1QBOA

Bovine trypsin 7-[[6-[[1-(1-iminoethyl)piperidin-4-yl]oxy]-2-methyl-benzimidazol-1-yl]methyl]naphthalene-2-carboximidamid zk-806711 inhibitor complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title Crystallographic analysis of potent and selective factor Xa inhibitors complexed to bovine trypsin.
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qboA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qboA02
1YCPK 2BY5X 2PUQH 2CJIA 3ODFA 1Z8JB 2A31A 1S81A 3L6PA 3B23B 3S9AA 1GGDB 1SGNE 2ZZUH 1SC8U 2CXVA 5DP5A 5GDSH 1HYLA 5AF9H 2Z3EA 1DFPA 2BD5A 4K1SA 1BHXF 4ABIA 3Q3YA 4CRFA 1O2HA 1HGTH 3AW0A 5LH8A 1HAOH 2BLQA 1YPHE 2FP7B 2SNWA 1ZSLA 1Y3VA 5DKMA 5JYIA 1GI8B 4H6TA 1EAUA 1WTGH 4A1XA 5JB8S 1V2RT 4KKDA 1LCYA 3GCNA 5DP7A 5J4QA 3RXJA 2R0KA 1MKWH 3DHKH 1KXFA 1GDQA 3IWMA 2AGEX 1DITH 1BDAA 1GBHA 2V6NA 2LPRA 1IQMA 2FS9A 4F49A 2BZAA 1LHFH 2P3TB 2QA9E 2J38A 1THRH 1HJ9A 6CHAC 1J8AA 1FY1A 1O3DA 1XUIA 1P2JA 4ZXYH 1FY5A 5C1YA 3MO3A 1WQSA 2P95A 3A7YA 6GCHF 4IC6A 1ZGIA 1SLUB 3ZZ8A 2XC5A 3QZRA 5GIBA 2ZFPH 1AHTH 1Z8GA 4ISOA 1NFUA 3SUFA 2GZ9A 5H4IB 4K5ZA 4Y7BA 3KHVA 3P8GA 3LJJA 1C1SA 3Q3XA 1DS2E 1LO6A 3SNDA 2IPHA 3RC6A 2P94A 5DP6A 1C5TA 1GHBF 1UCYK 1DLKB 4WMFA 5F8ZA 2KAIA 1BRUP 3VPKA 1ETRH 3UIRA 4D7GA 1UK2A 3I29A 1O30A 3E90B 1TGBA 1AE5A 4MQAA 1LVOA 2J95A 4UFDH 1GBJA 1K1JA 3U8RH 4ASHA 3V13A 5ETXA 2PTNA 3E8LA 4ISIH 4XBBA 1XUFA 1TAWA 1J9CH 4WF8A 4CRAA 1BT7A 3VB4A 1JIRA 1GBTA 2JH0D 2P8OC 1UK4A 3D65E 3UR6A 3M37A 2VIWA 1C5ZB 4GAWA 1UVPA 1YCPM 1C5PA 2P93A 2O8MA 1UTJA 1T31A 4Q7XA 1T4UH 1GWAA 4E06H 1TBZH 1OP2A 5FPTA 1C5OH 3SQEE 5EW2H 1KXBA 1YBWA 3GOVB 4YT6H 1WYKA 1W0ZU 1LVBA 2XXLA 1QGFA 3MH6A 2C8WB 1ZPBA 2QXGA 1C1NA 2GZ7A 3MU0A 1P11E 1GCTC 3UNQA 2YOLA 2TIOA 4INKA 1SHHB 4DJZB 1D6WA 2GDEH 1OP8A 1WV7H 2J34A 4LZ1H 1T8MA 2BLVA 2HLCA 4YLQH 1D4PB 2V0BA 3BTGE 1GG6B 1T4VH 2BY7X 1FN8A 2Z9IA 3BTKE 1GMCG 2ULLA 2ZI2H 5BRRE 1B7XB 4OS4A 1KSNA 2PKSC 4JZIA 1QRZA 1OYQA 1P8VC 1AD8H 5JBCS 1KDQB 2H9HA 1BQYA 2BD4A 3ZV9A 1HAZB 1Q2WA 2VVVA 3TJVA 1Y3UA 3ZZAA 3V12A 5FCRA 1A0LA 5FBIA 1EJMA 1C2JA 4CHAC 4BAMB 4YOGA 2ODYB 1OKXA 2QV1A 1DUEA 1VCQA 4NFFA 1O2JA 1W12U 3BG8A 3STIA 3LPRA 2CF8H 4WH6A 2BVXH 3E3TA 1L0ZA 1CSOE 3MNCA 4IBLH 1P2IA 1QCPA 4DIHH 1P2MA 1IQEA 1GJ4H 1MKWK 2ZWLH 3V7TA 1GI5A 5F8TA 2PWXA 2GT7A 1DX5M 3A84A 1PYTC 1CA0B 1SQTA 4OGYA 1O3EA 3DT0H 3QTVH 4Q7YA 1MZAA 4AB8A 2TGPZ 1O3JA 4NIWA 4B2BA 1NPMA 1ARBA 2A5KA 3E0NB 3A85A 3RLWH 1C5YB 3A87A 3RXQA 3KF2A 1L1NA 5TJXA 1BTWA 1CO7E 1GJ9B 3UFAA 4Y8ZA 3LDXH 1EUFA 1P09A 1RTLA 1ZSJA 1SLXB 1ZHRA 2W5EA 3OSYA 2GTBA 4E7RG 3PROA 2BXTH 3M7QA 1PFXC 2BM2A 8GCHG 3F6UH 3FVFB 2BD2A 3M3VA 1XKBC 3A83A 2QF3A 4OS2A 4X6MA 4ZHLU 3UY9A 2G5NA 1EJAA 2ZFFH 4Y11E 1TGNA 2ZDNA 2BVRH 3KQCA 5L2ZH 1O2MA 1H9LB 4CR9A 2WPKS 3TVJB 1E38B 1IHSH 2ASUB 1EASA 1N6YA 2VWNA 1UTMA 4NA8A 2Y5FA 1G3EA 4ZROA 2H9EH 4CRBA 2PSXA 1FIZA 1VCPA 4U32A 1ZMLA 3PWBA 2ZDKA 4I8LA 2ZO3H 2VU8E 2UUJB 2ANWA 5DK1A 1L2EA 3SQHE 4WVPE 2EC9H 5GCHF 3UWIA 1A7SA 3HGNA 1MBMA 5GJ4B 1MAYA 3M36A 1GJ6A 1XVOA 3AASA 3BG4B 3UOUA 1YLDA 4BTIB 2ZHDA 4YM9A 5JDUB 2R3UA 1XVMA 1O5DH 1W11U 3SU0A 1CGJE 4AFSA 2ZU1A 3RMOH 3LT3A 1BZXE 3M5OA 3U1JB 3W95A 2AEIH 2Y7ZA 1P2OA 4KTSA 5FPYA 1RRKA 4XE4A 3SJKA 3ZVFA 4AFQA 1CGIE 5J4SA 1INCA 5A8YA 1AVXA 1TPSA 4HI3A 1PPFE 3E16B 1TIOA 1AB9C 3KN2A 4MTBA 3TGJE 5DG6A 4A92A 2H1UA 1IQHA 2QC2A 1TMBH 3GYMA 1W14U 2NWNA 1O3PB 3ESTA 1GI2A 3ZVAA 5CMXH 1QURH 4E7NA 1Z8RA 2AS9A 1LPZB 2C4FH 3LGVA 2W3IA 4A6LA 1MTUA 1QNJA 3ZZ6A 6ESTA 4JMYA 1E0FD 1OWIA 1X7AC 2GT8A 2BD9A 1C1MA 1IAUA 1DXWA 1HIAB 3EE0B 1EAIA 3OY5U 2ZQ1A 3M35A 4AX9H 1PQ5A 3RMLH 1H8IH 1SFQB 1VITF 1TA2A 2G8TA 2QCYA 2A5IA 1ID5H 1DT2A 2FWWA 1LKAA 3U69H 2J94A 3RXKA 9LPRA 5JBTA 5SGAE 1EAXA 3SOSA 2FO9A 1BUIA 2FI5E 2F9VA 1TQ0B 4D9RA 3M7UA 1S83A 1MTNC 1EOLA 4INLA 1PYTD 1J14A 1SI5H 1S82A 2A2QH 3RDZA 1SR5C 3BTTE 2ZU5A 2JETB 3S69A 5FXLA 2RG3A 4AOQA 3RU4D 2XWBI 1HXFH 1F5KU 1TNGA 1SGEE 5CHAB 2BX3A 1A61H 1HBTH 4ESTE 1C5WB 1CU1A 3CS0A 3VB6A 3RUOA 1HCGA 3ZZ5A 1AB9B 2ZP0H 1A2CH 4KELA 1YLCA 1LDTT 1ZRBA 1Y3WA 2C8YB 3A80A 2Y80A 1F7ZA 1MQ5A 1V2OT 1C9PA 1V2MT 2FESH 1ANBA 3TK9A 4DT7B 4YLUA 1FN6A 1XM1A 1SGTA 1O33A 4I8KA 2GDDA 3PWCA 4OS7A 5EGMA 1HUTH 1Z1JA 2XBVA 2UUKB 5DP9A 2ALPA 2BY6X 1FJSA 2FOFA 1GBBA 3L3TA 4H4FA 1HAVB 1BTZA 1YPEH 1QQ4A 3ZZBA 5LPFA 3K6YA 4AG1A 4ZHMU 1O31A 4TY6A 1O35A 5T6GA 4XBDA 1K22H 5F6MA 6LPRA 3S9BA 1AVWA 1O2VA 1O2TA 1ORFA 1Z6JH 3NKKA 3F9FA 3ZZ3A 5DP4A 1TFXA 5EQRA 2G52A 7LPRA 1BCUH 3GY8A 2GMTB 3ZVEA 1S6FA 1BBRE 2ZFTA 5EXLA 1V2QT 1ZHPA 1FY8E 4R0IA 1QJ7B 2VIDA 3A7XA 3M3SA 3PLKA 3MHWU 4YOIA 3BEIB 2QY0B 4IMZA 1RFNA 4Y7AA 3SI4H 4I33A 2A4OA 4O3UA 1O3CA 4KGAA 1DVAH 1LHDH 1V2LT 2Y82A 3L33A 1E37B 1ELDE 2A7HA 1S5SA 1XUJA 2CN0H 3LH1A 3PV4A 3BV9B 5A0CA 3ZV8A 9ESTA 3LH3A 5L30H 5EQQA 4VGCC 3UQOA 2STAE 3GDUA 2O8WA 1AIXH 1FMGA 4MPXA 1DSTA 4MNXA 2Q6DA 3HKIB 4IC5A 3TJUA 1C2EA 1XUHA 4A1VA 1QL8A 1O2GH 3D49H 4FUHA 1TGCA 3IITA 2P3UB 1DWDH 2BZ6H 1C4Y2 3S0NA 1ARCA 2C90B 1ELTA 2FOCA 1EPTB 3UREA 1LTOA 1O2PA 3K2UA 2HNTF 1YM0A 2ILNA 3LGTA 1O39A 3M5MA 3QX5H 4ZKNU 2AIQA 1SFIA 4OS5A 1L4DA 2O9QA 1RXPA 1LPGB 3T5FH 2XWAA 2PW8H 2CV3A 3RXCA 4B1TA 3MO9A 1Q3XA 1GHYH 3BEUA 3VGCB 4DURA 1N6XA 4FUEA 2NU0E 4YESB 2BMGB 2J4IA 2J9NA 4ABJA 1GI3A 1ELVA 1P9UA 5E2PA 4X6OA 1GBMA 3VB7A 6GCHG 1MD8A 2FM2A 4O3TA 3AVZA 3PMJA 3RXVA 4WXIA 5K0HA 2UUYA 3RLYH 1C5QA 1O5CB 3LONA 4I32A 4MDSA 3VEQB 1CGHA 1DE7H 1EJNA 3S7KB 4ZKSU 1ELGA 1G37A 3TNTA 1GHBG 1O0DH 1T8OA 1UK3A 1O2WA 1UTOA 2ZDMA 2WV5A 4VGCB 3QN7A 4A7IB 3RXGA 4XBCA 2UWOA 4AYYB 1GL1A 3SNAA 1O3MA 2ZQ2A 4HZHA 3SGBE 1TNJA 4AFUA 5C5NA 4FUFA 1C5NH 1GJ7B 1LMWB 1NFYA 4PROA 4CRCA 5GWZA 3A86A 3QK1A 4JYUH 4UFFH 3R0FA 3GDVA 4MNYA 4ZAEA 2THFB 2TGTA 1Y3YA 5A0AE 4B75A 2O8TA 1UHBB 3A8DA 4HGCA 4X1RU 2F91A 4K1EA 3SV7A 1G2MA 1WAYB 1CT2E 1G3BA 4K1TA 1MBQA 2G51A 3T25A 2HNTC 3MH7A 5DPAA 1Z71A 5K7RA 1AY6H 3V3MA 1YPKH 8KME2 1QHRB 3SV9A 2VWLA 2W7UA 1AZ8A 1V2UT 5FHTA 3H7OA 1IQIA 1ANCA 1JIMA 1JMOH 1NO9H 2AIPA 1P0SH 1O5EH 3PTBA 4NIXA 1QBOA 1P03A 1NT1A 1Y5UT 1V2KT 1HJAC 2OC0A 3GY3A 2Y5GA 1P9SA 2BDHA 1GVKB 1EZUC 1XUKA 2BQ7B 2DE9A 4WH8A 2FOAA 2SGAA 4CH8B 2FEQH 1HJ8A 3TNSA 2BOHB 1Z7KA 2GD4B 3RU4E 1EKBB 2FXRA 2P59A 4I8GA 3H7TA 3DFJA 1TMUH 1GPZA 3G01A 1OYTH 2H2ZA 4JZFH 3GISB 3PYHA 4IW4E 1C1OA 3UR9A 1AKSB 2FDAA 2PGBB 2GCHF 2PFEA 3TH3H 5ESBA 1AQ7A 1OWKA 3KIDU 1LHGH 2FODA 1KY9A 1BMLA 1MU6B 1ZTKA 1GG6C 2B9LA 3UNRA 1L1GA 2XTTB 3TPIZ 1BTYA 1DPOA 5C5OA 1CHGA 1BB0B 2AGIX 4ABDA 1QL7A 4IN1A 5HXFA 1C2MA 1ELBA 5F03A 4ABBA 2AYWA 3QGNB 4ISLA 4JK5A 1C2FA 3BTEE 2JH6D 2ZHEH 1HJAB 2PKAB 2ZIQH 1TNHA 2BDGA 2G5VA 1RJXB 3MU5A 1GMHF 1NRRH 1QB6A 1YP9A 4AB9A 3HGPA 1YC0A 4UFEH 4GLYA 1O2XA 4U2WA 1P02A 4BXWA 2G4UA 3MWIU 1AO5A 3HATH 3P8NA 1J15A 1YF4A 2A2XH 2ANYA 1J16A 2O8UA 4MVNA 3TH2H 4JCNA 5C2ZA 2CGAA 1YYY1 2H6MA 1CA0C 1DWBH 1LHCH 1K1OA 2ZGCA 4JZEH 2VH0A 2OCVB 2BDBA 5ESTE 5C67A 5EOKA 1PPZA 1E36B 2CMYA 2GVFA 2TRMA 1LKBA 1W10U 4IN2A 1HV7A 4INHA 4BXSA 2B8OH 1NFWA 4X6PA 4JZDH 3ZYDA 1N1LA 4NSVA 5GCHG 1ZLRA 1YPGH 1FPCH 3SBKA 3PB1E 2ZU2A 1ESAA 2NU2E 1PQAA 1BMNH 2XBWA 1EP5A 1K2I1 1RTFB 1O5AB 4WY3A 3TJNA 4X0WU 3ZZDA 3A7VA 4Y71A 1P2NA 1K1IA 2F9NA 1D6RA 2VINA 3B8JA 3GDSA 1QIXB 1TOCB 1TPOA 1QL9A 1GHVH 1O2RA 1ELEE 1O5BB 3P6ZB 3RXUA 1IOEA 3MNSA 1LVMA 1D3DB 2ZCLP 4Y76A 1E34B 1Z8IB 1OSSA 1C2HA 3RM0H 1EOJA 2ALVA 3P8FA 2ZKSA 2R3YA 5LGOA 1O2ZA 1PPCE 2DE8A 1Y8TA 4R8TB 1GJ5H 2ZDLA 3RC4A 3SGAE 1WBGB 2NU4E 3BTFE 1NRPH 1GBFA 3BG4C 4ZHAA 4THNH 1FONA 5T6DA 2V3OH 1TRMA 1TOMH 3AAVA 2F9PA 2FI4E 1P04A 3SUGA 1VITG 1BA8B 2FI3E 1SPJA 1F5LA 2BYAX 2GV7A 1BBRH 3ZVBA 3A8CA 2XC0A 4FU8A 2HOBA 2OUAA 1CE5A 4XFQA 4Y8YA 7ESTE 1BRAA 5AFYH 1N8OB 2PR3A 3A82A 1MD7A 3Q00A 5HMAA 1O38A 4FXGH 3E6PH 3SV6A 4HFPB 1ZZZA 3TK5A 4NFEA 1O2LA 4NG9H 4WMEA 2FS8A 1TRYA 1W7GH 1TX6A 2QAAA 2WPIS 2C8XB 3PMBB 4FVDA 4NGAH 1AGJA 1DY9A 1YPLH 2IJOB 4IMQA 2AH4X 1TPAE 5EPNA 4UEHH 1FQ3A 3P92A 3ZYEA 2ZPSA 1FUJA 3PMHB 4ZUHA 3LC5A 1A0JA 3GCTF 1JRSA 1S6HA 1K1PA 4BAKB 1NU9A 1CT4E 2ZPQA 1MQ6A 1YPMH 2G00A 1E35B 2G81E 2A1DB 2SGFE 1H9IE 3O8DA 5DP8A 3DA9B 2Q6GA 1NC6A 2Z9KA 5I25A 1UO6A 2F83A 1MU8B 1Q31A 4TWWA 1ESBA 1HAYB 1DXPA 3BTDE 1O3OA 1ELFA 1GHXH 3M61U 1QBVH 1BRCE 2Z9GA 2JETC 2ZC9H 3W94A 4K60A 4TY7A 2RA3A 1D9IA 3T28A 5AFZH 7GCHF 1CHOF 1GVLA 3TGIE 1NM6A 5CHAC 3FFGA 2FMJA 4NSYA 2J2UA 4A1TA 1GI7B 1TPPA 2WYGA 4H6SB 3PLPA 1G30B 1SGDE 3U8TH 5TCAA 1IQLA 3VFEA 1WSSH 1Z6EA 2GCTC 5AHGH 1FPHH 2RDLA 4CBOA 3Q76A 2AERH 1KDQA 1CT0E 4DIIH 2J92A 3EA7A 1XKAC 1UJ1A 3K6ZA 1NESE 1IQJA 3MH4A 4RN6A 3BIUH 3SU2A 1PQ7A 4ABFA 4AG2A 5FCKA 1OWHA 1TQ7B 5C20A 2BTCE 1SGQE 1KXDA 3LKWA 1MAXA 1QRWA 3GCHB 1KTTB 1ESTA 1MZDA 3AAUA 3BN9A 1F5RA 1A4WH 1LVYA 1W0YH 2DUCA 1TABE 2VIOA 3FZDA 4I8HA 1FY3A 1XXFA 2HGTH 1FZZA 1SQOA 3RXLA 3SORA 1HAXB 1D3PB 2GMTC 5C1XA 3QDZB 1AN1E 1P2KA 5GXPA 1OXGA 3EA8A 1ZTLA 3EAJA 1S84A 4K3JA 3T26A 1NROH 3LGYA 1G3DA 1ANDA 1T8LA 2PV9B 5PTPA 3EGKH 5T3HA 1O3AA 1KIGH 3LOXA 1SBWA 3VXEH 1DY8A 4J1YA 3F9HA 1O5GH 1GJAB 3UOPA 1PPGE 4O03A 1UTNA 1V2PT 4ABGA 1QB9A 2GCTB 1CBWC 2QGRA 2YNAA 2SGEE 4FU7A 3JZ2B 3S7HB 4BOHA 3RXMA 3ATMA 3LGUA 2FX6A 1JXPA 3ZVGA 1C1QA 3SU3A 2EEKA 2BDAA 1MTWA 5A0BA 1JWTA 1SGYE 1C1TA 1EZXC 3FP7E 5G4BA 3BF6H 5JBAS 2FOGA 2ZFQH 2FYRA 2FTMA 3MO6A 2BDYA 2QXIA 1SLVB 4MNWA 1W8BH 2AMPA 4ZKRU 2A7CA 1FNIA 3KNXA 2C93B 1GJCB 4DW2U 1V2TT 1GBEA 5A2MH 1EPTC 2FOBA 2ZECA 1QTFA 4X1QU 2HNTE 2W26A 4ISNA 4U30A 1C5MD 2BD3A 2PHBA 2F3CE 1WU1A 3RXRA 1SOZA 4B2AA 1W7XH 4JYTA 4MPWA 3RMMH 3NPSA 3P17H 4KTCA 4UDWH 5B6OA 4I8JA 5EG4A 3VGCC 1YCPH 3F68H 3MH5A 3KEEA 2WPLS 3C27B 4ZKOU 1H9HE 3ELAH 1JRTA 1UVSH 4CH2B 5AVDA 1UVUH 1TBRH 4BANB 4FUDA 3FP6E 1FY4A 3RXAA 4NIVA 3VXFH 2OQ5A 1KXCA 1EXFA 1CBWB 3A8AA 1SGIB 1NTPA 3OX7U 1MH0A 3UWJH 4TWYA 1W13U 3ATIA 1NRQH 3SUDA 4HTCH 1DLEA 4GHQA 4JK6A 1GHZA 2OBOA 1K1LA 1YPJH 1F0SA 1ZMJA 1KLIH 1HRTH 4NA9H 1BTUA 5LPEA 1HIAA 2SGQE 2ZGXH 2PLXA 1KXAA 2Y5HA 1HXEH 5EXMA 3SN8A 2Z9JA 1V2WT 1ACBE 1GJDB 3U8OH 1CA8B 3RXPA 5E0JA 1NS3A 2XNIA 1MKXH 1QJ6B 2UUFB 3ATLA 1Z1IA 1AFQC 5TCCA 1A46H 3ODDA 3T62A 1C2LA 1SGRE 4YO9A 4Z6AH 4LXBH 3SNCA 1O34A 1C2IA 1GI1A 4SGBE 8ESTE 1A5HA 1PPBH 4JZ1A 1BOQA 1PPHE 4M7GA 3IG6B 4O97A 1C2GA 2QIQA 2BVSH 1XX9A 1ZMNA 1C1UH 2BQWB 4B73A 4D7FA 2VWOA 2QF0A 3SJ9A 1ELAA 1KXEA 1HAHH 1DUAA 1C1RA 3C1KA 2VWMA 2GCHG 3KL6A 1OPHB 1QFKH 1MUEB 2A5AA 2OC1A 3GY2A 1HDTH 3NK8A 1C5XB 1TYNA 5HYOA 4NWLA 2ZA5A 4TPIZ 4ZMAH 2V3HH 4NZLA 4A5TS 3LJOA 1ANEA 1DM4B 2GZ8A 3SW2B 4FU9A 1C5UA 4ABHA 3B9FH 2KAIB 2OINA 1XUGA 1FV9A 1QJ1B 2TPIZ 2ANMH 1CVWH 1C5SA 2GGVB 1ZOMA 2A4RA 1P3CA 1GVZA 3FZZA 1GCDA 4K8BA 2ZCHP 3SV8A 1DSUA 3ITIA 1U6QA 2SFAA 1HAVA 2ZHQH 5L2YH 1M9UA 2G4TA 1TBQH 1AU8A 2FYQA 4X8VH 4GVUA 2OC8A 3OU0A 2VGCC 3TK6A 1FIWA 1TA6A 5EODA 2Z6BD 1H1BA 2W3KA 2XYAA 2P16A 4GCHF 5JPMH 1EQ9A 3R3GB 2YNBA 1GMHG 1MCTA 2ODPA 2OTVA 1LQDB 1AFQB 3SU1A 4Y8XA 1CQQA 3FAOA 3NXPA 4D76A 4Q2KA 2PTCE 1RD3B 2V35A 3U1IB 1ZPZA 2NU3E 4FUCA 2ZDVH 1OOKB 2XBXA 2ZGJA 3I77A 3STJA 4B74A 1QA0A 2ZHWH 2ZFRH 4WXVA 3ZVCA 1ETSH 4XDEA 1O2IA 3UQVA 2BD7A 5C3NA 4GUXA 3TGKE 2AGGX 2GV6A 2OBQA 4X2WA 4YOJA 1C1PA 1NU7B 3PTNA 3FP8E 4Q7ZA 2ZHFH 2AMDA 5EXNA 2BY8X 4I31A 4OGXA 4DOQA 1UMAH 4I7YH 2OXSA 3QLPH 2H5DA 1B5GH 2FZZA 2BLWA 2Y6TA 1VR1H 3SJOA 1O3HA 1AUTC 1P3EA 3QO6A 2M5TA 1LPKB 3I78A 1A3BH 1EB1H 4GHTA 1VITH 3BTME 1TNIA 5EQSA 1O2NA 1SGCA 2F9UA 2VGCB 1QBNA 2R2WU 2BOKA 1TGTA 4DVAU 1KTSB 4MPUA 1EPTA 1P01A 3HPTB 3E1XB 1GI4A 4UD9H 4DCDA 1NRNH 1O3IA 5FX6A 1GBKA 2QYIA 4X8UH 7KMEH 5DJ7A 1MKXK 1AUJA 4F4OC 3AW1A 2CHAB 4X2VA 4CR5A 3M5LA 3RM2H 4WJG2 4GSOA 2ANKH 1BJUA 3ZZCA 3RP2A 2Q1JA 3GYLB 1G9IE 1ABIH 1AMHA 1FAKH 1LHEH 3MMGA 2G55A 5EW1H 2ODQA 2RA0A 1KLTA 3P95A 2ZTXA 1QQUA 1C5RA 2BLOA 1EX3A 4LZ4B 1O3LA 1ZPCA 1P2QA 3UUZA 1FLEE 4BAQB 5DGJA 1D3QB 2WPHS 1TLDA 1TALA 1O36A 1W3CA 5A8XA 4D9QA 2I6SA 5DO4H 1PQ8A 4ZXXH 1SHYA 1GI0A 1A1RA 1SQAA 1MMJN 1T7CA 2P3FH 3PO1C 1Y3XA 1GHAF 2ZFSA 2W7SA 3RXTA 2WPJS 3MYWA 3BTWE 4KTUA 1PPEE 2A0QB 4NWKA 1FAXA 3PM3A 3CS7A 1WUNH 3M3TA 3Q77A 5L6NH 1TX8A 3HKJB 1H4WA 1ZJKA 4RSPA 1O5FH 3EDXB 3ZVDA 4AFZA 3RC5A 2ZCKP 4ABEA 4H42U 3GCTG 2VB0A 1UHBA 3GCOA 1O3FA 3D23A 4FUJA 4NIYA 3U9AH 2C8ZB 1AE8H 3OYPA 1T8NA 1BITA 3SHCH 6CHAB 1F2SE 2XCNA 3A89A 1EZQA 3MNBA 1KYNA 1XMNB 2WINI 2QN5T 1AFEH 1UCYE 1N8OC 2XW9A 3BTHE 4YZUA 3ZZ9A 2VIPA 3UPEA 3QWCH 3ATKA 1MTVA 3F1SB 1OS8A 3NZIA 1VGCC 3KQBA 3A8BA 7GCHG 1CHOG 1NN6A 3LC3A 4NZQA 2VJ1A 1GBDA 3EQ0H 2VIVA 2Z94A 1HLTH 2K1QA 3NUMA 4FUGA 2PSYA 3SU4A 1HAGE 1V2ST 2O8LA 4MG3A 3SV2H 3JZ1B 4D8NA 2ZTZA 3PO1B 3SZNA 5C1UA 3D62A 5EPYA 5HM2A 2BDCA 4SGAE 1BHXB 2GKVE 2Q6FA 4CREA 2UWLA 1YPHC 4OS6A 1C9TA 1O2KA 1C1VH 3K9XB 1ZTJA 2P8OB 2ZGHA 1THPB 2WUBA 1NFXA 1TGSZ 1ABJH 2BXUH 2AFQB 1AKSA 1LQEA 1P12E 1GBLA 2VVCA 1O3BA 4ABAA 2F9OA 3HK3B 1T32A 4GPGA 3GY5A 1SLWB 1EZSC 4MNVA 4NCYA 1BMAA 1G3CA 1OWDA 1ZHMA 2ZDAH 1RGQA 1OX1A 3A7TA 2TBSA 4X6NA 5E2OA 1PJPA 2HPQH 2Z3CA 3UTUH 2ZGBH 1SGFA 2BY9X 3PLBA 4Y0ZE 1GCTB 2ZEBA 5FX5A 1EATA 3LIWA 1VGCB 3ENSB 1Y59T 4B2CA 1GBIA 3DUXH 3E91A 3SI3H 3M7TA 2ZTYA 3RXHA 2VVUA 1GBCA 4MPVA 1GMDG 1O3NA 2WV4A 3H5CB 4CBNA 3SU5A 1RTKA 1L1JA 4AN7A 4DGJA 5A8ZA 2PKAA 2EI6A 4LOYH 1SG8B 2R0LA 1V6DA 1SB1H 2PKSB 2XBYA 4X8SH 3MU4A 3GCHC 1GJBB 2BX4A 1C2DA 1C5VA 1C5LH 1HFDA 1BTHH 4E05H 2SGPE 1ZJDA 5I46H 1TB6H 2BB4A 1O37A 2OD3B 4CHAB 1O2OA 1ZR0A 1MTSA 1ETTH 4RKJB 1IQKA 1SMFE 2R9PA 2FOMB 4DG4A 5T6FA 2QXHA 3MTYA 5CE1A 4X1NU 2WYJA 2FOHA 1Y5AT 2D2DA 1J17T 4CRDA 4U01A 5E8EH 1C4U2 1SOTA 3VB5A 2B0FA 1RIWC 1O3KA 1K28D 5HGGA 3DD2H 1P10A 5E0GA 2B7DH 1GMCF 2D1JA 3Q3KA 4ISHH 3MU8A 3BSQA 3QUMP 2SGDE 4UE7H 4DY7B 1K1MA 1HNEE 1EP6A 1NRSH 1OP0A 3URCA 2ZG0H 5BPEA 1WCZA 3HK6B 1GBAA 4AGKA 1HB0B 1THSH 2OQUA 3N7OA 3GICB 1D3TB 3BEFB 4AGJA 1A0HB 2A45B 4Y0YE 3ZZ7A 5A09A 3T29A 1GI9B 1ZSKA 1GJ8B 2OLGA 2HRVA 2NU1E 1IHTH 1TWXB 3MFJA 5FBEA 4MLFB 4AZ2B 3TJOA 5E0HA 2FLRH 1Y5BT 1AWFH 3KQDA 1DDJA 3RXIA 1TX7A 1K21H 2IOTA 3CENA 1V2JT 2LNCA 3QTOH 4J2YB 5IDKA 3T27A 1IQGA 1ZRKA 4B76A 1GL0E 2CF9H 3TLOA 2ESTE 5FPSA 2Z7FE 4ZH8A 2Z9LA 1SVPA 2BDIA 1UVTH 4FUBA 4XOJA 4Q80A 1DWEH 1TE0A 2Y7XA 4X8TH 4FVBA 3UNSA 2D26C 1V2NT 4YT7H 1W2KH 1P06A 4YTAA 1L4ZA 2HWLB 1GMDF 1TNKA 1RIWB 2RCEA 1SGFG 4Y79A 1BBRK 1YGCH 3TITA 1QRXA 2XC4A 8GCHF 4TYDA 5EU8A 3FANA 3MI4A 4QT8C 4IS5A 1K9OE 2FX4A 1C2KA 2UWPA 2PGQB 1O32A 1SSXA 1ZGVA 2FLBH 3F9EA 1V2VT 3VB3A 3KCGH 2SNVA 3MU1A 3SJ8A 1G2LA 3QGJA 1GI6A 4X1PU 3SNBA 3NCLA 3U98H 1XXDA 2FIRH 3RXSA 1GDUA 3GY6A 1DICA 3TU7H 1AWHB 4WMDA 1ZYOA 5HM9A 3SNEA 1S0QA 1GDNA 3ZZ4A 1UVOA 2XCFA 4X2YA 1F92A 3A88A 4Z0KA 1S85A 2TGAA 3CP7A 3A81A 3O8CA 1SGPE 1IQFA 3E0PB 3MNXA 1B0EA 1TNLA 3GY7A 2WPMS 1O2UA 5ABWA 3KGPA 1HAPH 3RXBA 2ZU4A 4AORA 3RMNH 1YKTA 4XSKU 2A7JA 1FXYA 2WUCA 2BQ6B 3ATWA 2A4GA 2EI7A 2ZU3A 3TIUA 1QB1A 2GX4A 4GCHG 1AI8H 3RXEA 2HPPH 4NA7A 4BAHB 5JB9S 1HPGA 4K2YA 1QY6A 1MTNB 3OY6U 3M5NA 4X1SU 5F8XA 3TH4H 1A3EH 2TGDA 3SJIA 1OWJA 3V0XA 2Z3DA 1SL3A 1F0RA 2ZF0H 2JH5D 1RS0A 3LGWA 1OWEA 1F0UA 5JBBS 1G36A 2BD8A 1VZQH 4AYVB 2EI8A 3F9GA 1IQNA 2JKHA 5LPRA 4UFGH 4BAOB 4FUIA 4X2XA 1G32B 2BHGA 3P8OA 1WTHD 8LPRA 4RKOB 1UTQA 5DP3A 4TPYA 1C1WH 2FPZA 1BMMH 3O8BA 4CRGA 4LK4A 5FAHA 3P70B 4IGDA 5GPIB 1P05A 3RXFA 1HAIH 3LU9B 4BTUB 1AVGH 2PUXB 3MOCA 1UTLM 1C4V2 2STBE 1WOFA 1JOUB 4O9VA 1UTKA 3SO3A 2IN2A 1K1NA 1NY22 2VNTA 4K8YA 3URDA 1TMTH 2VIQA 1V3XA 1VJAU 1GHWH 5IYTA 3QZQA 1VCWA 2F9BH 1DWCH 2R2MB 3PMAB 1FDPA 2EA3A 1UTPA 1VJ9U 1P57B 3RXDA 1AZZA 2I6QA 1B0FA 2GP9B 1UCYH 1GGDC 1A5GH 2C3SA 4OS1A 1EB2A 1MCVA 2FTLE 1JBUH 2H5CA 3T2NA 1QA7A 2ZNKH 3SUEA 2ZPRA 4UONA 3EYDA 3A7WA 3RXOA 1WQVH 2OC7A 3BIVH 1BRBE 1BTXA 2HVXA 3GY4A 1H8DH 4WWYA 4BNRA 2H9TH 4Y6DA 4Y10E 2FOEA 3SHAH 1BJVA 4KP0A 1ELCA 2HALA 3S9CA 1TRNA 4B71A 1FI8A 2B5TB 1O3GA 3LGIA 1F0TA 3BTQE 4K69A 3DFLA 3K65B 1BIOA 2A32A 1O2SA 3O8RA 4BTTB 3WY8A 2XRCA 3SGQE 1A5IA 1GHAG 1NZQH 2Y81A 3OTJE 1O2QA 3EA9A 2D8WA 1DANH 1DOJA 1BTPA 2CHAC 3RU4T 2VH6A 1QR3E 1KLJH 3KQEA 1EAWA 2QXJA 4JYVH 3A7ZA 2OP9A 3NWUA 1O2YA 3SU6A 1TONA 2AMQA 2A4QA 1S0RA
chains in the Genus database with same CATH superfamily
1YCPK 2BY5X 2PUQH 2CJIA 3ODFA 2QF5A 1Z8JB 2A31A 1S81A 3AK5A 3L6PA 3B23B 3S9AA 1GGDB 1SGNE 2ZZUH 1SC8U 2CXVA 5DP5A 5GDSH 1HYLA 5AF9H 2Z3EA 1DFPA 2BD5A 4K1SA 1BHXF 4ABIA 3Q3YA 4CRFA 1O2HA 1HGTH 3AW0A 5LH8A 1HAOH 2BLQA 1YPHE 2FP7B 4DT4A 2SNWA 1ZSLA 1Y3VA 5DKMA 5JYIA 1GI8B 5HIZA 4H6TA 2HVYB 1E79D 1EAUA 1WTGH 4A1XA 5JB8S 1V2RT 4KKDA 1LCYA 2KX4A 3GCNA 5DP7A 5J4QA 3RXJA 2R0KA 4Q4LA 1MKWH 3DHKH 1KXFA 1GDQA 3IWMA 2AGEX 1DITH 1BDAA 2J5UA 1GBHA 2V6NA 1WXRA 2LPRA 1IQMA 2FS9A 4F49A 2BZAA 1LHFH 2P3TB 2QA9E 2J38A 1THRH 1HJ9A 6CHAC 1J8AA 1FY1A 1O3DA 1XUIA 1P2JA 4ZXYH 1FY5A 5C1YA 4P00A 3MO3A 1WQSA 2P95A 3A7YA 6GCHF 4IC6A 1ZGIA 1SLUB 3ZZ8A 2XC5A 3QZRA 5GIBA 2ZFPH 1AHTH 1Z8GA 4ISOA 2M2AA 1NFUA 3SUFA 2V3MA 2GZ9A 5H4IB 4K5ZA 2W6ID 4Y7BA 3KHVA 3DSGA 3P8GA 2HLDD 3LJJA 1C1SA 3Q3XA 1DS2E 1LO6A 3SNDA 2IPHA 3RC6A 2P94A 5DP6A 1C5TA 1GHBF 1UCYK 1DLKB 4WMFA 5F8ZA 2KAIA 1BRUP 3VPKA 1ETRH 3UIRA 4D7GA 1UK2A 3I29A 1O30A 4ACAA 3E90B 1TGBA 1AE5A 4MQAA 1LVOA 2J95A 4UFDH 1GBJA 1K1JA 3U8RH 4ASHA 2KCOA 3V13A 5ETXA 2PTNA 3E8LA 4ISIH 4XBBA 1XUFA 1TAWA 1J9CH 3PRBA 4WF8A 4CRAA 1BT7A 3VB4A 1JIRA 1GBTA 2JH0D 2P8OC 1UK4A 3D65E 3FOAA 3UR6A 3M37A 2VIWA 1C5ZB 4GAWA 1UVPA 1YCPM 1C5PA 2P93A 2O8MA 1UTJA 1T31A 4Q7XA 1T4UH 1GWAA 4B6FA 4E06H 1TBZH 1OP2A 3EE7A 2EQNA 2V7QD 5FPTA 1C5OH 3SQEE 5EW2H 1KXBA 1YBWA 3GOVB 4YT6H 1WYKA 1NBME 1LVBA 1W0ZU 1QGFA 2XXLA 3MH6A 2C8WB 1ZPBA 2QXGA 1C1NA 2GZ7A 3MU0A 1P11E 1GCTC 3UNQA 2YOLA 2TIOA 4INKA 1SHHB 4DJZB 1D6WA 2GDEH 1OP8A 1WV7H 2J34A 4LZ1H 1T8MA 2BLVA 2HLCA 4YLQH 1D4PB 2V0BA 3BTGE 1GG6B 1QZ8A 1T4VH 2BY7X 1FN8A 2Z9IA 3BTKE 1GMCG 2ULLA 2ZI2H 5BRRE 1B7XB 4OS4A 1KSNA 2PKSC 4JZIA 1QRZA 1OYQA 1P8VC 1AD8H 5JBCS 1KDQB 2H9HA 1BQYA 2BD4A 3ZV9A 1HAZB 1Q2WA 2VVVA 3TJVA 1Y3UA 3ZZAA 3V12A 5FCRA 1A0LA 5FBIA 1EJMA 1C2JA 1KMHB 4CHAC 4BAMB 4YOGA 3UAIC 3OEED 2ODYB 1OKXA 2QV1A 1DUEA 1VCQA 4NFFA 1O2JA 1W12U 3BG8A 3STIA 3LPRA 2CF8H 4WH6A 2BVXH 3E3TA 1L0ZA 1CSOE 3MNCA 4IBLH 5DSFA 1P2IA 1QCPA 4DIHH 1P2MA 1IQEA 1GJ4H 1MKWK 2ZWLH 3V7TA 1GI5A 5F8TA 2PWXA 2GT7A 1DX5M 3A84A 1PYTC 1CA0B 1SQTA 4OGYA 1O3EA 3DT0H 1EFRD 3QTVH 4Q7YA 1MZAA 4AB8A 2TGPZ 1O3JA 2PP6A 4NIWA 4B2BA 2KCAA 1NPMA 1ARBA 2A5KA 3E0NB 3A85A 3RLWH 1C5YB 3A87A 3RXQA 3KF2A 1L1NA 5TJXA 1BTWA 1CO7E 1GJ9B 3UFAA 4Y8ZA 3LDXH 1EUFA 1P09A 1RTLA 1W0KD 1ZSJA 1SLXB 1ZHRA 2W5EA 3OSYA 2GTBA 4E7RG 3PROA 2BXTH 3M7QA 1PFXC 2BM2A 8GCHG 3F6UH 3FVFB 2BD2A 3M3VA 1XKBC 3A83A 2QF3A 4OS2A 4X6MA 4ZHLU 3UY9A 2G5NA 1EJAA 2ZFFH 4Y11E 2JDID 1TGNA 2ZDNA 2BVRH 3KQCA 5L2ZH 1O2MA 1H9LB 4CR9A 2WPKS 2L74A 3TVJB 1E38B 1IHSH 2ASUB 1EASA 1N6YA 2VWNA 4FETA 1UTMA 4NA8A 2Y5FA 1G3EA 4ZROA 2H9EH 4CRBA 2PSXA 1FIZA 1VCPA 1W0JD 1ZMLA 3PWBA 2ZDKA 4I8LA 4U32A 2ZO3H 2VU8E 2UUJB 2ANWA 5DK1A 1L2EA 3SQHE 4WVPE 2EC9H 5GCHF 3UWIA 4RI0A 1A7SA 3HGNA 1MBMA 5GJ4B 1MAYA 3M36A 1GJ6A 1XVOA 3AASA 3BG4B 3UOUA 1YLDA 4BTIB 1MABB 2ZHDA 4YM9A 5JDUB 2R3UA 1XVMA 1O5DH 1W11U 3SU0A 1CGJE 4AFSA 2ZU1A 3RMOH 3LT3A 1BZXE 3M5OA 3U1JB 3W95A 3N7EA 2AEIH 2Y7ZA 1P2OA 4KTSA 5FPYA 1RRKA 4XE4A 3SJKA 3ZVFA 4AFQA 1CGIE 3F0PA 5J4SA 1INCA 5A8YA 1AVXA 1TPSA 4HI3A 1PPFE 3E16B 1TIOA 1AB9C 1K0HA 3KN2A 4MTBA 3TGJE 5DG6A 4A92A 2H1UA 1IQHA 2QC2A 1TMBH 3GYMA 2GJGA 1W14U 2NWNA 1O3PB 3ESTA 1GI2A 3ZVAA 5CMXH 1QURH 4E7NA 1Z8RA 2AS9A 1LPZB 2C4FH 2AHME 3LGVA 2W3IA 4A6LA 1MTUA 1QNJA 3ZZ6A 6ESTA 4JMYA 1E0FD 1OWIA 1X7AC 2GT8A 2BD9A 1C1MA 1IAUA 1DXWA 1HIAB 3EE0B 1EAIA 3OY5U 2ZQ1A 3M35A 4AX9H 1PQ5A 3RMLH 1H8IH 1SFQB 1VITF 1TA2A 2G8TA 2QCYA 2A5IA 1ID5H 1DT2A 2FWWA 1LKAA 3U69H 2J94A 3RXKA 9LPRA 5JBTA 5SGAE 1EAXA 3SOSA 2FO9A 1BUIA 2FI5E 2F9VA 1TQ0B 4D9RA 3M7UA 1S83A 1MTNC 1EOLA 4INLA 1PYTD 1J14A 1SI5H 1S82A 2A2QH 3RDZA 2JJ2D 1SR5C 3BTTE 2ZU5A 2JETB 3S69A 5FXLA 2RG3A 4AOQA 3RU4D 2XWBI 1HXFH 1F5KU 1TNGA 1SGEE 5CHAB 2BX3A 1A61H 1HBTH 4ESTE 1C5WB 1CU1A 3CS0A 3VB6A 3RUOA 1HCGA 3ZZ5A 1AB9B 2ZP0H 1A2CH 4KELA 1YLCA 1LDTT 1ZRBA 3F3BA 1Y3WA 2C8YB 3A80A 2Y80A 1F7ZA 4Q63A 1MQ5A 1V2OT 1WDIA 1C9PA 1V2MT 2FESH 3F0OA 2QF4A 2WV9A 1ANBA 3TK9A 4DT7B 4YLUA 1FN6A 1XM1A 1SGTA 1O33A 4I8KA 2GDDA 3PWCA 4OS7A 5EGMA 3U28C 1HUTH 1Z1JA 2XBVA 2UUKB 5DP9A 2ALPA 2BY6X 1FJSA 2FOFA 1GBBA 3L3TA 4H4FA 1HAVB 1BTZA 1YPEH 1QQ4A 3ZZBA 5LPFA 3K6YA 4AG1A 4ZHMU 1O31A 4TY6A 1O35A 5T6GA 4XBDA 1K22H 4YXWD 5F6MA 6LPRA 3S9BA 1AVWA 1O2VA 1O2TA 1ORFA 1Z6JH 3NKKA 3F9FA 3ZZ3A 5DP4A 1TFXA 5EQRA 2G52A 7LPRA 1BCUH 3GY8A 2GMTB 3ZVEA 1S6FA 1BBRE 2K8IA 2ZFTA 1V2QT 5EXLA 1ZHPA 1FY8E 4R0IA 2KM0A 1QJ7B 2VIDA 3A7XA 3M3SA 4ZCNA 3PLKA 3MHWU 4OM9A 4YOIA 3BEIB 2QY0B 4IMZA 2OK5A 1RFNA 4Y7AA 3SI4H 4I33A 2A4OA 4O3UA 1NBMD 1O3CA 4KGAA 1DVAH 1LHDH 1V2LT 2Y82A 3L33A 1E37B 1ELDE 2A7HA 1S5SA 1XUJA 2CN0H 3LH1A 3PV4A 3BV9B 5A0CA 3ZV8A 1YLNA 9ESTA 3LH3A 5L30H 5EQQA 4VGCC 3UQOA 2STAE 3GDUA 2O8WA 1AIXH 1FMGA 4MPXA 1DSTA 4MNXA 5EIYA 2Q6DA 3HKIB 4IC5A 3TJUA 1C2EA 1XUHA 4A1VA 1QL8A 1O2GH 3D49H 4FUHA 1TGCA 3IITA 2P3UB 1DWDH 2BZ6H 1C4Y2 3S0NA 1ARCA 3VG8A 2C90B 1ELTA 2FOCA 1EPTB 3UREA 1LTOA 1O2PA 3K2UA 2HNTF 1YM0A 2ILNA 3LGTA 1O39A 3M5MA 3QX5H 4ZKNU 2AIQA 1SFIA 4OS5A 1L4DA 2O9QA 1RXPA 1LPGB 3T5FH 2XWAA 3SYJA 2PW8H 2CV3A 3RXCA 4B1TA 3MO9A 1Q3XA 1GHYH 3BEUA 3VGCB 4DURA 1N6XA 4FUEA 2NU0E 4YESB 2BMGB 2J4IA 2J9NA 4ABJA 1GI3A 1ELVA 1P9UA 5E2PA 4X6OA 1GBMA 3VB7A 6GCHG 1MD8A 2FM2A 4O3TA 3AVZA 3PMJA 3RXVA 4WXIA 5K0HA 2UUYA 3RLYH 1C5QA 1O5CB 3LONA 4I32A 4MDSA 3VEQB 1CGHA 3DCLA 1DE7H 1EJNA 4ASUD 3S7KB 4ZKSU 1ELGA 1G37A 3TNTA 1GHBG 1O0DH 1T8OA 1UK3A 1O2WA 1UTOA 2ZDMA 2WV5A 4VGCB 3QN7A 4A7IB 3RXGA 4XBCA 2UWOA 4AYYB 1GL1A 3SNAA 1O3MA 2ZQ2A 4HZHA 1YWUA 3SGBE 1TNJA 4AFUA 5C5NA 4FUFA 1C5NH 1GJ7B 1LMWB 1NFYA 4PROA 4CRCA 5GWZA 3A86A 3QK1A 4JYUH 4UFFH 3R0FA 3GDVA 4MNYA 4ZAEA 2THFB 2TGTA 1Y3YA 5A0AE 2KCPA 4B75A 2O8TA 1UHBB 3A8DA 4HGCA 4X1RU 2F91A 4K1EA 3SV7A 1G2MA 1WAYB 1CT2E 1G3BA 4K1TA 1MBQA 2G51A 3T25A 2HNTC 3MH7A 5DPAA 1Z71A 5K7RA 1AY6H 3V3MA 5KGOA 5DN6D 1YPKH 8KME2 1QHRB 3SZEA 3SV9A 2VWLA 2LP6A 2W7UA 1COWD 1AZ8A 1V2UT 5FHTA 3H7OA 1IQIA 1ANCA 1JIMA 1JMOH 1NO9H 2AIPA 1P0SH 1O5EH 3PTBA 4NIXA 1QBOA 1P03A 1NT1A 4F55A 1Y5UT 1V2KT 1HJAC 2OC0A 3GY3A 2Y5GA 1P9SA 2BDHA 1GVKB 1EZUC 1XUKA 2BQ7B 2DE9A 4WH8A 2FOAA 2SGAA 4CH8B 2FEQH 1HJ8A 3TNSA 2BOHB 1Z7KA 2GD4B 3RU4E 3OE7D 1EKBB 2FXRA 2P59A 4I8GA 3H7TA 3DFJA 1TMUH 1GPZA 3G01A 1OYTH 2H2ZA 4JZFH 3GISB 3PYHA 4IW4E 1C1OA 3UR9A 1AKSB 2FDAA 2PGBB 2GCHF 2PFEA 2RDEA 3TH3H 5ESBA 1AQ7A 1OWKA 3KIDU 1LHGH 2FODA 1KY9A 1BMLA 1MU6B 1ZTKA 1GG6C 2B9LA 3UNRA 1L1GA 2XTTB 3TPIZ 1BTYA 1DPOA 5C5OA 1CHGA 1BB0B 2AGIX 4ABDA 1QL7A 4IN1A 5HXFA 1C2MA 1ELBA 5F03A 4ABBA 2AYWA 3QGNB 4ISLA 4JK5A 1C2FA 3BTEE 2JH6D 2ZHEH 1HJAB 2PKAB 2ZIQH 1TNHA 2BDGA 2G5VA 1RJXB 3MU5A 1GMHF 1NRRH 1QB6A 1YP9A 4AB9A 3HGPA 1YC0A 2J98B 4UFEH 4GLYA 1O2XA 4U2WA 1P02A 4BXWA 2G4UA 3MWIU 1AO5A 3HATH 3P8NA 1J15A 1YF4A 2A2XH 2ANYA 3N99A 1J16A 2O8UA 4MVNA 3TH2H 4JCNA 5C2ZA 2CGAA 1YYY1 2H6MA 1CA0C 1DWBH 1LHCH 1K1OA 2ZGCA 4JZEH 2VH0A 2OCVB 2BDBA 5ESTE 5C67A 5EOKA 1PPZA 1E36B 2CMYA 2GVFA 2TRMA 1LKBA 1W10U 4IN2A 1HV7A 4INHA 5EJZA 2B8OH 4BXSA 1NFWA 1SKYE 4JZDH 4X6PA 3ZYDA 1N1LA 3KYFA 4NSVA 5GCHG 1ZLRA 1YPGH 1FPCH 3SBKA 3PB1E 4I86A 2ZU2A 1ESAA 5IK2D 2NU2E 3PV2A 1PQAA 1BMNH 2XBWA 1EP5A 1K2I1 1RTFB 4TT3D 1O5AB 4WY3A 3TJNA 4X0WU 3ZZDA 3A7VA 4Y71A 1P2NA 1K1IA 2F9NA 1D6RA 2VINA 2L6OA 3B8JA 3GDSA 1QIXB 1TOCB 1TPOA 1QL9A 1GHVH 1O2RA 1ELEE 1O5BB 3KQ5A 3P6ZB 3RXUA 1IOEA 3MNSA 1LVMA 1D3DB 2ZCLP 4Y76A 1E34B 1Z8IB 1OSSA 1C2HA 3RM0H 1EOJA 2ALVA 3P8FA 2ZKSA 2R3YA 4RT0A 5LGOA 1O2ZA 1PPCE 2DE8A 1Y8TA 4R8TB 5EJ1A 3WWBA 1GJ5H 2ZDLA 3RC4A 3SGAE 1WBGB 2NU4E 3BTFE 1NRPH 1GBFA 3BG4C 3DSOA 4ZHAA 4THNH 1FONA 5T6DA 2V3OH 1TRMA 1TOMH 3AAVA 2F9PA 2FI4E 1P04A 3SUGA 1VITG 4AC9A 1BA8B 2FI3E 1SPJA 1F5LA 2BYAX 2GV7A 1BBRH 3ZVBA 3A8CA 2WHXA 2XC0A 4FU8A 2HOBA 2OUAA 1CE5A 3F2FA 4XFQA 4Y8YA 7ESTE 1BRAA 5AFYH 1N8OB 2PR3A 3A82A 1MD7A 3Q00A 5HMAA 1O38A 4FXGH 3E6PH 3SV6A 4HFPB 1ZZZA 3TK5A 4NFEA 2QE7D 1O2LA 4NG9H 4WMEA 2FS8A 1TRYA 1W7GH 1TX6A 2QAAA 2WPIS 2C8XB 3PMBB 4FVDA 1S6LA 4NGAH 1AGJA 1DY9A 1YPLH 2IJOB 4IMQA 2AH4X 1TPAE 1BMFD 4RT1A 5EPNA 4UEHH 1FQ3A 3P92A 3ZYEA 1YY3A 2ZPSA 1FUJA 3PMHB 4ZUHA 3LC5A 1A0JA 3GCTF 1JRSA 1S6HA 1K1PA 4BAKB 1NU9A 1CT4E 2ZPQA 1MQ6A 1YPMH 2G00A 1E35B 2G81E 2A1DB 2SGFE 1H9IE 3O8DA 5DP8A 3DA9B 2Q6GA 1NC6A 2Z9KA 5I25A 1UO6A 2F83A 1MU8B 1Q31A 4TWWA 1ESBA 1UW7A 1HAYB 1DXPA 3BTDE 1O3OA 1ELFA 1GHXH 3M61U 1QBVH 4P02A 1BRCE 2Z9GA 5HIYA 2JETC 2ZC9H 3W94A 4K60A 4TY7A 2RA3A 1D9IA 3T28A 5AFZH 7GCHF 1CHOF 1GVLA 4TSFD 3TGIE 1NM6A 5CHAC 3FFGA 2FMJA 4NSYA 2J2UA 4A1TA 1GI7B 1TPPA 2J97A 2WYGA 4H6SB 3PLPA 1G30B 1SGDE 3U8TH 5TCAA 1IQLA 3VFEA 1WSSH 1Z6EA 2GCTC 5AHGH 1FPHH 2K0QA 3PRDA 2RDLA 4CBOA 3Q76A 2AERH 1KDQA 1CT0E 4DIIH 2J92A 3EA7A 1XKAC 1UJ1A 3K6ZA 1NESE 1IQJA 3MH4A 4RN6A 3BIUH 3SU2A 1PQ7A 4ABFA 4AG2A 5FCKA 1OWHA 1TQ7B 5C20A 2BTCE 3OAAD 1SGQE 1KXDA 3LKWA 1MAXA 1QRWA 3GCHB 1KTTB 1ESTA 1MZDA 3AAUA 3BN9A 1F5RA 1A4WH 1LVYA 1W0YH 2DUCA 1TABE 2VIOA 3FZDA 4I8HA 1FY3A 1XXFA 2HGTH 1FZZA 1SQOA 3RXLA 3SORA 1HAXB 1D3PB 2GMTC 3OEHD 5C1XA 3QDZB 1AN1E 1P2KA 3GS9A 5GXPA 1OXGA 3EA8A 1ZTLA 5C0TA 3EAJA 1S84A 4K3JA 3T26A 1NROH 3LGYA 1G3DA 1ANDA 1T8LA 2PV9B 5PTPA 3EGKH 5T3HA 1O3AA 1KIGH 3LOXA 1SBWA 3VXEH 3H09A 1DY8A 4J1YA 3F9HA 1O5GH 2EY4C 1GJAB 3UOPA 1PPGE 4O03A 1UTNA 1V2PT 4ABGA 1QB9A 2GCTB 1CBWC 2QGRA 2WPDD 2YNAA 2SGEE 4FU7A 3JZ2B 3S7HB 4XD7D 4BOHA 3RXMA 3ATMA 3LGUA 2FX6A 1JXPA 3FN8A 3ZVGA 1C1QA 3SU3A 2EEKA 3WW7A 2BDAA 1MTWA 5A0BA 1JWTA 1SGYE 1C1TA 1EZXC 3FP7E 5G4BA 3BF6H 5JBAS 2FOGA 2ZFQH 2FYRA 2FTMA 3MO6A 2BDYA 2QXIA 1SLVB 4MNWA 1W8BH 2AMPA 4ZKRU 2A7CA 1FNIA 3KNXA 2C93B 1GJCB 1H8HD 4DW2U 1V2TT 1GBEA 5A2MH 1EPTC 2FOBA 2YMSB 2ZECA 1QTFA 4X1QU 2HNTE 2W26A 4ISNA 4U30A 1C5MD 2BD3A 2PHBA 2F3CE 5T1VA 1WU1A 5F53A 3RXRA 1SOZA 4B2AA 1W7XH 4JYTA 4MPWA 3RMMH 5CHBA 3NPSA 3P17H 4KTCA 4UDWH 5B6OA 2WSSD 4I8JA 5EG4A 3VGCC 1YCPH 3F68H 3MH5A 3KEEA 2WPLS 3C27B 4ZKOU 1H9HE 3ELAH 1JRTA 1UVSH 5GNDA 4CH2B 5AVDA 1UVUH 1TBRH 4BANB 4FUDA 3FP6E 1FY4A 3RXAA 4NIVA 3VXFH 2OQ5A 1KXCA 1EXFA 1CBWB 3A8AA 1SGIB 1NTPA 3OX7U 1MH0A 3UWJH 4TWYA 1W13U 2IJD1 3ATIA 1NRQH 3SUDA 4HTCH 1DLEA 4GHQA 4JK6A 1GHZA 2OBOA 1K1LA 1YPJH 1F0SA 1ZMJA 1KLIH 1HRTH 4NA9H 1BTUA 5LPEA 1HIAA 2SGQE 2ZGXH 2PLXA 1KXAA 2Y5HA 1HXEH 5EXMA 3SN8A 2Z9JA 1V2WT 1ACBE 1GJDB 3U8OH 1CA8B 3RXPA 5E0JA 1NS3A 2XNIA 1MKXH 1QJ6B 2UUFB 3ATLA 1Z1IA 1AFQC 5TCCA 1A46H 3ODDA 3T62A 1C2LA 1SGRE 4YO9A 4Z6AH 4LXBH 3SNCA 1O34A 1C2IA 1GI1A 4SGBE 8ESTE 1A5HA 3W1EA 1PPBH 4JZ1A 1E1QD 1BOQA 1PPHE 4M7GA 3IG6B 4O97A 1C2GA 2QIQA 5KECA 2BVSH 1XX9A 1ZMNA 1C1UH 2BQWB 4B73A 4D7FA 2VWOA 2QF0A 1SQRA 3SJ9A 1ELAA 1KXEA 5B6LA 1HAHH 1DUAA 1C1RA 3C1KA 2VWMA 2GCHG 3KL6A 1OPHB 1QFKH 1MUEB 2A5AA 2OC1A 3GY2A 1HDTH 3NK8A 1C5XB 1TYNA 5HYOA 4NWLA 2ZA5A 4TPIZ 4ZMAH 2V3HH 4NZLA 4A5TS 3LJOA 1ANEA 1DM4B 2GZ8A 3SW2B 4FU9A 1C5UA 4ABHA 3B9FH 2KAIB 2OINA 1XUGA 1FV9A 1QJ1B 2TPIZ 2ANMH 1CVWH 1OHHD 1C5SA 2GGVB 1ZOMA 2A4RA 1P3CA 1GVZA 3FZZA 1GCDA 4K8BA 2ZCHP 2KR7A 3SV8A 1DSUA 3ITIA 1U6QA 2SFAA 3MQKC 1HAVA 2ZHQH 5L2YH 1M9UA 2G4TA 1TBQH 1AU8A 2FYQA 4X8VH 4GVUA 2OC8A 5KEDA 2W6JD 3OU0A 2VGCC 3TK6A 1FIWA 1TA6A 5EODA 2Z6BD 1H1BA 2W3KA 2XYAA 2P16A 4GCHF 5JPMH 1EQ9A 3R3GB 2YNBA 1GMHG 1MCTA 2ODPA 4B6EA 2OTVA 1LQDB 1AFQB 3SU1A 4Y8XA 1CQQA 3FAOA 3NXPA 4D76A 4HG6A 4Q2KA 2PTCE 1RD3B 3F2HA 2V35A 3U1IB 2IPQX 1ZPZA 2NU3E 4FUCA 2CK3D 2ZDVH 1OOKB 2XBXA 2ZGJA 3I77A 3STJA 4B74A 1QA0A 2ZHWH 2ZFRH 4WXVA 3ZVCA 1ETSH 4XDEA 1O2IA 3UQVA 2BD7A 5C3NA 4GUXA 3TGKE 2AGGX 2GV6A 2OBQA 4X2WA 4YOJA 1C1PA 1NU7B 3PTNA 3FP8E 4Q7ZA 2ZHFH 2AMDA 5EXNA 2BY8X 4I31A 4OGXA 4DOQA 1UMAH 4I7YH 2LELA 2OXSA 3QLPH 2RFKC 2H5DA 1B5GH 2FZZA 2BLWA 2Y6TA 1VR1H 3SJOA 1O3HA 1AUTC 1P3EA 3QO6A 2M5TA 1FX0B 1LPKB 3I78A 1A3BH 1EB1H 4GHTA 1VITH 3BTME 1TNIA 5EQSA 1O2NA 1SGCA 2F9UA 2VGCB 1QBNA 2R2WU 2BOKA 1TGTA 4DVAU 1KTSB 4MPUA 1EPTA 1P01A 3HPTB 3E1XB 1GI4A 4UD9H 4DCDA 1NRNH 1O3IA 5FX6A 1GBKA 2JJ1D 2QYIA 4X8UH 1H8ED 7KMEH 5DJ7A 1MKXK 1AUJA 4F4OC 3AW1A 2CHAB 4X2VA 4CR5A 3M5LA 3RM2H 4WJG2 4GSOA 2ANKH 1BJUA 3ZZCA 3RP2A 2Q1JA 3GYLB 1G9IE 1ABIH 1AMHA 1FAKH 1LHEH 3MMGA 2G55A 5EW1H 2ODQA 2RA0A 1KLTA 3P95A 2ZTXA 1QQUA 1C5RA 2BLOA 1EX3A 4LZ4B 1O3LA 2KFWA 1ZPCA 1P2QA 3UUZA 1FLEE 4BAQB 5DGJA 1D3QB 2WPHS 1TLDA 1TALA 1O36A 1W3CA 5A8XA 4D9QA 2I6SA 5DO4H 1PQ8A 4ZXXH 1SHYA 1GI0A 1A1RA 4FOUC 1SQAA 1MMJN 1T7CA 2P3FH 3PO1C 1Y3XA 1GHAF 2ZFSA 2W7SA 3RXTA 2WPJS 3MYWA 3BTWE 4KTUA 1PPEE 2A0QB 4NWKA 1FAXA 3PM3A 3CS7A 1WUNH 3M3TA 3Q77A 3PV5A 5L6NH 1TX8A 3HKJB 1H4WA 1ZJKA 4RSPA 1O5FH 3EDXB 3ZVDA 4AFZA 3RC5A 2ZCKP 4ABEA 3WWFA 4H42U 3GCTG 2VB0A 1UHBA 3GCOA 5CDFE 2F4LA 1O3FA 3D23A 4FUJA 4NIYA 3U9AH 2C8ZB 1AE8H 3OYPA 1T8NA 1BITA 3SHCH 6CHAB 1F2SE 2XCNA 3A89A 1EZQA 3MNBA 1KYNA 1XMNB 2WINI 2QN5T 1AFEH 1UCYE 1N8OC 2XW9A 3BTHE 4YZUA 3ZZ9A 2VIPA 3UPEA 3QWCH 3ATKA 1MTVA 3F1SB 1OS8A 3NZIA 1VGCC 3KQBA 3A8BA 3OTPA 7GCHG 5EJLA 1CHOG 1NN6A 3LC3A 4NZQA 2VJ1A 1GBDA 3EQ0H 2VIVA 2Z94A 1HLTH 2K1QA 3NUMA 4FUGA 1E1RD 2PSYA 3SU4A 1HAGE 1V2ST 2O8LA 4MG3A 3SV2H 3JZ1B 4D8NA 2ZTZA 3PO1B 3SZNA 5C1UA 3D62A 5EPYA 5HM2A 2BDCA 4SGAE 1BHXB 1VKYA 2GKVE 2Q6FA 4CREA 5C94A 2UWLA 1YPHC 4OS6A 1C9TA 1O2KA 1C1VH 3K9XB 1ZTJA 2P8OB 2ZGHA 1THPB 2WUBA 1NFXA 1TGSZ 1ABJH 3CNRA 2BXUH 2AFQB 1AKSA 1LQEA 1P12E 1GBLA 2VVCA 1O3BA 4ABAA 2F9OA 3HK3B 1T32A 4GPGA 3GY5A 1SLWB 1EZSC 4MNVA 4NCYA 1BMAA 1G3CA 1OWDA 1ZHMA 2ZDAH 1RGQA 1OX1A 3A7TA 2TBSA 4X6NA 5E2OA 1PJPA 2HPQH 2Z3CA 3UTUH 2ZGBH 1SGFA 2BY9X 3PLBA 4Y0ZE 3UB0A 1GCTB 2ZEBA 5FX5A 1EATA 3LIWA 1VGCB 3ENSB 1Y59T 4B2CA 1GBIA 3DUXH 3E91A 3SI3H 3FO8D 3M7TA 2ZTYA 3RXHA 2VVUA 1GBCA 4MPVA 1GMDG 1O3NA 2WV4A 3ZIAD 3H5CB 4CBNA 3SU5A 1RTKA 1L1JA 4AN7A 4DGJA 5A8ZA 2PKAA 2EI6A 4LOYH 1SG8B 2R0LA 1V6DA 1SB1H 2PKSB 2XBYA 4X8SH 3MU4A 3GCHC 2J98A 1GJBB 2BX4A 1C2DA 1C5VA 1C5LH 1HFDA 1BTHH 4E05H 2SGPE 1ZJDA 5I46H 1TB6H 2BB4A 1O37A 2OD3B 4CHAB 1O2OA 1ZR0A 1MTSA 1ETTH 4RKJB 1IQKA 1SMFE 2R9PA 2FOMB 4DG4A 3FKSD 5T6FA 2QXHA 3MTYA 5CE1A 4X1NU 2WYJA 2FOHA 1Y5AT 2D2DA 1J17T 4CRDA 4U01A 5E8EH 1C4U2 1SOTA 3VB5A 2B0FA 1RIWC 1O3KA 1K28D 5HGGA 3DD2H 1P10A 5E0GA 2B7DH 1GMCF 2D1JA 3Q3KA 4ISHH 3MU8A 3BSQA 3QUMP 2SGDE 4UE7H 4DY7B 1K1MA 1HNEE 1EP6A 1NRSH 1OP0A 3KYGA 3URCA 2ZG0H 5BPEA 1WCZA 3HK6B 1GBAA 4AGKA 1HB0B 1THSH 2OQUA 3N7OA 3DSPA 3GICB 1D3TB 3BEFB 4AGJA 1A0HB 2A45B 4Y0YE 3ZZ7A 2WZQA 4M9FA 3T29A 5A09A 1GI9B 1ZSKA 1GJ8B 2OLGA 2HRVA 2NU1E 1IHTH 1TWXB 3MFJA 5FBEA 4MLFB 4AZ2B 3TJOA 5E0HA 2FLRH 1Y5BT 1AWFH 3KQDA 2YMSC 1DDJA 3RXIA 1TX7A 1K21H 2IOTA 3CENA 1V2JT 2LNCA 2XNDD 3QTOH 4J2YB 5IDKA 3T27A 1IQGA 1ZRKA 3OFND 4B76A 1GL0E 2CF9H 3TLOA 2ESTE 5FPSA 2Z7FE 4ZH8A 2Z9LA 1SVPA 2BDIA 1UVTH 4FUBA 4XOJA 4Q80A 1DWEH 1TE0A 2Y7XA 4X8TH 4FVBA 3UNSA 2D26C 1V2NT 4YT7H 1W2KH 1P06A 4YTAA 3N7DA 1L4ZA 2HWLB 1GMDF 1TNKA 1RIWB 2RCEA 1SGFG 4Y79A 1BBRK 1YGCH 3TITA 1QRXA 2XC4A 8GCHF 4TYDA 5EU8A 3FANA 3MI4A 4QT8C 4IS5A 1K9OE 2FX4A 1C2KA 2UWPA 2PGQB 1O32A 1SSXA 4ACBA 1ZGVA 2FLBH 3F9EA 1V2VT 3VB3A 3KCGH 2SNVA 3MU1A 3SJ8A 1G2LA 3QGJA 1GI6A 5C0UA 2VBCA 2F43B 4X1PU 3SNBA 3NCLA 3U98H 1XXDA 2FIRH 3RXSA 1GDUA 3GY6A 5C17A 1DICA 3TU7H 2XOKD 1AWHB 4WMDA 1ZYOA 5HM9A 3SNEA 1S0QA 1GDNA 3ZZ4A 1UVOA 2XCFA 4X2YA 1F92A 3A88A 4Z0KA 1S85A 2TGAA 3CP7A 3A81A 4F48B 3O8CA 1SGPE 1IQFA 3E0PB 3MNXA 1B0EA 1TNLA 2KZ4A 3GY7A 2WPMS 1O2UA 5ABWA 3KGPA 1HAPH 3RXBA 4XRNA 2ZU4A 4AORA 3RMNH 1YKTA 4XSKU 5FL7D 2A7JA 1FXYA 2WUCA 2BQ6B 3ATWA 2A4GA 2EI7A 2ZU3A 3TIUA 1QB1A 2GX4A 4GCHG 1AI8H 3RXEA 2HPPH 4NA7A 4BAHB 5JB9S 1HPGA 3NRLA 4K2YA 1QY6A 1MTNB 3OY6U 3M5NA 4X1SU 5F8XA 3TH4H 1A3EH 2TGDA 3SJIA 1OWJA 3V0XA 2Z3DA 1SL3A 1F0RA 2ZF0H 2JH5D 1RS0A 2JIZD 1OWEA 1F0UA 3LGWA 5JBBS 1G36A 2BD8A 1VZQH 4AYVB 2EI8A 3F9GA 1IQNA 2JKHA 5LPRA 4UFGH 4BAOB 4FUIA 4X2XA 1G32B 2BHGA 3P8OA 1WTHD 8LPRA 4RKOB 1UTQA 5DP3A 4TPYA 1C1WH 2FPZA 1BMMH 3O8BA 4CRGA 4LK4A 5FAHA 3P70B 4IGDA 5GPIB 1P05A 3RXFA 1HAIH 3LU9B 4BTUB 1AVGH 2PUXB 3MOCA 1UTLM 1C4V2 2STBE 2YMSD 1WOFA 1JOUB 4O9VA 1UTKA 3F2GA 4Z1MD 3SO3A 2IN2A 1K1NA 1NY22 2VNTA 4K8YA 3URDA 1TMTH 2VIQA 1V3XA 1VJAU 1GHWH 5IYTA 3QZQA 1VCWA 2F9BH 1DWCH 2R2MB 3PMAB 1FDPA 2EA3A 1UTPA 1VJ9U 1P57B 3RXDA 1AZZA 2I6QA 1B0FA 2GP9B 1UCYH 1GGDC 1A5GH 2C3SA 4OS1A 1EB2A 1MCVA 2FTLE 1JBUH 2H5CA 3T2NA 1QA7A 2ZNKH 3SUEA 2ZPRA 4UONA 3EYDA 3A7WA 3RXOA 1WQVH 2OC7A 3BIVH 1BRBE 1BTXA 2HVXA 3GY4A 1H8DH 4WWYA 4BNRA 2H9TH 5HKKD 4Y6DA 4Y10E 2FOEA 3SHAH 1BJVA 4KP0A 1ELCA 2HALA 3S9CA 1TRNA 4B71A 1FI8A 2B5TB 1O3GA 3LGIA 1F0TA 3BTQE 4K69A 3DFLA 3K65B 1BIOA 2A32A 1O2SA 2KCYA 3O8RA 4BTTB 3WY8A 2XRCA 3SGQE 1A5IA 1GHAG 1NZQH 2Y81A 3OTJE 1O2QA 3EA9A 2D8WA 1DANH 1DOJA 1BTPA 2CHAC 3RU4T 2VH6A 1QR3E 1KLJH 3KQEA 1EAWA 2QXJA 4JYVH 3A7ZA 2OP9A 3NWUA 1O2YA 3SU6A 1TONA 2AMQA 2A4QA 1S0RA
chains in the Genus database with same CATH topology
1YCPK 2BY5X 2PUQH 2CJIA 3ODFA 1Z8JB 2A31A 1S81A 3L6PA 3B23B 3S9AA 1GGDB 1SGNE 2ZZUH 1SC8U 2CXVA 5DP5A 5GDSH 1HYLA 5AF9H 2Z3EA 1DFPA 2BD5A 4K1SA 1BHXF 4ABIA 3Q3YA 4CRFA 1O2HA 1HGTH 3AW0A 5LH8A 1HAOH 2BLQA 1YPHE 2FP7B 2SNWA 1ZSLA 1Y3VA 5DKMA 5JYIA 1GI8B 4H6TA 1EAUA 1WTGH 4A1XA 5JB8S 1V2RT 4KKDA 1LCYA 3GCNA 5DP7A 5J4QA 3RXJA 2R0KA 1MKWH 3DHKH 1KXFA 1GDQA 3IWMA 2AGEX 1DITH 1BDAA 1GBHA 2V6NA 2LPRA 1IQMA 2FS9A 4F49A 2BZAA 1LHFH 2P3TB 2QA9E 2J38A 1THRH 1HJ9A 6CHAC 1J8AA 1FY1A 1O3DA 1XUIA 1P2JA 4ZXYH 1FY5A 5C1YA 3MO3A 1WQSA 2P95A 3A7YA 6GCHF 4IC6A 1ZGIA 1SLUB 3ZZ8A 2XC5A 3QZRA 5GIBA 2ZFPH 1AHTH 1Z8GA 4ISOA 1NFUA 3SUFA 2GZ9A 5H4IB 4K5ZA 4Y7BA 3KHVA 3P8GA 3LJJA 1C1SA 3Q3XA 1DS2E 1LO6A 3SNDA 2IPHA 3RC6A 2P94A 5DP6A 1C5TA 1GHBF 1UCYK 1DLKB 4WMFA 5F8ZA 2KAIA 1BRUP 3VPKA 1ETRH 3UIRA 4D7GA 1UK2A 3I29A 1O30A 3E90B 1TGBA 1AE5A 4MQAA 1LVOA 2J95A 4UFDH 1GBJA 1K1JA 3U8RH 4ASHA 3V13A 5ETXA 2PTNA 3E8LA 4ISIH 4XBBA 1XUFA 1TAWA 1J9CH 4WF8A 4CRAA 1BT7A 3VB4A 1JIRA 1GBTA 2JH0D 2P8OC 1UK4A 3D65E 3UR6A 3M37A 2VIWA 1C5ZB 4GAWA 1UVPA 1YCPM 1C5PA 2P93A 2O8MA 1UTJA 1T31A 4Q7XA 1T4UH 1GWAA 4E06H 1TBZH 1OP2A 5FPTA 1C5OH 3SQEE 5EW2H 1KXBA 1YBWA 3GOVB 4YT6H 1WYKA 1W0ZU 1LVBA 2XXLA 1QGFA 3MH6A 2C8WB 1ZPBA 2QXGA 1C1NA 2GZ7A 3MU0A 1P11E 1GCTC 3UNQA 2YOLA 2TIOA 4INKA 1SHHB 4DJZB 1D6WA 2GDEH 1OP8A 1WV7H 2J34A 4LZ1H 1T8MA 2BLVA 2HLCA 4YLQH 1D4PB 2V0BA 3BTGE 1GG6B 1T4VH 2BY7X 1FN8A 2Z9IA 3BTKE 1GMCG 2ULLA 2ZI2H 5BRRE 1B7XB 4OS4A 1KSNA 2PKSC 4JZIA 1QRZA 1OYQA 1P8VC 1AD8H 5JBCS 1KDQB 2H9HA 1BQYA 2BD4A 3ZV9A 1HAZB 1Q2WA 2VVVA 3TJVA 1Y3UA 3ZZAA 3V12A 5FCRA 1A0LA 5FBIA 1EJMA 1C2JA 4CHAC 4BAMB 4YOGA 2ODYB 1OKXA 2QV1A 1DUEA 1VCQA 4NFFA 1O2JA 1W12U 3BG8A 3STIA 3LPRA 2CF8H 4WH6A 2BVXH 3E3TA 1L0ZA 1CSOE 3MNCA 4IBLH 1P2IA 1QCPA 4DIHH 1P2MA 1IQEA 1GJ4H 1MKWK 2ZWLH 3V7TA 1GI5A 5F8TA 2PWXA 2GT7A 1DX5M 3A84A 1PYTC 1CA0B 1SQTA 4OGYA 1O3EA 3DT0H 3QTVH 4Q7YA 1MZAA 4AB8A 2TGPZ 1O3JA 4NIWA 4B2BA 1NPMA 1ARBA 2A5KA 3E0NB 3A85A 3RLWH 1C5YB 3A87A 3RXQA 3KF2A 1L1NA 5TJXA 1BTWA 1CO7E 1GJ9B 3UFAA 4Y8ZA 3LDXH 1EUFA 1P09A 1RTLA 1ZSJA 1SLXB 1ZHRA 2W5EA 3OSYA 2GTBA 4E7RG 3PROA 2BXTH 3M7QA 1PFXC 2BM2A 8GCHG 3F6UH 3FVFB 2BD2A 3M3VA 1XKBC 3A83A 2QF3A 4OS2A 4X6MA 4ZHLU 3UY9A 2G5NA 1EJAA 2ZFFH 4Y11E 1TGNA 2ZDNA 2BVRH 3KQCA 5L2ZH 1O2MA 1H9LB 4CR9A 2WPKS 3TVJB 1E38B 1IHSH 2ASUB 1EASA 1N6YA 2VWNA 1UTMA 4NA8A 2Y5FA 1G3EA 4ZROA 2H9EH 4CRBA 2PSXA 1FIZA 1VCPA 4U32A 1ZMLA 3PWBA 2ZDKA 4I8LA 2ZO3H 2VU8E 2UUJB 2ANWA 5DK1A 1L2EA 3SQHE 4WVPE 2EC9H 5GCHF 3UWIA 1A7SA 3HGNA 1MBMA 5GJ4B 1MAYA 3M36A 1GJ6A 1XVOA 3AASA 3BG4B 3UOUA 1YLDA 4BTIB 2ZHDA 4YM9A 5JDUB 2R3UA 1XVMA 1O5DH 1W11U 3SU0A 1CGJE 4AFSA 2ZU1A 3RMOH 3LT3A 1BZXE 3M5OA 3U1JB 3W95A 2AEIH 2Y7ZA 1P2OA 4KTSA 5FPYA 1RRKA 4XE4A 3SJKA 3ZVFA 4AFQA 1CGIE 5J4SA 1INCA 5A8YA 1AVXA 1TPSA 4HI3A 1PPFE 3E16B 1TIOA 1AB9C 3KN2A 4MTBA 3TGJE 5DG6A 4A92A 2H1UA 1IQHA 2QC2A 1TMBH 3GYMA 1W14U 2NWNA 1O3PB 3ESTA 1GI2A 3ZVAA 5CMXH 1QURH 4E7NA 1Z8RA 2AS9A 1LPZB 2C4FH 3LGVA 2W3IA 4A6LA 1MTUA 1QNJA 3ZZ6A 6ESTA 4JMYA 1E0FD 1OWIA 1X7AC 2GT8A 2BD9A 1C1MA 1IAUA 1DXWA 1HIAB 3EE0B 1EAIA 3OY5U 2ZQ1A 3M35A 4AX9H 1PQ5A 3RMLH 1H8IH 1SFQB 1VITF 1TA2A 2G8TA 2QCYA 2A5IA 1ID5H 1DT2A 2FWWA 1LKAA 3U69H 2J94A 3RXKA 9LPRA 5JBTA 5SGAE 1EAXA 3SOSA 2FO9A 1BUIA 2FI5E 2F9VA 1TQ0B 4D9RA 3M7UA 1S83A 1MTNC 1EOLA 4INLA 1PYTD 1J14A 1SI5H 1S82A 2A2QH 3RDZA 1SR5C 3BTTE 2ZU5A 2JETB 3S69A 5FXLA 2RG3A 4AOQA 3RU4D 2XWBI 1HXFH 1F5KU 1TNGA 1SGEE 5CHAB 2BX3A 1A61H 1HBTH 4ESTE 1C5WB 1CU1A 3CS0A 3VB6A 3RUOA 1HCGA 3ZZ5A 1AB9B 2ZP0H 1A2CH 4KELA 1YLCA 1LDTT 1ZRBA 1Y3WA 2C8YB 3A80A 2Y80A 1F7ZA 1MQ5A 1V2OT 1C9PA 1V2MT 2FESH 1ANBA 3TK9A 4DT7B 4YLUA 1FN6A 1XM1A 1SGTA 1O33A 4I8KA 2GDDA 3PWCA 4OS7A 5EGMA 1HUTH 1Z1JA 2XBVA 2UUKB 5DP9A 2ALPA 2BY6X 1FJSA 2FOFA 1GBBA 3L3TA 4H4FA 1HAVB 1BTZA 1YPEH 1QQ4A 3ZZBA 5LPFA 3K6YA 4AG1A 4ZHMU 1O31A 4TY6A 1O35A 5T6GA 4XBDA 1K22H 5F6MA 6LPRA 3S9BA 1AVWA 1O2VA 1O2TA 1ORFA 1Z6JH 3NKKA 3F9FA 3ZZ3A 5DP4A 1TFXA 5EQRA 2G52A 7LPRA 1BCUH 3GY8A 2GMTB 3ZVEA 1S6FA 1BBRE 2ZFTA 5EXLA 1V2QT 1ZHPA 1FY8E 4R0IA 1QJ7B 2VIDA 3A7XA 3M3SA 3PLKA 3MHWU 4YOIA 3BEIB 2QY0B 4IMZA 1RFNA 4Y7AA 3SI4H 4I33A 2A4OA 4O3UA 1O3CA 4KGAA 1DVAH 1LHDH 1V2LT 2Y82A 3L33A 1E37B 1ELDE 2A7HA 1S5SA 1XUJA 2CN0H 3LH1A 3PV4A 3BV9B 5A0CA 3ZV8A 9ESTA 3LH3A 5L30H 5EQQA 4VGCC 3UQOA 2STAE 3GDUA 2O8WA 1AIXH 1FMGA 4MPXA 1DSTA 4MNXA 2Q6DA 3HKIB 4IC5A 3TJUA 1C2EA 1XUHA 4A1VA 1QL8A 1O2GH 3D49H 4FUHA 1TGCA 3IITA 2P3UB 1DWDH 2BZ6H 1C4Y2 3S0NA 1ARCA 2C90B 1ELTA 2FOCA 1EPTB 3UREA 1LTOA 1O2PA 3K2UA 2HNTF 1YM0A 2ILNA 3LGTA 1O39A 3M5MA 3QX5H 4ZKNU 2AIQA 1SFIA 4OS5A 1L4DA 2O9QA 1RXPA 1LPGB 3T5FH 2XWAA 2PW8H 2CV3A 3RXCA 4B1TA 3MO9A 1Q3XA 1GHYH 3BEUA 3VGCB 4DURA 1N6XA 4FUEA 2NU0E 4YESB 2BMGB 2J4IA 2J9NA 4ABJA 1GI3A 1ELVA 1P9UA 5E2PA 4X6OA 1GBMA 3VB7A 6GCHG 1MD8A 2FM2A 4O3TA 3AVZA 3PMJA 3RXVA 4WXIA 5K0HA 2UUYA 3RLYH 1C5QA 1O5CB 3LONA 4I32A 4MDSA 3VEQB 1CGHA 1DE7H 1EJNA 3S7KB 4ZKSU 1ELGA 1G37A 3TNTA 1GHBG 1O0DH 1T8OA 1UK3A 1O2WA 1UTOA 2ZDMA 2WV5A 4VGCB 3QN7A 4A7IB 3RXGA 4XBCA 2UWOA 4AYYB 1GL1A 3SNAA 1O3MA 2ZQ2A 4HZHA 3SGBE 1TNJA 4AFUA 5C5NA 4FUFA 1C5NH 1GJ7B 1LMWB 1NFYA 4PROA 4CRCA 5GWZA 3A86A 3QK1A 4JYUH 4UFFH 3R0FA 3GDVA 4MNYA 4ZAEA 2THFB 2TGTA 1Y3YA 5A0AE 4B75A 2O8TA 1UHBB 3A8DA 4HGCA 4X1RU 2F91A 4K1EA 3SV7A 1G2MA 1WAYB 1CT2E 1G3BA 4K1TA 1MBQA 2G51A 3T25A 2HNTC 3MH7A 5DPAA 1Z71A 5K7RA 1AY6H 3V3MA 1YPKH 8KME2 1QHRB 3SV9A 2VWLA 2W7UA 1AZ8A 1V2UT 5FHTA 3H7OA 1IQIA 1ANCA 1JIMA 1JMOH 1NO9H 2AIPA 1P0SH 1O5EH 3PTBA 4NIXA 1QBOA 1P03A 1NT1A 1Y5UT 1V2KT 1HJAC 2OC0A 3GY3A 2Y5GA 1P9SA 2BDHA 1GVKB 1EZUC 1XUKA 2BQ7B 2DE9A 4WH8A 2FOAA 2SGAA 4CH8B 2FEQH 1HJ8A 3TNSA 2BOHB 1Z7KA 2GD4B 3RU4E 1EKBB 2FXRA 2P59A 4I8GA 3H7TA 3DFJA 1TMUH 1GPZA 3G01A 1OYTH 2H2ZA 4JZFH 3GISB 3PYHA 4IW4E 1C1OA 3UR9A 1AKSB 2FDAA 2PGBB 2GCHF 2PFEA 3TH3H 5ESBA 1AQ7A 1OWKA 3KIDU 1LHGH 2FODA 1KY9A 1BMLA 1MU6B 1ZTKA 1GG6C 2B9LA 3UNRA 1L1GA 2XTTB 3TPIZ 1BTYA 1DPOA 5C5OA 1CHGA 1BB0B 2AGIX 4ABDA 1QL7A 4IN1A 5HXFA 1C2MA 1ELBA 5F03A 4ABBA 2AYWA 3QGNB 4ISLA 4JK5A 1C2FA 3BTEE 2JH6D 2ZHEH 1HJAB 2PKAB 2ZIQH 1TNHA 2BDGA 2G5VA 1RJXB 3MU5A 1GMHF 1NRRH 1QB6A 1YP9A 4AB9A 3HGPA 1YC0A 4UFEH 4GLYA 1O2XA 4U2WA 1P02A 4BXWA 2G4UA 3MWIU 1AO5A 3HATH 3P8NA 1J15A 1YF4A 2A2XH 2ANYA 1J16A 2O8UA 4MVNA 3TH2H 4JCNA 5C2ZA 2CGAA 1YYY1 2H6MA 1CA0C 1DWBH 1LHCH 1K1OA 2ZGCA 4JZEH 2VH0A 2OCVB 2BDBA 5ESTE 5C67A 5EOKA 1PPZA 1E36B 2CMYA 2GVFA 2TRMA 1LKBA 1W10U 4IN2A 1HV7A 4INHA 4BXSA 2B8OH 1NFWA 4X6PA 4JZDH 3ZYDA 1N1LA 4NSVA 5GCHG 1ZLRA 1YPGH 1FPCH 3SBKA 3PB1E 2ZU2A 1ESAA 2NU2E 1PQAA 1BMNH 2XBWA 1EP5A 1K2I1 1RTFB 1O5AB 4WY3A 3TJNA 4X0WU 3ZZDA 3A7VA 4Y71A 1P2NA 1K1IA 2F9NA 1D6RA 2VINA 3B8JA 3GDSA 1QIXB 1TOCB 1TPOA 1QL9A 1GHVH 1O2RA 1ELEE 1O5BB 3P6ZB 3RXUA 1IOEA 3MNSA 1LVMA 1D3DB 2ZCLP 4Y76A 1E34B 1Z8IB 1OSSA 1C2HA 3RM0H 1EOJA 2ALVA 3P8FA 2ZKSA 2R3YA 5LGOA 1O2ZA 1PPCE 2DE8A 1Y8TA 4R8TB 1GJ5H 2ZDLA 3RC4A 3SGAE 1WBGB 2NU4E 3BTFE 1NRPH 1GBFA 3BG4C 4ZHAA 4THNH 1FONA 5T6DA 2V3OH 1TRMA 1TOMH 3AAVA 2F9PA 2FI4E 1P04A 3SUGA 1VITG 1BA8B 2FI3E 1SPJA 1F5LA 2BYAX 2GV7A 1BBRH 3ZVBA 3A8CA 2XC0A 4FU8A 2HOBA 2OUAA 1CE5A 4XFQA 4Y8YA 7ESTE 1BRAA 5AFYH 1N8OB 2PR3A 3A82A 1MD7A 3Q00A 5HMAA 1O38A 4FXGH 3E6PH 3SV6A 4HFPB 1ZZZA 3TK5A 4NFEA 1O2LA 4NG9H 4WMEA 2FS8A 1TRYA 1W7GH 1TX6A 2QAAA 2WPIS 2C8XB 3PMBB 4FVDA 4NGAH 1AGJA 1DY9A 1YPLH 2IJOB 4IMQA 2AH4X 1TPAE 5EPNA 4UEHH 1FQ3A 3P92A 3ZYEA 2ZPSA 1FUJA 3PMHB 4ZUHA 3LC5A 1A0JA 3GCTF 1JRSA 1S6HA 1K1PA 4BAKB 1NU9A 1CT4E 2ZPQA 1MQ6A 1YPMH 2G00A 1E35B 2G81E 2A1DB 2SGFE 1H9IE 3O8DA 5DP8A 3DA9B 2Q6GA 1NC6A 2Z9KA 5I25A 1UO6A 2F83A 1MU8B 1Q31A 4TWWA 1ESBA 1HAYB 1DXPA 3BTDE 1O3OA 1ELFA 1GHXH 3M61U 1QBVH 1BRCE 2Z9GA 2JETC 2ZC9H 3W94A 4K60A 4TY7A 2RA3A 1D9IA 3T28A 5AFZH 7GCHF 1CHOF 1GVLA 3TGIE 1NM6A 5CHAC 3FFGA 2FMJA 4NSYA 2J2UA 4A1TA 1GI7B 1TPPA 2WYGA 4H6SB 3PLPA 1G30B 1SGDE 3U8TH 5TCAA