3O8DA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
645
structure length
645
Chain Sequence
b'GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HCV NS3 protease/helicase
publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase
total genus 207
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8dA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8dA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8dA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8dA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8dA03
1HYQA 4ESHA 2B0FA 4IHQA 1E2IA 4XE4A 1NMYA 4TY6A 3CUEF 2W58A 5FBLB 1PVOA 1NM6A 1PYTD 4EPRA 1TQ0B 2EQBA 4LBWA 1KDQB 4PC7A 3VHLB 4NDZA 4OK3A 4X8LA 1MH0A 1WQVH 1AB9B 3KXLA 4UNPA 1CRPA 5FX5A 4X1RU 1ZMNA 2ZFPH 5B2ZA 2BCJQ 1GIAA 3NIBA 3QG1A 1L4UA 2GVDC 3PWCA 1Q3HA 1XP8A 1KK3A 3SS8A 3S7KB 1VJAU 4QOSA 3IBYA 1CF4A 4AGKA 1YPJH 3LQQA 3SU5A 4YDSA 2IK8A 2ZG0H 3B6EA 3PENA 3GCHC 1GAJA 1LHDH 1OH8A 3HR8A 4UXHA 1EFHA 3C15C 2ZQ2A 4GHQA 3U3MA 3NC0C 1N6PA 1ZU4A 3ZVAA 5FOXA 5HKKD 2QG6A 1U0LA 1Y3AA 3TH3H 1EFRA 1O3DA 1FNMA 4EIWA 2WWWA 1GG6C 2AEIH 3GICB 1FJSA 3UNRA 1M7BA 4WIAA 2C5LA 2O8MA 2W0MA 3K0AA 5FFMA 4AOQA 2FIRH 3DHKH 4I4LA 1XFAA 4Q9JA 5FI0B 4NYJQ 1GBDA 1OIWA 1NS3A 1A2CH 4B74A 1ANCA 2GDJA 1YCPH 2A4RA 1RGQA 2PBRA 5FTLA 3OIYA 2Z94A 3CS7A 3RXIA 1RRFA 4OQNA 4CRFA 1HNEE 3SC3A 4W5HA 1FUJA 2CXXA 4URXR 3RRMA 4J1YA 1CQQA 2UUKB 2DFLA 3A81A 1GNPA 3SU4A 1GHVH 4NMMA 2Y5GA 3UPEA 2VB0A 4NZYA 1NFWA 1TL7C 1YGCH 4DSTA 2BMDA 4Q9KA 1UTNA 4ABGA 2QQ0A 1LS1A 1ZZZA 3GLFE 1G5PA 3EE0B 5F6MA 4EFNA 1O5GH 2ZP0H 2D3WA 4MH0R 2I6SA 1BO6A 1KTTB 4A2PA 3M5LA 3QO6A 1ZGVA 5IYTA 3K0CA 1SGFA 2C95A 2PCJA 3F0TA 3PLKA 4JYVH 7KMEH 5A0BA 4RKOB 4MUAA 5L8VA 4ABHA 2FTMA 4ON9A 4LJYA 1AHTH 3SU0A 2KB0A 3LH3A 1LVGA 2OUAA 4QFMA 3U3RA 2IF2A 4B34A 1IQMA 1SKYE 1AZTA 5C5NA 1UFQA 3EGKH 4IFEA 4MNWA 1T8MA 5FAHA 1RRCA 4QGFA 5GDSH 2BDHA 3PLPA 1Z63A 1GI7B 3OSYA 5DP4A 3A4LA 1A5TA 1AZSC 3C4JA 2NZJA 3RXHA 2UKDA 5J40A 4ZDKA 1YPLH 2HUPA 1BBRE 2C8YB 3FGNA 2OD3B 3MH7A 4GPTA 3GFTA 4WH6A 4OS1A 1G32B 2Y5HA 1GVKB 3M5MA 1LFDB 5E0HA 2FZ4A 3UWIA 1EFCA 2GT8A 1Z0DA 4LC0A 3KIDU 1RTKA 2QA9E 2G83A 4D80A 1W13U 1AVXA 5AHGH 1OFTA 1BA8B 5ESTE 2HCJB 4K81B 3CB4A 1FQ3A 3ZZUA 3BK7A 1MTSA 1L4ZA 1BCUH 2WJVA 1T8TA 1H8HA 4CVNA 5C2ZA 1GDUA 2N46A 2JEOA 5GCHF 1N5LA 2WIAA 4V0NA 4OYHA 3FKSA 1N6OA 4K69A 2O0HA 3FMIA 3A8BA 4WZBE 1QBVH 2ZKSA 1XPOA 2BD5A 2ANBA 1VKJA 2W0SA 3Q77A 1Q20A 5TDHA 5EE3A 5EE5B 4X8SH 3SBEA 2UUFB 4XD7A 1NFYA 1ACBE 4PC3A 1CBWB 2ODBA 1GI3A 2WKPA 1W0JA 4JLDA 2ZS9A 1VCPA 1SOZA 1ANKA 1ANDA 4DCNA 2ZSEA 1SVWA 3EWSA 2Q9AA 3REGA 3EX7C 2CL6X 3KQBA 3MJRA 4IJMA 3U3JA 1ZUHA 2FFBA 3GLFA 1ZJKA 121PA 1FAXA 3LDAA 2BQ7B 2QRZA 1DO2A 3EA5A 3ATKA 2ZJYA 2MMGA 4E22A 3PMAB 3T5GA 5B64A 2OG2A 5KOYA 1TBRH 3SU2A 2VLIA 1IQEA 4DT1A 1Z0KA 1T3SA 5TCAA 3MCAA 2QSYA 1P4SA 4JYBA 4DURA 2W2XA 2F1JA 5DO9A 2FO9A 2CVHA 3TR5A 2DR3A 2ZGXH 2P6RA 2XC5A 1BTZA 2GVZC 1MQ6A 5H4IB 1EP5A 1KJWA 1O3EA 2H5DA 5EE1A 1KOFA 1NRPH 1E2FA 2R3UA 1GL6A 1P01A 4PPQA 1F2TB 3FTQA 4GL2A 4DCUA 1VHTA 2PTCE 1N8OB 1C5UA 2PZFA 4YONB 3C1KA 1J7KA 1F3OA 4C0HA 5K7RA 1BHXB 1XTIA 2BCGY 1UTPA 1O2ZA 1HAVB 2P3TB 1IONA 1YRBA 4HB0A 1J90A 3FZDA 4JLPA 2JKHA 3T5FH 3OTPA 1KMQA 2GCHF 3PV2A 1OJLA 2V9PA 4I1UA 1E99A 1EESA 1TPSA 2AKAB 1R5NA 2IW3A 4XSKU 4DW2U 2HNTC 1SGFG 2AS9A 1KY3A 4G1UC 1Z22A 1NU9A 2G4TA 3AASA 5C1BA 4AFUA 2L0XA 1NN1A 1DXWA 4CREA 1E35B 5IDVA 2F7SA 2ORWA 1BTHH 5BQ5A 4DLVA 1CKEA 4MRVA 3TE6A 2ZO3H 3GY4A 2C78A 4ERNA 2OLJA 1CJUC 2IYUA 4K8YA 4HDCA 5FOTA 2MSCB 1FW6A 3L43A 1Y3UA 3E5HA 5DISB 4LY6A 1S96A 1SVIA 4TQUS 5FBWB 1G3BA 1N5JA 4RN6A 1QL7A 2QUZA 4QGHA 5DG6A 1LKAA 4OS4A 3BIVH 4A0GA 1C4V2 3SJKA 5JI2E 3PUVA 2HLCA 4B2BA 2ANKH 5FHTA 4Y8ZA 1ABJH 1UTJA 1KY9A 4QBIA 2ZFQH 2BVXH 3URCA 2FSIA 1MBQA 1UTKA 1CS4C 1UCYK 3ZH9B 3KQNA 3ELAH 2W6JA 3B9PA 3SU1A 2BMGB 2O8FA 2NMVA 2FOCA 1E98A 3I32A 1NVVQ 3RMOH 4U01A 3NG1A 2CVFA 1SXJA 2Q1JA 1OWIA 2CHAC 3QTVH 4AG5A 3WBJA 4NYJR 3NVAA 2A5IA 4HTCH 4OHYA 5CK5A 5AUQA 2DWOA 4Q4LA 3TPIZ 4Q5IA 1G3UA 4C0LA 2ZVQX 4Q1AA 2R0LA 4HLUA 3LY5A 5FPHA 3GPLA 3P95A 4OL0A 1TWXB 4LJ4A 4OJKA 4JZFH 3TQCA 1G8PA 2ODYB 3W5JA 3PVSA 2DFTA 1RIFA 5JFGA 5F8XA 1O2XA 1L1NA 3GY3A 4ZHMU 4I8GA 2WPDA 1HQCA 3PEYA 1DAHA 2PV9B 5A8XA 2RHDA 4FMBB 1CRQA 4TL9A 3WBKA 3WMEA 3TW4A 5DKMA 2E1RA 1CEEA 2WOOA 3EA7A 1W8BH 3R20A 1WF3A 3C7KA 1CHGA 1SG8B 2PGQB 4EQ6B 1XCGB 4QXAA 1AUJA 1J2JA 1DWCH 2OV2A 1P03A 3H86A 1AN1E 2VH0A 1CJMA 3AH8A 3L0SA 1ELEE 2ZROA 2W83A 5M04A 2VU8E 2QP3A 1P06A 2Q6DA 3PUWA 5E95A 4IOKA 3CWZA 1KHTA 3OFNA 3SI7A 1E0SA 1OIXA 3H7OA 3CRQA 3AV0B 4QGAA 1J9CH 1U8ZA 3GEIA 3Q3YA 3HJNA 1OX1A 1CHOF 1YE8A 1TOMH 3LGVA 1A7JA 4M1SA 4IOLA 1MTNC 1NG9A 2WSMA 1E2QA 2ZI2H 3AVVA 3JZMA 1NRJB 2OFOA 4UFEH 5AJZA 2OC7A 4Q48A 3SNCA 1EAIA 3IILA 4KSBA 3OIVA 2ZR7A 1RFNA 3ZS9A 3KDSE 3CH4B 2DHRA 3BTME 4YTAA 4KLNA 1P2VA 1O2IA 1NY6A 3ZD7A 2XJ4A 3A8DA 3ZQ6A 2YWGA 5FTJA 2YZ2A 3S69A 5JCZA 3CZPA 1JJ7A 1OKXA 4A92A 4B3BA 3Q8XB 1DDJA 2ZPRA 1P04A 5HMAA 1P73A 3T1OA 3GEHA 3QNUA 1H8HD 4CEIB 5A09A 1G6HA 3VNUA 3BC1A 1ZYOA 4EFMA 5J4LA 3FANA 1LNZA 1UPTA 4TZ0A 2OC1A 1EX6A 1GVNB 1VIAA 3HGPA 1GHXH 1A1VA 1ZPCA 3FDIA 1AA9A 2VWNA 2XJ9A 5D3MA 5E7IA 2ZRKA 5FL3A 4WMDA 4ZHAA 4B76A 1J70A 2WWXA 4B3XA 2R3YA 3I8XA 3ZVGA 2FSGA 1HXFH 1WOFA 1JBUH 3D8BA 4OQXA 1UVSH 1GCTB 2FYRA 2R9PA 2O8EB 4MVNA 1GBHA 1O35A 3WY8A 3P17H 2K1QA 1E2JA 3SI3H 4IKEA 3VTKA 3SBDA 4D9RA 1CTQA 4ZKSU 3TSOA 5F2EA 1OLOA 1KLIH 2ZCLP 3MFJA 1QQ4A 4I32A 1VITF 2OZEA 1G2LA 3BJIC 3L0OA 2ZYWX 4PAQA 5KNBA 5CB6A 6CHAC 3PEUA 4B44A 5TMPA 4DLSA 2BD7A 3TK1A 3BH0A 4M21A 4LHZA 1UVTH 3TIFA 3UG6A 4OK6A 1AE5A 4I1VA 4LSGA 1O33A 3RXTA 1CR0A 2OE2A 1GJ8B 4B3DA 2R2MB 2SGAA 2ZTSA 1UTLM 1GITA 2FYQA 4TMZA 4LV5B 1XMSA 3U1JB 1GI5A 2VPPA 4L5BA 5CITA 2QAGA 2G1JA 4QBFA 4NG9H 3HYRA 1BUIA 1V2LT 1XEXB 3RLYH 1FY8E 1E2GA 3MLEA 1Z0AA 4C0SA 2HLDD 4Y7AA 2V3HH 3DM5A 1G3EA 3BIUH 4C0AC 1T0JB 3PV0A 4HAUA 4PPNA 2BD3A 2UVQA 1IM2A 2OILA 1T0HB 1ZNZA 4Y8XA 1ZC4A 1FV9A 2A0QB 4WZ6A 2CHGA 2RCNA 4FW9A 3ASZA 1V2WT 2JATA 3TLXA 1R2QA 4R0IA 5L3SA 4OQLA 5JHHB 5KHOC 1O2TA 5JWHA 4A2WA 4OK5A 1GBIA 4AG2A 2F1HA 3ECCA 4GVUA 1WRBA 5DI3B 2PLRA 1EZXC 1W2GA 1UCYE 4PHFA 3NZIA 5EP3A 2VBCA 3RXEA 2UUJB 2PZEA 2ILNA 4INLA 2XOKA 4RVCA 3F3YA 4M1MA 2FZZA 3SGAE 3GLHA 1WTHD 4TT3A 4QL3A 1GL9B 4PZLA 2FOMB 3TVJB 1XVOA 2A4OA 1X6VA 1ZRBA 4FVDA 4RFVA 5EQQA 3MJHA 4OI1A 4YMSA 3QF4B 1BIFA 2LPRA 1KSFX 2RGAA 1LS6A 4ZKEA 4AORA 4JLNA 7ESTE 1RVDA 1O2MA 3K0SA 4IEIA 1BT7A 1VCMA 2IOTA 3THWB 4WBSA 3ZGXA 1NSFA 2F9MA 4H6TA 1XUKA 4NYIQ 5KYKA 1SULA 3FHOA 4JVNA 3MNCA 1S83A 4AFQA 1T5IA 4UNQA 2Z9IA 3D62A 7LPRA 3ODFA 2QTVB 2ODQA 1NVVR 1HAHH 1SSXA 3SU6A 1JNYA 5FL7A 1E2EA 3LT3A 4ARZA 4RD0A 5LD2B 3VKWA 1E9RA 1EX3A 1SL3A 2C04A 3RXCA 1XXHE 1OHHA 5GJBA 3KCGH 1FY3A 2IUTA 2VHCA 4JLKA 2P5SA 4PSAA 4F38A 1AVWA 2G1KA 3VX3A 1RPZA 1ANBA 4OQMA 2NTYC 2ZJZA 1KAGA 3THXB 2VH5R 3N2EA 1A2KC 3Q76A 4JYUH 5GPIB 2CDNA 3RXBA 4C2UA 1PPHE 1YCPK 2UUYA 1QBNA 1SVSA 2QEQA 1Z29A 3NBXX 3PM3A 1E2MA 2B6HA 3RU4D 1IAQA 2Q3HA 3RSLA 1FTSA 1CGJE 2C90B 2FI3E 2NU1E 1FNNA 3LH1A 3H09A 2R8RA 3TJNA 3QI2A 3ZVNA 2Y81A 1CR1A 2OCPA 2WKQA 2OFXA 1OYQA 2BDCA 3QKRB 3BB4A 1XRJA 2EFHB 2ZZUH 2CXVA 4C2TA 3PB1E 4HLDA 4B32A 4RKJB 4DHEA 1GMCF 4XBBA 3LXXA 3AM1A 4MGZR 3ZVLA 2GBLC 1QDEA 1U0HC 2ZI5A 1XUIA 1AGJA 2GILA 1VCQA 1OXSC 1KDRA 3R7WA 4BTTB 1OS8A 2WV4A 4JYTA 2GD4B 1GKIA 2WSSA 4JZDH 3SJAA 5L3RA 2Z9KA 4IW3B 1HJ9A 4B2LA 1GHWH 4NONA 2J87A 3LBHA 1QJ7B 3MU4A 4V0LA 4DOQA 4PO9A 3ATWA 1P61B 3BH7A 1QL9A 2ZI3A 5HE9A 3SZEA 1TU3A 4IXMA 2OLGA 1TGBA 3TSZA 4Q7ZA 4R2HA 2AGEX 2GK7A 1BTXA 4KFRA 3T34A 1XUGA 3QG5A 2Q0HA 4Y11E 2PH1A 1D6RA 2J7PD 4IVQA 2JLZA 1OXXK 4FI3C 3H2YA 3HU1A 1TAWA 2ZFFH 4KO8A 4Q01A 1FIWA 1LQEA 3PUXA 1U9IC 1D6JA 3BEUA 1ELDE 2RGGA 5FBRB 4CBNA 1I4TD 5AUNB 3SHWA 1TNDA 1ZM3A 4ZH8A 1Y8TA 3DT0H 4FMCF 2CN0H 3UMSA 4BRUA 3PCRB 1F92A 1KSHA 3X1ZA 1QRAA 1XUJA 3Q3KA 4MUBA 4K1SA 4AYWA 2FDCA 1LVMA 2BBSA 3FFBA 3K6ZA 4OGXA 4NTZA 1II8A 5IK2A 4DDTA 2J2UA 1QR3E 3H5CB 5K8LA 2ZU6A 2ZIAA 2BBOA 1JR3D 4FXPA 1U90A 4LJ6A 4X6MA 1PLJA 3QIAA 2W6ID 1CSOE 3WYAA 1LTOA 2YINC 2IWRA 2V6IA 2V54A 1N3BA 5KPJA 1AE8H 2F91A 3MO3A 2XC0A 1YF4A 2HYDA 3U98H 5JSZB 1K8RA 2GJ9A 3R3GB 1SQ5A 1LO6A 1ZAKA 2XW9A 4GRAA 4PC6A 1QHGA 2CCKA 1V2PT 5EW2H 3CF0A 1W0YH 4AKHA 5JJLA 1JI0A 2HWLB 1E1RA 2FU5C 1EG7A 4XWKA 1KI7A 4M53A 2BEKA 2GCPA 2V6NA 4TYNA 1A0LA 2PZGA 3PMJA 4DKXA 5KNDA 3RXJA 2HDNB 2VP9A 1MUEB 4BFTA 4BRWA 5EP4A 2O0JA 1U94A 5BXQC 2D2DA 3VX4A 3IHLA 4JZIA 4NFEA 2BOVA 1UBCA 1DSTA 2XTTB 4SGBE 3U9AH 2Z9JA 1CBWC 2IPHA 2B21A 3ATIA 2NIPA 3F5FA 5HCNA 4D0LB 4MYTA 4XWOA 4WH8A 1W36D 1DG3A 1QHIA 1DVAH 4UKDA 1SHZA 2MMCA 3PWBA 3RP2A 3TK5A 2H7VA 4Q4AB 2BMFA 1P9RA 1YR8A 3GD7A 4IDQA 4H1UA 4UD9H 4TQ9A 1C2JA 3BERA 3F9GA 3VPKA 1K6MA 3EIEA 1TX7A 1RTLA 1NKTA 4NHOA 1BYIA 3CRW1 5KSYA 4ZKDA 4D82A 1A1RA 4HZIA 3BE4A 3I62A 2CJIA 2LCFA 1GDQA 3DVLA 4PC2A 3A8AA 3X2SA 4ASUA 1OYWA 2A7HA 4MRSA 4RD4A 1VCNA 5CDFE 1XMNB 1GI0A 3SUFA 3A4NA 3QOFA 5B6OA 1FQJA 1U8AA 3TK6A 5JBBS 3Q3JB 4XTCS 2PT7A 4D4JA 3DOFA 5IT5A 1XDBA 1GL1A 2ZJAA 2ZRLA 3CRMA 4RFSA 821PA 1UF9A 4MG3A 3NKVA 4KKDA 5EZ5A 4FU7A 2WINI 4Q18A 2G88A 2F3CE 3NH6A 2BVSH 1E9CA 1Q1QA 1YYY1 4GUXA 1PQ8A 2ANWA 1W0KA 1A82A 2A2ZA 4NYIR 1WBGB 2V7QA 1GI6A 1QB9A 1N8OC 2LKCA 2MSEB 4Z1MA 4ITRC 2KBEA 1RJXB 3SUGA 5FUYA 2ONKA 1KY2A 1KI1A 3EZ2A 1KO4A 4QJ5A 1RW4A 3T15A 1K1PA 1ZPZA 2GXQA 1SFQB 3IQWA 5DN6D 3GY7A 1MV5A 1E2HA 1WBDA 1GZSA 3SV7A 2GXSA 4P4SA 1QRWA 5DP6A 1QBKC 2ZEBA 3P27A 5DGXA 2BLVA 1E79D 1ZIPA 3TVDA 5FCKA 3H4MA 1C9TA 1CXZA 1NI3A 4TZ6A 5JEDA 1AKYA 4MNYA 1KXAA 9ESTA 1BS1A 3VNVA 2CV3A 4I8KA 1NBMD 2ZREA 1L7VC 2VVVA 2JIZA 4N0EA 4C0KA 3RLWH 2CBZA 4CH2B 2Y7XA 3EXAA 2Z3CA 3O8DA 2V8OA 1K1MA 4MKFA 2GV6A 2AGGX 4NGAH 1ZC3A 2H9EH 3UG7A 1E2PA 3RXMA 3S7HB 4GSYA 2O8BB 1BTPA 1C4Y2 4UFGH 1F6BA 2ZEJA 1G5RA 2GA8A 1F2UB 4AC9A 4FUBA 2XBVA 4OGYA 4CEJA 4ZXXH 3PITA 5AJXA 4B73A 2I4IA 2XTZA 1DAFA 4X2VA 3D23A 1GNQA 3R8FA 1UJ1A 1G6OA 2H8KA 4RCYA 2OBOA 1B7XB 4C4PA 1TUEA 1H9HE 1GCDA 1CVWH 1U2RA 4IVRA 3RDPA 3I5XA 2ZHFH 2UZ3A 3GLGB 1DX5M 4KSCA 1Q3TA 2I3BA 2ZS7A 2PWXA 3GDSA 4LPSA 3DL0A 1MU6B 1P8VC 4NKRA 5A8YA 2X2EA 3ZQJA 4EAQA 2MSDB 4XVUA 4P32A 1XD9A 1XMVA 1UKYA 2NO7A 1UHBB 4C7OB 3A7VA 1C9KA 2ONJA 2ZIQH 5KSZA 2VIOA 1VPLA 1RZ3A 5JRJA 3IEVA 3P26A 1TBQH 2R2AA 2IYSA 3IBGA 3IGFA 4INKA 3LV8A 1CA0B 3SE0A 4JZ1A 1Z08A 3MI4A 1JMOH 4LYHA 4NA7A 6Q21A 5AWFC 5EUMA 5LDDC 1EATA 4UDWH 4CBOA 2YWEA 3MTYA 4ABEA 4LX0A 2D7DA 4MITA 1Z6AA 4DT7B 3FYHA 3FKQA 3B8JA 3C5CA 2BHGA 2IYYA 4UXIA 3QWCH 1W2HA 3RUOA 4PQFA 2A45B 4M7GA 1P5ZB 1LQDB 3VQTA 3CR7A 3PUYA 1KDQA 3VMFA 5E8EH 1ELCA 1G8FA 1AFEH 4EDHA 4TL7A 2ZA5A 2N42A 2P8OB 3QXJA 4GT1A 1NPMA 2EI8A 2HXSA 3PV4A 1O5EH 1P9SA 5TXGA 2YOGA 4XH9B 1IXSB 4LXBH 4IDPA 2Y7ZA 3IIMA 4PO1A 2QXJA 2VWMA 2GXUA 1SQOA 1UBEA 1MO4A 1GJ6A 4DUGD 1A5GH 3SJ9A 3M6AA 3NBZC 3UNQA 4AG6A 1ELFA 3P6ZB 2WPHS 1TUIA 2ZHEH 1O5FH 3SJBA 3CZQA 1C5QA 1C1UH 1QB6A 3H84A 3UQVA 1ZJ6A 4D7GA 1IN8A 4BAOB 1G8GA 3I61A 1H9LB 4PANA 2P16A 2VHJA 2QMUA 4QBGB 2JAQA 2QSZA 4LHYA 2Z6BD 2ERYA 1W10U 1UVOA 1HAOH 3OEEA 1I4DD 3PQCA 3R8CA 4GZMA 4AYXA 3BFXA 4G01B 3BBPA 4UQOA 3UTUH 1EGAA 4B6FA 2TPIZ 1VMAA 2YWHA 2D8WA 2OBMA 2HF9A 2ZHWH 5E4FA 2O8DB 5J4HA 1XD2B 1SLWB 2XWBI 2ZSAA 1AGPA 2IJOB 3AAUA 2GBLA 1Q21A 4YC7A 5C18A 3T25A 2B8OH 3QVVA 2QXIA 2FM2A 1US8B 4WXRA 5JEEA 2A7QA 2HPPH 3BTDE 6GCHG 2PUQH 4FWTA 4FUHA 4UEHH 2G81E 2A5GA 1KIGH 4JL8A 5A0AE 4A8JB 2BDIA 1HRTH 2Z3EA 1S2MA 3W6NA 3BTEE 4DVGA 3FHTA 3MOCA 1C5PA 3B78A 1K5DA 1UEIA 3EPHA 4Q4JB 3UOUA 2O8CB 1NO9H 1TADA 1T8NA 4D4LA 1CA8B 1GCTC 4ZV4A 3AKEA 1W36B 1YZNA 4TMVA 1V2VT 2B7DH 3ATMA 2JLQA 2FI5E 3RM2H 1D2NA 5JCPA 2A5DA 1DE7H 3LFUA 1H1BA 3BTTE 2BV3A 4F92B 1SVKA 2G5VA 1DE0A 4QKQA 3EZ9A 5GNDA 3QSYA 1CR4A 1E2LA 3V4FA 4BZQA 3QVUA 4YQFA 1C5XB 4CF7A 4MRPA 1J17T 4G5SA 1YPEH 7GCHG 4K46A 1UKEA 3KJIA 2W3IA 3M4YA 5EZ6B 2GAAA 4AIIA 5F9HA 1DS6A 4K3JA 1ZW6A 4II7A 2RAPA 2FLBH 1XKAC 1JXMA 3PIRA 3UATA 3U7GA 5C5OA 3N70A 5IDKA 4I1SA 2BQWB 1W0ZU 4TL8A 3P8FA 4LDJA 1P9UA 4BFVA 1KK2A 3RVBA 2WMNB 1QHHA 3PO1C 1DVRA 3DOEA 1O2GH 3TNTA 3M3TA 1QJ1B 1GWNA 4Q21A 1KKLA 2ZDNA 4K1EA 2JJ8A 3PROA 4NIYA 4GMDA 4BEJA 2C77A 3VXEH 1BMMH 3LLUA 1GDDA 4A4DA 2W3KA 1O3JA 1P2IA 2A5AA 1OP2A 1KO1A 3TGKE 4YMTA 1Q1ZA 1Z8RA 1C1RA 5CK4A 1VG9B 4CRGA 3U2QA 2VF7A 4C0BA 2D2EA 3TJOA 1SHYA 1V2RT 3W5IA 4OS2A 2A78A 3AVQA 1ZINA 2ZU2A 5A2MH 2OCYC 3U8TH 4U32A 4URZR 2REXB 2BXUH 1O2KA 2VP2A 1XEWY 4QGGA 4BUJA 1ZTLA 2IS4A 2JJ1A 3NWUA 3MMGA 3AGPA 4W5JA 4XVRA 1ZYUA 3CNLA 1Y5BT 1W1WA 3SV9A 1MTWA 2QL6A 1A46H 4JZEH 3QUMP 5ELXA 4JLAA 2OM2A 1C2KA 1ELAA 1K5GA 5T6GA 1BYUA 2PTNA 2GCOB 3NDPA 4B71A 4MLFB 5E7MA 5LPEA 4RCZA 1D3TB 1E1QD 1O37A 2FP7B 2EFEB 3MWIU 3F68H 1P72A 4M2LA 3P8NA 1ZMJA 1FY1A 3TIUA 1J8MF 2ZAOA 2CHVA 3D3QA 4S2EA 3WP1B 1P9WA 3B1YA 4UONA 2ZYUX 1WXRA 4DCVA 3G5UA 2O0KA 4NYMR 4NCNA 4UJ3A 5CIQA 1YZGA 2CLCX 2IYXA 2H1UA 2GX4A 1NVUQ 2DB3A 1XVMA 4PSKA 1YLDA 1KK1A 1COWA 2KI5A 1C5YB 1G8YA 3BTQE 1VHLA 5JBTA 2ZRDA 4DZZA 4TLEA 1LVOA 4Z51A 3K53A 3OE7D 1XMJA 1IOEA 2A31A 3RMNH 5FUVA 5HYOA 3RMMH 1EAUA 4O97A 4ZKNU 5BW8A 5LD2C 4LJ9A 3LGTA 4NSVA 3NHAA 2XB4A 4M22A 1TQ2A 3EARA 2QQEA 4ZPXA 1PPEE 2FODA 5EPNA 1G7RA 4PZYA 4F7WA 1DLKB 4LC1A 1Z6YA 1XXFA 2OC0A 3AKYA 4NPHA 5DHFA 5GJWC 1VCOA 2NOAA 1HAYB 2QTFA 4I7YH 3KKPA 1W5TA 4D0GA 1F48A 5C46F 2H5CA 1Q2WA 5JMTA 3SFVA 4DIEA 1BRBE 3RAPR 2ZHQH 2H5EA 4EFLA 4KFSA 4NA8A 3SV2H 1F2TA 2P59A 3LQRA 3MYWA 2PLFA 4JS0A 3TAUA 1KSNA 1X7AC 3X1XA 5AK0A 1GJ5H 1HPGA 4M9ZA 1TA2A 4RSPA 1HAVA 1TQ6A 2ZRGA 3X1DA 1IHUA 1MO6A 4UNRA 5A0CA 5AUPB 2PMDA 4DJTA 3KJHA 2ANYA 3W6OA 4WJG2 1JAHA 2OBLA 2CHAB 3GJXC 3V4RA 3GQBA 4M9XA 5C1XA 1B0UA 2GJSA 5G3ZA 5K8UA 1W11U 2YHSA 5HZHA 1YR9A 4X8HA 2CE7A 5B6LA 1AKSA 3SQXA 1QZXA 3TUZC 4BTUB 2FEOA 3A82A 2VF8A 5F9FA 3U7EB 4E05H 1VZQH 4MGKR 4ZKRU 1Z8FA 1NG1A 1TMKA 1WDTA 4Z54A 2SGPE 4YLQH 5JB9S 3KQCA 2ZTYA 1PUIA 2CLSA 1BOFA 2IS1A 2GGVB 1N0WA 2BY5X 1SGWA 1SGYE 1LDTT 1M34E 4ACBA 3W95A 1FUUA 3DPUA 3NTUA 5HKKA 3IG6B 1DBSA 3UY9A 3C27B 2NGRA 1TONA 3AAVA 4Q80A 2JH5D 5FR1A 1T32A 1XD8A 1YPGH 1KK0A 5BN5A 4RD6A 5EXXA 4F93B 3BXZA 2VP0A 2VJ1A 1W14U 1XJCA 1ZJDA 2DFNA 3KKQA 4IMQA 1T6NA 1P2UA 1L0ZA 2PUXB 3BB1A 1HV8A 1BRUP 3CLVA 3NHBA 1ZNYA 2WTUA 1E0KA 1F0SA 1TRNA 1OWHA 4M9FA 1MTNB 1C5TA 1XXDA 3MWYW 3OHMA 3FMPB 1Z8IB 2BVRH 2ZI9A 5H68A 3M3SA 5EODA 4FU8A 1OFUX 6ESTA 3REFA 1NLFA 2WPJS 2NO9A 1NMZA 3GJ6A 4XWAA 3L0PA 1BB0B 2RMKA 1YPMH 2IEZA 4UNSA 2VSOA 4EQ6A 8GCHF 4QT8C 1QHXA 3RANA 1OP8A 1FX0B 2D62A 4BXSA 1AQYA 2O9QA 2OEPA 2GTPA 2FPKA 2CL7X 1UO6A 1OXGA 2XZLA 1ZNXA 3C14C 4DSOA 2IS2A 1XEFA 4C9BA 5ABWA 1P2KA 2G9NA 3F1SB 1FP7A 4DLUA 2AWOA 2CF8H 3GLIE 2ZRFA 2OLKA 4AFSA 1K28D 4TMKA 3S0NA 3A8TA 3RSOA 3TNSA 3HYTA 1KNXA 2BZAA 5KTYA 4R7ZA 1TNKA 2H1LA 4DC9A 4JJZA 1IJFA 4X0WU 2IYRA 1AY6H 1SKYB 5G3YA 3U8RH 2ZUBA 2C4FH 3QE0A 2BY7X 4Q02A 5AR1A 4XSGA 1EPTB 1O3IA 3ZZBA 4Q1EA 4D4MA 1DANH 2RH5A 1E38B 3EA8A 4ISIH 3A7ZA 2OBNA 1U0JA 3PUZA 1HCGA 4H1VA 1EWQA 1G18A 1GBKA 4JMYA 1MU8B 1BZXE 2WWGA 2Z9GA 1U6QA 1C2MA 1E96A 2ZI6A 5EE0A 4XOIA 4K60A 2FPLA 2ZJ2A 2ZF0H 2NU3E 1KZ7B 2FSFA 1HB0B 4IC5A 5F03A 1FY5A 1ZD8A 2IYLD 3NXSA 1NLZA 4PROA 1KDTA 4M9SA 1QVRA 1GPZA 4IDNA 2WWIA 4BNRA 1GOTA 5FOVA 1Z07A 5BWMA 4CEIA 2ZTXA 4TTPA 2ZYTX 5LB4A 1OP0A 4KITB 3Q72A 3U60B 2GEDA 1LHGH 1SBWA 2P65A 3SNDA 1EXMA 3G0HA 2RA0A 4ZHLU 3NXPA 2IYZA 1LTQA 2X1VA 1O0DH 4V0OA 1SGPE 2BOHB 5ETXA 4RKEA 3K9GA 2H16A 5EXSA 3F8TA 1AWHB 1OH5A 2HT1A 3QY0A 4DCDA 2ASEA 5FBQB 4Q1FA 1CP2A 1WAYB 1Q1BA 2YC4C 4B6EA 5BYKA 3SBKA 3MWJA 2ODEA 4X6OA 3NDBB 1OOKB 3FE2A 2WPLS 1F5RA 3HGNA 3QF7A 1O3YA 4OI4A 3TW8B 4MNXA 4IFBA 1BMAA 2BY9X 4NCIA 1GGDB 2ORVA 4BTIB 3SJCA 2I6QA 1NNEA 1D9XA 3B7GA 4TSFD 1OFHA 2STBE 4M4SA 3V7TA 1TPOA 1RKBA 1A3BH 1GJAB 3AKCA 4FCVA 1E9BA 3CS0A 4ACAA 1GJ4H 1E4VA 4HATA 4GAWA 5TCCA 2PLXA 4Q66C 1O3MA 1CULC 4X8TH 4Q1CA 1PPZA 3QJYA 2FX3A 4B3GA 1C5LH 1N6IA 4A9AA 1R0ZA 2BEJA 2FV8A 3MMPA 4AWXA 3VFDA 1MCTA 4Y8YA 1HIAB 1XEXA 2YV5A 4PZZA 2G3YA 2KBFA 1P2TA 2P94A 2JLRA 1T31A 1KSGA 3VFEA 4NCHA 3RYTC 5DYIA 3RXSA 1QHYA 2FFQA 2PMKA 1W7GH 3M37A 5JPMH 1SLVB 1KIMA 4BLPA 1K1JA 2F9BH 3KJEA 1MOZA 3JVVA 5CHAB 2GZ9A 2GCTB 5JB8S 1H8ED 1MQ5A 2WUCA 1YZTA 3ZD6A 1GMHF 5LPRA 1P11E 4YMWA 3HK6B 3TITA 1OH6A 1E3MA 3WNDA 4KXFB 4PQYA 3WXMA 3OIWA 3ZVEA 2GCHG 2AK2A 1GL7A 1SVMA 3LJOA 1ODFA 5DI3A 2WJHA 5TJXA 2EW1A 3MHWU 5FH9A 1RRKA 3FP6E 2FDAA 1EZUC 3K2UA 3L6PA 2J38A 1E4YA 3WHKA 1L2EA 4M1KA 3LBIA 3U4QB 1UAAA 5DP3A 4E7NA 3MU5A 4Y71A 3AF0A 1NY22 1OWEA 1TNIA 2XBYA 1ETSH 2KWIA 2QF0A 3SYLA 5DLQC 1C2FA 2ANMH 1P2QA 2BDYA 1E37B 3M5NA 3E1SA 2FEMA 2XRCA 2IA5A 1O2SA 1GBFA 3QF4A 4E09A 2XXAB 2FOLA 2JDID 5KDDA 2QE7D 1GL0E 1E0JA 1H65A 4FUGA 4KVGA 1CA0C 3THWA 4OHWA 1W5SA 1Z6EA 4W9MC 2H92A 2WYJA 4HDQB 3VR3A 4BFUA 3SO3A 3LKWA 4JVMA 2YOFA 3QGJA 1TQDA 3M1IA 1E6CA 3D7MA 1X86B 1K21H 3I4LA 4CYMA 4BFSA 1GI2A 1IOZA 3T12A 1OV4A 5EGMA 2Z4RA 3F6UH 3R0FA 3CENA 3SUEA 4A6LA 2FJUA 1QRZA 2HJGA 2J45A 2VWLA 1EB1H 3AGQA 4AI6A 4PR0A 3AP3A 3O8BA 2THFB 4CRDA 4F4JA 2XNDD 1ZGIA 4R2IA 4D6PA 2P8OC 4URUR 1T8LA 1XCPA 3MFYA 4HAZA 1TB6H 1D9ZA 3NK8A 1ZPBA 3UWJH 1BTYA 2XNSA 2NWNA 3IQXA 3O47A 5TY0A 1Z8GA 2AFHE 3I92A 4THNH 3THXA 3JZAA 1HXEH 5L6NH 4MPVA 1AMHA 3E16B 1NESE 1X8LA 3ASYA 1O3HA 2STAE 3AVWA 1ESBA 1GFIA 4NU0A 1XUHA 3SU3A 2GDEH 2AMPA 4IC6A 1QURH 1GHZA 1P10A 2Y6TA 2GWHA 1ZSJA 5L2ZH 1DTSA 3EIHA 1E9EA 1C1PA 2F9NA 3OY6U 1GRQA 3DKPA 3A4MA 4FXGH 4Z6AH 3ZV8A 2VINA 1Q12A 1LF0A 1LW7A 2X77A 3QKRA 3VR5A 3BOSA 1P02A 3V3MA 1FI8A 1FTNA 4ZDWA 3RRNA 2J3EA 3LW7A 3E2IA 2FS9A 4F4IA 4FCTA 5HGGA 1ZTKA 3LPRA 4K8BA 2VTKA 2ZSFA 4J0QA 2AXPA 4DIDA 5FPTA 4YZUA 2G6BA 3W3ZB 3BTHE 2XEXA 3QXXA 3TJZA 1Z2CA 1N6KA 4JYCA 3TQFA 3FFGA 2GK6A 1NIJA 1S0UA 2HT6A 2Z9LA 1BKDR 1AIXH 3LC5A 2R6CA 5L3QB 2QMHA 2RGXA 2B5TB 2ZAMA 1CHOG 3RDZA 4KHZA 1C4U2 3D31A 4IOMA 3QKSB 4DEYA 5JECA 3U7FB 1XTSA 2IEYA 2QMEA 1GJDB 1I2MA 1HJ8A 4A8JC 4QHTA 3EW9A 3TKLA 5EU8A 1X1RA 4JLMA 4PPGA 1QHHB 4F49A 4P33A 1MD7A 5CM9C 3TGIE 4POAA 3EDXB 1M6NA 1SPJA 1KXBA 3BN9A 2B8TA 5HM2A 3ZVFA 1ZNWA 2QBYB 1W36C 3RS4A 3B1ZA 3ADDA 4ABBA 2KAIB 4B43A 1J8YF 2VSXA 2R6AA 2YYZA 2HF8A 1V2TT 3RXUA 2BKEA 3P4XA 4M1WA 5JI3E 1J15A 2EU8A 1Z3IX 1DUAA 5BYJA 1X8JA 5HPYB 2F9OA 1YPHE 2OP9A 1C1TA 3LGWA 4FUJA 1BHXF 1QVAA 1UVUH 4BLTA 5HXFA 3H7TA 2ZJOA 4I8JA 5FPYA 4KGAA 5EXLA 4LZZA 1BMFD 2ZDVH 4BZXA 1GG2A 1AI8H 2DYKA 1THPB 4WXPA 3Q00A 4WWYA 6LPRA 5F3WB 3IPXA 5SZKB 3CRRA 3KGPA 2VQSA 2WZQA 3SJ8A 5C1YA 2JA1A 1GRRA 4Z8YA 3LVQE 4SGAE 3SJZA 3U44B 2ODNA 4WMFA 4LBZA 1E32A 1IQPA 2BDGA 1ZM4A 1EFTA 2WAYA 1V2JT 2NU2E 4V0MA 4F4CA 4M9QA 1IN7A 4N0DA 2REBA 2XSZD 1P3JA 5JSZA 1B23P 1CJVC 1G2MA 1VITG 1BTUA 2QXHA 4GDFA 4X8UH 2F9VA 1SXJE 4OQFA 1RIWB 1JALA 3OTJE 3VGCB 1W4RA 1OWKA 1TF7A 5AFZH 4JKIA 1JJVA 2BJWA 3CH5A 3PV5A 2Q6GA 2F3TA 4ABYA 4HAYA 2ZC9H 1HT1E 1JIMA 1ZP6A 3WHLA 3PYHA 2A5YB 4LOYH 1P9NA 3L8YA 4CRAA 3TUIC 2XCFA 4NL4H 1G36A 4TL6A 5FI1B 1M7GA 1V2NT 4OM9A 1IQHA 2OHFA 2HOBA 3GMTA 3QPWA 1PLKA 4DXAA 1QF9A 1N6YA 2PX0A 1XWIA 2ZXUA 4KJZA 3PEWA 1JWTA 2HLDA 2SGFE 2BYAX 1FMLA 221PA 2FGJA 1UKZA 1P75A 4US2R 5A4JA 4GSOA 4Q4AA 2ZS8A 3KUCA 3QTOH 4HEJA 2VP6A 4IXNA 3TBKA 2WICA 1YR7A 5AVDA 3SYJA 1TF2A 4BANB 3TH2H 3IDQA 4AFZA 1Z1JA 3SNHA 2BDBA 3CF6R 4FINA 5HR5A 1CGHA 2A5JA 4P3YA 1N6LA 3D6TB 4OS6A 4BFXA 2QORA 1JXPA 1INCA 2XAUA 2AN9A 3TGPA 3PJRA 4DY7B 1LPKB 2UWPA 1PJRA 1AUTC 1EP6A 1GVLA 1S8FA 2GMTB 3LGYA 2WWFA 2IHYA 2Y8EA 1P2NA 2ZPSA 2XB2A 1AKSB 1T4UH 3HKJB 3HPQA 4DGJA 2G8TA 3MSXA 5UKDA 1CT0E 2CF9H 3UIRA 5B57C 4CRWB 3QK1A 4O3UA 2WJJA 1TALA 2XCNA 2WVJA 3MU8A 1NLYA 2HRVA 5LPNA 1MBMA 4E07A 4HI3A 4BFWA 4EPTA 4NZQA 4A7IB 5EQSA 2Z0MA 3GCTF 1ZUIA 4I99A 1PQAA 2IXEA 3CNOA 3FVQA 4NZLA 5E2OA 4BXWA 3Q9LA 3T35A 3I73A 2B7BA 4ESVA 2ZDKA 2F1RA 5DPAA 2QENA 2YWFA 1T9HA 1O38A 1FMJA 3X1WA 1TFXA 4IEEA 3EASA 2GVFA 4X2WA 4B3CA 1NL3A 4LZ4B 4BLSA 1R7RA 4L15A 1KI4A 3K0CC 3ICEA 2V4ZA 2OBQA 4YLGA 3E3TA 1G4AE 3I5YA 3KQLA 1BTWA 2TIOA 3TJVA 1O31A 1O3BA 4YESB 4CIDA 1J14A 2O8TA 2P3FH 3KFVA 4XJXA 2ESTE 1TEXA 2YC2C 4DIIH 2AFIE 3ETLA 1R5BA 2ZANA 1PQ7A 4NIVA 2BM1A 1UDWA 2J59A 1Z0FA 1B5GH 3BTKE 2XNIA 1QA7A 1XXHB 4GBMA 4NCJA 1LB1B 1ESNA 3UR6A 3QPVA 3SZNA 4H4FA 4LHWA 1FDPA 3RXKA 4Q7KA 1TMBH 2OESA 1BIOA 4HZHA 5BRRE 2O8BA 2BM2A 1VTKA 2IBMA 3VAAA 3E91A 4DVAU 2JJ2D 1F2UA 1S0RA 2NO0A 1C1QA 3KHVA 1H9IE 2OXCA 5EG4A 3AP2A 1C1MA 1P05A 4XOJA 3CO5A 4MRRA 4L4UA 1FP6A 1NROH 3ZVDA 4TTRA 3N2IA 3J81k 3T1TA 2A7JA 2VRWA 2Z3DA 4DBLC 1E9DA 4Q03A 2QPTA 1YJ5A 1ZHPA 3ZZTA 3BWDD 4DCSA 1O2RA 2CMYA 1XX9A 3RRYA 5J4SA 2XTMA 1YR6A 1XJQA 1O5DH 4PTLA 3RXDA 3MGCA 2VVUA 1O2UA 1WB9A 2N1BA 3GLGA 5AJYA 2Z43A 1HAXB 4A1TA 1C5RA 1ZMXA 1K1OA 4O3TA 3NWJA 4AD8A 1MTVA 3QZRA 3WRYC 1DM4B 1GMCG 2CGAA 1C2IA 1EASA 1K1IA 4ZMAH 1JOUB 1TPAE 4PHTA 3ADKA 2H17A 1UHBA 1A61H 2IS6A 4C7OA 2NG1A 1UBFA 3ATLA 4LCBA 5L30H 2J9RA 1JBKA 1V2QT 2ZDAH 4GCHF 5SGAE 2P6UA 1WBBA 2BWJA 2VYFA 1HEIA 4Y0YE 2EYUA 1Z0JA 3A58B 1TGCA 1XTQA 3W34A 4A15A 2V1XA 1AU8A 2FA9A 4MDEA 2IX3A 1C5NH 3A7XA 2C3SA 2GEVA 1L1GA 4AB9A 2FWRA 1V2MT 4A1VA 4TMTA 2R6FA 1G8HA 1OSSA 4LGMA 3THYA 2AMQA 2ODPA 4GMXA 2ZFRH 3RXLA 4IS5A 5LBIA 1SZPA 2RB4A 4ISHH 2J7PA 2OXRA 1ZCBA 2CK3D 1C5VA 3CRVA 1DPFA 2A9KA 3CX8A 1T8OA 3E0PB 1Z6TA 1TQ7B 1XTJA 2P0EA 3GLHE 1GDNA 4B75A 1QNJA 8OHMA 1WUNH 4CGZA 3WYGA 2AIQA 1F5LA 3NPSA 2FH5B 1MT0A 5TV2A 3ND8A 4GOKA 3EC1A 4MKGA 1T4VH 4M1YA 2TGAA 1HT2E 4OBEA 2WWYA 3DM9B 2BX3A 3KZ1E 1EPTC 4TYYA 2YKGA 1HE1C 1TRMA 1JR3A 2A2QH 3VB4A 1C5OH 1HY3A 2W6IA 3A36A 2EFDB 2FN4A 3FB4A 3D65E 3KNXA 4XTRA 2C2HA 3RXRA 4NWLA 4NCYA 2ZECA 3FVFB 4DLRA 3SYKA 1ARBA 4TWZA 2PSXA 3T2NA 1TABE 3TH4H 2OFWA 2ZHDA 1N6HA 3HPTB 3SGQE 3MH4A 2Z4SA 3M0EA 1KI2A 2O8DA 3SORA 3GCGA 3DHWC 3A1TA 1XD2A 2GV7A 3GFPA 4A5TS 4WVFA 1HBTH 1E2DA 1KLJH 5G40A 3OEHD 3QEJA 1NBME 1US8A 2JLVA 3LA6A 1NN3A 2IC5A 5SZJA 3ZZ8A 4A8JA 1HFDA 4HLQB 1LHEH 4X1NU 2ZR9A 5DYGA 3T62A 4PPFA 3GYLB 4EPVA 3A85A 3PO1B 4AY2A 2CJWB 3GFOA 1C1SA 2P5TB 4Q4JA 3LGUA 1W4BA 2O8CA 4V03A 2ZJBA 5KDLA 4CR5A 4JBWA 1AZ8A 5EW1H 4ZCIA 4BE7B 1BJVA 1ZRHA 3B85A 2GTBA 1KO5A 2OXSA 5EXTA 5IHPA 4PX9A 5GJVC 1OXTA 4JZKA 4ZROA 5L2YH 5FTNA 1GHAF 1UTMA 2J46A 1C2LA 3LIWA 1O36A 1WQ1R 4E03A 2PHBA 2YOLA 2XGJA 1UJ2A 2FFAA 2TGTA 3B23B 3BTGE 1UM8A 3ZZ7A 4DB4A 1S81A 2HNTE 1GGDC 3AW1A 4A82A 2A4QA 3LONA 2GESA 3QGNB 4YT6H 2QNRA 1C5SA 4GHTA 2OINA 1BRCE 2ZU5A 3RNLA 2XWAA 2BY6X 1G7SA 4JJKA 3VR1A 4AYYB 3TNFA 1ONBA 3KKNA 4AKIA 4RJLA 2Q6FA 3DDCA 3KTAB 4RKFA 1LHCH 5BN4A 3LH5A 4DDUA 1DOAA 1EX7A 2FPMA 1GI9B 3GYMA 1UK2A 4TWWA 1AD8H 4XFQA 3EQ0H 5IRCD 1GKUB 1Q1EA 4DDWA 2BZ6H 5J4VA 4X8MA 2DE8A 1RJ9B 1NKSA 3NEJA 1AWFH 4EPYA 2J34A 4KP0A 1NN5A 3OAAD 1NJGA 2G51A 2X2FA 4O3MA 1D3QB 1HJAC 4QG7A 1DXPA 1BJUA 4A1FA 1G291 2WV9A 4E7RG 2Z5FA 1EWRA 521PA 1A2BA 3TR0A 1CO7E 2QA5A 1SR5C 4HUQB 4UNNA 1TBZH 4K8OA 5CHAC 3MD0A 3QEOA 1JB1A 2GCTC 3E70C 4IDHA 3K0FB 3V0XA 1CGIE 4AX9H 1QGFA 1W4AA 1M7HA 2ALPA 3SQHE 4FMDF 3UWOA 3L33A 3DZDA 1GI1A 4ABFA 2PKAB 2CE2X 5DN6A 1XBTA 1DWDH 2XX3A 1D2EA 2CLDX 4Q19A 2A32A 4HFPB 4X8OA 2VNTA 2QC2A 1V5WA 5C2JB 1E79A 4RD3A 1D3PB 4LOAA 1U8YA 3A1UA 2GCOA 3DMDA 4Y79A 3LNCA 1JRSA 1NBMA 1RC8A 4KBFA 2IUSA 4WMEA 3GJ4A 5JRZA 5FOSA 5AJVB 2IWHA 2WBLC 4Q9LA 3VU9B 1FLEE 3UPUA 1E9AA 3K70D 1N6XA 4V0KA 1VG1A 1KAOA 2QP4A 3WMFA 3RU4T 1R0YA 3RC3A 5CMXH 1EOLA 2YJTD 4Q4HB 1ZCAA 2Z7FE 3UNSA 4DB2A 5DP9A 1OWJA 4LK4A 1RRGA 3EG5A 4LK2A 1G4UR 4DWJA 3OZXA 4A0FA 1O2YA 1GHBF 4KU4A 5K8TA 4I33A 1NVXQ 2D74A 3E90B 2NO1A 1GVZA 4G3XA 3PMBB 1K22H 4FIDA 5CIWA 1VITH 2BLWA 1EXFA 3C41J 4MTBA 1BDAA 1DLEA 1MKYA 4HYYA 1S3SA 3I29A 3ZZ0A 2JLWA 2BQ6B 1Y59T 2FOHA 1DWEH 1NFXA 2V3OH 1P60A 1O2PA 1TMTH 4MYUA 4MDFA 2DE9A 3IIKA 3H0KA 4LYFA 1NRNH 5F98A 1HURA 3JZ1B 1DY8A 2FESH 3M35A 2QGNA 4B2CA 1SHKA 4EPWA 1WP9A 2BHRA 4U00A 1N5IA 3TH5A 1O34A 4A0HA 1UDXA 1G9IE 2OAQ1 2JLXA 1RTFB 1GBCA 1THRH 3A1VA 1OW3B 1UBGA 1OYTH 3AVOA 1XPRA 4QNMA 1SI5H 3VB5A 4XDEA 3LRPA 1UKVY 1DARA 3ZIAD 2IF0A 1Y3WA 1II0A 1RYHA 3W6PA 4YT7H 4FMDB 3ZS8A 1A4RA 4ZAEA 3CX7A 1C5WB 5LB2A 3BSQA 1YQTA 4DLWA 2WUBA 4Y7BA 3VB6A 3SQWA 3H1TA 1O2OA 3P32A 1QL8A 1UK3A 2CNWD 5FXLA 5LGOA 1FZZA 3LW8A 2V55B 4U02A 4NIXA 3VKGA 2FS8A 2WAXA 3RXPA 4F4OC 2O8UA 2A5KA 1V2UT 1QHRB 4MDSA 3QBVA 5KSPA 3KEEA 3BV9B 3QPUA 1O3FA 3RXFA 5KO2A 1PPCE 2AHOA 4FUIA 3S1AB 2R62A 1F2SE 4D76A 5HCIA 1TPZA 2P93A 1ZM7A 3TSWA 2G77B 4M1TA 1DT2A 1TNHA 4D2IA 4JLOA 2WV5A 1GBJA 1WTGH 1JXOA 1AS3A 4DUGA 3PFIA 4J2YB 4D25A 3WRXC 2QAGC 4DLXA 2FOAA 3WY9A 2A5FA 3U61B 4W5WA 2OO7A 2YNMA 2AD5A 4BWYA 1M74A 3Q7QA 5KSOA 5E0JA 1W44A 2HGTH 3MNBA 4O03A 3ZZAA 2D2FA 2ZU0C 2J0UB 5HE8A 4NE2A 1W2KH 4MGYR 3VB3A 2BIFA 4L9WA 4N3NA 4MYCA 3QXSA 4B3FX 2H18A 2W2TA 5CB8A 1MMJN 1ID5H 1MABB 2IYQA 3KL6A 3BORA 4BAMB 4LUCA 4TLBA 3QENA 2QCYA 4YM9A 4FU9A 4JT2A 3RS0A 3ZJYA 1AFQC 4QRHA 5CJ2A 2CMKA 5DK1A 4DSUA 2XZPA 3WNBA 1S9DA 2AFQB 4MNVA 4TPYA 3IWMA 4LPKA 2J7KA 1HAPH 5J4YA 1E9FA 3T1QA 1ZOMA 2V35A 2VHUA 5JHGB 3DFLA 4AYTA 1Q22A 2ZGCA 1UEJA 1YM0A 5DP5A 3ZZ4A 2H9TH 1IHTH 2QAAA 1GNRA 2Q9CA 1BOQA 2DCUA 5H70A 2BOKA 4Q9IA 2WJYA 2WPKS 1P2MA 4FN5A 3Q3XA 2PKSB 4DIHH 2Q3MA 1YRAA 3KQDA 1FX0A 3QN7A 5CLQA 4HAVA 4G5GA 2W2VA 2CHQA 2GRJA 3AF4A 3LO5A 4Y0AA 1GMDF 5FUWA 5T6FA 1GJCB 3TMKA 4RD2A 1RIWC 2PW8H 1E94E 4WZAE 3VGCC 5BN3A 2WM9B 1D2MA 2SGDE 4Z8XA 1DPOA 2VIWA 1M9UA 3BEFB 1F0RA 4CEHB 1XTKA 1T91A 1OXVA 2AXNA 1O3KA 2BD2A 5TB5A 2F9PA 5K8IA 2ZFSA 3I72A 4KV9A 2ZJ8A 1KJYA 2WPIS 4Y76A 3E0NB 3RC6A 4IRUB 3AVYA 4P0TA 4G0NA 4RY2A 4ABIA 1CIPA 2M5TA 2O52A 5DNYB 4KYUA 1YU9A 4BOHA 3MO9A 1EPTA 2FOFA 5AJWA 2AGIX 2C03A 1XEWX 2OK5A 1VECA 4DSNA 4YLUA 3LX8A 2J94A 1SHHB 3S9CA 2Q3FA 1B0FA 5E2PA 2ZPQA 4UFDH 2C93B 5EE9A 1WYKA 2ZE6A 1KDPA 3UKDA 5FBEA 3SDZA 1RE0A 2WWHA 4WW0A 4MPUA 1PUJA 1EAXA 5G41A 3EAQA 4NCKA 2F9UA 2EFCB 2HJVA 3ZLJA 1OB5A 4YO9A 1KI9A 2ZU4A 1OKKA 2D7CA 4KTSA 2ZQ1A 3SR0A 1IY1A 2VHTA 3M61U 4KODA 3SUDA 5EP1A 4LHXA 4BFYA 2GZ8A 1LY1A 2GMTC 4DRZA 2ANCA 5JWRA 1UVPA 3KQHA 1SKQA 2TGDA 1WSSH 1TGNA 3K0EA 4I1OA 1DY9A 3RXAA 3SQEE 2ATXA 3DO6A 3TAHA 5KDOA 1LKBA 4EJSB 3LOXA 2F43B 3KQUA 1E1QA 2YVUA 3V13A 1L8QA 3D49H 1KI6B 4I8HA 3K70B 1L4DA 1KO8A 4LRWA 3BF6H 1TGSZ 2VIVA 3RXGA 2D4HA 2C99A 5H1YA 4LZ1H 2C8ZB 1GKYA 2DPXA 1CBUA 2FE4A 2BMEA 2ZRMA 1KXDA 3KUDA 3QXHA 4YOIA 1FUKA 1QA0A 1EFRD 2WYGA 4B2PA 4G5OA 3MH6A 3MU1A 1I4LD 2BD8A 2GZDA 1Y3VA 3AK5A 4URYR 4ZIRA 1ABIH 2NQ2C 4CRBA 2ZETA 2J41A 1S82A 1TLDA 3I78A 1Q31A 2G52A 2ASUB 2OCAA 4JL5A 3CNNA 3AVTA 2LNCA 4CHAC 3OE7A 1MAXA 3U1IB 3K1JA 1VYUA 3MRSA 1XU4A 1IQGA 4L16A 1F7ZA 3W3AA 1S6HA 2P2LA 5A5GA 4HZUB 5KU1A 4HAXA 2PJRA 2ECKA 4P4UA 3AVZA 2KE5A 2ZNKH 2Y82A 3U8OH 2HALA 2Q21A 3G82C 3HATH 2FI4E 4PXAA 1H8DH 3NUMA 2R65A 1H8IH 3BD9A 1HIAA 4K1TA 1AKEA 4U7DA 4OS7A 3LGIA 4ZXYH 1YHNA 5C4GB 3MWLA 3BGWA 4CT5A 4MKHA 2PGBB 4M8NE 4ISLA 1ZTJA 5EXNA 4GFDA 2V1UA 4HGCA 3B1XA 3GJ5A 1NIPA 1L1JA 4A2QA 3ESTA 3CM0A 4OHVA 2BB4A 3CONA 1E0FD 2GNOA 4ISNA 2X19A 3ONWA 5E7JA 3V9PA 3TUJC 2J0SA 2GETA 1ZSLA 4WAUA 4PO8A 1ELTA 2B8WA 1TRYA 4QM6A 1EAWA 2J4IA 4GPGA 4OS5A 1QHSA 1TX8A 2QAJA 1PPBH 3T5DA 2RHMA 1OXUA 1GJBB 3THYB 3KXKA 5FPSA 4TN1A 3KF2A 4O25A 3GDUA 2RGDA 3W90A 1JQJC 2BMJA 4MYHA 1VYVA 4BLQA 1AQ7A 2GKVE 1Y3YA 3PR1A 3K9HA 2ZRAA 3NC1C 3UMRA 1DG1G 4CZ2A 1SVOA 3U4QA 3FMFA 1IXRC 5J5CA 4RI0A 2DWPA 3GY2A 2FLRH 3QDZB 2R44A 1K1NA 1LHFH 1XF9A 1YZKA 4OJQA 1ETTH 2ZI7A 2VO1A 5AFYH 1MKWH 2DWQA 1G21E 1HV7A 1P2OA 1WMSA 3AF1A 1O3LA 2XXAA 4OHXA 1PPFE 1MO5A 2ZE5A 3B5JA 4C0JA 1VCWA 5DP7A 4K5ZA 1G19A 4XSHA 1K2I1 1RFLA 3QUSA 2EI7A 1KMHB 1YKSA 1JPNA 3SNEA 1SGCA 2ZRJA 2D06A 3TVTA 3T29A 5GVSA 4GNKA 2B7CA 3LLMA 3AVPA 1FL9A 5DO4H 2ZCHP 1D8TA 621PA 4PHGA 1WCZA 3RC5A 3G01A 5JLJA 1RXPA 1M1YE 4PAMA 1FOEB 3RS7A 2FTLE 3RC8A 1GBEA 1VCIA 1GUAA 1SGIB 3UR9A 3FKSD 1JRTA 1MR3F 2ATVA 2O8LA 1EUFA 3C5HA 3UUZA 2IN2A 1NJFA 1TMUH 3B9FH 1ZHRA 3N5CA 3RC4A 4MKIA 2G5NA 1EOJA 1O2LA 2JETB 4XD7D 3A89A 1S0QA 2OQUA 4B47A 4EPXA 1W0JD 5EXPA 1QIXB 1OB2A 4KELA 3AEZA 5GADl 1YP9A 3K65B 2A1DB 5FBIA 1GM5A 1N0UA 2EI6A 2XTNA 1E0AA 1A5HA 2FMXA 2QF3A 3ZVRA 4AKGA 4I31A 4HDOB 1CR2A 3SJOA 2UWOA 3T06B 3FMOB 4WXVA 1DFPA 2JH6D 2C8VA 1DSUA 1Z5ZA 8GCHG 1OE0A 5FOWA 2J95A 4TLCA 3SNBA 1TIOA 3DEFA 4BAKB 1O3OA 3KKMA 3VR4A 2FZLA 1SB1H 1A0HB 3GEEA 2C9OA 1TEVA 2WKRA 1U9IA 1O5CB 2FOEA 1KTVA 2ZRPA 3M5OA 1IQLA 1G3MA 5JBQA 3I3SR 2A4GA 4Y10E 4R9UC 1FN6A 4V02A 2TBSA 4O9VA 3ZDQA 1R4AA 1SOTA 1DICA 2FX6A 2QY0B 1OT3A 3GLIB 5DI9A 3SJIA 5L3QA 2Z6VA 4PAOA 4QC2A 3RM0H 3U6KA 1JQLB 3QKSA 4JMPA 1KGDA 3SHCH 4B35A 1GWAA 4JK6A 2NU4E 2A2XH 4JT4A 3QXCA 1P3EA 2QPOA 1BITA 3HU3A 3HP1A 1BQYA 4PC1A 4WXIA 2Y5FA 2QBYA 1A3EH 4L9SA 3NH9A 3FAOA 1OIVA 5JJIA 2KAIA 1RRPA 3ZZDA 4JK5A 3URDA 2WPMS 1IY2A 2XXLA 5DSZA 3W9YA 1ELVA 1V2OT 5KPDA 1S84A 1VGCB 4KBGA 2H2ZA 4D9QA 3ZV9A 4Y0VA 3BIFA 1OKKD 4E5UA 2UWLA 3ZYCA 4G5QA 3IITA 1JEEA 1P3CA 1W7AA 1ZVQA 3LWNA 1WCV1 3BRWD 1SFIA 4DJZB 2QYIA 1IQIA 1Z71A 1FAKH 1AS2A 1ELOA 3ZVMA 1Z7KA 5GIBA 1PJPA 2ZR0A 4LJ5A 3U7HB 1Z6JH 3LBNA 1ZMLA 3GY6A 2F6RA 3BH6A 2R0KA 2VSFA 5E3HA 8KME2 3AVXA 2A3RA 1V2KT 1P09A 1BRAA 1P2JA 3Q7PA 5FPKA 1D4PB 4LV8B 4AZ2B 3LVRE 3U44A 2IYTA 3OESA 3B1VA 1SC8U 3VXFH 4FD2A 4TLDA 1MH1A 1IN6A 2D26C 1ESTA 3ZVCA 1C1OA 3SN6A 2GZ7A 1T3LA 3MG9A 3EAJA 2V6JA 1C2DA 3M7TA 2YNAA 2PFEA 2W6JD 4O2RA 4YMUA 1N6RA 4MQAA 1DS2E 2JLSA 4DLTA 3WNCA 4AN7A 5FTMA 1SXJD 5HM9A 1YCPM 4D7FA 3K0AB 1NP6A 3F9EA 1GJ7B 4TSFA 3U6BA 1TQ4A 4TLAA 3A84A 1AB9C 1K1LA 2ZGJA 4KAXA 2ZI4A 1DAEA 1EZSC 3GJ8A 5FCRA 5JS7A 1II9A 2SNWA 1NSTA 2J0VA 2GCNA 3MNXA 2ALVA 1GHYH 1XTRA 3ZVBA 1C5MD 4X8VH 2QRNA 1O32A 4IGDA 1TGTA 3ICQB 4AK9A 3STJA 1DITH 4HLCA 4PQRA 4RZ2A 2ZFTA 3PLBA 2QI9C 2WPDD 2YNBA 2ZDLA 2V0BA 3A6PC 2VIDA 1QBOA 1V2ST 1DEKA 3HWSA 4ABDA 2CEAA 2C8WB 4CR9A 3A7YA 5B58C 1H8EA 4Q7LA 1P6XA 4D26A 1ZHMA 5DGJA 3ZZ6A 4KLZA 1GMHG 3UOPA 3UANA 4OHZA 2F3RA 5DIFA 1TTTA 4JVSB 2ZQ5A 4CRCA 1XX6A 2QXGA 3OFND 1XJ0A 4RD1A 1G3DA 4Q7MB 3CBQA 1O3CA 3BEIB 3DD2H 2GP9B 3A88A 1XM1A 1GILA 4H9GA 3BFVA 4P4TA 1CLUA 4OKSA 2GHIA 1S4QA 1G20E 4GP7A 4QM7A 4ILEA 4MGIR 1PFXC 3MAAC 3CW2A 1KYNA 1LVYA 2UZIR 1E36B 2EVWX 3A1SA 3RWOA 1I2DA 3Q5EA 2PR3A 1IAUA 2J0QA 4TPIZ 3PEVA 3AB3A 2JDIA 1NU7B 2QE7A 1VR1H 2BDAA 2LWIA 1KI3A 2VL7A 1HAIH 1BH2A 3CX6A 4I8LA 1ETRH 1W4CA 1G3RA 4HSEA 3BB3A 3A86A 4JSTA 3CWQA 2O5VA 1KXFA 2EC9H 2ZVPX 2PJZA 1PPGE 2H57A 2PT5A 1O3AA 1JIRA 4JCNA 1IQFA 5CLLA 1JR6A 1WU1A 4BAQB 2EWVA 1G64A 2SGEE 2GAOA 3P92A 1T4GA 2RKOA 3R9IA 3Q5DA 3MU0A 5PTPA 3QKTA 4RZXA 5FTKA 3P8GA 4LI0A 2XNDA 2VWOA 2ORIA 1N5KA 4LJ8A 3BG8A 2TGPZ 1YKTA 2SHKA 1SVLA 1XXHA 1HUQA 2OSBA 3EA0A 1C1WH 1AS0A 1HLTH 3AP1A 2ZRBA 3QBTA 2IUUA 5KUTA 2BXTH 1Z1IA 2PEZA 2JCSA 3RRZA 4ZI2A 4B2IA 1O3PB 3TLOA 4U30A 4G5RA 1Z47A 2C9CA 3UWKA 1ZIOA 2AERH 1Z0IA 4PHHA 3PG5A 2QN6A 3PMHB 3X1YA 2ZPTX 3GLFB 8LPRA 4BASA 5JBAS 3WP0A 2TRMA 2KJQA 3ADCA 2VGCB 3BG4B 2VP5A 1CT2E 4CT4B 4QHSA 1ETUA 3BS4A 1ZUNB 2BTCE 3TGJE 1W12U 4DT1B 4US0R 1HA3A 1P57B 1Z28A 4Q1DA 1ZM9A 4IBLH 2BM0A 1O2VA 2G00A 2VH6A 1ZM2A 3PTBA 3SOSA 1YZUA 1O87A 2OQ5A 2YOHA 4GOXA 1SGNE 3L8ZA 4GP6A 4QJ3A 4ESTE 2V3CC 2IL1A 3NBYC 2C9YA 5H8WA 4P31A 3GY8A 2ZITA 3GJ0A 3GJ3A 2ODWA 5DHAA 1GI4A 4TYDA 2J1LA 2P6NA 1WQSA 2FX4A 1ESMA 5GXPA 1IJEA 1AGRA 2F1IA 1YZQA 3DKVA 2DBYA 3CPJB 2O8WA 4JVLA 3SHFA 2AH4X 1DELA 4EUNA 1C5ZB 3B82A 3U69H 3T1VA 4KCGA 4UJ5A 1IY0A 4RZUA 5FR2A 2PKSC 1G9XA 1W46A 2QU8A 1OPHB 2GKSA 2JLUA 1L4YA 5GVRA 5LPFA 4F91B 4D4KA 3BFKA 1N25A 2OCVB 2QN5T 4LBVA 4I81A 3ZZ5A 3HU2A 5JWOA 4FMCB 2FF7A 3K09C 3A8CA 2OTVA 1RD3B 4NWKA 3T61A 3RS2A 4BECA 2IXGA 2HCBA 1RS0A 1BMFA 4B2AA 2F55A 1G5TA 4VGCB 1O5AB 1G16A 2XOKD 3LD9A 3OIUA 3PXGA 4TT3D 2ZSBA 1KJZA 3EZ7A 1KKMA 2AL7A 2I1QA 2F4LA 3A87A 3ODDA 3AQ4A 2GZHA 1DAKA 2AYWA 4UFFH 3PTNA 2AR7A 1KI8A 3IHWA 1S3GA 4ZI3A 4XBDA 4LYJA 3VR2A 3LAWA 1M2OB 4WA7A 2I1VB 1SVPA 4M1OA 2H9HA 4NP6A 2QY9A 3UIEA 3FHCB 2WJGA 4ZO4A 1C1VH 2XSZA 1C9PA 3A1WA 4KFUA 3LU9B 2ZE7A 2JH0D 4ZIRB 3R9XA 3L2OB 2NU0E 4JKYA 2O8FB 5FL7D 1IQJA 4A6PA 3E1XB 1AK2A 3KX2A 4YXWA 3GP8A 1XB2A 3IEUA 1BBRH 2X8AA 4Q1BA 1SXJB 4FUEA 1PYTC 1G37A 2ZRNA 3LDXH 4UXJA 1OHHD 5TVKA 1EJMA 2ZTZA 3SN8A 1HQYE 1WV7H 4JLBA 1SQTA 1UMAH 4C0QC 1R6BX 4LJAA 3GCNA 4IOJA 1UK4A 3IIJA 1MTUA 1KXCA 3ZZCA 4EJSC 2G4UA 1H4WA 4AYVB 2ZYVX 2CJWA 3MUFA 4H42U 2FPZA 3K70C 1HJAB 3SV6A 2HXYA 4HAWA 4FCWA 3VR6A 1GP2A 3HDTA 1IXZA 1TNGA 5P21A 2Z83A 1W47A 1XMIA 4AB8A 4NYMQ 3S9AA 2A7CA 2B92A 4R71A 2EYQA 4WVPE 1XUFA 3DMNA 4KFTA 4AURA 3HPRA 4D81A 5IF9A 4N1AA 1AVGH 3SI4H 4CW7A 4MRNA 3KFXA 1QG4A 4JLVA 2ZU3A 421PA 2GJKA 1N0VC 4MPWA 1U99A 3AKDA 1KDOA 3V12A 4O0MA 3CR8A 1G17A 1ZBDA 2DUCA 5FUXA 1PZNA 2FWWA 3KTAA 1OSNA 2BKUA 3SNAA 1F0UA 3B13B 4JBXA 3B2EA 5LH8A 1Z2AA 5CDFA 1MKXH 4YMVA 3VB7A 1RJ9A 2WSSD 2ZM5A 4INHA 2AIPA 3L3TA 3GCHB 1BMNH 1NN6A 3T28A 1KSJA 1Y63A 1NY5A 4X6NA 1NN0A 3GCTG 3B8HA 5JDUB 2J92A 2ZWLH 3SFZA 3IUYA 1C1NA 1VG8A 1MKWK 4HUQA 3TK9A 2OCBA 1FY4A 2ZUDA 3ZYEA 4NFFA 1GG6B 1ZD1A 1T7CA 3K0FA 1CT4E 3CP7A 3QX5H 4DLYA 1VIYA 1W48A 2BY8X 2BBTA 2PKAA 1NTPA 1LV7A 1L2TA 2FOBA 1P0SH 1MAYA 3OY5U 3KQEA 5A8ZA 3RS3A 1MZDA 3BTFE 1C2HA 1G3CA 4AGJA 4M0LA 1EZQA 1P12E 3UFAA 1SGTA 1Z8JB 1Q3XA 4IN2A 1XZPA 4HB2A 3OU0A 2ZRCA 5HZKA 3MNSA 2ZE8A 3L82B 3MH5A 1RYFA 3VU9A 5A0FA 1DO0A 3M3VA 2FOGA 3OYPA 5IK2D 1QRXA 3VHXA 5D3MB 1O39A 4BEBA 1T8UA 4Q4HA 2J9NA 2BJVA 1OH7A 2JJ2A 2XBWA 1JEDA 4V0ME 4KTCA 3FP7E 2BC9A 4KTUA 1X8KA 3RABA 2R6DA 1J99A 4ZKOU 2QTHA 3EWAA 1FZQA 5GJCA 1A5IA 5K0HA 3BTWE 2R6GA 4GLYA 1XPUA 1HE8B 2D1JA 1VDZA 2BX4A 2QIQA 4CDGA 2ZRIA 1MZAA 5I25A 4A0RA 1Z06A 4DDVA 1FONA 2R9VA 2GT7A 4OI0A 1NC6A 4A36A 3DA9B 2K5UA 3SHAH 5ESBA 1E1RD 3UXMA 1P2SA 4LJ7A 1IN4A 2QM7A 3B1WA 4Q9HA 2NO6A 4ZDIA 1HH4A 5L3VA 2QT0A 2RGNC 5EUQB 1GBMA 1KNQA 1O2QA 5EQRA 2ZCKP 1LF5A 1C1YA 5ANRB 2FXRA 4Q2KA 2QGRA 3RWMB 2FNAA 2XITA 4LHVA 2JETC 1ZRKA 2W5EA 1K9OE 2C96A 2LKDA 1HUTH 4GCHG 2QAGB 3JZ2B 3UQOA 4KYIB 1NT1A 4WF8A 4K2YA 3C16C 3SGBE 1X3SA 3FOZA 5C20A 2XC4A 3A83A 5DE3A 5FBVB 4NA9H 5EP2A 3EZ6A 3SYNA 3E8LA 1V43A 1HYLA 1TNLA 1MRNA 3O8RA 4DLZA 1C2GA 3I77A 5F8TA 4TMXA 1AIPA 3FP8E 1J16A 1O30A 1G3IA 1WXQA 1P62B 5L3SB 4U5XA 1Z6GA 3RXQA 1SQAA 2GJAA 4QBHA 4X1SU 4Q7XA 1XKBC 3O8CA 5C67A 1P7CA 1R8QA 1QG2A 2CK3A 5CYPA 1JECA 5D3QA 4ASUD 3HK3B 4BZPA 1AFQB 2JGNA 3NBFA 1A0JA 1EJNA 5JS8A 2HNTF 721PA 3KB2A 4TTQA 3S1AA 5F8ZA 2VVCA 9LPRA 1HDTH 2J5XA 2FGKA 2G0TA 4A6XA 5J4KA 3GLHB 1UADA 3TJUA 2EEKA 1GBBA 2W26A 4NBSA 4FUDA 2DFKB 2HPQH 3VKHA 1YC0A 1LPZB 4JLJA 4BQSA 5EPYA 4GZLA 4D8NA 5I46H 2RDLA 5C3NA 4Z0KA 1W0KD 4EKDA 5KNCA 2V7QD 4BLOA 2HVXA 2J0UA 4Z1MD 1DOJA 3ENSB 1OFIA 1SGDE 5GJ4B 4JL6A 2ZGBH 1S1CA 1KXEA 4Q7JB 5JYIA 1VGCC 1FN8A 1X1SA 1S85A 4WOPA 2BLQA 4WY3A 4YXWD 5GWZA 1MABA 1U81A 1O5BB 4ARZB 4IMZA 4ABJA 5CM8B 1GJ9B 1C4OA 3IO5A 1ZLRA 4H6SB 3CPHA 1G1MA 1TA6A 2PCLA 2CL0X 4TMWA 3U5ZB 1CJTC 4HUTA 3OEHA 4C30A 4DCTA 4DG4A 2CCGA 3RMLH 3K9LA 2F83A 4JIMA 1FPHH 2JIZD 1EJAA 1MD8A 1D6WA 3B60A 2QV1A 4RSGA 2IYVA 1S1MA 1IN5A 4ZDJA 1LVBA 5T6DA 1OWDA 2QPAA 1KTSB 4ZUHA 2G55A 1WA5A 3V00A 1R8SA 2AKYA 1IQNA 4YOGA 4XIGS 2KSQA 4TY7A 3RU4E 5C4MA 3ND9A 2CCJA 5DH9A 1Y3XA 2QGZA 2R2WU 1ZR0A 4KVAA 2WOJA 1XZQA 4NH0A 1GHAG 2IHBA 1EFUA 4BLRA 2AX4A 3FFAA 2VIIA 1TX4B 1SLXB 3EPKA 4QNRA 2E87A 3RHFA 3AUYA 3NEYA 1Z6XA 1AN0A 3GLGE 3EPLA 3K09A 3AF2A 4B33A 4TWYA 4CEHA 3AVUA 1TX6A 4R98A 4URWR 4XVQA 3EZFA 3ZZ9A 3UMFA 2ULLA 1HAZB 5CE1A 3SZRA 1AQUA 3K6YA 2HV8A 4FWIB 1TU4A 3SEAA 2W7UA 1FQKA 2BVNA 1O2NA 4Y0ZE 4L8GA 1D9IA 4MA4A 4IVPA 2ERXA 1QJ6B 1QY6A 2BBWA 3RXOA 1GBLA 8ESTE 3MWKA 4ZCLA 1GRNA 1TYNA 3R7WB 3P4YA 2Y80A 5JZVA 2ZU1A 3CKLA 1C2EA 3LX5A 1THSH 2FSHA 4IW4E 1NRSH 3OAAA 2AWNA 1AO5A 3B9QA 4FUCA 1D3DB 2ZSDA 4R8TB 3OF5A 1UTQA 2VP4A 1A7SA 1R0WA 1T5LA 5J47A 5G4BA 1R10A 1E2NA 1NRRH 2F9LA 1TOCB 4E06H 1U98A 2G0NA 2RGBA 1TE0A 3CPEA 1CU1A 1LPGB 1CE5A 1HTWA 1SGRE 1W3CA 2VIPA 3QLPH 3A7TA 2WIBA 1ANEA 3Q85A 1HGTH 2Q6TA 1AJEA 3T27A 1EQ9A 4CHAB 2DY1A 2QZ4A 1SGQE 3RLFA 1QQUA 1IQKA 4UE7H 1NMXA 3SV8A 5EJEA 2BD4A 1ELGA 2GXAA 3W94A 3IPYA 3HKIB 5B30A 4LYAA 3NCLA 3ZYDA 4AKEA 2AK3A 3L0IB 1FXYA 1OYYA 3EYDA 5BPEA 4LBYA 1O3NA 1DWBH 4EJSA 4TYPA 2F43A 1O2WA 5T1VA 3T26A 4TYWA 4B48A 1VYTA 2GJ8A 1KI6A 1II8B 3I1FA 1W7XH 4Q7YA 1JR3E 1FNIA 5CJPA 1Y5AT 1W49A 3M7QA 3DZ8A 4ASHA 2OT3B 1UCYH 4X1QU 1LCYA 1AM4D 2EWWA 1LMWB 3K8YA 4A1XA 1AZZA 4GOJA 1JPJA 1OF1A 1E69A 2SFAA 3GDVA 1G7TA 4OI2A 4JBYA 3A80A 4Q00A 2HEIA 3WYFA 1E34B 4BPBA 1GHBG 4RZ3A 4QHYA 1O2JA 1YVDA 1DAIA 4Q47A 2P3UB 2PEYA 5JBCS 3OEED 3KB1A 5FX6A 3S9BA 1FPMA 3ADBA 2XZOA 3F9HA 4QJ4A 4HB3A 1DADA 5SZIA 2QMOA 3W8NA 3P20A 2W7SA 1FPCH 2PX3A 1JAIA 1E9SA 4X6PA 2EA3A 4AG1A 4HZUA 1TNJA 4MQBA 4HI0E 4X2YA 2ZRHA 4NIWA 4XBCA 3OX7U 1G3QA 2OAP1 3C8UA 4LV6A 5G53C 5DP8A 6GCHF 3WMGA 1QB1A 1Q0UA 4US1R 1PLLA 2SNVA 2BLOA 2VIQA 1PQ5A 2ZUCA 1TPPA 1NVWQ 4U2WA 3GY5A 1F60A 2C8XB 1Y5UT 2GF0A 3FZZA 3SW2B 1YPKH 3LC3A 1GSIA 1QCPA 3CIOA 1V3XA 2Q9BA 1KYIA 3M36A 1QHNA 3ZIAA 4PSVA 2ZJ5A 3THOA 4S35A 5E0GA 1OPXA 2REOA 3FPAA 2ZDMA 4YDHB 2P67A 1ORFA 2FFHA 3UK6A 4C3ZA 3P70B 1FMGA 2RG3A 2VGCC 3BG4C 1XNJA 4KI0A 2GEUA 3STIA 1DAGA 2CNWA 2BD9A 2TMKA 3CF2A 3LJJA 7GCHF 1D5CA 3UREA 1FIZA 1G41A 2NPFA 4URVR 3P8OA 3BAFA 3KJGA 2NZ8A 5JJKA 3R9WA 2JASA 5CYOA 2A30A 1EB2A 1E2KA 1N6NA 1F0TA 3I8SA 1R0XA 4GI7A 2BDTA 2IT1A 2QP9X 2WMOB 4CH8B 1ESAA 3GCOA 2EFGA 1MCVA 1ZU5A 3AW0A 4RFSB 1FFHA 3VEQB 3KKOA 3EPJA 2FG5A 3KXIA 1YLCA 1ZD9A 3F9FA 3NKKA 2QT1A 3QKUA 5FOUA 2XYAA 2RGCA 1DUEA 1IHSH 3P1JA 2PL3A 1ARCA 3AF3A 4FVBA 1KMHA 3ITIA 1GTVA 2C98A 4JSYA 3IKJA 1S5SA 3E6PH 2QROA 3MO6A 4BGDA 4IDOA 2AMDA 1ELBA 1R5OA 2B9LA 2OUKA 1SLUB 4IN1A 2P3SA 1MO3A 5J4QA 1G30B 3ZZ3A 6CHAB 3A7WA 2IYWA 4ZCMA 1CJKC 5TARA 4ISOA 2IJD1 5DJ7A 2JJ1D 3GOVB 4P4SB 3EA9A 3TRFA 4X1PU 3K9NA 2VEDA 1YPHC 1EK0A 2IXFA 1TF5A 2RGNA 2PSYA 5GCHG 2GZAA 3LXRA 1KLTA 3DUXH 3SU8A 4FUFA 3K9XB 2XBXA 4VGCC 3DFJA 1MRSA 4B1TA 1EKBB 1TAGA 1VG0B 4NSYA 1N1LA 2VHQA 1BBRK 2HYIC 1M8PA 4LWZA 1V6DA 1F5KU 2RGEA 2WJIA 3N7OA 3HR7A 3QZQA 2OC8A 1GI8B 1DAMA 1NFUA 2AD1A 5T3HA 3TU7H 5EOKA 1J8AA 1WE2A 2O8EA 1XCMA 2QM8A 1Z83A 4W7SA 5EXMA 1SGEE 1QTFA 3U3OA 4CEJB 2RCEA 2E9SA 2SGQE 1BMLA 4ABAA 1YBWA 1NZQH 4TYQA 3EIQA 4BAHB 1COWD 5SZHB 1S9HA 2GF9A 1O2HA 1GBTA 1S6FA 1GMDG 2JLYA 2W00A 1Q57A 4D0NA 3KQKA 4YOJA 3JVUA 4X2XA 3QQ5A 4MPXA 4Y6DA 3M7UA 1SXJC 1YZLA 2VA8A 1NF3A 2H6MA 5AUOB 4BFZA 1Q44A 1A4WH 1SMFE 5AF9H 3GLIA 1KO7A 1GBAA 2P95A 3SOPA 1N2CE 2GDDA 1O3GA 1ZSKA 1T3HA 4HLUC 3AUXA 3RS5A 3KN2A 5C1UA 4TQAA 1QFKH 1HAGE 2FMJA 2ZGHA 1F5NA 2RA3A 1VJ9U 3GISB 1KZGB 3IO3A 1UTOA 3EC2A 2WHXA 2FEQH 3A37A 1B0EA 1NRQH 3FWYA 3RXVA 3KL4A 5EQTA 4HB4A 4DEXA 1IBRA 1MKXK 5HTKA 3W8RA 2NPIA 3GJ7A 3U3KA 1G7CA 1PV4A 4PFSA 4O2LA
chains in the Genus database with same CATH superfamily
1HYQA 1V41E 3V8EA 4R05A 4KXLA 1NMYA 4TY6A 3WWPA 3B38A 1PVOA 4RLQA 4OEHA 1VSTA 4II2A 3OJWA 1KDQB 4PC7A 3VHLB 1AB9B 4X1RU 2ZFPH 1XVLA 2BM8A 1QNLA 4D4HA 2CLFB 1EMDA 2OQVA 4G6ZA 4MGEA 3NIBA 4OGFA 1UAGA 4DILA 5IAJA 4RY9A 3ESAA 4ZOAA 3O92A 2WMDA 5I7OA 4IDEA 5K0CA 4PGAA 4EDFA 3PFFA 3P2OA 3ETNA 4IXDA 4OXNA 2XUHA 4L72A 1POXA 4L08A 4AGKA 1EBUA 4YASA 3WK6A 2IK8A 2O50A 3TJRA 3TOXA 2GN9A 3BEDA 1I5RA 1HDRA 1GAJA 2R60A 2Q2VA 4BMSA 2X42A 1EFHA 3C15C 3SD7A 2PZMA 3NC0C 1N6PA 2QG6A 2ZB8A 1Y3AA 3ZXXA 3QE3A 4N41A 1GV0A 3PI7A 1FNMA 4N5LA 3T54A 2OZKA 1ZN2A 2BGTA 1GG6C 3WO0A 2VHVA 1FJSA 4X94A 5TPZD 2Q7DA 1U8CB 3A6FA 3S1SA 2W0MA 4O1IA 2MYPA 4RA6A 3QBJA 2FIRH 1F4LA 3EMDA 3MJVA 2C4WA 5HJEA 4I4LA 1XFAA 4XOUA 4NYJQ 1GBDA 3BRCA 2E0IA 4WJZA 3VH4A 4BO9A 2PBRA 2GBIA 2ZTUA 5FTLA 1IQUA 4OQNA 3KVYA 1HNEE 1RTTA 2YVLA 3CTPA 4HEHA 4TKVA 1KORA 3RRMA 3CSSA 4LS3A 4RVGA 2QNBA 3SU4A 3QELB 2Y5GA 4CLOA 4OYYA 1Y8RB 2QF7A 3PDHA 1LS1A 2YHIA 4DADA 1O5GH 1SKMA 2HMUA 4UOQA 1BO6A 2PDAA 2I7CA 1KTTB 3LU1A 2C95A 3S5UA 3FDZA 2ZCJA 4FT2A 1QM5A 5LBTA 4JYVH 7KMEH 5A0BA 2FW1A 3HABA 2FW6A 4F56A 4WV3A 5COQA 3WLAA 3IH5A 4EKNB 5JQGF 5HF8A 2G04A 2ZDGA 2QJWA 1WCYA 4QU8A 2IF2A 3ESBA 1IQMA 1GKKA 5K0JA 3GS9A 2G17A 3NO4A 4C22A 3PPYA 4TV8F 4MNWA 5C3UA 5EJAA 2C5FA 4UHBA 3H6KA 4XFJA 4XWTA 1RRCA 4QGFA 3IAM6 3KVRA 3R2JA 1UP4A 5HIIA 1Z63A 1GI7B 1ABEA 5DP4A 3A4LA 1FRNA 1ENPA 4O29A 1IG0A 2UKDA 4UTNA 1YPLH 1BWPA 8AT1A 4JJAA 2OD3B 2H4WA 1WVMA 3HKBB 5BNIA 4OS1A 1G32B 1BD4A 3M5MA 1LFDB 1D1TA 3NTLA 3HZHA 2OK8A 1Z0DA 3DV0A 2QA9E 2G83A 1W13U 1AVXA 1OFTA 1BA8B 1T3TA 3O4GA 2Z9CA 5KQRA 1SG6A 1L4ZA 3I2HA 3H87A 4M0PA 3WL7A 4AF7A 1H8HA 5FEUA 4CVNA 5ALDA 4JI1B 1N6OA 4K69A 2CFRA 1E5VA 2IPAB 2ZKSA 3VPXA 4MUNA 1Y98A 2A86A 1R00A 1QH1A 4NFYA 3Q77A 1RZRA 3ABRB 4Q4DA 2YASA 4MS1B 4OAPA 2AFHA 1Q1AA 4EBBA 1ACBE 1GI3A 2AOTB 3FJYA 4JLDA 3PRHA 2B1IA 3ILVA 5IM4A 4KMMA 1SOZA 4YCDA 4EG1A 4DCNA 1KFKB 2ZYDA 2Q9AA 1ZEMA 3REGA 1EXWA 1G4HA 1G2IA 3H42B 4ZYLA 4M1ZA 1CZLA 1PVVA 4FGSA 4DRYA 2V7XA 2FETA 4TQGA 5AVVA 4E4YA 2J30A 4X7PA 2GMWA 3IAUA 1JDJA 2OG2A 1ZUNA 1IQEA 4ZAZA 1GUDA 5GZ3A 4Q7EA 3LUBA 5TCAA 2QSYA 1P4SA 3MIIA 3MWFA 1QPGA 3EXEB 1C9EA 5HWSA 2SBTA 3O3CA 1W85B 2JBHA 4BFCA 2CVHA 2P9YA 1Y9DA 2HA3A 2JRLA