1QBOA

Bovine trypsin 7-[[6-[[1-(1-iminoethyl)piperidin-4-yl]oxy]-2-methyl-benzimidazol-1-yl]methyl]naphthalene-2-carboximidamid zk-806711 inhibitor complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (TRYPSIN)
publication title Crystallographic analysis of potent and selective factor Xa inhibitors complexed to bovine trypsin.
pubmed doi rcsb
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qboA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qboA02
1HBTH 1DE7H 4O3TA 1XUFA 1N8OC 1YP9A 2OQUA 4JZEH 3A7VA 1C2LA 1WOFA 1CGHA 1HXFH 2GGVB 3TITA 4NIWA 2BZ6H 3RC5A 2HPQH 1BA8B 1C9PA 3URCA 1EB1H 1HAVA 1Q31A 4RKOB 8LPRA 2HWLB 1SGEE 3BTHE 4D76A 4DIHH 1EQ9A 1FPCH 4INKA 1NFXA 3MNSA 2ANKH 2A4GA 1GCDA 1UTJA 3U8RH 5J4SA 1LO6A 2P3TB 1AD8H 3P8FA 1K1MA 2J94A 4I31A 1EUFA 3RXHA 1DXWA 1SHHB 1PQAA 2F83A 2RA3A 2GDEH 5A8YA 1GI9B 1CHOG 2ZU1A 5HM2A 1L0ZA 1KXBA 4PROA 4MDSA 5LPEA 1MTNB 5JBCS 1C2HA 2VB0A 1EP6A 3LJOA 8GCHG 5I46H 5K7RA 1K9OE 4Q7YA 4WWYA 1C4Y2 4ISLA 1D4PB 1WAYB 1MKWH 1AGJA 1O3MA 1PFXC 4H6SB 1L4ZA 4Q7XA 3TPIZ 3K65B 1P2KA 1ZMLA 3RXTA 1TYNA 2BXUH 1EPTB 1P2MA 2BD2A 4FUDA 3L3TA 3PMAB 3OYPA 3RU4D 2M5TA 4Q7ZA 1YLDA 2GD4B 1PPHE 2QC2A 4R8TB 4FU7A 3SNBA 2ZCHP 2WPJS 1O30A 1A46H 1XUKA 3PM3A 4Y11E 1NN6A 4O3UA 2QXGA 3ZV9A 4NWKA 2VIQA 3CENA 1F0UA 2C3SA 2R0KA 1CHGA 3RC6A 1K21H 1QL8A 3M5LA 8KME2 1JMOH 1FIWA 1T8LA 1HLTH 1SGNE 1GVZA 3M7UA 4YLQH 4DURA 1J16A 2ZI2H 5A8XA 3DUXH 3N7OA 2AH4X 2PTNA 4XE4A 1V2UT 2JKHA 4IC5A 1SGPE 1D3DB 3TK6A 2VIWA 2J9NA 1CGJE 3A84A 1SGDE 2ZU2A 5EOKA 3ZZ8A 4Y10E 4OS5A 2QIQA 3E0PB 2HALA 2VGCC 1ESTA 5FPTA 1PJPA 2O8TA 1QCPA 3SQEE 1JIMA 5FBEA 5FX6A 4OS6A 3LT3A 2FOGA 3RXAA 4I8JA 1D3QB 1MTNC 2BLQA 2PSXA 1EKBB 6GCHF 4MNVA 2V0BA 2V3HH 4U32A 1QGFA 2OC8A 2BQWB 3RXBA 3SU0A 1HDTH 1AY6H 4AORA 2FWWA 3P6ZB 4Y6DA 1GJCB 3F1SB 3S9CA 1AFQB 4MNWA 1Z6JH 4KTUA 3T27A 2BDGA 1EAUA 2ZGBH 1EPTC 3O8CA 1FMGA 1GI5A 2A4OA 1UCYH 3BIVH 3GY5A 3GY8A 1BDAA 3E91A 1C5ZB 1LQEA 1CVWH 1TFXA 1K1PA 1O2UA 3KNXA 1KLTA 1E0FD 3SJ9A 1FY3A 2ZTZA 1KLIH 1EAIA 3TU7H 1SGQE 1BHXB 5HMAA 3LJJA 1XUHA 1G2LA 4AB8A 1RFNA 2H9TH 4ZUHA 3VXEH 3SZNA 4LOYH 4J1YA 2QXHA 1YPLH 2Z9KA 1YC0A 3GCHB 5L6NH 1O34A 3U98H 3URDA 2EI7A 2TPIZ 1D3PB 1O2QA 3SI3H 1SOZA 4NZLA 4KGAA 1ZPCA 1CT2E 1BMNH 1BJVA 9ESTA 4GAWA 2Y7XA 4JZFH 1YKTA 3T25A 4DOQA 2SGQE 1GVKB 1O5DH 3DHKH 1F5RA 5F6MA 3MNBA 1A0HB 1UVPA 3MH6A 2PSYA 1ZTJA 2F3CE 1GHBG 4K5ZA 1FNIA 2FYRA 1AFQC 3NZIA 5EXNA 1C1WH 2BD3A 3HATH 1Q2WA 2VVUA 1GBIA 3M7TA 1EAWA 1CSOE 1K1JA 1PYTC 1E34B 1OWDA 1N1LA 4I33A 5TCCA 1C2GA 2CV3A 2ZQ2A 4H4FA 3LU9B 1IQIA 2FESH 1O33A 4BAQB 3ZYEA 4D9QA 3U9AH 4UDWH 1AO5A 2I6QA 1ZLRA 1BOQA 2BYAX 2Y80A 1DDJA 1GMDF 4X1PU 4Y7AA 1XUIA 4I8KA 4INLA 5F8XA 5EW2H 2OBQA 2ZDLA 1TMTH 3M35A 4UFDH 4CBOA 3NKKA 1ELCA 2O8LA 1FI8A 1PQ7A 1CGIE 2THFB 3GCHC 3KQCA 3SJIA 2FOHA 2SGDE 4A6LA 2HLCA 2WYJA 2EA3A 1DT2A 1BRUP 1EXFA 3E3TA 2P3UB 1C5OH 4BTIB 1L2EA 4K3JA 4X0WU 3SORA 2ZTYA 1GI4A 3BTEE 2GP9B 3GYMA 2H6MA 3C1KA 2W26A 3JZ1B 1O3HA 2QN5T 1NRSH 2ESTE 1C5RA 1EZQA 3PO1C 3SV9A 1O2VA 2GT7A 1ETSH 1WTGH 2FS8A 5E0HA 3L6PA 2CN0H 5DP7A 3TNTA 1QRXA 1HUTH 3VB5A 1O2WA 1JIRA 4HFPB 1QQUA 2BQ7B 4TWYA 3LH1A 1HAHH 1QB1A 2B7DH 3VB7A 1HAXB 1PQ8A 2STAE 3LIWA 1XXFA 2ALPA 2BD5A 6LPRA 4GUXA 3RU4T 5A0AE 1G30B 1UTLM 4RSPA 4M7GA 3ZVCA 5B6OA 1DUEA 1O35A 3PV4A 3GOVB 5F8ZA 1LKAA 1TONA 4E7NA 4AB9A 3LONA 2BD4A 1TPAE 1GL1A 1LVYA 1L1JA 2D26C 2FOBA 5HXFA 3QLPH 2SGAA 1SQOA 3RUOA 1WBGB 1V3XA 2ZO3H 1BBRK 3MMGA 3FZDA 3SUEA 1UK4A 1Y5AT 1E35B 5FPSA 4XBBA 3F68H 1V2PT 4LZ1H 1KXAA 5DPAA 3MH7A 1KDQA 3RU4E 1C4U2 2JH5D 3SNCA 1T7CA 4GSOA 1ELDE 1TBQH 4K69A 1RIWB 3L33A 1SSXA 1ID5H 5DP8A 2XW9A 7GCHF 4ABBA 3D65E 1BRAA 4DT7B 1F0TA 3UNSA 4YOJA 1H9LB 4ZKNU 4LZ4B 5CMXH 4YO9A 1UTOA 4WXVA 3SJOA 2TRMA 4D9RA 2FOFA 2G81E 2P94A 3HKIB 1AE8H 3DA9B 1GMCF 1OYQA 1UHBA 3ZVAA 2RCEA 1W0YH 3TJUA 2RG3A 4O03A 2GCTC 4Q2KA 1V2RT 1EJMA 1ARBA 2XYAA 4NIVA 1A0LA 4FVDA 2Z9JA 2QY0B 4CR5A 1SHYA 2BOHB 3AW0A 1TWXB 1G36A 2Z3DA 3M5OA 5J4QA 1CT4E 2AMQA 3LGIA 1ZGVA 4BANB 5C1UA 2ODPA 1NRQH 1TOCB 2OBOA 4YTAA 4SGAE 1E38B 1H9HE 1KDQB 1C5SA 1LVOA 1TRYA 5FAHA 1V2QT 1C9TA 1ELFA 5T3HA 3SHAH 4SGBE 4FU9A 5C67A 1OKXA 3H7OA 3MU1A 1O2KA 4IMQA 2Z9LA 1GMHF 5F03A 1TALA 2AFQB 4GLYA 5E2PA 1S82A 4MQAA 2VWOA 2P8OC 3KQDA 2ODYB 1RIWC 4UFFH 5EGMA 1GI7B 1CA0B 2GX4A 3S9BA 2ZGXH 1FLEE 5DKMA 1GBDA 5GCHF 4D7FA 1ZPZA 1YM0A 2A2XH 4Y0YE 1LKBA 1YLCA 1MTSA 1A5IA 1C2KA 2BDYA 1TRMA 3MOCA 4WXIA 4BAHB 3P17H 1BTYA 1G3BA 2AGGX 1G2MA 4KTCA 3VXFH 1TX8A 4X2VA 3Q3XA 2PGQB 3STIA 2AGEX 1SG8B 4CRCA 1GBEA 1PPZA 1IHSH 1K2I1 1O5EH 2G4TA 3DT0H 4GCHG 1HAYB 2PUXB 2XC0A 1KTSB 1O31A 3GCTF 4B71A 3PROA 2BDBA 4AFQA 2OCVB 4AG1A 3BG8A 1S83A 1YYY1 2B0FA 1SLUB 1T32A 1ZMNA 2ZU4A 1GJ6A 3A86A 3UREA 1P3EA 2FP7B 1TOMH 4JYTA 3PWBA 3ZVFA 2EC9H 1P9UA 1KY9A 4X8UH 1C1VH 4LK4A 1ZSJA 4MVNA 2VH0A 3PYHA 1Y59T 2ZCKP 1GG6C 2BVXH 2FLBH 1XX9A 4FUEA 3RM0H 3ZVDA 1ZHMA 3EA7A 1ANDA 1AB9B 1F5KU 3JZ2B 1QL9A 1UK3A 3B9FH 3FZZA 5L2ZH 3MNXA 1CA0C 4MG3A 3RC4A 2G55A 2ODQA 3TJVA 4HGCA 2GT8A 1CO7E 1C1QA 1EOLA 1T31A 2AIPA 2XCFA 4ZKRU 3KCGH 1PYTD 2ZF0H 3LPRA 3SI4H 1QBOA 2ZGCA 4MPWA 3UNRA 2F9OA 2WV5A 1AE5A 1QHRB 2BZAA 2FLRH 2HOBA 1P9SA 1C1RA 1P09A 1QA7A 4UONA 1FN6A 4A1XA 3RXOA 1O5GH 3NK8A 4BAOB 3BTME 1MD7A 2QAAA 5DG6A 3RP2A 1YCPM 1O2JA 1C2DA 2GZ8A 5F8TA 3SJ8A 3RXCA 5C20A 4CRAA 1XXDA 1ZZZA 1O3JA 2CXVA 2GMTC 1SGTA 1P8VC 1L4DA 2F9PA 2A4RA 2RDLA 5C1XA 1FIZA 5DP6A 2Z3EA 1THPB 4IGDA 1OP0A 2BX3A 4XDEA 1DWCH 2GCHF 3SU2A 1ZPBA 4I8LA 1NTPA 3M37A 2CHAB 1K22H 3FP7E 2UWPA 1HJ9A 3TJOA 1GHAF 1LVBA 3ZVEA 1GJAB 3A85A 1P03A 2TBSA 2A5IA 1SGCA 1C5MD 1IQLA 7KMEH 1AB9C 1TNKA 3NXPA 4ZKSU 1O3NA 1H8IH 1O2GH 3PMBB 1UK2A 4WMDA 1C5TA 2YNBA 3T62A 1NFYA 3U8TH 1DX5M 4DW2U 1W7GH 5IYTA 1OWKA 1S0QA 9LPRA 4HI3A 3QO6A 3UQOA 2CJIA 3TK9A 1O2XA 1JWTA 3MFJA 2FI4E 3KEEA 4MNXA 5EU8A 1TNGA 3QZRA 1L1NA 1WUNH 2GVFA 2HNTE 1EPTA 1AKSA 4CH8B 2ZDKA 1EX3A 1SVPA 1C5NH 4FUFA 3ZZBA 1VITG 1X7AC 4HTCH 1C1NA 1B7XB 2FIRH 3TGIE 1LHDH 2C8XB 2ZDVH 5EG4A 5FPYA 2B8OH 3ATLA 1O0DH 2ZDAH 5EQSA 3RXEA 2AS9A 2NU1E 1KXEA 3ZV8A 2P59A 2Y7ZA 4X1NU 3P8NA 3VPKA 1BUIA 1BBRH 1UO6A 1TMUH 2CHAC 2AMDA 1IQGA 4JZDH 3ODFA 4JK6A 2A45B 3VEQB 1ANBA 1S81A 2VGCB 2V6NA 2BD8A 2HNTC 2CMYA 4O97A 3SV6A 2UUKB 4FUBA 4D7GA 2Y5GA 1WYKA 1D9IA 1HB0B 4GHTA 1CHOF 5A09A 1J8AA 2BY7X 2ZPQA 4MTBA 2ZQ1A 2YNAA 1FY4A 3K6YA 3MU0A 1TNIA 1HNEE 4XBCA 1UVUH 1O2NA 8GCHF 1V2VT 1MZDA 3A8BA 3FP6E 6CHAC 1NY22 2FZZA 1AKSB 3MWIU 2TGPZ 2W7SA 4OS7A 1BB0B 1MKXK 1SQAA 3BEUA 3IG6B 1TA6A 1BHXF 1CT0E 1IQEA 4X6OA 2OINA 1XMNB 2QXJA 2D2DA 1MMJN 1TPSA 1GJ9B 1W2KH 4ABJA 3TGJE 4DIIH 4WH8A 1C5YB 4GPGA 4X6MA 1K1IA 3A8AA 4NFEA 1ESAA 4AFUA 2R3UA 2BDIA 4NA7A 2BB4A 3CP7A 2ZFFH 3EAJA 1BTPA 1W0ZU 4BXWA 1TAWA 1MTUA 4D8NA 1DANH 1AVGH 2BHGA 3MTYA 1VCWA 1XKAC 1AI8H 4B2BA 1XVOA 3PMHB 1XUJA 1DY8A 3I78A 3RXQA 2TGDA 3P8OA 4LXBH 4NIYA 4VGCC 3SU3A 3QGNB 1O2RA 1C5XB 2VVVA 3A87A 2VIDA 2H9EH 1A1RA 1TPOA 5C1YA 4BAMB 1QIXB 1P10A 3STJA 1PPGE 5GJ4B 3ODDA 4XOJA 3QK1A 2H5DA 5EXLA 3SO3A 5JB8S 3BTDE 1NU7B 1OWJA 1IQJA 3VFEA 1C4V2 2ZFPH 2R3YA 2G8TA 3BEFB 6GCHG 3GY2A 3DFLA 3MO3A 2FTMA 1HAIH 2FOMB 3TIUA 4DG4A 1C1TA 1ZOMA 1O3KA 3CS7A 2BX4A 1FY8E 1HYLA 4TWWA 1BTUA 1C1MA 4UFEH 3RMOH 2EEKA 1QJ6B 5EQQA 1MD8A 2JH0D 2LNCA 2P95A 2SNVA 1LQDB 2BVSH 1TLDA 1HAZB 2W3KA 1QRWA 1C5VA 1CA8B 3VB4A 2FOCA 1DM4B 2PKAB 1BRCE 3A83A 3EYDA 4FUGA 3HGPA 1OOKB 4CRGA 3GY3A 2OXSA 1GJ4H 4ABEA 4X8TH 2FPZA 1G3EA 2FI5E 2WV4A 1GI3A 3HGNA 1P57B 2ZECA 2G5NA 2J4IA 1BMMH 3PLKA 2YOLA 3GY4A 3GICB 1ELEE 4X2WA 1OYTH 4Y8XA 5EODA 4IC6A 5IDKA 2KAIB 1ZR0A 1WV7H 4ZAEA 2Y81A 2ZKSA 1DFPA 3PO1B 4KKDA 2Y82A 3A8DA 3M3VA 3QZQA 3SU6A 3SGBE 1P2NA 2DE8A 2BQ6B 3UTUH 3A8CA 1K1NA 2ZHFH 2FODA 2C8YB 2FM2A 2ZGJA 4UEHH 1GHBF 2TGAA 1MBQA 2IJOB 1AWFH 3H5CB 1RD3B 2PWXA 3R3GB 3E8LA 3TH4H 1YPGH 2ZHDA 1C1SA 2EI6A 1H9IE 2XRCA 5CHAC 5DP3A 4B74A 4ZROA 5LGOA 4X6NA 2BXTH 1YBWA 3M7QA 1SQTA 1ESBA 1PPCE 1NM6A 4X1RU 5FXLA 1NESE 3AASA 3UFAA 1K1LA 3Q3YA 1EZUC 1MCVA 2A7JA 1O3AA 1WU1A 1GPZA 4IN2A 4K1SA 2XBWA 3ZZ3A 1P06A 1UTQA 1FONA 1GHVH 4B1TA 4FUIA 1BITA 4I32A 2ZPSA 4KELA 2F9BH 4A1VA 3MYWA 2G51A 4X8VH 5LPFA 4NA8A 1KTTB 3MU4A 5TCAA 2OC0A 1S84A 1ABJH 3RLWH 1U6QA 5AF9H 1LPKB 1YPMH 1AZZA 1RGQA 1S85A 1SLXB 2VNTA 3F9GA 2Q6GA 3A7YA 3T2NA 1OWIA 5DP9A 2A5AA 3I29A 2PKSB 1TNHA 1GHXH 2V35A 1NFWA 3UOUA 4K2YA 1LPGB 1LHFH 2ZFRH 1ETRH 2OUAA 2XCNA 1AVXA 3P8GA 3RXFA 4MLFB 1XM1A 1TRNA 5AFZH 2A5KA 1G3DA 2GCTB 2IPHA 1P04A 1RXPA 5HM9A 3B23B 1AN1E 1O3FA 3ATIA 3UY9A 2FOAA 4WMEA 1GBAA 3SOSA 1DWEH 2O8UA 3MH5A 1IQNA 1QA0A 1O3IA 3GCNA 1S6FA 4OS2A 1V6DA 1A5GH 1ZJKA 2FX4A 1GBCA 2WPLS 2UUFB 1YPEH 3D49H 1NPMA 3E90B 1LCYA 1GI2A 1O5BB 1SLWB 2Q1JA 2ULLA 1CU1A 1VCPA 1O2YA 3RXUA 1GBFA 1BQYA 1WQVH 3MNCA 1V2TT 3QDZB 2P8OB 3KIDU 3ZVGA 4BOHA 4NFFA 2J92A 1GDUA 2ZDNA 1O3DA 3RXGA 1Z8RA 4ESTE 4IBLH 4GHQA 1O37A 2XNIA 3ZZDA 2C90B 5A8ZA 1SLVB 3MHWU 2PKSC 1ANCA 2C93B 1B5GH 1MKXH 3LOXA 3GDVA 4NSYA 5LH8A 1A3EH 1UJ1A 4ZHMU 1TGBA 5EQRA 3OY6U 1GJBB 1W13U 1P2QA 1CQQA 3QWCH 3RXRA 4ABGA 1NFUA 5AHGH 1N6XA 4B2CA 4NIXA 3LDXH 1WTHD 2BTCE 1Z8JB 1GVLA 5A0BA 1GI6A 3VGCC 1GMCG 3F6UH 1VR1H 1TBRH 1IQHA 4X1SU 2BY9X 1Z6EA 1VCQA 3P95A 1FPHH 1C5WB 3BTQE 1LHGH 3TH3H 1QJ7B 2QF0A 3RXSA 3ZZ5A 2VU8E 4KP0A 2VIVA 3Q00A 2V3OH 1GG6B 5JBBS 5GDSH 1V2NT 1AQ7A 1O3BA 4E05H 5ABWA 1AMHA 1T8NA 1P0SH 1P2OA 1Z71A 4AYVB 2ZIQH 3PTBA 1Z1JA 4BTTB 3FP8E 2HGTH 2BVRH 1FN8A 4UD9H 1SR5C 1INCA 2GZ7A 2ANWA 3G01A 2PTCE 1BT7A 4OS4A 5JBTA 1C5UA 4NGAH 2J38A 2NU0E 1EZXC 1A7SA 1NC6A 3KGPA 4I8HA 2R2MB 5T6DA 4RN6A 3CS0A 1HCGA 4AN7A 3TGKE 1GBHA 3NPSA 1BTHH 3IITA 2ZA5A 1O2PA 3AAVA 1DSTA 1KSNA 2G5VA 5FHTA 1EJAA 3NWUA 2NU4E 2GMTB 1P3CA 1O2OA 1DVAH 1SGFG 2VVCA 1G9IE 1NRPH 4GCHF 1MQ5A 3ENSB 3NCLA 1J15A 4DJZB 2H9HA 3SQHE 2VWNA 2UUYA 4OGXA 2ALVA 5JB9S 4X2YA 2HNTF 1Y3VA 3T29A 1TBZH 2VINA 2PR3A 3AVZA 1ZGIA 2Y5HA 1OWEA 1FQ3A 4ABHA 1GBLA 3K9XB 3S7HB 4XSKU 1A4WH 1O3LA 4YOIA 2ZG0H 4NWLA 3RMNH 4A5TS 1P01A 2Z6BD 5C2ZA 3M3SA 1AZ8A 1UTNA 4TYDA 2PW8H 4AGJA 4QT8C 3RXJA 2GZ9A 2ZFSA 1OSSA 1TGSZ 2VIOA 1O3PB 1C2EA 5JYIA 4I8GA 2WPKS 2I6SA 5I25A 2IN2A 2ZU5A 1O2IA 2SGFE 4MPUA 2ZGHA 3A7ZA 4B76A 1O2SA 1D6WA 3PMJA 3KQBA 3P92A 1DPOA 1BTWA 1BMLA 4K8YA 2OD3B 2FX6A 2WINI 4BAKB 1TNLA 1V2JT 1UCYE 5L30H 2TGTA 3W94A 3WY8A 1FZZA 1TGCA 1HIAB 2OQ5A 2Y5FA 1GJ7B 2XBYA 1XKBC 1J14A 1IAUA 2PV9B 2D8WA 5G4BA 1FDPA 3ATMA 1J17T 1DS2E 1ELGA 1EOJA 4ZKOU 2TIOA 4E7RG 4HZHA 2GCHG 4WJG2 1DLEA 1Y3XA 2F91A 2P93A 1W7XH 2AEIH 2BLOA 2UUJB 3V7TA 4AYYB 3U1JB 1VJ9U 1GI1A 2ZDMA 1YCPK 1O38A 1TX7A 5GWZA 2A7HA 1C1UH 2BOKA 1QBVH 5ESTE 3BV9B 6CHAB 4NG9H 1CBWB 1O39A 3IWMA 5HGGA 2ZZUH 5AVDA 1NRRH 1HAOH 3SHCH 1LHCH 2DE9A 2AGIX 4FUHA 1MZAA 1B0FA 2VWLA 1HXEH 3RXDA 5BPEA 1A5HA 1AIXH 1ETTH 1UVSH 1EB2A 1A2CH 1HJAB 1TQ0B 2ZPRA 3GISB 1THRH 2A7CA 2AMPA 1A3BH 4BNRA 5E0JA 1GDNA 1TGNA 1J9CH 3FFGA 3S9AA 2C8ZB 3ELAH 2A32A 3U8OH 3GY7A 4CHAC 2SGPE 3FAOA 4CRBA 3SV8A 2NU3E 3M3TA 4VGCB 1ZTKA 2Z9IA 3C27B 2BY5X 2ZNKH 4X8SH 1DY9A 1PPEE 2ZEBA 2BD7A 3D62A 2A31A 1LHEH 2H5CA 2ZP0H 4JZ1A 1RTKA 1IQMA 1FUJA 1AVWA 2GV6A 4JCNA 1QY6A 3GDUA 4IS5A 4K1EA 1E36B 1SFIA 3QTVH 3FVFB 1SGIB 1BRBE 1DITH 3SUDA 4F4OC 3EQ0H 1K1OA 1CBWC 2AYWA 1Y3UA 1HRTH 2DUCA 1D6RA 1G32B 3P70B 1H1BA 3W95A 3ZYDA 1QFKH 1NRNH 1SC8U 3PWCA 2R0LA 2BY8X 3LC3A 3BTFE 3Q76A 1FAXA 1HJAC 1SGYE 3M5MA 3UR6A 1DLKB 1O36A 2ZU3A 1KIGH 1QL7A 2QGRA 4ZXXH 4U2WA 2QV1A 1UMAH 3HK3B 2WPIS 3BTKE 1YPHE 4TY7A 2R2WU 4X2XA 1HAVB 4FU8A 7LPRA 1FV9A 1Y5BT 1W11U 1FY5A 2AERH 1NU9A 1EASA 1GWAA 1W10U 1SOTA 3SNEA 3Q3KA 1SGRE 3FANA 3SV2H 2PKAA 3OTJE 5FCKA 3LGWA 1AUJA 1JBUH 1T8MA 1WSSH 3BEIB 1BTXA 2FO9A 2O8WA 3TVJB 1F2SE 3TJNA 3MO6A 4DCDA 1F0SA 3BN9A 3BF6H 1MQ6A 4Y8ZA 2VH6A 1OP8A 1EAXA 3T5FH 1C5PA 1GJDB 3BG4B 2R9PA 5JDUB 1Z7KA 1P05A 1GDQA 3QTOH 1O3CA 1NT1A 1O5AB 2KAIA 1YPHC 4Y0ZE 3SU4A 4DGJA 2O8MA 3BIUH 3BTTE 1JRSA 1ZHPA 1EJNA 2ZC9H 2PFEA 3EGKH 3KQEA 3LC5A 4H6TA 1WCZA 3TK5A 3PB1E 1NS3A 2F9VA 2Z94A 1IOEA 1DSUA 1QTFA 2OLGA 1SL3A 2W3IA 5A2MH 5CHAB 1OXGA 4WF8A 2BY6X 2J95A 1W8BH 3M5NA 3HK6B 2RA0A 3BSQA 3PLBA 1ELVA 4K8BA 3OY5U 3RMMH 1ZSKA 3OX7U 4MPXA 1KXFA 4UFGH 1IQFA 2A1DB 3U1IB 2SFAA 5L2YH 2ZHQH 1PPFE 1GHZA 1JRTA 1SMFE 1P2IA 3HPTB 3QX5H 3SUFA 5DP5A 1S5SA 4A7IB 1HAPH 4AFSA 2FXRA 1S0RA 4IN1A 5T6GA 2B9LA 3T28A 2OTVA 5DGJA 3SV7A 1V2KT 4NZQA 2CF8H 3A81A 1V2WT 1F0RA 1GHYH 2XXLA 1Z8GA 1PQ5A 3GY6A 4ISOA 4B2AA 1TB6H 2P3FH 2J2UA 4A92A 1GHWH 3SNDA 3UWJH 4YOGA 2J34A 1K28D 5DO4H 3BG4C 1Y5UT 1G3CA 3SUGA 5GIBA 3SU5A 2XWBI 2P16A 3RXMA 4AGKA 5JBAS 4U30A 1TGTA 1MBMA 3RXLA 1UTPA 2BLVA 3Q77A 1N6YA 2ANYA 2OC7A 1BIOA 3DFJA 2GKVE 3UR9A 2A2QH 3NUMA 1AWHB 4AG2A 1ZJDA 3LGTA 1GBTA 2XBVA 1H4WA 1QR3E 2VWMA 3LH3A 4MPVA 5E8EH 3ATWA 8ESTE 5E0GA 1UTMA 1QRZA 1O5FH 1H8DH 1Y3WA 4WH6A 1C1PA 3ZZ4A 4ZH8A 3VB6A 1T4VH 2G00A 1MAXA 3KN2A 4DVAU 3A80A 2ANMH 1OX1A 1LTOA 3KF2A 1C2FA 3A7TA 3V13A 3OSYA 4Y76A 4ASHA 1DXPA 1GL0E 4Y71A 4ZXYH 1OP2A 2GTBA 1GMDG 1SI5H 3O8BA 1GCTB 1DOJA 4FVBA 2WUCA 3RMLH 1RJXB 4YM9A 2XC4A 1A61H 1MH0A 1GJ5H 1MTVA 1C2MA 2Y6TA 4ISNA 1VGCB 5EPNA 1JXPA 2VJ1A 3MU5A 2ZHEH 5HYOA 1KXCA 4U01A 1NROH 4CRFA 2Z7FE 1YCPH 2ZCLP 1OS8A 1RTLA 1ZYOA 2CF9H 4YLUA 3UOPA 2C4FH 2PHBA 1ARCA 1MU6B 2OP9A 5PTPA 2BM2A 1B0EA 3V12A 1BZXE 1IQKA 1VJAU 1MUEB 4A1TA 3O8RA 1P11E 3ZZCA 4F49A 2HPPH 1ZTLA 2SNWA 1ELBA 1M9UA 1ZSLA 1VZQH 5ETXA 5GPIB 1SPJA 3GDSA 3LGUA 5FX5A 3B8JA 2OC1A 3TLOA 3PLPA 1BMAA 4JYVH 3ATKA 2Q6DA 1HGTH 1Z1IA 1SFQB 3VGCB 4WY3A 1C2JA 2H2ZA 2Z3CA 1OWHA 4IMZA 1GBBA 3EA8A 4ZHAA 3ZZ9A 1DWBH 2FOEA 3UUZA 3SJKA 3QGJA 2JETB 2UWOA 1BCUH 3E0NB 7ESTE 2ASUB 2XBXA 1SBWA 5EXMA 2PUQH 1HV7A 4WMFA 3TH2H 1DICA 1BTZA 1CE5A 3SBKA 2K1QA 4BTUB 1GCTC 4Y7BA 1ZMJA 2PGBB 2HRVA 3A7XA 1V2ST 4XBDA 1YF4A 3D23A 2QXIA 1DWDH 1ZRBA 3MO9A 5GXPA 2ILNA 5SGAE 1FXYA 1VGCC 1O2TA 1QB6A 1ZHRA 3LKWA 3EA9A 3A82A 2VIPA 3O8DA 2NU2E 1C5QA 1QJ1B 2A0QB 3RLYH 1O2ZA 1TIOA 1KYNA 1O2HA 1ZRKA 3ZZ7A 2WPMS 4K60A 3MH4A 1T8OA 1VITH 2O9QA 3DD2H 2QYIA 4KTSA 1UVTH 1ELAA 4H42U 1JOUB 4AFZA 4X6PA 3ZZAA 2JH6D 4K1TA 1TPPA 7GCHG 2EI8A 1OPHB 4TPYA 4IW4E 2QCYA 5ESBA 1GI0A 3V3MA 2QF3A 3SGAE 3GCOA 4B75A 4AZ2B 3RDZA 1TQ7B 4I7YH 3A7WA 2ZWLH 1HFDA 5JPMH 1LVMA 2F9NA 1MKWK 2A4QA 1P2JA 3HKJB 3RM2H 4FXGH 2LPRA 3T26A 3F9FA 2JETC 1AHTH 5H4IB 1LMWB 1QB9A 3M61U 1T4UH 3A88A 5LPRA 3UNQA 3RXIA 2XTTB 2UWLA 2GV7A 1TNJA 2SGEE 5AFYH 2FDAA 1MU8B 6ESTA 2FEQH 3R0FA 3QN7A 4B73A 5E2OA 1V2OT 4Z0KA 1D3TB 1TA2A 3UPEA 3A89A 2C8WB 1Z8IB 2HVXA 1E37B 1XUGA 5K0HA 1GMHG 1KLJH 1BBRE 1O3EA 1Y8TA 1YPKH 3K2UA 4XFQA 5C3NA 2BDHA 1AUTC 5DP4A 4OGYA 3AW1A 1GGDB 1W12U 4Y8YA 2BD9A 1LPZB 1QBNA 2FI3E 5GCHG 2NWNA 4CREA 4E06H 1QQ4A 1NZQH 2FS9A 3ITIA 2BLWA 4JZIA 1G37A 1RRKA 3UQVA 1MTWA 1DUAA 4ABIA 2H1UA 1O3GA 1GJ8B 2G52A 2Q6FA 3SGQE 4ABDA 4O9VA 1GI8B 1HJ8A 1W14U 1W3CA 3TNSA 1ABIH 2AIQA 3SN8A 1UHBB 3K6ZA 1TE0A 4INHA 1KXDA 1TX6A 2WPHS 3S0NA 2F9UA 3OU0A 1SB1H 1P02A 3F9HA 3LGVA 1ANEA 3I77A 5CE1A 1EP5A 1UCYK 3E6PH 1F5LA 3GCTG 4CR9A 1UVOA 5C5NA 5EPYA 4TY6A 3M36A 4ABAA 3S7KB 1ACBE 1QNJA 2BDAA 3ZVBA 1HIAA 2IOTA 2QA9E 4YT7H 4UE7H 1AU8A 3UWIA 5A0CA 1SGFA 2CGAA 1ORFA 5T6FA 4YZUA 3BTGE 4CH2B 2XC5A 3VB3A 1FAKH 5DJ7A 4ZHLU 1GBMA 2FMJA 2BDCA 4J2YB 1C1OA 1FJSA 2WYGA 1PPBH 2XWAA 1A0JA 1P12E 2ZFTA 1GGDC 3S69A 4ISHH 3GYLB 2GDDA 4NSVA 2B5TB 4NCYA 2WUBA 4R0IA 4THNH 3UIRA 3F9EA 5BRRE 5DK1A 4CRDA 1F92A 3SU1A 4AX9H 4ABFA 3AAUA 2G4UA 1WQSA 2ZTXA 3EDXB 4Y79A 1S6HA 3ESTA 4JK5A 3U69H 1YPJH 1N8OB 1IHTH 1Q3XA 4YT6H 1RTFB 3E16B 3V0XA 4CHAB 3BTWE 1HAGE 4TPIZ 4NA9H 1MAYA 1Y3YA 2ZHWH 1O2LA 4AOQA 1TMBH 4JMYA 4DY7B 1C2IA 1EZSC 3RXPA 3ZZ6A 3RXVA 5TJXA 4Z6AH 5EW1H 4GVUA 3SW2B 3SNAA 2D1JA 3RXKA 4WVPE 1THSH 4RKJB 1NO9H 1RS0A 1TABE 1GHAG 4MNYA 4CBNA 2FTLE 4Q80A 1LDTT 2FYQA 2ZFQH 2STBE 3QUMP 1GBJA 3MI4A 1O5CB 4FUJA 4BXSA 4ZMAH 4JYUH 2PLXA 1C5LH 1V2MT 4ISIH 3LGYA 1O32A 3PTNA 1MCTA 4OS1A 1V2LT 5C5OA 3E1XB 1YGCH 4YESB 4X1QU 3KL6A 4FUCA 1ELTA 1O3OA 5FBIA 2W7UA 3EE0B 1HPGA 3KHVA 1GBKA 5FCRA 1F7ZA 1L1GA 3H7TA 3MU8A 1UTKA 1EATA 1AFEH 1FY1A 1VITF 2Z9GA 1XVMA 2W5EA 1BJUA 1O2MA 2BMGB 1QURH
chains in the Genus database with same CATH superfamily
1HBTH 1DE7H 4O3TA 1XUFA 1N8OC 1YP9A 2OQUA 4JZEH 3A7VA 1C2LA 1WOFA 1CGHA 1HXFH 2GGVB 5C17A 3TITA 4NIWA 2BZ6H 3RC5A 2HPQH 1BA8B 1C9PA 3URCA 1EB1H 1HAVA 1Q31A 4RKOB 8LPRA 3PV5A 2HWLB 1SGEE 3BTHE 4D76A 4DIHH 1EQ9A 1FPCH 4INKA 1NFXA 3MNSA 2ANKH 2A4GA 1GCDA 3KYGA 1UTJA 3U8RH 5J4SA 1LO6A 2P3TB 1AD8H 3P8FA 1K1MA 2J94A 4I31A 1EUFA 3RXHA 1DXWA 1SHHB 1PQAA 2F83A 2RA3A 2GDEH 5A8YA 1GI9B 4OM9A 1CHOG 2ZU1A 5HM2A 1L0ZA 1KXBA 4PROA 4MDSA 5LPEA 1MTNB 5JBCS 1C2HA 2VB0A 1EP6A 3LJOA 8GCHG 5I46H 5K7RA 1K9OE 4Q7YA 4WWYA 1C4Y2 4ISLA 1D4PB 1WAYB 1MKWH 1AGJA 1O3MA 1PFXC 4H6SB 1L4ZA 4Q7XA 3TPIZ 3K65B 1P2KA 1ZMLA 3RXTA 1TYNA 2BXUH 1EPTB 1P2MA 2BD2A 4FUDA 3L3TA 3PMAB 3OYPA 3RU4D 3N99A 2M5TA 4Q7ZA 1YLDA 2GD4B 1PPHE 2QC2A 4R8TB 4FU7A 3SNBA 2ZCHP 2IJD1 2WPJS 1O30A 1A46H 1XUKA 3PM3A 4Y11E 1NN6A 4O3UA 2QXGA 3ZV9A 4NWKA 2VIQA 3CENA 1F0UA 2C3SA 2R0KA 1CHGA 3RC6A 1K21H 1QL8A 3M5LA 8KME2 1JMOH 1FIWA 1T8LA 1HLTH 1SGNE 1GVZA 3M7UA 4YLQH 4DURA 1J16A 2ZI2H 5A8XA 3DUXH 3N7OA 2AH4X 2PTNA 4XE4A 1V2UT 2JKHA 4IC5A 1SGPE 1D3DB 3TK6A 2VIWA 2J9NA 1CGJE 3A84A 1SGDE 2ZU2A 5EOKA 4F48B 3ZZ8A 4Y10E 4OS5A 2QIQA 3E0PB 2HALA 2VGCC 1ESTA 5FPTA 1PJPA 2O8TA 1QCPA 3SQEE 1JIMA 5FBEA 5FX6A 4OS6A 3LT3A 2FOGA 3RXAA 4I8JA 1D3QB 1MTNC 2BLQA 2YMSB 2PSXA 3OEHD 1EKBB 6GCHF 4MNVA 2V0BA 2V3HH 4U32A 1QGFA 2OC8A 2BQWB 3RXBA 3SU0A 1HDTH 1AY6H 4AORA 2FWWA 3P6ZB 4Y6DA 1GJCB 3F1SB 3S9CA 1AFQB 4MNWA 1Z6JH 4KTUA 3T27A 2BDGA 1EAUA 2ZGBH 1EPTC 3O8CA 1E1QD 1FMGA 1GI5A 2A4OA 1UCYH 3BIVH 3GY5A 3GY8A 1BDAA 3E91A 1C5ZB 1LQEA 1CVWH 1TFXA 1K1PA 3KYFA 1O2UA 3KNXA 1KLTA 1E0FD 3SJ9A 1FY3A 2ZTZA 1KLIH 1EAIA 2XNDD 3TU7H 5HIZA 2L6OA 1SGQE 1BHXB 1S6LA 5HMAA 3LJJA 1XUHA 1G2LA 4AB8A 1RFNA 2H9TH 4ZUHA 3VXEH 3SZNA 4LOYH 4J1YA 2QXHA 3FO8D 1YPLH 2Z9KA 1YC0A 3GCHB 5L6NH 1O34A 3U98H 3URDA 2EI7A 2TPIZ 1D3PB 1O2QA 3SI3H 1SOZA 4NZLA 4KGAA 1ZPCA 1CT2E 1BMNH 1BJVA 9ESTA 4GAWA 2Y7XA 4JZFH 1YKTA 3T25A 4DOQA 2SGQE 2YMSC 1GVKB 1O5DH 3DHKH 1F5RA 5F6MA 3MNBA 1A0HB 1UVPA 3MH6A 2PSYA 1ZTJA 2F3CE 1GHBG 4K5ZA 1FNIA 2FYRA 1AFQC 3NZIA 5EXNA 1C1WH 2BD3A 3HATH 1Q2WA 2VVUA 1GBIA 3M7TA 1EAWA 1CSOE 1K1JA 1PYTC 1E34B 1OWDA 1N1LA 4I33A 5TCCA 1C2GA 2CV3A 2ZQ2A 4H4FA 3LU9B 1IQIA 2FESH 1O33A 4BAQB 3ZYEA 4D9QA 3U9AH 4UDWH 1AO5A 2I6QA 1ZLRA 1BOQA 2BYAX 2Y80A 2V3MA 1DDJA 1GMDF 4X1PU 4Y7AA 1XUIA 4I8KA 4INLA 5F8XA 5EW2H 2OBQA 2ZDLA 1TMTH 3M35A 4UFDH 4CBOA 3NKKA 1ELCA 5F53A 2O8LA 1FI8A 1PQ7A 1CGIE 2THFB 3GCHC 3KQCA 3SJIA 2FOHA 2SGDE 4A6LA 2HLCA 2WYJA 2EA3A 1DT2A 3OTPA 1BRUP 1EXFA 3E3TA 2P3UB 1C5OH 4BTIB 1L2EA 4K3JA 4X0WU 3SORA 2ZTYA 1GI4A 2KCOA 3BTEE 5DSFA 2GP9B 3GYMA 2H6MA 3C1KA 2W26A 3JZ1B 1O3HA 2QN5T 1NRSH 2ESTE 1C5RA 1EZQA 3PO1C 3SV9A 1O2VA 2GT7A 1ETSH 1WTGH 2FS8A 5E0HA 3L6PA 2CN0H 5DP7A 3TNTA 1QRXA 1HUTH 3VB5A 1O2WA 1JIRA 4HFPB 1QQUA 2BQ7B 4TWYA 3LH1A 1HAHH 3OFND 1QB1A 2B7DH 3VB7A 1HAXB 1PQ8A 2STAE 3LIWA 1XXFA 2ALPA 2BD5A 6LPRA 1SQRA 4GUXA 3RU4T 5A0AE 1G30B 1UTLM 4RSPA 4M7GA 3ZVCA 5B6OA 1DUEA 1O35A 3PV4A 3GOVB 5F8ZA 1LKAA 1TONA 4E7NA 2GJGA 4AB9A 3LONA 1H8HD 2BD4A 1TPAE 1GL1A 1LVYA 1L1JA 2D26C 2FOBA 5HXFA 3QLPH 2SGAA 1SQOA 3RUOA 3PRBA 1WBGB 1V3XA 2ZO3H 1BBRK 3MMGA 3FZDA 3SUEA 1UK4A 1Y5AT 1E35B 5FPSA 4XBBA 3F68H 1V2PT 4LZ1H 1KXAA 5DPAA 3MH7A 1KDQA 3RU4E 1C4U2 2JH5D 3SNCA 1T7CA 4GSOA 1ELDE 1TBQH 4K69A 1RIWB 3F2GA 3L33A 4AC9A 1SSXA 3VG8A 1ID5H 3N7DA 3H09A 5DP8A 2XW9A 7GCHF 4ABBA 3CNRA 3D65E 1BRAA 4DT7B 1F0TA 3UNSA 4YOJA 1H9LB 4ZKNU 3F3BA 4LZ4B 5CMXH 4YO9A 1UTOA 4WXVA 3SJOA 2TRMA 4D9RA 2FOFA 2G81E 2P94A 3HKIB 1AE8H 3DA9B 1GMCF 1OYQA 1UHBA 3ZVAA 2RCEA 1W0YH 3TJUA 2RG3A 1KMHB 4O03A 2GCTC 4Q2KA 1V2RT 1EJMA 1ARBA 2XYAA 4NIVA 2LP6A 1A0LA 2WSSD 4FVDA 2Z9JA 2QY0B 4CR5A 1SHYA 2BOHB 3AW0A 1TWXB 1G36A 2Z3DA 3M5OA 5J4QA 1CT4E 2AMQA 3LGIA 1ZGVA 5FL7D 4BANB 2ODPA 5C1UA 1NRQH 1TOCB 2OBOA 4YTAA 4SGAE 1E38B 1UW7A 1H9HE 1KDQB 1C5SA 1LVOA 1TRYA 5FAHA 1V2QT 1C9TA 1ELFA 2W6JD 5T3HA 4SGBE 4FU9A 3SHAH 5C67A 1H8ED 1OKXA 3H7OA 3MU1A 1O2KA 4IMQA 2Z9LA 1GMHF 5F03A 1TALA 1QZ8A 2AFQB 4GLYA 5E2PA 1S82A 4MQAA 1K0HA 2VWOA 2P8OC 3KQDA 2HVYB 1RIWC 2ODYB 4UFFH 5EGMA 1GI7B 1CA0B 2GX4A 3S9BA 2ZGXH 1FLEE 5DKMA 1GBDA 5GCHF 4D7FA 1ZPZA 1YM0A 2A2XH 4Y0YE 1LKBA 1YLCA 1MTSA 1A5IA 1C2KA 2BDYA 1TRMA 3MOCA 4WXIA 4BAHB 3P17H 1BTYA 1G3BA 2AGGX 1G2MA 4KTCA 2CK3D 3VXFH 1TX8A 4X2VA 3Q3XA 4RT0A 2PGQB 3STIA 2AGEX 1SG8B 4CRCA 1GBEA 1PPZA 1IHSH 1K2I1 1O5EH 2G4TA 3DT0H 4GCHG 1HAYB 4XRNA 2PUXB 2XC0A 1KTSB 1O31A 3GCTF 4B71A 3PROA 2BDBA 4AFQA 2OCVB 4AG1A 3BG8A 1S83A 1YYY1 2B0FA 1SLUB 1T32A 1ZMNA 2ZU4A 1GJ6A 3A86A 3UREA 1P3EA 2FP7B 1TOMH 3F2HA 4JYTA 3PWBA 3ZVFA 2EC9H 1P9UA 1KY9A 4X8UH 1C1VH 4LK4A 1ZSJA 4MVNA 2VH0A 3F2FA 3PYHA 1Y59T 2YMSD 2ZCKP 1GG6C 2BVXH 2FLBH 4P00A 1XX9A 4FUEA 3RM0H 3ZVDA 1ZHMA 3EA7A 1ANDA 1AB9B 1F5KU 3JZ2B 1QL9A 1UK3A 3B9FH 3FZZA 5L2ZH 3MNXA 1CA0C 4MG3A 2F43B 3RC4A 2G55A 2ODQA 3TJVA 4HGCA 2GT8A 1CO7E 1C1QA 1EOLA 1T31A 2AIPA 4P02A 2XCFA 4ZKRU 3KCGH 1PYTD 2ZF0H 3LPRA 3SI4H 1QBOA 2ZGCA 4MPWA 3UNRA 2F9OA 2WV5A 1AE5A 1QHRB 2BZAA 2FLRH 2HOBA 1P9SA 2J5UA 4RI0A 1C1RA 1P09A 1QA7A 4UONA 4XD7D 1FN6A 4A1XA 3RXOA 1O5GH 3NK8A 4BAOB 3BTME 1MD7A 2QAAA 5DG6A 3RP2A 1YCPM 1O2JA 1C2DA 2GZ8A 5F8TA 3SJ8A 3RXCA 5C20A 4CRAA 1XXDA 1ZZZA 1O3JA 2CXVA 2GMTC 1SGTA 1P8VC 1L4DA 2F9PA 2A4RA 1VKYA 2RDLA 5C1XA 1FIZA 5DP6A 2Z3EA 1THPB 4IGDA 1OP0A 2BX3A 4XDEA 1DWCH 2GCHF 3SU2A 1ZPBA 4I8LA 1NTPA 3M37A 2CHAB 3NRLA 1K22H 3FP7E 2UWPA 1HJ9A 3TJOA 1GHAF 1LVBA 3ZVEA 1GJAB 3A85A 1P03A 2TBSA 2A5IA 1SGCA 1C5MD 1IQLA 7KMEH 1AB9C 1TNKA 3NXPA 4ZKSU 1O3NA 1H8IH 1O2GH 5IK2D 3PMBB 1UK2A 4WMDA 1C5TA 2YNBA 3T62A 1NFYA 3U8TH 1DX5M 4DW2U 1W7GH 5IYTA 1OWKA 1S0QA 9LPRA 4HI3A 3QO6A 3UQOA 2CJIA 3TK9A 1O2XA 1JWTA 3MFJA 2FI4E 3KEEA 4MNXA 5EU8A 1TNGA 3QZRA 1L1NA 1WUNH 3FKSD 2GVFA 2HNTE 1EPTA 1AKSA 4CH8B 2ZDKA 1EX3A 1SVPA 1C5NH 4FUFA 3ZZBA 1VITG 1X7AC 4HTCH 1C1NA 1B7XB 2FIRH 3TGIE 1LHDH 2C8XB 2ZDVH 5EG4A 5FPYA 2B8OH 3ATLA 1O0DH 2ZDAH 5EQSA 3RXEA 2AS9A 2NU1E 1KXEA 3ZV8A 2P59A 2Y7ZA 4X1NU 3P8NA 2WZQA 3VPKA 1BUIA 1BBRH 1UO6A 1TMUH 2CHAC 2AMDA 1IQGA 4JZDH 3ODFA 4JK6A 2A45B 3VEQB 1ANBA 1S81A 2VGCB 2V6NA 2BD8A 2HNTC 5KECA 2CMYA 4O97A 3SV6A 2UUKB 3WW7A 4FUBA 4D7GA 5EJLA 2Y5GA 1WYKA 1D9IA 1HB0B 3SYJA 4GHTA 1CHOF 5A09A 1J8AA 2BY7X 2ZPQA 4MTBA 2ZQ1A 2YNAA 1FY4A 3K6YA 4FOUC 3MU0A 1TNIA 1HNEE 4XBCA 1UVUH 1O2NA 2JJ1D 8GCHF 1V2VT 1MZDA 3A8BA 3FP6E 6CHAC 1NY22 2FZZA 1AKSB 3MWIU 2TGPZ 2W7SA 4OS7A 1BB0B 1MKXK 1SQAA 3BEUA 3IG6B 1E1RD 1TA6A 1BHXF 1CT0E 1IQEA 4X6OA 2L74A 2OINA 1XMNB 2QXJA 2D2DA 1MMJN 1TPSA 1GJ9B 1W2KH 4ABJA 3TGJE 4DIIH 4WH8A 1C5YB 4GPGA 4X6MA 1K1IA 3A8AA 4NFEA 1ESAA 4AFUA 2R3UA 2BDIA 4NA7A 5CDFE 2BB4A 2XOKD 2KR7A 2EY4C 3CP7A 4Z1MD 2M2AA 2ZFFH 3EAJA 1BTPA 1W0ZU 4BXWA 1TAWA 1MTUA 4D8NA 1DANH 1AVGH 2BHGA 3MTYA 1VCWA 2PP6A 1XKAC 5EJZA 1AI8H 4B2BA 1XVOA 3PMHB 1XUJA 1DY8A 3I78A 3RXQA 2TGDA 3P8OA 4LXBH 4NIYA 4VGCC 3SU3A 3QGNB 1O2RA 1C5XB 2VVVA 3A87A 2VIDA 2H9EH 1A1RA 1TPOA 2JIZD 5C1YA 4BAMB 1QIXB 1P10A 3STJA 1PPGE 5GJ4B 3ODDA 4XOJA 3QK1A 4TT3D 2H5DA 5EXLA 3SO3A 5JB8S 3BTDE 1NU7B 3UB0A 3DCLA 1OWJA 1IQJA 3VFEA 1C4V2 2ZFPH 2R3YA 1EFRD 2G8TA 3BEFB 6GCHG 3GY2A 3DFLA 3MO3A 2FTMA 1HAIH 2FOMB 3TIUA 4DG4A 1C1TA 1ZOMA 1O3KA 3CS7A 3F0PA 2BX4A 1FY8E 1HYLA 4TWWA 1BTUA 1C1MA 4UFEH 3RMOH 2EEKA 1QJ6B 5EQQA 1MD8A 2JH0D 4FETA 2LNCA 2P95A 2SNVA 1LQDB 2BVSH 1TLDA 1HAZB 2W3KA 1QRWA 1C5VA 1CA8B 3VB4A 2FOCA 1DM4B 2PKAB 1BRCE 3A83A 3EYDA 4DT4A 4FUGA 3HGPA 1OOKB 4CRGA 3GY3A 3WWBA 2OXSA 1GJ4H 4ABEA 4X8TH 2FPZA 1G3EA 2FI5E 2WV4A 1GI3A 3HGNA 1P57B 2ZECA 2G5NA 2J4IA 1BMMH 3PLKA 2YOLA 3GY4A 3GICB 1ELEE 4X2WA 1OYTH 2QF5A 4Y8XA 5EODA 4IC6A 5IDKA 2KAIB 1ZR0A 1SKYE 1WV7H 4ZAEA 2Y81A 2ZKSA 1DFPA 2J97A 3PO1B 2Y82A 4KKDA 3A8DA 3M3VA 3QZQA 3SU6A 1YY3A 3SGBE 1P2NA 2DE8A 2BQ6B 3UTUH 3A8CA 1K1NA 2ZHFH 2FODA 2C8YB 2FM2A 2ZGJA 4UEHH 1GHBF 1COWD 2TGAA 1MBQA 2IJOB 1AWFH 3H5CB 1RD3B 2PWXA 4I86A 3R3GB 3E8LA 3TH4H 3AK5A 1YPGH 3DSOA 2ZHDA 1C1SA 2EI6A 1H9IE 2XRCA 4M9FA 5CHAC 5DP3A 4ZROA 4B74A 5LGOA 4X6NA 2BXTH 1YBWA 3M7QA 3ZIAD 1SQTA 1ESBA 1PPCE 1NM6A 4X1RU 1YWUA 5FXLA 1NESE 2QF4A 3AASA 3UFAA 1K1LA 3Q3YA 1EZUC 1MCVA 2A7JA 1O3AA 1WU1A 1GPZA 4IN2A 4K1SA 2XBWA 3ZZ3A 1P06A 1UTQA 1FONA 1GHVH 4B1TA 4FUIA 1BITA 4I32A 2ZPSA 4KELA 2F9BH 3OAAD 4A1VA 3SZEA 3MYWA 2G51A 4X8VH 5LPFA 4NA8A 1KTTB 3MU4A 5TCAA 2OC0A 1S84A 1ABJH 3RLWH 1U6QA 5AF9H 1LPKB 1YPMH 1AZZA 1RGQA 1S85A 1SLXB 2VNTA 3F9GA 2Q6GA 3A7YA 3T2NA 1OWIA 5DP9A 2A5AA 3I29A 2PKSB 2V7QD 1TNHA 1GHXH 2V35A 1NFWA 3UOUA 4K2YA 1LPGB 1LHFH 2ZFRH 1ETRH 2OUAA 2XCNA 1AVXA 3P8GA 3RXFA 4MLFB 1XM1A 1TRNA 4ASUD 5AFZH 2A5KA 3OEED 1G3DA 2GCTB 2IPHA 1P04A 1RXPA 3WWFA 2WV9A 5HM9A 3B23B 1AN1E 1O3FA 3ATIA 3UY9A 2FOAA 4WMEA 1GBAA 3SOSA 1DWEH 3PV2A 2O8UA 3MH5A 1IQNA 1QA0A 1WXRA 1O3IA 3GCNA 1S6FA 4OS2A 1V6DA 1A5GH 1ZJKA 2FX4A 1GBCA 2WPLS 2UUFB 1YPEH 3D49H 1NPMA 3E90B 1LCYA 1GI2A 1O5BB 1SLWB 2Q1JA 2ULLA 1CU1A 1VCPA 1O2YA 3RXUA 1GBFA 1BQYA 1WQVH 3MNCA 1V2TT 3QDZB 2P8OB 3KIDU 3ZVGA 4BOHA 4NFFA 2J92A 1GDUA 2ZDNA 1O3DA 3RXGA 1Z8RA 4ESTE 4IBLH 4GHQA 2JJ2D 1O37A 2XNIA 5EJ1A 1NBME 3ZZDA 2C90B 5A8ZA 1SLVB 3MHWU 2PKSC 1ANCA 2C93B 1B5GH 1MKXH 3LOXA 3GDVA 4NSYA 5LH8A 1A3EH 1UJ1A 4ZHMU 1TGBA 5EQRA 3OY6U 2K0QA 1GJBB 1W13U 1P2QA 1CQQA 3QWCH 3RXRA 4ABGA 1NFUA 5AHGH 1N6XA 4B2CA 4NIXA 3LDXH 1WTHD 2BTCE 1Z8JB 1GVLA 2KCYA 5A0BA 1GI6A 3VGCC 1GMCG 3F6UH 1VR1H 1TBRH 1IQHA 4X1SU 2BY9X 1Z6EA 1VCQA 3P95A 1FPHH 1C5WB 3BTQE 1LHGH 3TH3H 1QJ7B 2QF0A 3RXSA 5C94A 3ZZ5A 2VU8E 4KP0A 2VIVA 3Q00A 1BMFD 2V3OH 1GG6B 5JBBS 5GDSH 1V2NT 1AQ7A 1O3BA 4E05H 5ABWA 1AMHA 1T8NA 1P0SH 1P2OA 1Z71A 4AYVB 2ZIQH 3PTBA 3W1EA 1Z1JA 4BTTB 3FP8E 4TSFD 2HGTH 2KZ4A 2BVRH 1FN8A 4UD9H 1SR5C 1INCA 5DN6D 2GZ7A 2ANWA 3G01A 2PTCE 1BT7A 4OS4A 5JBTA 1C5UA 4NGAH 2J38A 2NU0E 1EZXC 1A7SA 1NC6A 3KGPA 4I8HA 2R2MB 5T6DA 4RN6A 3CS0A 1HCGA 4AN7A 3TGKE 1GBHA 3NPSA 1BTHH 3IITA 2ZA5A 1O2PA 3AAVA 2HLDD 1DSTA 1KSNA 2G5VA 5FHTA 1EJAA 3NWUA 2NU4E 2GMTB 1P3CA 1O2OA 1DVAH 1SGFG 2VVCA 1G9IE 1NRPH 4GCHF 1MQ5A 3ENSB 3NCLA 1J15A 4DJZB 2H9HA 3SQHE 2VWNA 2UUYA 4OGXA 2ALVA 5JB9S 4X2YA 2HNTF 1Y3VA 3T29A 1TBZH 2VINA 2PR3A 3AVZA 1ZGIA 2Y5HA 1OWEA 1FQ3A 4ABHA 1GBLA 1FX0B 3GS9A 3U28C 3K9XB 3S7HB 4XSKU 1A4WH 1O3LA 4YOIA 2ZG0H 4NWLA 3RMNH 2WHXA 4A5TS 1P01A 2Z6BD 5C2ZA 3M3SA 1AZ8A 1UTNA 4TYDA 2PW8H 4AGJA 4QT8C 3RXJA 5C0TA 2GZ9A 2ZFSA 2RFKC 1OSSA 1TGSZ 1OHHD 2VIOA 1O3PB 1C2EA 3PRDA 5JYIA 4I8GA 2WPKS 2I6SA 5I25A 2IN2A 2ZU5A 1O2IA 2SGFE 4MPUA 2ZGHA 3A7ZA 4B76A 1O2SA 1D6WA 3PMJA 3KQBA 3P92A 1DPOA 1BTWA 1BMLA 4K8YA 2OD3B 2KFWA 2FX6A 2WINI 4BAKB 1TNLA 1V2JT 1UCYE 5L30H 2TGTA 3W94A 3WY8A 1FZZA 1TGCA 3FOAA 1HIAB 2OQ5A 2Y5FA 1GJ7B 2XBYA 1XKBC 1J14A 1IAUA 2PV9B 2D8WA 5G4BA 1FDPA 3ATMA 1J17T 1DS2E 1ELGA 1EOJA 4ZKOU 2TIOA 4E7RG 4HZHA 2GCHG 4WJG2 2J98B 5CHBA 1DLEA 1Y3XA 2F91A 2P93A 1W7XH 2AEIH 2BLOA 2UUJB 3V7TA 4AYYB 3U1JB 1VJ9U 1GI1A 2ZDMA 1YCPK 1O38A 1TX7A 5GWZA 2A7HA 1C1UH 2BOKA 1QBVH 5ESTE 3BV9B 6CHAB 4NG9H 1CBWB 1O39A 3IWMA 5HGGA 2ZZUH 5AVDA 1NRRH 1HAOH 4F55A 3SHCH 1LHCH 2DE9A 2AGIX 4FUHA 1MZAA 1B0FA 2VWLA 1HXEH 2VBCA 3RXDA 5BPEA 1A5HA 1AIXH 1ETTH 1UVSH 1EB2A 1A2CH 1HJAB 1TQ0B 2ZPRA 3GISB 1THRH 2A7CA 2AMPA 1A3BH 2F4LA 4BNRA 5E0JA 1GDNA 1TGNA 1J9CH 3FFGA 3S9AA 2C8ZB 3ELAH 2A32A 3U8OH 3GY7A 4CHAC 2SGPE 3FAOA 4CRBA 4RT1A 3SV8A 2NU3E 3M3TA 4VGCB 1ZTKA 2Z9IA 3C27B 2BY5X 2ZNKH 4X8SH 1DY9A 1PPEE 2ZEBA 2BD7A 3D62A 2A31A 1LHEH 2H5CA 2ZP0H 4JZ1A 1RTKA 1IQMA 5KEDA 1FUJA 1AVWA 2GV6A 4JCNA 1QY6A 3GDUA 4IS5A 4K1EA 1E36B 1SFIA 3QTVH 3FVFB 1SGIB 1BRBE 1DITH 3SUDA 4F4OC 3EQ0H 1K1OA 1CBWC 2AYWA 1Y3UA 1HRTH 2DUCA 1D6RA 2QE7D 1G32B 3P70B 1H1BA 3W95A 3ZYDA 1QFKH 1NRNH 1SC8U 3PWCA 2R0LA 2BY8X 3LC3A 3BTFE 3Q76A 1FAXA 1HJAC 1SGYE 3M5MA 3UR6A 1DLKB 1O36A 1NBMD 2ZU3A 1KIGH 1QL7A 2QGRA 4ZXXH 4U2WA 2QV1A 1UMAH 3HK3B 2WPIS 3BTKE 1YPHE 4TY7A 2R2WU 4X2XA 1HAVB 4FU8A 7LPRA 4B6EA 1FV9A 1Y5BT 1W11U 1FY5A 2AERH 1NU9A 1EASA 1GWAA 1W10U 1SOTA 3SNEA 3Q3KA 1SGRE 3FANA 3SV2H 2PKAA 3OTJE 5FCKA 3LGWA 1AUJA 1JBUH 1T8MA 1WSSH 2W6ID 3BEIB 1BTXA 2FO9A 2O8WA 3TVJB 1F2SE 3TJNA 3MO6A 4DCDA 1F0SA 3BN9A 3BF6H 1MQ6A 4Y8ZA 2KCPA 2VH6A 1OP8A 1EAXA 3T5FH 1C5PA 1GJDB 3BG4B 2R9PA 5JDUB 1Z7KA 1P05A 1GDQA 3QTOH 1O3CA 1NT1A 1O5AB 2KAIA 1YPHC 3OE7D 4Y0ZE 3SU4A 4DGJA 2O8MA 5C0UA 3BIUH 3BTTE 1JRSA 1ZHPA 1EJNA 2ZC9H 2PFEA 3EGKH 3KQEA 3LC5A 4H6TA 1WCZA 3TK5A 2JDID 3PB1E 1NS3A 2F9VA 2Z94A 1IOEA 1DSUA 1QTFA 2OLGA 1SL3A 2W3IA 5HIYA 5A2MH 5CHAB 5T1VA 1OXGA 4WF8A 2BY6X 2J95A 1W8BH 3M5NA 3HK6B 2RA0A 3BSQA 3PLBA 1ELVA 4K8BA 3OY5U 3RMMH 1ZSKA 3OX7U 4MPXA 1KXFA 4UFGH 1IQFA 2A1DB 3U1IB 2SFAA 5L2YH 2ZHQH 1PPFE 1GHZA 1JRTA 1SMFE 1P2IA 3HPTB 3QX5H 3SUFA 3UAIC 5DP5A 1S5SA 4A7IB 1HAPH 4AFSA 2FXRA 1S0RA 4IN1A 5T6GA 2B9LA 3T28A 2OTVA 5DGJA 3SV7A 1V2KT 4NZQA 2CF8H 3A81A 1V2WT 1F0RA 1GHYH 2XXLA 1Z8GA 1PQ5A 3GY6A 4ISOA 4B2AA 1TB6H 2P3FH 2J2UA 4A92A 1GHWH 3SNDA 3UWJH 4YOGA 2J34A 1K28D 5DO4H 3BG4C 1Y5UT 1G3CA 1E79D 3SUGA 5GIBA 3SU5A 2XWBI 2P16A 3RXMA 4AGKA 5JBAS 4U30A 1TGTA 1MBMA 3RXLA 1UTPA 2BLVA 2K8IA 3Q77A 1N6YA 2ANYA 2OC7A 1BIOA 3DFJA 2GKVE 4ACBA 3UR9A 2A2QH 3NUMA 1AWHB 4AG2A 1ZJDA 3LGTA 1GBTA 2XBVA 1H4WA 1QR3E 2VWMA 3LH3A 4MPVA 5E8EH 3ATWA 8ESTE 5E0GA 1UTMA 1QRZA 1O5FH 1H8DH 1Y3WA 4WH6A 1C1PA 3ZZ4A 4ZH8A 3VB6A 1T4VH 2G00A 1MAXA 3KN2A 4DVAU 3A80A 2ANMH 1OX1A 1LTOA 3KF2A 1C2FA 3A7TA 3V13A 3OSYA 4Y76A 4ASHA 1DXPA 1GL0E 4Y71A 4ZXYH 1OP2A 2GTBA 1GMDG 1SI5H 3O8BA 1GCTB 1DOJA 4FVBA 2WUCA 3RMLH 1RJXB 4YM9A 2XC4A 1A61H 1MH0A 1GJ5H 1MTVA 1C2MA 2Y6TA 4ISNA 1VGCB 5EPNA 3F0OA 1JXPA 2VJ1A 3MU5A 2ZHEH 5HYOA 4B6FA 1KXCA 4U01A 1NROH 4CRFA 2Z7FE 1YCPH 2ZCLP 1OS8A 1RTLA 1ZYOA 2AHME 2CF9H 4YLUA 3UOPA 2C4FH 2PHBA 1ARCA 1MU6B 2OP9A 5PTPA 2BM2A 1B0EA 3V12A 1BZXE 1IQKA 1VJAU 1MUEB 4HG6A 4A1TA 3O8RA 1P11E 3ZZCA 4F49A 2HPPH 1ZTLA 2SNWA 1ELBA 1M9UA 1ZSLA 1VZQH 5ETXA 5GPIB 1SPJA 3DSPA 3GDSA 3LGUA 5FX5A 3B8JA 2OC1A 3TLOA 3PLPA 1BMAA 3EE7A 4JYVH 3ATKA 2Q6DA 1HGTH 1Z1IA 1SFQB 3VGCB 4WY3A 1C2JA 2H2ZA 2Z3CA 1OWHA 4IMZA 1GBBA 3EA8A 1W0KD 4ZHAA 3ZZ9A 1DWBH 2FOEA 3UUZA 3SJKA 3QGJA 2JETB 2RDEA 2EQNA 2UWOA 1BCUH 5KGOA 3E0NB 7ESTE 2ASUB 2XBXA 1SBWA 5EXMA 2PUQH 1HV7A 4WMFA 3TH2H 1DICA 1BTZA 1CE5A 3SBKA 2K1QA 4BTUB 1GCTC 4Y7BA 1ZMJA 2PGBB 2HRVA 3A7XA 1W0JD 1V2ST 4XBDA 1YF4A 3D23A 2QXIA 1DWDH 1ZRBA 3MO9A 5GXPA 3DSGA 2ILNA 5SGAE 1FXYA 1VGCC 1O2TA 1QB6A 1ZHRA 3LKWA 3EA9A 3A82A 2VIPA 3O8DA 2NU2E 1C5QA 1QJ1B 2A0QB 3RLYH 1O2ZA 1TIOA 1KYNA 1O2HA 1MABB 4ACAA 1ZRKA 3ZZ7A 2WPMS 4K60A 3MH4A 1T8OA 1VITH 2O9QA 3DD2H 2QYIA 4KTSA 1UVTH 1ELAA 4H42U 1JOUB 4AFZA 4X6PA 3ZZAA 2JH6D 4K1TA 1TPPA 7GCHG 2EI8A 1OPHB 4TPYA 4IW4E 2QCYA 5ESBA 1GI0A 3V3MA 2QF3A 3SGAE 3GCOA 4B75A 4AZ2B 3RDZA 1TQ7B 4I7YH 3A7WA 2ZWLH 1HFDA 5JPMH 1LVMA 2F9NA 1MKWK 2A4QA 1P2JA 3HKJB 3RM2H 4FXGH 2LPRA 3T26A 2LELA 3F9FA 2JETC 1AHTH 5H4IB 1LMWB 1QB9A 3M61U 1T4UH 3A88A 5LPRA 3UNQA 3RXIA 2XTTB 2UWLA 2GV7A 1TNJA 2SGEE 5AFYH 2FDAA 1MU8B 6ESTA 2FEQH 3R0FA 3QN7A 4B73A 5E2OA 1V2OT 4Z0KA 1D3TB 1TA2A 3UPEA 3A89A 2C8WB 2OK5A 1Z8IB 2HVXA 1E37B 1XUGA 5K0HA 1GMHG 1KLJH 1BBRE 1O3EA 1Y8TA 5GNDA 1YPKH 3K2UA 4XFQA 5C3NA 2BDHA 1AUTC 1WDIA 5DP4A 4OGYA 3AW1A 1GGDB 1W12U 4Y8YA 2BD9A 5HKKD 1LPZB 1QBNA 2FI3E 5GCHG 2NWNA 4CREA 4E06H 1QQ4A 1NZQH 2FS9A 3ITIA 2BLWA 4JZIA 1G37A 1RRKA 3KQ5A 3UQVA 1MTWA 1DUAA 4ABIA 2H1UA 1O3GA 1GJ8B 2G52A 2Q6FA 3SGQE 4ABDA 1YLNA 4O9VA 1GI8B 1HJ8A 1W14U 1W3CA 3TNSA 1ABIH 2AIQA 3SN8A 1UHBB 3K6ZA 1TE0A 4INHA 1KXDA 1TX6A 2WPHS 3S0NA 2F9UA 3OU0A 1SB1H 1P02A 3F9HA 3LGVA 1ANEA 3I77A 5CE1A 1EP5A 2KM0A 1UCYK 3E6PH 1F5LA 3GCTG 4CR9A 1UVOA 5C5NA 5EPYA 4TY6A 3M36A 2KX4A 4ABAA 3S7KB 1ACBE 1QNJA 2BDAA 3ZVBA 3MQKC 1HIAA 2IOTA 2QA9E 4YT7H 4Q4LA 4UE7H 1AU8A 3UWIA 5A0CA 1SGFA 2CGAA 1ORFA 5T6FA 4YXWD 4YZUA 2J98A 3BTGE 4CH2B 2XC5A 3VB3A 1FAKH 5DJ7A 4ZHLU 1GBMA 2FMJA 2BDCA 4J2YB 1C1OA 2KCAA 1FJSA 2WYGA 1PPBH 2XWAA 1A0JA 1P12E 2ZFTA 1GGDC 3S69A 4ISHH 3GYLB 2GDDA 4NSVA 2B5TB 4NCYA 2WUBA 4R0IA 4ZCNA 4THNH 3UIRA 3F9EA 5BRRE 5DK1A 4CRDA 1F92A 3SU1A 4AX9H 4ABFA 3AAUA 2G4UA 1WQSA 2ZTXA 3EDXB 4Y79A 1S6HA 3ESTA 4JK5A 4Q63A 3U69H 3N7EA 1YPJH 1N8OB 1IHTH 1Q3XA 4YT6H 1RTFB 3E16B 3V0XA 4CHAB 3BTWE 1HAGE 4TPIZ 4NA9H 1MAYA 1Y3YA 2ZHWH 1O2LA 4AOQA 1TMBH 4JMYA 4DY7B 1C2IA 1EZSC 3RXPA 3ZZ6A 3RXVA 5TJXA 4Z6AH 5EW1H 4GVUA 3SW2B 3SNAA 2D1JA 3RXKA 4WVPE 1THSH 4RKJB 1NO9H 1RS0A 1TABE 2WPDD 1GHAG 5B6LA 4MNYA 4CBNA 3FN8A 2FTLE 4Q80A 1LDTT 2FYQA 2ZFQH 2STBE 3QUMP 1GBJA 3MI4A 1O5CB 4FUJA 4BXSA 4ZMAH 4JYUH 2PLXA 1C5LH 1V2MT 4ISIH 3LGYA 1O32A 3PTNA 1MCTA 4OS1A 1V2LT 5C5OA 5EIYA 3E1XB 1YGCH 4YESB 4X1QU 3KL6A 4FUCA 1ELTA 1O3OA 5FBIA 2W7UA 3EE0B 1HPGA 3KHVA 1GBKA 5FCRA 1F7ZA 1L1GA 2IPQX 3H7TA 3MU8A 1UTKA 1EATA 1AFEH 1FY1A 1VITF 2Z9GA 1XVMA 2W5EA 1BJUA 1O2MA 2BMGB 1QURH
chains in the Genus database with same CATH topology
1HBTH 1DE7H 4O3TA 1XUFA 1N8OC 1YP9A 2OQUA 4JZEH 3A7VA 1C2LA 1WOFA 1CGHA 1HXFH 2GGVB 3TITA 4NIWA 2BZ6H 3RC5A 2HPQH 1BA8B 1C9PA 3URCA 1EB1H 1HAVA 1Q31A 4RKOB 8LPRA 2HWLB 1SGEE 3BTHE 4D76A 4DIHH 1EQ9A 1FPCH 4INKA 1NFXA 3MNSA 2ANKH 2A4GA 1GCDA 1UTJA 3U8RH 5J4SA 1LO6A 2P3TB 1AD8H 3P8FA 1K1MA 2J94A 4I31A 1EUFA 3RXHA 1DXWA 1SHHB 1PQAA 2F83A 2RA3A 2GDEH 5A8YA 1GI9B 1CHOG 2ZU1A 5HM2A 1L0ZA 1KXBA 4PROA 4MDSA 5LPEA 1MTNB 5JBCS 1C2HA 2VB0A 1EP6A 3LJOA 8GCHG 5I46H 5K7RA 1K9OE 4Q7YA 4WWYA 1C4Y2 4ISLA 1D4PB 1WAYB 1MKWH 1AGJA 1O3MA 1PFXC 4H6SB 1L4ZA 4Q7XA 3TPIZ 3K65B 1P2KA 1ZMLA 3RXTA 1TYNA 2BXUH 1EPTB 1P2MA 2BD2A 4FUDA 3L3TA 3PMAB 3OYPA 3RU4D 2M5TA 4Q7ZA 1YLDA 2GD4B 1PPHE 2QC2A 4R8TB 4FU7A 3SNBA 2ZCHP 2WPJS 1O30A 1A46H 1XUKA 3PM3A 4Y11E 1NN6A 4O3UA 2QXGA 3ZV9A 4NWKA 2VIQA 3CENA 1F0UA 2C3SA 2R0KA 1CHGA 3RC6A 1K21H 1QL8A 3M5LA 8KME2 1JMOH 1FIWA 1T8LA 1HLTH 1SGNE 1GVZA 3M7UA 4YLQH 4DURA 1J16A 2ZI2H 5A8XA 3DUXH 3N7OA 2AH4X 2PTNA 4XE4A 1V2UT 2JKHA 4IC5A 1SGPE 1D3DB 3TK6A 2VIWA 2J9NA 1CGJE 3A84A 1SGDE 2ZU2A 5EOKA 3ZZ8A 4Y10E 4OS5A 2QIQA 3E0PB 2HALA 2VGCC 1ESTA 5FPTA 1PJPA 2O8TA 1QCPA 3SQEE 1JIMA 5FBEA 5FX6A 4OS6A 3LT3A 2FOGA 3RXAA 4I8JA 1D3QB 1MTNC 2BLQA 2PSXA 1EKBB 6GCHF 4MNVA 2V0BA 2V3HH 4U32A 1QGFA 2OC8A 2BQWB 3RXBA 3SU0A 1HDTH 1AY6H 4AORA 2FWWA 3P6ZB 4Y6DA 1GJCB 3F1SB 3S9CA 1AFQB 4MNWA 1Z6JH 4KTUA 3T27A 2BDGA 1EAUA 2ZGBH 1EPTC 3O8CA 1FMGA 1GI5A 2A4OA 1UCYH 3BIVH 3GY5A 3GY8A 1BDAA 3E91A 1C5ZB 1LQEA 1CVWH 1TFXA 1K1PA 1O2UA 3KNXA 1KLTA 1E0FD 3SJ9A 1FY3A 2ZTZA 1KLIH 1EAIA 3TU7H 1SGQE 1BHXB 5HMAA 3LJJA 1XUHA 1G2LA 4AB8A 1RFNA 2H9TH 4ZUHA 3VXEH 3SZNA 4LOYH 4J1YA 2QXHA 1YPLH 2Z9KA 1YC0A 3GCHB 5L6NH 1O34A 3U98H 3URDA 2EI7A 2TPIZ 1D3PB 1O2QA 3SI3H 1SOZA 4NZLA 4KGAA 1ZPCA 1CT2E 1BMNH 1BJVA 9ESTA 4GAWA 2Y7XA 4JZFH 1YKTA 3T25A 4DOQA 2SGQE 1GVKB 1O5DH 3DHKH 1F5RA 5F6MA 3MNBA 1A0HB 1UVPA 3MH6A 2PSYA 1ZTJA 2F3CE 1GHBG 4K5ZA 1FNIA 2FYRA 1AFQC 3NZIA 5EXNA 1C1WH 2BD3A 3HATH 1Q2WA 2VVUA 1GBIA 3M7TA 1EAWA 1CSOE 1K1JA 1PYTC 1E34B 1OWDA 1N1LA 4I33A 5TCCA 1C2GA 2CV3A 2ZQ2A 4H4FA 3LU9B 1IQIA 2FESH 1O33A 4BAQB 3ZYEA 4D9QA 3U9AH 4UDWH 1AO5A 2I6QA 1ZLRA 1BOQA 2BYAX 2Y80A 1DDJA 1GMDF 4X1PU 4Y7AA 1XUIA 4I8KA 4INLA 5F8XA 5EW2H 2OBQA 2ZDLA 1TMTH 3M35A 4UFDH 4CBOA 3NKKA 1ELCA 2O8LA 1FI8A 1PQ7A 1CGIE 2THFB 3GCHC 3KQCA 3SJIA 2FOHA 2SGDE 4A6LA 2HLCA 2WYJA 2EA3A 1DT2A 1BRUP 1EXFA 3E3TA 2P3UB 1C5OH 4BTIB 1L2EA 4K3JA 4X0WU 3SORA 2ZTYA 1GI4A 3BTEE 2GP9B 3GYMA 2H6MA 3C1KA 2W26A 3JZ1B 1O3HA 2QN5T 1NRSH 2ESTE 1C5RA 1EZQA 3PO1C 3SV9A 1O2VA 2GT7A 1ETSH 1WTGH 2FS8A 5E0HA 3L6PA 2CN0H 5DP7A 3TNTA 1QRXA 1HUTH 3VB5A 1O2WA 1JIRA 4HFPB 1QQUA 2BQ7B 4TWYA 3LH1A 1HAHH 1QB1A 2B7DH 3VB7A 1HAXB 1PQ8A 2STAE 3LIWA 1XXFA 2ALPA 2BD5A 6LPRA 4GUXA 3RU4T 5A0AE 1G30B 1UTLM 4RSPA 4M7GA 3ZVCA 5B6OA 1DUEA 1O35A 3PV4A 3GOVB 5F8ZA 1LKAA 1TONA 4E7NA 4AB9A 3LONA 2BD4A 1TPAE 1GL1A 1LVYA 1L1JA 2D26C 2FOBA 5HXFA 3QLPH 2SGAA 1SQOA 3RUOA 1WBGB 1V3XA 2ZO3H 1BBRK 3MMGA 3FZDA 3SUEA 1UK4A 1Y5AT 1E35B 5FPSA 4XBBA 3F68H 1V2PT 4LZ1H 1KXAA 5DPAA 3MH7A 1KDQA 3RU4E 1C4U2 2JH5D 3SNCA 1T7CA 4GSOA 1ELDE 1TBQH 4K69A 1RIWB 3L33A 1SSXA 1ID5H 5DP8A 2XW9A 7GCHF 4ABBA 3D65E 1BRAA 4DT7B 1F0TA 3UNSA 4YOJA 1H9LB 4ZKNU 4LZ4B 5CMXH 4YO9A 1UTOA 4WXVA 3SJOA 2TRMA 4D9RA 2FOFA 2G81E 2P94A 3HKIB 1AE8H 3DA9B 1GMCF 1OYQA 1UHBA 3ZVAA 2RCEA 1W0YH 3TJUA 2RG3A 4O03A 2GCTC 4Q2KA 1V2RT 1EJMA 1ARBA 2XYAA 4NIVA 1A0LA 4FVDA 2Z9JA 2QY0B 4CR5A 1SHYA 2BOHB 3AW0A 1TWXB 1G36A 2Z3DA 3M5OA 5J4QA 1CT4E 2AMQA 3LGIA 1ZGVA 4BANB 5C1UA 2ODPA 1NRQH 1TOCB 2OBOA 4YTAA 4SGAE 1E38B 1H9HE 1KDQB 1C5SA 1LVOA 1TRYA 5FAHA 1V2QT 1C9TA 1ELFA 5T3HA 3SHAH 4SGBE 4FU9A 5C67A 1OKXA 3H7OA 3MU1A 1O2KA 4IMQA 2Z9LA 1GMHF 5F03A 1TALA 2AFQB 4GLYA 5E2PA 1S82A 4MQAA 2VWOA 2P8OC 3KQDA 2ODYB 1RIWC 4UFFH 5EGMA 1GI7B 1CA0B 2GX4A 3S9BA 2ZGXH 1FLEE 5DKMA 1GBDA 5GCHF 4D7FA 1ZPZA 1YM0A 2A2XH 4Y0YE 1LKBA 1YLCA 1MTSA 1A5IA 1C2KA 2BDYA 1TRMA 3MOCA 4WXIA 4BAHB 3P17H 1BTYA 1G3BA 2AGGX 1G2MA 4KTCA 3VXFH 1TX8A 4X2VA 3Q3XA 2PGQB 3STIA 2AGEX 1SG8B 4CRCA 1GBEA 1PPZA 1IHSH 1K2I1 1O5EH 2G4TA 3DT0H 4GCHG 1HAYB 2PUXB 2XC0A 1KTSB 1O31A 3GCTF 4B71A 3PROA 2BDBA 4AFQA 2OCVB 4AG1A 3BG8A 1S83A 1YYY1 2B0FA 1SLUB 1T32A 1ZMNA 2ZU4A 1GJ6A 3A86A 3UREA 1P3EA 2FP7B 1TOMH 4JYTA 3PWBA 3ZVFA 2EC9H 1P9UA 1KY9A 4X8UH 1C1VH 4LK4A 1ZSJA 4MVNA 2VH0A 3PYHA 1Y59T 2ZCKP 1GG6C 2BVXH 2FLBH 1XX9A 4FUEA 3RM0H 3ZVDA 1ZHMA 3EA7A 1ANDA 1AB9B 1F5KU 3JZ2B 1QL9A 1UK3A 3B9FH 3FZZA 5L2ZH 3MNXA 1CA0C 4MG3A 3RC4A 2G55A 2ODQA 3TJVA 4HGCA 2GT8A 1CO7E 1C1QA 1EOLA 1T31A 2AIPA 2XCFA 4ZKRU 3KCGH 1PYTD 2ZF0H 3LPRA 3SI4H 1QBOA 2ZGCA 4MPWA 3UNRA 2F9OA 2WV5A 1AE5A 1QHRB 2BZAA 2FLRH 2HOBA 1P9SA 1C1RA 1P09A 1QA7A 4UONA 1FN6A 4A1XA 3RXOA 1O5GH 3NK8A 4BAOB 3BTME 1MD7A 2QAAA 5DG6A 3RP2A 1YCPM 1O2JA 1C2DA 2GZ8A 5F8TA 3SJ8A 3RXCA 5C20A 4CRAA 1XXDA 1ZZZA 1O3JA 2CXVA 2GMTC 1SGTA 1P8VC 1L4DA 2F9PA 2A4RA 2RDLA 5C1XA 1FIZA 5DP6A 2Z3EA 1THPB 4IGDA 1OP0A 2BX3A 4XDEA 1DWCH 2GCHF 3SU2A 1ZPBA 4I8LA 1NTPA 3M37A 2CHAB 1K22H 3FP7E 2UWPA 1HJ9A 3TJOA 1GHAF 1LVBA 3ZVEA 1GJAB 3A85A 1P03A 2TBSA 2A5IA 1SGCA 1C5MD 1IQLA 7KMEH 1AB9C 1TNKA 3NXPA 4ZKSU 1O3NA 1H8IH 1O2GH 3PMBB 1UK2A 4WMDA 1C5TA 2YNBA 3T62A 1NFYA 3U8TH 1DX5M 4DW2U 1W7GH 5IYTA 1OWKA 1S0QA 9LPRA 4HI3A 3QO6A 3UQOA 2CJIA 3TK9A 1O2XA 1JWTA 3MFJA 2FI4E 3KEEA 4MNXA 5EU8A 1TNGA 3QZRA 1L1NA 1WUNH 2GVFA 2HNTE 1EPTA 1AKSA 4CH8B 2ZDKA 1EX3A 1SVPA 1C5NH 4FUFA 3ZZBA 1VITG 1X7AC 4HTCH 1C1NA 1B7XB 2FIRH 3TGIE 1LHDH 2C8XB 2ZDVH 5EG4A 5FPYA 2B8OH 3ATLA 1O0DH 2ZDAH 5EQSA 3RXEA 2AS9A 2NU1E 1KXEA 3ZV8A 2P59A 2Y7ZA 4X1NU 3P8NA 3VPKA 1BUIA 1BBRH 1UO6A 1TMUH 2CHAC 2AMDA 1IQGA 4JZDH 3ODFA 4JK6A 2A45B 3VEQB 1ANBA 1S81A 2VGCB 2V6NA 2BD8A 2HNTC 2CMYA 4O97A 3SV6A 2UUKB 4FUBA 4D7GA 2Y5GA 1WYKA 1D9IA 1HB0B 4GHTA 1CHOF 5A09A 1J8AA 2BY7X 2ZPQA 4MTBA 2ZQ1A 2YNAA 1FY4A 3K6YA 3MU0A 1TNIA 1HNEE 4XBCA 1UVUH 1O2NA 8GCHF 1V2VT 1MZDA 3A8BA 3FP6E 6CHAC 1NY22 2FZZA 1AKSB 3MWIU 2TGPZ 2W7SA 4OS7A 1BB0B 1MKXK 1SQAA 3BEUA 3IG6B 1TA6A 1BHXF 1CT0E 1IQEA 4X6OA 2OINA 1XMNB 2QXJA 2D2DA 1MMJN 1TPSA 1GJ9B 1W2KH 4ABJA 3TGJE 4DIIH 4WH8A 1C5YB 4GPGA 4X6MA 1K1IA 3A8AA 4NFEA 1ESAA 4AFUA 2R3UA 2BDIA 4NA7A 2BB4A 3CP7A 2ZFFH 3EAJA 1BTPA 1W0ZU 4BXWA 1TAWA 1MTUA 4D8NA 1DANH 1AVGH 2BHGA 3MTYA 1VCWA 1XKAC 1AI8H 4B2BA 1XVOA 3PMHB 1XUJA 1DY8A 3I78A 3RXQA 2TGDA 3P8OA 4LXBH 4NIYA 4VGCC 3SU3A 3QGNB 1O2RA 1C5XB 2VVVA 3A87A 2VIDA 2H9EH 1A1RA 1TPOA 5C1YA 4BAMB 1QIXB 1P10A 3STJA 1PPGE 5GJ4B 3ODDA 4XOJA 3QK1A 2H5DA 5EXLA 3SO3A 5JB8S 3BTDE 1NU7B 1OWJA 1IQJA 3VFEA 1C4V2 2ZFPH 2R3YA 2G8TA 3BEFB 6GCHG 3GY2A 3DFLA 3MO3A 2FTMA 1HAIH 2FOMB 3TIUA 4DG4A 1C1TA 1ZOMA 1O3KA 3CS7A 2BX4A 1FY8E 1HYLA 4TWWA 1BTUA 1C1MA 4UFEH 3RMOH 2EEKA 1QJ6B 5EQQA 1MD8A 2JH0D 2LNCA 2P95A 2SNVA 1LQDB 2BVSH 1TLDA 1HAZB 2W3KA 1QRWA 1C5VA 1CA8B 3VB4A 2FOCA 1DM4B 2PKAB 1BRCE 3A83A 3EYDA 4FUGA 3HGPA 1OOKB 4CRGA 3GY3A 2OXSA 1GJ4H 4ABEA 4X8TH 2FPZA 1G3EA 2FI5E 2WV4A 1GI3A 3HGNA 1P57B 2ZECA 2G5NA 2J4IA 1BMMH 3PLKA 2YOLA 3GY4A 3GICB 1ELEE 4X2WA 1OYTH 4Y8XA 5EODA 4IC6A 5IDKA 2KAIB 1ZR0A 1WV7H 4ZAEA 2Y81A 2ZKSA 1DFPA 3PO1B 4KKDA 2Y82A 3A8DA 3M3VA 3QZQA 3SU6A 3SGBE 1P2NA 2DE8A 2BQ6B 3UTUH 3A8CA 1K1NA 2ZHFH 2FODA 2C8YB 2FM2A 2ZGJA 4UEHH 1GHBF 2TGAA 1MBQA 2IJOB 1AWFH 3H5CB 1RD3B 2PWXA 3R3GB 3E8LA 3TH4H 1YPGH 2ZHDA 1C1SA 2EI6A 1H9IE 2XRCA 5CHAC 5DP3A 4B74A 4ZROA 5LGOA 4X6NA 2BXTH 1YBWA 3M7QA 1SQTA 1ESBA 1PPCE 1NM6A 4X1RU 5FXLA 1NESE 3AASA 3UFAA 1K1LA 3Q3YA 1EZUC 1MCVA 2A7JA 1O3AA 1WU1A 1GPZA 4IN2A 4K1SA 2XBWA 3ZZ3A 1P06A 1UTQA 1FONA 1GHVH 4B1TA 4FUIA 1BITA 4I32A 2ZPSA 4KELA 2F9BH 4A1VA 3MYWA 2G51A 4X8VH 5LPFA 4NA8A 1KTTB 3MU4A 5TCAA 2OC0A 1S84A 1ABJH 3RLWH 1U6QA 5AF9H 1LPKB 1YPMH 1AZZA 1RGQA 1S85A 1SLXB 2VNTA 3F9GA 2Q6GA 3A7YA 3T2NA 1OWIA 5DP9A 2A5AA 3I29A 2PKSB 1TNHA 1GHXH 2V35A 1NFWA 3UOUA 4K2YA 1LPGB 1LHFH 2ZFRH 1ETRH 2OUAA 2XCNA 1AVXA 3P8GA 3RXFA 4MLFB 1XM1A 1TRNA 5AFZH 2A5KA 1G3D<