1QBOA

Bovine trypsin 7-[[6-[[1-(1-iminoethyl)piperidin-4-yl]oxy]-2-methyl-benzimidazol-1-yl]methyl]naphthalene-2-carboximidamid zk-806711 inhibitor complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of potent and selective factor Xa inhibitors complexed to bovine trypsin.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PROTEIN (TRYPSIN)
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qboA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qboA02
3E16B 4WH6A 2ZHEH 1O2ZA 3RXQA 1JXPA 1L2EA 2PHBA 1BRAA 3QTOH 1SBWA 2PUXB 1RTKA 4O3UA 8LPRA 4YT7H 1F0SA 2A2XH 3BTEE 4DVAU 1UTMA 4DOQA 4H6TA 1DUAA 1YPHC 1TAWA 1MD8A 1WYKA 4ABBA 1LVYA 1P2KA 1SVPA 2QXJA 1GMDF 3GYLB 1TGTA 1KDQA 2HPPH 1W2KH 2V35A 1ETRH 4UD9H 2CF8H 3ZVBA 4OGYA 2FOBA 1SQAA 2Q6DA 3LGUA 3S7HB 1RXPA 3A8BA 2B0FA 3M35A 3E90B 3SU3A 3LGVA 3SGBE 2Z3CA 4WVPE 1C5SA 3PLPA 2P8OB 4NIVA 1B7XB 1PJPA 1THSH 2OD3B 1VJ9U 1FN6A 4ABJA 3FFGA 4ASHA 1Z8JB 2OBOA 1NS3A 1QL9A 1DDJA 2V3HH 3A7VA 1YLDA 1S81A 2BZ6H 4I8HA 4XDEA 3CS7A 3TITA 3HKJB 4JK6A 6LPRA 7GCHG 3W95A 3ZVFA 4DT7B 1SGDE 4XE4A 1LHFH 3RMOH 1GJAB 1ZGVA 2F91A 3SU4A 4PROA 1L1GA 2FI5E 5EGMA 1GHBG 1EJMA 1BTHH 4YT6H 2HOBA 5DGJA 1V2LT 1ORFA 2ZPQA 4IMQA 1GI2A 1GBDA 1ZMNA 3TLOA 3TGJE 1SFIA 1O31A 1QQUA 3IITA 3BEUA 4OS4A 1QBVH 3SHCH 3DUXH 1S0QA 1UHBB 1WOFA 4HTCH 3OSYA 3ZVAA 3ATWA 4FUFA 3Q76A 1JMOH 1P3CA 2G4TA 4Y11E 4INKA 2BY5X 1BUIA 1V2NT 1EOLA 3VXFH 1UVOA 3E3TA 1H1BA 1GHBF 4NG9H 3U8OH 4FUDA 1SB1H 2A32A 1GHZA 3D65E 5C5OA 3V13A 1GI1A 1HAGE 4D8NA 1QA0A 4X0WU 3ESTA 1IQFA 5E2PA 2BXUH 3RXCA 3F9GA 4HGCA 3QGJA 2LPRA 4WMEA 1O38A 2F9NA 3MNCA 3TK9A 1L4DA 1A61H 1MQ5A 4O9VA 2EC9H 2FEQH 2G52A 3LU9B 1P10A 1GJ8B 3ZYEA 2ZFTA 3P70B 1SQTA 2Z9LA 1F0TA 2GT7A 3FP6E 3F9HA 4IBLH 3GYMA 2ZKSA 4ZH8A 3O8DA 3SNCA 4A92A 3LC5A 4I8LA 2F9BH 1C4U2 1HXFH 3ATKA 1W14U 2P3TB 2Q6FA 3TJUA 4AFSA 1AMHA 3OYPA 3ZZ5A 2GCTB 3PMBB 1S83A 1UTLM 4ZHLU 2OC1A 1SQOA 1YPKH 1MMJN 1BRBE 4XBCA 1Y3WA 1GVKB 1QIXB 3QN7A 3SJ9A 3RXAA 4AFZA 1PPFE 3PTNA 3SUDA 3H7OA 1O2GH 4ZKSU 3V0XA 1FLEE 2VWLA 3MU0A 2HGTH 3VGCB 1TWXB 1O34A 2XBXA 4BAHB 2J4IA 1UK3A 1GG6C 8GCHF 4WWYA 3AAVA 4HFPB 2EI7A 2BQ6B 1O37A 1PYTD 3RDZA 2OUAA 1SSXA 3UOUA 3L6PA 1O3KA 1Y5AT 4GUXA 5EU8A 2OTVA 2FLRH 1OP0A 1XUFA 3D23A 1C9PA 1EUFA 1MAYA 3BG4C 1FJSA 1TA6A 3NXPA 1K1LA 2D2DA 1XUHA 3SNEA 1CO7E 1FZZA 1DY8A 1S6FA 2JETC 4YLUA 1SFQB 1BOQA 2J9NA 5A09A 5EG4A 1ARCA 3UNQA 3A87A 5HMAA 3RXEA 3EGKH 2VGCB 5SGAE 2Y7XA 4UFGH 4AGJA 4NIXA 1Q31A 3A80A 3QZQA 2EI6A 2PKAA 1DVAH 2ANMH 1RGQA 2H5DA 3M7UA 4YOGA 5DP8A 2ODQA 1HAYB 1WUNH 2WUBA 2BDAA 1AUTC 1O3MA 2WPIS 2BDYA 5EW1H 1YC0A 5JBTA 3BEFB 2ANKH 5L2YH 4BOHA 4AYYB 5AFZH 1QTFA 3K2UA 1T4VH 2Y6TA 3ODFA 3UR9A 3OTJE 1UCYE 3SQHE 1BTWA 1GJ5H 1Y5UT 4CR5A 3TNTA 1DOJA 1MCTA 1TOMH 1OKXA 1CHOG 1BTYA 2BDIA 1OXGA 1C1PA 3SU2A 1XM1A 2PFEA 3DFLA 3GY3A 3S9CA 1MZDA 7KMEH 2BX3A 1AKSB 3HGPA 2ZFQH 1D3TB 1EZUC 1Q3XA 4A1XA 3MU8A 1SGQE 3AASA 4INHA 4CH2B 1V2WT 1GI8B 2ZC9H 3DT0H 2F9OA 2PGBB 4KELA 2C8XB 2C8ZB 1XVOA 1W11U 3KL6A 2ZTZA 2YOLA 4A7IB 4I33A 1A0HB 1KLJH 3CENA 2AGGX 1NRQH 3T27A 2UUKB 4IN1A 3TGKE 1P11E 1HJAC 2GZ9A 1VZQH 2QIQA 1AVGH 2W7UA 1UCYH 1ELFA 5DKMA 2FS9A 3I29A 1MTSA 1QB1A 4ABHA 2FYQA 4OS6A 1F0UA 1KXCA 3QWCH 4BAKB 1BRUP 2PKSC 2FTLE 4CREA 1GBJA 3SW2B 5FPSA 5GXPA 1O39A 1HBTH 4DW2U 4Y10E 4O3TA 1MTVA 3A89A 4ZKOU 1C1SA 3QGNB 2OC7A 1NN6A 1YCPM 1FONA 2XC5A 1PFXC 3E0PB 1P12E 2A4GA 1BMAA 3OU0A 4F4OC 4CH8B 1LKAA 1TMTH 3NUMA 2SGPE 3EQ0H 4ESTE 1HYLA 2NU2E 3RC6A 4AGKA 1EZXC 2TRMA 1UTQA 4NCYA 1QQ4A 1DT2A 3DHKH 3VB6A 1O5AB 4ZUHA 1TB6H 3RXUA 5JPMH 1S5SA 4YLQH 3VB7A 1PYTC 3RMLH 1LHDH 2PGQB 3SJKA 1A2CH 1D3QB 1EOJA 2DE8A 2ALPA 2J95A 1C5LH 1IQIA 6GCHG 3A85A 4R0IA 3MO6A 4AB8A 3EA9A 2O8MA 3FP7E 1A0JA 2XBVA 1O5EH 1C1VH 3ZZ7A 2A7CA 4NWKA 3LJJA 2XWAA 1P09A 1G30B 1D6WA 3BTTE 2FM2A 3A88A 4K60A 2C4FH 1SGTA 2QXGA 5GPIB 4LZ4B 2H9HA 3AVZA 4X8SH 1TMUH 4WF8A 1HAIH 1A3BH 2ZO3H 4K2YA 1G3CA 4ISNA 1HAVA 1SMFE 1XXDA 1LVMA 1YPHE 1C5NH 3STJA 3T25A 2VIPA 2AH4X 1CHOF 1MKWK 1EB2A 2BXTH 1G9IE 1MTUA 4D7FA 3SV6A 1ZTJA 2ZDVH 3MMGA 1GG6B 2XC0A 3QX5H 2VINA 1HPGA 2GVFA 2ZWLH 5ABWA 1Z8RA 3E8LA 5LH8A 1S0RA 2ZU4A 1TPSA 3TH3H 4IS5A 1NROH 3MNSA 1SGFG 2OLGA 3F6UH 1P01A 4XOJA 3RMNH 1KDQB 2VH6A 1GI7B 3TVJB 1GMCF 1DSUA 1GI4A 4RKJB 2BY8X 2PWXA 1FY8E 1LKBA 1C2DA 2FOCA 1FQ3A 3RXBA 3MTYA 1TRYA 2ZGXH 1U6QA 2JH0D 5A8ZA 2A0QB 2AEIH 1TNLA 5PTPA 5C67A 1H9HE 2PTNA 3SGQE 1RIWC 1O35A 2OINA 2VIQA 3B8JA 2J92A 3F68H 2BD4A 4UEHH 1G3EA 1Z71A 3MHWU 4Y6DA 3RXPA 2GCHF 4ABIA 4MVNA 1Z1JA 3P8GA 1P57B 5HM9A 1Q2WA 1S6HA 1F92A 3DA9B 3U9AH 3MFJA 2FP7B 1DICA 1DXWA 4OGXA 4B2BA 5L30H 2TGAA 3MI4A 3M5LA 1IOEA 3TIUA 2ZU2A 5GDSH 1C5YB 1TQ7B 2I6SA 1J15A 1O3GA 1GMHF 1VITF 2A2QH 2SGDE 1L4ZA 5AHGH 7GCHF 3STIA 3A83A 2STAE 1DLEA 3S0NA 1DWDH 4X6OA 1D4PB 4YOIA 1PQ8A 1GL0E 3SU1A 1EP6A 2Z9JA 1E36B 3RM0H 3H7TA 1GBAA 1IQLA 3MO3A 1ZR0A 3PMAB 2SNVA 2ZZUH 3UY9A 2AMDA 4TY7A 1XUGA 1O2LA 1WTHD 4CBNA 1K1JA 1O32A 1G2LA 4UFDH 4KTCA 4GPGA 1YM0A 2O8LA 2Y5HA 4X2YA 4ISLA 1SGIB 1XX9A 4D9QA 4ZMAH 4UDWH 1XVMA 5CE1A 2IJOB 1C4V2 2VNTA 4MNYA 2STBE 5L2ZH 4FUHA 2G4UA 3PV4A 1VCPA 2PV9B 1FIZA 2TGTA 2QA9E 1ELVA 3UOPA 1MBMA 4CRFA 1W3CA 2Y82A 4ISIH 4AB9A 4A1VA 2YNAA 1EZSC 1OWEA 2EI8A 4AFQA 1ZHMA 1OP2A 2Y81A 1KTSB 1PPCE 1V2VT 3K6YA 1AE8H 1CGHA 4FUJA 1BBRE 3RLWH 4FUIA 3F1SB 4I7YH 1IQHA 3BG4B 4GLYA 1HV7A 3SJIA 1CA0B 3K65B 3PMJA 1Y3VA 4AN7A 1QFKH 3BTDE 3UWJH 1GI6A 1LHGH 1L1JA 4TPYA 1CQQA 3A7YA 2FI3E 3IWMA 1C2HA 1GJBB 3V7TA 3ZZ8A 1SGCA 4Y8YA 1O3NA 2ANWA 2O8UA 2Y5GA 4E7RG 1LQEA 1ZHRA 1TONA 2SGEE 1EATA 5C2ZA 2BVSH 1LTOA 1QJ6B 5JYIA 3RXIA 1E0FD 3V3MA 4DG4A 1HIAB 1TGCA 2BMGB 1AI8H 5FXLA 3EYDA 1ELAA 2ZDKA 3RXFA 1VCQA 2BTCE 3BSQA 3L33A 4NZLA 1AUJA 1O3BA 4JZDH 1C2LA 3VB5A 4D7GA 2XNIA 3RU4D 4FUCA 1BHXB 3RP2A 3TK5A 3BN9A 1GI0A 1BMNH 1FMGA 1FPHH 1MKWH 1S82A 1K1NA 2P3UB 3E1XB 5E0HA 1F5RA 3SI3H 4Y79A 3SI4H 1GJDB 1J16A 1FDPA 2A31A 5A8XA 3Q77A 4AORA 4HZHA 2JKHA 2FLBH 1W8BH 1KIGH 4OS7A 1QJ1B 1HGTH 3U98H 1JRSA 4FU7A 5HM2A 1J9CH 1MUEB 3K6ZA 4NIYA 4O97A 2ZCHP 1BA8B 4YZUA 1WCZA 1RJXB 5ESTE 3HATH 1OP8A 2XRCA 4K5ZA 3GDSA 3Q3XA 4ZXYH 1KYNA 4FUEA 5FBIA 1ZHPA 1W7GH 2F9UA 4KKDA 4I32A 3OX7U 1GBLA 4ABAA 1TA2A 2SGFE 4NSVA 1A4WH 3ZV9A 3QTVH 2XBWA 1GVZA 1SC8U 2VB0A 3BTFE 3DD2H 1C2EA 1EAXA 1O2MA 5DJ7A 2UUJB 2XW9A 1O3JA 1ZSKA 3RXVA 1PQ5A 1AU8A 3SV2H 3M3VA 5JBCS 4ZHAA 1TGNA 3SU5A 4UFFH 2BD2A 1MQ6A 2WV5A 4B75A 4JCNA 1K22H 2FWWA 3ZZAA 1NM6A 3Q3KA 4X1SU 2G55A 4O03A 1BITA 1D3DB 3KQCA 1OWIA 2XCNA 4UE7H 2ZU3A 2Y7ZA 2BM2A 3MOCA 1BT7A 2VGCC 1F5KU 3LJOA 2BLWA 1ANBA 4BTUB 2GZ8A 2GD4B 3P17H 1C2JA 2OC8A 5FCKA 5FX5A 4FUGA 1SOZA 2ALVA 1DITH 4MPWA 3LT3A 2D8WA 3KHVA 2KAIA 5F6MA 4X6MA 1RFNA 3LGIA 1GMDG 3RXSA 3QLPH 4KP0A 2Z94A 1AWHB 2PR3A 1O2IA 2GTBA 1YCPH 2Z3DA 3KN2A 1UK2A 3ZVCA 3VB3A 1D3PB 4YM9A 2QCYA 1V2JT 5F03A 3PYHA 5FBEA 2AGIX 3T28A 3UQOA 3ZZ9A 2ILNA 2QGRA 3GY8A 2HRVA 1UK4A 1IQMA 1BMLA 1P9UA 4INLA 1F0RA 2P93A 1O2NA 2R3UA 4XBDA 1FUJA 5JDUB 1TRNA 2FOAA 3RXGA 1CT0E 1SHYA 2WINI 3PWCA 3SV9A 1BTXA 3LPRA 4Z6AH 1HAVB 5G4BA 3R3GB 1KXFA 1BJUA 2BVXH 3S9AA 1EAIA 2TIOA 2ZDMA 1IQNA 3BTGE 5E0JA 2AYWA 3KF2A 2AS9A 2FX6A 1G36A 2A7HA 1GGDB 3PB1E 2ZCKP 3ZYDA 1TX8A 1LVOA 1DSTA 1NZQH 2GT8A 2SGAA 4TWYA 2CGAA 1QR3E 3HGNA 5BRRE 4MNVA 1SOTA 2R2WU 4QT8C 1AVXA 5GCHF 1VR1H 2Y80A 1HAHH 2GV6A 3ZZBA 1G37A 4K3JA 2F9PA 4AYVB 2LNCA 3MU1A 2SGQE 1OX1A 1FN8A 5DG6A 3ITIA 4OS2A 1O2TA 2HLCA 4X8UH 3D62A 1MBQA 1A46H 2RCEA 1FAXA 2ZDNA 2DUCA 1YCPK 2ZF0H 1GHYH 3LH3A 1CVWH 2RDLA 4E06H 2V3OH 5EPNA 1PPZA 1T8MA 2FMJA 5JB9S 1SGNE 3GISB 3A81A 1UTKA 1XXFA 3BF6H 1DXPA 1O2KA 2V0BA 5EPYA 1Y3UA 5EOKA 3MNBA 2ZFSA 4NWLA 2QF0A 2CHAC 1HB0B 3M5OA 4CBOA 3ZZDA 1L1NA 2HNTF 3B23B 4CRDA 4DURA 2ZA5A 2J38A 1LPKB 2I6QA 1UO6A 4Y7AA 1QGFA 2F9VA 1MCVA 1BMMH 1TNIA 1LPZB 1LHCH 4K8YA 4IN2A 4AG2A 1ANDA 2QAAA 1W7XH 1IAUA 3PLBA 1ESBA 1O5GH 2WPMS 1MZAA 2ODYB 3RXLA 3KQBA 1GBKA 2BOKA 1AFQB 1GMHG 4Q2KA 4B76A 4GHQA 1ETTH 3GY7A 4RKOB 1OOKB 1GBIA 2ANYA 2BQWB 1O5DH 4LZ1H 2AIPA 1GBCA 4ISHH 2ZI2H 1O2RA 1QBNA 1V2TT 1FI8A 3NWUA 1OWKA 4YO9A 3RXOA 1GJ7B 1JRTA 1QB6A 3KGPA 2A5AA 3JZ2B 1O2OA 1ZPBA 1OWHA 3JZ1B 3PM3A 3F9EA 1N6XA 2VU8E 2WPHS 5F8ZA 1T31A 4M7GA 3SUFA 4JZEH 1YPJH 4BANB 3LGWA 3H5CB 1C2IA 5EXNA 1O5FH 1EQ9A 2QV1A 3CS0A 1ZTKA 1T8NA 2FOMB 5JBBS 2FZZA 3RXJA 1MAXA 1AQ7A 4R8TB 2QF3A 2BZAA 2HPQH 1FPCH 2NU4E 1BDAA 1C5QA 1K21H 3A8DA 3NK8A 2NU1E 1FV9A 1AB9C 3SNAA 2P16A 2SFAA 3LGTA 5GJ4B 1YPMH 1O3EA 1ACBE 2EA3A 3PTBA 2BD8A 1XKAC 2VIDA 4Z0KA 4TY6A 3RM2H 2A4OA 1SGRE 4MNWA 1DS2E 1Z7KA 4D9RA 4X1PU 3PO1B 4BTIB 1RTFB 2PLXA 3T29A 1TNHA 1O0DH 1YBWA 3ELAH 2P94A 2BVRH 1F2SE 1FY3A 1V2UT 2Z7FE 2BB4A 3FAOA 1C1MA 2VVUA 2VWNA 3E91A 9LPRA 4OS5A 1AO5A 3SO3A 1UTPA 2FS8A 2XXLA 5LGOA 1TABE 2QXIA 1PPBH 3NZIA 3ATIA 1F7ZA 1ZMJA 1MKXK 4WH8A 1LPGB 1QB9A 4GCHG 1VGCC 5GWZA 4IGDA 3PROA 3TGIE 2ZU5A 1GBTA 2NU3E 3RLYH 3RXTA 2A45B 2Z6BD 1ELCA 1A3EH 2WUCA 2BQ7B 5ESBA 1F5LA 2A5IA 1V2ST 1INCA 3BIVH 1NO9H 3QZRA 4ABEA 1THPB 4JYTA 1WQSA 4ZKNU 3LOXA 2H6MA 1T7CA 1IQJA 3U8TH 1Z8GA 3ZZCA 1QA7A 1Y5BT 4CRCA 1PPEE 3SV7A 4WMDA 1AD8H 3T62A 4SGBE 1WAYB 3FP8E 6ESTA 2GP9B 2C8WB 4X6PA 3BTKE 3E6PH 1NU9A 1Y3YA 2FOEA 4Y7BA 4I8JA 1BBRK 3A7ZA 1GI9B 1C1WH 1GBBA 1T4UH 1LVBA 1T8OA 1SR5C 2PKAB 1B0EA 2ASUB 4NA9H 3UR6A 5K0HA 1O2UA 2VVVA 2QC2A 4JYVH 5TJXA 3U8RH 1ELDE 1WU1A 1UTJA 3I78A 1DWEH 1GBMA 4Y0YE 2VIWA 8GCHG 1O3HA 1A7SA 1ZGIA 2BLOA 1P2IA 1ZTLA 1ZSLA 2OQ5A 4DCDA 1C5TA 2BY7X 3ZZ4A 3M7TA 1NRNH 1BZXE 5JB8S 2P95A 1TALA 1SL3A 5CHAC 1B0FA 2TBSA 2FESH 1CGIE 3QO6A 1CSOE 3ZV8A 4X2WA 5T6GA 3C1KA 1NY22 1O2QA 4BNRA 2ZGHA 1BJVA 3A86A 2ZFPH 3SBKA 1Z6EA 2SNWA 2VWMA 4KGAA 3EA8A 2BY9X 2Q6GA 4VGCB 3MWIU 1SGYE 2JETB 2BD5A 1C5XB 1HAZB 2FO9A 1NU7B 4X6NA 1ZRKA 3TJOA 1AIXH 3UPEA 1ARBA 3K9XB 1WV7H 5EQSA 2BLVA 4RSPA 4DIHH 3BV9B 2UWLA 3KNXA 2NU0E 1FIWA 3MYWA 2ZFFH 1ABIH 2UWPA 1FNIA 1FY4A 1GDQA 2HNTE 1SI5H 2ESTE 4JK5A 4ZROA 1O5BB 1EJAA 2KAIB 1ANCA 4DGJA 4H6SB 1YP9A 3TU7H 3SJ8A 4AX9H 1O33A 4KTUA 1THRH 1RIWB 1GVLA 2ZQ1A 1ZZZA 1RD3B 1C1TA 2RA0A 4NFEA 2NWNA 3IG6B 1ZJKA 4B74A 1AFEH 1CBWB 1W0YH 2G00A 1G3DA 1CA8B 1C2KA 4MLFB 2BX4A 1MKXH 1TGBA 2AMPA 5AF9H 3SGAE 3URDA 2JH6D 2H1UA 3RU4T 4A6LA 4MQAA 1EPTB 1HAPH 3SU6A 3VFEA 2B5TB 4LXBH 2ZFRH 4BAMB 1H9IE 1GCTB 1TNGA 1MU6B 4MNXA 4NGAH 4AFUA 1EXFA 1BHXF 2Q1JA 4F49A 1DWBH 2ZG0H 2C8YB 2PSXA 4AOQA 1BRCE 4JMYA 5AFYH 1AFQC 1C9TA 2BDHA 3TH4H 1AB9B 4X8TH 3MH7A 1WSSH 4K1EA 2W7SA 4CRAA 1OYQA 2W5EA 3VXEH 1BBRH 2PKSB 3LIWA 1GHWH 5L6NH 1KXBA 1ZJDA 2P59A 2BYAX 1DE7H 1MTNB 4FXGH 1TGSZ 2B8OH 2CMYA 2Z9KA 2CN0H 2GCHG 3BG8A 3O8BA 1ANEA 1AWFH 2M5TA 1O2HA 3S69A 3LH1A 8KME2 1MH0A 3GOVB 1CT2E 5E2OA 3SNDA 3ENSB 2RA3A 3TPIZ 3P92A 1LQDB 3ATMA 3LGYA 2AGEX 3HK6B 2B7DH 2CXVA 1KLIH 4XBBA 2FTMA 4TPIZ 4ZHMU 1QNJA 2ZCLP 1KSNA 1WBGB 3BTWE 3RXHA 3AW1A 4K69A 1EB1H 2AFQB 4YTAA 1MTNC 1DWCH 3ZVDA 1PPHE 2GMTC 1O2JA 4H4FA 2ZPRA 1KXAA 3OY6U 2FPZA 1HFDA 1ZYOA 3BTQE 1C5UA 4U32A 2FOHA 1OSSA 1P8VC 1SGFA 1XUKA 3GDUA 1G3BA 7ESTE 1S85A 5C1YA 2ZTYA 3AAUA 1W12U 3MO9A 3SJOA 2ZNKH 2ZGJA 4JZIA 1YPGH 2HALA 1LHEH 4ZXXH 1N1LA 3M7QA 3EDXB 1TNKA 1P0SH 2R2MB 1IQGA 2ZHFH 1MTWA 4Y0ZE 5C5NA 5DP6A 1ZOMA 1A0LA 1C1UH 4A5TS 1P02A 1BTUA 2H9TH 2R0KA 2XYAA 3T5FH 2O9QA 1CE5A 1NRRH 3RUOA 1Z6JH 2WYGA 5FHTA 4U2WA 1MD7A 3M3SA 2A4RA 1JOUB 2XC4A 4GVUA 1OYTH 2HVXA 1J14A 2BDGA 1K9OE 1C5MD 3FVFB 2C3SA 4YOJA 3RXDA 3RMMH 5C1UA 5T6DA 3N7OA 1TPPA 3U69H 1OWJA 1NTPA 2R0LA 1C5PA 3ZVGA 1CU1A 2VVCA 4CHAB 1ELBA 5TCCA 1P2JA 3P8FA 1RTLA 5EXMA 3BTME 5F8XA 3Q3YA 3SUEA 1H8DH 3ATLA 4X8VH 1QHRB 3U1JB 2ULLA 3O8CA 1M9UA 4BAOB 5FPTA 3QK1A 1AHTH 5GIBA 5JBAS 3G01A 1XUJA 1GBHA 1PQAA 1V2QT 1C5VA 4UFEH 1ZPZA 3P95A 4KTSA 2D1JA 1GGDC 1UTOA 3EA7A 2W3KA 1K1MA 4HI3A 4NFFA 1NFYA 4WMFA 3VGCC 5DP7A 1ZPCA 2CJIA 1DANH 3KEEA 5E0GA 1CBWC 5DP9A 1ZSJA 1HJ8A 3A7WA 4JYUH 1E35B 1UCYK 5A8YA 2ODPA 2JH5D 1EAWA 1TBRH 2P3FH 3AW0A 1P2NA 1YPLH 2AIQA 2HNTC 3NCLA 1GHAG 3HPTB 1O2YA 1OPHB 1DLKB 2W3IA 1GPZA 1SLXB 1ELTA 3ZZ6A 1EJNA 2CHAB 2Z3EA 2C90B 2F83A 3GCHB 2THFB 1EX3A 4IC6A 4Y76A 1XMNB 2R9PA 1TBQH 3UUZA 2FIRH 3MH5A 1GBEA 1HAXB 1AZ8A 2QN5T 5I25A 1UTNA 1W0ZU 1C5RA 1N8OC 4ABDA 1JIMA 4GCHF 1AN1E 1SGPE 2OP9A 2WPKS 5H4IB 5EQRA 4K1SA 4NZQA 3T26A 2V6NA 1QRWA 1ELGA 3ODDA 1FY1A 4BXWA 2CV3A 5HGGA 1HAOH 2BD7A 1C1RA 1EP5A 2IOTA 2XBYA 1D9IA 2ZHDA 1QRZA 1GJCB 1D6RA 4Q7ZA 3OY5U 2GMTB 1YGCH 5AVDA 1AY6H 2XCFA 5F8TA 1EPTA 3ZZ3A 1ZLRA 2YNBA 4D76A 2J34A 1O3FA 5T6FA 4MTBA 2H9EH 2TGDA 1DUEA 4ISOA 4CR9A 2F3CE 1JWTA 2QYIA 5DP4A 3RXRA 2UUFB 4ABFA 3LONA 5A2MH 1N8OB 3TJVA 4X2VA 1XKBC 3T2NA 3UNRA 1NFUA 2EEKA 1QJ7B 2FDAA 3SUGA 3DFJA 3SV8A 4B71A 4Y71A 4ZKRU 1DM4B 3S9BA 4CHAC 3W94A 4FU8A 3TK6A 3NKKA 2Z9IA 1AKSA 1O2XA 4MDSA 1GHXH 2A4QA 5DPAA 1HUTH 1HNEE 1TX6A 5C1XA 3VPKA 2PUQH 4E05H 4FU9A 4FVBA 2TGPZ 1O2WA 4CRBA 1UHBA 1B5GH 5LPRA 3MH6A 3FZZA 1P05A 2IPHA 1P04A 2GDEH 2P8OC 3M36A 1DPOA 2BD9A 2UUYA 3M61U 4MPXA 2J94A 2G51A 2ZECA 3KIDU 3PWBA 3RU4E 3PMHB 5K7RA 3RC5A 1DX5M 4MG3A 4WXVA 4ABGA 4I8GA 3D49H 2ZP0H 1NRPH 1G32B 2A1DB 1TIOA 1TOCB 3GICB 5T3HA 3BTHE 1QY6A 2IN2A 3PO1C 1GJ6A 2Z9GA 2WPLS 5FPYA 3RC4A 5J4QA 1LMWB 2FI4E 1P2OA 1TMBH 3UNSA 2PTCE 1VITH 4TWWA 1IQKA 2H2ZA 5FX6A 3UREA 3FZDA 1KLTA 2VWOA 2TPIZ 3V12A 2WV4A 4RN6A 1GWAA 1QL8A 4BAQB 1C5OH 1IHTH 1GDUA 4U01A 1TLDA 3LDXH 1V6DA 4THNH 3SU0A 2G8TA 3WY8A 3UTUH 2WYJA 3CP7A 4NSYA 1V2PT 1V3XA 1QURH 4DJZB 1PQ7A 3M37A 5IYTA 3UWIA 1S84A 4I8KA 1O2SA 4B73A 2BHGA 1GHVH 2GDDA 3NPSA 1C2GA 2XWBI 1K1PA 1IQEA 1C2MA 4Q80A 1V2RT 1SLUB 1O3CA 1TX7A 1T8LA 1HCGA 2ZGBH 1UMAH 1ABJH 1SLVB 3A8CA 1ID5H 4X1RU 1V2KT 1EASA 2O8WA 1E37B 1O30A 1NPMA 1KXDA 1TNJA 3VB4A 1FAKH 2ZDLA 5B6OA 3BEIB 1V2OT 2VIOA 1ETSH 2W26A 5J4SA 3RXMA 3MU4A 5CHAB 1VJAU 4Y8ZA 2OBQA 2B9LA 1TFXA 4J1YA 1EZQA 1HXEH 2J2UA 3GY5A 2GX4A 3Q00A 4UONA 4GHTA 3GY6A 2VIVA 5C20A 1QRXA 1GCTC 3TJNA 9ESTA 2FX4A 1Z1IA 2BDBA 1WQVH 1ELEE 1GBFA 1HLTH 1O36A 3O8RA 1EPTC 4LK4A 2UWOA 4BXSA 2Y5FA 5DP5A 3KQEA 3SQEE 2A5KA 3U1IB 1AVWA 4OS1A 1OS8A 1J17T 1O3IA 1HJAB 3A8AA 1EKBB 1GI5A 1X7AC 1H4WA 1TE0A 2ZQ2A 4IMZA 4CRGA 2BLQA 1BTZA 3SHAH 1E38B 5LPEA 1LO6A 3GY2A 4K8BA 5DO4H 3P8OA 4FVDA 4NA7A 1GHAF 1C5WB 2OQUA 1JBUH 1O5CB 1UVUH 3PLKA 3M5NA 1Y3XA 4TYDA 3P6ZB 3MU5A 3LKWA 1C1OA 4XFQA 1Z8IB 1C1QA 5E8EH 3F9FA 4Y8XA 4DY7B 4Q7XA 3SORA 1ZRBA 1GDNA 2ZPSA 1BB0B 2PSYA 3GDVA 3UFAA 1H9LB 2G5NA 2H5CA 3FANA 3HK3B 3UQVA 1EAUA 2GGVB 1RS0A 5HXFA 1UJ1A 2CF9H 1T32A 2AMQA 2HWLB 3QDZB 1KY9A 1SPJA 6GCHF 3QUMP 4VGCC 4AZ2B 1VITG 8ESTE 2ZEBA 1RRKA 1ESAA 1AGJA 2FXRA 2FODA 2D26C 1HRTH 1YYY1 6CHAB 1QCPA 1G2MA 2K1QA 1IHSH 1AZZA 4H42U 2WPJS 1K1OA 1O3OA 3L3TA 1BQYA 5DK1A 5GCHG 4J2YB 1O3PB 3B9FH 5EW2H 4E7NA 4X1NU 1HDTH 3GCTF 4U30A 1AE5A 2C93B 1GJ9B 2G81E 1P3EA 4A1TA 1P2QA 1WTGH 2ZHWH 2ZTXA 3LC3A 4MPVA 1QL7A 3E0NB 4WXIA 6CHAC 1GCDA 3C27B 1GI3A 7LPRA 1A5GH 1O3DA 3MH4A 2XTTB 2VH0A 3A7XA 1TRMA 3SN8A 4SGAE 2O8TA 2AERH 2ZIQH 3I77A 3KCGH 3A82A 1CHGA 4X2XA 1CT4E 1OWDA 1C5ZB 1GJ4H 2ZGCA 1CA0C 1HIAA 1NFWA 1JIRA 3ZVEA 1GL1A 4B2AA 1O3AA 1TPOA 1NRSH 4Q7YA 2ZU1A 1GMCG 2BOHB 4B1TA 5BPEA 1O2PA 4WY3A 5EQQA 1O3LA 2FOGA 1YLCA 3A7TA 3EAJA 4I31A 3SNBA 1TBZH 3MNXA 5ETXA 1O2VA 1V2MT 2GKVE 4BTTB 3A84A 1BIOA 1HJ9A 4AG1A 4JZFH 2OXSA 5CMXH 5FCRA 3P8NA 4IC5A 1FY5A 1TPAE 3SOSA 1N6YA 1UVSH 3HKIB 1UVTH 2RG3A 1SGEE 4LOYH 1YF4A 1QBOA 3GCNA 1NC6A 5A0CA 2BY6X 1K28D 3GCOA 5IDKA 1A1RA 1W13U 1PPGE 3GY4A 1XUIA 1BCUH 3BIUH 3TNSA 2GCTC 5HYOA 5EODA 4FUBA 3KQDA 1SG8B 1P06A 1SLWB 1E34B 3R0FA 2DE9A 1SHHB 1ZMLA 3M3TA 4YESB 1Y59T 1BTPA 4XSKU 1LCYA 3EE0B 1K2I1 2FOFA 4K1TA 2ZDAH 1A5IA 2BD3A 2QY0B 1TQ0B 4MPUA 1VCWA 3URCA 1P9SA 3S7KB 4GAWA 3RXKA 1C1NA 4NA8A 1FXYA 1ESTA 5C3NA 3GCHC 2PW8H 2OC0A 4DIIH 2GV7A 4X1QU 1K1IA 5A0AE 5I46H 1J8AA 1C4Y2 1NT1A 1H8IH 1L0ZA 1NESE 4B2CA 4JZ1A 1A5HA 2GZ7A 2ZHQH 4WJG2 1VGCB 2G5VA 2OCVB 5LPFA 3UIRA 1CGJE 1UVPA 1LDTT 1C2FA 1MU8B 3VEQB 5FAHA 2QXHA 1KXEA 1TYNA 1YKTA 1P2MA 2BDCA 4GSOA 1DFPA 1KTTB 1W10U 2R3YA 3GCTG 5TCAA 1YPEH 5EXLA 3M5MA 4NIWA 1DY9A 3TH2H 2FYRA 2VJ1A 4IW4E 4ZAEA 3SZNA 2A7JA 5DP3A 5A0BA 1Y8TA 1P03A 1NFXA
chains in the Genus database with same CATH superfamily
4RT1A 3E16B 4WH6A 2ZHEH 4F55A 1O2ZA 3RXQA 1JXPA 1L2EA 2PHBA 1BRAA 3QTOH 1SBWA 2PUXB 1RTKA 4O3UA 8LPRA 4YT7H 1F0SA 4I86A 2A2XH 3BTEE 4DVAU 1UTMA 4DOQA 4H6TA 1DUAA 1YPHC 1TAWA 1MD8A 1WYKA 4ABBA 1LVYA 1P2KA 1SVPA 2QXJA 1GMDF 3GYLB 1TGTA 1KDQA 2HPPH 1W2KH 2V35A 1ETRH 4UD9H 2CF8H 3ZVBA 4OGYA 2FOBA 1SQAA 2Q6DA 3LGUA 3S7HB 1RXPA 3A8BA 2B0FA 3M35A 3E90B 3SU3A 3LGVA 3SGBE 2Z3CA 4WVPE 1C5SA 3PLPA 2P8OB 4NIVA 1B7XB 1PJPA 1THSH 2OD3B 1VJ9U 1FN6A 4ABJA 3FFGA 4ASHA 1Z8JB 2OBOA 1NS3A 1QZ8A 1QL9A 1DDJA 2V3HH 3A7VA 1YLDA 1S81A 2BZ6H 4I8HA 4XDEA 3CS7A 3TITA 3HKJB 4JK6A 6LPRA 7GCHG 3W95A 3ZVFA 4DT7B 4FOUC 1SGDE 2HVYB 4XE4A 1LHFH 3RMOH 1GJAB 1ZGVA 2F91A 3SU4A 4PROA 1L1GA 2FI5E 5EGMA 1GHBG 1EJMA 1BTHH 4YT6H 3OE7D 2HOBA 5DGJA 1V2LT 1ORFA 2ZPQA 4IMQA 1GI2A 1YY3A 1GBDA 1ZMNA 3TLOA 3TGJE 1SFIA 1O31A 1QQUA 3IITA 2V7QD 3BEUA 4OS4A 1QBVH 3SHCH 3DUXH 1S0QA 1UHBB 1WOFA 4HTCH 3OSYA 3ZVAA 3ATWA 2J97A 3UB0A 4FUFA 3Q76A 1JMOH 1P3CA 2G4TA 4Y11E 4INKA 2BY5X 1BUIA 1V2NT 1EOLA 3VXFH 1UVOA 3E3TA 1H1BA 1GHBF 4NG9H 3U8OH 4FUDA 5F53A 1SB1H 2KCYA 2A32A 1GHZA 3D65E 5C5OA 3V13A 1GI1A 1HAGE 4D8NA 1QA0A 4X0WU 3ESTA 1IQFA 5E2PA 2BXUH 3RXCA 3F9GA 4HGCA 3QGJA 2LPRA 4WMEA 1O38A 2F9NA 3MNCA 2W6ID 3TK9A 1L4DA 3EE7A 1A61H 1MQ5A 4O9VA 2EC9H 2FEQH 2G52A 3LU9B 1P10A 1GJ8B 3ZYEA 2ZFTA 3P70B 1SQTA 2Z9LA 1F0TA 2GT7A 3FP6E 3F9HA 4IBLH 3GYMA 2ZKSA 4ZH8A 3O8DA 1WDIA 3SNCA 4A92A 3LC5A 4I8LA 2F9BH 1C4U2 1HXFH 3ATKA 1W14U 2P3TB 2Q6FA 3TJUA 4AFSA 1AMHA 3OEHD 3OYPA 3SYJA 3ZZ5A 2GCTB 3PMBB 1S83A 1UTLM 4ZHLU 2OC1A 1SQOA 1YPKH 1MMJN 1BRBE 4XBCA 1Y3WA 1GVKB 1QIXB 3QN7A 3SJ9A 2WHXA 3RXAA 4AFZA 1PPFE 4Q63A 3PTNA 3SUDA 3H7OA 1O2GH 4ZKSU 3V0XA 1FLEE 2VWLA 3MU0A 2HGTH 3VGCB 1TWXB 1O34A 2XBXA 4BAHB 2J4IA 1UK3A 1GG6C 8GCHF 4WWYA 3AAVA 4HFPB 2EI7A 2BQ6B 1O37A 1PYTD 3RDZA 2OUAA 2XOKD 1SSXA 3UOUA 3L6PA 1O3KA 1Y5AT 4GUXA 5EU8A 2OTVA 2FLRH 1OP0A 1XUFA 3D23A 1C9PA 1EUFA 1MAYA 3BG4C 4FETA 1FJSA 1TA6A 3NXPA 1K1LA 2D2DA 1XUHA 3SNEA 4ACAA 1CO7E 1FZZA 1DY8A 1S6FA 2JETC 4YLUA 1SFQB 4ASUD 1BOQA 2J9NA 2QE7D 5A09A 2KZ4A 5EG4A 1ARCA 3UNQA 3A87A 5HMAA 3RXEA 3EGKH 2VGCB 5SGAE 2Y7XA 4UFGH 4AGJA 4NIXA 1Q31A 3A80A 3QZQA 2EI6A 2PKAA 1DVAH 2ANMH 1RGQA 2H5DA 3M7UA 4YOGA 5DP8A 2ODQA 1HAYB 4XD7D 1WUNH 2WUBA 2BDAA 1AUTC 1O3MA 2WPIS 2BDYA 5EW1H 1YC0A 5JBTA 3BEFB 2ANKH 1YWUA 5L2YH 4BOHA 4AYYB 5AFZH 1QTFA 3K2UA 1T4VH 2Y6TA 3ODFA 3UR9A 3OTJE 1UCYE 3SQHE 1BTWA 1GJ5H 1Y5UT 4CR5A 3TNTA 1DOJA 1MCTA 1TOMH 1OKXA 1CHOG 1BTYA 2BDIA 1OXGA 1C1PA 3SU2A 1XM1A 3CNRA 2PFEA 3DFLA 3GY3A 3S9CA 1MZDA 7KMEH 2M2AA 2BX3A 1AKSB 3HGPA 2ZFQH 1D3TB 1EZUC 1Q3XA 4A1XA 3MU8A 1SGQE 3AASA 4INHA 4CH2B 1V2WT 1GI8B 2ZC9H 2VBCA 3DT0H 2F9OA 2PGBB 2V3MA 4KELA 2C8XB 2C8ZB 1XVOA 1W11U 3KL6A 5C0UA 2ZTZA 2YOLA 4A7IB 4I33A 1A0HB 1KLJH 3CENA 2AGGX 1NRQH 3T27A 2UUKB 4IN1A 3TGKE 1P11E 2YMSD 1HJAC 2GZ9A 1VZQH 2QIQA 1AVGH 3F0PA 2W7UA 1UCYH 1ELFA 5DKMA 2FS9A 3I29A 1MTSA 1QB1A 4ABHA 2FYQA 4OS6A 1F0UA 4ACBA 1KXCA 3QWCH 4BAKB 3W1EA 1BRUP 2PKSC 2F43B 2FTLE 4CREA 1GBJA 3SW2B 5FPSA 5GXPA 1O39A 1HBTH 4DW2U 4Y10E 4O3TA 1MTVA 3A89A 4ZKOU 1C1SA 3QGNB 2OC7A 1NN6A 1YCPM 1FONA 2XC5A 1PFXC 3E0PB 3OAAD 2RFKC 1P12E 2A4GA 1BMAA 3OU0A 4F4OC 4CH8B 1LKAA 1TMTH 3NUMA 2SGPE 3EQ0H 4ESTE 1HYLA 2NU2E 3RC6A 4AGKA 1EZXC 2TRMA 1UTQA 4NCYA 1QQ4A 1DT2A 3DHKH 3VB6A 1O5AB 4ZUHA 1TB6H 3RXUA 5JPMH 1S5SA 4YLQH 3VB7A 1PYTC 3RMLH 1LHDH 2PGQB 3SJKA 1A2CH 1D3QB 1EOJA 2DE8A 2ALPA 2J95A 1C5LH 1IQIA 6GCHG 3A85A 4R0IA 1VKYA 3MO6A 4AB8A 3EA9A 2O8MA 3FP7E 1A0JA 2XBVA 1O5EH 1C1VH 3ZZ7A 2A7CA 4NWKA 2CK3D 3LJJA 2XWAA 1P09A 1G30B 1YLNA 1D6WA 3BTTE 2FM2A 3A88A 4K60A 2C4FH 1SGTA 2QXGA 5GPIB 4LZ4B 2H9HA 3AVZA 4X8SH 1TMUH 4WF8A 1HAIH 1A3BH 2ZO3H 4K2YA 1G3CA 4ISNA 1HAVA 1SMFE 1XXDA 1LVMA 1YPHE 1C5NH 3STJA 3T25A 2VIPA 2AH4X 1CHOF 1MKWK 1EB2A 2BXTH 1G9IE 1MTUA 5KECA 4D7FA 3SV6A 1ZTJA 2ZDVH 3MMGA 1GG6B 2XC0A 3QX5H 2VINA 1HPGA 2GVFA 2ZWLH 5ABWA 1Z8RA 3E8LA 5LH8A 1S0RA 2ZU4A 1TPSA 3TH3H 4IS5A 1NROH 3MNSA 1SGFG 2OLGA 3F6UH 1P01A 4XOJA 3RMNH 1KDQB 2VH6A 1GI7B 3TVJB 1GMCF 1DSUA 1GI4A 4RKJB 2BY8X 2PWXA 1FY8E 1LKBA 1C2DA 2FOCA 1FQ3A 3RXBA 3MTYA 1TRYA 2ZGXH 1U6QA 2JH0D 5A8ZA 2A0QB 2AEIH 1TNLA 5PTPA 5C67A 1H9HE 2PTNA 3SGQE 1RIWC 1O35A 2OINA 2VIQA 3B8JA 2J92A 3F68H 2BD4A 4UEHH 3U28C 1G3EA 1Z71A 3MHWU 4Y6DA 3RXPA 2GCHF 4ABIA 4MVNA 1Z1JA 3P8GA 1P57B 5HM9A 1Q2WA 1S6HA 1F92A 3DA9B 3U9AH 3MFJA 2FP7B 5HKKD 1DICA 1DXWA 4OGXA 4B2BA 5L30H 2TGAA 3MI4A 3M5LA 1IOEA 3TIUA 2ZU2A 5GDSH 1C5YB 1TQ7B 2I6SA 1J15A 1O3GA 1GMHF 1VITF 2A2QH 2SGDE 1L4ZA 5AHGH 7GCHF 3STIA 3A83A 2STAE 1DLEA 3S0NA 1DWDH 4X6OA 1D4PB 4YOIA 1PQ8A 1GL0E 3SU1A 1EP6A 2Z9JA 1E36B 3RM0H 3H7TA 1GBAA 1IQLA 3MO3A 1ZR0A 3PMAB 2SNVA 2ZZUH 3UY9A 2AMDA 4TY7A 1XUGA 1O2LA 1WTHD 4CBNA 1K1JA 1O32A 2J98B 2GJGA 1G2LA 4UFDH 4KTCA 4GPGA 1YM0A 2O8LA 2Y5HA 4X2YA 4ISLA 3MQKC 1SGIB 1XX9A 4D9QA 4ZMAH 4UDWH 1XVMA 5CE1A 2IJOB 1C4V2 2VNTA 3F0OA 4MNYA 2STBE 5L2ZH 4FUHA 2G4UA 3PV4A 1VCPA 2PV9B 1FIZA 2TGTA 2QA9E 1ELVA 3UOPA 1MBMA 4CRFA 1W3CA 2Y82A 4ISIH 4AB9A 5KGOA 4A1VA 2YNAA 3OEED 1EZSC 1OWEA 2EI8A 4AFQA 1ZHMA 1OP2A 2Y81A 1KTSB 1PPCE 1V2VT 3K6YA 1AE8H 1CGHA 4FUJA 1BBRE 2L74A 3RLWH 4FUIA 1BMFD 3F1SB 4I7YH 1IQHA 3BG4B 4GLYA 1HV7A 2IJD1 3SJIA 1CA0B 3K65B 3PMJA 1Y3VA 4AN7A 1QFKH 3BTDE 3UWJH 1GI6A 1LHGH 1L1JA 4TPYA 1CQQA 3A7YA 2FI3E 3IWMA 1C2HA 1GJBB 3V7TA 3ZZ8A 2WPDD 1SGCA 4Y8YA 1O3NA 2ANWA 2O8UA 2Y5GA 4E7RG 1LQEA 1ZHRA 1TONA 2SGEE 1EATA 5C2ZA 2BVSH 1LTOA 1QJ6B 5JYIA 3RXIA 1E0FD 3V3MA 4DG4A 1HIAB 1TGCA 2BMGB 1AI8H 5FXLA 3WWBA 3EYDA 1ELAA 2ZDKA 3RXFA 1VCQA 2BTCE 3BSQA 3L33A 4NZLA 1AUJA 1O3BA 4JZDH 1C2LA 3VB5A 3KYFA 4D7GA 2XNIA 3RU4D 4FUCA 1BHXB 3AK5A 3RP2A 3TK5A 3BN9A 1GI0A 1BMNH 1FMGA 1FPHH 1MKWH 1S82A 1K1NA 2P3UB 3E1XB 5E0HA 1F5RA 3SI3H 4Y79A 3SI4H 1GJDB 1J16A 1FDPA 2A31A 5A8XA 3Q77A 4AORA 4HZHA 2JKHA 2FLBH 3KQ5A 1W8BH 1KIGH 4OS7A 1QJ1B 1HGTH 3U98H 1JRSA 4FU7A 5HM2A 1J9CH 1MUEB 3FKSD 3K6ZA 4NIYA 4O97A 2ZCHP 1BA8B 4YZUA 1WCZA 1RJXB 5ESTE 3HATH 1OP8A 2XRCA 4K5ZA 3GDSA 3Q3XA 4ZXYH 1KYNA 4FUEA 5FBIA 1ZHPA 1W7GH 2F9UA 4KKDA 4I32A 3OX7U 1GBLA 4ABAA 1TA2A 2SGFE 4NSVA 1A4WH 3ZV9A 3QTVH 2XBWA 1GVZA 1SC8U 2VB0A 3BTFE 3DD2H 1C2EA 1EAXA 1O2MA 5DJ7A 2UUJB 2XW9A 1O3JA 1ZSKA 3RXVA 1PQ5A 1AU8A 3SV2H 1NBMD 3M3VA 5JBCS 4ZHAA 1TGNA 3SU5A 4UFFH 2BD2A 1MQ6A 2WV5A 4B75A 3NRLA 4JCNA 1K22H 2FWWA 3ZZAA 1NM6A 3Q3KA 4X1SU 2G55A 4O03A 1BITA 1D3DB 3KQCA 1OWIA 2XCNA 4UE7H 2ZU3A 2Y7ZA 2BM2A 3MOCA 1BT7A 2VGCC 1F5KU 3LJOA 2BLWA 1ANBA 4BTUB 2GZ8A 2GD4B 3P17H 1C2JA 2OC8A 5FCKA 5FX5A 4FUGA 1SOZA 2ALVA 1DITH 1OHHD 4MPWA 3LT3A 2D8WA 3KHVA 2KAIA 5F6MA 4X6MA 1RFNA 3LGIA 1GMDG 3RXSA 3QLPH 4KP0A 2Z94A 1AWHB 2PR3A 3FN8A 1O2IA 2GTBA 5CDFE 1YCPH 2Z3DA 3KN2A 1UK2A 3ZVCA 3VB3A 1D3PB 4YM9A 2QCYA 1V2JT 5F03A 3PYHA 5FBEA 2AGIX 3T28A 3UQOA 3ZZ9A 2ILNA 2QGRA 3GY8A 2HRVA 1UK4A 1IQMA 1BMLA 1P9UA 5EJLA 4INLA 1F0RA 2P93A 1O2NA 2R3UA 4XBDA 1FUJA 5JDUB 1TRNA 2FOAA 3RXGA 1CT0E 1SHYA 2WINI 3PWCA 3SV9A 1BTXA 3LPRA 4Z6AH 1HAVB 5G4BA 3R3GB 1KXFA 1BJUA 2BVXH 3S9AA 1EAIA 2TIOA 2ZDMA 1IQNA 3BTGE 5E0JA 2AYWA 4TT3D 3KF2A 2AS9A 2FX6A 1G36A 2KR7A 2A7HA 1GGDB 2EY4C 3PB1E 2ZCKP 3ZYDA 1TX8A 1LVOA 1DSTA 2W6JD 1NZQH 1W0JD 2GT8A 2SGAA 4TWYA 2CGAA 1QR3E 3HGNA 5BRRE 2L6OA 4MNVA 1SOTA 2R2WU 4QT8C 1AVXA 5GCHF 1VR1H 2Y80A 1HAHH 2GV6A 1H8ED 3ZZBA 1G37A 4K3JA 2F9PA 4AYVB 2LNCA 3MU1A 2SGQE 1OX1A 1FN8A 5DG6A 3ITIA 4OS2A 1O2TA 2HLCA 4X8UH 3D62A 1MBQA 1A46H 2RCEA 1FAXA 2ZDNA 2DUCA 1YCPK 2YMSC 2ZF0H 1GHYH 3LH3A 1CVWH 2RDLA 4E06H 2V3OH 5EPNA 1PPZA 1T8MA 2FMJA 5JB9S 1SGNE 3GISB 3A81A 1UTKA 1XXFA 3BF6H 1DXPA 1O2KA 2V0BA 5EPYA 1Y3UA 5EOKA 3MNBA 2ZFSA 4NWLA 2QF0A 2CHAC 1HB0B 3M5OA 4CBOA 3ZZDA 1L1NA 2HNTF 3B23B 4CRDA 4DURA 2ZA5A 2J38A 2XNDD 1LPKB 2I6QA 1UO6A 4Y7AA 1QGFA 1S6LA 1MCVA 2F9VA 1BMMH 1TNIA 1LPZB 1LHCH 4K8YA 4IN2A 4AG2A 1ANDA 2QAAA 1W7XH 4B6EA 1IAUA 3PLBA 1ESBA 1O5GH 2WPMS 1MZAA 2ODYB 3RXLA 3KQBA 1GBKA 2BOKA 1AFQB 1GMHG 4Q2KA 3N99A 4B76A 4GHQA 1ETTH 3GY7A 4RKOB 1OOKB 1GBIA 2ANYA 2BQWB 1O5DH 4LZ1H 2AIPA 4Z1MD 1GBCA 4ISHH 4OM9A 2ZI2H 1O2RA 1QBNA 2IPQX 1V2TT 1FI8A 3NWUA 1COWD 1OWKA 4YO9A 3RXOA 1GJ7B 1JRTA 1QB6A 3KGPA 2A5AA 3JZ2B 1O2OA 1ZPBA 1OWHA 3JZ1B 3PM3A 3F9EA 1N6XA 2VU8E 2WPHS 5F8ZA 1T31A 4M7GA 5EIYA 3SUFA 4JZEH 1YPJH 4BANB 3LGWA 3H5CB 2KX4A 1C2IA 5EXNA 1O5FH 1EQ9A 2QV1A 3CS0A 1ZTKA 1T8NA 2FOMB 5JBBS 2FZZA 3RXJA 1MAXA 1AQ7A 4R8TB 2QF3A 2BZAA 2HPQH 1FPCH 2NU4E 1BDAA 1C5QA 1K21H 3A8DA 3NK8A 2NU1E 1FV9A 1AB9C 3SNAA 2P16A 2SFAA 1E79D 3LGTA 5GJ4B 1YPMH 1O3EA 1ACBE 2EA3A 3PTBA 2BD8A 1XKAC 2VIDA 4Z0KA 4TY6A 3RM2H 2A4OA 1SGRE 4MNWA 1DS2E 1Z7KA 4D9RA 4X1PU 3PO1B 4BTIB 1RTFB 2PLXA 3T29A 1TNHA 1O0DH 1YBWA 3ELAH 2P94A 2BVRH 1F2SE 1FY3A 1V2UT 2Z7FE 2BB4A 3FAOA 1C1MA 2QF5A 2VVUA 2VWNA 3E91A 9LPRA 4OS5A 1AO5A 3SO3A 1UTPA 2FS8A 2XXLA 5LGOA 1TABE 2QXIA 1PPBH 3NZIA 3ATIA 1F7ZA 1ZMJA 1MKXK 4WH8A 1LPGB 1QB9A 4GCHG 1VGCC 5EJ1A 5GWZA 4IGDA 3PROA 3TGIE 2ZU5A 1GBTA 2QF4A 2NU3E 3RLYH 3RXTA 2A45B 2Z6BD 1ELCA 1A3EH 3DSOA 2WUCA 2BQ7B 5ESBA 1F5LA 2A5IA 1V2ST 1INCA 3BIVH 1NO9H 3QZRA 4ABEA 1THPB 1W0KD 4JYTA 1WQSA 4ZKNU 3LOXA 2H6MA 1T7CA 4RT0A 1IQJA 3U8TH 1Z8GA 2HLDD 3ZZCA 1QA7A 1Y5BT 4CRCA 1PPEE 3SV7A 4WMDA 1AD8H 3T62A 4SGBE 1WAYB 3FP8E 6ESTA 2GP9B 2C8WB 4X6PA 3BTKE 3E6PH 1NU9A 1Y3YA 2FOEA 4Y7BA 4I8JA 1BBRK 3A7ZA 1GI9B 2AHME 1C1WH 1GBBA 1T4UH 1LVBA 1T8OA 1SR5C 2PKAB 2OK5A 2WZQA 1B0EA 2ASUB 4NA9H 3UR6A 5K0HA 1O2UA 2VVVA 2QC2A 4JYVH 5TJXA 3U8RH 1ELDE 1WU1A 1UTJA 1MABB 3I78A 1DWEH 1GBMA 4Y0YE 2VIWA 8GCHG 1O3HA 1A7SA 1ZGIA 2BLOA 1P2IA 1ZTLA 1ZSLA 2OQ5A 4DCDA 1C5TA 2BY7X 3ZZ4A 3M7TA 1NRNH 1BZXE 5JB8S 2P95A 1TALA 1SL3A 5CHAC 1B0FA 2TBSA 2FESH 1CGIE 3QO6A 1CSOE 3ZV8A 4X2WA 5T6GA 3C1KA 1NY22 1O2QA 4BNRA 2ZGHA 1BJVA 3A86A 2ZFPH 3SBKA 1Z6EA 2SNWA 2VWMA 4KGAA 3EA8A 2BY9X 2Q6GA 4VGCB 3MWIU 1SGYE 2JETB 2BD5A 1C5XB 1HAZB 2FO9A 1NU7B 4X6NA 1ZRKA 3TJOA 1AIXH 3UPEA 1ARBA 3K9XB 1WV7H 5EQSA 2BLVA 4RSPA 4DIHH 3BV9B 2UWLA 3KNXA 2NU0E 1FIWA 3MYWA 2ZFFH 1ABIH 2UWPA 1FNIA 1FY4A 1GDQA 2HNTE 1SI5H 2ESTE 4JK5A 4ZROA 1O5BB 1EJAA 2KAIB 1ANCA 4DGJA 4H6SB 5FL7D 1YP9A 3TU7H 3SJ8A 4AX9H 1O33A 4KTUA 1THRH 1RIWB 1GVLA 2KCPA 2ZQ1A 1ZZZA 1RD3B 5DSFA 1C1TA 2RA0A 4NFEA 2NWNA 3IG6B 1ZJKA 4B74A 1AFEH 1CBWB 1W0YH 2G00A 1G3DA 1CA8B 1C2KA 4MLFB 2BX4A 1MKXH 1TGBA 2AMPA 5AF9H 3SGAE 3URDA 2JH6D 2H1UA 3RU4T 4A6LA 4MQAA 1EPTB 1HAPH 3SU6A 3VFEA 2B5TB 4LXBH 2ZFRH 4BAMB 2KCAA 1H9IE 1GCTB 2K8IA 1TNGA 1MU6B 4MNXA 4NGAH 4AFUA 1EXFA 1BHXF 2Q1JA 4F49A 1DWBH 2ZG0H 2C8YB 2PSXA 4AOQA 1BRCE 4JMYA 5AFYH 1AFQC 1C9TA 3UAIC 2BDHA 3TH4H 1AB9B 4X8TH 3MH7A 2KM0A 1WSSH 4K1EA 2W7SA 4CRAA 1OYQA 2W5EA 3VXEH 1BBRH 2PKSB 3LIWA 1GHWH 5L6NH 1KXBA 1ZJDA 2P59A 2BYAX 1DE7H 1MTNB 4FXGH 1TGSZ 2B8OH 2CMYA 2JIZD 2Z9KA 4XRNA 2CN0H 2GCHG 3BG8A 3O8BA 1ANEA 1AWFH 2M5TA 1O2HA 3S69A 3LH1A 8KME2 1MH0A 3GOVB 1CT2E 5E2OA 3SNDA 3ENSB 3WW7A 2RA3A 3TPIZ 4B6FA 3P92A 1LQDB 3ATMA 3LGYA 2AGEX 3HK6B 2B7DH 2CXVA 1KLIH 4XBBA 2FTMA 4TPIZ 4ZHMU 1QNJA 2ZCLP 1KSNA 1WBGB 2LELA 3BTWE 3RXHA 3AW1A 4K69A 1EB1H 2PP6A 2AFQB 4YTAA 1MTNC 1DWCH 3ZVDA 1PPHE 2GMTC 1O2JA 4H4FA 2J5UA 2ZPRA 1KXAA 3OY6U 2FPZA 1HFDA 1ZYOA 3BTQE 1C5UA 4U32A 2FOHA 1OSSA 1P8VC 1SGFA 1XUKA 3GDUA 4HG6A 1G3BA 7ESTE 1S85A 5C1YA 2ZTYA 3AAUA 1W12U 3MO9A 3SJOA 2ZNKH 2ZGJA 4JZIA 1YPGH 2HALA 1LHEH 4ZXXH 1N1LA 3M7QA 3EDXB 1TNKA 3F2FA 1P0SH 2R2MB 1IQGA 2ZHFH 1MTWA 4Y0ZE 5C5NA 5DP6A 1ZOMA 1A0LA 1C1UH 4A5TS 1P02A 1BTUA 2H9TH 2R0KA 2XYAA 3T5FH 2O9QA 1CE5A 1NRRH 3RUOA 1Z6JH 4Q4LA 2WYGA 4F48B 5FHTA 4U2WA 1MD7A 3M3SA 1K0HA 2A4RA 1JOUB 4AC9A 2XC4A 4GVUA 1OYTH 2HVXA 1J14A 3GS9A 2BDGA 1K9OE 1C5MD 3FVFB 2C3SA 4YOJA 3VG8A 3RXDA 3RMMH 5C1UA 5T6DA 3N7OA 1TPPA 2JDID 3U69H 1OWJA 1NTPA 2R0LA 1C5PA 3ZVGA 1CU1A 2VVCA 4CHAB 1ELBA 5TCCA 1P2JA 3P8FA 1EFRD 1RTLA 5EXMA 3BTME 5F8XA 3Q3YA 3SUEA 1H8DH 3ATLA 4X8VH 1QHRB 3U1JB 2ULLA 3O8CA 1M9UA 4BAOB 5T1VA 5FPTA 3QK1A 1AHTH 5GIBA 5JBAS 3G01A 1XUJA 1GBHA 1PQAA 1V2QT 2JJ2D 1C5VA 4UFEH 1ZPZA 3P95A 4KTSA 2D1JA 1GGDC 1UTOA 2J98A 3EA7A 2W3KA 1K1MA 4HI3A 4NFFA 1NFYA 4WMFA 3VGCC 5DP7A 1ZPCA 2CJIA 1DANH 3KEEA 5E0GA 1CBWC 5DP9A 1ZSJA 1HJ8A 5C17A 3A7WA 4JYUH 1E35B 1UCYK 5A8YA 2WSSD 2ODPA 2JH5D 1EAWA 1TBRH 2P3FH 3AW0A 1P2NA 5HIZA 1YPLH 2AIQA 2HNTC 3NCLA 1GHAG 3HPTB 1O2YA 1OPHB 1DLKB 2W3IA 1GPZA 1SLXB 1ELTA 3ZZ6A 1EJNA 2CHAB 2Z3EA 2C90B 2F83A 3GCHB 2THFB 1EX3A 4IC6A 4Y76A 1XMNB 2R9PA 5B6LA 1TBQH 3UUZA 2FIRH 3MH5A 3FO8D 1GBEA 1HAXB 1AZ8A 2QN5T 5I25A 1UTNA 1W0ZU 1C5RA 1N8OC 4ABDA 1JIMA 4GCHF 1AN1E 1SGPE 2OP9A 2WPKS 1UW7A 3N7EA 5H4IB 5EQRA 4K1SA 4NZQA 3WWFA 3T26A 2V6NA 1QRWA 1ELGA 3ODDA 1FY1A 4BXWA 2CV3A 5HGGA 1HAOH 2BD7A 1C1RA 1EP5A 2IOTA 2XBYA 1D9IA 2ZHDA 1QRZA 1GJCB 1D6RA 4Q7ZA 3OY5U 2GMTB 1YGCH 5AVDA 1AY6H 2XCFA 5F8TA 1EPTA 3ZZ3A 1ZLRA 2YNBA 4D76A 2J34A 4ZCNA 1O3FA 5T6FA 3F2GA 4MTBA 2H9EH 2TGDA 1DUEA 4ISOA 4CR9A 2F3CE 1JWTA 2QYIA 5DP4A 3RXRA 2UUFB 4ABFA 3LONA 5A2MH 1WXRA 1H8HD 1N8OB 3TJVA 4X2VA 1XKBC 4M9FA 3T2NA 3UNRA 1NFUA 2EEKA 1QJ7B 2FDAA 3SUGA 3DFJA 3SV8A 4B71A 4Y71A 4ZKRU 1DM4B 3S9BA 4CHAC 3W94A 5EJZA 4FU8A 3TK6A 3NKKA 2Z9IA 1AKSA 1O2XA 3DSPA 4MDSA 1GHXH 2A4QA 5DPAA 1HUTH 1HNEE 1TX6A 5C1XA 3VPKA 2PUQH 4E05H 4FU9A 4FVBA 2TGPZ 1O2WA 4CRBA 1UHBA 1B5GH 5LPRA 3MH6A 3FZZA 1P05A 2IPHA 1P04A 2GDEH 2P8OC 3M36A 1DPOA 3SZEA 2KFWA 2BD9A 2UUYA 3M61U 4MPXA 2J94A 2G51A 2ZECA 3KIDU 3PWBA 3RU4E 3PMHB 5K7RA 3RC5A 1DX5M 1NBME 4MG3A 4WXVA 4ABGA 4I8GA 3D49H 2ZP0H 1NRPH 1G32B 2A1DB 1TIOA 1TOCB 3GICB 3F2HA 5T3HA 3BTHE 1QY6A 2IN2A 3PO1C 1GJ6A 2Z9GA 2WPLS 5FPYA 3RC4A 5J4QA 1LMWB 2JJ1D 2FI4E 1P2OA 1TMBH 2RDEA 4RI0A 3UNSA 2PTCE 1VITH 4TWWA 1IQKA 2H2ZA 5FX6A 3UREA 3FZDA 3PV5A 1KLTA 3ZIAD 2VWOA 2TPIZ 3V12A 2WV4A 4RN6A 1GWAA 1QL8A 4BAQB 4TSFD 1C5OH 1IHTH 1GDUA 4U01A 1TLDA 3LDXH 1V6DA 4THNH 3SU0A 2G8TA 3WY8A 3UTUH 2WYJA 3CP7A 4NSYA 1V2PT 1V3XA 4P02A 1QURH 4DJZB 1PQ7A 3M37A 5IYTA 3UWIA 1S84A 4I8KA 1O2SA 4B73A 2BHGA 1GHVH 2GDDA 3NPSA 1C2GA 2XWBI 1K1PA 1IQEA 1C2MA 4Q80A 1V2RT 1SLUB 1O3CA 1TX7A 1T8LA 1HCGA 2ZGBH 1UMAH 1ABJH 1SLVB 3A8CA 1ID5H 4X1RU 1V2KT 1EASA 2O8WA 1E37B 1O30A 1NPMA 1KXDA 1TNJA 3VB4A 1FAKH 2ZDLA 5B6OA 3BEIB 1V2OT 2VIOA 1ETSH 2W26A 5J4SA 3RXMA 3MU4A 3DCLA 5CHAB 1VJAU 4Y8ZA 2OBQA 2B9LA 3PRBA 1TFXA 4J1YA 5DN6D 1EZQA 1HXEH 2J2UA 3GY5A 2GX4A 3OTPA 3Q00A 4UONA 4GHTA 3GY6A 2VIVA 5C20A 1QRXA 1GCTC 3TJNA 9ESTA 2FX4A 5C94A 1Z1IA 2BDBA 1WQVH 1ELEE 1GBFA 1HLTH 1O36A 3O8RA 1EPTC 4LK4A 2UWOA 4BXSA 5IK2D 1E1RD 2Y5FA 5DP5A 1E1QD 2LP6A 3KQEA 3SQEE 2A5KA 3U1IB 1AVWA 4OS1A 1OS8A 3KYGA 1J17T 3PRDA 1O3IA 1HJAB 3A8AA 1EKBB 1GI5A 5KEDA 1X7AC 1H4WA 1TE0A 2ZQ2A 4IMZA 4CRGA 2BLQA 1BTZA 3SHAH 1E38B 5LPEA 1LO6A 3GY2A 4K8BA 5DO4H 3P8OA 4FVDA 4NA7A 1GHAF 1C5WB 2OQUA 1JBUH 1O5CB 1UVUH 3PLKA 3M5NA 1Y3XA 4TYDA 3P6ZB 3MU5A 3LKWA 1C1OA 4XFQA 2YMSB 1Z8IB 1C1QA 2KCOA 5E8EH 3F9FA 4Y8XA 4DY7B 4Q7XA 3SORA 1ZRBA 1GDNA 2ZPSA 3DSGA 1BB0B 2PSYA 3GDVA 3UFAA 1H9LB 2G5NA 2H5CA 3FANA 3HK3B 3UQVA 1EAUA 2GGVB 1RS0A 5HXFA 1UJ1A 2CF9H 1T32A 2AMQA 2HWLB 3QDZB 1KY9A 1SPJA 6GCHF 3QUMP 4VGCC 4AZ2B 1VITG 8ESTE 2ZEBA 1RRKA 1ESAA 1AGJA 2FXRA 2FODA 2D26C 1HRTH 1YYY1 6CHAB 5HIYA 1QCPA 1G2MA 4DT4A 2K1QA 1IHSH 1AZZA 4H42U 2WPJS 1K1OA 1O3OA 3L3TA 1BQYA 5DK1A 5GCHG 4J2YB 3N7DA 1O3PB 3B9FH 5EW2H 4E7NA 4X1NU 1HDTH 3GCTF 4U30A 1AE5A 2C93B 1GJ9B 2G81E 1P3EA 4A1TA 1P2QA 1WTGH 2ZHWH 2ZTXA 3LC3A 4MPVA 1QL7A 3E0NB 4WXIA 6CHAC 1GCDA 3C27B 1GI3A 7LPRA 1A5GH 1O3DA 3MH4A 2XTTB 2VH0A 3F3BA 3A7XA 1FX0B 2EQNA 1TRMA 3SN8A 4SGAE 2O8TA 2AERH 2ZIQH 3I77A 3KCGH 3A82A 1CHGA 4X2XA 1CT4E 1OWDA 1C5ZB 1GJ4H 2ZGCA 1CA0C 1HIAA 1NFWA 1JIRA 3ZVEA 1GL1A 4B2AA 1O3AA 4YXWD 1TPOA 1NRSH 4Q7YA 2ZU1A 1GMCG 2BOHB 4B1TA 5BPEA 1O2PA 4WY3A 5EQQA 1O3LA 2FOGA 1YLCA 2K0QA 3A7TA 3EAJA 4I31A 3SNBA 1TBZH 3MNXA 5ETXA 1O2VA 1V2MT 2GKVE 4BTTB 3A84A 1BIOA 1HJ9A 4AG1A 3PV2A 4JZFH 2OXSA 5CMXH 5FCRA 3P8NA 4IC5A 1FY5A 1TPAE 3SOSA 1N6YA 1UVSH 3HKIB 1UVTH 2RG3A 1SGEE 3OFND 1YF4A 4LOYH 1QBOA 3GCNA 1NC6A 5A0CA 2BY6X 1K28D 5GNDA 3GCOA 5IDKA 1A1RA 1W13U 5CHBA 1PPGE 3GY4A 1SKYE 1XUIA 1BCUH 3BIUH 3TNSA 2GCTC 5HYOA 5EODA 4FUBA 3KQDA 1SG8B 1P06A 1SLWB 1E34B 3R0FA 2DE9A 1SHHB 1ZMLA 3M3TA 4YESB 1Y59T 1BTPA 4XSKU 1LCYA 3EE0B 1K2I1 2FOFA 4K1TA 2ZDAH 1A5IA 2BD3A 2QY0B 1TQ0B 4MPUA 4P00A 1VCWA 3URCA 1P9SA 3S7KB 4GAWA 3RXKA 1C1NA 4NA8A 1KMHB 3FOAA 1FXYA 1ESTA 5C3NA 3GCHC 2WV9A 2PW8H 2OC0A 4DIIH 2GV7A 4X1QU 1K1IA 5A0AE 5I46H 1J8AA 1C4Y2 1NT1A 1H8IH 1L0ZA 1NESE 4B2CA 4JZ1A 1A5HA 2GZ7A 2ZHQH 4WJG2 1VGCB 2G5VA 2OCVB 3H09A 5LPFA 3UIRA 1CGJE 1UVPA 1LDTT 1C2FA 1MU8B 3VEQB 5FAHA 2QXHA 1KXEA 1TYNA 1YKTA 1SQRA 1P2MA 2BDCA 4GSOA 1DFPA 1KTTB 1W10U 2R3YA 3GCTG 5C0TA 5TCAA 1YPEH 2F4LA 5EXLA 3M5MA 4NIWA 1DY9A 3TH2H 2FYRA 2VJ1A 4IW4E 4ZAEA 3SZNA 2A7JA 5DP3A 5A0BA 1Y8TA 1P03A 1NFXA
chains in the Genus database with same CATH topology
3E16B 4WH6A 2ZHEH 1O2ZA 3RXQA 1JXPA 1L2EA 2PHBA 1BRAA 3QTOH 1SBWA 2PUXB 1RTKA 4O3UA 8LPRA 4YT7H 1F0SA 2A2XH 3BTEE 4DVAU 1UTMA 4DOQA 4H6TA 1DUAA 1YPHC 1TAWA 1MD8A 1WYKA 4ABBA 1LVYA 1P2KA 1SVPA 2QXJA 1GMDF 3GYLB 1TGTA 1KDQA 2HPPH 1W2KH 2V35A 1ETRH 4UD9H 2CF8H 3ZVBA 4OGYA 2FOBA 1SQAA 2Q6DA 3LGUA 3S7HB 1RXPA 3A8BA 2B0FA 3M35A 3E90B 3SU3A 3LGVA 3SGBE 2Z3CA 4WVPE 1C5SA 3PLPA 2P8OB 4NIVA 1B7XB 1PJPA 1THSH 2OD3B 1VJ9U 1FN6A 4ABJA 3FFGA 4ASHA 1Z8JB 2OBOA 1NS3A 1QL9A 1DDJA 2V3HH 3A7VA 1YLDA 1S81A 2BZ6H 4I8HA 4XDEA 3CS7A 3TITA 3HKJB 4JK6A 6LPRA 7GCHG 3W95A 3ZVFA 4DT7B 1SGDE 4XE4A 1LHFH 3RMOH 1GJAB 1ZGVA 2F91A 3SU4A 4PROA 1L1GA 2FI5E 5EGMA 1GHBG 1EJMA 1BTHH 4YT6H 2HOBA 5DGJA 1V2LT 1ORFA 2ZPQA 4IMQA 1GI2A 1GBDA 1ZMNA 3TLOA 3TGJE 1SFIA 1O31A 1QQUA 3IITA 3BEUA 4OS4A 1QBVH 3SHCH 3DUXH 1S0QA 1UHBB 1WOFA 4HTCH 3OSYA 3ZVAA 3ATWA 4FUFA 3Q76A 1JMOH 1P3CA 2G4TA 4Y11E 4INKA 2BY5X 1BUIA 1V2NT 1EOLA 3VXFH 1UVOA 3E3TA 1H1BA 1GHBF 4NG9H 3U8OH 4FUDA 1SB1H 2A32A 1GHZA 3D65E 5C5OA 3V13A 1GI1A 1HAGE 4D8NA 1QA0A 4X0WU 3ESTA 1IQFA 5E2PA 2BXUH 3RXCA 3F9GA 4HGCA 3QGJA 2LPRA 4WMEA 1O38A 2F9NA 3MNCA 3TK9A 1L4DA 1A61H 1MQ5A 4O9VA 2EC9H 2FEQH 2G52A 3LU9B 1P10A 1GJ8B 3ZYEA 2ZFTA 3P70B 1SQTA 2Z9LA 1F0TA 2GT7A 3FP6E 3F9HA 4IBLH 3GYMA 2ZKSA 4ZH8A 3O8DA 3SNCA 4A92A 3LC5A 4I8LA 2F9BH 1C4U2 1HXFH 3ATKA 1W14U 2P3TB 2Q6FA 3TJUA 4AFSA 1AMHA 3OYPA 3ZZ5A 2GCTB 3PMBB 1S83A 1UTLM 4ZHLU 2OC1A 1SQOA 1YPKH 1MMJN 1BRBE 4XBCA 1Y3WA 1GVKB 1QIXB 3QN7A 3SJ9A 3RXAA 4AFZA 1PPFE 3PTNA 3SUDA 3H7OA 1O2GH 4ZKSU 3V0XA 1FLEE 2VWLA 3MU0A 2HGTH 3VGCB 1TWXB 1O34A 2XBXA 4BAHB 2J4IA 1UK3A 1GG6C 8GCHF 4WWYA 3AAVA 4HFPB 2EI7A 2BQ6B 1O37A 1PYTD 3RDZA 2OUAA 1SSXA 3UOUA 3L6PA 1O3KA 1Y5AT 4GUXA 5EU8A 2OTVA 2FLRH 1OP0A 1XUFA 3D23A 1C9PA 1EUFA 1MAYA 3BG4C 1FJSA 1TA6A 3NXPA 1K1LA 2D2DA 1XUHA 3SNEA 1CO7E 1FZZA 1DY8A 1S6FA 2JETC 4YLUA 1SFQB 1BOQA 2J9NA 5A09A 5EG4A 1ARCA 3UNQA 3A87A 5HMAA 3RXEA 3EGKH 2VGCB 5SGAE 2Y7XA 4UFGH 4AGJA 4NIXA 1Q31A 3A80A 3QZQA 2EI6A 2PKAA 1DVAH 2ANMH 1RGQA 2H5DA 3M7UA 4YOGA 5DP8A 2ODQA 1HAYB 1WUNH 2WUBA 2BDAA 1AUTC 1O3MA 2WPIS 2BDYA 5EW1H 1YC0A 5JBTA 3BEFB 2ANKH 5L2YH 4BOHA 4AYYB 5AFZH 1QTFA 3K2UA 1T4VH 2Y6TA 3ODFA 3UR9A 3OTJE 1UCYE 3SQHE 1BTWA 1GJ5H 1Y5UT 4CR5A 3TNTA 1DOJA 1MCTA 1TOMH 1OKXA 1CHOG 1BTYA 2BDIA 1OXGA 1C1PA 3SU2A 1XM1A 2PFEA 3DFLA 3GY3A 3S9CA 1MZDA 7KMEH 2BX3A 1AKSB 3HGPA 2ZFQH 1D3TB 1EZUC 1Q3XA 4A1XA 3MU8A 1SGQE 3AASA 4INHA 4CH2B 1V2WT 1GI8B 2ZC9H 3DT0H 2F9OA 2PGBB 4KELA 2C8XB 2C8ZB 1XVOA 1W11U 3KL6A 2ZTZA 2YOLA 4A7IB 4I33A 1A0HB 1KLJH 3CENA 2AGGX 1NRQH 3T27A 2UUKB 4IN1A 3TGKE 1P11E 1HJAC 2GZ9A 1VZQH 2QIQA 1AVGH 2W7UA 1UCYH 1ELFA 5DKMA 2FS9A 3I29A 1MTSA 1QB1A 4ABHA 2FYQA 4OS6A 1F0UA 1KXCA 3QWCH 4BAKB 1BRUP 2PKSC 2FTLE 4CREA 1GBJA 3SW2B 5FPSA 5GXPA 1O39A 1HBTH 4DW2U 4Y10E 4O3TA 1MTVA 3A89A 4ZKOU 1C1SA 3QGNB 2OC7A 1NN6A 1YCPM 1FONA 2XC5A 1PFXC 3E0PB 1P12E 2A4GA 1BMAA 3OU0A 4F4OC 4CH8B 1LKAA 1TMTH 3NUMA 2SGPE 3EQ0H 4ESTE 1HYLA 2NU2E 3RC6A 4AGKA 1EZXC 2TRMA 1UTQA 4NCYA 1QQ4A 1DT2A 3DHKH 3VB6A 1O5AB 4ZUHA 1TB6H 3RXUA 5JPMH 1S5SA 4YLQH 3VB7A 1PYTC 3RMLH 1LHDH 2PGQB 3SJKA 1A2CH 1D3QB 1EOJA 2DE8A 2ALPA 2J95A 1C5LH 1IQIA 6GCHG 3A85A 4R0IA 3MO6A 4AB8A 3EA9A 2O8MA 3FP7E 1A0JA 2XBVA 1O5EH 1C1VH 3ZZ7A 2A7CA 4NWKA 3LJJA 2XWAA 1P09A 1G30B 1D6WA 3BTTE 2FM2A 3A88A 4K60A 2C4FH 1SGTA 2QXGA 5GPIB 4LZ4B 2H9HA 3AVZA 4X8SH 1TMUH 4WF8A 1HAIH 1A3BH 2ZO3H 4K2YA 1G3CA 4ISNA 1HAVA 1SMFE 1XXDA 1LVMA 1YPHE 1C5NH 3STJA 3T25A 2VIPA 2AH4X 1CHOF 1MKWK 1EB2A 2BXTH 1G9IE 1MTUA 4D7FA 3SV6A 1ZTJA 2ZDVH 3MMGA 1GG6B 2XC0A 3QX5H 2VINA 1HPGA 2GVFA 2ZWLH 5ABWA 1Z8RA 3E8LA 5LH8A 1S0RA 2ZU4A 1TPSA 3TH3H 4IS5A 1NROH 3MNSA 1SGFG 2OLGA 3F6UH 1P01A 4XOJA 3RMNH 1KDQB 2VH6A 1GI7B 3TVJB 1GMCF 1DSUA 1GI4A 4RKJB 2BY8X 2PWXA 1FY8E 1LKBA 1C2DA 2FOCA 1FQ3A 3RXBA 3MTYA 1TRYA 2ZGXH 1U6QA 2JH0D 5A8ZA 2A0QB 2AEIH 1TNLA 5PTPA 5C67A 1H9HE 2PTNA 3SGQE 1RIWC 1O35A 2OINA 2VIQA 3B8JA 2J92A 3F68H 2BD4A 4UEHH 1G3EA 1Z71A 3MHWU 4Y6DA 3RXPA 2GCHF 4ABIA 4MVNA 1Z1JA 3P8GA 1P57B 5HM9A 1Q2WA 1S6HA 1F92A 3DA9B 3U9AH 3MFJA 2FP7B 1DICA 1DXWA 4OGXA 4B2BA 5L30H 2TGAA 3MI4A 3M5LA 1IOEA 3TIUA 2ZU2A 5GDSH 1C5YB 1TQ7B 2I6SA 1J15A 1O3GA 1GMHF 1VITF 2A2QH 2SGDE 1L4ZA 5AHGH 7GCHF 3STIA 3A83A 2STAE 1DLEA 3S0NA 1DWDH 4X6OA 1D4PB 4YOIA 1PQ8A 1GL0E 3SU1A 1EP6A 2Z9JA 1E36B 3RM0H 3H7TA 1GBAA 1IQLA 3MO3A 1ZR0A 3PMAB 2SNVA 2ZZUH 3UY9A 2AMDA 4TY7A 1XUGA 1O2LA 1WTHD 4CBNA 1K1JA 1O32A 1G2LA 4UFDH 4KTCA 4GPGA 1YM0A 2O8LA 2Y5HA 4X2YA 4ISLA 1SGIB 1XX9A 4D9QA 4ZMAH 4UDWH 1XVMA 5CE1A 2IJOB 1C4V2 2VNTA 4MNYA 2STBE 5L2ZH 4FUHA 2G4UA 3PV4A 1VCPA 2PV9B 1FIZA 2TGTA 2QA9E 1ELVA 3UOPA 1MBMA 4CRFA 1W3CA 2Y82A 4ISIH 4AB9A 4A1VA 2YNAA 1EZSC 1OWEA 2EI8A 4AFQA 1ZHMA 1OP2A 2Y81A 1KTSB 1PPCE 1V2VT 3K6YA 1AE8H 1CGHA 4FUJA 1BBRE 3RLWH 4FUIA 3F1SB 4I7YH 1IQHA 3BG4B 4GLYA 1HV7A 3SJIA 1CA0B 3K65B 3PMJA 1Y3VA 4AN7A 1QFKH 3BTDE 3UWJH 1GI6A 1LHGH 1L1JA 4TPYA 1CQQA 3A7YA 2FI3E 3IWMA 1C2HA 1GJBB 3V7TA 3ZZ8A 1SGCA 4Y8YA 1O3NA 2ANWA 2O8UA 2Y5GA 4E7RG 1LQEA 1ZHRA 1TONA 2SGEE 1EATA 5C2ZA 2BVSH 1LTOA 1QJ6B 5JYIA 3RXIA 1E0FD 3V3MA 4DG4A 1HIAB 1TGCA 2BMGB 1AI8H 5FXLA 3EYDA 1ELAA 2ZDKA 3RXFA 1VCQA 2BTCE 3BSQA 3L33A 4NZLA 1AUJA 1O3BA 4JZDH 1C2LA 3VB5A 4D7GA 2XNIA 3RU4D 4FUCA 1BHXB 3RP2A 3TK5A 3BN9A 1GI0A 1BMNH 1FMGA 1FPHH 1MKWH 1S82A 1K1NA 2P3UB 3E1XB 5E0HA 1F5RA 3SI3H 4Y79A 3SI4H 1GJDB 1J16A 1FDPA 2A31A 5A8XA 3Q77A 4AORA 4HZHA 2JKHA 2FLBH 1W8BH 1KIGH 4OS7A 1QJ1B 1HGTH 3U98H 1JRSA 4FU7A 5HM2A 1J9CH 1MUEB 3K6ZA 4NIYA 4O97A 2ZCHP 1BA8B 4YZUA 1WCZA 1RJXB 5ESTE 3HATH 1OP8A 2XRCA 4K5ZA 3GDSA 3Q3XA 4ZXYH 1KYNA 4FUEA 5FBIA 1ZHPA 1W7GH 2F9UA 4KKDA 4I32A 3OX7U 1GBLA 4ABAA 1TA2A 2SGFE 4NSVA 1A4WH 3ZV9A 3QTVH 2XBWA 1GVZA 1SC8U 2VB0A 3BTFE 3DD2H 1C2EA 1EAXA 1O2MA 5DJ7A 2UUJB 2XW9A 1O3JA 1ZSKA 3RXVA 1PQ5A 1AU8A 3SV2H 3M3VA 5JBCS 4ZHAA 1TGNA 3SU5A 4UFFH 2BD2A 1MQ6A 2WV5A 4B75A 4JCNA 1K22H 2FWWA 3ZZAA 1NM6A 3Q3KA 4X1SU 2G55A 4O03A 1BITA 1D3DB 3KQCA 1OWIA 2XCNA 4UE7H 2ZU3A 2Y7ZA 2BM2A 3MOCA 1BT7A 2VGCC 1F5KU 3LJOA 2BLWA 1ANBA 4BTUB 2GZ8A 2GD4B 3P17H 1C2JA 2OC8A 5FCKA 5FX5A 4FUGA 1SOZA 2ALVA 1DITH 4MPWA 3LT3A 2D8WA 3KHVA 2KAIA 5F6MA 4X6MA 1RFNA 3LGIA 1GMDG 3RXSA 3QLPH 4KP0A 2Z94A 1AWHB 2PR3A 1O2IA 2GTBA 1YCPH 2Z3DA 3KN2A 1UK2A 3ZVCA 3VB3A 1D3PB 4YM9A 2QCYA 1V2JT 5F03A 3PYHA 5FBEA 2AGIX 3T28A 3UQOA 3ZZ9A 2ILNA 2QGRA 3GY8A 2HRVA 1UK4A 1IQMA 1BMLA 1P9UA 4INLA 1F0RA 2P93A 1O2NA 2R3UA 4XBDA 1FUJA 5JDUB 1TRNA 2FOAA 3RXGA 1CT0E 1SHYA 2WINI 3PWCA 3SV9A 1BTXA 3LPRA 4Z6AH 1HAVB 5G4BA 3R3GB 1KXFA 1BJUA 2BVXH 3S9AA 1EAIA 2TIOA 2ZDMA 1IQNA 3BTGE 5E0JA 2AYWA 3KF2A 2AS9A 2FX6A 1G36A 2A7HA 1GGDB 3PB1E 2ZCKP 3ZYDA 1TX8A 1LVOA 1DSTA 1NZQH 2GT8A 2SGAA 4TWYA 2CGAA 1QR3E 3HGNA 5BRRE 4MNVA 1SOTA 2R2WU 4QT8C 1AVXA 5GCHF 1VR1H 2Y80A 1HAHH 2GV6A 3ZZBA 1G37A 4K3JA 2F9PA 4AYVB 2LNCA 3MU1A 2SGQE 1OX1A 1FN8A 5DG6A 3ITIA 4OS2A 1O2TA 2HLCA 4X8UH 3D62A 1MBQA 1A46H 2RCEA 1FAXA 2ZDNA 2DUCA 1YCPK 2ZF0H 1GHYH 3LH3A 1CVWH 2RDLA 4E06H 2V3OH 5EPNA 1PPZA 1T8MA 2FMJA 5JB9S 1SGNE 3GISB 3A81A 1UTKA 1XXFA 3BF6H 1DXPA 1O2KA 2V0BA 5EPYA 1Y3UA 5EOKA 3MNBA 2ZFSA 4NWLA 2QF0A 2CHAC 1HB0B 3M5OA 4CBOA 3ZZDA 1L1NA 2HNTF 3B23B 4CRDA 4DURA 2ZA5A 2J38A 1LPKB 2I6QA 1UO6A 4Y7AA 1QGFA 2F9VA 1MCVA 1BMMH 1TNIA 1LPZB 1LHCH 4K8YA 4IN2A 4AG2A 1ANDA 2QAAA 1W7XH 1IAUA 3PLBA 1ESBA 1O5GH 2WPMS 1MZAA 2ODYB 3RXLA 3KQBA 1GBKA 2BOKA 1AFQB 1GMHG 4Q2KA 4B76A 4GHQA 1ETTH 3GY7A 4RKOB 1OOKB 1GBIA 2ANYA 2BQWB 1O5DH 4LZ1H 2AIPA 1GBCA 4ISHH 2ZI2H 1O2RA 1QBNA 1V2TT 1FI8A 3NWUA 1OWKA 4YO9A 3RXOA 1GJ7B 1JRTA 1QB6A 3KGPA 2A5AA 3JZ2B 1O2OA 1ZPBA 1OWHA 3JZ1B 3PM3A 3F9EA 1N6XA 2VU8E 2WPHS 5F8ZA 1T31A 4M7GA 3SUFA 4JZEH 1YPJH 4BANB 3LGWA 3H5CB 1C2IA 5EXNA 1O5FH 1EQ9A 2QV1A 3CS0A 1ZTKA 1T8NA 2FOMB 5JBBS 2FZZA 3RXJA 1MAXA 1AQ7A 4R8TB 2QF3A 2BZAA 2HPQH 1FPCH 2NU4E 1BDAA 1C5QA 1K21H 3A8DA 3NK8A 2NU1E 1FV9A 1AB9C 3SNAA 2P16A 2SFAA 3LGTA 5GJ4B 1YPMH