3O8DA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HCV NS3 protease/helicase
publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase
total genus 207
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8dA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8dA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8dA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8dA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8dA03
1GHZA 3LW8A 2GP9B 4O3TA 4BTUB 3EIQA 1LS6A 5JHGB 1FQ3A 4JZKA 4UONA 2YZ2A 3KQHA 2KBEA 4CREA 4HLQB 3W5IA 4B1TA 2FZLA 2I4IA 4DIHH 4ACAA 2QAGB 2CVHA 3OAAD 1UEIA 4BAHB 1KXEA 1XJCA 4US2R 4KFUA 1BMAA 1EQ9A 5KDLA 2O8UA 2H57A 5L3RA 1KDRA 3TRFA 3UY9A 2EW1A 2FEQH 1SGYE 4FUCA 4KGAA 4NIWA 1T9HA 2OBLA 3Q85A 1TUIA 2J5XA 1II9A 3I3SR 4AG1A 1W46A 2PX0A 4ZKSU 2ZPRA 2UUJB 5AJZA 1E38B 4XWOA 4I4LA 4EJSC 1P57B 1WE2A 5CLLA 4W5JA 1T4GA 1A5TA 2X8AA 4YT7H 1AB9C 2GF9A 1ZD1A 4MUAA 5GWZA 2VSFA 8ESTE 4AGJA 4PHFA 2A4QA 5JWRA 1UKVY 5JJKA 1TEXA 3K0CA 1XUKA 1WF3A 4Y79A 3FVFB 3P20A 1VG8A 1OH6A 4BTIB 2ZROA 3AF1A 4QBGB 4R8TB 2AGIX 1R7RA 1PUIA 1XJQA 1MRNA 1N1LA 4RI0A 2F91A 4CT5A 1ZPZA 1NVWQ 4QT8C 2O8TA 1CSOE 3GCTG 1XWIA 4DHEA 2BDGA 1C5WB 2FZZA 4FINA 3CNOA 3TVTA 5DKMA 1GNQA 2BC9A 2I6SA 4DIEA 2H1UA 1GJ7B 3HU3A 1O5FH 2VIQA 2QGRA 4LJAA 1P2VA 2V7QD 1QHRB 4NWLA 2YINC 3L0IB 1K1LA 3VB3A 5J4LA 1IQLA 1KSFX 5EZ5A 2BDYA 5TCAA 3GP8A 5ESTE 4WZBE 3F8TA 3H84A 4A2PA 3A1UA 2OE2A 4LYFA 2OCVB 3E3TA 3AVZA 3TK1A 5FL7A 2BY8X 4M8NE 3RXCA 1NN3A 2BD8A 3AVTA 2D06A 1AIXH 4QJ3A 3ZZ0A 3KQCA 5K8TA 1H9LB 2TBSA 1O5EH 2XZLA 2O8DA 3Q7PA 3L2OB 4UJ5A 4MKHA 3TMKA 4JBXA 2B7CA 2OXCA 1II8B 3UKDA 4I1VA 3PTBA 2KBFA 3OHMA 4IOJA 5C5NA 2FPZA 1V2KT 3OFNA 1QA0A 1NN0A 5FBLB 1BO6A 1RRKA 1QL9A 5LPEA 1PLJA 1GBCA 3GLFE 1IN7A 5JEDA 3FTQA 4LV5B 1TPSA 1WYKA 5H8WA 1X86B 4B3BA 1FZZA 2OQ5A 3KIDU 4QJ5A 1GRRA 1E98A 5FBRB 4M0LA 2FF7A 2F3CE 1D3PB 1PZNA 2O8CB 4RD0A 1WBDA 4Q5IA 2J0UB 1G17A 2P3TB 2WOJA 4F4IA 2QSYA 4ERNA 2WJIA 2WJJA 3BG8A 4R71A 3EASA 1W11U 4DT1A 1W5TA 1P04A 2OTVA 2FDCA 2X77A 1FJSA 1TGBA 1GVNB 1WBBA 3SGAE 5L3SA 2PR3A 1BDAA 1R5NA 2NPFA 1ELEE 1D3QB 3UNRA 4XBBA 3I29A 3SQHE 3K09A 4E7NA 1BH2A 1E1RA 2V3CC 3VXFH 1GM5A 3BS4A 2BD2A 2FWWA 3BTQE 3O8BA 3O8CA 2EC9H 2FX4A 1NSFA 3WNDA 1GJ8B 3D31A 4BEJA 5JYIA 1XEXB 3RC8A 3TJOA 5CYPA 3ZZTA 2ZQ2A 3P70B 1G3UA 2IYRA 1WAYB 1XMVA 3LWNA 4KU4A 2XTNA 2A5AA 2GCNA 4TYNA 6CHAB 4IC5A 2PV9B 3A8TA 2YV5A 4FMCF 1GMDF 3U5ZB 4X0WU 1NU7B 3Q72A 1BYIA 2NO0A 1C5LH 4JMPA 1TMTH 4KODA 1PQAA 1TNKA 3IWMA 1GZSA 1AZ8A 5JI3E 1HH4A 1D6JA 1GL0E 5JB8S 1O38A 4Q7ZA 3MWIU 1S0UA 4LYJA 3Q77A 4C30A 4JK5A 2VWMA 3EW9A 1Z0AA 2QL6A 1ESTA 4DKXA 5KDDA 2C90B 1UDXA 4UXIA 1E2NA 1GOTA 1EZXC 1GDNA 3SORA 1RRGA 5BW8A 2A5KA 1TIOA 1C1SA 4ABHA 2Y80A 1W4BA 1W3CA 2A32A 3M7UA 5B57C 4NIVA 2EYUA 2CEAA 4MPXA 1CHOG 4C0HA 4I1UA 4NCYA 2XCFA 2HF8A 4YO9A 1SLVB 3SJKA 1O3LA 2ZGCA 3SU1A 2EFEB 1Z6JH 1U90A 2YWGA 1PPBH 4KFRA 5F9FA 1RRCA 1PV4A 3NH6A 1L1NA 1JWTA 3RU4E 2ZU3A 1C2HA 3U8TH 1UF9A 2ZRIA 2ANYA 1TPOA 3KKQA 1W0ZU 3A4MA 4KFTA 5TDHA 1IQGA 3SZNA 2G5VA 1CT4E 1ZMNA 2EFGA 4EIWA 3ZZBA 1QCPA 1S83A 4K8BA 2V6NA 2RAPA 2VBCA 4IDQA 1HIAB 4H6SB 3SV7A 1A2BA 1AKYA 1IJFA 1U9IC 3LJJA 5SGAE 4F49A 5DP9A 3KEEA 1N6OA 2FMXA 2BKUA 1UTQA 4D7FA 2GCTB 3VFDA 1Z29A 3FFAA 4JSTA 1ABJH 3RRYA 2RGEA 4IEEA 2DPXA 5FX5A 3DO6A 1G7RA 1FONA 4BLSA 1FY5A 3GCTF 4GAWA 1TPAE 2XNSA 3NHAA 2QPTA 1XEWY 3A4LA 3BOSA 2J7KA 1RFLA 3ZYCA 1OB2A 1HB0B 1GI4A 3ZQ6A 1ZHRA 3AP2A 2AIQA 5SZHB 4DLTA 3PV4A 4MRPA 2JLXA 1V3XA 1E32A 1ZM2A 3UQOA 1Y5UT 1IN5A 1B0EA 2ZYTX 4TTPA 1UPTA 1Z63A 1FAXA 3V00A 2QG6A 4DLUA 3LBIA 3UG7A 1II0A 2OLKA 1CULC 2B9LA 2PKAB 1HGTH 1CVWH 1JR3A 2ZEJA 1L8QA 2OZEA 2QPAA 4UJ3A 4WAUA 2EFHB 1CTQA 1BIFA 4MKFA 4DIDA 2VHUA 2FIRH 4IDOA 5F8TA 4NL4H 1N6HA 4ISNA 3I5YA 4BTTB 1MBMA 3FP8E 1TOCB 3DHWC 4CIDA 4IOMA 1WTGH 1W44A 2WPDA 1SKQA 1D6WA 4X8VH 1O3OA 3LGIA 2PMKA 4L9SA 1XUHA 3AVQA 4L4UA 2NQ2C 1AZTA 4A8JB 2J92A 3DPUA 1VCOA 4X6NA 2P0EA 1D4PB 4K1TA 1BB0B 5DYGA 2V54A 4BRUA 2Z6BD 5HKKA 2P59A 2H5CA 3DKPA 4BFYA 3BB4A 1T8NA 4IRUB 4PZLA 1KYNA 2IYVA 2ZJZA 4NU0A 1TWXB 1QRXA 1C9TA 2F1IA 1RJXB 4DJZB 2FOHA 1O5GH 3BK7A 1ELCA 2XZOA 2AIPA 3EPLA 2H9EH 5JDUB 1O2HA 3CNNA 3OEHD 3KHVA 2DR3A 2BCJQ 4NCHA 1S3GA 3U69H 3RS2A 3W8RA 3RM2H 2ZRAA 2R44A 5JJIA 2ZDLA 2F9NA 1O32A 1JR3E 3FMFA 4LRWA 4Z8XA 4YDHB 4FUEA 2BM1A 1AY6H 3KCGH 4YXWA 4DCSA 1OB5A 4RKEA 2WSSD 121PA 1AHTH 1Y3UA 1J15A 4JT2A 3E5HA 1MABA 3QXCA 2I1QA 3DM9B 1ZUNB 3A58B 2C95A 1M6NA 4A5TS 1EESA 1MO5A 2IJD1 1ZSJA 2WBLC 5C18A 2ZU0C 4JL5A 4OQFA 1CT0E 2W2VA 4C0QC 1HEIA 3X2SA 3D3QA 4LK4A 1NMZA 4PC3A 3QXJA 2A5DA 2R2AA 3N70A 2R6DA 5E0HA 5JJLA 1H8IH 2KAIA 3F1SB 3W34A 1FTNA 2ZIQH 4B2AA 5EW2H 4OHZA 3LH5A 3M7QA 2VU8E 3RXOA 1TMUH 4LGMA 5DLQC 4M1TA 5FTLA 1O2UA 3P8GA 1V2MT 4DDTA 1EX6A 3K6YA 3AVYA 2Y82A 1KO7A 3B60A 5EE3A 4DCDA 1O2RA 2D3WA 2ALPA 1ETTH 1OE0A 1N5KA 5F9HA 3GLHB 4ZHAA 2VGCB 3SHCH 1A1RA 1Y3VA 1NF3A 3I77A 6LPRA 2O8BA 4X8UH 1IAUA 1K2I1 4MLFB 2ZRPA 1LVMA 3LY5A 1CHOF 4CR9A 2BDBA 4DLRA 3CW2A 1C2MA 4DJTA 1GDUA 1GI1A 5GCHG 3C5CA 3T28A 2WPMS 3X1WA 5B30A 1NVUQ 2WWFA 1SGRE 4OK3A 3GJ4A 2CCGA 3MJHA 1KI4A 3ZVRA 2EWVA 4B2LA 4Y10E 2IPHA 1S6HA 2QCYA 1U94A 4PO1A 4KV9A 1DEKA 4B48A 3PB1E 2ANKH 1HJ9A 4GZMA 4ZO4A 3AGPA 2JETB 4C0JA 2W2XA 3ADDA 4B35A 2ZUCA 1K1IA 3R7WA 1BIOA 3RDZA 1TADA 2OAQ1 4VGCB 1O36A 4IDPA 1SFIA 2G55A 3M3VA 3I8SA 3ADBA 1E2QA 4I8GA 1JB1A 5E0GA 1OIVA 2JCSA 2BJVA 1BBRK 5J5CA 2V35A 1HAHH 3AF3A 3SFZA 1H9IE 1ZTJA 3B78A 3CH5A 4PR0A 4CBOA 3R9WA 1DVRA 1XXFA 1GILA 3WMFA 5F8XA 4INKA 4CBNA 2H5EA 1R5OA 3A85A 1S0RA 4KJZA 1SPJA 1NIPA 4IVPA 2NMVA 1BTWA 2THFB 2G83A 1L0ZA 3JZ2B 1JIMA 2WINI 2XBXA 4HI3A 1GKIA 2A7CA 4D4KA 1L4DA 4NHOA 3LC3A 3KJGA 1QY6A 5FFMA 1Q57A 4G5RA 3RAPR 1BZXE 2GZ9A 2QORA 1NRPH 3IG6B 1O2VA 5J4SA 1NFUA 1KDTA 3U98H 3B1YA 3T27A 1L7VC 4C0BA 5TJXA 1E96A 3NUMA 1GJBB 5EXMA 5FPKA 1R10A 1AS2A 1YR8A 1Q1ZA 4GP6A 1C4U2 2QM8A 4ABGA 3EZ2A 1UKEA 2IYYA 1HA3A 2JLYA 2ZVPX 2BDCA 3R20A 4F93B 2IYXA 2ASUB 1AKSA 1WOFA 1NFYA 2ZYUX 3LKWA 4D76A 1KXAA 3H0KA 1NG1A 1X3SA 1E2JA 3BGWA 4F38A 4TY7A 1BHXB 1RRPA 2K5UA 2GTBA 1ESNA 3ZQJA 1SGNE 5CMXH 2AK2A 1COWA 3SNHA 4BFZA 4Q1EA 1KLIH 2BMDA 4A1XA 3NXSA 3D65E 1YP9A 4B71A 1GCTC 1OSNA 4QL3A 1P62B 4OHWA 3QO6A 3DMDA 3I92A 1YPLH 1CRPA 221PA 2NU0E 5BWMA 1RTFB 2PUXB 5FXLA 1XTRA 4DT7B 2WAYA 2HPPH 1FNIA 2VWLA 1KXDA 1KY9A 2UWPA 4Q4JA 4NSYA 3SHWA 2R6GA 3SZEA 4CRFA 3Q5DA 2WYGA 4YOJA 1TMKA 1XUFA 1FPCH 3OTPA 3BFKA 3WHKA 1SGFG 1Z6XA 1O2OA 2ZRBA 4Q9KA 4ZROA 3A8AA 5JB9S 2JGNA 1A61H 1FQKA 2PBRA 3KQKA 1KI8A 5CE1A 1G7TA 3BTFE 2KE5A 3K0CC 1SFQB 2CNWA 1WQVH 1XMIA 5DI3B 1TX8A 1B0FA 2ZZUH 5A0FA 4YMSA 2VEDA 5EODA 4TLCA 2J0VA 4MRSA 4ZCLA 1OXXK 4H9GA 3MWKA 2QAJA 2P65A 3GYMA 4LXBH 1EWQA 1ONBA 1GITA 4R2IA 2ZYVX 3BH7A 1SSXA 2QXHA 4B2IA 1T5IA 3M6AA 1GBFA 1OP8A 2O8FB 3WYGA 2Q21A 2A31A 2DWOA 2Y7ZA 3ASYA 3OF5A 3VKGA 4I7YH 2AX4A 2J9NA 1VCQA 4C2TA 3M37A 1E2MA 2Z94A 3RXPA 3HP1A 1OJLA 3X1XA 3OY5U 4GCHG 1DWBH 1GJAB 4CEJB 3ELAH 3RYTC 3MCAA 4L15A 2R0KA 2D62A 5HCNA 1R8QA 4LHZA 2QMEA 2C4FH 5E7MA 2QM7A 1NLYA 1OPHB 2X2FA 4KVGA 2WV9A 2ZCHP 3RXKA 4Z1MA 1BKDR 3E90B 3K0FA 2EFDB 3P92A 5F2EA 2DCUA 3K53A 4X2VA 3PVSA 2FYQA 2DE9A 1XTSA 4LUCA 3FDIA 1F0TA 5GCHF 1F2UB 2O0HA 5LD2B 3M5NA 3OSYA 3UQVA 1Z8FA 2BMJA 2JLQA 1DT2A 3TPIZ 2YNAA 3SI3H 1NVXQ 4Q9LA 1NNEA 2D1JA 4LZ1H 1VPLA 4FVBA 5DP3A 1SVLA 5AUQA 4O3UA 2VP2A 4TMZA 4UKDA 1GG6B 1ZD8A 2W6JA 4XJXA 4U7DA 4XTRA 3GJ0A 2ZI6A 1BRUP 4I8KA 1UVPA 2HT6A 2BQ6B 3ZZ5A 2AGGX 2Q9CA 4LBZA 4TTQA 2QGZA 4DC9A 1OFTA 3MO3A 4OQXA 4ZXYH 4V0NA 5C46F 4FXPA 3AKEA 5KSPA 1DXWA 4BPBA 4FUBA 1KSGA 1NJGA 2PLRA 4XD7A 1UTNA 4ZKOU 1TBZH 1ZPCA 1UBGA 4JVMA 1LFDB 3SV9A 2KSQA 3VR2A 5KSOA 5BN4A 3KGPA 1DPFA 1F0SA 2F4LA 2VWOA 2VIDA 1YLCA 3LD9A 4F92B 4A15A 4Y8ZA 5DPAA 4AD8A 3NEJA 3UANA 3K09C 5FTKA 3TE6A 3P26A 4X8LA 2AR7A 2JATA 1XPRA 2Q9BA 1OYYA 5EXLA 3ASZA 2A5YB 1KMHA 3EPHA 2BVSH 1O3KA 3VR4A 2PZGA 1AVWA 3A37A 2O5VA 1OV4A 3AGQA 3TVJB 4JVSB 2BD7A 3P8NA 1JR3D 1XP8A 4Z51A 3A87A 3AH8A 1VIYA 3WP1B 4QGGA 2ZI2H 1C5RA 4URZR 1SBWA 3FHTA 3E6PH 3EAQA 4WZ6A 3RXSA 2HRVA 4ZDIA 4JZFH 3RM0H 1Z1IA 1ZJ6A 2JLRA 2ZKSA 1I4TD 1Y3AA 3K9GA 4IHQA 1EATA 1RJ9B 3GY4A 5JRJA 8OHMA 3M4YA 1Z5ZA 2PCJA 1W36C 1QHYA 5T1VA 3CO5A 4ZUHA 2P3UB 3LO5A 4X6PA 3IQWA 4U01A 4AWXA 4B6FA 1G18A 1UHBB 1O2WA 1P9UA 2EYQA 2WYJA 1GRQA 4Q7JB 2PZFA 2WMOB 5A0BA 2CLSA 1TYNA 1HCGA 1A2CH 3UOPA 1TRMA 5A8YA 4CEIB 3BG4C 3S0NA 4RFSA 3W6OA 2ERXA 4FUIA 2NU3E 4BXWA 1QHHA 1U8ZA 3TKLA 1LHCH 3LPRA 2OFOA 2ZFPH 4IS5A 1X8LA 3QLPH 2G9NA 1FX0A 5JCPA 4M4SA 1C2FA 1O3AA 2WJGA 1C5PA 2ZTZA 3PM3A 3U7FB 2GV6A 4K8OA 1E0SA 4TYYA 2GXSA 2H8KA 1H8HA 2FPKA 1GDQA 5I46H 4PAMA 4LBYA 2WPKS 4X8SH 4X2YA 2Z3CA 2FOMB 3GDSA 4NH0A 3PV2A 4NZQA 3T2NA 1SQAA 1TEVA 1GBHA 2ZJYA 1OWEA 2EFCB 1GVKB 2RGNA 1UTMA 3REGA 2RKOA 2XTZA 4PPNA 4AZ2B 3TLXA 4OGYA 3EQ0H 1CE5A 1AVGH 5KDOA 3S69A 4TL7A 1YPEH 4INHA 1ZMXA 1NM6A 1C2KA 1NN5A 2QP4A 3CPJB 2QQ0A 1MO3A 2Q9AA 2OC8A 4TMXA 2QENA 3HK6B 3L3TA 1Z1JA 4A4DA 5E0JA 2H16A 1BTHH 3UWKA 3RUOA 5IHPA 4IBLH 1KO5A 3ENSB 1AS3A 3OIUA 3QKRA 4TMWA 1FY1A 2ZP0H 1SG8B 2BHGA 2Z43A 2H18A 1JJVA 1VTKA 3RXRA 4I1OA 3UMRA 1IHSH 3EZ6A 4GCHF 2FE4A 1TAWA 4NYMQ 3FANA 3RVBA 4OS1A 2WTUA 1MBQA 3ETLA 1AD8H 1G37A 4ZKNU 1GI5A 1UK3A 1YE8A 2H7VA 4DSOA 4AK9A 4URWR 3PV0A 1TQDA 2ODNA 3TW4A 4TWZA 4ZDJA 1E79A 1P0SH 3MNXA 2QE7A 1ZBDA 4I8LA 4BANB 1YZTA 1C1YA 1EOJA 1T4VH 3LH1A 1G5TA 4DLVA 4MYUA 1XXHB 4DLSA 4NYIQ 3KQLA 2J3EA 3SZRA 5EP1A 4ZCIA 2ZJ8A 1P09A 3SQEE 2IXGA 3QY0A 1M7BA 2OLJA 2ZRLA 4PX9A 1FV9A 3AF4A 3AUXA 2YVUA 2EVWX 1ANKA 1EXFA 1DS2E 1Q2WA 1N2CE 3LVRE 1ZCAA 3A7XA 5TB5A 2OQUA 2Q6GA 1TQ2A 2BBWA 2ZDMA 3NIBA 3RXTA 4E22A 5AR1A 3TU7H 1KAGA 2CHQA 3K70B 3ODDA 2Q3FA 2PGBB 2PW8H 2V6JA 5B64A 4CRDA 1ORFA 3VU9B 2LWIA 4XOIA 4CF7A 3ZZ6A 3RRNA 2IYSA 2XCNA 3IIJA 4JYVH 4KITB 3HYRA 1JPJA 2FXRA 2G0TA 4DY7B 3E2IA 2A5GA 4ILEA 4QFMA 2W0SA 1P9RA 1R0XA 1V2JT 2ZNKH 1YR6A 3W9YA 1WU1A 4R7ZA 1O5CB 3CENA 4HAUA 2BOHB 1NIJA 1QR3E 3AF2A 3U61B 3CF2A 1G6OA 4IGDA 2VHTA 3A8DA 3TK6A 1OXUA 4C0LA 4UXJA 1XU4A 4UXHA 4BGDA 1Z8JB 1EJMA 2BY9X 3BIFA 5C3NA 2C04A 1I4DD 1LVOA 4DW2U 5G3YA 1P2OA 3MWJA 4PPFA 2FG5A 1M8PA 3CRMA 3EXAA 3SU3A 1IN8A 2G52A 4XWAA 4B2PA 1ZCBA 1AS0A 2IJOB 3BEFB 3GCHC 2XSZA 2OHFA 3CPEA 2PMDA 1RXPA 1KTTB 3QEJA 4AIIA 2YWFA 1LB1B 1F5NA 3KKOA 4OI2A 1T6NA 3EG5A 2PSXA 1E0FD 1TFXA 3QXSA 4FCWA 1KK1A 1MAXA 1D3TB 3RSLA 5T3HA 3KNXA 1KO1A 3F6UH 5L2YH 2QBYB 4XE4A 3HGNA 2MSDB 4BNRA 1XRJA 1Q3XA 4FUHA 1QRAA 3UPEA 4JZ1A 4HZHA 3MU1A 1OWDA 3L8YA 4PHGA 2BDTA 2C78A 3WYAA 2WIAA 2VIVA 2J0QA 1COWD 3A8BA 3U1IB 5H1YA 1W12U 3A7WA 3VNVA 4HUQB 3U7EB 2Q3MA 3B23B 3VB7A 1FN8A 4D4MA 4DDVA 4JJKA 1BTPA 1EFCA 3ZVAA 3NKVA 4IJMA 2W3KA 2GD4B 2NU1E 1N3BA 1C4Y2 1S4QA 3NDPA 2WJYA 3FZDA 421PA 2GVFA 2BMFA 3RRZA 1T3LA 1U8YA 4LOAA 3OTJE 1HAVB 4WY3A 1LF5A 5BYKA 3PUYA 5ELXA 3Q00A 1E1QA 4IW3B 2WWYA 4XDEA 3LU9B 3MJRA 5IK2A 1Q1QA 4C2UA 5LH8A 2BQ7B 3EA5A 5GXPA 1P3EA 1UTPA 2YHSA 1LMWB 3VR1A 3A7ZA 3D7MA 1MU8B 2OP9A 2WV5A 1S6FA 1K6MA 1JRSA 1TL7C 3B1XA 2ZDAH 3BERA 1Z6GA 4JLMA 5GJBA 4ZDWA 3PEYA 3MH4A 1XJ0A 4Q01A 2CNWD 5EE1A 4G01B 4BECA 4PO8A 2HPQH 3U6KA 1K21H 4FMBB 3L0SA 3LAWA 3D49H 7LPRA 5F3WB 3QPUA 2CHAB 1MKXK 1NBMD 4OS4A 3JZAA 4K69A 3M61U 1GMCG 3LONA 4QJ4A 2CHGA 4Q2KA 2ZSBA 3BEUA 1UBCA 3WY8A 4US1R 1JOUB 4MKIA 5BXQC 1HAGE 3UOUA 4XVQA 2DWQA 3MGCA 3QN7A 3IQXA 4K81B 2VH6A 1ZHMA 2W5EA 1KZGB 4WJG2 1EX3A 1HDTH 3PO1B 5DHFA 4ZIRB 1UADA 4EQ6B 2GCPA 1EJAA 2IS4A 1W7GH 2CJWA 1SVMA 1XMNB 1TNDA 1LVBA 1QQ4A 2GEVA 2ZGBH 2JJ1A 1EK0A 1EB2A 5JBCS 3GJXC 1GJDB 1ZC3A 3TAUA 2J45A 2DY1A 2ZJOA 2ZPSA 5C4GB 1DOJA 4KI0A 1Z2AA 4OBEA 3E0NB 2RA3A 3F9EA 3C8UA 3HR7A 1TRNA 1LQDB 5A8XA 2ANBA 4BFXA 3STIA 4Z1MD 5DGXA 4UNNA 3M7TA 1GBAA 3VB4A 3N2IA 2QF0A 1ZAKA 1O2MA 5GJWC 1RE0A 4GNKA 1W2KH 4LHXA 4MQBA 2C9CA 1QZXA 4D4LA 1IHTH 1ANDA 2CVFA 3KUDA 1P60A 2QEQA 2P93A 1S5SA 5EQTA 3UR9A 3EIEA 5FTNA 4MGIR 1GCTB 1GHYH 1OSSA 4M7GA 1YYY1 1ELDE 1SGWA 2FS9A 1H1BA 1O3IA 2GK6A 3DHKH 1EFRA 1ZU4A 1G21E 4PAQA 1AVXA 2V9PA 3SV6A 1YZKA 4Z8YA 3OIWA 3KQNA 2ZJ5A 3RANA 3GJ7A 4ABEA 5C1YA 3OAAA 4BLTA 4HAZA 5EXNA 1CR0A 2RGGA 5H4IB 5JBBS 1PLKA 1HT2E 6ESTA 1TU4A 1N5IA 2AMPA 2J4IA 2OCPA 2Q0HA 1NVVQ 2P67A 821PA 4B43A 4QXAA 2IN2A 1SXJD 4UNRA 4TY6A 3PCRB 2BXUH 4HGCA 1BRCE 4XD7D 4CEHB 5TXGA 2QMUA 4KXFB 5HTKA 3JVVA 2VNTA 1HE1C 3HU1A 4Q19A 4AG2A 4RD2A 2IL1A 2ORVA 2JAQA 3RXMA 2Q1JA 3SDZA 1IY0A 1ZUIA 3SFVA 4DUGD 2BMEA 2WMNB 1II8A 1W7AA 1GBKA 5FOSA 1FQJA 1ELVA 1TUEA 2K1QA 4RN6A 5DGJA 4OI0A 2FOGA 1N6KA 1G30B 3K9NA 3I5XA 4B2CA 1DLEA 3Q3KA 4Q7LA 5CLQA 3PROA 5ETXA 3ZVBA 1KDQB 1DFPA 1GNRA 2ODEA 2ZRMA 1Q3TA 2A9KA 4NZYA 1ARBA 1UAAA 3RS7A 2O8CA 3PLBA 3RLWH 5CK4A 4INLA 1TNGA 3RXFA 2ZPQA 4K5ZA 2J0UA 3AW0A 3RWOA 7GCHG 1Z8GA 4PZZA 4CHAC 1TNIA 1KHTA 3A4NA 1XUIA 5HXFA 3QE0A 5FAHA 4C4PA 1NRSH 4O2RA 2V7QA 2A5IA 5FUXA 4NIYA 2DHRA 2W6ID 4BAOB 5KNBA 1DSTA 4EFNA 1SVOA 2EI6A 3PMAB 1E34B 1H8EA 1MZAA 7ESTE 1P4SA 4GPGA 4IFEA 4MRVA 1VG0B 2NGRA 3SI7A 3SJBA 1GI7B 1IAQA 2AERH 1XTKA 4YOGA 3A89A 4II7A 5EP4A 2O8DB 3U2QA 3FVQA 1XEXA 1O3HA 1TNJA 1ETUA 2FSGA 2Y5GA 3IHLA 2FOCA 5CDFA 1ZLRA 2A1DB 2PWXA 3VR3A 3CRRA 1FIWA 3M5MA 4LPSA 4KVAA 2ZFRH 3OYPA 3OEED 5DO4H 4ESVA 1O2XA 1VG1A 4BRWA 2OBOA 1GBTA 3KX2A 4JLKA 1GIAA 1DAGA 1DUAA 1N0WA 1MD7A 1WCZA 1MMJN 5TMPA 3EARA 1NC6A 1NROH 2GA8A 1U2RA 2GMTC 1W49A 1J8AA 1MKYA 1F0UA 3QXHA 3CIOA 1Y5BT 1PQ8A 3SYJA 1G5RA 2Z6VA 3ATLA 3LDAA 2OSBA 1C5MD 2XTTB 4QHYA 3P8FA 2VP4A 1O3NA 1GKYA 3EA0A 1KAOA 1J8YF 2MSEB 1SL3A 2VF8A 3W94A 1KXCA 5L3SB 2GGVB 4O2LA 3AVUA 2BQWB 3SOPA 4KSCA 2OCBA 2WWXA 5HM2A 5SZKB 4YLUA 1W2GA 3BC1A 2XWBI 1DWEH 3G01A 3P27A 4ZKDA 1GMCF 1OYQA 1I4LD 2ODBA 1A5HA 3M0EA 4A1VA 1AZSC 4D9RA 2HCBA 1GBIA 3F3YA 2J2UA 1P10A 3BTEE 1GBLA 1QHSA 1N25A 5I25A 3CS7A 2CN0H 1EAIA 2PZEA 1GKUB 2R65A 4M1SA 2ZGXH 5CDFE 5DO9A 2A5FA 1S8FA 1E2IA 3R9XA 1ZVQA 4ESTE 2R9PA 2G8TA 3ZZ9A 1XTJA 1DOAA 3SJOA 2AFIE 2C8XB 2WWIA 4U00A 2YNMA 4JLBA 1MTNC 2YYZA 1HIAA 2D7DA 4D80A 1W7XH 4O25A 3L0PA 1Z6AA 4RKFA 3MU0A 1ZMLA 1W36B 4ISIH 4V0LA 1U81A 3HKJB 2G77B 4G1UC 3CP7A 3F68H 1MH0A 5HYOA 2DFNA 2B6HA 1E79D 1P2TA 2QE7D 4HB4A 1D2NA 4OHXA 2IWHA 1F2TB 5DISB 1QBVH 1WSSH 2WUBA 1SQTA 2YWHA 1JXMA 1YKSA 4E7RG 1PFXC 3M36A 2IOTA 2C9YA 3K0SA 3ZVGA 3LW7A 4LC1A 4Y76A 4JCNA 1EAUA 3ND9A 5JBQA 2Z9KA 1IQIA 1DE7H 8LPRA 5G4BA 1G41A 4ABFA 4U2WA 1T0HB 4OKSA 4DB4A 2F43B 1QNJA 4KTUA 4YMWA 1HJ8A 2V55B 1NFWA 4XSKU 1W13U 2IF0A 1AM4D 3Q3YA 4ZI2A 3T61A 5DI9A 3NKKA 3ZZAA 2WAXA 3E70C 3KKMA 1DVAH 2BBSA 1UO6A 4JZIA 5DNYB 3CBQA 1CR1A 1E0JA 3BFXA 3KQDA 3HK3B 2YOGA 1N6LA 4TMKA 2VB0A 2N46A 4TTRA 2WWWA 3IIKA 2HNTF 3AKCA 1PPFE 2HALA 5LPFA 2FI4E 2TGDA 3S7KB 4OQMA 4GDFA 1WP9A 3S9AA 4BWYA 4WXPA 3IBYA 1G32B 1OH7A 1RFNA 1W8BH 2EEKA 1VZQH 1QIXB 1P2IA 4M1KA 1BCUH 2RGNC 2N42A 4RCYA 1VR1H 3OESA 1PJPA 2GT8A 2XJ4A 1VGCC 3TSOA 3UIEA 1XCGB 4ASUA 3EA9A 3U44B 5DH9A 1NPMA 1BITA 3PXGA 1XDBA 1ZM7A 1GL7A 2G1KA 1QDEA 3TAHA 1ZTKA 3H5CB 1ZIOA 4OQLA 4TMTA 2A78A 7GCHF 4Q1BA 4TLBA 4EFMA 1TGTA 2OM2A 4DDUA 1XCMA 1FZQA 3E0PB 3GJ5A 3ATWA 1FNMA 4B47A 5DK1A 4LJ5A 4YMUA 1FUUA 4Z6AH 3SYLA 3SO3A 3BTHE 3SNEA 3BAFA 1GJCB 4X1QU 1CJMA 4DXAA 2FFAA 1E37B 5GVRA 2ZO3H 3FHCB 4IXNA 3BEIB 5FPHA 2G00A 1JPNA 5E2PA 1GWNA 2ZRFA 4FUJA 3B1VA 3U6BA 1HJAB 4UQOA 1XZQA 4Z0KA 4MDEA 5FTJA 2SGFE 1EB1H 1DAHA 4OS5A 1Q12A 1MTUA 5JWOA 2VH5R 2J1LA 2H5DA 3KTAB 1G36A 2HEIA 1FLEE 3RXEA 4JS0A 4K46A 2BLVA 1N6NA 1HXFH 3KJEA 5IK2D 1SVWA 2JDID 1IXZA 5L8VA 3I62A 2IYZA 3A84A 2FX6A 3THOA 4P0TA 2MMCA 4B76A 1W0KA 1YKTA 2Z4SA 3KL4A 3PMBB 2WIBA 2ZR0A 2ZC9H 1NKTA 4ZMAH 3Q9LA 2XTMA 2WWGA 1YZQA 3QGJA 3TNSA 3AEZA 1Q20A 4JVLA 1S84A 1P05A 2XWAA 4OM9A 3ZVEA 2C03A 4BOHA 3GLHA 1WDTA 4X1SU 2DUCA 1Z0JA 1DANH 3DFLA 4MUBA 3FFGA 3NBYC 1ZRHA 3BD9A 2WSSA 1C1MA 4Q48A 2DBYA 2P8OB 3SUEA 2AH4X 3KJIA 2QZ4A 1T8UA 5KHOC 1K1NA 3T5GA 2G4TA 2IWRA 5L6NH 1E2GA 4YZUA 1M7HA 2ZITA 1US8A 3A7VA 2ZAOA 1OF1A 3QX5H 1CO7E 1TQ0B 4YOIA 2JJ1D 2GEDA 2AMQA 1ZYOA 1E9SA 3RRMA 1E9CA 3QG5A 1YCPH 1S3SA 2B92A 2FWRA 1WV7H 3IEVA 5P21A 1THPB 3A7YA 3T12A 2ECKA 2GCOA 4LSGA 2FV8A 1G3BA 3OX7U 3FFBA 4IDNA 2FA9A 5PTPA 1IQJA 1FP7A 2H1LA 4HAVA 2BLQA 2BV3A 2HGTH 1KJYA 4LI0A 3MO6A 1LS1A 2GJ9A 4LHWA 1GUAA 5JSZB 1KKMA 4Z54A 1DADA 2YC4C 1W14U 4ZCMA 4MRNA 1TNLA 3WXMA 4CW7A 5G40A 2AWOA 4X2WA 4PSAA 2ZU1A 2VRWA 2QV1A 4Q00A 4QG7A 1EFRD 1VYUA 3GLHE 1YPHE 5EUQB 3LA6A 1Y63A 2O8BB 1EOLA 2QTHA 1LTQA 2W83A 1O5AB 3QVUA 1NRJB 1EFHA 4X8HA 1M74A 1EKBB 3A8CA 2O8WA 2D2FA 5BN5A 1BRAA 3QK1A 3LC5A 2Y8EA 3PMJA 1V2VT 1ZNXA 1SR5C 1VITH 2H92A 5AJWA 4DCNA 1BMNH 5D3MB 3QGNB 3NPSA 3SU4A 4RCZA 2E87A 3RWMB 3UPUA 2BD5A 1OWKA 4TMVA 4AYTA 2BD3A 2XNDA 3LLUA 2D74A 1CJVC 1RRFA 3H1TA 5C2ZA 4D81A 2ZIAA 4A92A 1N8OB 1AWHB 1GJ4H 1QHGA 2F1JA 3R7WB 2BZAA 1BQYA 3QKTA 4XFQA 3NVAA 3EAJA 1V2ST 3W5JA 1KSHA 2FGJA 4G5OA 3GLFA 5AF9H 1C5VA 1O3CA 1TLDA 5FX6A 2W26A 4FU7A 1GRNA 2W00A 1CQQA 3P17H 2EI7A 2BVNA 1RD3B 3Q76A 4ZHMU 3FAOA 3PLKA 1YVDA 5A8ZA 1CIPA 2QAGC 1FUJA 4M1YA 4OJKA 1CS4C 3TSWA 3TJVA 2HXSA 2OXRA 1XX6A 3B2EA 1R8SA 3V9PA 1ZNZA 4Q18A 2ZE8A 3MFJA 2VP6A 1S81A 1P2NA 1ZGVA 4WMDA 3BTKE 3HDTA 1W2HA 1GBBA 3SN6A 3SI4H 1DBSA 3ZH9B 1E9BA 3PEUA 1CA8B 4HAXA 4QOSA 3JZMA 3VX3A 3P1JA 1ZJKA 1H8ED 4RVCA 1YR9A 2SGPE 2BJWA 3ZS8A 1W48A 3DZDA 1YM0A 1YLDA 2AKAB 3U3OA 1IOEA 1DS6A 1RIFA 1TQ7B 3ODFA 1Z06A 1OPXA 1NO9H 2Z9LA 4TZ0A 1JBUH 3IILA 1O0DH 3E1SA 2OAP1 2JJ2A 1VHLA 1AMHA 1EUFA 2ZETA 1AKSB 1PPZA 2FS8A 1Q1BA 1DARA 2QN5T 2HNTC 4DCUA 2QXIA 3ICEA 1YBWA 2GVZC 4F7WA 1CHGA 4BASA 4POAA 1OXTA 4OGXA 3SUDA 1H4WA 4ESHA 3BJIC 5A2MH 3H7OA 1AKEA 2PEZA 1W4RA 3ATKA 2ASEA 4UFEH 2C3SA 5DE3A 3RXQA 4WZAE 1QG2A 1FAKH 1C5QA 3TUZC 4EFLA 1LQEA 3AV0B 4WWYA 5JZVA 1ZINA 2Q3HA 4M9XA 4D8NA 1ELBA 2GZHA 1XPUA 4TSFA 5A4JA 1JI0A 2QIQA 2GJAA 2BM0A 1HAXB 3SE0A 2IXFA 2ILNA 3HR8A 1AK2A 1D5CA 2YNBA 3URCA 5CJPA 3RLYH 1K5GA 3K0AA 1GI0A 1ACBE 4I81A 1QBNA 4EDHA 1C2EA 3OZXA 4Q4JB 3IEUA 1TMBH 4GFDA 4YT6H 2FOFA 2J87A 5SZJA 1C5SA 1EPTB 4MPWA 4M9SA 3T5DA 1C2IA 3LX5A 5L3VA 1QVRA 2GXAA 1C1PA 2XC0A 1FMGA 2BVXH 4CZ2A 2BB4A 1DM4B 3S1AA 1P73A 1O30A 1SGEE 4QBHA 4R9UC 5AJVB 5LBIA 1K1JA 1T32A 2JJ8A 5FBQB 2NWNA 4FWTA 1PLLA 3KKNA 4B44A 4V0KA 1O3FA 3WNCA 1F2UA 4XH9B 4URXR 3MSXA 5K8IA 1U99A 1V2LT 2YJTD 4FUGA 1O3PB 1XFAA 1NMXA 1X8KA 4B3FX 5IF9A 1Z71A 3QBVA 1TF2A 3ZZUA 2RDLA 1Q1EA 2OC1A 3K0EA 4LBWA 2CL7X 2FPLA 2OINA 4CHAB 3T06B 3OIYA 4MDFA 4QM6A 3WYFA 2ZG0H 3B7GA 1KTVA 4EPRA 3SYNA 5H68A 1MR3F 4JYCA 1U0LA 4GL2A 3ZIAA 1JR6A 4U5XA 2ZM5A 2A4GA 1N6YA 5FHTA 5GIBA 2GT7A 1GWAA 3JZ1B 2ZRJA 5LB4A 4XBDA 3RS0A 1CA0B 3LLMA 1S96A 1XD2A 2QT1A 1PJRA 3MH6A 8KME2 5H70A 2YWEA 3GEEA 1EZUC 3LQQA 2HCJB 3U4QB 5HM9A 2AYWA 2WWHA 2ZSAA 3PYHA 1VYVA 2A7JA 5TY0A 3SJZA 2IYLD 1BBRE 4DSTA 3AM1A 4TYQA 1TBQH 3CZQA 5FOTA 1Z83A 4N1AA 1SHKA 1UVUH 1F0RA 3CONA 5HR5A 1Z6YA 2F9MA 3RXVA 1UCYH 1W0JA 1R0YA 2WVJA 3RC6A 1VCPA 2ZR7A 3LGUA 5LPRA 1Z8RA 5K0HA 4Q9JA 1MAYA 6CHAC 1P2KA 4I31A 1MU6B 2J7PA 3LT3A 1OXSC 1JBKA 1P75A 1M7GA 3A86A 2A2XH 1ZU5A 1SVSA 5JPMH 3EYDA 1IJEA 1N0UA 1FPHH 1X6VA 1ZUHA 4OQNA 1ZJDA 2YOHA 5EG4A 1YJ5A 2NZ8A 4LJ7A 3BF6H 2BIFA 5DHAA 3SGQE 5DSZA 5CHAB 1FY4A 1Q3HA 3AVWA 1A1VA 1IQMA 1ELGA 2AXPA 4Q7MB 4ASUD 5GADl 2FYRA 2C9OA 1J9CH 3GY2A 1E0KA 2BTCE 1Z0IA 3SN8A 1HY3A 4CEIA 1DAFA 4Q1FA 1ZP6A 1NLZA 3MNBA 3EE0B 1BOQA 2WICA 2C2HA 1YPJH 3ZYDA 3PQCA 4PQFA 4OI1A 1T3HA 1NRRH 2ZE5A 2O0KA 3RC3A 3LXXA 4ZHLU 1ZRBA 4OS7A 2C8VA 1P61B 1GGDB 2XBWA 5EJEA 1BOFA 3A1SA 2FFBA 5E95A 1YZGA 4JLNA 4RSPA 1MTNB 2JEOA 4Q4HA 2EQBA 4A6XA 4DZZA 4M9FA 4NCKA 4DCTA 2QF3A 5KOYA 5DIFA 1ZM4A 5FPYA 1SLXB 3SR0A 4NGAH 1Z0DA 2VPPA 1T3SA 1IQEA 3U3JA 3A1VA 3BTTE 1O3YA 1UTJA 3SC3A 2BEKA 4DRZA 2GCTC 1E94E 1BHXF 2AS9A 2PKSC 3KXIA 4D0NA 5K8UA 2W2TA 1V2WT 1EXMA 1GI2A 4D4JA 1AFQB 1GJ9B 3LRPA 3IBGA 5EPYA 2D7CA 5IT5A 1A4WH 1T4UH 5GJ4B 4RY2A 1F6BA 3I72A 2JLVA 3G5UA 3LGVA 2J41A 3CWZA 3BRWD 1WXQA 4BLRA 3QF7A 4FU9A 3V4FA 5C1XA 4LPKA 2X19A 1X8JA 3VHXA 3TQCA 4GMDA 1FY8E 1A3EH 3FPAA 1BTYA 1QHHB 1W0KD 1ELOA 3QOFA 4EAQA 5DJ7A 2BD4A 1FN6A 1R6BX 2G1JA 2VP5A 3EZ9A 1NG9A 3PWCA 1DICA 4Q21A 3I61A 5FPTA 1Z6TA 1FX0B 4HDCA 5KSYA 2VWNA 1D2MA 1J70A 1H8DH 4SGAE 2BDAA 2GDJA 3EZFA 2FFHA 1M1YE 2GJKA 1C1NA 3SUGA 2R6FA 3G82C 4K3JA 2Q6DA 1PPHE 3VX4A 4IEIA 1SLUB 3QTVH 1F48A 4PC6A 2IHYA 2O8MA 4AY2A 4C9BA 4D0GA 2QYIA 1TQ6A 2B5TB 1G3EA 2WM9B 4GZLA 4DGJA 1KZ7B 1YZUA 4E09A 4QKQA 2ANWA 3EZ7A 3SW2B 3G0HA 3NBFA 5F03A 2XB4A 2ZAMA 3KB2A 4QGAA 4N0EA 4FCVA 3ZZ7A 2XAUA 2ZGJA 1D9IA 4XSHA 2WPLS 4A8JC 5CM9C 4HZUA 5FUYA 2IEYA 2GEUA 1B7XB 5C1BA 4DCVA 2HJGA 3ZZCA 1YPGH 3TGPA 4DSNA 2VJ1A 3LX8A 2RGXA 3A82A 3QSYA 3ZVNA 4GSYA 2OUKA 3GLIB 4LCBA 3EDXB 2ZHDA 4TQ9A 2MMGA 2RHMA 1IQHA 4WMEA 3MOCA 1AUTC 5AK0A 1EP5A 5FBIA 1E0AA 4V03A 1OWIA 2JH5D 1RS0A 1L4YA 1F5RA 3TR5A 2AXNA 1UJ1A 4P4SB 1HAOH 5FPSA 2ZHQH 2XGJA 5A09A 2ESTE 3BORA 1MQ5A 3PFIA 1GSIA 1O2IA 4DLZA 2O0JA 5EE9A 3C1KA 3U9AH 4P3YA 5HCIA 3MMPA 4O97A 1HUQA 1FFHA 5IYTA 1DWCH 3DT0H 2CGAA 1SVPA 4WIAA 5IRCD 2FH5B 2I1VB 1INCA 1SGTA 2BYAX 1F2SE 3FP7E 4JKYA 3AAUA 1FW6A 3F5FA 4CGZA 3DOFA 4UDWH 3C15C 1XXHE 1F7ZA 1MT0A 2Z4RA 2ZJBA 1LPGB 2PJRA 4Q7XA 3MRSA 4LOYH 2F3TA 1Z7KA 4KKDA 4Q80A 4I32A 2JASA 4HI0E 3PEVA 2P6NA 3P6ZB 1OYTH 4LZZA 4NP6A 2XNDD 1P2SA 3N5CA 4FUDA 4FCTA 4LYAA 1OIWA 3U7GA 2HUPA 2C5LA 4ON9A 2BXTH 4RFVA 1TB6H 1V2NT 2FMJA 1HPGA 3SJAA 1HRTH 1AO5A 2ZF0H 4MNYA 2ZUDA 2YKGA 3HPTB 1LO6A 3ZLJA 4KYIB 4Q02A 1BUIA 2VL7A 3P4YA 2A4OA 1KI6B 1SGQE 1RZ3A 3PIRA 1ZM3A 2DYKA 1ZMJA 2ZRKA 2GVDC 1P72A 2FSHA 3AQ4A 4HUQA 3B1WA 1AFEH 4B3CA 2ZI3A 3TW8B 4B6EA 4BZXA 1YPHC 2VGCC 2ZQ1A 3RMMH 1C5UA 3TNTA 1TA2A 3BE4A 3RNLA 1X7AC 4JLPA 3R0FA 3KXLA 1IXRC 4HLCA 4C7OB 4PXAA 2OESA 4M53A 3S9BA 1PPCE 2IW3A 2OD3B 2CE7A 2ZHFH 5AWFC 2HF9A 2PT7A 3M5LA 4W7SA 3IIMA 2A2QH 1CJKC 1N5LA 5M04A 1YC0A 2B8WA 2XOKD 5F98A 2C93B 4DLYA 4RD1A 4A6LA 4Q7KA 1DY9A 1PUJA 2QA9E 2ZFFH 4J2YB 4NWKA 1MCTA 5L3QB 4DSUA 2WPIS 4WVPE 3QKSA 1V43A 2O8EA 1DLKB 1P2QA 3GICB 1IQFA 3KQUA 5T6GA 1SGFA 4NYMR 2WPHS 1K1PA 3UWJH 2VQSA 2JETC 2A30A 4NCNA 2JJ2D 3F9GA 4UFGH 4HYYA 2IHBA 2GJSA 4PSKA 1NN6A 3O8RA 2ZJAA 1E2DA 2E1RA 3MTYA 3SHAH 1VKJA 3SJIA 4VGCC 2A7QA 2ZHWH 4E06H 1YQTA 3PEWA 2VIWA 2XITA 4YMVA 1WCV1 2XX3A 5GNDA 5A5GA 3OU0A 5J4HA 1GHBG 4NYIR 1O3MA 5JWHA 2G3YA 1E9RA 4BQSA 3I1FA 2QRZA 4JYTA 3RHFA 2CJIA 4J0QA 2DE8A 4TSFD 2RCEA 4BAMB 3IPXA 3DMNA 3RU4T 2IUTA 4ZIRA 1DSUA 1EZSC 3K6ZA 4C0KA 4LV8B 4MQAA 2IEZA 1SQ5A 2NO1A 1T31A 4A36A 1S0QA 3NBZC 1MH1A 3KDSE 4RD6A 3UTUH 5KTYA 4JYBA 2FOEA 1OHHD 4EJSB 1AB9B 2CCJA 5CITA 4AG5A 3TR0A 1YU9A 3THWB 2FSFA 2ZFSA 2AKYA 3NDBB 1Q44A 4NPHA 4ARZB 3TVDA 1G9XA 2ONJA 1C1QA 4X2XA 4CVNA 1RTKA 1UTOA 2FI3E 1BMFA 1W1WA 4OL0A 2VH0A 3LV8A 1W10U 5EU8A 3BWDD 1RKBA 4LBVA 1C1UH 4EKDA 4A0FA 2GBLC 1AGJA 2FLRH 1B0UA 4JJZA 4JIMA 1E2EA 2GX4A 1C2JA 1UBEA 1G5PA 1NBMA 5G53C 3AB3A 2IS1A 1P06A 1WRBA 3FKSA 4PPGA 4G5GA 1TX6A 2JA1A 1G3RA 3CKLA 3ZVMA 1XEFA 2ODYB 2HJVA 1CBWC 4Y8YA 3DEFA 4BE7B 3IPYA 1IHUA 2F3RA 1FTSA 1GL6A 5JS8A 1R0WA 2F83A 2TMKA 3AKYA 3ZIAD 1CGJE 4I99A 2CJWB 4AYYB 1HV7A 1CU1A 5FR1A 4L5BA 4UNSA 4CEHA 2IUUA 4M9QA 3CRW1 4GOXA 4H42U 4XVRA 3KN2A 1OOKB 1K5DA 5K8LA 1OXVA 3VQTA 5JI2E 1CEEA 1AQUA 4TYPA 9ESTA 2OUAA 2VIPA 2JLUA 1QGFA 2F9LA 1CGHA 1W47A 1C1RA 2ORWA 4HDOB 2CE2X 3AP3A 3NHBA 2CK3D 1BTZA 4KTSA 1KK0A 3CPHA 3ZJYA 3QDZB 4KLNA 1LPKB 2GZDA 3HPRA 4DEXA 1GI9B 1NTPA 1KY3A 1XBTA 1G2MA 1RYHA 3KKPA 2QI9C 4HEJA 2GRJA 1KDQA 2O9QA 4OI4A 1NY5A 1W0JD 3W90A 2VVUA 3LDXH 4JL6A 4UNPA 1EWRA 2KJQA 2J94A 1NBME 2J7PD 1MKWH 5TCCA 5DYIA 3QUSA 1GMHG 1G8PA 4LV6A 4M22A 4PZYA 1GJ6A 3L0OA 1AQ7A 4P32A 5AUOB 2FSIA 4IN1A 5KO2A 2AD5A 3DDCA 3C41J 1Z3IX 1NRNH 1BA8B 1D9XA 1ABIH 3Q3JB 4CRGA 3THXA 1SXJA 3H2YA 4A0GA 4NFEA 1Q21A 3M3SA 1D3DB 1L1GA 3HGPA 4DURA 3UWOA 1OS8A 2P3FH 1DELA 2G5NA 1SKYB 2ERYA 3BTME 1G291 4YONB 1F5KU 3FGNA 2IT1A 1K28D 1O2LA 3ECCA 2SHKA 3VKWA 1VMAA 3SNAA 4DUGA 1IQNA 1L1JA 4WXIA 2B7DH 1CXZA 3OE7A 5C1UA 4ZDKA 2WKPA 1QFKH 4BXSA 3L33A 4CYMA 2DFKB 3W6PA 4BFVA 4NFFA 1Z2CA 1ETRH 5LD2C 1BTXA 4A6PA 3MLEA 4HFPB 2OBNA 2WKRA 3MH7A 5K7RA 2Z9IA 1EAXA 2FU5C 3GMTA 4AKHA 1FPMA 1K8RA 3SBDA 2ZE6A 1YRBA 1G19A 1TU3A 4TL9A 1B5GH 1QF9A 1GG6C 2C98A 1G8YA 3IGFA 2YC2C 1D6RA 1JJ7A 3CWQA 3EPKA 1AGPA 2W6IA 1AWFH 1ID5H 4PO9A 2NPIA 4TPYA 2GXUA 2FO9A 4ZH8A 2GHIA 2HV8A 1A5GH 3HATH 2PT5A 1C1TA 3TK9A 1TA6A 4LHYA 4YMTA 2IF2A 1SXJE 3GOVB 1XNJA 4P4TA 4MTBA 3SU0A 3FWYA 2IC5A 1GHBF 1SI5H 5CIQA 5DN6A 3QF4A 1XTQA 1QURH 4KCGA 3V12A 2OLGA 3CH4B 3CF0A 3TGIE 2IUSA 1DXPA 1P2JA 4WH6A 1CT2E 1XUJA 5CK5A 1BJUA 4TQAA 3OEEA 1O39A 4J1YA 3VFEA 3Q8XB 2X1VA 2GESA 1RGQA 4BZPA 2A45B 1J16A 4ABJA 2PLFA 1YPMH 1NVVR 5FTMA 1E9FA 2W0MA 4FMDB 2C8WB 1Z08A 5B6OA 1D2EA 4KTCA 4KLZA 2ZTXA 2VINA 3OY6U 2FDAA 5ANRB 1SHZA 2P3SA 4LC0A 2HWLB 3H7TA 1ELAA 3SQXA 1S82A 1F2TA 2ZEBA 2ZWLH 3GJ6A 2GXQA 4TLEA 3C16C 4GMXA 3X1DA 4N0DA 1Q22A 1VG9B 5KPJA 1G3MA 1W5SA 1TF7A 3LXRA 4Q1DA 5J4KA 3MMGA 4MITA 1SZPA 1A7SA 3N2EA 1E69A 1V2UT 2OO7A 2JLZA 4TYDA 2WUCA 3HU2A 3EX7C 2F43A 1A2KC 2ODWA 5DP4A 3LIWA 4HAYA 3K70D 1S1CA 3BBPA 1FY3A 2GWHA 1C2LA 1T5LA 4CH2B 4WXVA 621PA 1GTVA 3GJ8A 2J38A 2ZRDA 5EXSA 1TGCA 1UVSH 2QGNA 4BUJA 1SVKA 1BRBE 1QRWA 1UEJA 4GHTA 1LPZB 1ELTA 4RZ2A 2OFWA 4THNH 2FNAA 1WQSA 3UNQA 4XWKA 1B23P 1G16A 4AB9A 1PPGE 1FI8A 3QUMP 4WOPA 4G3XA 3HKIB 2QUZA 2BBTA 2Q6FA 3SU6A 2PKSB 5HE9A 3ZVFA 1A46H 3BTDE 4K60A 4ABAA 3GLGA 1E2PA 2OBMA 4XSGA 4QNRA 4AC9A 4K1SA 1JXOA 2HLCA 2FEMA 4TN1A 5JBTA 2IK8A 4D9QA 3U44A 1WQ1R 4LY6A 4FU8A 2TPIZ 4PC1A 3KXKA 2H9TH 2A7HA 4LDJA 1KJZA 3QJYA 5FBEA 1EAWA 2H2ZA 2IS2A 4Q1CA 5D3QA 2F9VA 1CJUC 3EWSA 4OS6A 2RB4A 2KWIA 3WHLA 1ESBA 4JBYA 4RKOB 1GMHF 3VHLB 2ZTSA 2GZ8A 1E2FA 1S9DA 3IUYA 4C0AC 4EPWA 5JMTA 1JAHA 3VB5A 4R0IA 1ARCA 3AASA 1UM8A 1TNHA 1GVLA 2P94A 4DB2A 1GHAG 3KZ1E 1P8VC 3THYB 3VGCC 3RMOH 1U0JA 2PUQH 4ITRC 3PUXA 4WA7A 4EPVA 2VLIA 2JLSA 2ZI5A 4D82A 3RXAA 3ZDQA 3A1WA 4UEHH 5B2ZA 1HURA 4A2WA 2VHJA 2UVQA 1AZZA 2GDDA 3KL6A 4Y0AA 3QBTA 2P2LA 1NP6A 2HLDA 5LPNA 4LJ4A 4HUTA 3KTAA 3AW1A 3CR8A 3GLGE 1C9PA 4KBFA 5FCRA 2NOAA 1DAKA 3RXBA 2BY6X 4JVNA 1PVOA 2XXAA 4AI6A 3RXGA 2OCAA 3I8XA 1OFIA 3HPQA 2ODQA 3TGJE 2VHQA 6GCHG 4GLYA 1G3IA 1XMJA 1UKYA 1C5YB 1IXSB 3ADKA 4Q4AA 2TGTA 1GPZA 3PR1A 3DVLA 1TQ4A 2C77A 3UREA 1QB1A 3OIVA 4TZ6A 3PUWA 3GCNA 3K70C 2A0QB 1XB2A 4GHQA 1O5BB 2QAAA 5LB2A 4D7GA 1SHYA 4BLPA 4IOKA 2RMKA 4E03A 3KFVA 1O2KA 2RGDA 4CH8B 3GCOA 1NKSA 4A1TA 1MRSA 5EXTA 2ZCLP 1NLFA 1N5JA 1KLTA 3X1YA 1BMMH 4M2LA 1O2QA 3TH3H 4QRHA 1LNZA 3GCGA 1KKLA 3NG1A 1QHNA 1OFHA 4SGBE 3VR5A 1O31A 2OEPA 2PX3A 4H1UA 3WRXC 1GHVH 2UWOA 2HVXA 4Y8XA 1QTFA 1SOTA 3A83A 2PTCE 2FN4A 4AKEA 3NC0C 1DDJA 3SHFA 1O3JA 2VP0A 4E05H 4HSEA 3TQFA 1JEEA 3QG1A 3BN9A 3BB1A 2WJHA 1A0JA 1HAPH 3GEIA 5J4YA 4CR5A 4KAXA 3FOZA 1Y59T 1P9NA 2ZFQH 2ZRNA 5AJXA 2F9UA 1FP6A 2JDIA 5DP5A 4FMCB 2FP7B 2BCGY 5JLJA 4N3NA 2WPJS 2C8YB 3FHOA 5JSZA 3T26A 721PA 1BMFD 1XKBC 2Z9GA 2PSYA 4PANA 1DG1G 2IYQA 1ESMA 3PMHB 1O2SA 3ATMA 1DE0A 1E2LA 1XMSA 4DOQA 1E99A 3O8DA 3BTWE 3RABA 1FMLA 1DO0A 4B32A 2IYWA 4HDQB 2FODA 1VITG 3STJA 1GHWH 2Y6TA 3RMLH 4BFSA 1R4AA 2ZSEA 2QAGA 3FKSD 1TONA 4NONA 1Y3YA 5L30H 2VYFA 4FUFA 4PQYA 3P8OA 1D8TA 4MYHA 3UMSA 1OH5A 4XTCS 4F4OC 2VVCA 1QJ7B 2Z83A 1DUEA 2OC0A 4CRWB 1KNQA 1US8B 2ZE7A 2P6RA 5D3MA 4B74A 1TE0A 2P6UA 2ZXUA 4IW4E 2ZDVH 5AFZH 2W3IA 3R9IA 2FJUA 1P02A 2DFTA 2G88A 4MH0R 5J40A 2REBA 4GBMA 4WBSA 1TPZA 4K2YA 4GI7A 4PC7A 3MU8A 1NJFA 4MNWA 1CGIE 5AVDA 2GV7A 1O2PA 4IKEA 1TABE 2GCOB 3CM0A 1S9HA 2XW9A 3CX6A 3T15A 2R6AA 3IO5A 4F4JA 2OCYC 2B8OH 1AI8H 1UTLM 1NN1A 2LKCA 4JBWA 4AURA 4FWIB 2CV3A 5E4FA 3FMPB 3RSOA 1LVGA 3R8FA 4ISOA 4DWJA 1LCYA 5ABWA 1EX7A 2FLBH 2CL6X 1HBTH 2CHAC 3D62A 1XPOA 4NTZA 1ANEA 1VCNA 4ABDA 1LTOA 3W8NA 4YESB 2BHRA 3KQBA 4HB3A 5EXXA 4JLDA 3VB6A 5C2JB 3B8HA 1RW4A 4B73A 4Q9HA 2R8RA 4CRAA 2STBE 1PQ7A 3FP6E 1T8OA 2D2DA 3PO1C 1V6DA 2P5SA 5EP2A 3ZVLA 2AHOA 1AJEA 4JLOA 1CP2A 3PTNA 1K22H 1GBEA 4AFSA 5HE8A 1C1WH 2NO6A 1CBUA 1X1RA 1Z07A 4BFWA 4R98A 3M35A 1GHAF 5FL7D 2BWJA 1SGPE 2ZU5A 2ZSDA 1E2HA 5L2ZH 2G4UA 3LGTA 1HT1E 1G7SA 3GQBA 2ZANA 2REXB 4PTLA 1KO8A 3H4MA 2ZRGA 3LH3A 3TH4H 1R5BA 2QMHA 2ZS7A 5KNDA 1DPOA 2ZS9A 1PYTD 4UE7H 1HXEH 2HNTE 5G3ZA 1P03A 3OFND 2VSXA 1FOEB 3OE7D 4U30A 4CDGA 1HNEE 3GLFB 4RZUA 3KB1A 4GOJA 5E3HA 4O0MA 4YQFA 4OK5A 3GY8A 2ORIA 4B3GA 1VCIA 3SQWA 1MZDA 3MG9A 1FIZA 1O3EA 3LNCA 1OIXA 2QTFA 1HQYE 2J46A 2VIIA 1YF4A 2GF0A 4B3XA 3B85A 1CBWB 4LJ9A 1D9ZA 3ATIA 3MO9A 1BJVA 3PV5A 4TLDA 1P12E 3F9FA 2ZU6A 4M21A 3GDUA 1DY8A 4LJ8A 4TLAA 2OXSA 3PITA 6GCHF 1Q0UA 1DO2A 4H6TA 3FMOB 1P2UA 2ZI9A 4ACBA 4AKGA 3IITA 4AYWA 4CT4B 4Y71A 1ODFA 3H86A 1IN6A 3HJNA 3E8LA 5JS7A 4D26A 1EPTA 2QXGA 3S7HB 2V1UA 3E91A 5FOUA 2Z7FE 2ONKA 1HAYB 2JIZA 2NZJA 1E9AA 3SNDA 3U8RH 3TJNA 2AL7A 1Q31A 1XVOA 1E1RD 3NZIA 3GY6A 3L6PA 3K1JA 3QNUA 1GBDA 2ATXA 1HFDA 5BN3A 1KI9A 4MDSA 2RG3A 1P9WA 1XTIA 2CMKA 5DN6D 3QIAA 1G8HA 5C20A 3AP1A 5B6LA 3RU4D 3V0XA 1OKKA 3ESTA 1IONA 1NY22 4IDHA 2R2MB 2QQEA 3VAAA 5T6FA 1WTHD 1O87A 3MH5A 1EGAA 3MD0A 3IO3A 4OYHA 3LGYA 1V2OT 1A82A 1VIAA 1LHFH 3U8OH 1Y8TA 2SGQE 1G4UR 4MYCA 2FESH 1S85A 3MUFA 2JH6D 2UZIR 4EPTA 4JKIA 2V1XA 3EC2A 2NO7A 1MQ6A 1W36D 1ZIPA 3VTKA 2DFLA 3T29A 2ZPTX 1ZR0A 2NU2E 2QSZA 2F1HA 2FZ4A 4O03A 4Y6DA 3K0AB 4X8TH 4DT1B 4F4CA 5TV2A 3MU5A 4IVRA 2A4RA 4NYJR 2EU8A 1OP0A 4YDSA 4ABBA 2RHDA 3MYWA 1LDTT 5LDDC 1UJ2A 5CJ2A 2GZAA 8GCHG 2ZJ2A 1P3JA 1SXJC 5T6DA 3U4QA 3TH2H 3S1AB 4AGKA 1VITF 1NMYA 2NIPA 1LKAA 2FX3A 4AFZA 1OKXA 1KMQA 2I6QA 3RMNH 1YCPK 1S1MA 1FDPA 2Z0MA 4BLOA 5C4MA 1UCYE 4HLUA 5HMAA 1XF9A 3QTOH 1O2NA 1PYTC 1V2PT 4R2HA 5DP6A 2WSMA 4NIXA 1E35B 4K8YA 4IC6A 2IX3A 2CF9H 5BYJA 3V3MA 3T1OA 3MWLA 1XUGA 3O47A 1A5IA 3FE2A 2QNRA 4NSVA 4A0HA 1DITH 3AAVA 4RZXA 3B9FH 3ZZ8A 1UBFA 3UK6A 2TIOA 1KIGH 1WBGB 3K9HA 3NEYA 5FR2A 1CLUA 3SJ8A 2V3HH 1H9HE 1Y3WA 2ZGHA 4MGKR 2UUFB 3IHWA 4DVGA 1MV5A 2W7SA 1G9IE 4KSBA 1QHXA 2A2ZA 1NRQH 1ZSKA 2W7UA 1MUEB 1E4VA 1U98A 3IDQA 5FOXA 2FOAA 2SGAA 2QY0B 2Z3DA 1T7CA 1XD2B 2LPRA 1QB6A 1KGDA 1ZM9A 2Z5FA 4NMMA 5FI1B 1G3DA 3HWSA 5EUMA 5J4VA 2AGEX 2C99A 4I1SA 3GY7A 2QPOA 2EI8A 2G81E 3BG4B 1YCPM 4QC2A 4A82A 5AJYA 3V7TA 2ZI7A 4NA9H 4Y7BA 4E5UA 3KUCA 1BBRH 3B8JA 4WMFA 1BMLA 1OW3B 5FUWA 2PKAA 4URVR 3RS3A 2QN6A 4A0RA 3AUYA 5BQ5A 3GDVA 1AIPA 3BTGE 4PHHA 3ZD6A 1KXFA 3BIUH 1GI6A 1EG7A 5KPDA 3ZZ3A 4D25A 4GP7A 2F55A 2BX3A 2UUKB 4PAOA 1OP2A 3VKHA 2D26C 5EZ6B 2UWLA 1O37A 2WPDD 1W4CA 4BAQB 1JQJC 1N6PA 1KLJH 2ZCKP 3C7KA 3I4LA 3C4JA 3QENA 1CJTC 2BMGB 3QZQA 4TWWA 2AEIH 4WXRA 2HLDD 4D2IA 2F7SA 4A8JA 4Y0YE 4U32A 1T0JB 2QC2A 1G2LA 4RD4A 3PUZA 3LBHA 4QGFA 4Y0VA 4G0NA 1C5NH 1HYLA 2VF7A 5HKKD 3WMEA 5A0CA 1J8MF 1WB9A 4L9WA 1O3DA 2PJZA 4ISLA 4RJLA 1MD8A 1ELFA 3ZYEA 3TJUA 4PFSA 3TH5A 3BSQA 1LY1A 2GILA 3B82A 4DDWA 3K9XB 2ZU4A 4GPTA 1Z28A 5FOVA 1VDZA 1LHGH 4HB2A 2BY7X 4OHYA 4G5QA 1UMAH 4PSVA 1V5WA 1Y5AT 2RA0A 4EPXA 4MYTA 5HPYB 2CXXA 2PL3A 4NCJA 2REOA 3GYLB 1ZOMA 4OS2A 4A7IB 4YLQH 1E4YA 1FXYA 3KF2A 4Q4HB 2GTPA 4NA8A 1BS1A 4YXWD 3J81k 5FUVA 4A9AA 4XOJA 2V8OA 5TARA 2AN9A 3GFPA 3NXPA 3LBNA 3LVQE 3L8ZA 3S9CA 4URYR 1RIWC 4BEBA 1AA9A 2F9OA 1NESE 4TPIZ 5E8EH 1KNXA 3PUVA 2EWWA 5KNCA 1GNPA 2R62A 4RSGA 1HQCA 4D6PA 1J17T 3U60B 2XC4A 3V13A 2BLWA 3Q7QA 3QKUA 1G8GA 3FZZA 4C3ZA 1ESAA 2B21A 3REFA 3CF6R 4B33A 2GKVE 3FYHA 4IOLA 3BIVH 3WBKA 3WP0A 5J47A 4AKIA 3UWIA 3GLIA 2PEYA 3RC4A 1TBRH 3K8YA 3TGKE 3BH0A 3GISB 3MHWU 2C8ZB 1M9UA 2X2EA 2P5TB 4H1VA 3SUFA 1OLOA 5JECA 3NC1C 2XEXA 1TRYA 3ADCA 1P6XA 1OXGA 5A0AE 1BTUA 4FVDA 4LK2A 1YRAA 4ZPXA 1X1SA 3LGWA 4P4SA 3VGCB 4Q1AA 4PPQA 2ZHEH 1OYWA 3EC1A 2B7BA 4RZ3A 4LX0A 1HLTH 1YHNA 4X8OA 5AUNB 4LHVA 4URUR 2XXLA 4IMZA 8GCHF 1ZD9A 4MNXA 4W5WA 3ZD7A 1EZQA 5JHHB 1YR7A 1CR2A 2DWPA 1EP6A 1Z47A 1HJAC 2R6CA 4UFDH 1I2DA 1ZSLA 2GJ8A 2YOFA 1MABB 1CR4A 2OK5A 3MWYW 2GDEH 1NY6A 3BXZA 1P9SA 1U8AA 2R3UA 3EWAA 1Z8IB 1XD9A 5FOWA 4Y11E 3SBEA 1KK3A 3VMFA 1F3OA 3SU2A 3R3GB 3W3AA 3GCHB 3CRVA 4P31A 4HZUB 1C1OA 2ZI4A 1NZQH 3EGKH 5F8ZA 1GL1A 3VNUA 1A4RA 4Q66C 4WVFA 1O33A 3SJCA 1KDOA 2BY5X 2HXYA 2YOLA 1N6IA 2BBOA 3CB4A 2QA5A 4HAWA 2XBVA 4AYXA 2TGAA 5CIWA 3SEAA 3GLIE 2KAIB 1HAIH 4Q7YA 2RGCA 1FNNA 1SMFE 3VXEH 3QXXA 1BYUA 2IBMA 1JRTA 3GJ3A 4RKJB 5FBVB 1UDWA 1KI6A 4M1MA 4K1EA 5EW1H 1LKBA 3P95A 1JECA 1P01A 1WMSA 4ASHA 2ZQ5A 1UCYK 1WA5A 5EGMA 5CB6A 1O34A 4C7OA 1EFUA 3RXIA 4QBFA 2BEJA 1E2KA 3U3RA 4ZI3A 2QY9A 5EOKA 1EFTA 2P8OC 4QM7A 4AB8A 2XNIA 4M1WA 1ZRKA 1MCVA 3BV9B 2FTLE 4A1FA 1J14A 3DFJA 2PTNA 3RXLA 4JZDH 2XBYA 2PHBA 2H9HA 1J90A 1ANBA 1JXPA 1A7JA 3B9QA 1PQ5A 2HT1A 2VO1A 5L3QA 4NZLA 1GHXH 1K1OA 3SYKA 3RXHA 3H09A 1O5DH 521PA 3SBKA 3NWJA 1C9KA 3SNBA 2J34A 1QHIA 1DTSA 4NYJQ 5GPIB 2GBLA 1W0YH 3CUEF 2VVVA 3C27B 3I32A 2G51A 4EPYA 4HATA 2VIOA 2N1BA 4EUNA 3C5HA 2DB3A 3RXDA 2W58A 3CR7A 1XXDA 1LVYA 1NS3A 4Y7AA 1ZTLA 1KY2A 2GKSA 2FOLA 1KSJA 4BLQA 4OK6A 3UXMA 4C0SA 3TSZA 5CYOA 5J4QA 5HZKA 4TL8A 3DOEA 3BH6A 3P32A 2PLXA 3RXJA 2KI5A 4DG4A 4W9MC 5EE0A 5HZHA 3ZS9A 3JVUA 4JL8A 5ESBA 4A2QA 3HYTA 1AE8H 3A80A 3GY3A 4EJSA 5G41A 4TQUS 5GJVC 5E7IA 3THWA 4MG3A 1EJNA 1RTLA 3PG5A 1O3GA 3SV2H 4TT3A 2XOKA 3NK8A 2TRMA 2JIZD 3R8CA 4OHVA 3D8BA 4AFQA 4ARZA 1C5ZB 3QKSB 5CB8A 2O8EB 5AHGH 1QJ1B 4Y0ZE 4JLJA 2FM2A 2QRNA 1UVTH 2GETA 2BDHA 2AD1A 1M2OB 3K2UA 2IYTA 1A3BH 1DAMA 1N8OC 1U0HC 5GVSA 1OKKD 2NTYC 4LWZA 5DI3A 1RPZA 5KU1A 3MI4A 4Q47A 1P3CA 2ZECA 3A88A 4QHTA 4L8GA 1O2TA 3M3TA 3DUXH 3A6PC 4QHSA 3T1QA 3PENA 2ZVQX 3WMGA 3TJZA 4AN7A 2E9SA 5LGOA 5AUPB 2QP9X 2IS6A 3TK5A 1TF5A 2O8FA 3RLFA 1JQLB 2ATVA 3UG6A 4DEYA 2Y81A 4QNMA 4KP0A 1J99A 1GBJA 1TGNA 2CCKA 3EPJA 1KXBA 1E36B 4Q03A 3EA7A 4X8MA 1OHHA 1T91A 1C5TA 4CEJA 1G8FA 5EQRA 1I2MA 2MSCB 4FI3C 3E1XB 4LJ6A 1KI1A 2FI5E 2R2WU 4IMQA 4DLWA 5BPEA 1AGRA 1V2QT 5FI0B 4CRCA 1VECA 1C5OH 1GJ5H 1THSH 3NBXX 3QWCH 3ZV9A 2IYUA 5GJCA 1KYIA 2OT3B 3B6EA 4X1PU 1G7CA 3AF0A 2J95A 1GCDA 1HE8B 1XKAC 3L43A 1Y3XA 3A7TA 4X1NU 1IY1A 1JMOH 3Q3XA 3W6NA 9LPRA 5TVKA 2ZR9A 2ZU2A 1QBOA 4WW0A 2VA8A 2R9VA 4MGZR 1P5ZB 2BVRH 1QL7A 3ZZDA 2XC5A 1GBMA 1NFXA 4MPUA 5AFYH 2PCLA 1XM1A 2W6JD 2CBZA 3UMFA 1MO4A 2Z9JA 4JLVA 3T34A 1TGSZ 4MA4A 3AK5A 3QPVA 2Y5HA 1O2ZA 3DA9B 4TYWA 2RGBA 2GNOA 5DG6A 4P33A 4S35A 1FMJA 1ZNYA 2JKHA 1G3CA 3UNSA 4O3MA 2O52A 2RGAA 2AFHE 2QXJA 4TWYA 4L16A 4ABYA 3NTUA 1EPTC 1KI3A 4M1OA 3ZV8A 2OC7A 3QPWA 3GEHA 1XCPA 3T1VA 3ONWA 2IA5A 4IFBA 2PH1A 4GSOA 4D0LB 2VHCA 4RD3A 1XEWX 1OWHA 5HGGA 5JCZA 2JH0D 2CK3A 1OX1A 1XVMA 1AN0A 3K0FB 3URDA 1JNYA 3U7HB 1V2TT 2FOBA 1ZZZA 5E2OA 1MO6A 4XVUA 1HYQA 2NU4E 1R2QA 4KELA 2FEOA 4I33A 1DG3A 5CM8B 1KIMA 1GAJA 3D23A 3ND8A 3W3ZB 3EIHA 1U6QA 3LFUA 1OT3A 4U02A 3FB4A 3TUIC 4JMYA 1O2YA 1ZW6A 1MOZA 4S2EA 2ZA5A 2BKEA 4JZEH 4F91B 2AFQB 2GMTB 2WZQA 1GP2A 2OBQA 2STAE 1OFUX 1GDDA 2RH5A 5JEEA 3C14C 4PC2A 4BFTA 1L2TA 2I3BA 1T8TA 1OH8A 2QU8A 1IOZA 2QROA 1HUTH 1G3QA 1RC8A 2Y5FA 1IN4A 2ULLA 4NDZA 1RJ9A 1XX9A 4B34A 1CKEA 2AMDA 2BOKA 4XBCA 3RS4A 4KO8A 4WF8A 4LJYA 2V3OH 2RCNA 4BAKB 4JT4A 2BDIA 1VYTA 5JFGA 3DL0A 2SNWA 3DM5A 3THXB 1SXJB 4US0R 1Z0KA 3D6TB 1HAZB 4FN5A 4V0MA 1UHBA 4H4FA 3CX8A 1CA0C 1FUKA 2WOOA 3NCLA 1GVZA 1NSTA 1SKYE 5EP3A 4TL6A 4AX9H 2CL0X 3KFXA 4ZV4A 3EA8A 3E16B 2LKDA 2BM2A 1A0HB 4DLXA 1A0LA 1QL8A 1VJ9U 4UFFH 3UFAA 3WRYC 4JLAA 1HV8A 1ZC4A 1QRZA 1Z22A 2Y7XA 3CRQA 4P4UA 2NO9A 1UKZA 5IDKA 4PROA 5GDSH 1KMHB 3KJHA 2PFEA 3TLOA 2CHVA 2G6BA 4HLUC 3QQ5A 1E3MA 3AVVA 4B3DA 5BRRE 5EQQA 3AKDA 4MVNA 3UIRA 4MNVA 1H8HD 3M1IA 2WJVA 2ZYWX 3FKQA 1U9IA 1TX7A 1QVAA 1T8LA 1CF4A 4X6OA 3B13B 1SGCA 4UD9H 1VJAU 3L82B 1SGDE 2D4HA 2ZS8A 4NE2A 1IBRA 3DD2H 3I78A 2P16A 3QVVA 1KJWA 4NA7A 4YTAA 3RC5A 2HOBA 3MAAC 3PLPA 3MFYA 1UFQA 1KI7A 2PGQB 5CHAC 3DKVA 4GVUA 3TUJC 1IQKA 2D8WA 1C2GA 4HZIA 2F6RA 2AWNA 4YC7A 3SGBE 1DAIA 2JLWA 1LHEH 1JALA 2GCHG 3RP2A 4V0ME 3RXUA 3QI2A 1IY2A 1KDPA 2GZ7A 2V6IA 3SV8A 4O9VA 2G0NA 3WY9A 1S2MA 1JAIA 2ALVA 3A81A 3QF4B 4JSYA 1H65A 3DZ8A 4X1RU 1SVIA 4MKGA 3TIFA 3ZGXA 3QEOA 1LHDH 1P11E 4RFSB 5SZIA 1MKXH 3TBKA 3GPLA 5C5OA 1KK2A 2GK7A 1GGDC 4MGYR 4CRBA 3TITA 5FCKA 1P7CA 1RVDA 1AU8A 1DAEA 1QBKC 3M5OA 3GFTA 2BZ6H 1TOMH 1ZYUA 4KHZA 4HTCH 4G5SA 3NWUA 2VP9A 3RDPA 2VSOA 2J9RA 3T62A 2P95A 1KO4A 2ZRCA 2CXVA 2F9BH 2GAOA 2H17A 4IN2A 3T5FH 2XB2A 2UZ3A 5C67A 3F0TA 3W95A 2C96A 4I8HA 4LZ4B 1SB1H 1HTWA 2M5TA 4YLGA 1SLWB 1F60A 2XYAA 1AUJA 2ANCA 1TX4B 1GL9B 1VGCB 1XXHA 2QMOA 2IXEA 2FPMA 3SNCA 3CX7A 2XJ9A 1Z0FA 4QGHA 1TAGA 2WHXA 2ZTYA 4GOKA 4X6MA 1KSNA 4NCIA 1AFQC 3BB3A 1ANCA 2F1RA 1QA7A 3ITIA 4BZQA 5KYKA 3SJ9A 1G6HA 2WV4A 1O3BA 1LF0A 1GFIA 3LJOA 3CS0A 2FGKA 1C2DA 2CDNA 1TPPA 2OV2A 5DP8A 1MTWA 4HB0A 4JYUH 2J59A 3PJRA 4AFUA 1K1MA 2QT0A 3CNLA 2HYIC 3I73A 1K9OE 3QKRB 2CLDX 1YZLA 3B9PA 2UKDA 4ZKEA 2OFXA 3VR6A 3WNBA 3VU9A 4ZKRU 3THYA 4I8JA 4ISHH 1ZHPA 1WUNH 1UK4A 1RYFA 2TGPZ 1THRH 5KSZA 2B0FA 4PHTA 1LW7A 3AVOA 1O2JA 1E9DA 4NBSA 1RIWB 1ZGIA 2HDNB 4DIIH 4NG9H 3SOSA 3B1ZA 2R3YA 2WKQA 4UNQA 2J0SA 3PWBA 3ZVDA 5B58C 1SQOA 4W5HA 1NL3A 1MKWK 3GLGB 2LCFA 4BFUA 1SC8U 3AVXA 2HYDA 1KOFA 2H6MA 4HLDA 1OWJA 2FFQA 5EXPA 2QTVB 2ZSFA 3CLVA 1NT1A 5DP7A 2V0BA 1O35A 3MNSA 2XSZD 4KYUA 1QJ6B 1ZPBA 1AQYA 5EQSA 1KI2A 2ZREA 3QZRA 3UATA 1C4V2 4KFSA 1LV7A 5JRZA 4QBIA 2R0LA 2AK3A 2GAAA 2SGDE 2SNVA 2ANMH 4B75A 1Z6EA 3P4XA 3T35A 4B2BA 2KB0A 4IXMA 2QBYA 1C5XB 4FXGH 1GI8B 5F6MA 1UTKA 1TTTA 1M34E 1VHTA 1N6XA 1JIRA 1PPEE 3ZVCA 3SU8A 3U1JB 1J7KA 3VPKA 3U3MA 1SOZA 1YGCH 5FH9A 1BT7A 2ODPA 1C4OA 2ZDKA 2XZPA 4AOQA 3TNFA 1E9EA 5EPNA 4FIDA 1JEDA 1L4UA 3X1ZA 2ZRHA 4V0OA 2SGEE 1ZNWA 4PQRA 1QB9A 1UVOA 1G4AE 2ZUBA 3GD7A 2O8LA 4XIGS 4M9ZA 3TIUA 1EASA 5KUTA 1QQUA 5FL3A 4ABIA 4AORA 1GI3A 2BD9A 2FTMA 1N0VC 3V4RA 2ZFTA 3K65B 2OG2A 3LOXA 4LYHA 1N6RA 3AVPA 1SHHB 1VCMA 1E1QD 4GRAA 1HAVA 5UKDA 2CMYA 1AN1E 2D2EA 1C1VH 1XZPA 4TT3D 3F9HA 1V2RT 2XXAB 5IDVA 4YM9A 4KBGA 4ZXXH 2LNCA 3WBJA 3VEQB 1NU9A 4Q9IA 1SGIB 1W4AA 1IM2A 1NI3A 4Q4AB 2V4ZA 4E07A 1WXRA 3GY5A 3T25A 1XD8A 5JBAS 3OEHA 4FW9A 2B8TA 3B5JA 1VCWA 3NH9A 4WH8A 1YZNA 1AE5A 3N7OA 1CRQA 1G20E 2EA3A 4AYVB 3SU5A 3IKJA 1DX5M 3LQRA 3A36A 2OILA 4FD2A 1FL9A 4V02A 1YPKH 3BFVA 1O2GH 4GT1A 1L4ZA 1E6CA 1GG2A 2QP3A 4DBLC 2GCHF 2UUYA 2CLCX 1G64A 2CF8H 1T8MA 1QG4A 5E7JA 4AG6A 1MTSA 2SFAA 3UR6A 4EQ6A 2A5JA 3A1TA 2XRCA 4GUXA 1SULA 7KMEH 3SS8A 5FBWB 3MNCA 3GFOA 2BX4A 1KTSB 3UUZA 2BLOA 1F5LA 3KQEA 4Q4LA 1R0ZA 4FMDF 1GMDG 2F9PA 4ZAEA 4MRRA 1ETSH 1DWDH 1TALA 4DVAU 3K9LA 4OJQA 3Q5EA 2VTKA 4MPVA 4JK6A 3T1TA 3U3KA 3RS5A 1IQPA 1J2JA 2Q6TA 2NG1A 2Z3EA 3ICQB 4NKRA 1L2EA 1UK2A 2L0XA 1G1MA 2A3RA 1F92A 2BOVA 1MTVA 3ZZ4A 5EE5B 6Q21A 3FMIA 1P2MA 2ZDNA 4IVQA 3MU4A 3CZPA
chains in the Genus database with same CATH superfamily
4IF6A 2GP9B 5TGZA 4RX1A 3NKLA 3RC2A 1LS6A 4JZKA 2YZ2A 3TF5A 3I0MA 4DIHH 1K7CA 2CVHA 3IRVA 4JYAB 4FSHA 3MJVA 3HZOA 1UEIA 4GX5A 4R2WA 3H2ZA 4GOMD 2NU8B 3OC6A 4KNVA 5L3RA 1KDRA 1Q0PA 3UY9A 1C3VA 3I04M 3QEBZ 4MQLA 5CLFA 1A2OA 4KGAA 3STWA 3VR5H 2D1SA 4H0CA 2CFCA 1W46A 2ZPRA 4X20B 2UUJB 3DE1X 2EX1A 4XWOA 5KTPA 4W5JA 2I4OA 2CZCA 1WWKA 1AB9C 2GNPA 1ZD1A 1LPBB 4MUAA 4UHJA 5GWZA 3ZU6A 2QLJA 4HLNA 4AGJA 4PHFA 5JWRA 3LOPA 2P0YA 1TEXA 1XUKA 1WF3A 3IUPA 3P20A 3DZJA 4GR4A 3V5NA 2XUJA 3AF1A 5EGNA 2ACKA 5CVCA 3Q41A 3SHQA 2F91A 4MP8A 4KG7A 3KYCA 4QT8C 4EEZA 5BUCA 5C0OE 2XIJA 1AUPA 2BDGA 1C5WB 5HUJA 1DHTA 2GPBA 5KJ6A 5CYFA 3ABSB 4UM8B 2BC9A 2C8KA 2I6SA 4TSKA 1GEEA 4M0KA 4DIEA 1KYQA 1GJ7B 1VYHA 3LLSA 2X8BA 3WLKX 2QGRA 2ALJA 3P2YA 1P2VA 5AXBA 2V7QD 1YWGO 2FEWB 3AUKA 4Q9NA 4MRMA 1GY8A 2XBLA 3JQRA 5EKUA 3G0IA 3VB3A 1T4DA 1U8UA 5J4LA 1IQLA 1KSFX 1Q16A 2VG8A 3GJQA 5I7SA 2GO7A 4OVKA 3WL3A 3D8UA 4JP1A 3GYGA 4LYFA 1XKTA 3WI7A 3TQHA 4E32A 3KAPA 1IWBB 5AM4A 4M8NE 2CB0A 3RXCA 3C3XA 4BZZA 2BD8A 2VNIA 2Q5CA 3ZDFA 3QM1A 3C5EA 3AVTA 3ZWPA 3ZZ0A 3UJ9A 4IDGA 1T2DA 5FTWA 2O8DA 1T0BA 1TGVA 4ND1A 4UJ5A 2CZGA 4UM9D 4QYWA 1TFRA 1HDEA 1V2KT 2AJTA 3OFNA 1NN0A 5FBLB 1QL9A 5LPEA 5E9QA 2W42A 1IN7A 4NNPA 4H3KB 1A8QA 1TPSA 4BMVA 4EM6A 4IQ0A 1WYKA 1ECPA 2OQ5A 2H9YA 5C35A 2B2CA 2FF7A 2F3CE 3OQBA 5HM8A 4RD0A 5DM60 1RNLA 3O26A 4Q5IA 2J0UB 4Q7EA 5A1JA 2QSYA 4AY6A 4ERNA 3OQVA 1N57A 3K32A 2WJJA 3DEYX 3NBMA 5AI6A 1W11U 4J0HA 4DT1A 1P04A 4IIJF 1L5WA 1IJBA 2X77A 1B6TA 3SGAE 2QT9A 3F7NA 1HFEL 3K31A 1C4XA 1K86A 1RTTA 4EGJA 1G2QA 5TQ2A 1ELEE 1D3QB 3UNRA 1BH6A 2HO5A 1EFLA 1EBUA 1S6YA 3I29A 3L7IA 3IAHA 5AVRA 1XCBA 3K09A 1J2UA 1UJ4A 1E1RA 4IUCS 3RYHA 3QHAA 3O8BA 3CO0S 1URPA 1KE1A 2PTGA 1LPMA 1QGAA 2FX4A 3M4XA 5IG2A 4E12A 1GJ8B 1TJ5A 5JYIA 3RC8A 3BWXA 2NZ2A 2ZQ2A 4CV2A 3FSGD 4OOFA 2QWXA 4LK3A 5LDHA 2X7JA 1WAYB 1Y3BE 1XMVA 4JLSA 4UU8A 1Y6RA 1CSEE 1N2SA 1UT5A 3E48A 4FGWA 3WBBA 2YV5A 4CXMA 4ESEA 2A4MA 1GMDF 1KJ9A 3U5ZB 3Q72A 1BYIA 4I4TB 3EGVA 1C5LH 4CTJA 2XWPA 4I55B 1PQAA 3LVBA 3SY8A 1GZSA 1AZ8A 5JI3E 3EW7A 3WGMA 5CX4A 4W8HA 3TZQA 1ZAYA 4GRDA 1S0UA 1EFPA 4JK5A 2Z3VA 4BNNA 3EW9A 1NVBA 1Z0AA 3L4BC 4UXIA 1E2NA 1GOTA 1GDNA 3SORA 3T4EA 5BW8A 4CETA 3HFGA 1DZ3A 4IFTA