3O8DA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords HCV NS3 protease/helicase
publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
total genus 207
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8dA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8dA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8dA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8dA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8dA03
2XNDD 3MCAA 3RLFA 3K9XB 1A82A 1G8YA 3VHXA 5DGXA 1RRFA 1GJ6A 1C1SA 1DADA 1EAUA 3MJRA 2ZJ2A 1AUTC 2GAOA 2ZVQX 3OE7D 1GBEA 1VCIA 1YCPM 4JVNA 4ZROA 2FXRA 2BLVA 4TQUS 1IQKA 1XCPA 4MQAA 3SHAH 5L3VA 4AG6A 2BXUH 1EK0A 3DUXH 1DEKA 3BTHE 2OAP1 2XWAA 3MG9A 1M7BA 3VR1A 1N0VC 4JZIA 1UVOA 1ZNXA 2FS9A 4X1SU 2Z3DA 1F0RA 4TL8A 1FJSA 1P11E 5JSZA 5FX5A 3LNCA 3W3AA 2V0BA 3QXSA 1H8HA 3BTQE 2YWFA 1ZW6A 3SJAA 2VL7A 4Q4AA 2JJ2D 3EZ7A 4AWXA 1P2VA 2R62A 1BTHH 1O2NA 4K8BA 1E0JA 1UTLM 1D5CA 4XTCS 1SR5C 5DYIA 1FMJA 2AXNA 2GJ8A 2LKDA 1BO6A 5FBWB 4JBWA 2ZPTX 3T29A 2SGPE 4MPUA 4KJZA 3R0FA 2G83A 1C5WB 2FPMA 3HKIB 1O2WA 3DM9B 3OIVA 5C67A 5FHTA 1V2UT 1ZIOA 1T4GA 1CO7E 4A1FA 3B82A 2ZHWH 3ZVLA 2ZI3A 1NPMA 1KTVA 2BDBA 1A2CH 1VPLA 3C14C 2QY0B 2NQ2C 5FPSA 3DZDA 2CLCX 1G291 3FMFA 5EXXA 4U00A 3SV9A 1LTQA 1R7RA 2Z9IA 4C9BA 1D8TA 2H6MA 2VHJA 1EJMA 3LX5A 3T25A 3MO6A 3MU4A 3OFNA 2OUKA 2EYUA 4DLSA 3KXLA 3SJBA 3LH5A 3RC8A 1MKWH 3GCHC 4LBYA 3TJVA 1YCPH 1SQ5A 3UMFA 3PMJA 4BXSA 1HAZB 3S1AB 2G4TA 1XJ0A 1OX1A 3PV4A 1W11U 4Q03A 3M5LA 1UKEA 1ZD9A 2TMKA 5KUTA 3SUFA 1VCQA 1XUKA 1OH5A 3KNXA 1FAKH 4MYCA 1KZ7B 4C7OB 4P4SA 1TNLA 1KO8A 4LZZA 5B2ZA 2RGBA 1HIAA 3ZIAA 2OLGA 1E3MA 621PA 4DIIH 1V2ST 2RA3A 1CTQA 3TUIC 2CLSA 2ZI9A 4WXIA 4M1MA 4FUJA 1J90A 2OG2A 4D2IA 1AKSA 2OQUA 4IMQA 3Q7PA 2DY1A 3M0EA 4CEHB 4UKDA 4YMVA 5JWOA 2Z0MA 4KGAA 4K1EA 3WP0A 1Z5ZA 1J7KA 1MTUA 2PZFA 1GDQA 5F3WB 1Y63A 3SI7A 1SFIA 4D0GA 3ZZAA 1IN5A 3CNOA 5DP8A 3U2QA 2SGAA 6GCHG 1KYIA 3K6ZA 5CDFA 1N6XA 4X0WU 4BTTB 3IPYA 1IN8A 1NRNH 4FXPA 2ZS8A 3W34A 1NVVQ 5EE0A 1MU6B 3GLGB 3CF6R 1G3QA 1UK4A 2R3UA 3IITA 4LV5B 5EP2A 3AVPA 3PQCA 3ODDA 3URDA 1N6IA 3ZVGA 1YZQA 2OLJA 3BBPA 4M1KA 2GVFA 1OLOA 2W7UA 3B13B 1SGRE 1DANH 3WMEA 2P3SA 3FVFB 4BZXA 4BFUA 4TYWA 5B6OA 3GLFE 1CR2A 3VR2A 4Q7XA 1AQ7A 2SFAA 2QT0A 4H9GA 3DFLA 1XZQA 3GCOA 3G0HA 1DXWA 3OIUA 1Z8JB 1CBWB 5H4IB 4B2LA 1GI7B 2F9PA 5FR2A 3FDIA 1G9IE 1BITA 1J14A 3RRNA 2FI3E 2QUZA 4DLVA 4ABEA 4PC2A 2WPDA 2AK3A 3T1OA 5E0JA 5EXLA 3EA0A 2DUCA 1V2KT 1QL7A 4Z0KA 1GG6B 4G5RA 4WF8A 2CCGA 2WPKS 2YJTD 2ILNA 4URXR 2QEQA 3UMRA 1JPJA 2Q3MA 2PCJA 4GT1A 3QXHA 1JXMA 3BTFE 4MYHA 2GCHG 4PAQA 4TYQA 1DY9A 2JA1A 1RD3B 2QA9E 4LC1A 3L0OA 2ZJBA 4NMMA 2RCEA 1Z83A 2GCOB 1KAOA 3NVAA 3AB3A 3BG4B 3PWCA 2ZU3A 4JLKA 1RFLA 4C0KA 1RIWB 3M6AA 1C1TA 1C5PA 4X1QU 3RU4E 2P2LA 1D2EA 1EFRD 4CIDA 4GNKA 1KI3A 2OUAA 2VWOA 2ZU4A 5A2MH 3I72A 3PV0A 1KO7A 5KTYA 1XVOA 1XU4A 1ODFA 1S4QA 3ND9A 3GJ6A 3RRZA 2O8FA 1EWRA 6ESTA 4AKEA 4G01B 2D7DA 1W2KH 1XMIA 1XUFA 2EYQA 3U98H 1TPZA 4JJZA 3IO5A 1UVTH 5M04A 3CRRA 3A88A 1OP2A 4PSKA 2CN0H 4XIGS 1SXJE 4PHHA 3EZ2A 2ZWLH 4TLEA 4B34A 3KKMA 1RRGA 4D76A 1S81A 4QKQA 2GF0A 3IHLA 3EA8A 3RRMA 1E2MA 1NF3A 1R4AA 5G40A 3TQFA 1EFCA 2VTKA 2Z9JA 5KPJA 3U44A 2OP9A 3H2YA 3B1VA 1VGCB 2PUQH 5AJWA 4I8KA 2TGTA 2STAE 2PMDA 1AVGH 1TPOA 5E7IA 2C9OA 5J4LA 2AKAB 2ZJYA 1TRMA 2OK5A 4LJYA 3KGPA 4KP0A 1KI7A 2ZDKA 4DSTA 3ASZA 4ESVA 4RCYA 1SGFA 3QKUA 3DT0H 4N3NA 1HE1C 4Y8ZA 2XCFA 4M9ZA 3I32A 1XTRA 2FYRA 4JVSB 1CJUC 1Q31A 2Y5FA 4WBSA 5JYIA 5KSYA 2RGDA 4A0GA 3T2NA 4B35A 1R0XA 4E03A 2BX3A 3QDZB 4UNPA 2O8BB 2BB4A 4B43A 2JCSA 3HJNA 2BD3A 4LSGA 3VKGA 4A2QA 1XXHE 3TVDA 4NIWA 5C5OA 5A4JA 5FI0B 3A7YA 2QAGB 5FCKA 1SGYE 3BSQA 4TPIZ 5AUQA 1TX8A 2Y80A 2G5VA 1QBKC 3TJNA 5A5GA 1VITG 1QF9A 2JLSA 2QE7A 1UK3A 1X8LA 3CZQA 3NK8A 1FX0B 3AASA 2I1VB 2J4IA 1ZD8A 1DXPA 2IYVA 3U5ZB 3TUJC 5L8VA 3UNRA 3C7KA 2BIFA 2K1QA 2GGVB 4W5JA 1A1VA 2A4OA 4PANA 2ZYVX 3TAUA 3I5XA 1MBQA 1LVMA 2F55A 1KO4A 3IIJA 2GCTC 1Z8IB 2AN9A 2ZO3H 4WOPA 1GBTA 4UFFH 4RCZA 1ZC4A 3NWUA 3O8RA 2NIPA 2VGCB 1O5CB 1DBSA 4QGHA 2ANBA 3A37A 3PTBA 5JI2E 1T32A 2WPHS 3A4MA 5DPAA 1P4SA 3RXQA 3CIOA 1HYLA 3RC4A 1D2MA 4LI0A 1ABJH 2WPMS 3TW8B 1OYWA 3FMOB 2VP5A 3ICEA 2F6RA 4GRAA 2FI4E 2I3BA 1EUFA 1HY3A 2ZR7A 3KUDA 1UDWA 3VB3A 2HLCA 3GDUA 2CGAA 5FOWA 2PR3A 1W14U 3ONWA 4UE7H 1LPKB 2G1JA 4AIIA 5E7MA 5FTJA 1N8OC 2NOAA 4DDUA 1N6HA 1YQTA 2GDDA 2AD5A 2VBCA 3TVJB 2HPQH 4NKRA 2JLYA 1NN3A 5GDSH 2A7QA 1BTYA 2W6IA 4FUFA 1C1VH 4D9QA 3W6PA 5KDLA 2ZRLA 5AF9H 4OK6A 3PFIA 4L4UA 3WMGA 2XITA 3G01A 1II9A 1C2MA 5T1VA 1GDUA 2WV4A 1FQ3A 4WZAE 2QYIA 2EW1A 2RHMA 4V03A 2O8EA 2HVXA 4B2BA 2VIQA 1ZHPA 2HOBA 2CE2X 3TW4A 1P2NA 1LQEA 4LK2A 1DUEA 1Z28A 2ZEJA 2GESA 2XYAA 1OIVA 4CEHA 2ODPA 2GJSA 4G5QA 4PC3A 1L2TA 2YV5A 2JH0D 1W36D 4KLNA 3SUDA 1ZU5A 5CLQA 1OXUA 3A8DA 5JEEA 1UO6A 3PO1C 1HAIH 3L8ZA 2AEIH 2OBOA 1XTIA 1F5KU 1DARA 2ONKA 1WA5A 2VPPA 3LRPA 1XM1A 2VLIA 3T34A 2C78A 4ZDKA 3E8LA 1X3SA 3G82C 4GSYA 4IHQA 3IO3A 1M6NA 3W8NA 1P2SA 2BM0A 4NCJA 1HAHH 1TPPA 1IAUA 4A2WA 3GLGA 2BWJA 4II7A 1OS8A 1FP6A 1N6KA 4NHOA 3MO9A 4PTLA 3L8YA 2Y5GA 4HB4A 1SG8B 3TH3H 1G6HA 1X86B 2ODWA 2Z94A 1IQPA 1Y3AA 4JZFH 1YP9A 3ZZTA 4INLA 1F92A 2FOLA 1EXFA 5DHFA 1S2MA 5DO4H 4OI1A 4B73A 2HT1A 1LPZB 5L6NH 1IQIA 3T28A 1MO4A 1MR3F 1GVLA 3KQBA 1T4VH 4JKYA 1NO9H 1R0ZA 2ZROA 3N5CA 5ETXA 2ZHDA 1IJFA 3TGPA 2C5LA 2XC0A 4JYTA 2PLRA 1O3EA 1G7CA 1VCWA 2VHCA 4NA7A 2QXIA 1K1IA 1OYTH 2QBYB 1K5GA 5JHGB 2ZRMA 1K22H 2C93B 2QM7A 1JR3E 4DT7B 1YR8A 4ZKNU 4CREA 1K1JA 3TVTA 1NMZA 4KO8A 1T5IA 3TKLA 1K5DA 4IRUB 1EP6A 1SI5H 4JYCA 4ISLA 3RXTA 2GCOA 3F3YA 4F92B 2GKVE 2BHRA 3VKHA 1DPOA 3P20A 1XD2A 1UVSH 1E2PA 4ARZA 4NFFA 3HGPA 5JPMH 1GBIA 4IVRA 3SYKA 1G5RA 2FSIA 4RD3A 1D6WA 2A4QA 3QJYA 5JLJA 3ZJYA 3VB4A 5D3QA 1GDDA 1HPGA 1EZUC 4IOLA 2OT3B 3MO3A 4PPQA 1QRWA 2WZQA 2GZHA 4PC7A 1E69A 4ILEA 4DDTA 4CRBA 1XEWY 1SKYE 2ZM5A 1NLZA 1C5SA 3QXXA 4WZBE 3P17H 3RWOA 1B23P 1I4TD 1XTQA 3Q9LA 1KTSB 3RXVA 5DI3A 1KOFA 4JT2A 3CO5A 3SQEE 1QB1A 4QGFA 1NY6A 2H1UA 5EZ6B 1V2WT 2GT7A 3A81A 2GZ8A 1TU3A 2Q1JA 1GL1A 3RMLH 2KE5A 1KMQA 1WSSH 1TQ4A 3OU0A 2G52A 4JSYA 1TTTA 4Q1DA 4P3YA 2JAQA 1AS0A 4I99A 3SNBA 1II8B 2AX4A 3KQDA 1ANKA 1CULC 4DG4A 4P0TA 3ADBA 4G0NA 2DYKA 4MKHA 3B5JA 1BHXB 4OHWA 3W5JA 3P92A 1BJVA 1O5DH 3RMMH 4UXHA 1HT2E 1GHYH 3UFAA 3EGKH 1XZPA 1H8EA 4TLAA 5C4GB 1KY3A 1E2JA 4GFDA 1O2MA 2CE7A 1IQJA 2A5IA 2V54A 2NO7A 3FP7E 3OAAA 4QBHA 1XTKA 4BOHA 3BC1A 1WCZA 4ABBA 4HB0A 3TIFA 2VP4A 3M5MA 1FNMA 4PROA 4CVNA 1QBNA 2FDCA 1DWCH 1AKYA 1EWQA 1H9HE 3I8XA 1OH7A 1XEXA 2R6CA 4IKEA 1IHSH 3BFVA 1N2CE 2AD1A 1Z71A 4IDOA 4BQSA 3V3MA 4LYJA 1RVDA 2O8BA 5FBVB 1QJ6B 2O8WA 1MZDA 3SU2A 4DEYA 2B7BA 521PA 2QAGA 2SGQE 3F1SB 2OE2A 1KI2A 4C0AC 5KNBA 2B9LA 1T7CA 2GVDC 3M61U 1W36C 4YZUA 1DM4B 3UG6A 1Q0UA 1CP2A 1L8QA 1UCYK 3UTUH 4LYHA 3B1XA 3KIDU 4Q4JA 1O3GA 5EODA 3AM1A 1AFQB 1ELGA 4C0SA 3U60B 3AVZA 1XUGA 4RKEA 1QRZA 1MRNA 2LCFA 4PHTA 2H92A 1BMMH 1P2UA 3SI4H 4BLQA 3LOXA 3QTOH 3FKQA 1ZRBA 5ABWA 4PZLA 4B48A 3OZXA 4HLCA 2ZAOA 1JAIA 1AUJA 3IBGA 3IEUA 4R2IA 3TQCA 3RXEA 2J38A 3ZVAA 1BMFA 1VECA 5SZKB 3GCNA 1NBMD 1QRXA 4Q80A 3W6OA 1W2HA 3CH5A 3X2SA 3QPVA 1TADA 3AW1A 2CBZA 2OCPA 2BZ6H 3QZRA 4MDEA 3CLVA 1L4UA 3SYJA 1GKUB 4BANB 3MUFA 1DY8A 3EDXB 1XNJA 2QROA 3OEHA 2ZEBA 3Q85A 4LX0A 1X7AC 2C96A 5JRJA 1OSSA 2VIPA 4ZXXH 1T91A 4GOKA 2VH6A 5H68A 2CNWD 5IT5A 2VIDA 3T15A 3CRVA 2ZSBA 3C16C 3GEEA 4R9UC 2XBWA 4Q2KA 1MTVA 3M1IA 5HCIA 1O3CA 1BRCE 4RJLA 1Z8RA 4RD6A 1TA2A 2AMPA 3MJHA 1BA8B 4J2YB 2Z83A 3K70B 1OT3A 1O2ZA 1AS2A 4W5WA 1OH8A 3MLEA 1T8MA 1ZNYA 2Z4SA 2WIBA 3SOPA 2J9RA 3U3JA 1BOQA 2AWOA 2JATA 1GILA 3QE0A 3LQQA 1ESBA 4JLJA 1M8PA 2XTZA 4PAMA 2ZJ8A 1P2OA 3JZ1B 2FV8A 2ZRHA 3PUVA 2F7SA 4TSFD 4LZ1H 2Y82A 3CWZA 3NBYC 2QTHA 3KCGH 1GG2A 1O3BA 1NRJB 4DJTA 1KYNA 4QOSA 2QP9X 1E2QA 5CE1A 1P9WA 3MFYA 5JWRA 2JLQA 2JASA 3RM2H 1ELOA 4Q7LA 2YHSA 5FUWA 5FPKA 3UUZA 5GJWC 2QMHA 2RGNA 3SN8A 4RZ2A 2BD4A 4CRDA 4TQ9A 4AORA 3EW9A 3QVVA 4C0QC 3RS2A 5BWMA 1W0ZU 3CR8A 1A1RA 5BN5A 1T5LA 3P95A 3VGCC 2A0QB 4B32A 2WKPA 1EPTB 2O8CB 1CA0C 5DI9A 5IF9A 3ZZ9A 1ZM3A 4E06H 3U9AH 3MAAC 1AA9A 1DLKB 2WV9A 4VGCB 1E1QD 3B23B 4A8JB 5FPYA 1EOLA 3E91A 1GI1A 2BQ6B 3UQVA 3KF2A 5FBIA 2ZJAA 3B9FH 2WSSA 1NMYA 2H17A 1YVDA 3KKOA 2J94A 4HGCA 2JETB 1IHUA 2FG5A 1Z6GA 4GMXA 1JAHA 1KY2A 3I77A 2ASEA 2R65A 2FO9A 1Y5AT 1CXZA 4DSNA 3ZD6A 5CHAC 4XD7A 3WHLA 2OO7A 1HJAC 4K5ZA 1TALA 4Y76A 4KTSA 1CE5A 3QNUA 1ZTKA 3ZVFA 1SVWA 3ITIA 2GD4B 4JLDA 4X8LA 4A0HA 5C1XA 6CHAC 1R8SA 1O39A 4DXAA 2CXXA 4FWTA 3A8BA 2BD2A 4WXPA 1DE7H 4XSKU 1TOMH 3WP1B 2UWLA 4B2IA 4PFSA 4S2EA 2W2TA 5GVRA 4QHYA 1ZMJA 2TIOA 4CDGA 1N1LA 2GILA 2GRJA 2IK8A 4DJZB 3H09A 1JBKA 3ZDQA 1TGBA 3A7ZA 1YF4A 2BCJQ 3S0NA 4AFUA 2BDYA 2BMJA 4Q19A 1A46H 1W7GH 2PTCE 1DAEA 1O2HA 2G77B 1DOJA 1JBUH 3BH6A 3OF5A 2VB0A 4XVQA 4O0MA 1O3JA 3UWJH 1GDNA 4K46A 5G53C 2R8RA 2D8WA 1FPHH 3MU0A 5HMAA 4BUJA 2HLDA 2CCKA 2O0KA 1S0UA 2HJVA 2J0VA 4K3JA 2OLKA 3B6EA 4C2TA 4CT5A 3SBEA 3ZV9A 5HE8A 2XJ4A 4D25A 5JWHA 3SU0A 4G1UC 2BMFA 4HZIA 1IXSB 1E4VA 4GHTA 3F68H 4NFEA 4KODA 3I5YA 3AVYA 2YNAA 4ZDIA 2J9NA 3TNFA 1II8A 2REXB 4DLTA 1QHIA 2GWHA 4RD2A 4BNRA 5DH9A 3RDZA 3LLMA 2IOTA 2OC0A 4XWAA 3HPQA 4EDHA 1QIXB 4HDCA 3KN2A 2XNDA 3T1VA 1MABB 4DVAU 4E05H 2FOFA 2CMKA 1A7SA 5C1YA 2Y8EA 1HA3A 2RB4A 4O9VA 4DW2U 3PR1A 2BJVA 4JK6A 1MH1A 3SNHA 3OE7A 1F3OA 3AW0A 3IKJA 1P7CA 3MNSA 5JHHB 2X2FA 3LGTA 4D4KA 3SJ9A 3ODFA 1Q57A 3SV2H 3KFVA 1E96A 1ZR0A 4M1SA 1UVUH 4I1UA 4RFSB 4UXJA 3K6YA 3BD9A 4FINA 4LBZA 3THYB 1DG3A 3WHKA 3DPUA 4JL5A 1D3DB 4A15A 1O3NA 3TGKE 3KQLA 2WWHA 4CEJB 4HZUA 1PFXC 3P26A 3GY5A 2XTTB 1YR9A 3A8AA 4INHA 1AN1E 4NTZA 2ZRAA 1E98A 5CK5A 1YPHC 3SO3A 2JJ2A 2GJAA 3GLIB 4G3XA 3QUMP 2VP9A 1GL7A 2BD5A 2IHYA 3GDVA 2QG6A 3SUEA 2UWOA 4DY7B 1GMCF 2VJ1A 2ZE8A 2BLQA 2ONJA 2BX4A 1DITH 4GHQA 1VCOA 2IWRA 2HRVA 4AB9A 3UK6A 4A1VA 3LC3A 3R7WB 3GJ8A 1C2FA 1B7XB 4Q4HB 2F3RA 2BBSA 2ZRJA 1DVAH 1NRPH 5I46H 2WPDD 2IJD1 3RS3A 3LDAA 4YC7A 4Q9IA 3BH0A 2OBNA 2BKUA 3TLOA 1NTPA 4M9XA 1F48A 3TH4H 3H7OA 1PQAA 1GL0E 3HU2A 1QFKH 4I7YH 4EPRA 1HT1E 1DS2E 3E16B 3RLYH 4JLMA 4D81A 1IQLA 1ESAA 5EPNA 2HXYA 1LVOA 3RYTC 1RJ9A 2ZVPX 3SNAA 2CL7X 4KXFB 5B58C 1PUIA 2WPIS 3RABA 4EJSB 1PQ8A 1GBLA 3GQBA 2J7PD 1DO2A 2FF7A 4NBSA 2JLUA 4GPTA 4RFVA 3QZQA 1NC6A 3U61B 2KWIA 4C30A 2BD9A 5SZHB 2JJ1D 1INCA 1HUTH 4OKSA 1G41A 1F2UA 4AYWA 5CB8A 3PXGA 2P94A 1C2EA 5E0HA 6Q21A 2QSYA 4X8OA 4ABGA 3CRQA 3NZIA 2RHDA 1JJVA 2QPOA 4NCNA 2CF8H 1TIOA 2NZ8A 1ZJDA 4DCTA 2V55B 1ZNZA 5FOUA 2PLFA 3RXJA 1SZPA 3RM0H 3QKSB 1KSNA 1FN8A 2YVUA 2PSYA 3W8RA 3F9EA 2A5YB 4B71A 4OHZA 1G3RA 3R9WA 5CM8B 3SU8A 2J0UA 5FL3A 4WVFA 4MKIA 3QBVA 1VYVA 3M37A 5CLLA 1T8TA 2IF0A 1A61H 4Q66C 1S85A 3OHMA 3N2IA 2BD8A 3BN9A 5CB6A 1MO3A 1F7ZA 4OS6A 2WWGA 1GHBG 1P03A 4Z8YA 5HCNA 1PLJA 3T06B 1Q1QA 4OJQA 4ABYA 4M9QA 4KAXA 2SNVA 1UCYH 4U2WA 1N6LA 4K1SA 3B7GA 3SJKA 2Q6FA 1GMHG 4F4JA 1ZPBA 1N5IA 3ECCA 1EPTA 2O8CA 4BAMB 3UXMA 4HYYA 4E07A 5L30H 3A7WA 4I1SA 4DCNA 2YWEA 4DT1A 3KQKA 2O8UA 3C8UA 3LGUA 3OTPA 1DS6A 2SNWA 5GADl 2A2QH 1P61B 4GMDA 3Q76A 5K0HA 2QTVB 2G4UA 3F9GA 2PWXA 4XJXA 2ODBA 2ZE6A 1Z07A 5SZIA 2C77A 2QRNA 2UUFB 1GJCB 1OWEA 2C2HA 5UKDA 5DN6D 2QAJA 1G18A 1IY0A 4GAWA 2AFQB 4U02A 1DSTA 1LS1A 4WIAA 1ZC3A 1TFXA 5F2EA 2G0NA 2IS4A 3E70C 1XKBC 1J8AA 1UJ1A 1KXBA 1Y3WA 1CGHA 4AFQA 2ZTZA 1KKMA 1MAYA 3BB1A 5JI3E 3Q5EA 1Z6EA 2FEMA 1HLTH 4HAXA 3VX4A 4K1TA 1U98A 3CR7A 4NIYA 1COWD 2IYXA 3PEYA 5I25A 1KY9A 4QXAA 1TNGA 3GD7A 2WOOA 1EFRA 1G4AE 4G5GA 1YHNA 1KO1A 2RDLA 2AFIE 3GJ0A 5DE3A 1E0SA 4TL7A 5FTMA 1AK2A 1T8OA 1C9KA 2P59A 5J4VA 1G37A 1QGFA 1TUEA 8GCHF 5FOTA 4NYIQ 2FEOA 3GY7A 1SOZA 3EIHA 2AL7A 2EWWA 1UHBB 3GY4A 1J8YF 4MPWA 2J87A 3SQXA 3WYAA 1D4PB 3MRSA 1ELVA 3IQWA 1U6QA 4XVRA 1ETSH 2XB4A 2BKEA 2EU8A 2NPFA 4NYIR 5GIBA 5FBEA 4L5BA 4HATA 1EZQA 2FZZA 4MQBA 2PGBB 3PMHB 1YLDA 2QM8A 5EP3A 4NWLA 2ZS9A 2H9EH 4FUDA 5JS7A 3C4JA 5GCHG 2JIZA 1GHBF 1N6OA 2XSZD 4URUR 2W6ID 1KDOA 1IXRC 4OM9A 5JBAS 3REGA 3K8YA 1UKVY 4X1NU 4LDJA 1BHXF 1KJWA 4CH8B 4IFBA 3UIEA 4Y0YE 4EFMA 3W9YA 1HXFH 3UATA 5DO9A 4GDFA 2GDJA 2Q9AA 3UREA 1R10A 1FMLA 2WJIA 3OIWA 1E0KA 3K0FB 5FI1B 2ANCA 4M7GA 1E37B 4Z8XA 5EXPA 4KFSA 3QPUA 1MKYA 4ZAEA 3FFAA 1ZJKA 1GOTA 4ZUHA 2H2ZA 1MABA 1E9RA 1CKEA 3JZ2B 1NM6A 4RI0A 1IBRA 2RCNA 3GCTG 4GCHG 1E9CA 1E2HA 3QEOA 1QB9A 2VP6A 4WW0A 1UFQA 4TY6A 5LBIA 421PA 1SPJA 1O0DH 5TB5A 3A7TA 2ZGXH 3JZAA 3S69A 2YWHA 2J45A 1XBTA 1BB0B 3EWAA 2FSFA 1OPHB 4GOJA 1AFEH 4H1VA 1OSNA 4RFSA 1HRTH 3THYA 2BYAX 5J47A 3MD0A 1SGPE 5G41A 1JOUB 1PPBH 4POAA 3ZVRA 2B8TA 3UWIA 2WJYA 2FIRH 1DT2A 1ELAA 4O2RA 3GLIA 3SC3A 4LJ5A 3CF2A 1OXXK 1GHZA 5FTKA 4TN1A 1AB9B 4NGAH 1FONA 3LGWA 4UNSA 2PX0A 1U99A 4ZPXA 4TMVA 2NZJA 4NYMQ 4AFSA 4Q4HA 2ZFTA 4RD4A 1HYQA 1HQCA 3AUXA 3LPRA 3IQXA 821PA 4HFPB 3VB5A 3E2IA 2F43A 1KI8A 1XMSA 1K1MA 3MWIU 1XRJA 2OBQA 1XB2A 1CS4C 4NYMR 1KDQB 1UTOA 2SGDE 1YR7A 1LVYA 1E2IA 1K1LA 3K2UA 1KXCA 4WH6A 1KZGB 1QNJA 4WJG2 5JECA 4XOJA 2G3YA 4TPYA 1Z0FA 2ZRFA 1NRQH 4IC6A 2GTPA 4IW3B 1E34B 4EJSA 1W3CA 3CPHA 1FW6A 3TE6A 1F2TB 3RXOA 3RXCA 1OYYA 2PX3A 5FTLA 1WBBA 2C03A 2IYYA 3BEFB 1ZUNB 2QQEA 2F9BH 4KBGA 2NO0A 1S3SA 1GWAA 1SFQB 4PO9A 2PV9B 2AK2A 1V2OT 5AK0A 1HAOH 1NJGA 4QG7A 1NN0A 1LHDH 2ERXA 4LGMA 4LV8B 3BTKE 2BDTA 2IEZA 4CBNA 1DELA 3ZV8A 3GCTF 1ZSKA 2BDAA 5CK4A 3WNCA 4MNYA 2ZJZA 3ATLA 1NJFA 3U1JB 1G7TA 5CJPA 1QA7A 3BORA 3NDBB 1Q44A 1JB1A 2A3RA 2C90B 2XW9A 4OQFA 1O30A 3KJIA 3D23A 1QVRA 5K8LA 4CEIB 1NFUA 3PEUA 3F9HA 4ITRC 1V2MT 4H1UA 3FP6E 2TGPZ 5KSZA 2QXHA 1AWFH 2WINI 2A31A 3SNDA 4LOYH 1YR6A 3C41J 2HCBA 4PX9A 3BIVH 3HKJB 1AY6H 4FCTA 2KB0A 1P06A 1H8ED 1Y3VA 3JZMA 5DK1A 4IW4E 2DWQA 2PSXA 2XNIA 3P1JA 2ZU0C 3LVQE 1A3BH 2PBRA 1YC0A 2H5DA 4R2HA 1WV7H 3CF0A 1BMAA 1LHFH 2NPIA 1CT2E 1HV8A 1YGCH 5C46F 4D6PA 3ND8A 2ZNKH 1YPKH 3B85A 3RP2A 2ZECA 1G3CA 2VF8A 4HUQA 4KSCA 1XCMA 3RAPR 5T6DA 2RGGA 3ZH9B 2V7QA 1UKYA 4A7IB 1GRQA 4LHWA 1R8QA 1Q21A 4RSPA 3A6PC 2HYIC 1YPHE 2SHKA 4TMTA 2IXGA 2QF3A 3VR4A 1C2JA 1U2RA 3LIWA 1Z47A 1ZOMA 3THWA 1EFTA 1C4V2 2ZSEA 4INKA 4CHAC 5TVKA 5K8TA 4JVMA 2JLZA 1E36B 2Q3HA 4KFTA 3GLHB 1NVUQ 4YDSA 1TQ0B 1FFHA 3KJGA 3BTGE 3AP1A 4LPKA 1OWDA 5FPHA 2GCTB 1Q3TA 1GCDA 1DPFA 4MRNA 4A36A 3PTNA 3H5CB 2OSBA 5E95A 1EATA 3RXFA 3HWSA 1ZLRA 1S9HA 5FAHA 3EG5A 2IS6A 4MLFB 4E22A 4A82A 3UR6A 1IJEA 2OC7A 7GCHF 3A4LA 1SLUB 1UCYE 1L7VC 2IN2A 1TNDA 4QFMA 1XTJA 4ZCMA 1DWBH 5KHOC 4JLBA 1SGDE 1XCGB 1G5PA 3SFVA 3HATH 1YRAA 1CRQA 2R6FA 2RGCA 4Y79A 1CBWC 1NT1A 1GFIA 1M9UA 1UHBA 1XF9A 4PQRA 4RD1A 1N8OB 2V1UA 2RA0A 1YZUA 2CVFA 1W10U 5F6MA 1W44A 2KBEA 3OYPA 1GGDB 4R8TB 3OEHD 2ZPSA 2ZA5A 1W1WA 1GHVH 5E3HA 2IJOB 1ZYUA 4AG1A 5IRCD 3LKWA 1W46A 3DM5A 5HKKD 2GP9B 1GHAF 1UTMA 5K8UA 3U8OH 2ZI4A 2WWIA 4V0NA 3QGNB 2C98A 3FKSD 1O36A 4EQ6A 3LU9B 2PFEA 1KHTA 1W7XH 3DD2H 4K8YA 3AKDA 5C1BA 3KJHA 4HAWA 1TMBH 3BG4C 4DIHH 5CYOA 2AXPA 4UJ3A 4O3UA 1U0HC 2D06A 2ZRIA 2EFCB 4A6XA 1RIWC 3A80A 4XWOA 1JNYA 1P60A 3VPKA 2GTBA 1LW7A 4Q9KA 2PH1A 3SYNA 3LONA 3RHFA 1MQ5A 1P8VC 2A5JA 1AGRA 3K0FA 4PHFA 3LQRA 3PO1B 4DURA 2OV2A 3PJRA 3QGJA 1MTNC 4JSTA 4F7WA 3BXZA 4EKDA 1MZAA 2EI7A 3L3TA 3U8RH 1HDTH 1ARBA 1TF5A 1LMWB 3MMPA 4XBBA 2BDIA 3GJ7A 3KX2A 1C1OA 3X1YA 1GMDG 1GJ8B 2QCYA 2WWXA 2YNMA 3UOUA 4UNRA 1ZSLA 2F9MA 2FODA 4Z54A 3P4XA 4Z1MA 2P95A 2JKHA 1KI6B 5AHGH 3FE2A 1JPNA 3AEZA 3SN6A 1CF4A 2ZP0H 1QHXA 1MO6A 2VSFA 1CSOE 1SGNE 2KAIB 2F91A 4CF7A 2X19A 2A7JA 5DIFA 1ZIPA 2GVZC 3K0CA 4EPWA 1Z7KA 3Q5DA 3NHBA 3H4MA 1SLXB 3C5CA 1VMAA 5AJXA 4B2AA 3DL0A 1NNEA 2ZJ5A 1US8B 2J59A 1AIXH 4Y0VA 5CDFE 2V1XA 1S1MA 4NIVA 1AQYA 3MI4A 3MSXA 4F49A 2JLWA 3IDQA 3RMNH 4FI3C 3CRW1 1W0KD 3THXA 5EQQA 2WPJS 1NBMA 1GBFA 2ZRDA 3NHAA 3V4FA 2FM2A 3GY2A 1IQEA 2ZGCA 4LRWA 1G2MA 2DE9A 1GI4A 1MCVA 2QAGC 1THRH 1N3BA 3KFXA 1TB6H 1PZNA 4TMWA 3SU6A 2A4GA 1OP8A 5EE1A 2CNWA 1JXOA 4KVAA 4KKDA 1PPGE 3S9BA 3FB4A 1Z6YA 1VJ9U 1ZRKA 2ZHFH 3A36A 3KB2A 3LY5A 1C9TA 2O8DB 3SORA 4LJAA 3PM3A 2IWHA 3SJ8A 2QMOA 4BFTA 5GJ4B 3WNBA 1KNQA 1V2JT 1F6BA 1FP7A 4ZV4A 4V0MA 1KK2A 1EFHA 3KKPA 5L3SB 2HPPH 2DPXA 1HJ9A 3FZDA 4UFEH 3BIUH 2AERH 3E0PB 2A5KA 4I1VA 2UVQA 4FVDA 1W4AA 2PMKA 1IQGA 3FAOA 2C8ZB 3IEVA 1LKAA 1JEEA 4EAQA 3PYHA 2Y5HA 2OCBA 1P01A 1G8PA 2HLDD 1O3DA 1SGWA 1W5TA 4ZKRU 1GWNA 2CL0X 1RS0A 1HEIA 1GI2A 1GHXH 1TYNA 4NZLA 4AYVB 4D26A 2PEZA 1ZP6A 2HALA 4ZXYH 2TGDA 4CEIA 1M74A 1QA0A 2ZZUH 4YESB 5LPEA 1RE0A 1P57B 3BV9B 1ZM7A 2HDNB 1MTSA 1Q3XA 3FMPB 3GFOA 2OM2A 1C5UA 1XD8A 4GSOA 4TY7A 1DWDH 2ZIQH 2GZDA 3D31A 1UTKA 2W0SA 4E7RG 1MUEB 1GVKB 1KJYA 3EXAA 3ZVEA 1AS3A 1O2PA 1E1QA 2Z3CA 1ZBDA 2EEKA 4P31A 1W7AA 4MDSA 3M7UA 1V2LT 2PZGA 4HI0E 4XWKA 1ELDE 1FNIA 5GJBA 2K5UA 2EFGA 1WB9A 2JLXA 2Y81A 4ESTE 4FU8A 2B6HA 2GBLA 5JB8S 4JLNA 1P3CA 1VJAU 1CQQA 1S6HA 2YINC 2RKOA 1N0WA 2OFOA 4NL4H 3U3MA 1C1QA 4DEXA 1Z6TA 2FEQH 2FE4A 2HGTH 1T8LA 4Q7KA 5JCZA 2W6JD 2PHBA 3GISB 1NG1A 4BAQB 2MSEB 3BS4A 5FBQB 3QPWA 3GLHA 1O32A 3MWLA 3ZVCA 3STJA 2Z9GA 1SQOA 4QRHA 3NBXX 5KDDA 2RGNC 1S5SA 2Q9BA 2FU5C 3QQ5A 4JMPA 5TARA 2CHGA 4D9RA 2QRZA 2GEUA 3PENA 2P3FH 5B30A 1AN0A 2E1RA 1ZNWA 4UXIA 1NSFA 3VAAA 1KLIH 3IGFA 2YYZA 2FMJA 1O34A 2Q9CA 3ATIA 9LPRA 2FP7B 4B47A 2ZRBA 2ZFQH 1GITA 2XNSA 1YM0A 2CJWA 2WBLC 3DA9B 5FFMA 3RMOH 3EA5A 4K60A 2W26A 4LV6A 1TQ7B 2PKSC 4YMWA 3DDCA 2PKAA 3S9AA 4X8HA 2AS9A 2WWWA 5IYTA 2WUBA 4JVLA 2BVSH 1WF3A 1O37A 2ZCHP 4BTIB 4BRUA 1KI9A 3KQNA 4AKHA 3R8FA 5TCCA 2XBXA 2B0FA 3VB6A 4DCUA 3I92A 5BW8A 1TOCB 2DE8A 3LH1A 1K6MA 2FPLA 2F1RA 1GM5A 1E6CA 1NESE 1OFTA 1TRNA 4E7NA 3IPXA 2F1IA 4JBYA 2J0SA 2FSHA 1UBFA 2BY6X 2BVXH 2ZC9H 1ANCA 1MD7A 1IM2A 4ZKOU 1Y3XA 3CX7A 4Y10E 1PPHE 1R6BX 1V2NT 2QT1A 2RGAA 2C8YB 3RSLA 3ZS9A 1U0LA 1G3DA 4NPHA 1TA6A 2O8LA 3UQOA 3CX8A 1ZUHA 3AVUA 3K70D 4BEBA 2UUJB 3GJ3A 2NU3E 1PLLA 2ZE5A 2NU4E 3RC6A 5GPIB 1OJLA 1G30B 3CS7A 2G1KA 3GEHA 2W3IA 1O31A 2XZOA 1H65A 2HT6A 4PC1A 1Q1ZA 3RNLA 3V00A 5EJEA 3Q7QA 1B5GH 1FY1A 1OIWA 2YC4C 4BLRA 4UNQA 4UDWH 3RXUA 2VF7A 1E2LA 1CRPA 5EP1A 4LPSA 1MKXK 3BTDE 4FUCA 2IA5A 1YLCA 2O8TA 2V6IA 3BTME 2WHXA 1TGTA 1TX7A 2FTLE 5BRRE 4IFEA 1TNJA 3VGCB 1VTKA 2ULLA 2Z7FE 2Z3EA 4TZ6A 2WWYA 4KV9A 4B44A 4WMEA 4UD9H 2V3OH 2GEDA 1TNHA 3MU1A 3MNBA 4D7GA 3WRXC 3HDTA 1EX7A 2VNTA 4X8MA 4I1OA 5JJIA 5KOYA 1KI6A 4Q47A 2EI6A 1ETRH 3MU5A 3EA7A 3E5HA 4ABDA 2KAIA 1QHHB 3A1UA 5KDOA 1ZCAA 2VIVA 3TITA 2HWLB 1PQ5A 2AGIX 4YMTA 1OWJA 2OXCA 1NKSA 3O8BA 4AN7A 4L9WA 5HXFA 1LB1B 3EWSA 1BRBE 5JEDA 4CR5A 4QNMA 2OFXA 1MQ6A 3V9PA 4DRZA 1HAYB 2N1BA 3MGCA 3ZD7A 1BYUA 5EXTA 3VEQB 3ZQ6A 2GV7A 1CHOG 1P9UA 2F1JA 4BTUB 2H57A 3GJ4A 1TABE 2AIPA 3LT3A 5CHAB 2XTMA 1TQDA 1UDXA 4MUBA 1HJAB 1O5GH 1E0FD 3IG6B 5DKMA 5JBTA 1OXTA 2A78A 2LKCA 2ZG0H 4MKGA 3GLGE 6CHAB 1ZU4A 5DGJA 3OY6U 3CZPA 2ZDAH 2ZRCA 3SEAA 2DR3A 5FR1A 2EI8A 1AVWA 2O0JA 2WJJA 2AHOA 1QDEA 1KGDA 1QVAA 1M1YE 2J7PA 3BB3A 1HCGA 4WA7A 2ASUB 1C5TA 1XD9A 2JJ1A 4CW7A 2XC5A 3TR5A 2GHIA 1BRAA 1VIAA 1UPTA 1GBDA 1FTNA 4KSBA 2FDAA 3SV7A 5C20A 2YOGA 4KITB 1KSGA 3KQHA 1V6DA 5IK2A 3TSZA 3DKVA 3RU4D 4CT4B 2F9OA 3QKRB 1YPLH 1L1GA 3F8TA 4M9FA 3K53A 1HGTH 2CCJA 4ZHAA 4B2PA 1KLTA 3D49H 2EFHB 1ZJ6A 4A5TS 1YPGH 8ESTE 2VH0A 3HP1A 5HM9A 1GVNB 6GCHF 1P2QA 1OWIA 5F03A 5K8IA 1PQ7A 2GA8A 3MWKA 5EW1H 3U4QB 1FUKA 1GIAA 4KLZA 1G7RA 1E4YA 3P70B 5DP5A 1BT7A 1UTPA 3DO6A 1D9ZA 1E1RA 1TQ6A 4XVUA 2JIZD 3PCRB 4TMXA 5P21A 2QP4A 1C5MD 4ISNA 3HR8A 5D3MB 1G3IA 1A5IA 3F5FA 3MWJA 2P6NA 1UJ2A 2I1QA 2VVUA 3UKDA 1O2YA 1SVOA 4WAUA 3QOFA 3SFZA 2PEYA 5LB2A 1Z0AA 1RRKA 1E0AA 2FX4A 3CPJB 4M53A 1OFUX 3TAHA 1LTOA 1ZMNA 3NCLA 4RKOB 3PG5A 1R5NA 3ZYCA 3KL6A 2ZR9A 4DSUA 3O47A 3SHCH 1JQLB 1OIXA 3LX8A 3CWQA 1EESA 4B3DA 1OKKD 3BFKA 2G5NA 1W49A 1R2QA 5FUXA 5A8YA 1MT0A 2IUSA 4GUXA 4TZ0A 1J9CH 1WBGB 1E79D 4FUIA 4X8TH 4E5UA 5E7JA 3GY8A 2I6QA 2HF9A 2R0LA 4AD8A 2ZI5A 3BAFA 3SJZA 4XH9B 4I8LA 2GCHF 4CH2B 2NGRA 2H5EA 3RVBA 5DN6A 4ACAA 1NFXA 2F1HA 2FMXA 1XUHA 3K9HA 1JEDA 1U9IA 1S0RA 2YZ2A 4YOGA 3HU3A 3ADDA 1VR1H 1XPOA 4J0QA 2OESA 4M2LA 1TUIA 4DUGD 2MMGA 1J2JA 4HLDA 4BLTA 5F8XA 2XEXA 4IGDA 1COWA 1B0UA 1A2BA 1FAXA 4LJ9A 4G5OA 3U6BA 4I4LA 1J17T 2FFAA 5CYPA 4ZCIA 3AH8A 5LB4A 4QL3A 3AP2A 4X6MA 1BZXE 1BBRK 2Y7XA 3CX6A 4Z6AH 1ABIH 1EPTC 4D4LA 1K1NA 3CM0A 2WSMA 1DX5M 4LHVA 2VQSA 2FA9A 4MYTA 1S0QA 4CZ2A 4K69A 1TPSA 3IIMA 4TLDA 3I61A 2HF8A 4LXBH 1NIJA 4A92A 5H8WA 4LHYA 3ZZ0A 4WMDA 1SVSA 4HEJA 5T3HA 1KK0A 1KI4A 1XKAC 4C0JA 1C2DA 2DWOA 1X8JA 1O2IA 3P27A 5L3QB 4Q4AB 2CHAB 1SGCA 4TQAA 1BTZA 4OS1A 1GCTB 3B1ZA 4Q48A 2JJ8A 3H7TA 3I1FA 1G5TA 1UK2A 4X8SH 2B8OH 1QQ4A 5C1UA 1QL8A 2CL6X 1N5JA 4BRWA 1DAMA 3IIKA 2XSZA 3S1AA 2UZIR 4YQFA 4DLXA 1RTLA 3NXPA 1A4RA 3I62A 4A0RA 1GKYA 1LO6A 2GEVA 1K21H 1O2GH 2NU2E 3ATKA 3LXRA 4C7OA 4D80A 4PZYA 2QXGA 4SGAE 4NYJR 4N0EA 4WMFA 4Y71A 4LK4A 4BAHB 2ERYA 2TRMA 4U5XA 4H6SB 3STIA 1GBJA 3MWYW 5JBBS 4LJ4A 3MYWA 4TWWA 3C1KA 1JRTA 4DKXA 4UQOA 2BD7A 1JMOH 1VITF 1A0HB 2GXAA 3LJJA 2ZYWX 5EE3A 4QT8C 2P65A 1HAVB 1TBQH 2ZCKP 1HXEH 4DZZA 5FXLA 4OQNA 1ZMLA 1RTKA 3VFEA 3K9NA 3BH7A 4XBDA 5IHPA 1OHHD 4IMZA 4P4SB 5C2ZA 3C15C 2BTCE 2F9NA 1TONA 2Z6VA 5AUOB 1V43A 5CIWA 5L3RA 1FMGA 4YDHB 1W4RA 3AKYA 4OQLA 3M3SA 5H70A 1MRSA 2ZQ2A 1C1WH 4HZHA 4MTBA 4X2VA 5DJ7A 1GNRA 1G2LA 3PWBA 3QX5H 2V7QD 1OFIA 1QHHA 4BEJA 1P2JA 4Y7BA 3X1DA 2OFWA 1OPXA 2GK6A 3LGIA 4AGJA 1ID5H 5LPFA 4DSOA 5ELXA 2BMEA 4PQYA 2GNOA 4YLGA 1ZCBA 3QG1A 1P75A 3TNTA 2ZDNA 1G64A 3U69H 2IUTA 5KYKA 5GJCA 2BOHB 2OTVA 1Z22A 1O3OA 4MKFA 2QENA 5G4BA 1TGNA 3R20A 1KSJA 3K1JA 3NPSA 3N2EA 1ETTH 4NP6A 1FTSA 1P2TA 4ZKSU 1BMNH 1L1NA 5J4QA 2NO6A 3ZZCA 1VHTA 2ATVA 1ZINA 1YKTA 3RLWH 1YZTA 1BDAA 3W94A 3D3QA 1DWEH 3DHWC 1CT4E 1P72A 3SBDA 5DSZA 1T6NA 3RU4T 3AF4A 4C2UA 4IDNA 4ZHLU 4DDVA 4YXWA 5HR5A 3EYDA 1VG9B 4AK9A 4XFQA 2ANMH 3QN7A 1RYFA 1TMTH 4NONA 1GP2A 1LY1A 1VKJA 1TEVA 4UEHH 5LH8A 4U7DA 2XRCA 4RD0A 3KZ1E 5PTPA 2FESH 5EU8A 2GXSA 2P0EA 2G9NA 1Q22A 2LNCA 3LWNA 1ARCA 1KLJH 1VG8A 2JDID 5BQ5A 1ETUA 4K8OA 1E32A 1KXEA 4GZMA 1SLVB 1XPRA 2ZETA 1KI1A 5HYOA 1BTXA 1A5GH 1MKXH 3TNSA 3FWYA 1C4U2 2P8OC 4RN6A 1AQUA 5E4FA 2F9LA 3QSYA 3U4QA 1CEEA 4MPVA 1XXDA 3SS8A 2BXTH 4BECA 3FZZA 2BEKA 1OV4A 2V6NA 2XXAB 1ZMXA 4H6TA 2DFNA 2FS8A 1AZSC 4ON9A 4F4CA 1BMLA 2G55A 3ESTA 3WNDA 5JDUB 3PIRA 4EJSC 1A5HA 2NG1A 5D3MA 1SVMA 2ZSAA 1YKSA 4JJKA 3PLKA 2GETA 3BTWE 4O97A 3LH3A 4ZKDA 3SV6A 1HTWA 1NSTA 1F2SE 1NLYA 3A84A 1B0EA 2IYZA 1QHRB 4L16A 2PT7A 4ESHA 2CVHA 3WRYC 1AU8A 2DCUA 1D9IA 2QGNA 1UTJA 4I8GA 1O2SA 4B74A 1XMNB 4X2XA 3BTEE 3BERA 4TWZA 3M4YA 1C5LH 3B60A 1XMVA 2ZQ5A 1HJ8A 4UFGH 1Z6AA 1JRSA 4LHXA 3AF2A 4MRVA 3U44B 1IOZA 1S83A 2OC8A 5TCAA 2IL1A 1TX4B 5HE9A 3HPRA 2WJHA 1SGEE 4OI4A 3VR6A 5JFGA 4GL2A 1C5NH 5JJLA 3E1SA 1GBKA 1P5ZB 3KTAB 4Z1MD 4WZ6A 1O5AB 5JBCS 2WJGA 3V0XA 2H18A 3QENA 2NU0E 1G3EA 4HTCH 2FFQA 3B8HA 3LFUA 1JI0A 2HV8A 4DLUA 4HLQB 5HPYB 2EA3A 1NMXA 4ZI3A 1RXPA 1FX0A 3AKCA 3SJOA 5CMXH 1LHEH 3BOSA 1R5OA 1Y3UA 2VSOA 3AQ4A 3AVVA 1NRSH 2O5VA 1LHCH 3SU1A 2QIQA 2DWPA 2FZ4A 2EQBA 3ZS8A 4P32A 2FJUA 3MU8A 4HAYA 2TGAA 1KIMA 3RXKA 5JCPA 1F0TA 2QORA 2CF9H 2FNAA 1OYQA 5JRZA 4G5SA 3HK3B 1ZAKA 3K09A 3SGQE 3BK7A 4TMKA 2O52A 3PEWA 4AFZA 1S1CA 4OYHA 1HFDA 2FTMA 5EPYA 1N6PA 5C18A 1NN5A 2VIOA 2BQ7B 1ANDA 1II0A 3ADCA 2ZFFH 1LDTT 4DIDA 1CR0A 4I81A 3EC1A 1RIFA 1TU4A 2QZ4A 3N7OA 5EXNA 4DCVA 1FIZA 1R0WA 3EARA 2BY8X 3C27B 4TTPA 3SW2B 1FQKA 5EQSA 1GL6A 1RKBA 5L3QA 5DP7A 1E2DA 5HKKA 1V2VT 1Z1JA 2WTUA 4YO9A 1JIMA 1FUJA 2A5DA 4UONA 4QGAA 3FKSA 3KQCA 1P9SA 1P3JA 4M1OA 3UG7A 4JLVA 1K28D 2W0MA 4FU7A 7ESTE 2BM2A 3NTUA 1SSXA 2IYSA 1GI0A 1NIPA 1HAPH 1GBBA 5HZKA 5BN4A 5C4MA 3KQUA 1PYTD 3EE0B 3PMAB 3UR9A 5EGMA 1DAFA 4JZKA 4X6OA 3SU4A 4A1XA 5E2OA 3QWCH 1GJ5H 4PPGA 3PV2A 1QHNA 1EGAA 1J70A 4FCWA 4HLUA 1T0HB 1D6JA 3O8DA 2BC9A 1UKZA 3L33A 2PTNA 3AVTA 4XE4A 4RVCA 1YE8A 1E2KA 4QGGA 2QQ0A 2Q6TA 2FOMB 3GJ5A 2BLOA 3QXCA 1MV5A 2OD3B 2ZU1A 3GFTA 4MPXA 2QV1A 3UNSA 3GFPA 1LF5A 3B1YA 1OXGA 2V6JA 4EPYA 1GBAA 3BGWA 1Z08A 2B21A 2XB2A 1ELEE 1WMSA 1SGQE 1SC8U 1HAVA 3R3GB 2A2XH 4KELA 2EWVA 1Z0JA 2ZRGA 3PLBA 3KKNA 1NRRH 2W3KA 1Z06A 3ZZ4A 2AMQA 3GLFB 2O8EB 2NWNA 1VG0B 2F9UA 3S7KB 1OW3B 2GZ7A 1RZ3A 5FL7D 1AMHA 5LD2C 5A0BA 2A30A 1WCV1 1D9XA 5FCRA 2Q6GA 4B3XA 2OXRA 4CHAB 2XAUA 2VP0A 2R9PA 2G8TA 4LBWA 3W95A 3T5DA 3VNUA 1YU9A 1E9EA 1AWHB 1C1YA 1CJVC 3T1TA 3SHFA 5FPTA 1BBRH 2ZREA 3V12A 1QHGA 3M7QA 1XMJA 1OB2A 5HZHA 2D7CA 1PVOA 2ZI7A 4TT3A 4J1YA 2XX3A 1W0KA 1NU7B 2ZYUX 3HR7A 1NVXQ 7KMEH 1MH0A 1WAYB 4OS5A 3AF1A 4DLWA 4JCNA 4GI7A 2H8KA 2N42A 4ISOA 2HJGA 1D3TB 4A6LA 2OAQ1 3A85A 4MNVA 2QBYA 1NZQH 4W7SA 1H1BA 1WXRA 1NVVR 4MITA 3TSWA 1XJCA 1EP5A 4XSHA 2D3WA 3LVRE 1C1MA 2REOA 4GOXA 3EPLA 2F3TA 1GKIA 1YPMH 4MGYR 1QL9A 3ZYDA 2BLWA 3K0EA 1XP8A 2OBMA 1E9FA 3K0CC 3U3OA 2P3TB 4FUBA 1KNXA 3TH2H 3MNXA 2JLRA 3OEED 3RXAA 4X8UH 4UJ5A 4FW9A 3SHWA 3TK9A 4EFNA 3BG8A 4AC9A 4Y0ZE 4IC5A 2W2XA 3D7MA 3RXLA 3VTKA 4OI0A 1AB9C 1A7JA 2D2EA 4HAUA 3ICQB 3EZ9A 2FOAA 1TLDA 4HI3A 1SXJB 2ZFPH 4ZDJA 3K9LA 4MGIR 1GJ9B 2Y7ZA 4OK5A 2IPHA 4GZLA 3V13A 1CJTC 3NC1C 4DLRA 3B78A 3U7HB 3RS4A 4PAOA 2F83A 5HGGA 2R2WU 4V0OA 3UPEA 4FD2A 1XD2B 3CNNA 4ISHH 2VWMA 4ARZB 4KFUA 1UMAH 4V0KA 2XXLA 2ZI2H 1HAGE 2C8XB 5DISB 2CK3D 2PT5A 1C2GA 4LY6A 4KU4A 4M1TA 3LW7A 3M5OA 2XXAA 1VCMA 1DVRA 3NKVA 3VXEH 3TJZA 2IHBA 4JYVH 3N70A 5DNYB 1CVWH 4AURA 4RKJB 5B64A 2A45B 2GCNA 3ZZ8A 2HNTF 1MCTA 2GF9A 3FPAA 1MTNB 2UUYA 3AV0B 5L2YH 1CGJE 2VINA 1Z0IA 1TL7C 4FMBB 3L0PA 4X1PU 2G00A 1HURA 1PYTC 1BQYA 5J40A 5DI3B 1NY22 2FSGA 2D26C 2I6SA 1XXHB 1HB0B 2BBWA 4BZQA 1PPEE 4Q02A 5G3ZA 3QK1A 4Q1FA 3Q3JB 3S9CA 2OILA 1Q20A 4I31A 3DFJA 2YKGA 3GJXC 2ZCLP 1LKBA 1EB1H 4ZHMU 4BLSA 3QI2A 1J8MF 1G4UR 2VWNA 2W6JA 4B75A 5KNCA 1P9NA 4GLYA 1AZ8A 2AKYA 4AX9H 3KTAA 4LJ7A 1EB2A 1Y5BT 4JZ1A 3H1TA 1E9SA 4LOAA 4NZYA 4BAKB 2FLBH 2PCLA 5LPNA 1E9DA 2GJKA 3P8FA 1FUUA 1SHZA 1OB5A 4KVGA 2P16A 3OIYA 1W0JD 3FFGA 1O5EH 1XEXB 1KSFX 1GAJA 3NBFA 1LF0A 4NH0A 2IT1A 2TPIZ 1O2XA 1O5BB 1ZTJA 3EIEA 2WVJA 4RKFA 1GPZA 1S6FA 1C1PA 1TEXA 1D3QB 1G8FA 3P8OA 3SZNA 2GBLC 1UTNA 4B76A 4NU0A 3F0TA 3GP8A 4LWZA 3ZZDA 1X8KA 4A2PA 5JB9S 1G8HA 2J2UA 5B6LA 4X8VH 4Q4JB 1I4LD 2C9CA 4BASA 3GLIE 2P5TB 1E38B 2C95A 1QTFA 2TBSA 2SGFE 4JK5A 1E94E 4WVPE 3CPEA 3ATMA 1HAXB 3D62A 1XWIA 1L4ZA 4F93B 2Z5FA 4GVUA 4MDFA 1DSUA 5IK2D 1UBCA 1ZHRA 5LPRA 3ZLJA 3Q3XA 2ZUCA 3BF6H 4LYFA 3ZZ7A 4QBGB 4ABIA 5EE5B 1WOFA 5KU1A 3GMTA 2FYQA 4WXRA 1F60A 1V3XA 2FOHA 1EZSC 4XTRA 4AY2A 4QHSA 2WPLS 1I4DD 5AJZA 1RC8A 1NU9A 4P33A 2AWNA 3BFXA 1P3EA 3MMGA 4YOJA 2NU1E 4B33A 4BZPA 1C4Y2 1NG9A 4BFXA 3TLXA 4BE7B 1P02A 2A32A 2AIQA 3PV5A 5CJ2A 5GNDA 3ZVDA 1SOTA 1P10A 2ZHEH 2GT8A 1N0UA 1C5RA 1E1RD 1UVPA 4U01A 5FTNA 3QUSA 1O3FA 2BBOA 5FOSA 2R3YA 4IS5A 5A0FA 1BTUA 2VHUA 1GNQA 3CRMA 2HCJB 5EG4A 4US2R 1GRRA 4Y7AA 2F3CE 1ELFA 2THFB 1TWXB 1E9BA 3ELAH 4HDOB 1GGDC 4I8HA 4X2YA 3QF4B 3ZZBA 3DZ8A 2VYFA 1SHKA 5ANRB 3G5UA 4YTAA 1TAWA 3L6PA 2ZTYA 3FHOA 1KJZA 4Q4LA 1OOKB 4AOQA 4DVGA 4JLAA 4JYBA 1JECA 3EPHA 3RSOA 1A3EH 3ZYEA 1ZYOA 2GMTC 3LAWA 1U8AA 3QBTA 2FH5B 3GLFA 5FOVA 1BH2A 1NFWA 8OHMA 1PLKA 4A8JA 2QY9A 1Z8FA 4B3GA 4Q7ZA 1VZQH 3F6UH 3R9XA 3AAVA 1THSH 3T26A 1NL3A 1OH6A 3KEEA 4FU9A 1DO0A 1IN7A 1SKQA 3NC0C 1N6YA 3A1WA 1AGJA 5T6FA 4N1AA 1IQMA 1ZGIA 1Q2WA 2ZJOA 1LHGH 1UEJA 3LDXH 4NCYA 4BFYA 2KI5A 4TTQA 4DGJA 3L43A 2Y6TA 1IN4A 2CLDX 4HDQB 2J0QA 4HSEA 2OXSA 2IYWA 1THPB 1MD8A 3LLUA 1R5BA 4O3MA 4LZ4B 4B3FX 1SGFG 3O8CA 2G0TA 1YPEH 4X2WA 5DP4A 2PKSB 4FIDA 4QBIA 1LVBA 1FDPA 1K9OE 3TPIZ 2V3CC 4AZ2B 3D6TB 2YWGA 3KQEA 5FBRB 3VXFH 1RPZA 1G1MA 1WDTA 4IEIA 1K1PA 4LYAA 1Y3YA 1EKBB 1ANBA 3TU7H 3AVQA 2WAYA 1VYUA 2C8WB 3GCHB 1G20E 1O3AA 3LA6A 1YZNA 1SQAA 2PGQB 4ASUA 1BBRE 1V2TT 1SKYB 2GJ9A 3LD9A 1KO5A 1FY3A 2FLRH 1U81A 4EIWA 2QL6A 2L0XA 1F0SA 3VFDA 2P93A 1KXFA 2R6DA 2ZRNA 1MBMA 2IYLD 2IUUA 1SXJA 3FFBA 1KSHA 2BDCA 4SGBE 1Z2CA 1TF7A 4P4TA 2QAAA 4URVR 1V5WA 4FWIB 4Q00A 3W5IA 4JBXA 1PPFE 5BPEA 3IUYA 3PUZA 1PV4A 2OCAA 2GAAA 1GSIA 2V9PA 3QG5A 5EOKA 1GMHF 1C4OA 1N6RA 3SZRA 3BEUA 4M22A 1P2IA 2VVVA 4ABFA 3RDPA 3ZZ5A 1VITH 4V0LA 4IEEA 2BY5X 1TX6A 1WU1A 1OKKA 4UNNA 4PO1A 1BIFA 1DOAA 4RSGA 1TGSZ 4QBFA 3M36A 1W4CA 1E79A 3A86A 4OQMA 1OE0A 1ANEA 3Q8XB 4D82A 3UPUA 2X1VA 5TV2A 3NWJA 2RH5A 3B1WA 1G3MA 1AKEA 1FXYA 3AGPA 1XXHA 1QQUA 5DP6A 1O35A 1JWTA 1TNKA 4F38A 1KIGH 3HPTB 4FCVA 3SE0A 2MSDB 3BWDD 1I2MA 3PUXA 2O0HA 4CYMA 1W8BH 1R0YA 5A0CA 3P8GA 1BOFA 4XDEA 4CEJA 1C5VA 1M7GA 3F9FA 3RXDA 4IBLH 4DUGA 1VDZA 4DB4A 2WMNB 1LQDB 2OC1A 2XOKA 4JL6A 4LUCA 2CMYA 3B2EA 3T27A 4DLYA 3QTVH 1OWHA 3B9PA 4PHGA 3U6KA 4FMDB 1VCNA 3R7WA 1L1JA 4B6EA 3FTQA 4LJ6A 2IX3A 3RXRA 4HB3A 2DFLA 2AR7A 2HYDA 3ZQJA 3SYLA 3DEFA 2IYRA 5JZVA 3EASA 1ESNA 3ZGXA 1J16A 4ABAA 2X8AA 3NEJA 1RYHA 4HZUB 2G88A 3GICB 2ANKH 2BDGA 4BGDA 1W48A 5AUNB 1GHWH 3MTYA 3IBYA 2IW3A 2DFTA 5GCHF 3A1TA 1OXSC 1SL3A 4ZIRB 4CGZA 1U9IC 2QSZA 1DAGA 4LC0A 2Q6DA 1LNZA 3W6NA 1RTFB 1GJ7B 4D7FA 3NEYA 2FPKA 1GBMA 1WXQA 1DAIA 2H1LA 1U0JA 1ESMA 1Z6XA 1G21E 3SZEA 4AG5A 2OQ5A 4YXWD 4RZXA 4NZQA 5JMTA 4ZMAH 4OK3A 1C2IA 4EUNA 4F4IA 3U3KA 5GXPA 2B7DH 4TMZA 1NBME 1HBTH 1JQJC 1T9HA 4IDPA 1P2KA 3LJOA 1XEFA 3AUYA 1W5SA 1WYKA 3SDZA 3LBHA 4GCHF 4ZH8A 3EA9A 1QZXA 3MFJA 3H84A 2ANWA 2ODYB 1RJ9B 3I29A 1FY8E 5H1YA 3QKSA 1WP9A 2OCYC 2YOFA 1C5QA 3FMIA 2ZKSA 5TMPA 5FX6A 2OCVB 1G3UA 1YRBA 3SQHE 1O3LA 2GKSA 3Q72A 2V4ZA 4MYUA 5TDHA 1RW4A 4OBEA 2BV3A 1OWKA 1F2UB 2ZU2A 3L0IB 2OEPA 1DUAA 1ZPZA 2XGJA 3A7VA 3P32A 2ZU5A 1BYIA 2REBA 2EFEB 1XJQA 1OHHA 1NKTA 1ORFA 4V0ME 1DDJA 4LJ8A 1C5XB 2D2FA 2AH4X 2A5GA 4Y6DA 2W5EA 4OJKA 4OHVA 2BMDA 5G3YA 3SJCA 1PPZA 2WJVA 3NG1A 2BVNA 3QF4A 1ELBA 2EFDB 3THOA 3PLPA 2BJWA 3UWKA 4OS2A 1K2I1 4PQFA 2WIAA 3K65B 5J4YA 4Y8YA 1ZZZA 3OY5U 3PVSA 1W47A 1O5FH 4Z51A 4OS4A 1NVWQ 4ABJA 2J0UB 4BFSA 4K2YA 2G6BA 4PO8A 2HUPA 3BIFA 4L8GA 4XOIA 2PW8H 1FL9A 5TXGA 3A1SA 3LGYA 5KO2A 3E0NB 1J15A 1NN1A 4AYXA 1SVIA 4GPGA 2FFBA 3A8CA 1ZHMA 1AHTH 9ESTA 5CM9C 3AGQA 1BS1A 3ZZ6A 1EXMA 4RZ3A 1BJUA 3X1WA 3HU1A 3DHKH 5FOXA 4NWKA 1F5LA 2E87A 4QJ3A 3CB4A 2QPTA 4AI6A 1JR3A 3RXMA 4AKGA 1TQ2A 1O2VA 5AJVB 1C9PA 2PJZA 2G51A 4KYUA 3P4YA 4DT1B 2YOLA 1OP0A 4ZCLA 4DOQA 3CW2A 1IXZA 1U8YA 2FWWA 1UF9A 3PUYA 5GJVC 1H9IE 3CH4B 3LO5A 1LCYA 5A8XA 3V7TA 4QM7A 3WY8A 3AF3A 2Z6BD 1OF1A 4A1TA 2H7VA 4IVQA 3TK1A 2QGZA 3KXIA 4A6PA 3GLHE 2QU8A 1FIWA 1C1NA 4QJ5A 4IN2A 3UNQA 1YJ5A 2ECKA 3GY3A 1A2KC 2G81E 3K0SA 4BAOB 1ONBA 2JDIA 3LV8A 1H8HD 1GG6C 1QBOA 2GX4A 5JS8A 3A83A 3HK6B 2P3UB 3H86A 2R6AA 2DFKB 4EPVA 3WYFA 2M5TA 1M34E 1TAGA 1SMFE 3FANA 1QR3E 2YOHA 4FUGA 2H5CA 2GV6A 1Z3IX 2KSQA 5EUMA 1UBGA 3TR0A 4DIEA 5EZ5A 1G16A 2IEYA 1GMCG 1SULA 1A0LA 1LPGB 1MO5A 4L9SA 4NSYA 3KKQA 2N46A 1EAIA 4IDHA 1C5ZB 3SNEA 4YLUA 5FBLB 3RXSA 3H0KA 3CP7A 3V4RA 2X77A 1Z0DA 1ZTLA 1FPCH 4JL8A 2ZYTX 2V8OA 2O8MA 1C2HA 1S8FA 2FGJA 1TF2A 3AVOA 2NO9A 1P2MA 2Q21A 1UM8A 1Y5UT 1ELTA 2ORIA 3OTJE 4QM6A 1KAGA 1V2RT 5IDKA 2QMUA 5DP3A 2VRWA 2WYGA 3KJEA 2P6UA 4YONB 4Y8XA 1Z0KA 4CRAA 1YBWA 5ESBA 3K0AB 1G8GA 3ADKA 3OFND 1EX6A 3W90A 1WTHD 2QXJA 4NA8A 4Q7JB 1AIPA 2CV3A 1P04A 1B0FA 1T31A 1P62B 1BUIA 1RRPA 4FMCB 4U32A 3BRWD 1Q1EA 3U3RA 4Q7MB 2IYQA 3X1XA 4XSGA 2ZQ1A 5HTKA 4PXAA 3OX7U 1SHYA 3MNCA 3OESA 3B8JA 2W2VA 3RXBA 1M7HA 3ZIAD 4A4DA 1VGCC 4WY3A 3SQWA 2A1DB 1F5NA 1C2LA 1IY2A 4Q9HA 1QHYA 2BMGB 1VIYA 2ZFRH 1EOJA 4JIMA 1X6VA 4C0LA 1IOEA 3A82A 3Q00A 3PEVA 1Y59T 3VMFA 2QMEA 4QC2A 1IHTH 4ASHA 1IQFA 3RXPA 1SLWB 1GBCA 3IHWA 1W2GA 1IONA 4R71A 4D4MA 2BDHA 4W9MC 3EZ6A 4TT3D 2HNTC 4IVPA 2E9SA 3GY6A 3I78A 3UIRA 4B6FA 2R44A 1ACBE 4R7ZA 1GI8B 4CR9A 2YC2C 4A0FA 1O3KA 3AK5A 1GNPA 1NY5A 3SJIA 1Z63A 4WXVA 1O2RA 3VQTA 2WICA 1KDQA 2ALPA 3TGIE 1P09A 2FOEA 4PSAA 4JS0A 2VO1A 721PA 3NIBA 4BPBA 1ZM9A 2ZTSA 1CR4A 4KFRA 1M2OB 2J7KA 2W58A 2WKQA 5A8ZA 2AGEX 1F5RA 4O03A 2VSXA 1KTTB 4ZIRA 1CU1A 2J1LA 4C0HA 4JT4A 1F2TA 1N25A 2QP3A 4R98A 2Z4RA 2V3HH 4IXMA 4O25A 1WQVH 2GDEH 2I4IA 1NROH 2F43B 1UADA 2AMDA 4DLZA 1AZZA 2B8WA 1ZVQA 3A89A 3TGJE 3LBNA 5AFYH 2BQWB 3K09C 3HYTA 3ZVNA 4HB2A 1P9RA 2P8OB 3IILA 2C9YA 3TMKA 2VGCC 2FOCA 2ZIAA 4LBVA 3GCGA 4HUTA 4OGXA 3UANA 3FOZA 1KMHB 3CENA 1GMDF 3GYLB 3WXMA 3VX3A 3M3VA 1O3YA 1Q3HA 3A58B 1RJXB 1L0ZA 2R6GA 2DB3A 1GUAA 4IOMA 4OI2A 1T8NA 1WRBA 4ZO4A 5JJKA 2J5XA 2PUXB 4ABHA 1G32B 4I32A 5F9HA 1KKLA 2CHVA 5GVSA 4W5HA 4JZEH 2GK7A 2CHAC 2RG3A 4NSVA 3LW8A 6LPRA 1LS6A 2CHQA 4PZZA 1GCTC 1Z2AA 4NE2A 2WUCA 4XBCA 5TY0A 2ANYA 2RGEA 5J4SA 1VHLA 2QGRA 1Q1BA 3REFA 1AD8H 5FL7A 4AYTA 8GCHG 2JLVA 1ZM2A 3TJOA 4AYYB 3TK6A 2ZDLA 1G19A 1WQ1R 4M9SA 1DLEA 4HLUC 4NA9H 1W36B 3ZVMA 1C5OH 1AVXA 3MHWU 1OKXA 1SBWA 4Q21A 2W00A 2ZUBA 1J99A 1BTWA 1RFNA 3PMBB 3A4NA 1H8DH 2IS2A 3FHCB 1QBVH 1P12E 1OXVA 3M35A 5DLQC 2P6RA 4DB2A 3RS0A 1PJRA 3U7GA 1SB1H 1W0YH 4M0LA 2KJQA 3T5GA 3L2OB 4OQXA 1ELCA 1HQYE 1QCPA 2Z9LA 4HUQB 5C2JB 4JMYA 4H42U 1KK3A 2AYWA 4YMUA 4F91B 2VU8E 3U1IB 1QJ1B 3VU9B 2VA8A 1T3HA 1CIPA 2ZF0H 3NXSA 4FXGH 5J4HA 4A9AA 3S7HB 3TK5A 3A1VA 1NI3A 1JJ7A 3WBJA 2ODEA 1UAAA 4Y0AA 1PUJA 2ZS7A 3OEEA 3QXJA 1TGCA 3X1ZA 3THWB 1DICA 3KL4A 5EQRA 1OFHA 5AUPB 2ZR0A 5HM2A 1QJ7B 2A4RA 2ODQA 4U30A 3TIUA 4Q1CA 2QE7D 2ORWA 2ZPQA 2QN6A 2ZGBH 2IYTA 4MGKR 3HGNA 1S84A 5J5CA 4WWYA 4AGKA 2JEOA 1BCUH 4OHYA 2XTNA 1EZXC 1N5KA 2QI9C 4Q1BA 1G6OA 4FUEA 2QTFA 1T3LA 3T1QA 4MRRA 3L82B 1FN6A 4DHEA 1O2OA 1W4BA 3RXGA 4PC6A 1QG2A 1E2NA 3R8CA 4D4JA 2V35A 3I73A 5BYJA 3VKWA 2FX6A 1K1OA 2XWBI 2QPAA 4TYPA 1GRNA 4TYDA 2EVWX 2CK3A 4IDQA 2ZFSA 4GBMA 2CDNA 3RXIA 4TYNA 2YNBA 1LVGA 3QKTA 5F9FA 2ZHQH 4Q18A 3Q3KA 3J81k 3QY0A 4MRPA 4TL9A 4PPNA 2ZE7A 3RC3A 5LDDC 1C5YB 3AKEA 1EASA 2FGKA 1XUJA 4YOIA 1HV7A 2BEJA 2W7SA 1L2EA 1C2KA 1BIOA 3DOFA 1NLFA 3E1XB 4ZDWA 5J4KA 4JLOA 4NDZA 1AE5A 4NCHA 2MSCB 3SGAE 4F4OC 2O9QA 3DKPA 5KPDA 5KNDA 3VB7A 3HYRA 1S9DA 1FY5A 1U90A 2VIWA 3K0AA 2OINA 1CA0B 5AVDA 4US1R 5F98A 4EQ6B 1DAHA 2C04A 3UOPA 2BOVA 5EP4A 1P6XA 1XVMA 1A5TA 3T5FH 3CUEF 1NP6A 5LD2B 3GEIA 3NH9A 4X6PA 4MG3A 4LHZA 1MU8B 3ETLA 3FVQA 2C8VA 1U94A 1T4UH 1A0JA 3QEJA 5K7RA 1CA8B 2BY7X 2OBLA 2Q3FA 1QY6A 4KTCA 1Z1IA 1UEIA 2JGNA 2JH6D 3SOSA 2ZGJA 4X6NA 1W0JA 4FMDF 4FVBA 1FLEE 1AM4D 1EFUA 3EC2A 3BTTE 2UWPA 2R2AA 4KHZA 3SNCA 2ZITA 1US8A 3AAUA 1EJNA 1KDRA 4EFLA 4C0BA 3A8TA 1DTSA 8KME2 2XJ9A 3PUWA 3AVXA 1RGQA 2MMCA 4BFVA 1XTSA 3PB1E 5EXSA 2GZ9A 1W13U 1TBRH 1AZTA 3EAJA 1RRCA 5ESTE 5A09A 1GTVA 1O3PB 3C5HA 4BLOA 2AGGX 1ZRHA 3BB4A 4OGYA 3NH6A 3UMSA 4CRGA 3JVUA 2J3EA 5AFZH 5F8ZA 1HNEE 1D3PB 4IXNA 4M21A 3SU3A 3NDPA 3DOEA 4MNWA 1EJAA 3D8BA 2H9TH 1SVLA 1UTQA 1EX3A 4O3TA 3KUCA 4YM9A 3PROA 2OHFA 1SVKA 1MTWA 2FWRA 4CRWB 3M3TA 4YLQH 1O2QA 4TLBA 1MOZA 1IAQA 1AFQC 4FN5A 4THNH 4FUHA 1FZZA 1WE2A 2O8DA 5T6GA 2BHGA 3ZZUA 2ZDMA 3THXB 1E2FA 2BZAA 5E0GA 4S35A 4TTRA 4MGZR 4BXWA 2JH5D 2FZLA 1Z8GA 4ASUD 1ZGVA 5L3SA 1F0UA 1Z6JH 4B3CA 1XEWX 3QVUA 1ZM4A 5EUQB 2FOGA 2PLXA 3FGNA 1SXJD 4YT7H 2ATXA 3MH4A 1K8RA 4Q9JA 2VEDA 1O2UA 4RZUA 4N0DA 2XZLA 2FI5E 1SVPA 3FYHA 3M7TA 3W3ZB 4IOJA 2C3SA 1KMHA 4L15A 3CS0A 1TMUH 3NBZC 4Y11E 1H4WA 4I8JA 3A87A 1O3MA 2IS1A 5CIQA 1Z29A 1BRUP 1AE8H 1FZQA 3TSOA 5BN3A 3AVWA 5EE9A 4DBLC 3I4LA 3PITA 1O2KA 4URZR 1S96A 1CGIE 2XBVA 4O2LA 7GCHG 2QN5T 4MA4A 2A9KA 4K81B 4DCDA 2RGXA 8LPRA 4X1RU 3CONA 3RUOA 1GBHA 3NUMA 2WAXA 2B5TB 1AJEA 2XZPA 1G36A 4DCSA 3K70C 2PJRA 1CHOF 1G3BA 1ZSJA 2IC5A 3LXXA 1TMKA 1Y8TA 2HXSA 4M1WA 3GPLA 1NFYA 1MKWK 1YZGA 2FOBA 1YCPK 1N5LA 2VVCA 2WKRA 3B9QA 4HAVA 3I3SR 1O38A 4Q5IA 1DAKA 1E2GA 3UWOA 3Q3YA 2FPZA 2LPRA 2XCNA 3MH6A 2D62A 1SQTA 1GHAG 121PA 2FN4A 1WQSA 3WMFA 3EIQA 4US0R 1GI6A 1HE8B 1BTPA 2ORVA 3MH5A 4IOKA 1O2LA 2XOKD 2B7CA 4NIXA 1EAXA 2Q0HA 4HAZA 1CBUA 2HNTE 1O87A 3E3TA 1ZPCA 1E2EA 3OAAD 1PJPA 1FY4A 2D1JA 2P67A 3SI3H 1GJ4H 2NO1A 1YZKA 1GJBB 1E99A 4BFWA 1E35B 1GVZA 2BCGY 2X2EA 2OZEA 3VHLB 2UUKB 1VYTA 4KYIB 5DP9A 1O33A 4IN1A 3D65E 1XDBA 2IXFA 4H4FA 3SU5A 4D0LB 3VU9A 1KDPA 4NG9H 4VGCC 3UY9A 3QIAA 2KBFA 4URYR 2A2ZA 4A8JC 4Q1EA 1TPAE 2WMOB 1XX6A 1T3SA 1AI8H 2CJIA 5JSZB 3SUGA 5EXMA 4ZI2A 1TRYA 1D6RA 4B1TA 3VR5A 1X1SA 5BXQC 3U8TH 5FUVA 2LWIA 1CJMA 1TNIA 2VHTA 2GXQA 3R9IA 1WUNH 3GDSA 1JIRA 4OS7A 1WTGH 1O3HA 4B3BA 2JETC 1L4DA 2QF0A 1FV9A 1N6NA 5FUYA 4D0NA 4DWJA 3IWMA 3SBKA 2C99A 4NYJQ 5A0AE 2ZGHA 2CJWB 4QJ4A 2A5FA 3BE4A 1G9XA 2R2MB 1CT0E 3T12A 5L2ZH 3JVVA 3ASYA 1V2PT 4EPXA 3TBKA 1P05A 5KSOA 3DVLA 1QURH 2PKAB 3EZFA 2ZRKA 4ACBA 1FQJA 1GI9B 4QHTA 1SHHB 2VP2A 3CNLA 4URWR 4M8NE 1BMFD 3VR3A 5EQTA 5E2PA 3U7FB 2H16A 1KK1A 4WH8A 1BKDR 1I2DA 2Z43A 3QF7A 3LGVA 4KBFA 4PR0A 2ODNA 1H8IH 3VNVA 2WWFA 2BVRH 3L0SA 2VHQA 4LCBA 3KB1A 1IY1A 5DHAA 4JZDH 3BJIC 2WM9B 1O2TA 3EAQA 4GP7A 3EQ0H 3AF0A 2R9VA 1L4YA 2VIIA 4FMCF 4TYYA 4JYUH 4OHXA 2QA5A 3T35A 2ESTE 3GOVB 1SXJC 1CHGA 1W12U 2ZSDA 5TJXA 2PZEA 2ZXUA 2D4HA 3WBKA 2ZRPA 1HIAB 1G7SA 4ZKEA 1IN6A 1YYY1 2GMTB 1C1UH 4C4PA 2ZTXA 5IDVA 1ZUIA 5LGOA 4P4UA 4MVNA 1XUIA 1AKSB 3M5NA 1DG1G 3AP3A 2IYUA 1Q12A 1O2JA 1DE0A 2BOKA 2EC9H 5GWZA 3NKKA 1P73A 1HH4A 3T61A 2IBMA 3EX7C 5SZJA 1PPCE 3FHTA 3OSYA 1VCPA 1EAWA 2ALVA 4DDWA 4CBOA 5BYKA 1QRAA 5C3NA 2RAPA 3WY9A 1T8UA 3RANA 4DC9A 1SGIB 2A7HA 1FNNA 1TE0A 2NMVA 2BY9X 1A4WH 2D74A 3URCA 2ZUDA 2GZAA 1GZSA 1QG4A 2DBYA 3EPJA 2GXUA 2IF2A 1NS3A 3I8SA 4BFZA 1LV7A 3TUZC 1DFPA 1GL9B 1YPJH 1JALA 4UFDH 3KXKA 1X1RA 1TBZH 4YT6H 3RWMB 1FI8A 1XXFA 1HUQA 4RY2A 4MRSA 5DG6A 1IQHA 2PL3A 4C3ZA 2QNRA 4I33A 1ZD1A 1JR3D 2P5SA 3BEIB 4TL6A 2UZ3A 4MH0R 3P8NA 3SV8A 1WBDA 2AFHE 2WOJA 1T0JB 2BBTA 1AO5A 1EQ9A 4OL0A 1QHSA 4YMSA 3FP8E 1H9LB 2SGEE 2VWLA 3GYMA 1G17A 3DMDA 4GP6A 4PSVA 3DMNA 1XFAA 3ZVBA 5C5NA 1JXPA 2WSSD 1NN6A 4BWYA 3QKRA 2B92A 3TH5A 3MH7A 2BM1A 5AWFC 3TJUA 4M4SA 2H9HA 3E6PH 2R0KA 1GI3A 5E8EH 3CBQA 2STBE 1GJAB 1FPMA 1UBEA 1XX9A 5JBQA 3CKLA 2F4LA 1D2NA 1ESTA 2HEIA 2J46A 4XD7D 3U7EB 4IJMA 7LPRA 4TWYA 1SGTA 2ZDVH 3TRFA 4NCKA 3P6ZB 3RXHA 2UKDA 1MMJN 3MOCA 1QB6A 3T62A 4B2CA 1AGPA 1GI5A 5DYGA 1P0SH 2WV5A 3QO6A 5KSPA 3LBIA 4Q9LA 4TLCA 4NCIA 4CRFA 4MNXA 2O8FB 1CR1A 2Z9KA 4BLPA 4V02A 2A5AA 2C4FH 5FH9A 3RC5A 3Q77A 2ZSFA 2FX3A 1O3IA 4CRCA 4JLPA 2QC2A 3ZZ3A 5B57C 2DHRA 2XBYA 1IQNA 5F8TA 3E90B 1KDTA 2CEAA 3QLPH 1KXAA 1GJDB 3WYGA 2D2DA 1V2QT 3A7XA 2ZU6A 2J41A 1KXDA 3K9GA 4AKIA 5EW2H 4ERNA 2W83A 2ZAMA 1FOEB 3KHVA 1E9AA 4QNRA 2ZPRA 2IXEA 4TSFA 3RS5A 4KCGA 2CXVA 4EPTA 1JR6A 2RMKA 3ATWA 4KI0A 4JKIA 3RRYA 4M1YA 3SR0A 2J92A 2ZANA 2F9VA 4PPFA 1CLUA 2J34A 4Q1AA 4R0IA 3SGBE 4AB8A 2VH5R 4KTUA 3EPKA 2A7CA 3KDSE 5CITA 4D8NA 2GCPA 4Q7YA 4Q01A 4E09A 2WYJA 3LC5A 5AJYA 1XPUA 4MUAA 1U8ZA 1VG1A 2NTYC 2FFHA 5AR1A 1S3GA 3RS7A 4ISIH 1S82A 1YZLA 2ZI6A 4AG2A 1EG7A 2J95A 1CJKC 221PA 5SGAE 2XC4A 1MAXA 3ENSB 1C1RA 1LFDB
chains in the Genus database with same CATH superfamily
1ZA1A 3BUSA 2VJQA 2AE2A 2R1VA 1G8YA 4II2A 5ADVA 4CMCA 2YDXA 5DGTA 4CMEA 1RRFA 3H9GA 1NUHA 2ZJ2A 4BB6A 2W6PA 5KWEA 2P5YA 1KOGA 4K1XA 1BDMA 5CB4B 4JVNA 2WIKA 1L5LA 1KRHA 1XCPA 4MQAA 5L3VA 2Y0PA 2I0FA 1EK0A 1DEKA 3DB1A 3BTHE 2OAP1 1SWVA 1DWQA 1H23A 4FNMA 4FHCA 1M7BA 3PPIA 1ZNXA 5E38A 1JAXA 4LX8A 5JSZA 3W5VA 1JHPA 3JX9A 4FE3A 4K9QA 3EXHA 3EF1A 4LWOA 1H8HA 4NCAA 2YWFA 1P5HA 2JJ2D 2Y6UA 2R62A 5M2QA 4P08A 2N75A 5DYIA 1FMJA 1F1BA 1SBIA 1I4EB 2GJ8A 2LKDA 4YBZA 1O8CA 4QUAA 2SGPE 3CLKA 1VYHA 5EIBC 3OIVA 4C78A 3UUGA 5C67A 1HKHA 5DX8A 1SCKA 1GTSA 1GGVA 1MGPA 3O2QB 3B82A 4B79A 4ENRA 3K1YA 3ZVLA 2ZI3A 4QXOA 1KTVA 1VIVA 3C48A 2VWGA 4NMHA 4DXHA 2QY0B 3TXXA 2YRFA 5FPSA 4BNYA 1U5BA 5FWXA 3FMFA 4HHEA 4U00A 1M0WA 3K1AB 3H0EA 1PFYA 4C9BA 5KOIA 1EJMA 3LX5A 1J25A 1PHPA 3OF3A 3KXLA 4RA6B 3GCHC 1OYOA 4MTCA 1WZNA 1U1CA 1PJBA 3UMFA 3PMJA 1HAZB 2ZP1A 4V0SA 2I8LA 3HBAA 4RTLA 3PV4A 2VPIA 1QS0B 4Q03A 2GN1A 1UKEA 5DM4A 1WSWA 5TS2A 1GCUA 1KZ7B 4OGGA 5F9MA 8ABPA 3CVYA 2OXIA 1TNLA 4LZZA 2WDPA 1E3MA 1TLFA 1XRSB 1V2ST 1WDKA 2P41A 2RA3A 2XNHA 3PU6A 4WXIA 4FUJA 1J90A 2FP4B 1QZTA 2OQUA 1SURA 5DWDA 4C7JA 2C7QA 4UBIA 4UUOA 3M4ZA 1L7BA 2Z0MA 4R01A 3RSSA 2FMFA 3BA6A 1Z5ZA 3HUEA 1CERA 3WS7A 5F3WB 4JJAA 1PL0A 3SI7A 4D0GA 4AT1A 3ZZAA 1IN5A 3CNOA 4LSWA 3U2QA 5LQKA 3TZHA 2FK7A 6GCHG 5DULA 3K6ZA 5L40A 5CDFA 4BTTB 3IPYA 4WT7A 1IN8A 1FU7A 1NVVQ 1P5JA 3WJ1A 4BNXA 4XYGA 1P1IA 2HU7A 3RU9A 5EP2A 3U4GA 2HI0A 3PQCA 1XZEA 1N6IA 4L9AA 4KOAA 3ZHOA 2XGGA 2G7MC 3WMEA 4QGSA 3MT9A 4BZXA 1M1YB 1Z62A 3MSCA 4M8SA 1AQ7A 2SFAA 2P1DA 3DFLA 3GCOA 3G0HA 5JDIA 2EJCA 1I9GA 4JBNA 5H4IB 1K8XB 3G17A 3DFUA 4MMXB 4C87A 1JHQA 3NDRA 1G9IE 1FFYA 1J14A 2FI3E 1RSZA 5E0JA 3EA0A 4WF8A 1Z6ZA 2QEQA 5CVTA 1JPJA 1GCIA 3QXHA 2XDAA 2GARA 3SYTA 1RD3B 2QA9E 1DFHA 4P3PA 2Z2JA 2I66A 2D2IA 1D04A 4FYPA 1QK4A 3MOGA 1SUEA 3PWCA 1RFLA 4KR3A 1R9NA 3HZZA 2EDCA 5I9IA 3HDGA 4C0KA 1UDRA 2I91A 1TU0A 3ZHQA 2OUIA 2XMRA 3RU4E 2P2LA 2PKWA 3Q6MA 5SV2A 1D2EA 3B2NA 3DFKA 1PE0A 3M5DA 1YT5A 1KI3A 2X23A 5H82A 5EWMA 2VEOA 2HJ9A 4DR5B 4HH0A 6ESTA 3E22A 3ZIUA 1U7WA 2OP1A 3VTZA 1U65A 3S68A 1P0FA 5LLTA 2ZIEA 3U98H 2ATCA 1G5QA 1TPZA 4LRQA 5M04A 2OL4A 3A88A 1OP2A 4E3WA 4PSKA 4FBMA 4XIGS 3JQAA 3E05A 4CJXA 1V5IA 4MX8A