3O8DA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HCV NS3 protease/helicase
publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase
total genus 207
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8dA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8dA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8dA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8dA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8dA03
1Z63A 3GCTG 5JJLA 2K1QA 1VGCB 4GP7A 2VWLA 1O3HA 3PV4A 4NIWA 1GBAA 2HXYA 1S85A 2YV5A 5CJPA 4A1TA 2VSFA 1AFEH 3B9PA 3TQCA 2CCGA 2ZYUX 4Q9JA 2ODWA 1B0EA 1F60A 2AL7A 2R9PA 4BXSA 4BLSA 4IFEA 1VIYA 2ZPQA 3I8XA 1SI5H 4ASUA 5TJXA 3BIFA 3GLIE 2J4IA 4B74A 3TH5A 2W2VA 5AJWA 1YJ5A 1LKBA 2IS2A 3Q3KA 1O3LA 3B6EA 2QG6A 1BRUP 2ZI9A 2V3OH 1NTPA 1EPTA 1R8SA 4A6XA 2P3UB 4PC3A 2ZRLA 1O3FA 1RXPA 5FBRB 4Y6DA 4FCVA 1AZTA 3A36A 2OFOA 2ZSBA 1V3XA 4V0ME 2C4FH 2G0NA 3NBZC 2QE7A 2Z9LA 1G2MA 2XXLA 4PPGA 4PXAA 4I99A 1ELVA 2KBEA 5IDVA 3S9BA 4M1SA 1ZD9A 5EE3A 2F9MA 3TU7H 2ZFRH 3RMNH 2GCTC 3PUYA 3BC1A 3PO1C 5TXGA 1SVWA 2AIQA 4C30A 3VU9B 1C5LH 3LQRA 1UKZA 4YMTA 2QT0A 3KL4A 3BN9A 3R7WA 4PTLA 4LV5B 1C5RA 3MO3A 2PJZA 1XVMA 2PKSC 3V3MA 5DIFA 4I8KA 3MHWU 1V2OT 2SFAA 1H8ED 2KB0A 1EXMA 1OT3A 3SU8A 2XAUA 1TRYA 4JK5A 2ZI4A 1VYVA 1M8PA 1FY1A 4JLKA 1DAHA 4CH2B 5EG4A 1ZIOA 1FQKA 1MRNA 4QG7A 4ZDJA 3UPEA 2DR3A 4DSOA 1Y8TA 4H1UA 5JCPA 4L5BA 3W6NA 4B32A 2XNDD 3SOSA 4Q7XA 2JDIA 1TGBA 1KLJH 1EFHA 2ZI7A 2RHMA 3EC1A 1TUEA 1SLXB 3MWLA 1BTUA 2J59A 1OYYA 4F93B 5JRZA 1GBBA 1W4RA 1HAXB 1DITH 3GY3A 3UOPA 1TRNA 1UTMA 5HPYB 3EQ0H 5EE1A 3KTAB 1THRH 1GL9B 2XBYA 3DM5A 1W2KH 1HURA 4Q4AB 1C5TA 2VTKA 2FZZA 4RSGA 4AG1A 3AV0B 3K09C 4ZROA 3VB7A 1LNZA 5AHGH 3FHCB 2ZRMA 3KJHA 3TPIZ 3QXJA 5F9HA 1LVMA 5JWRA 1GBFA 2IJD1 1RPZA 2F43A 1AJEA 2H17A 4AI6A 4CHAC 2XW9A 2O52A 1QA7A 1EKBB 5J47A 3GLIB 5A0CA 3RXFA 4KTCA 3ATLA 2H1LA 5LPRA 4O0MA 2WKPA 5CK5A 4URWR 1BQYA 4CEIB 1BCUH 1COWD 4DIEA 2RGEA 2YOFA 1J16A 2ZCHP 5KDLA 4DLZA 2VIPA 5IYTA 3VKHA 1K21H 1NRRH 1CA8B 1O2TA 4K8BA 4KCGA 4FU7A 1MMJN 4TYWA 1W11U 1RRPA 3D3QA 1FIWA 3T5FH 4B34A 3PMBB 2EVWX 4BTTB 4R71A 4MPUA 3A80A 1UADA 1O3CA 3RXAA 1N1LA 5LB2A 3U60B 1XXHA 2QORA 5GADl 3K9XB 4HGCA 2YYZA 3VB6A 1FX0A 3VB5A 4QOSA 1F5NA 3LH5A 1GRRA 4JLPA 1LO6A 1O2ZA 3VR2A 1LHCH 1E2DA 2I3BA 1OIXA 2SGDE 5H70A 1KO4A 4BRWA 3VXEH 2JJ8A 3LY5A 5CDFE 3DHWC 2V1XA 3RXEA 2AWNA 1C1PA 1DT2A 1O5FH 2FLRH 4VGCB 1SG8B 4XBDA 4CEHB 1MTUA 2OFXA 1SGYE 5ESBA 4Z1MA 2OQ5A 2G77B 2OK5A 1K5GA 4XWAA 1GL7A 3F9EA 3LXRA 4GSOA 1YR9A 3Q3YA 1GVNB 1DSTA 4TYNA 1A1RA 1PPCE 2ZNKH 1Z08A 1G8YA 1KXAA 1E2IA 3NH9A 1S6FA 4M1YA 1G3UA 3I3SR 1P62B 4XTCS 2GK6A 3VPKA 1MO3A 1ELCA 2ATVA 2Q3FA 1XEFA 3X1WA 4R8TB 1MTVA 4H6SB 3PQCA 4QJ5A 4Y8ZA 2FM2A 5CE1A 2BDIA 2DE9A 5A0AE 2FSIA 1YYY1 3QENA 4BTUB 2ZRGA 4URZR 1GHWH 3GY8A 4M22A 2A5GA 1HAVA 1O33A 3BH0A 1UKVY 3TGPA 2ZTZA 1V2LT 2EFDB 1BBRK 2C93B 1PUIA 1R5BA 1FI8A 3AVTA 2SHKA 2EC9H 3QTOH 2VF8A 1S1CA 1SKQA 3Q85A 4MDEA 4BFZA 4URVR 3AVQA 2G1JA 4JYUH 1EFTA 1TYNA 2YZ2A 1O31A 2X77A 1Z2CA 3QBTA 1P2UA 1WB9A 1V2KT 3VFEA 1PZNA 1XDBA 2ZFQH 1Z8IB 1L1JA 3TJUA 3GJ8A 1JQLB 4KO8A 2OXRA 3PENA 4WAUA 4HAWA 4ISOA 3PTNA 5F6MA 4B3DA 4Q4JB 2CVHA 4OK6A 2EI8A 2IX3A 2J7PA 3RSLA 1CULC 3M61U 2ZTYA 1O3NA 1MT0A 3TJVA 3DO6A 3OYPA 2GJ9A 3EPHA 5BWMA 4IS5A 3TGKE 2C90B 5EXXA 3Q7PA 1VCMA 1C1QA 3GDVA 4B35A 4DDVA 2O0HA 5JI2E 2XZPA 1GJ9B 3A1UA 1VYUA 2VQSA 2P3SA 1P02A 3ZVCA 3HKIB 3OSYA 5FBVB 5EP4A 2GBLA 3K2UA 1AQYA 1XF9A 3FGNA 1PPZA 5HMAA 4IJMA 2QYIA 5DHAA 4LBWA 3GJ0A 1CP2A 2QC2A 4HZHA 1GBTA 2QAGB 1E2EA 2LKDA 3Q9LA 1Q21A 2JLXA 1U8ZA 1AS3A 3MLEA 3WNCA 2O0JA 1P9UA 1GDUA 1ZRHA 1SULA 5SZKB 5T3HA 3SHFA 2BD8A 2PZFA 4HDCA 1ZRKA 4B3GA 2P6NA 5BXQC 2WBLC 1AMHA 1ZAKA 4NG9H 1XTIA 2G81E 1NIPA 4G3XA 4URYR 2QXHA 4WMFA 3OEHD 3ND8A 4ZCMA 1BTPA 1SXJA 1OWJA 3RXRA 2FEOA 3RRZA 5FL7D 5IK2A 1KY2A 2R3UA 1O2OA 2ZSAA 2ODNA 5B6OA 3V0XA 1CKEA 1C1SA 1OKKD 2Z94A 3ZVBA 2X1VA 3F8TA 2W0SA 5FPKA 3I62A 1KTSB 5EQQA 3BF6H 1EX3A 4ISHH 5CIWA 1YP9A 2VWNA 4DURA 3QG5A 2BBWA 1JXOA 4QL3A 2OBMA 4BPBA 3UQVA 5BW8A 3T28A 3U44A 3UATA 5JSZA 2Z3DA 1KIMA 5E2OA 2GKSA 2PW8H 4IN2A 2ZSEA 2JLUA 2NO0A 2GTPA 1K1NA 2FPMA 3QIAA 4XVRA 5E7MA 1P11E 3JZ1B 3SBDA 3GISB 4TLDA 2AK3A 2QTVB 2HNTC 1TUIA 1SLUB 4X1NU 3SJCA 1DOAA 3RXGA 3ZVRA 2NG1A 3A88A 2DBYA 5L6NH 3GICB 5G3ZA 1MKXK 1FTSA 2KBFA 1LTQA 3MTYA 2ZP0H 2OESA 4RD0A 2ZQ1A 3BG8A 3NC0C 4H1VA 4TL6A 3AVVA 5A2MH 2FSHA 1WBGB 5B6LA 1ESMA 4NIYA 3MSXA 1KK0A 2ZRJA 2QY0B 3NDPA 2H9HA 3QXXA 3FHOA 1O3JA 4IDNA 3VU9A 4ESVA 4AGKA 4BEJA 2ODPA 3ZD7A 1OWHA 3WYAA 2VGCB 1EGAA 2IXFA 4LHYA 1JJVA 4QBFA 1Y63A 1N6RA 1U0JA 3TITA 5HE8A 4A1VA 4BFXA 3H0KA 1RE0A 1ZPBA 4CW7A 1TNIA 3IPXA 3PV2A 1TNKA 1SGFA 1AE8H 4M8NE 1NN0A 3H4MA 1XCGB 1QVAA 1O87A 3E1SA 1OB2A 3U7GA 2ZVPX 4ARZB 4X6OA 4FN5A 3GJXC 1F2UB 3AVWA 3CRMA 1O2MA 4DCVA 1V2WT 4AB8A 2Z9KA 2IT1A 1E99A 3UK6A 1Z0DA 3OY6U 2PV9B 3DL0A 4AG6A 1LS1A 5EP1A 1CJKC 4JK6A 2OO7A 4YQFA 5A8ZA 1DS6A 4Y76A 2GZHA 1HGTH 2RGDA 3R9WA 2ZS7A 2HEIA 3GEIA 1Q22A 3PG5A 3D23A 1P2NA 1L1GA 3KTAA 1NI3A 2F1RA 2AS9A 1S83A 4Q4AA 1MKXH 3SV9A 4LJ9A 2WWHA 2DCUA 2QPOA 4E5UA 4RN6A 3RAPR 5DI3B 5H4IB 2R0KA 3HYTA 2ZRFA 3V9PA 4K1TA 1PQAA 4ZV4A 1W0YH 4CIDA 3T27A 1VCPA 1Z3IX 1GMCG 3L6PA 1KK3A 3K0EA 4KYIB 2NU0E 3GLIA 4BFWA 3KQEA 4GLYA 1NT1A 5CHAC 3TSZA 2P8OB 2ZS9A 2I6SA 5M04A 3DDCA 3BTME 2PL3A 2G0TA 4DSTA 2GHIA 2F1HA 2F9UA 4N1AA 1P9NA 3RLWH 2EFHB 2QPAA 3BEIB 1UJ2A 3QVUA 2W7UA 2VP2A 3TJZA 3DZDA 4QGFA 3SDZA 1OFUX 4B2BA 1EQ9A 1GVZA 1P01A 2A4GA 4MDSA 2RGXA 1UCYK 3PV5A 2IPHA 2ZJAA 2AXNA 1P8VC 2P16A 3FOZA 3KKQA 4OL0A 4D4LA 4V0MA 1J14A 5C18A 4BFVA 1Z1IA 2JETB 3X1ZA 2G00A 1ARBA 4JKYA 3BSQA 3RXOA 5GWZA 2B21A 3HJNA 4NU0A 1OS8A 2EFGA 4DLVA 2TPIZ 1XNJA 1BTXA 6Q21A 4CRCA 821PA 1FAKH 4X8UH 5CYOA 3BB4A 3LA6A 1AWHB 1QDEA 4WOPA 4AFZA 5BQ5A 3BG4B 4BUJA 3C41J 2PX0A 4XVQA 4A8JB 1WA5A 4EPVA 1C1NA 1YZTA 2HV8A 3VQTA 4WWYA 4XFQA 4HI3A 1H9HE 1U6QA 3QZQA 1BO6A 1LPZB 4U7DA 4HAUA 1GI5A 1AS0A 4CEHA 2ZRAA 1E79A 4KFRA 2D74A 3A7ZA 1XTJA 2PZEA 4EPTA 2WPDD 4BTIB 3A7YA 4HEJA 4JVLA 1ZD8A 2GJAA 4A4DA 4FCWA 5EJEA 3C16C 3K70D 1SVSA 3CIOA 2WKQA 3TUZC 2C8YB 4MTBA 4XVUA 5KSYA 4A6LA 2IEZA 3RS0A 2ZSFA 3ZIAA 2NZJA 1VJ9U 1Y3WA 5JB8S 1SOZA 3B9FH 2F1JA 3IDQA 4JL6A 5F2EA 4A0RA 1W3CA 3T26A 1AM4D 3I8SA 1TQ6A 4NYJQ 1O3IA 4B2CA 4QBGB 2ZCLP 2QUZA 3CBQA 2QGNA 4ERNA 2DWPA 2PUQH 2HF8A 4NIVA 4MPVA 4NA9H 5LPNA 2V3CC 5FR1A 4OS4A 3P4XA 4IDOA 4UFGH 3W34A 4IOMA 1ZR0A 2RB4A 1NF3A 2AHOA 5JLJA 1O36A 2WOOA 1PLJA 5C1YA 1N6LA 3THXA 1UTLM 4OS6A 3LBNA 5AK0A 2OXSA 3GCGA 2WWXA 2M5TA 1DG3A 4OS1A 4TYQA 3T1TA 4EFLA 3PUXA 4OHWA 1C4Y2 3M4YA 4EJSB 1A2BA 5A5GA 4F4JA 4ZDKA 2QXJA 3RXMA 2ZEBA 1B5GH 2A7HA 3A85A 2ZQ5A 2UWPA 3SU3A 1XPOA 1KLTA 2OHFA 2QAAA 1QFKH 4K46A 3BOSA 4DY7B 3U6BA 5AR1A 1GNPA 2QGRA 1OW3B 2OBLA 4RKFA 3U5ZB 1XEWY 1V2NT 1G18A 2J7KA 2BDTA 5E4FA 1PYTC 2DFTA 1P3EA 2BYAX 1H8HA 4QXAA 1DWBH 3W9YA 4GOXA 2PZGA 2HGTH 2O8BB 3SUGA 1Z7KA 4V02A 2PHBA 1ODFA 1O39A 4F4OC 2FOAA 2BJVA 3LFUA 1GMHG 2GV7A 4HLCA 2O8CA 3REGA 3E8LA 3T25A 5JJIA 3SV7A 3LGUA 3KZ1E 1DLEA 2NU1E 2QAGA 1GI2A 2V9PA 1DEKA 4WZBE 2GILA 4LWZA 4URXR 3U8TH 1ZM9A 4PX9A 4WZAE 4DJZB 4D82A 4NCIA 1T3HA 1F0SA 4XSHA 2ORWA 3MFJA 2ZANA 2I1VB 3DEFA 1BITA 1AFQB 4UNQA 5KYKA 4TMKA 3K9LA 1KOFA 1OFTA 4POAA 2C8WB 3TRFA 3RXVA 4CRGA 2FU5C 3RXCA 4IOJA 1QG4A 3PUVA 1GBLA 3D65E 7GCHF 3U7EB 1DE7H 2C77A 4C0JA 2QU8A 3SNAA 1NY5A 2BDAA 4XJXA 1N6IA 3LVQE 4DUGD 1GJDB 3GY4A 3QVVA 3P8OA 5LH8A 4K60A 2GGVB 4EUNA 4U00A 3PWCA 2DHRA 2FOLA 2Q6FA 3B23B 4IW3B 2BQ7B 2YNAA 4U5XA 1DVRA 4MG3A 1P5ZB 4INHA 2KE5A 3THWB 4WXVA 2Q21A 1RKBA 3QKTA 1WE2A 1M1YE 1Q44A 3W95A 4WXRA 2ANKH 1TX7A 1EWRA 1G20E 2FFQA 1LTOA 5LD2B 1ZVQA 1GJ6A 2BIFA 3PMAB 4A36A 4KJZA 2JGNA 1DAKA 1UFQA 3LVRE 1TQ4A 1NU7B 1DWDH 2IWRA 2EU8A 1C5ZB 2GKVE 1ZRBA 4LK4A 2O8UA 4WF8A 1ZNYA 1IJEA 1IQMA 1K1LA 2FSGA 1ESBA 2O8WA 3GCHB 1ELGA 4K8YA 5JHHB 5JB9S 1KI6B 2IC5A 4DSUA 3NXSA 1BMNH 3PVSA 2GP9B 4P4SB 4BEBA 2QMOA 1ZP6A 9ESTA 4IFBA 4E07A 5DO4H 3OX7U 4UNNA 3NXPA 4GOJA 3QOFA 3QLPH 4GHTA 2WPIS 2WZQA 3VHXA 1SQ5A 2VHQA 6GCHG 4UXJA 1KMHB 1UTQA 1CHGA 2ZGJA 1WQ1R 2IA5A 4Y0VA 2XTMA 3E90B 3RLFA 1HRTH 3P4YA 1IQLA 4RZUA 5PTPA 3SHAH 1W2GA 2BCJQ 1IQEA 3CNOA 1HIAB 3SYKA 2BD2A 2D2FA 3QBVA 4TTRA 1RFNA 1WMSA 3SJKA 4XOIA 4X1QU 3I32A 4MH0R 1D3DB 1P2VA 1YGCH 2KSQA 4JS0A 1ZMJA 4THNH 2P3FH 1KO7A 4TQUS 1KI8A 1S0QA 1CF4A 1KDQB 4MQBA 4WH8A 3MU4A 1W7GH 5FOSA 1FDPA 1HAHH 421PA 1Q12A 1H4WA 1H1BA 1GNQA 3A4NA 2QT1A 4J1YA 1SVIA 2R6FA 2OBQA 2FJUA 2QAJA 4TQAA 3SJBA 1TFXA 4Y0YE 1J8AA 4HLUA 1ZUHA 4ARZA 4C2UA 1DO2A 1KJWA 1F2UA 3CPHA 1BTHH 3M3SA 1F0TA 3GY2A 4AK9A 1QHSA 1YPHC 2SGAA 5FPSA 1E96A 3QJYA 3ZVGA 2ZGCA 2GD4B 1FY3A 5JRJA 2OBOA 2O8MA 1TF7A 4B3BA 2TBSA 5ABWA 2ZJBA 5TV2A 1NL3A 2TGPZ 5C2JB 1WRBA 3RXLA 4NBSA 1RRFA 3CNNA 2GWHA 1VKJA 3F9GA 2JH6D 3CO5A 1UCYE 1R2QA 2OZEA 1W1WA 1O5EH 1RIWC 3UG6A 5G41A 4DIIH 4XBBA 4TWYA 3ODDA 3EZ6A 4ZDIA 1ZGVA 4O25A 1TAWA 2ORIA 1C5XB 1SLWB 2ONJA 2XZOA 2PEYA 4X8OA 1NY6A 1EJAA 3DT0H 1O3GA 2NO6A 2YOLA 3H7OA 1EESA 4LJ7A 2C3SA 2GMTC 1UVSH 1AUJA 1Z5ZA 5IHPA 1SGPE 3OE7D 3MU5A 5KU1A 1BH2A 2OUKA 1DLKB 1Z8FA 3SHCH 1LHFH 5FPYA 4YLUA 2FN4A 3U98H 4BAKB 3MGCA 1MO4A 1P2MA 2GNOA 1HDTH 1YC0A 5C4GB 1ZUNB 1C2IA 4JVMA 1ANKA 1GBDA 2C9YA 3S7KB 1EOLA 1XPRA 1WV7H 1JI0A 1GI1A 1KI7A 2LCFA 2WSMA 2R0LA 1GBCA 1G7TA 2HXSA 4Q5IA 3E3TA 3QO6A 1KO5A 5EU8A 4Q9KA 1YKSA 1ZW6A 2YWGA 2V3HH 2NGRA 5G3YA 2R2WU 3SFZA 1X1SA 2O0KA 5GDSH 3GOVB 4A8JA 4ISIH 3ESTA 1QRWA 5F8ZA 1M7HA 4GCHF 1LVGA 1E1QA 3PXGA 3SU2A 2AD1A 1OPXA 3L3TA 5SZJA 2Z3EA 1ABIH 3IITA 4AKGA 2GJSA 1UDWA 1OWDA 1BHXB 1S5SA 4OS5A 5KUTA 1NESE 3HPTB 3I78A 2CJWB 3EG5A 1ETRH 4AY2A 1NO9H 2ZTXA 3VEQB 3OEHA 1Q1ZA 4AYWA 4W5HA 4LHZA 1G8GA 2GCNA 1QBKC 4GT1A 1QRAA 4D4KA 1AZSC 3T61A 3V7TA 3LX5A 2D2EA 3DKPA 2VIQA 1SHHB 2QA5A 1XFAA 2D2DA 2DUCA 3HK3B 5E8EH 3RXKA 1CGIE 5C3NA 5J5CA 3OY5U 2V7QA 4DEXA 1ZNXA 1V2TT 2ZO3H 5C46F 3UPUA 1ELAA 1VITH 1YHNA 2QBYA 3STIA 3K53A 4PANA 3L33A 1G3BA 2D4HA 4F4IA 1QY6A 1G1MA 1W0ZU 1VITG 4B48A 1FOEB 4OS2A 3TBKA 4TZ6A 1IN6A 4LYJA 2XJ4A 5FXLA 3K0AB 1EOJA 1ELEE 1ZC4A 1EPTC 2BXUH 4NYIQ 3TW4A 3ZYEA 2JIZD 3M5NA 4EJSA 3AM1A 3P20A 4GRAA 3ADDA 4LK2A 1EAIA 1E69A 2HNTF 4Y8XA 3CRRA 3RDZA 3RSOA 4KITB 1JEDA 3BAFA 2QA9E 3AVUA 1IQNA 1D3PB 4UNPA 1O2QA 1DANH 3VB4A 1Y5BT 3OIYA 3SOPA 3M5OA 2PSYA 1E36B 3SV2H 4C0LA 2D26C 4ZXXH 4F38A 1G3QA 3LU9B 4G1UC 1CQQA 2F55A 1G37A 5K8LA 4FUFA 4BFYA 1Z6YA 3CH5A 3K8YA 2ZRPA 3R3GB 2FFBA 3AASA 2BV3A 1LF0A 3A7XA 3M37A 4BAHB 2O8BA 1JRTA 1QB6A 4DGJA 4ZO4A 1O2IA 4NP6A 1EXFA 1L4UA 2YINC 4JYTA 2W3IA 1SHZA 4R9UC 4IEEA 1IY0A 1ZMLA 1I2MA 2XTTB 1U0HC 3HP1A 5FH9A 2A9KA 4W9MC 1OWEA 3KKOA 4MNWA 3O47A 4WIAA 4C0KA 1OB5A 2F4LA 2GCOB 2WPLS 2WOJA 2GX4A 2X8AA 2GF0A 3MNCA 3RXUA 4C3ZA 1GOTA 3EASA 3CP7A 3KKNA 5ESTE 2Z83A 2XBXA 2ZU2A 4PFSA 2ZDLA 3AF4A 2BY8X 8KME2 1T4VH 1Z71A 1XUJA 2AD5A 3SU0A 1GBIA 3GJ7A 1E2NA 1CT2E 4QGGA 5JS8A 2XITA 4QJ3A 5FTMA 1ZIPA 8GCHF 5LGOA 1SMFE 2QPTA 4JLJA 3PMHB 1NM6A 1N0VC 4NCHA 5EXPA 2VIOA 2ZFTA 2ORVA 2IJOB 1WOFA 2XWAA 1S82A 4A82A 1U99A 3MWIU 5FUVA 3GYMA 1DTSA 2Q9CA 1AY6H 3L82B 2DB3A 1CEEA 2XOKD 1CR0A 1C1OA 3RWOA 4HZUB 1MU8B 3WY8A 3M6AA 2FTLE 5ANRB 5FCKA 4M1MA 1C2FA 4PPFA 1QQUA 1IQIA 3S1AB 3VHLB 5EQTA 1FZQA 1XX6A 4CBOA 1U9IC 5C4MA 5B57C 1A5GH 4QGAA 4IVRA 3MU8A 4OS7A 4TWZA 4GSYA 1QA0A 2BBSA 5DP4A 2FGJA 4I31A 2WPKS 5AVDA 2D7CA 1OXTA 5TMPA 4Y11E 2BX4A 2VINA 2VPPA 1O2NA 4DLUA 3NBFA 1GHAG 2W00A 3SI3H 1OIWA 1TB6H 2ZJ2A 5FI0B 5JJKA 2PX3A 4PC6A 5A4JA 1KI6A 3NHAA 1W2HA 2ZE6A 5C1BA 4P4SA 4ZAEA 3I73A 1TQDA 2V8OA 3OIVA 1T8TA 1IQFA 3Q76A 2ANMH 1KNXA 4NONA 2ZI5A 2PLFA 3LWNA 2Z4RA 4MVNA 3F0TA 2IYVA 2OTVA 1OF1A 1BMFD 1CTQA 1KMHA 2RG3A 1R7RA 3BTGE 4Z8YA 4JZDH 5EE0A 3IPYA 1OYQA 1W46A 2WV9A 5EXLA 3R8FA 1VYTA 4Y0AA 1VTKA 621PA 1UO6A 3SZRA 4DDUA 1SGCA 5EXTA 1HIAA 1IHTH 2OCBA 3WYGA 1HV8A 3RWMB 3S69A 3OFNA 4B1TA 2ZR9A 4YLQH 1GGDB 2ALPA 4OM9A 3P95A 1QR3E 2IEYA 1NRSH 1E2HA 1W0JA 4INLA 2A5KA 5AUPB 1KDQA 2TGAA 1ANEA 1NBME 1QNJA 1W4BA 2CHAB 2JEOA 2XB2A 8ESTE 3EAJA 1N8OB 4I32A 1ELFA 1OOKB 4IRUB 4RZXA 2FI3E 5JHGB 3AVYA 3N5CA 4US0R 3A83A 3AAUA 5EUMA 1L8QA 4A1XA 1Z6XA 1O2XA 2G3YA 2Q6DA 4RZ2A 2QV1A 2OC0A 4UKDA 1OKXA 1UDXA 2PKAA 4LZ1H 1UMAH 3P17H 1HJAB 1L0ZA 3S7HB 3U69H 3T62A 1AGRA 1GL1A 5E0JA 3E91A 1G21E 4DLRA 3KUDA 3ZVMA 4P4TA 1GBKA 1T7CA 3SC3A 3P70B 1QGFA 2WJIA 4HDOB 4A1FA 1KK1A 4TLAA 5F8XA 2V54A 3HWSA 4I33A 4PR0A 1OXXK 1TX8A 2BDHA 1GHBF 1W10U 4Q1FA 2ZU1A 3SQEE 2BQWB 1ZINA 4QM6A 3A58B 1GZSA 2B5TB 4U2WA 1QIXB 4ASHA 4M9SA 1AO5A 1OXSC 3SJZA 1OP8A 1SR5C 4IGDA 3R9XA 1QHNA 3P32A 1GHAF 1I4DD 3FMPB 1XEWX 2FOGA 3FANA 4FUEA 5I46H 5FI1B 5FTJA 2VLIA 5KHOC 3B85A 1E0FD 1A7SA 3WY9A 2Q9AA 4AKHA 2ZIAA 2RGBA 4CRWB 1ZNZA 1X8KA 4PC7A 1PYTD 1EP6A 1GG6B 2BVSH 4MGKR 1SFQB 4TMZA 2PT7A 1BRCE 3K0SA 3TNTA 2Y6TA 2ZUBA 5ELXA 3WNDA 2ZGXH 3VGCC 5FTNA 3THYA 4X0WU 3K6ZA 4DT1B 1P57B 4KXFB 2GBLC 4II7A 3LDAA 3CUEF 1E9AA 1K6MA 1HAYB 2FX4A 3R9IA 1P9SA 1C2GA 1NVUQ 4TL8A 4L16A 5CB8A 5DKMA 1EWQA 3CR7A 2XRCA 3IO3A 1TIOA 2FI5E 3GDUA 5BYJA 4K81B 1U98A 1R5NA 4WZ6A 1QHHB 1GM5A 3Q8XB 3C7KA 4Q19A 2ZDKA 4K2YA 1FTNA 1N0UA 1XWIA 5KSPA 1TQ2A 3LDXH 1XU4A 1DX5M 4A0HA 2PGQB 1UBFA 3EAQA 3VX4A 4MGZR 2ESTE 1C2KA 4D8NA 3SS8A 5CMXH 1I2DA 4XDEA 2FOBA 2HF9A 3TSWA 3HGPA 1CS4C 1XEXB 2CJWA 4JT2A 2W6ID 1BHXF 1JALA 2JCSA 3B1XA 4LDJA 2IS4A 4WXPA 4Y7BA 1GDDA 5F98A 1ZCAA 1VCNA 2QN5T 2BZAA 4DUGA 1J15A 4LGMA 3PV0A 1GDNA 3NTUA 2A5YB 3LXXA 5HM9A 3VFDA 2AKYA 4I1UA 3MWKA 5E0HA 4PHGA 1E0KA 1JQJC 1YLCA 2NU3E 1D2NA 1F3OA 3AVZA 1O2LA 4YMUA 3EGKH 3BTHE 4QHTA 2NO9A 3OEEA 3BTTE 1YE8A 4NWKA 4WMEA 1W0KD 1HUTH 3C15C 3AP2A 3K0AA 1CU1A 4YDSA 1ZOMA 4CEJB 2JLZA 4S2EA 1QHYA 2AH4X 4LYAA 4M53A 3H1TA 4GPTA 3MCAA 3EZ7A 4JLAA 1JOUB 4GDFA 1QJ7B 2BLVA 1TNLA 1FNIA 3SNCA 5C2ZA 5DP6A 5FR2A 1A1VA 1IJFA 1OFHA 1E2JA 2CF9H 1H9IE 1BKDR 2UUJB 2D8WA 2EFCB 4RVCA 2GXQA 1UVUH 2UWLA 3OAAA 3EC2A 3KQKA 5B58C 2ZI6A 1KYNA 2GDEH 1DM4B 4ISLA 1CIPA 1T32A 3SORA 3TH4H 3URDA 3RU4E 1CRPA 2ZR7A 4M4SA 1CR2A 4X6MA 4JL8A 1T8UA 3WRXC 4XD7A 1AKSB 4RKEA 4DWJA 2DY1A 3GLHE 1R0WA 4LYFA 2HWLB 2RGNA 1DELA 3HU3A 2G52A 1KYIA 1JB1A 3NKVA 3IBYA 1P04A 3AP1A 1DS2E 5KNCA 1CBUA 1W48A 4US2R 3W5JA 1S84A 3CX8A 1V2JT 3DMNA 1Y5AT 2HVXA 4XWKA 3GDSA 1D9ZA 4FW9A 1G6HA 4TLEA 5H68A 1ESAA 1YCPK 3ZV8A 2J2UA 3JVUA 5L3VA 1PLKA 4AORA 2FNAA 1YKTA 1SXJE 4Q9HA 1O2RA 1WAYB 2V0BA 1IXZA 2ZHFH 1XJCA 2IYYA 2F9OA 2ZRIA 2QP3A 2CNWD 2ZJOA 2P6RA 1BTWA 2OLKA 5CM9C 3EIHA 2GXUA 3CPEA 2UUYA 2J38A 4CR9A 2ZFSA 1C5QA 2XEXA 1BZXE 1NVXQ 1A82A 1N6NA 4G5RA 1SKYE 2Z3CA 2W3KA 2TMKA 1XD9A 2IL1A 1Q3XA 2C96A 3QKUA 5CYPA 1PQ7A 2R44A 2QENA 2QROA 2YVUA 1GCDA 1Z6TA 1OLOA 1VHTA 3TK6A 2QY9A 5J4QA 2YOGA 3M36A 3FPAA 2JLSA 2GVDC 3LONA 2QQEA 4O3TA 1NROH 4HZUA 1IY1A 4MQAA 3FFGA 1FNNA 1IHSH 4AOQA 3RANA 2YC2C 3P8GA 3ZH9B 1NMXA 1FV9A 2H6MA 4NZYA 3S1AA 1RYFA 2Z9JA 4M0LA 1WBDA 3GQBA 1KSFX 1XUKA 1G291 4XOJA 1GBEA 1Z47A 3ASZA 1SGDE 5GVRA 3PROA 3QXHA 3RXBA 5H1YA 5JWHA 1OH7A 3QWCH 2CK3A 3DA9B 1QZXA 2OSBA 1YM0A 5KOYA 2HPQH 4IBLH 2WSSA 4PHHA 2VHUA 1XBTA 4FI3C 4XIGS 3VX3A 1GKIA 5FBWB 1E9RA 3SZEA 1NVVQ 2HCBA 4FD2A 4QBHA 1C4OA 1MZAA 4PO9A 2H1UA 1ZPCA 3RRMA 1CR4A 5JBBS 4R0IA 1AIXH 1TGNA 5DN6A 2E1RA 2J0QA 2C5LA 1II8B 2D3WA 5EOKA 3SW2B 2BLWA 2B6HA 3D49H 1J8YF 3BV9B 1N5IA 4V0LA 2P59A 1HYLA 4D4MA 4I1VA 1C1TA 3FVFB 721PA 3GLHB 1SL3A 3BGWA 3KJEA 2O9QA 4OI2A 2ANBA 2H5EA 1G8HA 3QEOA 2B7DH 5J4SA 3C5CA 2NQ2C 3BRWD 4MKHA 4PAQA 4OKSA 4MYTA 4HAVA 2XJ9A 4DCNA 4VGCC 3U3MA 1X7AC 1EFRA 3VXFH 1TA2A 2F1IA 2QMEA 4Q7MB 2BD5A 1Z2AA 1VCOA 2A30A 3BORA 4TY7A 1XMJA 4DB2A 2GZDA 3K0CA 5I25A 1SXJB 4AX9H 1RGQA 3EDXB 2ZEJA 1DY8A 1T31A 1NY22 1S4QA 2NPFA 4UE7H 521PA 4V0KA 1MCVA 2P93A 3GJ6A 4ABFA 2L0XA 3SJ9A 1Z8RA 3KXIA 1B0FA 1GJAB 4BLPA 1TNJA 2AFIE 2FOMB 3Q7QA 1CBWB 3KGPA 1D6RA 1RTLA 4LBZA 3B1YA 3T12A 1UAAA 2TIOA 1J9CH 3GFTA 1XMIA 5TY0A 1SKYB 4I8HA 4IDHA 2W2TA 1ANBA 1NSTA 3QDZB 4LHWA 1H8IH 3U44B 1AVXA 1E2QA 3DFJA 1DAIA 1XX9A 4ASUD 3MNBA 1G3RA 2GVZC 2ODBA 3K9NA 5JSZB 5JPMH 4AC9A 2Y82A 4HLDA 2QI9C 4KFSA 1KDRA 2A3RA 1S1MA 1U8YA 4C0AC 1C1WH 2R6AA 4AWXA 1UM8A 3MH5A 2W5EA 4CT4B 4FUIA 3ICQB 3KIDU 2GEDA 5AUQA 2B7BA 3EIQA 5FBQB 4FMCB 3V00A 1UVPA 4QHSA 2JIZA 2UZIR 2ZR0A 4JLNA 3KL6A 4PZLA 1RJ9B 1UKEA 1EG7A 4LJ4A 3L8YA 4FIDA 3TR0A 4KI0A 4YOIA 1FN8A 1OSSA 1GKUB 3TSOA 2HYIC 3STJA 1G3IA 3QE0A 2X19A 3O8CA 1JIMA 4KYUA 2J9RA 3EZ2A 4TYDA 2BY6X 4JMYA 3LBIA 5EUQB 4IEIA 3TGIE 1TBRH 4H42U 3SO3A 1P09A 1WTHD 4D76A 4JSYA 1JR6A 2DYKA 2QE7D 3V13A 1Q1EA 3SQWA 1DSUA 4O3MA 3KKPA 1SVMA 3CS7A 2XGJA 1KGDA 2XSZA 4KAXA 4IN1A 4NZLA 4A2PA 2N42A 4GBMA 3BEUA 3OU0A 2OINA 1JRSA 4DT1A 3AVOA 4Q1CA 4B44A 3KQNA 2CLCX 1ETSH 3F68H 4NKRA 3GLGE 5HGGA 4L8GA 2ZRKA 4BGDA 3SYLA 1GL6A 1G17A 4I8LA 2BWJA 2QAGC 3UANA 4BFTA 2GRJA 1CXZA 4Q7LA 1HA3A 1CSOE 3MD0A 3SU4A 1QHHA 2AFQB 4CRBA 1TEVA 3ICEA 1N2CE 4YC7A 1PLLA 3DVLA 4HDQB 3O8DA 3RHFA 2FYRA 1P6XA 3AB3A 3PLKA 2JDID 4BE7B 1GG2A 1NBMA 1QTFA 1XEXA 1O5CB 3AF2A 1QRZA 1VG0B 3TGJE 4CBNA 4KLNA 3NC1C 2VIWA 2IYWA 6CHAB 4U02A 5EXNA 5C1UA 1HQYE 1KDTA 3LO5A 1OP2A 1YR7A 1CA0B 2IS6A 1MV5A 3PTBA 5GJBA 2AERH 1UJ1A 2BMFA 1A3BH 1SLVB 5DI9A 4ZHAA 5EXSA 3G01A 1GNRA 2FH5B 2JLVA 4Q1DA 1AKYA 3FMFA 1ETUA 3W94A 2IYUA 1JXPA 3T34A 3SN6A 2H8KA 4WMDA 3MRSA 1C9PA 2W83A 2VH5R 2ANCA 2A0QB 4FUJA 4DLWA 3A89A 5FPHA 2BLQA 2IYRA 2KI5A 4Q9LA 1S3GA 1G64A 2IHBA 2ZRBA 5BYKA 1A5TA 5F3WB 4CEJA 1TU3A 3VAAA 2PMDA 1S6HA 2UZ3A 4BFUA 3H7TA 3K1JA 2WM9B 3QF4B 2LKCA 1HCGA 1D6WA 4UFDH 2WWIA 4I4LA 3R0FA 3NH6A 2QSYA 3U6KA 5CM8B 2IUUA 4JLDA 3QXCA 3WRYC 1Z07A 4JYVH 1G4AE 2BY9X 2WIAA 1D4PB 1H8DH 2A2ZA 1OHHD 2GTBA 3FZZA 1W36D 4FMBB 3AEZA 3AUXA 1OSNA 1J7KA 3ZVEA 4SGAE 2WJHA 1G16A 3SZNA 5FAHA 2DWOA 1OH8A 5KSZA 1T8NA 4B2PA 4JBXA 1C5WB 2BMGB 4ZHLU 2GCPA 4Q48A 1Q3HA 2SNWA 3W3AA 4F7WA 5C20A 1AKSA 4HFPB 1N0WA 3BERA 4RZ3A 1E9SA 1M7BA 1LPKB 4PAMA 3P6ZB 4FVDA 1QB9A 3T2NA 4FUBA 1QJ6B 2ZYVX 1OIVA 4BLQA 3FFBA 1NNEA 4Q9IA 4C4PA 1ACBE 1XMVA 3UWIA 1Q1QA 1FJSA 5LPEA 2WIBA 1AB9B 1UTKA 1Z1JA 1MR3F 2CHGA 2VGCC 1ZHPA 4G5QA 4M2LA 3HDTA 1A0LA 4HATA 2BY7X 1DVAH 5K0HA 2R6DA 1K8RA 5T6GA 1Q0UA 3E0NB 2UKDA 1MTNB 3ZJYA 4Z1MD 5FOXA 4B3CA 4OI1A 2JH5D 1RS0A 1JIRA 2Z4SA 4PSAA 4TSFA 4H4FA 3N2IA 1SGNE 2ZRDA 2QEQA 1OX1A 3KNXA 2AIPA 4DLTA 5EXMA 1GDQA 4HLUC 5FUWA 2ZDNA 3IQWA 3BJIC 3DOFA 2NPIA 1E1RA 3RDPA 2GAAA 2J46A 2B7CA 4DCTA 2YJTD 4A92A 3RS3A 3IHLA 3SEAA 2WJYA 1GRNA 2ECKA 5HCIA 4N0EA 1GILA 2ZPTX 4NCKA 3THXB 1MBQA 3F9FA 4JVNA 4NCJA 4KFTA 3ZZBA 1ZJKA 1K2I1 1Y59T 4LHXA 8LPRA 2AGGX 2VHJA 1LMWB 1VHLA 2ZJ8A 2PEZA 3A1TA 4DC9A 2ZG0H 2WWGA 4W5WA 1L1NA 2Q0HA 4AN7A 2OCAA 3ENSB 4IC6A 2ZI2H 3MU0A 2VA8A 3DPUA 5BRRE 4MPXA 3DUXH 3EA7A 1NN5A 1KNQA 5C1XA 3DFLA 2WJJA 4EIWA 3B2EA 2ZM5A 3P8NA 1F5RA 1TRMA 2A7QA 1V2MT 4Y0ZE 5E95A 2P8OC 4RKJB 4LHVA 2HLCA 4OJKA 1FL9A 4ZIRB 3C27B 2BLOA 4Q1BA 3Q00A 4IDPA 4IXNA 1T8OA 1OP0A 2J7PD 4PAOA 4MYUA 2ZFFH 1LQEA 4TLCA 1JJ7A 3I5XA 3U4QA 4SGBE 2CCJA 2VEDA 1GWAA 2NIPA 4RCZA 1NRNH 2ZI3A 3QGNB 1RYHA 4KLZA 2TGTA 3NG1A 1WTGH 3CH4B 4IOKA 4Q02A 1P2IA 1HE1C 1RRCA 1NLFA 4DG4A 2HRVA 3UMFA 2O8CB 4MRRA 1R6BX 3IBGA 3FB4A 1EX7A 4KTSA 4NTZA 2MSEB 1HEIA 3SNEA 1KI2A 2A7JA 1II8A 4HZIA 4IHQA 5L3SA 2GZAA 3GFOA 2JETC 2OQUA 2QM7A 3A8CA 1EZUC 3QUSA 1UEJA 2B0FA 2KWIA 1W44A 2HALA 1W4CA 1V2VT 3RU4T 4RFVA 5IT5A 2HLDA 3NWUA 1YRBA 3GLHA 3R20A 4INKA 1TMBH 1LVOA 1AA9A 1D9IA 4DCUA 2QP4A 1NLZA 5EGMA 2G4UA 3BG4C 1PQ8A 4L9SA 1EK0A 3GEHA 2PGBB 5KDDA 4A8JC 4QFMA 2V6NA 1UBGA 1T9HA 3WMFA 1NPMA 1IN7A 3RABA 3KJGA 4DIDA 2CMYA 1DDJA 1MCTA 3UKDA 4LJAA 1R8QA 1YPGH 3ODFA 4P31A 2ZDVH 3RM2H 3U7FB 1GFIA 1U94A 5GJVC 1O5GH 1K1MA 1K1PA 1GBHA 4O9VA 3T15A 4AG2A 1II9A 1NLYA 3SV6A 1KSJA 3AW1A 1FP7A 1ZPZA 1O2PA 3NUMA 3SQXA 4YXWA 4A0GA 5IK2D 4MRNA 3OHMA 1E9EA 2ERYA 3TIFA 3AP3A 2IYZA 2HJVA 4JYCA 1GMDF 5JS7A 1UTNA 2Z6VA 3DMDA 4P32A 3CWQA 1AQ7A 2R3YA 2JJ1A 1UK4A 3ECCA 2VIIA 2XBWA 4YT6H 1ONBA 3W3ZB 1A5IA 1GUAA 1FW6A 1KJZA 5GPIB 2ASEA 1OXVA 4FUDA 5F03A 4EPYA 4RD6A 2A32A 2WMOB 2G1KA 2ZETA 4IVQA 221PA 4OGYA 1SZPA 3QKSB 3SUDA 1W0KA 4OQFA 3B60A 1H65A 5GIBA 2EYUA 4W7SA 1O2YA 4JZEH 4TTQA 4HUQB 1XXDA 4ABGA 1W5TA 1DXPA 4D0LB 2BCGY 4LRWA 4EJSC 1T3LA 1RJ9A 2ZXUA 1SVOA 3L0OA 3UWJH 4FMCF 1IOEA 1DUAA 2IBMA 2FS9A 1WQVH 1R0YA 5AJXA 7ESTE 2P67A 2X2FA 1VMAA 3IILA 1O2HA 2F9LA 4MUBA 4DIHH 2WV4A 3SJIA 1GVLA 1NKTA 1QL7A 2R62A 3K65B 4LC1A 3QPUA 2JA1A 3I92A 4TPIZ 4D4JA 1TWXB 3SFVA 1CT0E 2BBTA 4GOKA 1QHGA 4BLRA 1TPOA 4DLYA 1Z0KA 3RXTA 3EPLA 1NG1A 1ZM2A 5E2PA 1TQ7B 1D3TB 2WICA 1E6CA 5BN4A 3F9HA 2OFWA 5CJ2A 4I1OA 2Q3HA 4BLTA 3KN2A 1Y3YA 5JI3E 1SHYA 3H86A 1ZSLA 3KF2A 4RD2A 3F3YA 4GL2A 5DLQC 3QEJA 3AUYA 3P8FA 1F5KU 3A4LA 2ATXA 5L2YH 1KTTB 1HXFH 2BVXH 1DADA 4NYMR 4L4UA 2ASUB 2ZRHA 1O37A 2AMQA 1CHOF 1CGJE 1O3MA 2GZ8A 2CNWA 1AFQC 1SBWA 2YNBA 2PJRA 1DG1G 1HJ9A 1XUGA 3UREA 2GJKA 2SGQE 3A87A 3GY5A 1GSIA 2GETA 1BTYA 1G36A 2DFNA 4BZQA 1JAHA 4AYTA 2RA3A 1WXRA 2VYFA 3T1QA 1N6XA 4X2YA 4TMTA 1BA8B 1C1MA 2OC7A 1EATA 4B2IA 2ONKA 1KY9A 4EFNA 3QQ5A 1C5SA 2LNCA 3I4LA 1V43A 1ZYUA 2FX6A 1E4VA 2F91A 4O3UA 1SQOA 2BEKA 3I5YA 4C9BA 2RCNA 4CRFA 3CF0A 2R2MB 5HKKA 4LPSA 2FPLA 3AQ4A 4DCSA 4JBYA 2ZA5A 2NOAA 4XBCA 4FXPA 5DP7A 4PZYA 4PQYA 3UUZA 1KI4A 3CF6R 4WVFA 1FQJA 4LYHA 1TX6A 4ITRC 3KFXA 2FG5A 4KFUA 2AGEX 5LD2C 1VPLA 2PBRA 4C0SA 4LOAA 4FU8A 3S9AA 3MO6A 4CREA 2SGEE 2YOHA 3LX8A 1WXQA 4G5GA 1HUQA 2P95A 1Q1BA 1GCTB 2VVCA 3E0PB 3BB3A 5GVSA 1P7CA 2HDNB 1HJ8A 2O8TA 3RXIA 2PT5A 2MSDB 1AVWA 4BXWA 1DAMA 2C9CA 1YRAA 1PVOA 3QF4A 4D7GA 3BE4A 4GNKA 2GVFA 5AWFC 1FUKA 1SGRE 4P33A 4DEYA 4ZH8A 2AYWA 3GCHC 2AN9A 3TNFA 4Y8YA 1VR1H 1TNGA 2CVFA 5HM2A 1J99A 1TONA 1W13U 1C2JA 3SU6A 4K5ZA 1W5SA 4MGYR 3GJ3A 3JVVA 1PPBH 1C5OH 2ZU0C 1LVBA 1SVLA 3K9HA 1V2ST 1Q3TA 3MO9A 5LB4A 5AJVB 3B5JA 3L0PA 1EZXC 1ETTH 4I1SA 4LSGA 4TT3A 1P10A 3F1SB 1RZ3A 4OBEA 1LPGB 3EA0A 3MOCA 1BBRE 2B9LA 1AU8A 2X2EA 3UIRA 1P3JA 2FYQA 4AG5A 3DHKH 3PEYA 5GCHF 3CS0A 2WWWA 2WV5A 2W6JA 3GLGA 4TZ0A 5K8TA 5AJZA 4BRUA 1QJ1B 3GLFA 4RD3A 4U30A 2UWOA 1E79D 1JECA 4NDZA 1Y5UT 1HAGE 1KZ7B 5AJYA 1O3DA 1D3QB 2VHCA 4M1TA 3MMPA 1L2TA 1E0JA 2STBE 2JJ2D 3NEJA 3LH3A 4RD4A 1ZC3A 2VP4A 3QG1A 2NO1A 2BOKA 1ZGIA 5EPNA 3RXHA 2W26A 1B7XB 4FWIB 1KO1A 3ZIAD 2VSXA 7GCHG 3FYHA 3W90A 4GP6A 4GAWA 1G19A 1JR3D 1K28D 3DD2H 2ZHDA 1XMSA 1F5LA 4PHFA 1ZU5A 1MZDA 4D0GA 1K9OE 3MNSA 3UQOA 1TE0A 2IHYA 1W4AA 3IWMA 3I1FA 2ULLA 4DJTA 3BTQE 3RVBA 3GY7A 1UVOA 3TE6A 2QBYB 1K1IA 2ZJZA 1NRQH 2OEPA 1UVTH 2A31A 4X2WA 4JZFH 2EYQA 1Y3UA 3CZQA 3M5MA 1MRSA 4TN1A 2YWHA 3RS4A 4HB0A 3TW8B 1P3CA 2EI7A 4M9FA 5EQRA 1LF5A 1O38A 3D31A 4JJKA 2W58A 2WMNB 1E0AA 3TAUA 2FZ4A 1EFUA 3TNSA 4LZZA 4MKIA 1CJUC 3L0SA 3MFYA 5FX5A 1FQ3A 2VWMA 1JBKA 2CJIA 1OXUA 4B76A 1GI7B 4PC1A 4A6PA 2F3RA 1N3BA 2ZFPH 2ZREA 1QHRB 4AFQA 1M74A 3U3OA 1PPFE 5FUYA 2H18A 1XKAC 3A6PC 2OT3B 4XE4A 1LDTT 1KK2A 3QN7A 4D26A 4WA7A 1D2MA 4ZIRA 3BS4A 4N0DA 1GJ8B 3U3KA 1YZQA 1G3DA 3FWYA 1BMLA 3CWZA 5JWOA 2BVNA 4YESB 3KQBA 2WWYA 1BMMH 4PC2A 5JYIA 3MYWA 5JBCS 1Y3XA 3UFAA 1DAGA 3SJOA 1MU6B 2VVVA 1ZSKA 3B13B 3P1JA 1TF5A 4M9QA 4B75A 1H8HD 1G3EA 2ZE5A 4IOLA 1ZU4A 1QURH 2AX4A 3V4RA 3PJRA 2WYGA 1XVOA 1ZSJA 1UBEA 1P9WA 1ZZZA 2MSCB 2ZDMA 1H8EA 1CJMA 4A9AA 1EB1H 2G6BA 2FP7B 2MMCA 4Q18A 4V0OA 5A8XA 4PROA 1XUFA 4YZUA 3URCA 3O8BA 121PA 4BLOA 2TGDA 3AKCA 3CRQA 1DXWA 2VU8E 5L3RA 1IBRA 3H5CB 3HPRA 5BPEA 5FHTA 2CLDX 3C1KA 2IYTA 4YONB 2FPKA 1IAQA 3DOEA 4XTRA 1KLIH 2XNDA 2A4RA 1YR8A 4KVGA 1JR3E 4EAQA 3RXQA 4YOGA 4BASA 1WQSA 1THPB 2VVUA 3U61B 5F9FA 1GJCB 1AZZA 1P06A 4RJLA 1C5NH 1BB0B 3M1IA 4Q00A 1Q57A 1KXBA 2IUTA 1VCWA 3GCTF 2BOVA 2DPXA 3RRNA 1N5LA 2VP6A 4B47A 3RMMH 1DAFA 1ZYOA 2NU2E 3FP7E 5DG6A 5TARA 4AYYB 4NSYA 3A81A 5EE9A 4NFFA 1IXRC 1CE5A 3K9GA 1Q20A 1O32A 2NU4E 4NPHA 2BMEA 3QXSA 5GJCA 2H5DA 5FL3A 4MPWA 1W47A 4JL5A 3U1JB 1X86B 1FAXA 9LPRA 3T1VA 3K0FA 2R2AA 2WINI 2P65A 4KODA 5DO9A 2V1UA 3KQUA 2NMVA 2J45A 1MQ5A 4A15A 2PR3A 3W6PA 4X8LA 4OQLA 1U9IA 4JLOA 1COWA 4E7NA 1O2GH 1PFXC 3Q3XA 4AZ2B 1DE0A 4AFSA 3QKSA 2Y7XA 4NL4H 1MH0A 4C0BA 4HUQA 2SGFE 3GCNA 1DPFA 2FEQH 1KSHA 5AFZH 1E9BA 2HUPA 2XNIA 1IY2A 5CITA 3EW9A 3RC8A 1RVDA 1OHHA 1SSXA 2GXAA 1LHGH 3FE2A 4ZKEA 2CXVA 1I4LD 5L3QB 4RD1A 2BQ6B 1SQTA 1VECA 3SUFA 4V03A 1XJQA 4M9XA 4NFEA 5P21A 2P0EA 2WAYA 4FINA 1C2MA 1LHEH 2HJGA 1LKAA 4D80A 1UF9A 3QZRA 2WPJS 1YLDA 2ZHWH 1Z6GA 1O3OA 2RGNC 5EP2A 3GCOA 3KCGH 3BIVH 3A1VA 1S81A 2PLRA 4N3NA 3CRW1 3EE0B 1TBZH 1T5LA 4HB3A 3C14C 3MH6A 1GHVH 4GVUA 2XC4A 2PCJA 3WYFA 1MO5A 1VJAU 2J0VA 4QT8C 2B8OH 1N25A 1RIFA 4O2LA 5JFGA 3EYDA 4GCHG 4EFMA 4GUXA 1WDTA 3ZZ4A 4M9ZA 3PLPA 2BEJA 3K70B 2N46A 3BH6A 5HZKA 4OQXA 2V35A 1S2MA 2CL7X 3BFVA 3FVQA 3W5IA 1KMQA 4X1RU 3ZZ9A 1TPZA 2VP0A 3HR8A 2Q3MA 1N6KA 2OV2A 3TLXA 1HAOH 1OYTH 2QSZA 2C8VA 3SYNA 3Q5EA 2ZU4A 2YNMA 4HYYA 1LY1A 1N5JA 4KSBA 1PPHE 3TAHA 1OFIA 2J94A 1C4V2 4UONA 1ZCBA 4TL9A 3G5UA 1ZM7A 4M1KA 2PKAB 2GT8A 1AIPA 3TUIC 3RUOA 1JPJA 3L0IB 4ISNA 1NJGA 1GP2A 2A5DA 3T5DA 4MYHA 1AQUA 1A7JA 5IDKA 2ZU5A 4A2QA 4OHVA 5HTKA 2ZQ2A 3ZQ6A 4FXGH 7KMEH 2GDJA 2QXIA 4AKIA 3EA5A 1PV4A 5E7IA 1SGQE 3UIEA 2P3TB 1SGWA 2EQBA 2WPMS 4X8HA 3RYTC 4MDFA 4CF7A 4H6TA 3RXDA 2VBCA 5JBAS 1B0UA 2BKEA 2HOBA 1ZM3A 3ATWA 3B1ZA 2WJGA 1F2TB 2JASA 1C5YB 1LW7A 1ZTLA 3KXLA 4Z8XA 2PMKA 1AGJA 1MAYA 1AHTH 1NN3A 2H9EH 3WMGA 4GHQA 2J41A 1IQHA 3ATIA 1NKSA 4YDHB 4HUTA 1Z6AA 2RDLA 1BOQA 1YF4A 4ZMAH 3A86A 4RSPA 2GK7A 1BMAA 2NTYC 3CB4A 1KHTA 1RRKA 3WBKA 5DJ7A 1UTOA 1FUJA 3QPWA 2C98A 1YCPM 3THYB 4ZHMU 2GCTB 3UR6A 4MITA 3PO1B 3U3JA 1TF2A 5SGAE 4K3JA 1TNDA 4RFSB 1FPHH 1TOMH 2FS8A 1MAXA 2OBNA 1DFPA 2PKSB 4FCTA 5J4HA 4XSGA 4Z54A 3TK1A 4Q7YA 4E05H 4B43A 2CF8H 3FMIA 1EZQA 2H9TH 2CLSA 1M6NA 3ELAH 3BK7A 2F9NA 3BTDE 4YTAA 3V12A 2FE4A 1BBRH 1V2RT 4IDQA 2OILA 3Q77A 3RXJA 3C8UA 2ILNA 3CKLA 1GGDC 1NS3A 3SE0A 1MO6A 1WCZA 3BBPA 1PQ5A 3ZLJA 1E1QD 1TQ0B 2BM1A 2GJ8A 2AFHE 1S9HA 2B92A 5L8VA 3P26A 2PCLA 2Q9BA 3CM0A 3K0CC 2CHAC 2EA3A 3SQHE 1N8OC 2EI6A 1G8PA 3C5HA 5FL7A 1ANCA 2R6GA 3W8NA 8GCHG 3H09A 4IMZA 2YWEA 4K1EA 1FPCH 2ZJYA 3G0HA 3TVDA 2G51A 1BYUA 1Z6JH 5CLQA 3NKKA 2A7CA 3CW2A 3VKWA 1OKKA 1W49A 2GF9A 3HU2A 3OF5A 3FDIA 4UDWH 5T6DA 5TDHA 4XWOA 1UK3A 2V7QD 1HJAC 1SGIB 2LPRA 4CVNA 2OG2A 5E0GA 1QVRA 1A2CH 4MKFA 4CHAB 2QQ0A 3BWDD 3LIWA 2H57A 3M35A 1S9DA 4TTPA 1BJUA 1G5TA 2QF0A 3NHBA 2YHSA 3M7TA 1G4UR 2HCJB 3LKWA 1JPNA 4G0NA 3GMTA 3LV8A 2C04A 3P92A 1IQKA 1GL0E 4FVBA 1KXDA 3EXAA 1XM1A 3AKYA 1RW4A 1FP6A 3JZMA 1FNMA 1RJXB 2QMHA 2ZECA 4TY6A 4ABBA 3U7HB 1O2JA 2FMXA 1GJ7B 1T8LA 4Z0KA 3AF0A 2Z6BD 2Z7FE 2IYXA 2ZRNA 1NVWQ 2REBA 1FFHA 1HH4A 2C2HA 4WW0A 3DZ8A 2A78A 1O5BB 3A7WA 4ZI2A 1OYWA 3A37A 3LC5A 1AD8H 1TMKA 2GAOA 3TUJC 1P2OA 4JYBA 4C2TA 2FDAA 2O8LA 4LC0A 2ZAOA 4KSCA 3RP2A 1GG6C 1NRJB 4G5SA 2G88A 2WKRA 5EZ6B 5EP3A 4C0HA 1A46H 1WP9A 3OZXA 1CVWH 1XZQA 5TVKA 3CONA 2OC1A 5T1VA 4Q4HB 4R98A 2BKUA 1C2DA 3PB1E 1TADA 1CLUA 1O2UA 1FONA 2VF7A 3E1XB 5HE9A 2I6QA 3RS5A 3PWBA 3A82A 1FPMA 1G41A 1LFDB 1VG1A 1O3YA 2BX3A 2FGKA 3MI4A 1C9KA 1XTQA 1QRXA 1BT7A 3ADKA 1DPOA 1ELTA 2O8EB 2W7SA 4DBLC 4AYVB 1O30A 4LJ8A 1HNEE 1ZHMA 2OCYC 4AURA 2VRWA 1ARCA 3M3TA 3LOXA 1II0A 4JBWA 1AGPA 5DK1A 2IK8A 4M1WA 1R0XA 3FFAA 3TH2H 5FOWA 3UOUA 2PTCE 4KBFA 2O8DB 3U8RH 1P03A 4YLGA 1L4ZA 5SZIA 3N7OA 1GHXH 1QF9A 2CL0X 3AGPA 3MAAC 3WHLA 3IIMA 4JT4A 1VZQH 3B1VA 4NSVA 4TMXA 1BOFA 2ZCKP 2RGCA 1LHDH 1FY8E 1SVPA 3TJOA 1MQ6A 4J2YB 3IHWA 2BC9A 2FIRH 2VB0A 2JLYA 4C0QC 2R8RA 3VR3A 1AS2A 2XTNA 3PFIA 1CJTC 3UNSA 5FCRA 5KDOA 1UK2A 1WU1A 1SB1H 4JMPA 1CR1A 1XD8A 1AE5A 4PZZA 4IMQA 4MUAA 5K8UA 5AUNB 4BAQB 5LDDC 4P4UA 2GDDA 1C2HA 3F5FA 1GHBG 2THFB 2HNTE 3EA8A 1A0JA 3MH7A 3ZYCA 1P75A 2PTNA 3NBYC 4X6NA 5EW1H 3GFPA 1F0RA 4Q1EA 4GMDA 2GZ9A 2Z43A 2J1LA 3WP0A 3PUZA 2XZLA 3M7QA 5FTLA 3Q3JB 1NN6A 2FV8A 3CLVA 3KDSE 2VP5A 4CEIA 2Z5FA 5B2ZA 4JZKA 1ID5H 1MKWK 4ABYA 1TTTA 4W5JA 3A8AA 4LI0A 1WUNH 1Z06A 1Z8GA 4Y79A 2FESH 1QBNA 4URUR 2Y80A 2HYDA 3BTFE 2FMJA 1P12E 1QCPA 3I29A 3MMGA 1O2KA 1X8JA 3CRVA 4AB9A 1CO7E 1C1UH 3RC4A 4YOJA 5DYIA 3VR1A 4MRSA 3MJHA 4UD9H 2ALVA 3IGFA 4JKIA 4ABDA 1E2LA 5L3QA 2RCEA 2BTCE 3QPVA 3E6PH 1E0SA 2OCVB 1NSFA 2WHXA 1KO8A 2GEVA 2A4OA 2FA9A 4JZIA 1NFUA 5C5NA 1GWNA 3V4FA 3ZZ5A 1XKBC 5AUOB 2CE7A 1A4WH 3C4JA 3OFND 1YBWA 2WPDA 2OXCA 1R5OA 3KQLA 5LPFA 1SQAA 1G8FA 1ELOA 2CE2X 2OP9A 3A8DA 4ILEA 5GNDA 1F92A 1W0JD 4HAZA 3NZIA 1IAUA 1P61B 2ZZUH 4X1SU 2A5FA 2ANYA 1NU9A 2V4ZA 1KXFA 1JXMA 1CJVC 2QRZA 3SV8A 1GJ5H 2J87A 4LX0A 1RC8A 2JJ2A 1A4RA 1IN4A 1E3MA 3BEFB 5KO2A 1EP5A 5EQSA 3TIUA 4KV9A 2XBVA 4BECA 2FOEA 4DOQA 3QUMP 1JR3A 3LGWA 4O97A 1G3MA 1JBUH 1G9IE 1G2LA 5KPJA 1XP8A 1HE8B 5FBEA 3ZQJA 2IXGA 2BDCA 2Z9IA 1NP6A 1MKWH 1E98A 1TL7C 1SVKA 1G7SA 3OESA 2EW1A 3ZZ6A 2J34A 2ZUDA 3NCLA 1IXSB 2LWIA 4R2IA 3ZZDA 3CF2A 4GZMA 1EJMA 2BM2A 1NG9A 3H2YA 1UCYH 1IOZA 3TKLA 3SU5A 1GMCF 2EWWA 2QXGA 1HT1E 3VNVA 3U3RA 1FXYA 2DFLA 3FTQA 1F2TA 1EAXA 3E2IA 1AWFH 3REFA 1ZNWA 2ZSDA 1A3EH 4NYJR 3PR1A 4KP0A 3MJRA 1NFWA 3CR8A 3SNHA 1E37B 3A1SA 1KAGA 4PO1A 4MNVA 1GTVA 2BVRH 2F83A 1QL9A 4Q4JA 5JZVA 1AVGH 1YPKH 4X8VH 1UBCA 3LW8A 2XYAA 5FBLB 1FY4A 3UMSA 2GA8A 5HR5A 1N6YA 4QC2A 1U8AA 4A7IB 1VCIA 1CRQA 1T5IA 2GEUA 4AD8A 4NCYA 4CRDA 1XRJA 4NWLA 4NHOA 1E9CA 1O3AA 4HB4A 2W2XA 1S3SA 4RFSA 3RNLA 4Y10E 1J70A 3PCRB 4GMXA 3R8CA 2OC8A 1HV7A 2FFHA 1NIJA 3IQXA 2C95A 1TA6A 2ZRCA 3VR5A 1WSSH 2Q6TA 3MG9A 4G5OA 4F92B 5CB6A 3X1XA 4S35A 1U90A 3EARA 1S0UA 1WYKA 4B3FX 4MNYA 5DP8A 4TMVA 4M1OA 3B78A 2JLRA 4EPWA 4PPNA 4EKDA 3EWAA 3ZGXA 3RMLH 2RKOA 3SJAA 4LJ6A 5JCZA 1ZBDA 1KY3A 5CDFA 4QBIA 2XB4A 4OJQA 2ZPRA 1YU9A 1E2MA 2XX3A 4JVSB 1PJRA 2V6IA 1QQ4A 1N6OA 4GPGA 1MABB 4LBVA 4ON9A 3AK5A 3SN8A 3Q72A 1ZTKA 4Q2KA 1FMJA 2WPHS 1C9TA 1SXJC 3TVTA 1IQGA 1GIAA 3ZV9A 1G5PA 3ZZTA 1IM2A 1J8MF 1E2FA 2FO9A 4D25A 5A09A 1KKMA 2O8FB 1HLTH 1D2EA 5J4YA 4CRAA 3A1WA 2GV6A 4ABIA 1JNYA 1P72A 3K09A 1CBWC 2ZHEH 3RXSA 2IYLD 1C5MD 2Y5FA 1OWIA 4F49A 3RC6A 2ZS8A 1O2VA 1XZPA 1AN1E 5D3QA 1SC8U 3GPLA 4CGZA 2F3CE 2K5UA 3SNDA 2HT1A 2Z9GA 5EPYA 3U8OH 2NZ8A 5CHAB 1JWTA 1EAUA 3UY9A 2CDNA 4OHXA 1ELBA 1ZUIA 3EPKA 2J95A 4D6PA 3QF7A 1XPUA 2ODQA 4JLBA 1FLEE 2AMPA 1Z0IA 5L2ZH 3OEED 3KQHA 1O3EA 4X2VA 2ANWA 1H9LB 3LLMA 1HFDA 1ZLRA 2CN0H 1BRBE 1RTFB 2VIVA 2J0UB 5FBIA 1GVKB 4B2LA 1VDZA 3ZZ0A 1N6PA 2Z0MA 3GD7A 3NPSA 4X6PA 4A5TS 2C78A 1TU4A 1BJVA 2IF2A 3FMOB 1YR6A 3LQQA 3NDBB 3SI7A 2BMJA 1O3BA 1T6NA 1TLDA 2QRNA 1TEXA 2G5VA 1T0JB 4Q01A 2E9SA 2QM8A 2RHDA 1Z28A 3OAAD 4WJG2 1HBTH 3T35A 2J0SA 4LV6A 4DRZA 2QGZA 2Y8EA 5HZHA 1ABJH 5IF9A 1FN6A 1FUUA 4JSTA 2QTFA 5E7JA 2QNRA 4XD7D 3LJOA 1XUHA 1GMHF 2A4QA 5JMTA 3M5LA 1G6OA 4Q4HA 2WTUA 3B1WA 2FLBH 3D6TB 1S0RA 3ZZAA 2CXXA 1MD8A 3KB2A 4YMVA 3M3VA 4MGIR 4F4CA 1ESNA 1KXEA 3ZVFA 5GXPA 1HQCA 2QL6A 4X8MA 2DE8A 4MLFB 2O8EA 1M9UA 2PUXB 1IQPA 3VR6A 3QNUA 3T5GA 1DO0A 2P94A 1SGEE 1E2KA 4F91B 2ODEA 2F3TA 4JZ1A 2FSFA 1C4U2 1ZM4A 1MOZA 4ABAA 3RMOH 5KTYA 3QKRB 1HY3A 3WXMA 2O8DA 2FWRA 1C5UA 3ZVDA 3UWOA 2BHRA 1YZGA 2BDYA 2BD3A 3I61A 3AKDA 1WBBA 2UVQA 4I81A 2ZJ5A 1P9RA 4V0NA 3J81k 3HPQA 2QF3A 4HI0E 1W8BH 4E09A 3H84A 1P2SA 2QTHA 4AGJA 1BIOA 3MWJA 4EDHA 1D6JA 2QMUA 3ZVAA 4D2IA 1ELDE 6CHAC 2QCYA 4ZXYH 1CA0C 2NO7A 3A7VA 5IRCD 5G53C 1P4SA 3IIJA 3ZZCA 2RAPA 1E32A 1Z83A 4Q4LA 1X6VA 3FKSD 2Q1JA 1FMLA 3KEEA 3LT3A 5DI3A 1K5DA 1ZMNA 3QSYA 4B73A 2EEKA 2AEIH 1S96A 1A5HA 2ZPSA 4PSKA 3ETLA 3B82A 3GY6A 4QKQA 1EJNA 1JEEA 8OHMA 4YM9A 4BANB 5HYOA 3MU1A 1KZGB 4DB4A 1GI0A 2FODA 1YPEH 2F9BH 2CK3D 3KQDA 1BUIA 1KTVA 4LV8B 1T8MA 4DDTA 3OE7A 1O3PB 5EW2H 3T29A 3VB3A 4TYPA 2VH6A 2XNSA 3U4QB 1V6DA 1U81A 1AZ8A 2JAQA 1XUIA 4AIIA 2WSSD 4Q21A 2WUCA 1XCMA 3ATMA 2RH5A 1P2QA 1TPPA 4IXMA 1GBJA 4FWTA 4ACBA 4ABHA 2WVJA 1Y3AA 2J5XA 4FMDB 1ZTJA 4H9GA 2FPZA 1LV7A 1L4DA 1T4UH 3A7TA 5L3SB 3T1OA 1DICA 4BFSA 3HGNA 1OH5A 2XC5A 3SGQE 5DYGA 1YZUA 1KSGA 2BZ6H 2BDBA 2WWFA 4XH9B 5DN6D 1WF3A 4ZKSU 6GCHF 3PITA 7LPRA 1C5PA 4Q03A 1A0HB 1OV4A 3M7UA 3I77A 1K1JA 2ZGBH 4FUHA 4LOYH 3OIUA 3W6OA 3HK6B 4NH0A 4P3YA 4US1R 4KKDA 3D62A 1Y3VA 5FOUA 3TLOA 4WH6A 4DDWA 4FU9A 3CX7A 4X8TH 3PUWA 2Y5GA 1YZLA 2QZ4A 1Z29A 3TQFA 3WP1B 4UXIA 2IYSA 3RS7A 2I4IA 3AAVA 1AB9C 4HTCH 1KAOA 3IO5A 3U9AH 4TL7A 3RS2A 5FFMA 1YPHE 4ABEA 1EFRD 4LUCA 1MTNC 2ZIQH 5HXFA 3LJJA 3NVAA 2G5NA 2G8TA 4UQOA 4M21A 1Q31A 1KI9A 2A1DB 5ETXA 4BNRA 2PFEA 4C7OB 3PYHA 1R0ZA 1ANDA 1OXGA 4BQSA 4I8JA 2OD3B 1Z8JB 4K69A 1J90A 1R4AA 4P0TA 3DKVA 2BD7A 5FX6A 1XTRA 4QM7A 1FMGA 1P0SH 1YPJH 4OQNA 1TMTH 2E87A 3B8HA 1YZKA 3RC5A 3GJ5A 4OHYA 1OPHB 1Z0FA 1OE0A 2WYJA 1W12U 2G83A 1TAGA 4LJ5A 2I1QA 4CYMA 1E2GA 1EAWA 1ZD1A 1GJ4H 3IUYA 4JLMA 3L2OB 2XCNA 2WAXA 2IOTA 3MNXA 1YZNA 1THSH 3OTJE 4EQ6B 2D06A 2PSXA 2KAIB 5EZ5A 1XJ0A 2A5AA 2F9VA 4MRVA 2OUAA 3THOA 4Q7KA 2D1JA 1DARA 1NFYA 5BN3A 4Q1AA 5D3MB 2HPPH 3CNLA 5FTKA 3ZDQA 4IKEA 4NMMA 3TK5A 1GPZA 2ZGHA 2H2ZA 3WMEA 3SJ8A 4EPRA 4IC5A 3EPJA 3VKGA 1X1RA 2V55B 1U0LA 4ESHA 4BWYA 4NA8A 4TLBA 3PM3A 4OQMA 3S0NA 3WNBA 1ZJ6A 4CDGA 1ZHRA 4E22A 3TH3H 2ZTSA 2N1BA 1FIZA 5DE3A 1D9XA 1TX4B 1VG8A 4A0FA 1BYIA 4U32A 3ZZ8A 2ZE8A 1F2SE 2IXEA 1W7XH 2XCFA 4Y71A 1VIAA 3ZVLA 3QK1A 4ZPXA 1DWCH 3GJ4A 3KFVA 5H8WA 2YWFA 2GZ7A 2F7SA 5KSOA 3BD9A 4LZ4B 3QX5H 3SGAE 2D62A 4QJ4A 1TGTA 1GITA 2OAP1 1KKLA 5KNBA 2ZF0H 3EWSA 4NYIR 2XSZD 4RCYA 2GCHG 5K7RA 3GLFE 1GHZA 1X8LA 4ZI3A 2W0MA 5CLLA 3TR5A 2VL7A 3KJIA 3LPRA 1NMYA 1F7ZA 1ZJDA 3EZFA 1RTKA 1TNHA 5JBQA 1NC6A 1UHBB 2A2QH 2A2XH 4B3XA 3E70C 5G40A 2IF0A 3NBXX 4PHTA 3UR9A 5LBIA 4KVAA 2PWXA 3VTKA 2WUBA 3QI2A 1MBMA 2SGPE 1D8TA 1LVYA 4ZKNU 4M7GA 3EIEA 4X8SH 1BDAA 1G3CA 2BM0A 4OI4A 1FY5A 4UNRA 3MH4A 1MABA 4Z6AH 4CZ2A 3RM0H 1TGSZ 2P2LA 1E4YA 2AR7A 3BFKA 1M7GA 4FUGA 4YT7H 2Q6GA 1NBMD 2FTMA 3LH1A 1EASA 3BTEE 2CHVA 3SHWA 1AK2A 2H5CA 3CZPA 1B23P 2D7DA 1KDPA 2EFEB 4AFUA 2O8FA 1QG2A 1UTPA 1YPLH 4D0NA 2XXAB 2IS1A 4DT7B 4JLVA 4DVGA 2XOKA 3EX7C 4GZLA 1J17T 4PQRA 4BOHA 4TWWA 1RD3B 3P27A 3X1DA 5DNYB 1RIWB 4Y7AA 3W8RA 2CL6X 2FEMA 4MNXA 3THWA 1QBVH 1E94E 2HT6A 1VITF 4NZQA 2AXPA 5DPAA 1O5DH 2OM2A 1VCQA 1S8FA 1QBOA 4R2HA 4QHYA 2Y7ZA 2IYQA 1O3KA 1US8B 2F6RA 2C03A 2AMDA 1M34E 3WHKA 1C1YA 3B7GA 1XTKA 2GMTB 3PMJA 2BDGA 2STAE 1MUEB 1GI3A 2J0UA 4MKGA 3F6UH 2G9NA 1KI1A 4JIMA 4DCDA 3SNBA 5TB5A 4DW2U 3SBEA 4UEHH 4PPQA 1C2LA 2JKHA 2IN2A 3SYJA 1P2TA 4WBSA 1MKYA 1R10A 4JCNA 4HSEA 5AF9H 1GI9B 1W36C 2J3EA 1Z6EA 4UFFH 1P2JA 1MTWA 2GCHF 3ADBA 1NZQH 1BMFA 3ZD6A 4LBYA 3LGIA 4LJYA 3IEUA 1QL8A 2FZLA 3TJNA 1HAIH 1DY9A 2VWOA 1AKEA 3FP6E 4R7ZA 2MMGA 4LXBH 2H7VA 1KJYA 4QRHA 5FUXA 5CK4A 4XSKU 1K1OA 3GLGB 3LAWA 3UNQA 3GLFB 1EB2A 2AGIX 4LPKA 3TK9A 4ZCIA 2R9VA 3PEVA 1DWEH 1ORFA 4I7YH 2BMDA 2RGAA 4E7RG 1F6BA 4D9QA 2C8XB 5DGJA 3IG6B 1P05A 1C5VA 3AF3A 2XC0A 1N5KA 1XD2B 2VHTA 1MTSA 1G9XA 3QKRA 2H92A 3AVPA 1N6HA 2O5VA 4B71A 4TSFD 1TMUH 1J2JA 2ZWLH 5EE5B 3LLUA 5KNDA 4L15A 3SI4H 1O35A 1E34B 3PEWA 2V6JA 1OWKA 2ZYWX 1E1RD 2BHGA 2PLXA 2ZU6A 3D7MA 5B30A 1XCPA 1IN5A 4NA7A 3BIUH 1W7AA 4OK3A 3OIWA 2ERXA 3NK8A 4ESTE 2ZROA 3BH7A 1GI4A 1DAEA 1GMDG 5JBTA 1CGHA 4K1SA 4ACAA 2FOFA 5TCAA 1HAZB 2REXB 4UXHA 2NWNA 1I4TD 3CPJB 5E3HA 1T0HB 4DKXA 1YPMH 1KDOA 2FOHA 1A61H 3EA9A 1M2OB 1UPTA 1EPTB 1NJFA 2IUSA 2PH1A 4D9RA 3U1IB 3HATH 3PEUA 5J4VA 2VJ1A 3E5HA 5T6FA 3A4MA 3IKJA 5DISB 2JATA 1TABE 1JAIA 1ZMXA 1NMZA 1SOTA 3KUCA 2FFAA 1OH6A 3UWKA 2JLWA 4B33A 4YO9A 5JECA 3A8BA 1BS1A 2FF7A 4KGAA 1GCTC 2P5TB 5C5OA 4ZKDA 4Q47A 1UKYA 3CX6A 6ESTA 3JZAA 1XXHE 5C67A 3MUFA 2IWHA 2DFKB 4LY6A 2EWVA 1G32B 4CH8B 3T06B 1U2RA 3ASYA 3LW7A 4G01B 2C8ZB 3LNCA 4HAXA 4OK5A 5B64A 4KELA 2VSOA 4WVPE 2OLJA 4FMDF 1V2PT 5DGXA 1A2KC 2RA0A 2QP9X 3R7WB 3KQCA 1GAJA 2FX3A 3HR7A 4MYCA 3KXKA 3ZS8A 1DUEA 4FUCA 3RU4D 1E35B 4RY2A 3QTVH 1YQTA 3X1YA 1AUTC 2DWQA 2HLDD 3E16B 4NGAH 1EUFA 3ADCA 5UKDA 5J4KA 1TPSA 5J4LA 1QHIA 3VNUA 3UNRA 4QNRA 2BD9A 3JZ2B 4BAOB 1AN0A 2VO1A 3N2EA 3UG7A 1SGFG 2ODYB 4ZUHA 2AWOA 3IEVA 3KKMA 2FWWA 4NE2A 1TOCB 4Q66C 2XWBI 2CBZA 4TYYA 1K22H 1CHOG 1P60A 3LGTA 4UJ5A 3VR4A 6LPRA 3A8TA 1LS6A 2ZUCA 4X1PU 1O2WA 2W6IA 1AI8H 3NIBA 4BZPA 1SXJD 3SBKA 5KPDA 1HT2E 3UTUH 1MD7A 4C7OA 4RKOB 1INCA 4IW4E 3ZYDA 3ZZ3A 2BY5X 1JMOH 1GBMA 1FZZA 2ZYTX 2F9PA 4Z51A 5CIQA 5A0FA 1V2QT 4ZDWA 4YXWD 3VMFA 4OGXA 1V5WA 3KB1A 1F48A 5JEDA 2ZITA 1GKYA 3KX2A 1VGCC 1TALA 3HU1A 3K0FB 3FZDA 5F8TA 1TBQH 1O34A 3U2QA 4E06H 1Z22A 2C99A 1L4YA 5GJ4B 5DHFA 3ONWA 1IN8A 3I72A 1F0UA 2F43B 3ND9A 4I8GA 4EQ6A 1EX6A 2P6UA 2JJ1D 5JEEA 4AYXA 2KAIA 2AK2A 4DZZA 4DLSA 1T3SA 1EZSC 3G82C 1GI8B 1T91A 3S9CA 3OTPA 3LD9A 4O2RA 3N70A 5BN5A 3EZ9A 1G7CA 1KSNA 4BZXA 5D3MA 3M0EA 1IQJA 2SNVA 5JDUB 2CEAA 3L43A 4AKEA 4Q7ZA 3SU1A 3FHTA 1Q2WA 1P2KA 3HKJB 3AH8A 2VIDA 3GP8A 5L30H 1GJBB 3BXZA 3CENA 1E9DA 1W36B 4D7FA 4E03A 1HAPH 4KBGA 4DLXA 4TPYA 2ZDAH 3SGBE 5DSZA 2TRMA 1BTZA 1O2SA 3AGQA 2G4TA 2J9NA 4NYMQ 1XXHB 4MRPA 3FP8E 3NWJA 2ZC9H 5FOTA 4RI0A 1L7VC 2YC4C 1FX0B 5GJWC 1G5RA 2BB4A 3K6YA 4ABJA 1Z0AA 1XB2A 2AKAB 2CCKA 2BOHB 1TGCA 4PQFA 1HXEH 2A5IA 3O8RA 5G4BA 1LCYA 4UJ3A 3FAOA 1SHKA 2GXSA 2UUFB 3SR0A 1NN1A 5FOVA 2OE2A 3PIRA 2G55A 4D81A 5GCHG 2OAQ1 1YVDA 5TCCA 2A5JA 1UTJA 1WCV1 5EODA 5K8IA 1UHBA 2BBOA 1SGTA 2OLGA 1C1RA 3GYLB 2FI4E 2A45B 1D5CA 1E9FA 3ZZ7A 3AF1A 1GRQA 4B2AA 2GCOA 1NFXA 2BJWA 4B6FA 4CR5A 4DVAU 2FXRA 2RMKA 1E38B 2RGGA 3ITIA 3A84A 5AFYH 1EFCA 1KI3A 1PJPA 1PPGE 1DOJA 2C9OA 4ZCLA 4LCBA 3WBJA 1C1VH 5DP3A 2ZE7A 3TVJB 4IVPA 1HB0B 3RRYA 4TMWA 2FOCA 1HAVB 4OI0A 4KTUA 2QN6A 3ZZUA 3B8JA 3AKEA 3RXPA 1PPEE 3UXMA 1MH1A 4QGHA 2XXAA 3SUEA 5FPTA 4HAYA 2Y81A 1LQDB 5DH9A 3BFXA 4JJZA 1T4GA 1SFIA 4DHEA 4TQ9A 4OHZA 2VP9A 4NIXA 4PO8A 4WY3A 1L2EA 2CV3A 3BTKE 3QGJA 4J0QA 2XTZA 3LC3A 2QIQA 5HKKD 2CMKA 2GT7A 3FKSA 1PUJA 4OYHA 2ZKSA 1CT4E 3MWYW 3AW0A 1BIFA 1Z0JA 2VH0A 2P5SA 1US8A 2R6CA 3ATKA 4Q80A 1XTSA 3RLYH 1TPAE 3D8BA 1G30B 3ZS9A 2Y5HA 4Q7JB 3BTWE 1HTWA 2ZHQH 4YMWA 5HCNA 3ZVNA 2J92A 3GEEA 2UUKB 4MA4A 2IW3A 3RC3A 1G7RA 3BB1A 2B8WA 4A2WA 2JLQA 3AVXA 4QNMA 3QY0A 5DP5A 1W14U 1XXFA 4HLQB 1HPGA 2BXTH 3UMRA 2FDCA 1YCPH 2R65A 2ZAMA 1P73A 2CGAA 4WXIA 4L9WA 4O03A 2GESA 3LBHA 3VGCB 4U01A 4UFEH 4DSNA 5J40A 3LRPA 1KXCA 1O5AB 1LB1B 1E2PA 4NCNA 4BAMB 1SPJA 5DP9A 2WJVA 1RRGA 1XMNB 3HYRA 1HYQA 1C2EA 3PLBA 4UNSA 4ZKOU 4EPXA 2H16A 4HB2A 3KHVA 5SZHB 2CHQA 4PSVA 4KU4A 4TT3D 1O0DH 3X2SA 1RFLA 2KJQA 4YMSA 5A0BA 2OCPA 1QHXA 1IHUA 2REOA 4CT5A 1DBSA 5A8YA 1KIGH 3NEYA 1GHYH 4B6EA 2B8TA 4KHZA 3TMKA 1V2UT 3Q5DA 1ESTA 1VG9B 2W6JD 1NVVR 3L8ZA 3FKQA 2JH0D 3K70C 1UEIA 1GI6A 2ZVQX 1NRPH 3IIKA 4K8OA 1QB1A 2YKGA 1XD2A 4X2XA 1X3SA 4GI7A 3B9QA 3LGVA 4DXAA 1BRAA 1IONA 3DM9B 2ZU3A 1OJLA 2BD4A 3LGYA 4ZKRU 2VNTA 4GFDA
chains in the Genus database with same CATH superfamily
5IT9A 1L4BA 1YHYA 4FCCA 4XM2A 1EGVB 1OLXA 3VAYA 2YV5A 3NT5A 3S28A 3B9PA 3TQCA 3M6UA 1Q0SA 2ZYUX 4ISCA 4Q9JA 2G9UA 3GBVA 2DH6A 1F60A 1RM3A 1YB6A 1Q7EA 3NXKA 4IFEA 1NR1A 2ZYDA 3T5TA 5LOVB 1E1NA 2ST1A 3MA0A 4WLFA 5C7OO 3BIFA 2J4IA 1MRZA 5AJWA 2NUAB 1LKBA 4GM4A 3A1EA 3B6EA 5F1YA 1X7YA 4HNHA 4JJEA 3OPYA 2JKYA 1QQAA 4U63A 4S1PA 2RC5A 3DMYA 3H5VA 3DT9A 5EMKA 5TPZA 5A62A 2ZLBA 1L4EA 1HE3A 1GUDA 2LVBA 5KVVA 1T3TA 2ZRLA 1O3FA 4HNUA 1RXPA 2GHTA 4L7QA 3F96A 4HDRA 2PTGA 4FCVA 1W19A 4LVOA 2VBGA 1LGYA 1HDCA 1W6UA 4G81A 2DBQA 4QPJC 1N0HA 2C4FH 1GG5A 1G8MA 3BTOA 4PPGA 1SPXA 2BUAA 4M1SA 2BGLA 2HKIA 5EE3A 1P1RA 4QE3A 3BC1A 5TXGA 1SVWA 4EYEA 3VU9B 1C5LH 1UKZA 1GTSA 1YHZA 2JIDA 2QT0A 5FO1A 5ES4B 3BN9A 4M8IA 3LPLA 1D2HA 3TEJA 2NLOA 1J0EA 4LV5B 1QUFA 1G8JA 3AFGA 2PJZA 1XVMA 2BFDA 2R4UA 5DIFA 4QDKA 2QXTA 2I29A 4F5YA 3TOVA 3H3JA 4KPFC 1OT3A 2HTEA 3ROEA 2XAUA 2O4UX 1TRYA 3JQFC 1NP7A 1U7XA 4R9VA 3BTSA 2VXBA 2HRZA 2PR2A 3VOBA 1GCUA 3N1UA 4F86A 1MRNA 2QLFA 3UPEA 2DR3A 1GCGA 2Z1DA 4GZ6A 5JCPA 4L5BA 4JUAA 3SOSA 5F64A 1KLJH 2IFTA 1ABBA 4P3KA 3EC1A 4CKWB 3A28A 1SUSA 3MWLA 2J59A 1OYYA 3W5CA 4F93B 2P30A 5JRZA 1GBBA 1DITH 1YFLA 1G9TA 3DV2A 3UOPA 2BEVB 1TRNA 1UTMA 4AN1A 3A4IA 2O07A 2O54A 2PZLA 5EE1A 1THRH 1WUHS 2P1ZA 1GL9B 3DM5A 1W2KH 1ARZA 2JH3A 3ET4A 2FZZA 3BMQA 3R0ZA 3K09C 3DNPA 2ZRMA 3KJHA 3QXJA 1LVMA 2E55A 4OLJA 5EWLB 1AJEA 3C3MA 2VOEA 2H17A 4AI6A 2XW9A 3PX7A 1QA7A 1EKBB 4HD8A 4QXRA 3RXFA 2JIMA 3HB7A 4F2GA 4O0MA 4S12A 4URWR 1M5RA 2GPSA 1BQYA 1JEAA 1COWD 2RGEA 3EHDA 4YAEA 3I8OA 1QP4A 2VIPA 2X4IA 3PP8A 5IYTA 4JAVC 2HA4A 2GEFA 3HJHA 1O2TA 4UTOA 3EDYA 1GTJ1 1RXIA 4GPD1 5JG7A 3T5FH 1PTKA 1EK5A 2G17A 2V98A 4FQ8A 2CVOA 4BTTB 3N2YA 1NZJA 1N1LA 1XQYA 2JHPA 5LB2A 1A9TA 3K9XB 3Q2IA 2FWBA 4QU9A 1FX0A 2XQVA 3IJPA 3PTLA 3UJAA 5L9AA 2IDZA 4N7MA 4RQAA 2BFCB 1IDOA 1NVBA 1GRRA 4MRAA 1O2ZA 2YMSD 3JQ7B 5H70A 1U8UA 1QR2A 3DHWC 2BGUA 2V1XA 1BXRB 1DT2A 1PU2A 4UHKA 3GUYA 2X4LA 2GCEA 1MTUA 2OFXA 1I1QB 2OK5A 1K5GA 2XCIA 3AO0B 4UAUA 3FD8A 4EI8A 3RODA 4R2LA 1YR9A 1IEQA 1RPAA 1KXZA 1VP3A 2ZNKH 5K03A 5KAPA 1KXAA 2FUKA 4E70A 5AK3A 1E2IA 1UCFA 2COEA 4P54A 3EXG1 2BMAA 4LY3A 4ZO7A 4QEZA 3X1WA 1XZDA 5CE1A 3KQ5A 3L7JA 4DPKA 5A0AE 4RQBA 3AUJB 2Q3CA 4ZVMA 3M5PA