 2GHIA 2IYUA 5EOKA 2XITA 4JL5A 5G3YA 1PUJA 3GJ5A 3TK5A 4CDGA 2O8EA 4JMPA 2XRCA 4Q1EA 1OXTA 1SKYE 1N5KA 4AKEA 2CLSA 2XJ9A 1MTSA 2QC2A 4JKYA 3IEVA 1NM6A 2RGBA 4HI3A 1THRH 1XD9A 1Z0AA 1SXJC 3QDZB 1GPZA 2WPMS 3OF5A 1E4YA 2ZGHA 1W13U 2GZHA 1GKYA 4IDNA 1YJ5A 3KJHA 2RGCA 4RD0A 3RU4E 5TCAA 4GSOA 3U7HB 3B8JA 1MT0A 1N6RA 3QKRB 3ND8A 4QFMA 1WCZA 3B1ZA 4IOJA 1AU8A 1G37A 3EA8A 3UUZA 1F2UB 4BTTB 3B9QA 4M1TA 2BD4A 2R6AA 3I8SA 4Q4AA 2QPTA 3FE2A 3K70D 1E2GA 2Y5GA 2W6ID 2ZI3A 3LJJA 4Y11E 1YKTA 4I8HA 2VIVA 5JCZA 1TF2A 2YC4C 1K5DA 2WWYA 4D8NA 1PPZA 1F2SE 1KK2A 2MSCB 5C4GB 4K69A 4IN2A 1RC8A 4YT6H 4FCVA 4YLQH 3EASA 1EB2A 5EQSA 3NKVA 1O3BA 5AUPB 2WPKS 2LWIA 1Q3XA 4Q2KA 1YZQA 2Q6DA 1P2SA 2V1XA 1Y3XA 2PFEA 1NFXA 4GFDA 3TH5A 1L8QA 4KELA 1EJNA 1N6YA 4IC5A 2YWEA 3BH0A 1XVOA 5TV2A 1QHGA 2ZFQH 2ZEJA 2FX3A 4JLPA 1NU9A 1Q1ZA 4FUDA 3UQVA 1SQ5A 5FOSA 221PA 2GCHF 4LJ8A 3DO6A 2WUCA 2R2WU 1GTVA 4GLYA 1L7VC 3TJZA 1ZNZA 2F55A 3TJVA 1AO5A 1D2MA 1W5SA 2AFHE 3KJIA 1JMOH 2BBWA 1SVLA 1Z2CA 4NCYA 2J9NA 1J15A 4N0EA 2FX6A 2VPPA 5GVRA 4Q80A 5AR1A 4A6XA 1C5WB 2JH0D 2SGDE 4QGHA 2YOLA 4I31A 1GHAG 1J7KA 1IHSH 5BYJA 3VR6A 1ZC4A 4KP0A 4ZDWA 2G1JA 4OI4A 1C5XB 4ZXYH 1LW7A 2J0UA 2OXCA 1N5JA 1MO4A 2QBYB 3AVPA 2IHYA 4DT1A 3TR0A 1G5TA 2ZHQH 4GSYA 2QMHA 2A78A 1LPZB 3HU1A 2CK3D 4HUQA 4DDUA 2BCJQ 3MMPA 5TDHA 3MYWA 4TPIZ 4FMDF 3X1YA 1F0RA 1Z28A 7ESTE 2AK3A 3B5JA 1L0ZA 1WUNH 1E0JA 2JKHA 1OFIA 3K70B 4V0MA 2A7QA 2B0FA 4C0QC 1VITF 1NVUQ 1C2IA 5TARA 3KFVA 2C9CA 5A4JA 1EESA 1R0YA 2O8UA 1E1RA 5FAHA 4M9XA 2CXVA 4OK5A 1GRQA 1P72A 1OJLA 1R5OA 1E2EA 1FTNA 2NU0E 5C1XA 2VIOA 2RHMA 2ZE6A 4PPQA 1EK0A 2ZS8A 2CE7A 4L4UA 5JJIA 2V9PA 4Q03A 1TNKA 2ANKH 1DDJA 2VP0A 4GOXA 3AVWA 4HGCA 5DP3A 1R2QA 2ZFPH 4JLJA 1EJMA 1H8DH 2RA3A 3T2NA 3TW4A 5JEEA 4CBOA 1X8LA 4Z8YA 2OM2A 1EP6A 2MSDB 4Q4AB 3R20A 1Q0UA 1YZGA 2NU3E 4LZ1H 2VQSA 2BIFA 2ZJ2A 2FPKA 5DI3A 2HNTF 4NE2A 1AWFH 1B23P 4BZXA 2ZFSA 2ZDLA 1MTNB 2AMDA 1O2ZA 1R8QA 1SQOA 4XVQA 4Q1CA 5JEDA 1E9AA 5C4MA 4IN1A 4A8JA 1LVYA 3RC6A 1ELGA 3TH3H 3PWBA 4URVR 2ZDVH 4E03A 1GKUB 4TL7A 4RD2A 121PA 4Q9HA 3NH9A 3SE0A 2CCGA 3RXTA 3LW8A 3QI2A 1E2HA 1TNIA 5TY0A 2G5VA 5SZKB 4OBEA 4LY6A 4GAWA 3MJRA 1Z07A 3BIFA 5EXSA 4JVSB 4YLUA 3DMDA 1YE8A 3GLGB 1K1MA 1W10U 1FOEB 3GYMA 1UBEA 3D23A 4JLVA 3S9AA 3H2YA 2VJ1A 1PJPA 3W8RA 2KSQA 2K1QA 1KOFA 2HYDA 3RM0H 1FJSA 1AGRA 3V0XA 2QN5T 1EZUC 2ZU1A 4WVPE 4AWXA 1MU8B 2F1RA 1VCNA 3CP7A 1YPJH 2QY9A 3A7ZA 1R10A 2CF9H 3I3SR 1C1QA 3SJ8A 1YZTA 3TUJC 4JVLA 1V2NT 2CJWA 3SYLA 1GCTB 3BTFE 3L6PA 4M21A 3MH6A 2ZCHP 3KIDU 4K3JA 1DE0A 3HGPA 1CR1A 4DRZA 3A88A 3EZ6A 2BLVA 3WYAA 4KFRA 1T4GA 2L0XA 1O2KA 2OZEA 1ZM4A 4OJKA 3QF7A 4WA7A 5HCNA 3TUIC 5BXQC 3GCTG 1ABIH 3SV6A 4D7GA 3Q77A 4DLYA 3DUXH 2BDYA 1NLZA 4HDOB 1TRYA 4C4PA 4I33A 3X1WA 4KU4A 3CM0A 5JJLA 3C16C 5GPIB 4HUQB 4URZR 3TGJE 1YC0A 3IG6B 1FTSA 2V1UA 3GJ8A 1P9UA 5ABWA 3ZZ4A 2ORIA 3F9FA 5JSZA 2QPOA 1GNRA 1LVGA 4TLCA 3L2OB 4X8UH 4QXAA 1D6JA 5TCCA 1LS6A 1HJAC 4INHA 3E70C 5KSOA 4BFVA 4KBFA 4TSFA 4F4CA 2C4FH 3RXCA 3CF0A 3IIKA 2FA9A 2QU8A 3EIQA 1T3LA 1HCGA 1W1WA 5IDVA 3HP1A 1UTPA 2PMKA 2BVRH 1C2FA 1HUQA 2XEXA 1O33A 4A0HA 4DLRA 1M34E 3QEOA 3QF4A 3K9HA 1X3SA 1SGRE 2ZE5A 1GBTA 1TF7A 5HKKD 1JWTA 3FKQA 3M5OA 1K6MA 2QTVB 4ZUHA 4TSFD 4LJAA 1O3OA 3LKWA 1NU7B 3BG4C 4CRAA 1NN3A 1S3SA 1S8FA 2ZG0H 3JVUA 1V2RT 3SO3A 3NVAA 3I72A 3B1XA 1B0EA 3A37A 3PEWA 2Z9JA 1DT2A 2VVCA 4E06H 2ZTXA 1E2IA 5JJKA 4OKSA 1QBKC 3I5XA 2DBYA 2IWRA 5LPFA 2IX3A 1ZLRA 3B8HA 2P0EA 2VP2A 4NIWA 1WDTA 3TQFA 1HEIA 4KV9A 3ICEA 5EXNA 3ZZ6A 3KFXA 1TABE 1RGQA 3GY6A 1DSUA 2PZEA 3A7TA 1HT1E 3F68H 1ARBA 4YXWD 1F92A 5DHAA 4OL0A 1ZM3A 1U81A 4KVGA 4JJKA 2PV9B 4GDFA 1EZSC 4Q4JA 4HLUA 1SR5C 1LY1A 2JASA 4BANB 3SQHE 1O3DA 1RVDA 1N8OC 4TTQA 3R9WA 1NRQH 5JBQA 1QHXA 1BJVA 3W6OA 1A7JA 1CULC 2Z3EA 4NSYA 1EFCA 1AZTA 4XWKA 3M3TA 2PTCE 3ATIA 2ZRLA 2FXRA 1E3MA 1II8B 4AYTA 1ORFA 1TGNA 4D6PA 3T12A 1NZQH 2GXUA 2W2VA 1Z08A 4FUBA 2Z0MA 1RTLA 3DHKH 3I5YA 3G01A 2KWIA 1H9LB 2ZRNA 1HAVA 1K5GA 2AFIE 3RXRA 2B21A 1CEEA 1KIMA 1G8FA 2FI3E 4Z1MD 1KKLA 1P02A 4Y8YA 1CTQA 2FOAA 1S6FA 2WJVA 1P6XA 4MPXA 2A30A 3RXPA 3A89A 1TONA 3A1SA 5AHGH 1K8RA 4BAHB 2GT7A 3VAAA 3ODDA 3X1DA 4I8LA 2ZIAA 1HQYE 4US0R 4NYJR 1O3GA 3P8NA 3U8TH 5GCHG 2IXGA 2J0QA 2GETA 2ZJ8A 1XXHA 3L0OA 1SQAA 2O8DA 3M37A 1VKJA 2XZLA 1OFTA 1TRNA 4AKGA 3EE0B 2ONKA 2A3RA 4ZIRB 4PPNA 1R0XA 1DAIA 1O35A 2IPHA 5JBTA 3HKIB 1QA7A 3MHWU 1HYLA 2ZHEH 7KMEH 2WIAA 2ZCKP 2GJSA 1ZNXA 4X1NU 1O2MA 4IXNA 5T6DA 1NRJB 3U44A 4DSTA 2VBCA 2GMTB 4FUIA 2HRVA 1H9HE 1NG9A 4X8OA 2JH6D 5FUVA 4R0IA 1V2MT 1ZU5A 2GV7A 3LBIA 4MYCA 1D2EA 1GBIA 3U8OH 4AYVB 3U7EB 1P2JA 1QRAA 4ABFA 2CNWD 1G21E 3EQ0H 5FBIA 4AIIA 3LQRA 2GBLC 3ICQB 1XMJA 3CX6A 1Z6YA 5FI1B 4O97A 1AWHB 1ZD8A 2Q9BA 5CHAB 1QHYA 3ATLA 1GI3A 3PVSA 4JT4A 1E0FD 1AKEA 2B8OH 2PT7A 3VKWA 1ZTKA 2BD8A 1BYUA 1C2JA 5AVDA 1TYNA 4HDCA 1W0YH 3TITA 2CF8H 4OHZA 1W47A 4GOJA 4CREA 1D9XA 4N1AA 3ZZDA 1MCTA 3U1IB 1Z2AA 2ZP0H 1CJKC 3DT0H 3LY5A 1DS2E 4I8JA 3BB3A 4RVCA 3TVTA 1AQ7A 2DPXA 3C1KA 2PEYA 1XUFA 2EVWX 1ZD9A 1OYQA 1UMAH 3SJCA 1IHTH 1EFTA 5JBAS 3NHAA 2Z43A 5GCHF 4JLKA 4ZKRU 2K5UA 4Z54A 1AY6H 1WQSA 3H09A 3A8TA 1XPOA 1O5BB 1W36C 1A61H 4F49A 1NY5A 1TLDA 4ERNA 1QJ7B 4ZHMU 1M7GA 4UD9H 4RD6A 3TJOA 4X6NA 4TY7A 2V4ZA 4M7GA 4X8LA 4DIHH 2ZSDA 5CLQA 1L4YA 3RHFA 5C5NA 1IXSB 2GD4B 5A5GA 2BQWB 3ZZ5A 1G36A 4FI3C 1ZUIA 4NYMQ 2G51A 1H8IH 5L3SA 1NPMA 3AEZA 4Q7MB 1XUKA 3UOUA 3PUXA 5CDFE 3DMNA 2IYXA 1FV9A 3PYHA 1IJEA 3LRPA 3RS5A 5GJ4B 2GDDA 1I2DA 1XCGB 2NQ2C 2ZZUH 2C78A 1E98A 2BOKA 5EXPA 3ATWA 1NMZA 3QUSA 1IQPA 4TQ9A 3TSOA 4AFQA 5C2ZA 1Q21A 3FVQA 4GT1A 2BM2A 3LH5A 4ZIRA 3GLFB 4B2PA 2XWBI 4FWTA 3U3JA 4KVAA 4DLZA 1HAIH 3N2EA 3ZZ8A 2QXIA 2BOVA 3KUDA 3EX7C 5T3HA 1SLWB 1G41A 3LBHA 4MKFA 5K8TA 3SHFA 1DEKA 4B73A 5AJVB 4DCDA 1OFUX 2XW9A 1A0LA 4NZYA 4G5OA 2BCGY 3W94A 2BEJA 2BX3A 1YPEH 1UAAA 2GXAA 4A5TS 1TPOA 1WV7H 1TAWA 1CR0A 2Q1JA 3AF3A 1C2DA 1HLTH 3SBEA 2WWFA 2QM7A 1KXDA 4RJLA 1ZSKA 5GJWC 4BAKB 5EW2H 1ZMXA 4D2IA 4Y10E 3KXKA 4EPTA 4P33A 1S9DA 1O2IA 2XB2A 3BTDE 3FMOB 4ZMAH 4NA7A 4DLWA 5BQ5A 3HYRA 3TLXA 3KB1A 3ADKA 1O2XA 2X1VA 4JYBA 5DO4H 3NBFA 5DP8A 4DCSA 1S0UA 4K8BA 5LB2A 2D7CA 5DP7A 2W3KA 4CRGA 4AB9A 1MO6A 4H1VA 3RS4A 5K8UA 3IHLA 1SKQA 4AFUA 1C5QA 3LH3A 1UJ1A 1JJVA 1QZXA 1SGTA 3GLGA 3ZZTA 4AYXA 3UNQA 4I4LA 1SB1H 3RLFA 1KXCA 5SZJA 2Q3HA 4D80A 2HALA 2QXHA 3GCOA 4ABJA 3V9PA 3SQEE 2Y5FA 4H9GA 5HXFA 4ZDKA 4OM9A 4U00A 1FNNA 3E1SA 2ZU5A 5HMAA 2WPHS 2G83A 2QORA 3ND9A 3L33A 3W5JA 4DVAU 3HJNA 2F4LA 4HB4A 1V2JT 3FP7E 1MU6B 3TJNA 3R9IA 2JATA 1TOCB 2D4HA 3GJ0A 4Q66C 3GICB 4XBDA 4X6MA 5CLLA 1FAKH 3QVUA 1QL8A 3RS7A 1NTPA 4DB4A 1KI8A 1ABJH 3QZQA 1VHLA 3ZYEA 2HUPA 1DPOA 3RRMA 2TIOA 1XUJA 5GNDA 1ZD1A 2FP7B 1H65A 2PW8H 3A1WA 5PTPA 2VO1A 4RCYA 3GLIB 3K0CA 2WV4A 3TK1A 2GJAA 2GJKA 2Y8EA 2GVFA 5B2ZA 1GJ7B 2OT3B 2W2TA 2WJHA 1FY5A 2W6JD 1ELAA 1G7CA 1L4DA 3P27A 3CUEF 2IW3A 3BBPA 4TQUS 1HFDA 1C1WH 1VITG 5EU8A 4LJ4A 5CJ2A 3QWCH 2OCBA 2W0SA 4JIMA 2VINA 4NCNA 3W9YA 1U99A 4LYAA 4GL2A 2A5JA 3MTYA 4RD4A 4KLZA 3RANA 1GG6B 1FUUA 4ZCMA 1LHGH 4B47A 5C67A 1OFHA 4Z8XA 1ZYOA 1LB1B 2D62A 3OZXA 2F1JA 2A2QH 2XC5A 3KQCA 3SJ9A 2ZEBA 4OQMA 3HPQA 1MABA 2BVNA 1IN8A 1PPGE 2ZU0C 4EUNA 1HXEH 2A5IA 1JR3E 2IS4A 1NY6A 3B6EA 3RXKA 3ASYA 1FMLA 3CR8A 1FXYA 3TIFA 2GCPA 4TLAA 2ZDMA 1G6OA 1BMLA 3U3RA 4PXAA 3B2EA 1U0HC 3EA7A 4Y0YE 4PHGA 3Q3XA 1A2KC 2ZRIA 3RYTC 1CBWB 1WXQA 1ANKA 2V55B 3EC2A 4CYMA 1NNEA 4GOKA 3I78A 4ASUD 1HAHH 4KGAA 1T3SA 2F9BH 2Q9AA 1MOZA 1OWDA 2GF0A 4TMWA 1ANBA 2AKAB 2JCSA 3ELAH 4LJ6A 4HB3A 1KAOA 1FAXA 2GRJA 1GMHF 3EZFA 1F60A 2C03A 1Z6GA 4I8KA 4QKQA 1DY8A 2Q0HA 2VLIA 4W5JA 1LF0A 5UKDA 4BFXA 4LBZA 3TGIE 2FDCA 4PC3A 4OI2A 1EXMA 3H84A 1GBHA 3U5ZB 5CITA 1XTKA 4X1PU 4Y0VA 2G81E 1XM1A 1ZRKA 4JYVH 2E9SA 1TX4B 2VRWA 3V4RA 4EPWA 4XBBA 1DADA 3U98H 2WWWA 2Q6GA 1G4UR 2ZKSA 1NG1A 4AC9A 1UTNA 1X8KA 2ZJ5A 1EX3A 4QBFA 2Z6VA 2KJQA 3GFPA 3VKHA 4JCNA 1AUJA 4A2PA 2VIIA 5JHGB 4V02A 1XXFA 1Z8RA 1RRPA 3BFVA 2LCFA 2F7SA 3RMOH 3SC3A 3BFKA 4MITA 1Q44A 1RXPA 2H57A 2ZTSA 5KPJA 4UXHA 3FMIA 1EGAA 5CHAC 1Y5UT 4LJ7A 4MRRA 1TGCA 4ZKEA 1CF4A 3RXIA 2BDBA 1O3YA 1E34B 5AUNB 3BTHE 621PA 3LONA 4I8GA 4JLAA 5HE8A 4AY2A 1O3LA 4GNKA 1GRRA 3DHWC 2O0HA 3O8CA 4A36A 1P75A 2ZAMA 3OAAD 2ZR0A 1BITA 1HIAB 3CB4A 4LPSA 1OKKD 3HKJB 3EWAA 5TVKA 1W2HA 4PAQA 2QAAA 5L3RA 3TK9A 1BS1A 4A7IB 1OP0A 5TJXA 2CJWB 2EWWA 3SYKA 4BFTA 1RFNA 2V6NA 1GL0E 1XMNB 4M1KA 4QNMA 1G32B 1O3FA 4GUXA 1NN1A 5L8VA 2EI6A 2IJOB 1AIXH 4X6PA 3KHVA 2VHCA 4LSGA 2XBYA 3FZZA 2RGDA 4NZLA 1KY2A 1ACBE 1RZ3A 4C2UA 4UEHH 2JJ1D 2W00A 5A0BA 5AJZA 5KHOC 1NMYA 2KI5A 1OLOA 5DP9A 2LKDA 3PV2A 1L4UA 1GL9B 4R98A 2Z83A 1G7TA 3M0EA 1FNIA 1M9UA 4IKEA 1GL1A 3U8RH 1BA8B 1YBWA 1UDWA 2J87A 5JCPA 5KUTA 3H5CB 3TGKE 3GEIA 4A82A 1PPCE 3D6TB 2EU8A 4XH9B 2QAGC 4PAMA 3EPJA 1GVZA 3T61A 2ZA5A 3DFLA 3SEAA 3EZ2A 2F3TA 1C2GA 3W3ZB 1DOAA 3BS4A 5EXMA 1UK3A 2QZ4A 3WRXC 1YF4A 2AD5A 4BPBA 4AX9H 2NO7A 2WWIA 2IYZA 4L16A 2WWHA 5C1UA 1C5VA 1WCV1 2ZRBA 4CIDA 2VGCB 2WKRA 1ZHRA 1GP2A 4DKXA 1IY0A 5J4VA 2JLRA 5FPHA 2OC1A 3VB5A 3UG7A 1GBBA 1E69A 5C5OA 5KDOA 1TF5A 2ANBA 2AIPA 1UKEA 4Q01A 4J1YA 5E0GA 4X8HA 1TWXB 4LBWA 5E7IA 2ZRGA 2XBWA 3HGNA 1KO7A 1B5GH 3KNXA 2QP9X 1XEXB 2ZDAH 4YOIA 4I7YH 6CHAC 2BDGA 5IF9A 2I1VB 1THPB 3Q7PA 2IUUA 4CR5A 4NIYA 1TALA 3AAVA 4B74A 3M7TA 2ZI9A 3P1JA 4Q7LA 1KJZA 5FHTA 1J70A 5L6NH 3WRYC 3CENA 4TMKA 1SOTA 1CA0C 1S4QA 5C2JB 1ELCA 2REXB 4NL4H 1U9IC 3A8AA 4WIAA 2F6RA 5LDDC 2QXJA 4PSAA 4X8SH 1DAEA 2YOHA 3REGA 1T8MA 3K9XB 2VF8A 1IJFA 1XEWX 5J5CA 4JZ1A 4CEJB 3VR4A 3AVYA 1QJ6B 1VHTA 3PCRB 2C98A 2VSXA 4PQFA 1G3UA 2ZR9A 2REOA 3IILA 2Y81A 4CRCA 4FINA 4AG2A 1CO7E 2ZI5A 3T1TA 1JJ7A 1NSFA 1RRCA 1ZNWA 2FOLA 2XTTB 2VHTA 5L3SB 2H8KA 2IEYA 5JS8A 1DWCH 2ORWA 5AFYH 3OIYA 4WXVA 1UBCA 2XCNA 2BLOA 3AASA 4K2YA 4HUTA 1KXEA 1Z71A 3SV9A 2Y5HA 3VFEA 1TX6A 4EJSA 1G3IA 1GI9B 2ZRHA 4D4JA 3THWA 3E6PH 1G7RA 4LYHA 5G40A 2O0KA 3C41J 1C5SA 1YR9A 5EXXA 1OS8A 3Q85A 2JGNA 4R9UC 1E9DA 4LJ5A 4Y7BA 4JSYA 3LBNA 3KQHA 2ZYUX 1NRPH 2HCBA 3EC1A 1B0UA 4LOYH 1C1NA 4PC6A 1KZGB 4A6LA 2VWNA 2NWNA 1H4WA 2VA8A 2R3YA 3EIHA 2H9HA 3ZVAA 1GMCG 3K70C 4YOJA 1E35B 1UVSH 1Z29A 2J95A 2SGPE 2V3CC 4CEHA 1Y3VA 1GDDA 1D6WA 2RDLA 1KTVA 2FWWA 1JXPA 3QKRA 1NVWQ 4QNRA 1GOTA 2JETC 3BRWD 4FUHA 1M7BA 1FDPA 5EUQB 3T06B 4QGGA 3CZPA 4BFUA 4Y76A 2R6GA 4Q00A 2QENA 4BLTA 1DWBH 3S9BA 1LKBA 1IONA 3M35A 5LGOA 1SVWA 4K60A 1SKYB 3TVDA 3VR2A 1G2LA 4D81A 1C5MD 1KDQB 2IYTA 1XEWY 2P3TB 5FOUA 3RXMA 3UG6A 3LVRE 2YOGA 2QV1A 3BH6A 4ZO4A 3R3GB 3M1IA 2IEZA 1VITH 1UM8A 4AOQA 1S81A 1BHXF 4A2WA 4AI6A 2ZGBH 4S35A 3BF6H 1AN1E 1OX1A 3PO1C 1E37B 3E5HA 2BDTA 1AGPA 4BEJA 1PFXC 1G7SA 1LVBA 2IC5A 2Z3DA 3BTKE 1PUIA 3UWIA 1PZNA 4B2CA 2ODYB 2GILA 1TRMA 2ZS9A 2ZFTA 1DM4B 4LK2A 3PMJA 4WJG2 5ANRB 4DUGA 5AJXA 4I32A 3SJZA 5JFGA 1K1LA 3MU8A 2AK2A 1Z0JA 3K0FB 4F4IA 1LO6A 1IQJA 1MQ6A 2F9UA 2TGPZ 5DYGA 1XX6A 2R8RA 3ESTA 5L3VA 2PUXB 3K09A 4DBLC 3K2UA 2ANYA 4R2IA 2J59A 1P3CA 2AWNA 5BWMA 5FPSA 4KSCA 1KYIA 3LC3A 3BN9A 4LOAA 1S3GA 2BMGB 1QIXB 1UVPA 1YLDA 4XOJA 1BMNH 3PFIA 2PSYA 1COWD 1PLKA 3A87A 3GEHA 1XPUA 3K53A 1UEJA 1IHUA 1HTWA 5DP4A 4RD1A 2OBQA 2NU4E 4DIIH 4NONA 5DO9A 2W7SA 1O3IA 1V2LT 1KHTA 1UVUH 1P05A 4HB2A 3RP2A 2QAJA 1TQDA 2IYLD 4PANA 2NIPA 4IDOA 1QHHB 4ZHAA 2YWFA 2XBXA 1HQCA 1KO1A 1OH5A 3A7WA 1Z8GA 3QKSA 4B3CA 4X1QU 3K0EA 1ZM7A 3EIEA 4DGJA 5CYOA 3SNAA 3LV8A 3PXGA 4U02A 3QZRA 4FCWA 4UKDA 2VF7A 1EWQA 4MDSA 1EG7A 3GY5A 2PLXA 3B23B 3VB6A 2OINA 2Q6FA 1V43A 1W4CA 2GDEH 1AVWA 2KBEA 2R3UA 2GWHA 5FR2A 4Q5IA 1UHBB 2TBSA 1E99A 5DE3A 4MGKR 3SN8A 1MZAA 2BY8X 1CSOE 1LMWB 1UJ2A 2ZRKA 2FSFA 4CHAC 3ZZ3A 1BMFA 2LNCA 3FGNA 1S1CA 4B71A 2C3SA 1BTHH 4OQXA 1TIOA 2VIWA 4RZ2A 3AUYA 4U2WA 3L82B 5KDDA 2DWPA 1ZHMA 3NWJA 4O2LA 1GI4A 1O2HA 1OH8A 1IOZA 1GL7A 2GAOA 3Q5DA 2F9OA 4WF8A 1NRRH 3NKKA 3CNLA 1CIPA 2YNBA 2OAQ1 4GP6A 2RCNA 3CO5A 1QBNA 2XB4A 3TH4H 3RVBA 1XEFA 2H92A 1QQUA 4E5UA 2ZRDA 1I4LD 1V2KT 1ZCAA 1C1TA 2VP9A 3B9PA 1K1OA 1MKXH 4DCNA 1G30B 5F8TA 2ZFFH 1QB9A 4XWOA 2GA8A 2IUSA 2VSOA 2JLXA 1HY3A 2J1LA 3DOFA 3UNRA 5ESTE 4OK3A 3KXLA 5M04A 3N5CA 5FBRB 5K8LA 1FX0A 2P6RA 3E8LA 4O25A 4B75A 4MPUA 4JT2A 1G3EA 2PR3A 2JDID 1JRTA 4PSKA 4D0GA 4ZDIA 4KCGA 4MUAA 1XFAA 4DWJA 3LO5A 2ZPSA 3UFAA 1KY3A 1EX7A 2TGTA 1R6BX 3PV0A 1E6CA 4DLUA 4PQYA 1HJ9A 3E1XB 1C4Y2 4WAUA 2P6UA 2ERXA 1G18A 4QRHA 1IQGA 1P8VC 2RB4A 1ELDE 1Y8TA 1BOQA 2V0BA 4D0LB 2J0SA 5FOWA 1AVXA 2PLRA 1D4PB 2JLZA 3AVVA 2IHBA 3UR9A 3ATKA 4RKFA 3A1UA 1SHZA 2F9MA 1XZPA 1P61B 3GCHB 2HT1A 1AFEH 2QROA 1SVOA 2E87A 2A4OA 1IQFA 1BH2A 1OWKA 1E38B 4GMDA 2STAE 3NEJA 1U2RA 4R2HA 1VYVA 2XOKD 3AVZA 1UKVY 2ZFRH 1P09A 1VIYA 5FCRA 2BBSA 4JYCA 3CBQA 5A8YA 2NU2E 4U5XA 1G8PA 4YXWA 1RPZA 2ZI6A 4HAZA 3U2QA 2Z9KA 3OTJE 2VWOA 2QG6A 1QHNA 5DPAA 1AE8H 1VIAA 1KI4A 2B92A 1GL6A 3DEFA 2DWQA 3AAUA 1V2TT 2QRZA 4ON9A 1UBFA 1GJAB 2XXAB 3PUZA 5T1VA 1QGFA 3EARA 1E2LA 1LQEA 1UTLM 4NU0A 2BY5X 1Z6TA 2ALVA 3EYDA 2OP9A 3OYPA 4BEBA 3A7XA 2AHOA 2BM0A 4MVNA 3GY7A 3WXMA 5F2EA 2IYVA 3MGCA 1SLVB 2P59A 4EDHA 1EAIA 3KGPA 3PITA 2A1DB 3A83A 3SFZA 2ZDNA 4LJ9A 1C1PA 1YPGH 1C2MA 1TADA 2ZDKA 2FH5B 2BVSH 1XB2A 3F9HA 3ADBA 2AD1A 1P2KA 3NTUA 4ABDA 3AVUA 3THYA 2ONJA 5BYKA 1NP6A 4FMBB 1UBGA 4DSUA 1GNQA 3U60B 4NIXA 4Q21A 2QA9E 4KYIB 1PPEE 4EPVA 2JEOA 5EPNA 1GDNA 2ZI2H 1R5BA 3EA5A 1K1NA 4ISHH 4ZKSU 1R8SA 3SUEA 3Q3KA 4B44A 5C1YA 3K6ZA 2OUKA 1ESBA 1NT1A 2BXTH 1C4OA 4ACAA 4D9QA 1T8NA 3BEIB 2Z5FA 4MUBA 2A5YB 3QNUA 3AGPA 3NBXX 2E1RA 1P01A 2DFKB 3MNSA 4RZUA 3ASZA 1YR6A 1O37A 4DSOA 4TPYA 1QG4A 4AG6A 3P4XA 1P2IA 3TNSA 2QP4A 1XTSA 4MKIA 4JL6A 5KNCA 3Q00A 1CS4C 2FU5C 5JZVA 3TU7H 1QJ1B 5A0AE 1E2JA 1UO6A 3VFDA 4D76A 1XXHE 4F4JA 5IK2A 4A6PA 1GJBB 5IDKA 3DZ8A 4AZ2B 1YQTA 5C3NA 4X1SU 5KU1A 2F9VA 2D26C 4BNRA 1SVIA 2CE2X 3A1TA 1SGPE 5EE1A 4G0NA 1Z0KA 2VHJA 5HZKA 1PQ5A 3NC0C 5FXLA 4ZKDA 1MTVA 3GDUA 4QBHA 4BFWA 2BKEA 4X2VA 1TFXA 3PEUA 3MMGA 1AJEA 4Q1AA 3QY0A 2J7PD 2Q9CA 4FUEA 2SGAA 5A2MH 2QTHA 4GMXA 5P21A 1G64A 4AURA 1P06A 3KKOA 3EZ7A 4WZAE 4OS6A 2QMEA 1YRBA 3S9CA 3ZV9A 2P2LA 2JLQA 3AF2A 4KTSA 2H5EA 1SGIB 1RKBA 1JR3A 2G00A 1ZTLA 3TQCA 1V2PT 3SGQE 2R6FA 3RLWH 4AFSA 1U8ZA 2P94A 2RAPA 521PA 4TT3A 5AWFC 4B2AA 1P03A 1C1YA 4N0DA 3CZQA 1H1BA 5D3MB 1TPPA 1K9OE 5KNDA 1VGCB 1T7CA 3KL6A 2CL0X 1EUFA 5FL7A 4NYJQ 3A6PC 1W36D 3AW1A 3RU4D 1HURA 2AXPA 3CIOA 1HIAA 2NO1A 3A4NA 1TQ7B 2O8BB 2ATVA 1N1LA 4PPFA 4OS1A 4LC1A 2EFEB 1F3OA 1G5PA 4G5SA 1FL9A 4I1SA 3ZZCA 5CM9C 4V0LA 2FYQA 1DITH 5LB4A 1OW3B 4D25A 2J38A 1SGFA 1XNJA 1O5CB 3MNCA 1KMHA 1AA9A 1EFRD 1LQDB 4M1SA 5FFMA 3W5IA 1W7XH 3TRFA 1E2KA 1BTXA 1BB0B 2BQ6B 1A5HA 2FEMA 3RS0A 2FYRA 5FX5A 1SGWA 4C0HA 1SGEE 3FZDA 2CMYA 2BD9A 1C5NH 4QL3A 4DDTA 5J47A 3FYHA 4P4TA 4SGBE 4KAXA 1NBMA 2ZR7A 4MDEA 3MFYA 3VMFA 3EPKA 4WXRA 3AKCA 1BTYA 2ZRJA 4US2R 1QURH 1VG8A 1GMDF 5GVSA 3UWKA 1E9BA 3T5GA 1Q12A 3WBJA 2WSMA 1GI6A 1BUIA 2YNAA 5BN4A 3VHLB 3LW7A 4ZHLU 3D8BA 1OB2A 4YC7A 2ODPA 5E95A 4U01A 1FIWA 1AB9B 1O3EA 4MRNA 1TGSZ 3THXB 5KSZA 4PO1A 1ZC3A 1U0LA 1ZPCA 5L2YH 3PIRA 3HATH 1KGDA 3TMKA 1O2RA 3HPRA 4TLDA 3LGWA 3ODFA 2ODQA 4C0JA 4BRWA 2BWJA 1C4V2 2ASEA 1GI0A 3AQ4A 1HH4A 3V00A 1SXJE 1O2JA 2R62A 1KSFX 4AG1A 1Y3YA 2H17A 4TYYA 1TEXA 5FR1A 4OHVA 3AB3A 2WUBA 2GMTC 2Z7FE 1GITA 1XD2B 2JIZD 1GBLA 4JZIA 4KXFB 3B9FH 1M1YE 1QBVH 2CJIA 3CPHA 1UCYE 2QL6A 4TYPA 2G9NA 1Z6JH 5DKMA 2W0MA 4HFPB 4HZHA 1MKWH 1F0TA 4CHAB 2BZ6H 3Q9LA 1NRSH 1SGCA 2RKOA 2IJD1 3PUVA 1TBQH 3CPEA 3BSQA 2C90B 1JXOA 2KBFA 1JR3D 2XGJA 1TUIA 2VIQA 2IUTA 1GBAA 2J7PA 1DUEA 3O8DA 1FPMA 2AS9A 2H18A 3UPEA 4OJQA 2PH1A 1DAGA 4PQRA 3EG5A 2AMPA 4TL9A 4UNQA 3A8CA 1QFKH 3EWSA 2D7DA 2PKSB 2G88A 1JIRA 3U9AH 3U69H 4IW3B 1XTJA 1CT4E 4NGAH 2EFDB 2QP3A 1EFUA 4P31A 4ZCIA 3BTWE 1MO5A 4TMZA 2WTUA 2GCOB 3NK8A 1ZIPA 2R9PA 4MGZR 2Z9GA 4OGXA 1XTQA 3AKEA 4A1FA 7GCHF 1YM0A 5FI0B 3MNXA 3V13A 2OC7A 1O2GH 1C1OA 2H5DA 1T32A 3Q3JB 2IYYA 1KMHB 1IN6A 1T8OA 5B30A 3DFJA 3UTUH 2SGFE 1A1VA 3PQCA 2UUJB 4UONA 3QKTA 4JBYA 4KKDA 1X1SA 4QHTA 1IXRC 2NPIA 3T35A 2RGAA 4E09A 3AVQA 2PHBA 2BC9A 5EQRA 3ZYCA 1C2EA 2F9PA 2ZREA 2ZUDA 1GRNA 1ZPBA 4MPVA 1F0UA 1RRFA 3O47A 4G01B 4PR0A 1HJ8A 1KI9A 1S6HA 1IQEA 2QPAA 5LD2C 3VGCB 2IK8A 1K1PA 2JH5D 6GCHG 2D2DA 5DP5A 1G4AE 2XWAA 2FM2A 4D7FA 2P65A 3WHLA 3M3SA 1WQVH 1SHYA 1EOLA 1NL3A 1SHKA 1PPBH 1Q3TA 4L5BA 4M1YA 4O3UA 1Q1QA 1L2TA 2ZSEA 4UFFH 1DVRA 1ZRHA 1GI2A 1G8GA 1SZPA 2D3WA 3WYFA 2JJ1A 4M9ZA 1YYY1 3THXA 1UPTA 4UFEH 3RC8A 2AL7A 1FI8A 1LFDB 2QQ0A 4NFFA 2VVVA 5EP1A 2R2AA 2HPPH 5FBEA 4ABGA 2YWHA 1LTOA 1KK0A 4DXAA 4O3MA 721PA 2DE9A 1SGYE 3IQWA 1LNZA 1SFIA 1ZPZA 3T15A 1P73A 4JVNA 1MQ5A 1W46A 3RXAA 4INKA 3ETLA 4ZAEA 3SUFA 3C8UA 4WZ6A 1OPXA 1OIVA 4LHXA 1TQ4A 3W34A 2ZYWX 1Y5BT 2ZU4A 1FONA 5IT5A 2PX0A 2CCJA 1HAVB 4ZI2A 2YOFA 3B13B 3TNFA 2ZRCA 3KKPA 2ZHDA 3TGPA 4WOPA 1VTKA 1G8YA 2NZJA 4PAOA 1CHGA 3SBDA 4W7SA 2FFAA 1WU1A 4JJZA 5SZIA 3ZVGA 2SGQE 1P4SA 4V0KA 1AE5A 1J14A 2H9EH 3AP2A 1OWEA 4JVMA 2ZS7A 1G5RA 4TN1A 3GJ3A 4P0TA 3REFA 1UF9A 1VG1A 1SXJB 3WBKA 1YVDA 1OP2A 4C30A 1TPSA 4FXPA 3TSZA 4Z1MA 4ZXXH 3MJHA 2Q21A 1RE0A 4PHTA 1H8ED 1XXHB 2GX4A 3C4JA 3SJBA 2VH5R 1O87A 3F6UH 1GIAA 5C1BA 3KQLA 1G9IE 4GRAA 4URYR 1TBRH 2C8XB 3MU1A 4FMDB 3GJ7A 3ZVFA 1PVOA 4CW7A 3C5HA 4D4KA 1NVXQ 2J7KA 2UWPA 2IOTA 2G8TA 5K8IA 1O2UA 5EZ5A 4LC0A 4M9SA 2BXUH 1LV7A 4MA4A 2G0TA 1MZDA 4YMUA 1TGBA 4GPTA 1QR3E 3SU3A 3C27B 3A58B 2JLVA 1C5ZB 2FPZA 1J2JA 1JI0A 1US8B 2AX4A 2J5XA 1P11E 2C93B 2IBMA 3QG1A 1MBQA 4TLBA 2WPDA 2WPIS 3UOPA 2P8OC 3T1QA 2BJWA 1SGDE 3BK7A 1GVKB 3KTAA 1SQTA 1XMIA 1CJVC 2HVXA 4HDQB 3FFGA 4M9QA 4YT7H 2OLGA 3SU5A 4K8OA 4A9AA 2OC0A 1RIWB 2SGEE 3L0IB 5JDUB 1NMXA 3MOCA 2ZQ2A 5DJ7A 3VR1A 3QKUA 4OI1A 3QXXA 2OLJA 3EZ9A 3DZDA 5JB9S 1EWRA 4A0FA 2FF7A 1CGJE 4EPRA 1QRZA 5KNBA 1BHXB 1OPHB 1TPAE 5EZ6B 3GCTF 2VB0A 5DGXA 3BEFB 5E4FA 2ODEA 1MUEB 1SGFG 2STBE 5AJWA 5CIQA 4PPGA 2DY1A 2YHSA 2PEZA 3BG8A 1KYNA 2XXLA 1MTWA 1OIXA 1OSNA 4RZXA 4Q9KA 2EFGA 1MAYA 4WY3A 3K8YA 1YZKA 4NCHA 3BC1A 1O2TA 3B85A 3DKPA 1PYTD 1E1RD 3TK6A 4ZROA 2B8WA 2GCTB 1O2YA 1C9TA 2UZ3A 3QBTA 3UR6A 3MU4A 1SBWA 1ZHPA 1C5LH 4C0AC 2RG3A 1AZSC 2RGEA 3F9GA 3I8XA 3RMNH 4LYJA 4EFLA 3SOSA 1DE7H 1JB1A 3RC3A 1J99A 4G1UC 2YNMA 5A09A 1PQAA 3M61U 4I99A 3MH7A 1HGTH 1QHRB 1A0HB 1E2PA 4FWIB 3SHWA 4RI0A 1OYTH 4OS4A 2WJIA 2WMOB 2B7BA 1CBUA 3A82A 1FUKA 4YM9A 1CRPA 2O8CB 3LGYA 3RDPA 1ANCA 3RXEA 1Z1JA 2HLCA 3QXHA 2ZI4A 1O38A 1O3MA 1FUJA 3SYJA 1WSSH 2R0KA 4FIDA 3FHOA 5DHFA 1H8EA 2QE7A 1INCA 3EPLA 3QX5H 3SGAE 3MI4A 4TYDA 2VTKA 1P2NA 2WPLS 1O2WA 1SVSA 1W44A 2SFAA 3AKDA 1W2GA 2WJJA 2BY6X 2MMCA 2TPIZ 2P5SA 3BB4A 3RC5A 2DYKA 3KF2A 1KO5A 2OHFA 2EI8A 3IKJA 3KN2A 1DUAA 1EPTC 4XSGA 4UE7H 1SGNE 3SNEA 5FCKA 5D3MA 1DBSA 1O0DH 2AYWA 2VL7A 5FL3A 4NIVA 3J81k 4ZCLA 1LCYA 1N6LA 4QM6A 1A0JA 5FH9A 2ZPRA 1MV5A 1KTTB 1LVOA 1RS0A 2BHGA 6Q21A 4R7ZA 3RXQA 3ZV8A 1L2EA 2BDAA 1KI1A 1ZJ6A 2HLDA 3KQUA 4YMVA 3QTVH 1Q3HA 5TMPA 2P3UB 4WMDA 2DHRA 3FHTA 2J9RA 3PMBB 3KQKA 3FP8E 2BMEA 4YMWA 4B43A 3WMEA 5EW1H 4B3FX 2Y80A 2BDCA 2O0JA 5E2PA 1GWAA 4OHXA 5A0CA 1E2MA 5J4LA 3MLEA 1QF9A 3VGCC 3WMGA 3TW8B 4RKJB 2JIZA 3D7MA 1N5LA 5EXLA 3DOEA 4J2YB 1E2QA 2Q3FA 1F5NA 5GJCA 4NPHA 1N6OA 1TU4A 1P9RA 3A4LA 1VCPA 3L8YA 2ZPQA 2ZO3H 4YONB 3U44B 3NIBA 4B3GA 1KXBA 4DLXA 5T6FA 2FPLA 4BXWA 2QGRA 1N25A 1CR4A 4L9WA 1U0JA 1QHSA 3I29A 3BJIC 1S83A 4A2QA 2FN4A 2DR3A 2TMKA 4O0MA 2P5TB 3GD7A 4KSBA 4YDHB 4WVFA 1GBFA 1OXSC 1SFQB 1W7AA 3M7QA 3U7GA 1NF3A 2CGAA 4NZQA 3VXEH 1ZSLA 1L1GA 5JBBS 1G3QA 4NH0A 2ANMH 3OFNA 2RH5A 1S96A 4LV6A 1AM4D 4Q48A 1O2SA 3N70A 4DLSA 3OAAA 1W36B 4DW2U 4PC1A 2KAIA 2C96A 3E2IA 4FUGA 3CW2A 4C0BA 4GPGA 2THFB 1ZUHA 1AS0A 1TQ6A 4ARZB 5DI9A 4IVRA 2ODBA 1DLKB 1RIWC 4JSTA 3PR1A 3DDCA 4XJXA 4TMVA 2IA5A 3U3KA 3S7KB 3RSLA 2ZGXH 1E94E 2H2ZA 1Q2WA 3SJIA 1BMAA 3P8GA 1TA2A 1O2VA 2FMXA 1P9WA 3GLIA 2IYSA 3ITIA 3KXIA 5F6MA 1NIPA 1Z0FA 1EKBB 1CBWC 4K8YA 4GI7A 1FY8E 1KXAA 1JQLB 5LPNA 1A2CH 1L1NA 3SGBE 1SG8B 3OEED 1NLYA 2XX3A 4FXGH 3IPXA 1PQ7A 3K09C 1DX5M 3ZVMA 4DDVA 1F6BA 4B3XA 1ZSJA 2IXFA 1O3CA 3NG1A 3TSWA 1JEDA 4DCVA 2OCAA 1AMHA 1UCYK 4B3DA 1P2MA 2X2FA 1O39A 4M0LA 3AM1A 4KTUA 1C5RA 1BYIA 3AF1A 1HB0B 4ABEA 2FO9A 4Q4HA 3T5FH 3FMPB 4IMQA 3BORA 3IDQA 1YRAA 4LHWA 1Z7KA 2OV2A 1KNQA 5LH8A 1P2QA 1VPLA 3TKLA 4XSKU 3IBYA 2FS9A 4C2TA 3WHKA 3LPRA 5BPEA 2FOEA 4Z6AH 4V03A 2DCUA 1T4UH 2XBVA 5JB8S 4QC2A 4VGCB 1NFWA 4IXMA 1KKMA 2I6SA 3I73A 4XVRA 2PKAB 4BFZA 3QPVA 2B9LA 1GHZA 1VZQH 5JWHA 2ZC9H 3LD9A 3WYGA 4IDPA 2BD5A 1OWHA 4LXBH 2P16A 2LKCA 1XCPA 2BD3A 2V3OH 2WOJA 1ZMLA 5LBIA 2ODNA 1QDEA 1P60A 1CT0E 2EW1A 3OFND 2WYJA 2XSZA 2D8WA 5F03A 2BY9X 4FU9A 3EPHA 1TQ0B 1ZW6A 5IYTA 1COWA 1C2KA 4CH8B 1L4ZA 4QJ5A 2PJZA 1S84A 1KI6A 1BDAA 4E07A 2G5NA 4QG7A 3PB1E 2VWMA 2AGEX 1S5SA 2FLBH 2C5LA 3SR0A 2UUFB 1HYQA 1P2VA 3PTBA 2OBMA 2C8ZB 1HAYB 8GCHG 1F5LA 2BQ7B 5CM8B 3QXCA 2XJ4A 1EP5A 2OE2A 1Z0IA 2J46A 4EFMA 2GXSA 3GY3A 2ZUBA 1G8HA 1W11U 1YZNA 1G3CA 2JJ2D 1WTGH 5I46H 2FJUA 3I61A 1CLUA 3RMMH 1NC6A 1R7RA 3DKVA 3T28A 3TUZC 5JYIA 3LC5A 1W4AA 2YC2C 1IQMA 2XZPA 1ZGIA 4B2LA 4YESB 1RFLA 2EQBA 4MQBA 4CRBA 1QNJA 1QG2A 1Z6AA 2ECKA 3B7GA 1P04A 1LTQA 3MCAA 3PLBA 1OXUA 4Q1DA 3SS8A
chains in the Genus database with same CATH superfamily
4IGDA 2PZMA 3UMVA 3WY8A 4FMCB 2GEUA 3U7FB 1DGQA 4LZ4B 1GCIA 3AK5A 2GNOA 3OCZA 3C8HA 1KLJH 2JFVA 4E3ZA 2IOQA 1FLDA 4W8GA 3RB8A 3IIJA 1G5QA 3Q3HA 4P7GA 1NHGA 1LXCA 2XUFA 2AN5A 2XNDD 4OA8A 3TFOA 1GDQA 2LCQA 1J2UA 1AI8H 2G55A 2CHQA 2H3HA 3KQ5A 1VKNA 2NXEA 3GB9A 2FEOA 4HDSB 5F4ZA 3I92A 5J4HA 4Y2XA 5CX1A 4OSPA 3IQXA 4RTSA 1E7RA 1DUIA 2CVHA 3I53A 4ZHQB 4BO4A 2AIQA 2XVAA 3I2KA 2P93A 1B26A 2JFWA 1Y3BE 3AEUB 1ZGHA 4WFQA 1T36A 2CLDX 1BE0A 1OZ0A 5FAKA 4WFJA 2QF3A 3W6ZA 3BV9B 1EP1B 2PQ0A 4HQOA 5JYEA 5DULA 4P0QB 4IVPA 4FCTA 1C2HA 3GISB 4GZ3A 2QX6A 5EG5A 3H4MA 4ZMRA 3JQBA 1KE1A 2VUIB 5TB5A 3IUMA 1MX3A 4MI6A 4QGFA 2WF9A 5CB8A 4ND6A 1M66A 2O7QA 1O5EH 1ODCA 3KUCA 3NU1A 4UNIA 3WNCA 4BLPA 3SWWA 4AGKA 1R0WA 3W5JA 3KL4A 2E48A 1CE8B 3F3BA 1GUBA 1XKXA 2H2DA 3EA0A 5CPBA 1EATA 3ZVEA 5J40A 3OX7U 4IDBA 5IHPA 3C4VA 2C2BA 1RHMA 3GP5A 1UHBA 2RK4A 1QNFA 3G7SA 3P95A 2FGJA 3CSSA 5DHQA 2HGTH 3VAZA 3R0FA 1XUOA 3TEMA 3CF2A 4F2DA 1FEZA 3L49A 3R3JA 1HJAB 5JYDA 1E36B 4OJTA 1NQTA 5EGMA 2GEBA 5H9VA 3QLVC 1VSTA 5HGGA 3VZRA 4G1EB 1E79A 4B6FA 3CV3A 4FUJA 1G3BA 1H6DA 3A11A 2OXRA 4J0GA 3BDIA 5DBFA 4FUCA 1Y63A 4H2DA 5JCOC 5E1DA 4EITA 2GP9B 2XTZA 1ZAKA 2C5EA 3TB6A 4QDXA 3OQ1A 1DPFA 4CBNA 1WZUA 2H31A 1IM2A 4LV5B 1TMTH 4LISA 5GJVC 2ZRFA 3W6PA 3U4MA 1XJ5A 3GMTA 4IEFB 1BDIA 4G0XA 4HYYA 4HDKB 1G6Q1 1LHFH 4TYQA 1YA6A 2V6JA 4GH5A 2YVKA 4TKVB 1NIJA 2B98A 3H99A 4OS5A 4Q1FA 5F64A 4Q63A 4MRSA 5IKMA 1YDGA 1L5WA 1PQYA 2PUBA 4UXIA 4A4DA 2QS9A 1GUAA 3L6OO 2RMKA 1CQIA 4O4IB 4BLVA 5ES3A 1YV9A 5JD5A 1W7AA 3OX3A 2IUEA 1AQUA 1K6IA 1SXJD 5BV7A 1LHDH 4E7NA 2C83A 2GD1O 2OWDA 2G52A 3M3VA 3OTPA 3F71A 2Y05A 4KSYA 1TE0A 1P0PA 2YRWA 3QBVA 4YI3A 3ZHYA 2GCEA 4DDWA 5KOIA 2QIQA 1JMVA 3F2HA 1UAYA 1DAMA 1EM8B 1NJFA 1ZH2A 2C07A 1UZLA 2BFAA 1DWUA 2DE0X 3TL6A 4B3HA 4QU5A 2BONA 3KJEA 1J8MF 1EBBA 3QGJA 4CGZA 4DHWA 3F5QA 1YMVA 1O5FH 2WILA 3LDGA 1M34B 1NXQA 13PKA 4RY8A 4AP9A 3O8QB 3SZEA 1ZXBA 4BU1A 4EPXA 3LUCA 3KIPA 5AXCA 4RK0A 3GDFA 5D3ZA 4BQEA 2XUJA 5ESDA 4BFSA 5CM2Z 2FG7C 5J59A 4AMYA 1JEYA 4P34A 3RYHA 1JS1X 4E70A 4U1RA 3S29A 1ONBA 1ZINA 5DEOA 2HWWA 1FQKA 4LUCA 2I4MA 2C1ZA 5BN5A 4EBFA 4MKGA 5I7SA 2WKSA 1ZUWA 1XKBC 5HBGA 2H63A 3TLZA 4UC0A 1MTUA 4RHEA 3PDJA 3ZU2A 2CEAA 3OZ7A 4CMBA